1V95A

Solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
130
structure length
130
Chain Sequence
GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nuclear receptor coactivator 5
publication title Solution Structure of Anticodon Binding Domain from Nuclear Receptor Coactivator 5 (Human KIAA1637 Protein)
rcsb
source organism Homo sapiens
total genus 30
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1v95A01
1H4VB 5C52B 4YRRA 4KR3A 1NYRA 4HWOA 1HTTA 2J3MA 2ZXFA 1G5HA 4G85A 3IALA 4ZTZB 4X5OA 4HWPA 4TTVA 4YRLA 4HWTA 1QF6A 1HC7A 4YDQA 1B76A 4HWSA 4K88A 1NJ1A 4YRSA 2ZT7A 2LW7A 1ADJA 4YRGA 2EL9A 3HRIA 4EO4A 2Q5HA 1ATIA 1NJ8A 4KR2A 1KOGA 5C53B 1NYQA 1NJ5A 2PMFA 1EVLA 4PHCA 3HRKA 1NJ2A 2ZT5A 3IKMB 3UH0A 4P3NA 1GGMA 4YROA 4YRPA 1KMNA 3NETA 1NJ6A 1QE0A 3LC0A 1FYFA 4TWAA 2I4LA 1ADYA 4K87A 4P3OA 2Q5IA 3A31A 4YREA 2PMEA 4YRIA 4HWRA 4YRTA 4OLFA 5C51B 4YRMA 4YYEA 1H4SA 4KQEA 2I4MA 1G5IA 4YP0A 4RDXA 2J3LA 1KMMA 4P3PA 4Q15A 4G84A 4HVCA 2ZT8A 4YRFA 1H4TA 3UGQA 3IKLA 2ZT6A 4YRCA 3A32A 4NCXA 4YRQA 4YPFA 1V95A 4WI1A 2I4OA 4YRNA 5E3IA 1EVKA 4ZTUB 2I4NA 4YRKA 4E51A 4YRJA 3UGTA 1WU7A 4K86A 2G4CA 1H4QA
chains in the Genus database with same CATH superfamily
2ZI4A 3SM9A 3ZX4A 1J7JA 2IXBA 1QQ6A 3U48A 1G9SA 4NBTA 3ZEIA 3E70C 1S9DA 4YDSA 3TNLA 5KJCA 5AVXA 4RTKA 3HPRA 3H0KA 2Q1SA 2W6PA 1EJBA 2YFKA 3FKQA 3L01A 1IEQA 1E3EA 1BWPA 1F51E 2HK7A 4PG7A 4UMVA 1YFLA 3Q8LA 2O8DB 4NQZA 3UK2A 2QLTA 4M46A 3S2YA 4G5QA 5FUXA 1Y3HA 3WWDA 2PCLA 4MP6A 3H5OA 2F2TA 4LYAA 1IULA 4HNAB 4Q3EA 4QHYA 2AXQA 2Q4EA 2YN0A 4WERA 4YONB 2A9FA 4G5GA 4C0KA 2XJ9A 2C1EA 1LY1A 2ZE6A 3WL8A 1KXZA 1YTLA 3DE7X 4DLWA 4FOOA 1YJXA 2H4XA 1O6CA 1KE1A 3GPCA 2AN1A 3SZ3A 3HBAA 1XQYA 2DWCA 3DA8A 4WLVA 2BISA 3HDHA 2IV7A 3V46A 5IHPA 3OZCA 1FB5A 4CMCA 4J7XA 2WYWA 1EE1A 1E59A 2ZKIA 4Q3LA 3T9FA 5I8WA 1WM1A 3MT8A 2H00A 2BLNA 1D4ZA 1QLHA 3H87A 4E12A 1IQUA 4EWLA 4Z4GA 4JYCA 5BRAA 1EI9A 3PEEA 2B82A 2IZ1A 3E61A 2ZRMA 1V6CA 1VBKA 5JS1A 4MAAA 3HR7A 2VHEA 3NHFA 4G9GA 5KI6A 2FFJA 2FZKA 4LZNA 2CL7X 2QG9A 5FBRB 3ZIDA 6LDHA 4U2CA 2RHRA 3T0GA 1FDVA 4HZGA 3LCMA 2CMHA 3BGIA 2BHLA 1BVHA 1IDN1 1WXHA 2MSNA 4EDFA 4YMHA 5IFLA 1X9HA 1HNZB 5DLEA 5HRAA 1F3LA 2YFYA 1A9QA 4QELA 2HT1A 2YDYA 3TUJC 2C7OA 3DAPA 4XX0B 1UFQA 4IX1A 4KYIB 2Y8EA 3HBNA 4TMXA 1W4ZA 3BTUA 3C4QA 4M60A 4PINA 3WK5A 2CNKA 3TG8A 1PFGA 3D64A 3SQXA 4ZK6A 2FSGA 3M4NA 1JG3A 3E3MA 3N59A 3I0MA 1M1ZA 2XD9A 2Q7OE 3T54A 3O5AA 3CLHA 5FOXA 4JLOA 4ZODA 2E4WA 5AJZA 1FDIA 2SKEA 4D9MA 3MW8A 2PL9A 1V96A 4KBYA 3WLHA 4CLRA 2XKAA 3SFVA 5H4HA 1IIRA 2J32A 4HZIA 1X7XA 3A32A 1JL3A 1J00A 2WWHA 2Q9AA 2O2ZA 3AB3A 1T36B 4M1QA 3KR2A 4F72A 3FUCA 3SBOA 3VPAA 3A10A 2WI8A 3BRCA 4C01A 3AZPA 1RYBA 3A9WA 2FJUA 3CF0A 5AJTA 2WB2A 4L76A 2RGRA 3CF6R 1X80B 2AFHA 1VBNA 3FOAA 1SZPA 1GDHA 1H3EA 3IAEA 3AKCA 3CWQA 3LQQA 2I80A 3NEPX 4YFVA 5IEJA 2BGMA 2EBWA 2JFQA 1COWA 5FBVB 1H22A 2OFXA 2FNAA 1GUDA 3CQ9A 3L8DA 5F7JA 3FAKA 3ZQUA 2ETVA 1IAQA 2G77B 1ZGZA 5ALPA 4BMDA 3AL0C 3KU1A 1J8DA 1JIVA 4LF6B 1NE2A 1K86A 3FKJA 4II2A 3WI7A 1DZ3A 2VPTA 4X7MA 4ND4A 4L6AA 5FTLA 2HF9A 2X14A 1RWQA 2B1IA 3MFQA 3G1UA 5F9HA 2WAMA 1DAGA 4ZEMA 3BTSA 3OM1A 4CMAA 4ESHA 1NBME 4MVJM 5H3HA 2WYOA 1UM9B 1NF2A 3U3MA 4KR7A 2Z4RA 1Q3KA 4B1FA 1A76A 1Z4QA 1H9AA 5HP4A 1YRHA 1KYWA 2ADMA 4F1WA 3D8RA 4WBNA 1NY6A 3Q7PA 1DJOA 1R9NA 4EB0A 1E3QA 2KX7A 4BIIA 2P7HA 2ZSKA 1U31A 4LRWA 2BCEA 4OHXA 5AK0A 3C2QA 4BLUA 2G9ZA 1SCAA 2AH5A 1HBJA 1E79A 1BS9A 1K5GA 1Q50A 1Z4MA 2Z56A 3IAFA 3ICPA 1SKUA 1QZ3A 3ABIA 3KCQA 3GFBA 4EP1A 3OE7D 2Q6LA 2FKAA 4DIMA 4LPSA 1Q0SA 4XPIA 2OQVA 1EK2A 4EFKA 3WNZA 3ZVMA 1VGQA 2XECA 3QXHA 4G0OA 4INPA 4IFTA 4X3OA 3RB8A 3KVRA 3CNNA 2LPMA 4Q9AA 4IQ8A 4X6UA 4OX9Y 1H1LB 3LHKA 4BO7A 2YCBA 2WJAA 2XCUA 1AGXA 2X76A 2B5OA 2NOAA 2QIOA 2ZBQA 3RWMB 4CEJB 5CVDA 3M1AA 4QTTB 3TVDA 4HX5A 4C88A 2X13A 3VGPA 2XWBF 3H5LA 3AEQA 4FBMA 4INOA 3UMYA 3W3AA 3DP9A 4JL8A 5J4KA 1QOQB 3H75A 4L22A 2QZZA 4ICIA 3QOYA 5EXPA 5JFTA 2OR3A 2QPLA 2GF0A 3IVRA 4BJ5A 2ZM6B 2ZVDA 5B7QA 5EWJB 1UKEA 3JZAA 3U4GA 5TQ2A 4YUZA 3B78A 3ZU3A 3GLUA 4OLFA 4X20B 2KYRA 1V3VA 1SUEA 3UO8B 3B6ZA 1KQFA 5IMBA 1ZD2P 3HGQA 5KWIA 5KC9A 4YP0A 1PR4A 3LQYA 2ZPTX 2WNSA 4C43A 5B1EA 5FULA 4DSNA 1NRWA 3EC7A 5I9NA 4ZVKA 1EUCB 2DVMA 2WHEA 1ISFA 4ZJYA 2QTTA 2GFIA 2BM0A 4WCFA 2R9VA 3EDQA 4OGGA 5EXEA 1TJPB 4MQEB 3R0JA 1Z13A 4OQXA 5J59A 1PZXA 1TZKA 4OXIA 5H82A 4L85A 1TK2A 4CV1A 4TMKA 3W1WA 3DWIA 1AQYA 4Z0HO 1U28A 1HL7A 1R5JA 4U6NA 4X6YA 2A1TS 2VUUA 1XMOB 4C7OA 2EKPA 2ZJ2A 4I50F 4QFMA 2PQMA 3EVCA 4G1FA 4BX3A 5I3ZA 4JDUA 5LZ7A 3R9XA 3EDCA 3RRBA 3IELA 4OA8A 1NULA 1JFVA 1TMOA 5CM8B 4BAUA 2QLBA 4JBLA 5J1TB 1NNEA 2XQFA 3D1LA 3G8DA 3IA7A 2KLBA 1DCFA 4TTTS 3DOJA 3REQA 2DWUA 1T8SA 4ND3A 3T1VA 4C7KA 1P1IA 3FF4A 5CIYA 2AYXA 1KFEB 3EPPA 1XZLA 2FZVA 1G8YA 3ONFA 4CR8A 4RH3A 3VR0A 1Z6AA 5JT1A 5CURA 1L4FA 2TMDA 1VJRA 2G5GX 1Q0UA 3AGPA 4XXHA 421PA 4F2DA 2Q8NA 1ONOA 3N8IA 4H0FA 1PSWA 1VJDA 3U09A 1YVPA 1H0KA 4IAOA 2PK3A 2WDPA 1J0BA 1K66A 1Y1QA 2J6CA 3OKAA 4MSUA 3L7NA 5EUQB 2VDLB 2NVBA 4QXRA 4TRJA 1R64A 2D00A 3D6HA 4EB6B 2AFVA 2ZYUX 2B6NA 5IAKA 1KERA 16PKA 1JHOA 4DRZA 3G2JA 1QIGA 1E2FA 1XBTA 3PKIA 5IXYA 5ELXA 2CVOA 4DG9A 3SC2B 4Z9FA 4R2KA 1VIMA 2GZDA 3AWIA 3ADCA 1KDOA 3AR9A 4ND6A 3E1GA 3O4HA 2LE0A 5HCUA 1UP6A 1NYLA 2R8ZA 4ZANA 2FAXA 4PONA 1HO3A 5B53A 1E6KA 3FI0A 3TNJA 3I62A 3JYNA 3TLXA 1W73A 4N1AA 4KR0A 4O2AF 3HQ4O 1QHYA 4KMRA 4B3CA 1GGEA 4FZVA 1VG8A 2YJ4A 2CC2A 1ZUD1 1C7IA 4HCJA 5K8JB 5E6UB 4KTVE 1XFDA 4HAOA 5ALLA 4D6XA 2PSSA 5EHGA 3MCVA 4L5YA 3DTNA 3RJMA 2BEJA 1Z5OA 2PKYX 4G4SO 5T6MA 1XZNA 3SPXA 4DFDA 1KVTA 1MQ8B 4TM8A 1UDXA 2GJ9A 2YRWA 1I9CA 1JIKA 2VJQA 7YASA 4ND7A 1QANA 2JS7A 2RKWA 3FVRA 3OZ7A 3HR4A 2EFCB 4B3SB 3VVMA 4X41A 2V98A 3EOZA 4ARCA 1PG5A 3A31A 4AF8A 3TIXB 4FSHA 1CJUC 1E5QA 1AS2A 1LI4A 2BJHA 3FKSD 4OHWA 3AI2A 2ZBUA 3EFOB 3I61A 2NTVA 1LGYA 2VN8A 4MNTA 5KYWA 4WXYB 4JQSA 3A1WA 3WMEA 1QLJA 2AMVA 3GRRA 4JOQA 2IEAA 3A6PC 2FEPA 2ZWOA 3H17A 3ZQKA 3L06A 5EESA 3K72B 4XI9A 2N42A 3KVVA 4U9UA 3ELWA 1TB4A 3G9UA 1O94A 1SOWA 1XE3A 1E9RA 3PUJA 4FFVA 2FLVA 1ORVA 4GP7A 3A4LA 4R3NA 3WHPA 3G0HA 2REQB 4O0MA 5BSGA 4CHTA 4GM0A 5I4IA 4JQZA 3BSSA 5TQ0A 5CXQA 2CZGA 5FWDA 1N9KA 3ASVA 5E4TA 5BXYA 2QPTA 4EA9A 2OLEA 3IYLW 1SEPA 1J06A 1V35A 3Q40A 1F17A 3PGXA 5HZHA 3AW9A 1E32A 2MSWA 1G2OA 3WK9A 2VHZA 5FTMA 4OOFA 3C87A 1XCJA 4YNBA 1QFMA 5F7XA 3CVUA 1VLZA 1GGFA 2ESRA 2IOFK 2GCIA 5JD4A 1IPHA 1S4MA 1U3VA 3I2IA 3MBOA 4MYCA 5TMBA 4M38A 5SYNA 1O7JA 3ER8A 1Y63A 2JHFA 3GUZA 2QUBA 4FYVA 4H7KA 4IIFA 1BO6A 4PLFA 4B75A 1LI7A 3KXPA 3AVUA 3MCTA 1SKMA 2RMKA 3PNLA 4LW8A 5FKJA 2D74A 3KZ1E 3VV3A 4JR0A 2PMBA 3D8UA 2IX9A 2Y1WA 3DMTA 3S29A 3NT4A 4IOJA 1IY0A 2AEMA 4ZHQF 4GICA 4N0EA 1I10A 4MA5A 1SHTX 1X2EA 1P0IA 5JAPA 4QGGA 2H4YA 1D1QA 4CN9A 1Q91A 5DXJA 1NAIA 4EO7A 5HBRA 5EIXA 2ZQYA 5A5GA 1SXHA 2JLYA 3FW1A 4YI5A 1VYVA 2X0NA 3ASYA 5JMPA 2Z8XA 5DULA 1XZPA 4YR9A 5GY7A 3R8XA 3HB9A 4P5PA 4LTDA 1I4OA 4PC7A 4LV5B 1L7PA 4JXJA 5DTMA 3VFDA 4PGGA 3DNMA 3EEQA 3O92A 1AB5A 1GNTA 1M9NA 1S3GA 3IDFA 5CW1A 4P9NA 1WZUA 3ZWNA 4EGJA 5CB4B 4FSDA 5BPFA 5E0OA 3VR4D 5DXAA 2FQYA 3OCUA 3U81A 3MUOA 2VXOA 3CLVA 5DGCA 1KIMA 3Q7IA 1JHMA 5G02A 3TLJA 2E48A 2C9CA 2DTDA 2WV7A 3SXJA 1TTHA 2YQZA 5E2BA 4LF7B 1Z8NA 5DTEA 3C8HA 5AHRA 2Y1OA 1PK7A 1QE5A 3G89A 4MWEA 4D7AA 1RIIA 4AG6A 1GSHA 1NQXA 4NE7A 2PUGA 1PVDA 1C4XA 1I0IA 1TKRA 2X5JO 4J91A 2W2MA 4YRZA 1M1UA 3GH3A 3Q72A 5IZCA 4BECA 5AOCA 4EHKA 2WMDA 3KR0A 3MXTA 3DTVA 4N3BA 1DC7A 5EJAA 5FLYA 3FDZA 3R9IA 3OQ6A 4W8OA 3JRNA 5D1NA 3SHWA 1VCOA 1XRMA 2VBCA 4BVGA 1Y8CA 4DV6B 1ZU5A 1S3FA 2EEZA 1A4RA 4BYGA 1Z45A 4RD1A 2VZ9A 4AZWA 4Z86A 3CLKA 2QZPA 3H2GA 5F78A 1VMAA 5M7EA 1E2GA 2ZVPX 1EFVB 4I08A 4KXVA 4EMUA 4RIHA 2QX9A 3OPNA 5E4FA 3C5WP 5FWXA 2CNBA 2EKDA 1TF7A 4I9NA 4ESEA 2PSEA 5C8YF 5CGZA 2JI9A 2P9JA 3MERA 1M2OA 2JZCA 3MGAA 4IEEA 3ACDA 4N5NA 4A6PA 3C8MA 1Z0DA 3FOBA 1TIBA 3OIGA 3UMCA 5KMGB 5K8IA 4QDZA 4AWXA 2IX3A 1XCBA 4P3XA 4TYNA 1ZDMA 1K7XB 3PLRA 4FZRA 4KN5A 5CA0F 4EYEA 1ZJZA 2DJ5A 3WJ1A 4GX2A 2ZG6A 1X1CA 2YVAA 3BD9A 3LKDA 4J1QA 2MSEB 4MEBA 4R2IA 1N2EA 4X85A 3GXOA 4LI3X 4ZV9A 4O0LA 3KQHA 3DKRA 5JIBA 2CNOA 4G4IA 3VGJA 4CQLB 4IMJB 5DXFA 1A3CA 4ARIA 4JUBA 4B80A 3B5EA 1U3CA 3F4KA 3VR2D 3WX0A 3UV7A 2BTQB 5JRDS 3QVOA 3P4YA 5CXSA 3PKZA 5DBIA 4BB5A 1O57A 3TQFA 1LBEA 4U7FA 4B7AA 1CRZA 1T8UA 4OLAA 3FD8A 1GM5A 5HZMA 1N25A 2WV9A 3RRNA 4FW8A 2A0KA 2P6OA 3OEHD 3R6TA 2P2DA 3GVCA 2HI0A 2JHPA 1UODA 4QQKA 3SR3A 4O4JF 5IH3A 5C8ZA 1O6GA 1YHNA 1WBDA 1AV6A 3G85A 4X92A 1FNDA 3T6KA 2RFLA 4PYIA 2W6OA 1SFRA 5EQJB 4X64B 2HMVA 5FAKA 1BE0A 2XJ4A 3U3KA 4DYDA 4N0MA 1DPFA 1WW2A 3TQHA 2PXAA 3VR3D 1OW3B 1U2EA 4DABA 4H1UA 3SLKA 1JKXA 1PLJA 3NBAA 5A0VA 1VMDA 4L5BA 3KFVA 1VYHA 2AFIB 1D1SA 1JJVA 1O95C 2ZIXB 4MDFA 3FHCB 2UYYA 3ICQB 1T6NA 3K30A 2EGGA 2BEVA 3LX6A 3WGZA 4KK3A 2CLLB 2P1RA 1SCNE 2ZJAA 4FT2A 3K4PA 4JLBA 4WZBE 3DBRA 4IH4A 3DCJA 1FDSA 4YDQA 4Q01A 3IFSA 3DBHB 5CVVA 5JARA 2YV5A 3HCRA 3W4JA 2VJOA 2N3ZA 4MI9A 3WDMA 2YN4A 5LXTF 3PIRA 3QXSA 1U1GA 3UA3A 5FL7D 1QHHB 2FWIA 5IKPA 4YO8A 3DEZA 2WAXA 2JGNA 2FMHA 4JC8A 5KTNA 1PNRA 2V3WA 3FMFA 3OQNA 3CURA 4RQBA 1XPRA 3ETDA 1N0IA 3ETGA 4OQ4A 4TN5A 2KSQA 2C07A 1E7RA 1MVOA 4UUNA 2ZROA 3HUDA 4H3HB 3TOSA 1GILA 3PQ6A 4BFWA 1X6VA 4Y3UA 4ENQA 1RRMA 4J6FA 4BVLA 2ZB3A 1II8B 3NDBB 1DXOA 4G07A 2JZNA 4MWSA 4G1MB 1OLUB 4D9NA 1MXFA 2F9FA 3GZJA 2UUOA 1T4DA 3SHFA 1XV5A 3R5XA 3AT1A 3SR0A 4UVDA 1AF7A 4B5KA 3RRJA 4UBOA 4YJFB 1N2IA 2NYAA 3NLLA 3UT5B 4B71A 4PCUA 3ON5A 2WJ6A 1M66A 2C3OA 3D02A 3JQGB 4ZOBA 4CCAA 1EXMA 1I2CA 4NONA 1T3SA 4JYAB 5BSEA 3VJRA 4DR4B 1EM8A 1GWNA 2GN6A 5SICE 1IY1A 3I52A 4JL5A 4ZAVA 3ZH9B 3UT6A 3D7RA 4ZDWA 2HEGA 4P3YA 1VL6A 1YRLA 5BORA 3O31A 1E0DA 4MQ4A 4R9SA 2Q9CA 5K3FA 1PQUA 4IUBS 3ZLTA 4EJSA 4P0TA 4UAGA 4GOKA 3DMNA 1AG9A 4XAQA 3GQVA 4E2ZA 4DR6B 1NW8A 1XTZA 3PB3A 4WN3A 5DHFA 1JW9B 1T6XA 1BFDA 3BK7A 5F33A 3I5UA 4EZEA 2P4EA 2ZE8A 2IF2A 2QGZA 3P2IA 4TQ9A 3UATA 2F3PA 1M33A 3PKJA 2VEOA 4M1WA 4OJTA 1GPWB 4YR7A 2ZS8A 2OD7A 2PRIA 1AO3A 1R6XA 2G04A 2Q6VA 4ZPXA 3D43A 1I51A 3OQHA 2B1JA 1EMDA 3TJRA 3OD5A 4OUDB 1AZWA 4V0RA 1E3JA 2EIHA 2B92A 1DTSA 2XOXA 2BHTA 4UCQA 4DA9A 1K5HA 5ILOA 4RTOA 4LA4A 5E8RA 5C31A 5FWYB 4RPIA 3O95A 4HTFA 4YRJA 2RKOA 1KDTA 1RXIA 4HLCA 2Q3DA 1Q15A 4YJ3A 2GH1A 1Y6GA 1SXJD 4KN9S 3WXBA 3L8EA 4CFYA 1BU5A 4E4YA 7ABPA 4HN4B 4MQ5A 5CTJA 5T6BA 4J2OA 4JLVA 3FA2A 1N92A 4FILA 4TVOA 4RWEA 4ZVTA 5I7UA 2GYUA 4I5IA 2FY8A 2OEPA 4KFSA 3SK0A 2J6IA 1GGHA 4IXWA 1RAGA 1S96A 1X86B 2DGDA 4NEHB 4OEHA 4DA4A 1RRPA 2FWRA 2DETA 4W6QA 3ZS8A 3O90A 1VLMA 2PGNA 3R4CA 3N1UA 4EFLA 1MOZA 5JADA 4CM4B 4DLYA 4C4TA 4OGWA 2YCLA 3PNOA 1WUHS 1C9JA 1XQXA 4YRLA 5DM4A 4QREA 1QZZA 5CFOA 1SVKA 2Q3MA 5ALEA 1NFQA 1V5FA 1NR7A 3GO4A 3V6MA 5EPEA 1RFLA 3KZXA 5A6SB 3BE6A 5AVVA 3RUAA 1B8VA 3QELB 3TQSA 1ZMRA 1N5OX 4CPDA 4D3SA 2AHRA 3ADKA 1E2IA 3DPIA 2UXCB 4JB2A 3TE6A 2IYOA 3WSTA 1SR8A 2K7FA 3KWMA 2VQEB 1NBAA 1O97D 2JC3A 1L4EA 1DBPA 5JSFA 2PL3A 5E4JA 2IEYA 1NRJB 2BONA 3DOEA 1JTEA 4MEJA 4KX5A 5HCNA 3RK1A 4IX9A 1SWWA 4FCWA 2ZOSA 4FEAA 1JEYB 4B7UA 3WDLA 1J0CA 2CLKB 1JJBA 1M3SA 3BFKA 1F0NA 4ZYWA 2FMFA 2X40A 2XHEA 2JFOA 3SE0A 4EPYA 2MR6A 4DEYA 1RI1A 1CUIA 2GZSA 3UA4A 3IDSA 3IEKA 3QW4B 2J48A 4H17A 3T3IA 4CIWA 2YJ6A 5H7XA 3AM5A 4OI0A 4WDQA 2JFGA 2HBZA 1OV6A 2HF7A 1KO5A 2RIRA 3AK4A 2BFPA 4JLJA 3R76A 4A0SA 2FQWA 4MGEA 4H35A 2M6RA 3VH2A 3LDGA 1B16A 4DANA 2F1RA 3GA5A 1Q1AA 1R0BA 5EZSA 1NBHA 1YCDA 1BHSA 1EFDN 4FI3C 5HNKA 1DBIA 4XFJA 2ONKA 1J25A 4R1NA 4GUDA 1I14A 1SBIA 3KOOA 2NUAB 3TLGB 2B7BA 5T8KA 4HJRA 2ZBFA 2QZ9A 1C7JA 3IP3A 3IHWA 3KFLA 4ITUA 4QTUB 2Y0EA 4L3WA 5HDBB 5L4SA 4H1WA 5FOUA 1E6CA 4FR2A 1VCHA 5KNCH 2F8LA 1E9BA 4XA8A 3ILSA 4G1VA 4GQIA 4HD8A 2Q2WA 1FTSA 3CRZA 3WLAA 4YV2A 5BRJA 1JU3A 2C00A 4I8XA 1EFCA 4BGUA 5KNCA 3VSAA 1PZMA 1CVLA 3CA8A 3P96A 3BF8A 1E1RD 4OP2A 4ZAFA 4YP7A 3HJHA 1ZM7A 5HILA 1UCFA 1RZRA 4YJ2B 4EKDA 2IQ5A 5EXXA 5CG2A 1TQDA 3FMVA 2JD1A 4FD3A 1GNRA 4RDHA 4YA6A 2CVQA 2XVZA 4U2GA 2GJAA 2VWGA 4MHTA 3PPIA 2XTNA 3NI2A 1UJ6A 4LHVA 3AJAA 3NHLA 4PIVA 2K4MA 3DDZX 1LNQA 3LU1A 2ZAYA 2CHFA 2I62A 4ZOLF 3U49A 4EPXA 3GG9A 4Q9DA 1JR2A 2H92A 4YN3A 3W79A 3CNLA 2R8RA 2EVWX 1G7CA 1H6BA 2JRCA 2JAUA 2RB4A 3S2SA 5JECA 3LFUA 3THYB 5FNVF 4JI0B 5DX8A 2A92A 4LF8B 3HACA 3PXAA 1SCDA 1U65A 2FWPA 5DB4A 4BO5A 2PNFA 2OWEA 1K75A 4O4LB 2CWWA 4KR3A 4WKGA 1YK1A 1DE0A 2Y4OA 5EY5B 3PC6A 1HTTA 3HDJA 4Q3CA 5D6NA 3URMA 1KZGB 4N12A 2ATEA 4O3MA 2D7JA 5DKFA 5UKDA 5DLPA 3O4FA 3K1JA 5JI3E 4DEXA 4UU8A 5KYXA 1LCIA 1SKYE 2FEOA 5CMLA 1NONA 1NZJA 4D80A 1S1CA 1QYRA 1Y80A 4J4TA 3C3XA 3DW3X 5H3LA 2EU8A 3JYLA 5BWBA 2QSYA 1DELA 2VP5A 2WOJA 1II0A 3I34X 4MXDA 1RQ7A 1SXJE 3AJ9A 1JFSA 2HA6A 1N5IA 3QZUA 3QK7A 3T5GA 3SHOA 2HYDA 2PE5A 5A0FA 3PDIA 1XNHA 3TZCA 5IU6A 2C9MA 1X7ZA 3LZDA 5LQDA 1JALA 3ILVA 1TKBA 1MRZA 4MUYA 5JQGB 5EEGA 4HPWA 4NCJA 2C9OA 5FA5A 5FQNA 3AJ8A 1FRNA 3FGZA 2FX3A 1P18A 1EE9A 1NDUA 2PTHA 2EZUA 3DQQA 3GLGA 3GJ7A 3UB2A 4F5EA 1PCXA 1UDWA 2JFUA 3I4FA 2PYIA 5EKXA 1KPIA 4OIFA 2XBMA 4OH1A 1ZM9A 1NJ6A 1O8BA 2PZGA 4FFBB 2JFZA 5DK4A 4YECA 3M33A 1U7ZA 3JQ8B 4TWAA 3RK0A 3PQDA 3CINA 4KE8A 2B4YA 3NBFA 2HUPA 3EXAA 3U3DA 1Z08A 3I8OA 2W00A 1FFWA 4JVSB 4JKOA 4TV8F 4IS2A 1ZS9A 3PWSA 3KNZA 4RA6A 1KC3A 4WCFC 5G1PA 3U6KA 3EXHC 5DNEA 1KRWA 1VHDA 3FNEA 4YXWD 5AVWA 5JNUA 1I4TD 1NL3A 4URYR 4U0KA 2H2AA 1S8OA 2XDQB 1U28C 2O1XA 1AHNA 4YRTA 5HBGA 1E3IA 4HGYA 3OTOB 1JS1X 3KZCA 1NW3A 1W4RA 5TX7A 3RQIA 4YYEA 1J8VA 1NMZA 1ZCZA 4WDRA 1T9GR 4QUIA 4NK4A 1OFTA 2YWGA 2EFEB 4LFAB 2P9ZA 4UXIA 1FRVA 1K8YB 3OLCX 4YAJA 3DE2X 4L9AA 4KVZA 4HWGA 1QV6A 1X92A 5D5PA 4WA7A 3QMPA 2HHCA 4Y1FA 3ADBA 4P36A 3RSFA 1CLUA 1F06A 2B20A 2R6ZA 3LT0A 3DM5A 4HYYA 4JI3B 1OXTA 3HY6A 3OKCA 2NSLA 4GH5A 4K9NA 3KSZO 2Q8QA 1UXIA 3ZJTA 2KWIA 1L1FA 1M2JA 4F9GA 1JNXX 4MROA 5LA6A 4C87A 3IERA 3VZQA 3AY3A 3FLAA 2R3SA 3OJEA 3ADPA 1TYAE 1UH5A 3SY8A 4KUEA 3SQWA 4I4NA 1GA4A 1UBTS 1Z36A 4AURA 4HEQA 3TUIC 2A0FA 2HRZA 1GYPA 2W6JD 2GARA 2EWVA 3GJQA 4PS1A 3K8QA 2O1WA 2VWPA 2YIVX 3H9CA 4TMYA 4R71A 5J3JA 3T1OA 3HRHA 5AVSA 3SAJA 5EVJA 4BL5A 3FTFA 2YIMA 2EW8A 2D2IA 5KPDA 2FFQA 3HEBA 3MHPA 3WOHA 2CHUA 1MFZA 2GILA 4ME6A 1Y6JA 2YXPX 3BH0A 4QJ5A 3BOSA 3OMXA 5TXGA 3AVWA 4WLUA 4MVCA 2QUZA 2J3MA 4DLNA 1VPVA 4ZT6A 1THZA 4PBSA 4GM4A 1PAUA 1A98A 3E3AA 4RKRA 1TQ6A 2QMEA 1VMIA 3WNCA 4F11A 1XVUA 3A14A 1SY7A 1I3OA 1Q7TA 1NQTA 2NU6A 4FYHA 4X0EA 4D42A 4BNMA 3T9CA 3Q1KA 1U3GA 2VL7A 4C78A 2VP6A 4R0VA 3BFXA 4KITB 4HADA 1UJCA 2CMKA 4RF5A 1YFJA 3PBKA 1JAYA 1F2TB 1ZUIA 1KZ4A 2RONA 2OBXA 4WH0A 1ONNA 5KSWB 4ETNA 2WOOA 3FWKA 2IFTA 4QTXA 4DLLA 3T3PB 1PFYA 2O0LA 1SCUB 4Q3DA 3KPJA 4V02A 5K3CA 4ER5A 4ZYVA 4IICA 1OLXB 1T2NA 4MRPA 4TXMA 3HMKA 1HDEA 3HABA 4IJKA 1ZC3A 4GPAA 2VH2A 2C96A 2Q0XA 2ZDGA 3HU3A 4GSLA 4J90A 2O1SA 1T4GA 3QI2A 4WLFA 2ORWA 3NKLA 2GM9A 1QGZA 3KXKA 4LG1A 4QG7A 5AWFC 2JFYA 3DDNA 4KNYA 2HGSA 4PYMA 3U62A 4NBUA 1LH0A 1ZN2A 3OX2A 1NWCA 5E1MA 3QEOA 2ZYDA 2FUG1 1SWVA 1SUBA 4JT9A 4L74A 4TVSA 2XMPA 5FPKA 1O94C 3NBYC 3T7IA 4UEOA 5FORA 4CEIA 3LRPA 4ZYUA 1NP3A 5GJCA 4OLJA 4Z3DA 3RARA 1LLUA 4R6XA 3WP0A 1H8ED 2W2XA 4ISBA 4CIAA 1H94A 3WA7A 2A9KA 3QEBZ 4Q9IA 2MSKA 1RTTA 3C3BA 5BSWA 4PLHA 3ZBQA 5DASA 1SOUA 2C97A 2XCRB 1GPBA 1ILEA 5JAUA 2ZRBA 1KZ9A 1QSGA 3W77A 3JAKA 1RLMA 2LIVA 3BH6A 2VEDA 1W88B 2RC5A 3E7PA 3FPJA 3H84A 3IDQA 3K0AA 4F5DA 4CMBA 1COZA 2F1KA 1X1BA 3KTAB 2ZJFA 1NVKA 4XQEA 3V6LA 5IHXA 3FRHA 3HA2A 5CNJA 3IIIA 2JLCA 1Z6XA 3H2IA 3W5AA 2JI6A 3U3JA 2F1JA 4GO1A 3ZK9A 4KB5A 2GAFA 1DINA 2GHQA 4BO2A 3IQZA 4S0XA 1T8RA 1HX7A 1PS0A 1QK4A 3LT1A 2H5LA 4COKA 1Z4JA 3MD0A 3FNGA 4L6CA 5AUOB 2MYTA 3F2IA 2HRCA 1E66A 3FLBA 3MWYW 4OHZA 4IF6A 3C3MA 3EVBA 3BX1A 3GLIB 2O8DA 4EL5A 2AN3A 3RYCA 3MPOA 2ZJ6A 3KSMA 1HYEA 2XZTA 3PWTA 2CHQA 1CUWA 2C2MA 4LXYA 4JJKA 4M8IA 4PLZA 5E9WA 3PJGA 2NSDA 4TSFA 5HKOA 3CUWA 2WU8A 5G53C 2GM4A 4FIDA 1T9CA 3ZTTA 2A67A 2CFCA 4HNAA 1FVXA 4PPNA 1GAEO 5IC4A 2CDBA 2QN1A 4JSTA 2FVXA 2JEYA 5ILGA 4BMYA 3ECCA 4IKPA 3PQ8A 1P77A 3OY2A 1N2OA 4CVNA 4JLDA 3BIJA 3Q2KA 5FHRA 1U1EA 4MUHA 3OOEA 5EZYB 1BJRE 1U7XA 3VTKA 1QYIA 3HEMA 4LEIA 2HDOA 4HEA1 4RENA 4RLHA 1LVHA 3THXB 3VAYA 1EVEA 1GGNA 2VDOB 3P20A 5AQ1A 1H42A 1TW2A 3C4JA 1W35A 2J46A 4HNHA 4N49A 4RKFA 2C77A 1R8QA 2J0VA 4NBKA 4R6WA 5KQPA 1F2VA 4C7VA 1E4EB 1QCZA 4FYYA 3CVYA 4GZ5A 1HC7A 3W1EA 1SCBA 4C7OB 3F5SA 3FE2A 3ZNPA 5IZCC 2NU8B 1YR2A 1TC2A 1DX4A 3C97A 1B3BA 3MWEB 1LBIA 3JXEA 1U0TA 3WBKA 1KAGA 1C9NA 4US0R 1K06A 3LWZA 1ECFA 5ED0A 1QNLA 3M6FA 4F8YA 2ZJ8A 3OE5A 4C0SA 4A6DA 2ZTMA 3EGCA 3OJCA 4MQLA 4B0PA 2ONZA 3LT2A 3A28A 5FBLB 4D0LB 3E48A 4QARA 4LJYA 5IT0A 4LGCA 1A9YA 3T4EA 1NC3A 1B00A 1CW2B 3E81A 5DO9A 2PFSA 2JARA 1OZGA 4XX0A 4O1IA 3CZ4A 1E0KA 3BRWD 3UQZA 3JQPA 1OYYA 4YRAA 1PRYA 4YX9A 4AJLA 3Q5GA 1OH5A 1PEYA 4OXRA 3VAZA 4P0PB 1AOXA 2GAIA 4XUDA 5JO9A 4KWEA 1ZK2A 2DLNA 1UPBA 2WF7A 3CFYA 3AHDA 4B40A 4GOND 1W2GA 3EIHA 1AZTA 2P9BA 5IYZA 2ZSIA 3AFMA 5CCBA 3A3KA 4WRRA 1T1GA 4TSRA 5A4JA 2Q5OA 4FQ7A 3SMQA 5IXJA 3BCHA 3ESZA 2PNJA 3PQ4A 2G3YA 1JHZA 4HF7A 1W96A 1N4DA 1KI2A 1V39A 4WGFA 4ZI5A 1DGQA 2C2GA 3U7FB 3FUTA 4CG0A 4GW3A 1MO5A 2CLMB 2F3UA 1B73A 3GNTA 2XRZA 1LBHA 3DT6A 3KD3A 4Y6RA 1G59A 5KWJA 5JBQA 4PNZA 1XEFA 1DKOA 3X2SA 2OAGA 5DTQA 3G02A 1QZXA 2GBFA 2NO9A 2ANCA 5LYJB 3EXG1 2GSDA 2C4NA 2GBGA 5CFRA 1IRIA 2GPJA 2ZW9A 3A06A 4GZ3A 1NXXA 3M9XA 1ILWA 1SC9A 2R6CA 2QS9A 5EUBA 1E0SA 5L8VA 2A86A 5C5CA 2NUPB 3DXZA 3EGIA 1XALA 3GZNB 1U02A 1U5CA 1KH3A 2QY6A 3FWPA 3MZ0A 3N8NA 4IFBA 2OG2A 3SFZA 3TJZA 3VPXA 2C4KA 1Z2DA 4R8LA 4XQGA 4KQKA 1ZHFA 1HETA 4NFSA 3WTCA 1YACA 5G0SA 1VFPA 3DWGA 1PIWA 4MQFA 2G9QA 3BDAA 5CUQA 4IVNA 1UC8A 1YDMA 5LB4A 5IDXA 5LD2B 3IOEA 5K09A 3GNLA 4GOMD 4M7PA 1N36B 3SX2A 1LK0A 3DZHA 2V6IA 1KZYC 3DONA 4PG6A 3T41A 3COZA 3TNFA 3QBTA 2CZQA 5HIAA 1Q1ZA 1TVKA 2AI2A 3RKSA 3JYQA 3BFVA 4XOIA 2PA0A 4AF7A 3G59A 2IHTA 5LN1A 4IIVA 3LS2A 2FMKA 2HIHA 5F98A 2AG5A 3RVPA 4EI2A 4OAQA 3V42A 4PLVA 3VHLB 3EXFA 4HGNA 1XVAA 2WWRA 1EGAA 5JCZA 4DQDA 3FIJA 3KTFA 2GVNA 1IRXA 4KU4A 1JSZA 3HI4A 3DGEC 4I2VA 4OQLA 3K53A 1WWKA 3IX7A 3DVSX 1QH8B 1GU0A 1WHTB 1DNPA 1YFKA 1LWNA 2VNKA 2WJYA 3ERCA 3UN1A 4Z5XA 2IYUA 1QYDA 2O3UA 3C7TA 4O2LA 4R1LA 1P2DA 2RH5A 2C4WA 1E92A 2V7QA 4AP9A 2EL9A 1IXRC 5DI9A 5DCLA 1CUVA 4DR1B 3RREA 1RW4A 2ISSD 5TPWB 2WU0A 3QEKA 3WLNA 2F48A 3MGBA 3RAGA 3S1LA 2WG2A 1I7DA 3RS3A 4Q03A 1OAOA 2WDZA 4PHCA 5JC1A 3D6AA 1OA1A 4H7EA 5JAZA 2BOVA 4I99A 4NAVA 5C9ZA 1M1YB 5B1HA 4EJSC 4M0EA 3QE9Y 4P4TA 1EP2B 3QFCA 5LOVF 4C5AA 4ENPA 2R87A 3IJPA 4L7QA 5KAMA 2ZUEA 1ISIA 1IFXA 1T91A 2YQ5A 2FG6C 1VE9A 4L4YA 3M2PA 3EPHA 4Q1EA 4Z1MD 3ORYA 2O2DA 1N6LA 1OH7A 1NLMA 1L6RA 1L7EA 1RBZA 2YXLA 4L02A 1IG0A 2VDJA 2O4UX 4PZEA 2PJDA 2O4CA 1MCZA 5BWMA 1HZJA 4RVNA 4YBZA 1UPCA 3TLYA 4HQNA 3STTA 3ORSA 4RFVA 5LZ5A 3C3YA 4PLCA 2UAGA 4J29A 1NUQA 1NNSA 1GJRA 2B6HA 3BWVA 3Q9UA 1RWWA 2BIFA 3ZCVA 4E5VA 1K3FA 4K05A 1QB8A 2QE7D 2AGVA 2R8OA 3B1WA 4MW0A 4BV9A 1K8RA 4Z7NB 3HYNA 5EUCA 4YRMA 4L0MA 5JRZA 3D8NA 3IS3A 3LF1A 5FO0A 3WDKA 3WAKA 3AVQA 4X54A 5B1IA 4ARZB 3RSCA 4BO6A 4WBNF 5KTPA 2GN2A 2KBEA 2VOEA 1MDFA 1Z7WA 3G0BA 1P91A 4GKBA 3RJZA 2Y1XA 1T3TA 2H4HA 3WLMA 3V97A 4PYLA 1SVSA 2HMSA 1PKEA 2Z4SA 3KQMA 4FWIB 2OFOA 2HW8A 1KQNA 1CHNA 2DQSA 3HI6A 4YLYA 4Q48A 1ZIPA 2NU9B 3T7CA 3HJBA 1J0EA 3ANNA 3QU7A 5K45A 1ZX1A 5JJBA 3V1KA 1Z17A 3TSYA 4EFNA 1FBTA 1Q3HA 5IAGA 4EB6A 3HFSA 5H1YA 4D81A 5CG1A 2C42A 3NTRA 4M6WB 3PFKA 2ZKLA 1T9GS 1EPUA 3FCAA 3H5NA 4K9LA 3RYIA 4KGVA 3GN2A 5E9JA 3SC2A 4YAIA 3QUCA 4D3ZA 3C3PA 4FFRA 1I2BA 4G23A 1DKLA 2Q49A 3BMOB 3UJ3X 1UZUA 4PHHA 4CWAA 1GGJA 3F4LA 4M1OA 2HJVA 4C5CA 3NHMA 1KU6A 3I2KA 3EG5A 3MUFA 3HVKA 5LQKA 3MAJA 5HK8A 2M1XA 4COOA 2W93A 1NXQA 1M7GA 4YS6A 5E6UA 4D43A 4DHWA 5JYCA 2ECFA 2R6JA 3AESB 3OQBA 1UJMA 1B74A 4WK0B 2C92A 3HYTA 2H5IA 4RMNA 4HV4A 1UPFA 2JDIA 2IYWA 1ZSNA 4L8LA 4X93A 5FBWB 1NSTA 2HHHB 3KM0A 4BLOA 1NLFA 3PP8A 1XZGA 4YMVA 4GVXA 4MPDA 3LHFA 4QYMA 4GKAA 4UD6A 3HDQA 4WOKA 3ZY5A 4H7JA 3BXOA 3PCRB 2ET6A 2JKYA 1ACMA 4HMPA 4ZOCA 1CNMA 5HF9A 3U1VA 2ZJ1A 4CKCB 1Q20A 2R6FA 3B2QA 1G20A 2I4RA 3QFSA 1IE3A 1R74A 4TN1A 1VMKA 4YMUA 4NYIQ 2PGIA 3H7IA 4DT1B 1XEXB 2O48X 1FNCA 5MHTA 5T8KC 2UKDA 3CNOA 3DXYA 3GVHA 2JIZD 1RRVA 2QL7A 2UYOA 3PHLA 1VPLA 2N1MA 3C7DB 4M9CA 2WY2D 3TEJA 4AC9A 1E2KA 2PRJA 3KS9A 4Q21A 2F3QA 2CE2X 4ECEA 2W2QA 1FFCA 4U7HA 2M6SA 5JMWA 4F6LA 5FDFA 2REQA 1YCHA 2GPSA 3F96A 4DIEA 2V54A 2VYFA 1FPQA 3KYDB 2OLJA 1CRWG 1TFRA 4EI8A 1Z5PA 3T3OA 4NKRA 3R0XA 5ENDA 4E1VA 5CGQB 4IKEA 1JBKA 1J09A 3T4PA 2WB4A 2RBEA 4JSYA 5F5LA 4KGXA 3HDYA 2YOHA 3D59A 2A5DA 4RV9A 5AUQA 1EA7A 3CZQA 5DOVA 2QL5A 3REFA 1F8XA 3N39C 2JW5A 4FHFA 4HLUC 4U3JB 1NAHA 4OXQA 3MD9A 4C4SA 1JJIA 3AQ4A 3M5WA 2J7PD 3OT1B 4IF4A 2ZYIA 2I2FA 2F7SA 3A58B 4A2CA 4D4JA 1T2CA 4X7RA 2NGRA 3I5MA 4YC7A 4C0QC 5IANA 3G5MA 3CIOA 3B9QA 1QDUA 3Q11A 5AW9A 2IHNA 3N3AC 4CLDA 1TUEA 5EP1A 5JZSA 3GUUA 3L7JA 2GBLA 4M49A 2ERCA 3Q6NA 2A0UA 4GLJA 1EUQA 3MC1A 1E5DA 4FKZA 1YZTA 1BQ3A 4HDOB 3C8ZA 5TV2A 2YRFA 2VUTA 2E1RA 2TMGA 2IEBA 1W94A 3CVVA 4RHCA 4PYQA 4RD6A 2XUPA 1MB3A 1IHXA 2WTXA 1KEKA 1A7AA 3BEDA 4XB2A 3SXPA 1UADA 3AF6A 2OECA 3M3PA 1SQ5A 1LBQA 4QXOA 3NXKA 4CF4A 2DWQA 3VR6H 3ZWOA 1EA5A 4P4LA 5EN4A 2G4VA 4XGRA 2NSYA 1M2NA 3WLIA 2OCXA 1PG2A 4LC9A 1LS6A 3EZLA 1JDSA 2I4NA 3HJRA 2GNAA 3HYRA 5EG5A 1P0MA 3GEHA 3AR5A 3MJEA 3VR6A 4F7DA 5PGMA 2FF5A 5L3VA 1GKUB 2I71A 5CB4A 4I81A 3WWPA 1MQSA 5TC4A 5EJMA 5FOQA 5KVAA 5AJWA 4J75A 2B3DA 2QTMA 3GDFA 5DISB 3ZVKA 2GQ0A 1PG0A 1W5FA 3DDOA 1CY7A 1NT2A 1BDMA 3OFND 4J2TA 4UUMA 1QGUB 3D1JA 3DMYA 3TLMA 3V7NA 3BD7A 3OESA 3EBOA 3AR6A 2BFCB 3QEJA 4TROA 3ZJ5A 5DP2A 2OHOA 1MHPA 5KINB 2FR8A 2DCMA 3S70A 3DZJA 1YB5A 4X94A 3ST7A 3HCBA 4IKOA 2B94A 2I6QA 3R5HA 2VK2A 1QVVA 3N2GB 3ZKWA 5L6MB 4DMUB 1NWHA 5A9SB 4KG7A 4RUKA 3GLIA 1UPAA 2I7XA 3L05A 1XAIA 2AI3A 1Y4SA 1JJ7A 2PZMA 3WFZA 1H0SA 4QRHA 1SELA 2H4WA 2RHLA 4D9IA 1Y8QB 1RRCA 1DDOA 5LJLA 1WAMA 1LVGA 2BTEA 3HADA 4RLQA 1B1CA 2CVFA 1EFVA 4QTZA 4H6XA 4OSEA 4RZHA 2Q5FA 2REXB 4MV7A 2X1MA 3ZQ4A 1PGPA 4JS0A 1TEXA 3BMXA 4TL7A 2NV6A 2PZJA 4PYKA 5E4YA 5KTYA 3KKLA 1V48A 2OCBA 1V16B 3E4CA 3GDHA 1WDMA 3SIRA 4S12A 1NY5A 2H5EA 5C5DA 2UUBB 1TUGA 1BGXT 2X9QA 2H1HA 1Z2PX 4AJJA 2BI7A 1V8DA 5CVTA 2IS1A 3BWMA 3HB4X 2YWRA 1W1UA 1MAVA 2B8NA 3IGFA 1G17A 4YDRA 1RCFA 1E2EA 1WZCA 3W6OA 4WEQA 4LTMA 2XF2A 1BXKA 3QTLA 1DT5A 5EYPB 5IWAB 1JR6A 3PXEA 2RB5A 4CQLA 2RGGA 5DHPA 3I5AA 3JQFA 3OF3A 1Z6YA 2BCJQ 5KOYA 1ESNA 1XPJA 5D7NA 3AIKA 1L8QA 4A1OA 3CS3A 4PGMA 1P29A 2ZUCA 4F3RA 3QIVA 4BLSA 3NG1A 3ZWKA 2EX1A 3DCYA 2PMCA 2X23A 1D6MA 2I6SA 4JBIA 4MVYA 3JWGA 4KOAA 2V03A 3E9QA 3FB4A 5T4BA 3ME5A 1KK2A 1NT4A 4R2HA 4X45A 4AXXA 2G9VA 4IG9A 5F1KA 1IDOA 3ZI0A 4CMJA 1RIFA 4A5SA 2OP0A 1X39A 1KP9A 4UUOA 4MQBA 1KVQA 2YNMD 2JH3A 4IDGA 1RXSA 2DUJA 5AI0A 4RMGA 3HXPA 1WIWA 4QQNA 4YIHA 4WNAB 2VG8A 1W4CA 1V1RB 5EZ6B 4CCSA 2YYYA 3IOBA 5KJ1A 3ZDAA 1QU2A 4L57A 2ZI9A 3QMMA 4V0ME 1OHHA 1G3UA 2OAP1 4O4HA 4W82A 4BFUA 4HEA6 5HR5A 1C7FA 1B2LA 2KW5A 3PPWA 3ZNQA 4YRQA 2O05A 2ZIXA 4FHDA 4LV6A 1ZU4A 5TGTA 3TTUA 1RC0A 2JCSA 4OBXA 1R4MB 3H83A 3SYTA 2ECKA 3OZXA 4KR9A 1WMAA 3BCUA 2ZI7A 2I7CA 3R6LA 4PQGA 3CVWA 1GSAA 1KO7A 1T5HX 2B98A 2HA2A 2OV3A 3K5HA 1RYNA 2CXHA 3E2MA 4JLAA 4KQXA 1G8SA 1ESEA 5F77A 1VI5A 4E94A 1BEUB 3CRQA 5KUTA 1Y1TA 1GCAA 2V6MA 3M83A 1EUZA 1KMQA 2GEFA 2F3TA 3PL1A 1QB7A 4OK3A 4Q5IA 3DE0X 4KXMA 2OVFA 3D6FA 4WY2A 1ARZA 5LBTA 2HQSA 5C80A 1QHHA 2EWWA 2QMYA 4AP5A 1DRWA 2CNWD 2PUVA 2XUZA 3R0IA 4J16A 4TL6A 2V1UA 3FYUA 5AOAA 4OK6A 3ZKAA 2DHQA 2VCYA 2BDTA 4ZI7B 2ZZNA 1HK7A 1GU7A 3PIDA 5D3ZA 4Z4IA 2E4ZA 3HKCB 1ZH4A 3GJ4A 1V5GA 3TZHA 1TLFA 2B2CA 3TW6A 1UR5A 3OZBA 4LZPA 3I6IA 4MLZA 4DLRA 1II8A 4RH1A 5AVKA 4XJXA 4BTEA 4OLHA 3PA6A 1HDCA 2DUNA 3G7NA 1PX0A 4U2EA 3C5EA 4R05A 3F46A 3HB7A 1HRKA 3PWZA 3G79A 1AO0A 1TQ8A 1TXGA 3C70A 1S2GA 4RL4A 3SX4A 2OCKA 1K0FA 2IT1A 1FUUA 1GAXA 5LUBA 3UT5A 1GEGA 1QG4A 1YR8A 2RHBA 3QU5A 4PRKA 3TR5A 3JQGA 1E1QA 2EBUA 2ZIAA 1ZOSA 1KHTA 4WCDA 1W0JD 1ZVMA 4IDFA 1KTVA 4WK6A 2UXBB 1I01A 3OZWA 1CVIA 3H9QA 5HA5A 1OJ7A 4EG4A 1LV8A 1YUMA 5HS6A 2FPSA 1KIAA 1P2FA 4X3CA 1FP7A 1L4MA 4ZREA 1D4OA 2AOTA 5LQNA 4TKUB 4I0WB 5E0KB 4YV7A 3T35A 1NHWA 1HORA 3IAAA 5CK4A 1JQJC 4HGRA 1I30A 2Y1FA 4GPD1 1MBZA 4CL2A 4W5TA 2RHJA 1WZ2A 4BLQA 2C3UA 2WSYB 4CM1A 1NBIA 1FC0A 4NOKA 3CM0A 3T7DA 1C0IA 1DCKA 1TYZA 3OZGA 4RQTA 1UPUA 4I50B 3PV0A 2A9RA 1VE5A 1VL1A 4UM5A 1FY2A 3CKMA 1UL1X 1EVYA 4XM1A 3EWSA 1HKHA 2ZR9A 1PVVA 1YDEA 3MINA 1PJQA 2W43A 3JR7A 4I7EA 3RHZA 1F7VA 1LZKA 2Y6VA 1HM5A 3PRYA 4OI4A 2DSNA 5CAEB 5JSZB 1FSZA 2RHTA 3LH5A 4LJ8A 5EMMA 3USCS 821PA 1Y8ZA 1DVRA 1YB4A 3A1DA 4CQNA 1L5YA 4Z9AA 1FA9A 3HZHA 1NVVR 3BYZA 1RJDA 3CTPA 5TGDA 4EENA 3RODA 2HR1A 3KIPA 2AK2A 1VCIA 2XUFA 3K20A 5D5QA 3DO5A 3GG2A 1WKVA 4L4XA 1AMNA 4KH1A 5T7BA 4EA7A 1TM4E 2R84A 1QMGA 3PRKE 3OHPA 3O8QA 3PXCX 3RUEA 4BQIA 4G0UA 2NMVA 1XD9A 3MRXA 3NWPA 3LNCA 2ZB2A 4B2IA 3K70B 1ODTC 2C2OA 2X7HA 2FWJA 5FCDA 3DDUA 4GYWA 4L0DA 3W0LB 3G88A 1OWOA 3T0FA 4CDNA 1E5LA 5J23A 4KFCA 3IAS1 1N1MA 5IUNC 2QIPA 2AD5A 3TOXA 4CM4A 1YRYE 4R1PA 1F20A 2YJTD 4MV4A 4PXAA 5D86A 3E84A 4BC1A 1CF9A 3SC6A 3BSFA 3Q7RA 5C18A 2KBFA 3X44A 2YHBA 1RWBA 1Z3CA 3FJOA 4G5FA 5M3BA 1A0OA 3C7KA 5BQOA 3SZRA 2AJDA 5A6SA 5DRTA 4O2AB 4TTIA 2Q9UA 4CQMD 5I7RA 4MZDA 4OVKA 5BN4A 1EP9A 3AETB 1HA3A 3QELA 1VPDA 2PQ2A 2ZTUA 3VOAA 1YRQA 2XB4A 1ZRHA 2MMCA 2VDNB 3QPAA 1UFRA 4K9KA 4MW7A 4ZU1X 4Z0PA 2P4UA 1GPNA 1NUTA 2C1ZA 2YTZA 2BH9A 1E8DA 1CQPA 3AU8A 3I1IA 3L77A 1U9YA 3L84A 1GTSA 1AQUA 2VDRB 5LB2A 2VF2A 3QXCA 4Y6PA 1KI6A 3TMKA 5JO0A 4CFZA 3AQIA 3AEUB 1XEWX 2Q50A 2QKYA 2HSZA 2DKNA 1ULBA 2W7TA 3O9MA 5D84A 1TZ2A 1CPYA 4MVJG 2V3VA 4R98A 3QYFA 4CMGA 1JEYA 4D82A 2XYPA 2F43B 3R5KA 3UJ8A 1KTIA 4D4LA 1B93A 3OLZA 2ZE7A 5AM1A 7REQA 2H1OA 2IW3A 3LP5A 3AY6A 2QVXX 3CU5A 4MCHA 4MVJI 2R4TA 4LZLA 4ZZ1A 5L3QB 3I09A 3RU2A 4DG8A 1BS2A 2PPVA 2IZ5A 1UBEA 3BJZA 4GRAA 4JGGA 3PCXA 1K7EB 4TYPA 5F2EA 4K9SA 5CXUA 1CDOA 2Q1UA 4FGJA 1A8QA 4QAQA 1ADJA 1EWRA 1TKAA 3CMCO 4ZVRA 3EZNA 3M1IA 1PT7A 4ZMRA 1RAAA 4DLZA 5E6SB 4YMGA 1X94A 4FE3A 3BSYA 2IODA 3IUMA 4WKOA 2C99A 4A26A 4GMHA 4NEGA 2ZWMA 2FPGB 3LFHA 4KMOA 2NUAA 3TLGA 4W5NA 3GEGA 4G67A 2XDAA 1KOFA 1NKVA 3C41J 1M5UA 1RE1A 4JT8A 2NP6A 2DLDA 5HPYB 4B33A 4FBLA 2FZ4A 4C14A 1GTG1 1SU6A 2OBYA 2OV4A 2I22A 4ZJUA 5D3QA 1XWIA 2WHPB 1E1YA 4YJ3F 4MGKR 1NZDA 3RABA 3RSHA 1SGWA 1SEVA 3IJRA 3RU7A 4BIMA 1EFAA 1ZG3A 4Z99A 2O8BA 5LDGA 4N6GA 5C0OE 3X1KA 3YASA 2EOAA 5JZVA 4E5PA 4KI0A 1VIVA 3G2QA 4NRDA 4GL4A 4PG4A 4Q4DA 4ZAWA 3DV0A 2GZRA 2GRAA 3L0IB 4G0QA 3BBPA 1ML4A 1XRLA 2X41A 3EX7C 3V2IA 3ZD8A 1XZQA 4WNIA 2IOYA 3OCVA 3GFGA 1U04A 2W8ZA 1IC6A 4KDFA 1M73E 1AKUA 1MJGM 1TO6A 2YWJA 1PGNA 5HKAA 2FB9A 1AKMA 4KRXA 4MPRA 3WWEA 3WQBA 4ARBA 2DC1A 5L3SB 1S2OA 1IN6A 2L19A 5ELMA 2J9RA 2YWHA 2CVHA 3CXRA 4OJYA 4UAJA 3THYA 5HMMA 3TOVA 1KI3A 1NZFA 2BGUA 1PNVA 4RJJA 2OYRA 5CT5A 1A5SB 4GXRA 2GHIA 4IFIA 1LX6A 3J81k 5IVHA 3ITKA 1AHIA 4GHWA 4RE5A 3T7SA 1AURA 1E77A 4UCFA 4K81B 3G2MA 3A6GA 3VYSB 2AR7A 4J7UA 4O4LA 4RMHA 4EGQA 2IVZA 1RYMA 2QTAA 2X5NA 3ABQB 3LD9A 5I9LA 3H5IA 5CW2A 1NXTA 2OKCA 3C85A 3FFAA 2GBPA 1WDKA 2IU6A 4MJXA 4MLCA 4RKQA 4YMWA 2V6FA 3D8HA 3N2KA 3ZYZA 4DBLC 2J0UA 4G2TA 1RE0A 3L0SA 1TCBA 2X8BA 3RYHB 3K73O 2HK9A 1HDZA 1EESA 1EXDA 4YQZA 3OF5A 5JAMA 4GVPA 3WNQA 2GPYA 3OAAA 4B45A 5I48A 1G6Q1 2GLTA 1ZQ9A 1UQTA 3LUHA 4QDOA 3STYA 4Q4JB 5E3IA 3ET4A 2XZLA 3OEEA 2DQZA 2YS7A 3CEMA 3P0JA 4GE3A 4GIBA 5AKGA 4BZPA 5KDDA 2VT6A 4K3VA 5KPJA 1KZ7B 1T1JA 1Z5GA 2X2PA 3T34A 5FOWA 3TH5A 2PX8A 4C0JA 4HY3A 1Y3FE 1N5LA 1W44A 1OILA 1K7SN 4DVJA 4N0DA 4NMMA 4RHUA 4JU9A 4KUGA 1DBSA 2V6JA 5EVCA 1ML3A 2R2GA 3WC4A 2QZ4A 4FU0A 2QXTA 2O54A 4UCWA 2Q3JA 3PG5A 2L0XA 3GELA 3FFBA 1BAPA 3F9RA 5HOQA 2IH5A 5JQGA 2XTAA 4MUXA 5JXWA 5K0LA 2KM1A 2Y9PB 3N28A 4N5HX 1JKIA 1I4EB 2WLSA 1XQVA 1KJWA 1OAOC 1TF5A 3GRYA 3NBMA 5C2JB 3PQ3A 2A7XA 1IHUA 2JF0A 5LDDC 4ZYZA 4LOKA 1C50A 1PR6A 2BKUA 1E6MA 5C8YB 1OWLA 4FFBA 1O0SA 2H0AA 2AN5A 2H06A 3T7EA 4TYQA 2CLFB 3JQ8A 1E99A 1TAQA 1E9SA 1G8FA 1WSDA 4IQ4A 1JVSA 3F5QA 4LXHA 4OM8A 4ADSG 4E5MA 1L8LA 4PCLA 2RCNA 2OHIA 1Z0IA 4CRWB 2GEUA 1HF3A 5CA0B 1WY5A 3WYGA 2GAJA 4HUQB 1DU4A 5AVRA 3JZDA 1PYOA 3CHYA 5KNBH 3SOZA 5KEIA 2VJYA 4QULA 1PL8A 1J2UA 1QF9A 4JK3A 5HJ5A 1PV4A 5EEHA 3QE4A 3BA6A 4Q1AA 2IW1A 3HWX1 3BQNB 1ACJA 4M55A 3LBFA 4UE3S 5SY6A 1GADO 2RK4A 3VJKA 4W5JA 5KNBA 3ZLVA 3D2BA 2XW6A 4RPJA 4YTEA 3T7KA 3Q1LA 4N6NA 3W7BA 1FXWA 2RAPA 3LPLA 2WUDA 2V8OA 4UTNA 3U5ZB 4S1OA 1J0DA 1JAHA 2D7DA 4N7JA 1BWSA 1LPOA 4MYSA 4E07A 5K51A 4ALMA 3O4VA 2QTVA 1G2QA 3B38A 3L0YA 5K5EA 5DDIP 5J2UA 4EGAA 3FOFC 4PQRA 4DNXA 3RBXA 2JGRA 2VKQA 3FTQA 3B20A 2NZYA 1SQGA 2CV2A 2QMHA 5I8ZA 1USGA 4UTVA 3U4AA 1BOOA 3ITNA 5ALUA 5DIFA 3V4VB 1XO1A 1KAHA 3N8KA 1TZJA 5A5FA 4Q9LA 3ZWXA 1BXGA 1VXOA 1O9BA 3ZHXA 2NXWA 3M1YA 4DV7B 3THWB 2RJNA 1O4VA 1RACA 4OB7A 2FHSA 3CN9A 1L5VA 3VPDA 5IKOA 1MC4A 3AUAA 5JNSA 4OK5A 3RBVA 1KC1A 1GTJ1 1YZFA 2VP0A 1CZHA 3I9KA 3QWBA 4H1VA 2QUJA 2DFPA 1CE8B 3AI7A 1KKUA 2CYAA 2VJDA 1AK2A 4Y9TA 4RDXA 1EHYA 4WA8A 4UPEA 4A8PA 3FOZA 4H16A 1F4VA 3BMQA 3VZDA 3QUTA 5GPBA 4QATA 2XQKA 2F4VB 1IVYA 3EY4A 1H9BA 1ZGJA 2XUDA 3K35A 3SM3A 3KXIA 2W70A 3IKTA 3CLSC 2CNLA 5D8DA 4YAGA 4X1KA 4BLVA 4JJZA 1SZCA 2C5AA 1J20A 1Z3IX 3B36A 2HOQA 4IMRA 4ETWA 1UIRA 1RQNA 1NGSA 4Z9XA 5BN3A 3TR0A 1D0SA 3N6XA 1C8VB 2EQAA 2JCBA 2Z30A 5ABPA 2D4AA 3KB2A 3TD2A 3ROFA 1M6HA 2HNBA 4G24A 1P39A 1QVAA 1F4LA 3GNSA 2P65A 3H4IA 4LVNA 1B43A 1YAHA 4TXLA 1ZK4A 1Z33A 3KT8A 4OUKX 4KACA 1K6JA 1KO1A 2XIJA 1G18A 3V9PA 4YP6A 3WL7A 4YCAA 2R5FA 3M7IA 4FZJA 1F2TA 1VFNA 4XSGA 3H2BA 4RLSA 5G3ZA 3ESCA 4YP9A 1RAEA 1SURA 2HWUA 2J5KA 4YJDA 2M6LA 4MUGA 5A1JA 4NCAA 3F6EX 5HQ3B 3IJEB 4EG7A 1UJ5A 1KP3A 1OLXA 3B7GA 5BV2P 1TF2A 1G8KA 1NV8A 6ABPA 1TUBB 2A4KA 3MJRA 4B6JA 3GNQA 3GOHA 5C7YA 2IH4A 1FMLA 3HXMA 3U7GA 2VS1A 1H2RS 1Q21A 3QHAA 2DR2A 2XB6A 1BA2A 1FFBA 1U9CA 2H0QA 2WFZA 3OZFA 3KEMA 3RTCA 2NXEA 5FOTA 3SBXA 2VPYA 4BNNA 4HLDA 5GONB 1E1DA 1DEAA 2B4TO 3PT5A 4G36A 5TS3A 3RC7A 3VC2A 3W9SA 2ZB7A 4HWSA 5ICSA 4IJ6A 5EKUA 2PX2A 4H4EA 2ZS9A 5AIAA 1R3UA 2XMQA 1KP2A 3NO4A 3WLEA 1RWMA 1DKPA 4DE5A 3WWOA 1H65A 1IU9A 1P19A 3BFPA 3DVQX 3F2VA 4H60A 1FSGA 2NU7B 3LA6A 4LWZA 4R5HA 1DTEA 3F6PA 3IP7A 4XGKA 3RM3A 1XU9A 3I2GA 4PYNA 1UUFA 3R7SA 4HXYA 3O3OB 4EFDA 4IHJA 1G3RA 5LA6F 5A03A 1E3SA 1KDZA 2EKQA 2O14A 3F90A 5DEIA 1NFFA 5JS2A 3WLOA 2LKCA 4MCIA 5F52A 4OXNA 1CKEA 2E7ZA 1JEQA 2IU4A 2VAMA 3EQ6A 3KTAA 3KUDA 4L8VA 2AWNA 4MUKA 2ATVA 3NHPA 4YPVA 1UMDB 4ENVA 2AD1A 3OIWA 2B5WA 1P3DA 2BYTA 1KJJA 1DZIA 1FF9A 4E03A 3GJXC 2OZPA 4CQJA 2H9IA 1J2RA 3SXUB 3O47A 2QRMA 1YV9A 1SKAA 2ZDHA 4NHEA 3VNQA 4GMFA 2NO6A 4EDHA 1H9CA 1M8KA 2PBZA 3EZ2A 2GBLC 8OHMA 2GK4A 3DZGA 4II7A 1E9EA 2OOSA 5IDQA 1IZ9A 1KS2A 1PNQA 2FZLA 2QN8A 4KDEA 1LNSA 2XZDA 3R1IA 2PJRA 1QIJA 4XR9A 3ICWA 1WPXA 4HDAA 2ZUDA 3MWJA 4MCJA 4RFLA 3SHQA 4EY4A 1OIWA 1IWOA 3T7JA 4HG2A 5F64A 3HCDA 4PLGA 4B2PA 1HNNA 2I2BA 4NU0A 5BV7A 3LPAA 1L8OA 2PMDA 4ZVPA 4Z51A 1HE1C 1GCOA 3RW9A 1UP4A 1YHZA 3DEYX 1R0LA 1VLHA 3VHRA 2PUEA 2CUKA 4UVGA 5G4KB 1J2EA 1VJ0A 1BXZA 3HUUA 5GZ6A 1M74A 2A1UB 2CJWB 2N47A 1CD5A 4XTRA 1KK1A 3IV6A 1QGYA 1UXOA 4WZAE 5EZYA 3WKBA 3QITA 1ZJ6A 3JQAD 1F0YA 5BSHA 3O4JA 2A7QA 3RJ9A 1UMBA 2Q5CA 4CBVA 5B7NA 3THXA 4ZPJA 5CCEA 3KZOA 4LQ4A 1MRNA 2NWQA 3H0CA 4MA0A 4WI1A 2FR8C 1UZLA 3BXZA 3FPCA 2HH9A 1YDHA 3KC2A 4RCYA 2W6MA 1C9EA 4Y9RA 3T99A 4BN5A 3SZLA 4G89A 5AM0A 1B41A 1RYDA 2NU8A 4B8ZA 4F92B 1RWKA 2JG3A 2O2CA 4IR7A 3MWEA 3CUVA 1L4BA 4QBTA 4Q9JA 4TKLA 3L02A 5EKSA 3BHNA 4E4TA 3ZV4A 3D6UA 2QD1A 1CDZA 3LPMA 1ADFA 4B3TB 2BPOA 5E8JA 4WXPA 3NBZC 4OY3A 5EL0A 3R75A 3S81A 4I66A 3K4QA 1M0TA 5H83A 1JTFA 1H93A 4BMOB 4BWGA 4C2TA 5AK6A 3RYTC 3RU3A 3GK3A 1H5NA 1OU0A 1H6CA 2QYOA 3ZCXA 3SQLA 4DF3A 4Z3OA 1QVRA 2OHXA 2G67A 4QYIA 4DNQA 2XADA 5LMZA 3T3NA 1DBQA 2PLAA 2Q29A 3D6MA 5DLQC 5CLJA 5DHAA 3DQPA 4IEIA 4V2IA 1QKJA 2QTHA 3PUYA 3R4VA 1P5FA 1P1JA 2XMRA 4M1SA 3STXA 1ZA1A 1RJEA 5DX0A 4C08A 5ECYA 3TN7A 2D3WA 1MXHA 3KHTA 3H9GA 9MHTA 4JD5A 3DC2A 4JHLA 2XEDA 1JA0A 3DQZA 4EELA 5JASA 4MW9A 4BQPA 1J5XA 4G09A 2ORVA 2XB8A 4DQKA 1E5XA 1KGSA 4NECA 3DCNA 1WW8A 3JQFC 2JB9A 2YXNA 3KQYA 1NG1A 2OFPA 2TSYB 4N6OA 3QNWA 5HGXA 4FEYA 4GGPA 3E22B 5BR8B 1Z68A 4AKGA 2IYVA 3B52X 1LWOA 3B60A 1E58A 3R9KA 3TQOA 1U8FO 1EVLA 2FDRA 5BR4A 5GIPE 1E61A 1K6IA 4J94A 3V7FA 5I7FA 3L2OB 3MJDA 3D0QA 1TT5A 5TS2A 4QWWA 1WNTA 3N86A 3KQPA 4GSYA 2FDCA 5IN4A 1EFKA 1E63A 4MRSA 4DTIA 3K32A 4BLPA 3ILHA 1QIIA 2VJMB 3EVAA 2RD2A 5COAA 2H17A 3RT7A 2AVNA 4F96A 1RQLA 4ACAA 1LDGA 3A4TA 2ZRNA 4WNYA 3KETA 4ZOLB 2VDWA 3FPEA 1Z6TA 1VJ5A 1EFHA 1P5RA 3AUJB 3CB2A 5HDQA 4EW3A 2DYKA 3QY9A 2ZTVA 4AQYB 2E4XA 2QTGA 3RVKA 3IIEA 2ZAIA 4DCGA 4O4IA 4EPVA 1XDUA 2ZSJA 3L07A 4QBKA 4DV2B 2R5WA 3KSAC 5F51A 3V7YA 3WJ2A 1KEZA 4MLDA 3DLBA 1IB0A 3LW8A 4HNSA 2R00A 3A37A 5SY9A 4GOOD 2FOLA 3G0CA 2ZS7A 4QSMA 1H3FA 1YQDA 5EHIA 3TFQA 2VJPA 2Y92A 4JVMA 1SVIA 1YCFA 1JIJA 3P26A 5EA2A 1RU3A 1YULA 2IUFA 3FRIA 2P79A 3I23A 1LEHA 3LXMA 4U2KA 5HUQA 5JTTA 1RQRA 4IDDA 2NG1A 4NE2A 1XA0A 3EE6A 3U5TA 3WTBA 1U8YA 1ZL0A 2QL6A 3T0IA 1M8GA 1U0OC 2FZGA 3L8ZA 4JWKA 1D1PA 4HH3C 3F73A 1RWPA 1IN8A 2YJZA 3RG2A 3IQEA 1KH1A 4PZDA 4U9IS 2YMQA 3OKFA 2J45A 2SHKA 1IEXA 2FV8A 3VKGA 1CHDA 1QC5B 3EMVA 1TJ4A 1DC3A 2NQ8A 5K3BA 3WSWA 3H9UA 1N6RA 2OO7A 2RI0A 4HAWA 3AIIA 1Y3AA 2NACA 3B3FA 1Y0BA 3D3QA 3FYUC 3HUFA 4KBFA 4URFA 5KQRA 1YMUA 2IS6A 1XOIA 1R5OA 1RKQA 3H99A 2PD3A 5EI5A 1NURA 4BBPA 2Y0CA 1RVDA 4LYHA 4HNTA 5KYTA 2PX6A 1Y9EA 2GXUA 2MOKA 4AD8A 1U3FA 3GJTA 1QM5A 3LT4A 3A7DA 3DBIA 4LZJA 2HA7A 3KELA 4MWGA 1SC6A 4NJMB 3ZZ0A 4P5EA 5CXXA 2V4ZA 4CMIB 2XT9A 4MWOA 5AK4A 1E2UA 4TS1A 4BE4A 1M8JA 1PFWA 2NO1A 2O6HA 2R60A 3JVDA 4HUJA 5FUQA 5JCJD 2VR1A 1MC5A 1LDNA 5IYZF 4B44A 3AR8A 3L8YA 2HNAA 3OBIA 3IPAA 5TPWA 1SOVA 1J42A 2EBHX 5FI5A 4G4SP 1H8HA 2AOXA 4KUHA 1DKUA 1MG0A 3OFSA 4AG5A 2J3IA 1N5DA 1Z63A 4KW7A 1JXOA 3C1OA 3H2ZA 3DEAA 1OAKA 2DT5A 4O5AA 1U2GA 4G85A 1CV2A 3KJFA 2ZB8A 2GTIA 2BR3A 3LPCA 1NI4B 2IYNA 1YE8A 2J0EA 3EIOA 4D9JA 2ZRKA 2OBLA 1JT9A 4GLLA 3PFHA 3ZXUB 1FS6A 3C39A 1UINA 1W30A 2QVBA 1CJMA 2G5TA 3G2IA 1YQXA 2K7ZA 4ZU3A 3VU8A 2BFEB 4A91A 4EA6A 3IQWA 3K3PA 4PLWA 3GRKA 4LWOA 3V9AA 2BW0A 5KNDH 3HBLA 2YOGA 2ZP1A 3FNFA 3QM1A 1ATIA 2QP3A 3L0CA 5K99A 1QV9A 1P8AA 3BE8A 3PEUA 3ZD7A 5KNDA 1QFJA 3W1VA 1UXHA 2VC2B 4LDZA 4X6XA 4E32A 4EVRA 5DBHX 1D6JA 3LBIA 3M6VA 4MVJD 1QO0D 4N3AA 5ADHA 3ET5A 1EFLA 2I0FA 1ST3A 2FUCA 3CH7A 3Q7QA 1Y8AA 3NV9A 3WXMA 1UBHS 3ZWYA 2HU8A 4NYMQ 4YK7A 4ARZA 4TTPA 5TMPA 2C2KA 4GF5A 4L15A 3D7LA 5D01A 3AEXA 3OE1A 4NFHA 2D5AA 2HM7A 4EJ0A 4D02A 3QI7A 5HKKA 2G0AA 4GZMA 1XWFA 1YIDA 1RMQA 5TVGA 4KXLA 4TLMB 1YKGA 1M6EX 2X9VA 3FSGA 3PC3A 4ER0A 5HS4A 2YV3A 4B09A 4RKYA 1YT5A 1V5WA 2NU9A 2WD8A 4RDCA 1ISHA 1T9ZA 3JWHA 3N2ZB 2UYGA 4MV5A 4WOBA 4R31A 1GR0A 2J4CA 2ODAA 1FP6A 3GRZA 3QE3A 2AUMA 5DEOA 4O63O 4XDGA 1C7EA 1PJBA 2J3EA 2RGUA 3ETLA 2ZJZA 5AI8A 3ONDA 4M6WA 3U31A 4BNLA 2C7PA 3UK6A 3CG4A 3E7FA 4CKWA 4MGHA 3CLTD 4P4SB 1SBCA 1OZHA 2D0DA 3U4QB 3GLTA 4IJ5A 3TBHA 1Q19A 2BTOA 4HAYA 2JBAA 1P45A 1KEPA 2VZEA 4RJIA 4C4PA 3GV0A 3G2HA 2J3LA 4Q6BA 3TZLA 2VYND 4FMBB 4XIYA 4I4TA 5AJXA 5JG7A 1P72A 2OSVA 2GSWA 1ZN9A 3BIXA 3VR1A 1SKYB 2FEMA 5EE3A 4CZ2A 5IXSA 4D8VA 1XVTA 4JEHA 2PVPA 4B2YA 1GTL1 4MZXA 1G21B 3AG5A 3WMWA 1KMIY 3P94A 4AL4A 1G4HA 3GIWA 3KV3O 2GLUA 4EHBA 1V6AA 5F73A 2I4OA 5T41A 4WL0A 5CFQA 1KDVA 4X62B 1HT1E 3G0IA 3NYIA 1M6NA 1JG1A 3A4MA 2O0KA 3CCCA 4FDVA 4NE9A 5ALFA 3QBVA 1KVSA 4QU9A 4H7DA 2PRYA 5BMVA 4NDNE 4Q7KA 3FPAA 1GIAA 3Q85A 5BOSB 4AN4A 1AUPA 1LSUA 3OF2A 1U2TA 1GZHB 5ELLA 2OG1A 1WCYA 4LQLA 2CXPA 3VYUB 4CI9A 4OREX 5ES3A 2FZWA 2Z5FA 1M2HA 2HSDA 4DA7A 3IBTA 4Z54A 4WEOA 4XYBA 2XQVA 2WT8A 2XYQA 1I7PA 4XIIA 5DOZA 1FFXA 4ZT2A 2HCRA 4LOJA 4GI1A 3TLAA 3KBBA 2WA2A 3WMGA 1Z7EA 8ADHA 1XEXA 3TW8B 2P41A 1VDMA 1RYHA 1L5FA 2Q62A 3U44A 2KB0A 4XRRA 2P3LA 2WSSD 1KY3A 1YD7A 4DZRA 5HYVA 1T15A 2WP0A 1A7UA 3M4ZA 5KQGA 2QVGA 3ABOB 1H0HA 1WVIA 2MR5A 3JQEA 1M5TA 1GZ4A 3KYDA 2H4ZA 3OICA 4JBXA 5DMXA 1G7TA 1KYZA 3W4IA 3RLIA 4J0EA 1WMSA 3KJIA 3N7UA 3T7TA 3W6PA 5A7HA 2ZJ5A 4OATA 4NIMA 3UANA 1HRDA 2H3EA 1LFDB 3I2FA 2JCXA 3QOXA 3L7CA 1ORIA 4WOPA 1Z0SA 3EZ9A 3LCJA 4LMPA 4BO9A 3GLHA 2VLBA 4ZDKA 2PZBA 2I33A 4A0FA 4U3JA 3G5TA 2PYDA 4OYYA 4B7ZA 2AA3A 3O3MB 1PUJA 4CCYB 1QBKC 1KJIA 1QOZA 1GFWA 1GCIA 3QENA 3FPBA 1AK9A 3R5JA 3U7EB 2BFBA 1PU2A 4H15A 5BNZA 5IPFA 1T10A 2BMWA 3WGJA 4II3A 3A3OA 4EK9A 5D6OA 1RXWA 2HD4A 4W7HA 4MOWA 3RS7A 4OQDA 3MS2A 4IILA 3R3UA 1LPBB 5EMNA 4BEJA 1A5TA 5HXAA 1FS5A 4B48A 3U7RA 1BZYA 1CC1S 3CX8A 2YS6A 5F3RA 1N57A 3TXXA 2JHGA 2QG6A 3VU0A 4XYMA 4DMLA 3K16A 5JBNA 1KI4A 2QZSA 3GWZA 5EFZA 4F3KA 2AEEA 3KPYA 3NHJA 2EJVA 2QNRA 1BDBA 2H11A 4MO9A 4E2WA 2GZ1A 4XJTA 1TE2A 1EGHA 4MVJE 2IYEA 2DECA 3CPSA 3BMCA 4DIUA 5F2OA 1ZP6A 5AT1A 1V4NA 4E1BA 3DTYA 2GUGA 4A03A 4MKFA 3TINA 3ZD9A 3PU6A 1G5QA 3H1TA 2A78A 4MI6A 3VYTB 2QMQA 1JR4A 2JJQA 5L53A 4L9RA 1C1DB 4DHEA 2FK8A 3G9QA 3P9PA 2FGJA 2LIPA 4P3PA 4W7SA 5CIQA 2ZJ3A 3DUFB 2A5LA 4EGSA 1E7MA 5B58C 1MNQA 1YZLA 3REOA 2Q3EA 3CH4B 3LUDA 2D1SA 1PT5A 3QU4A 3LW7A 4HB4A 3OU2A 3L82B 4AXBA 4ENTA 2BFCA 3EFHA 4W8HA 2OXRA 4EW2A 1K98A 2SBTA 2XXBA 1LTQA 3AHHA 3IURA 1E3DA 1RTKA 2RARA 1XJCA 2VZ0A 3NHYA 2P8JA 1B42A 4NZYA 1XD8A 3PX2A 3CLRC 4LYGA 1IM2A 2OCIA 1LF0A 1Z7GA 3N2GA 3OTIA 4IIYA 4P98A 4F3YA 1VRCA 4UUQA 5A9SA 5MN5A 4CEHB 3JX9A 1DB3A 4JVOA 4M9QA 3E5MA 3IEXA 2ZLBA 1MB4A 1HE3A 5C1BA 2NTYC 1ABBA 1PV2A 5KYUB 1XGKA 3AVYA 1GZ7A 1KFKB 4B9EA 4D9FA 4IHQA 4L73A 3RANA 4E5UA 4QSHA 3KUUA 3U16A 4JH0A 4FDUA 3HXOA 2XSZA 4YLEA 4CN8A 1V16A 3I2HA 3DAGA 1IBCA 3P0EA 3BHMA 3IOMA 4MS4B 1SU4A 1C0LA 3EXEB 5EQFA 5J5VA 3ISJA 3EUAA 3VZPA 4AKIA 3WLTA 3KKPA 4WD3A 1GRRA 1XTJA 3W6UA 3I5XA 5CHYA 5ECDA 3ANTA 1QKKA 2FEKA 2JGIA 5FB3A 3BBLA 1UIMA 1ONSA 1JIQA 2IYAA 4FHEA 4H59A 1QO7A 3ZDZB 4CF6A 4YV1A 3GQBB 3CRVA 1SBZA 2CCKA 3DLPX 5EYPA 2X0EA 3STWA 4C89A 2P5SA 2IE8A 3HLKA 3O8OB 1JYSA 3KQQA 3T3HA 1VCMA 3KAQA 3WL6A 1E98A 3L6EA 4YCLA 4B3RB 3QEMA 2CXRA 3JD2A 4KJZA 3QE2A 4O02B 3R3SA 1CIVA 2NIPA 3LUKA 4YHHB 3U39A 5HFAA 3N0TA 1TMGE 1FMTA 2NXCA 2OXIA 3ZK8A 4AMBA 4D45A 1AN0A 1XYYA 4FNMA 1QHGA 5DBEX 1KOGA 2GNPA 3AF4A 3LPDA 3I01M 2IL1A 5HF5A 1ECJA 2ID4A 1BFKA 3OZIA 1MU0A 3HL0A 4RIFA 1EBUA 4NXMB 3IP5A 4XEUA 2B4QA 5K2MA 1SVOA 2ZT5A 1JHVA 3WMXA 2YXEA 5CB4F 3UWSA 1TEZA 1G41A 2C9DA 4F85A 3GUHA 4HI0E 4LECA 4ZT3A 4LF9B 4AJHA 4GECA 2WICA 2FSUA 1EZZA 4JP2A 4WNAA 3WRXA 4Z7QB 1V1RA 3PNQA 1YS7A 2BF7A 2VH5R 4KLZA 4R9RA 4IDNA 4TV9A 5DGIA 3T3MB 3KKQA 3TW4A 3P9YA 1PW5A 4BY9E 5EIBD 2FUEA 2EDAA 1AH2A 2P4HX 2XTJA 5ITVA 5GJWC 4WPGA 3PZBA 4XOUA 4BNJA 4RTSA 2W2LA 2AJBA 4AYXA 2JIRA 3NAGA 3DHYA 3WA6A 4XWWA 2VATA 5A9TA 1KJZA 3R6GA 1D8TA 3HVJA 5JH7A 1NR1A 4EHJA 1QGOA 4UOZA 1Q6ZA 1Q12A 2EF0A 4JI4B 1V11B 3ZVNA 2QAJA 4KXNA 4B8YA 1CQWA 4UPVA 4FUQA 2YJ3A 5KCMA 2IHYA 1KEEB 4OQPA 3D7MA 1R6VA 2WJ4A 2Y1CA 1CDEA 3L0DA 2V6BA 2H6EA 1IB6A 4JWTA 3IMGA 4R2LA 4RZ2A 3HO6A 3RFCA 3RTGA 1IWPB 5JR3A 121PA 2P5YA 3NJ8A 1RYEA 2FDXA 4F2PA 2ZIFA 2VSFA 2OUIA 4ZI7A 3L8GA 4CLRB 5AKYA 3JVVA 3HKCA 3O4RA 4HXGA 2EJBA 3NGXA 2HHAA 4GMKA 5G4LA 3MIIA 1Y6FA 3UJCA 2P2ZA 4R8VA 4W1QA 1FQOA 5B4VA 3IDOA 4D5GA 4INZA 1PQYA 2H18A 3VPFA 1B23P 2QN3A 1TM5E 4JLNA 4XVHA 1HKUA 5DNWA 5IK2A 3VI3B 2ODWA 2VNAA 1PL0A 3ROQA 5B3AA 1C8LA 1T1EA 3SG0A 3STUA 1DIAA 1V7CA 2QUIA 1EVZA 2AFHB 2D7CA 2Z1MA 1Y6RA 3UB4A 1IMOA 2HO5A 2QRZA 1N0VC 4JIMA 2PLFA 2WFAA 5K3SA 1CNEA 2HU7A 5TQJA 4ASUA 2FPIB 3D4LA 3DPUA 1TKCA 4N5DA 2VT3A 3F0TA 4PX9A 1QQBA 4RIGA 1QR2A 1I32A 2JFFA 3DWFA 3EQZA 3ZGLA 4F45A 5LOVB 1M7HA 3PLNA 4LJ4A 2QTBA 2XQGA 4TKZA 4YRSA 2WP8J 4I6EA 3VO2A 5ADWA 4I1PA 1XJ0A 2AC4A 2GEJA 4UNRA 4C05A 1GZ6A 5JMOA 4BUJA 1VJTA 3O83A 3K1ZA 4LHEA 3VA7A 3RFUA 5F2NA 3W2IA 1QIFA 1NPDA 1C5KA 2IHUA 2PL1A 1W36D 3WE7A 1DAMA 2PS0A 1YS4A 1RKUA 1DQPA 1X14A 3QNUA 4CTNA 2G5CA 2VRCD 1PSDA 5KDLA 5F3DA 4EYGA 4PU0A 5J2TB 2BHRA 2ZAGA 2NW6A 3MMSA 4Q24A 3MG9A 4O4HF 4B82A 3HB5X 1TAUA 1I5OA 4J0CA 2JH9A 2WTUA 2PUAA 2H4JA 4FIZA 1J22A 1E6EA 4AKSA 3IJ5A 2V0GA 3CUEF 2QNIA 3QKRA 3ZWQA 4PNEA 2OQIA 3WV4A 1WA5A 3GGJA 3ED1A 3D6VA 1UKVY 1Q57A 4QQFA 3ZE0B 2BGKA 1DDGA 1AIPA 2ZQZA 1Z62A 1W29A 3KBOA 4D56A 2OCGA 4DLKA 1NM5A 2CHGA 3O8NA 2C2BA 1IZ0A 4LVOA 3I5YA 3AJRA 1PJ2A 4QX6A 3BZUA 5A5DA 2I6GA 3OPXA 4OHCA 1D2NA 2YHUA 4UNNA 3O7WA 1GGMA 3OZEA 4UHJA 3SZMA 3FGPA 3UJNA 1JPVA 3NT2A 4WKNA 4JJAA 1VGVA 1VE3A 1JNYA 1TCVA 4I8DA 1OJLA 1UQRA 4JR2A 3GLFE 1R3DA 1NBMA 4K87A 1XTKA 5H16A 1E4VA 2HA3A 3KT3A 4Y2QA 2H51A 1UBKS 4QOJA 3RUIA 3I6MA 1F1BA 3C0KA 5KYKA 2DFVA 5TEVA 3W5HA 2WZDA 2I76A 3WV5A 2Q45A 4PC1A 3VTAA 4EYSA 3T3GA 5HUHA 1MX1A 3NBQA 2H2WA 2Q7XA 1XRSB 1VKZA 3RAFC 5H5JA 5TQ2B 4F4JA 1O8CA 4R81A 1G2IA 2HWWA 3QLJA 3AETA 1KEUA 5K8UA 2WVJA 3QYAA 4LHYA 4ZGBA 1XXHE 3C1AA 3NOXA 4OHFA 1Y48E 3KU4A 1CS0B 4M0MA 4NJOA 1UXJA 4R69A 1ZIDA