1V95A

Solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
130
structure length
130
Chain Sequence
GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Anticodon Binding Domain from Nuclear Receptor Coactivator 5 (Human KIAA1637 Protein)
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Nuclear receptor coactivator 5
total genus 30
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1v95A01
4YREA 4HWOA 5E3IA 1H4SA 1KMMA 1NJ8A 3LC0A 1H4TA 4K88A 2ZT5A 4YRTA 4TTVA 4G85A 3IALA 4NCXA 4YRMA 4YRKA 2ZXFA 4K86A 3A32A 1H4QA 1HC7A 4HWSA 1B76A 4YRQA 4HWTA 4TWAA 1ADYA 3NETA 4YRGA 1NYRA 1NJ5A 2Q5IA 4WI1A 3IKMB 4HVCA 2PMEA 1KMNA 2G4CA 2J3MA 1NJ6A 4HWRA 1GGMA 4HWPA 4YRFA 4K87A 4KR2A 4YRLA 1NJ1A 5C52B 4YP0A 2Q5HA 4YYEA 4P3NA 4ZTUB 2LW7A 4PHCA 1EVLA 4E51A 3UH0A 5C51B 1ATIA 1ADJA 1QE0A 2PMFA 4YRNA 4P3PA 4X5OA 1V95A 4G84A 2I4MA 1H4VB 4YRSA 4KQEA 4ZTZB 3UGQA 4YRRA 4EO4A 4YRCA 2ZT8A 4KR3A 1FYFA 2I4LA 1G5IA 4YROA 3HRIA 4RDXA 1G5HA 1HTTA 1NJ2A 2J3LA 3UGTA 3HRKA 3A31A 4YDQA 4P3OA 4YPFA 2I4NA 5C53B 2ZT6A 3IKLA 1WU7A 1KOGA 4Q15A 2I4OA 2ZT7A 1EVKA 4YRIA 4OLFA 4YRPA 1QF6A 1NYQA 2EL9A 4YRJA
chains in the Genus database with same CATH superfamily
4MR8B 5FWXA 3AW8A 2PA0A 4LQDA 1N6PA 1FDSA 5C18A 3I01A 1O0CA 1JQ5A 1LDNA 4WLFA 1DO8A 4RLFA 2HREA 1R0SA 2X4LA 3OM0A 1T2EA 2HLDA 4MRVA 4BRWA 2VTBB 4UAVA 4NIMA 1G42A 4O4LA 1QFSA 5KAMA 3WGKA 2YNMD 1MPTA 5KPJA 3HSKA 5HM6A 1Z3CA 3E3OA 4UDYX 1GPDG 1WE2A 1VLZA 3CQ9A 2VF4X 3GZJA 3LMKA 4UZFA 2RC5A 1GUFA 3PQCA 2Z1MA 4ZQGA 4DABA 5AVKA 2ZIGA 2JH8A 3M5WA 3OIUA 4UBNA 4XQEA 4GZMA 5EE5B 2G77B 1SCAA 4UXIA 2FXIA 4F3TA 2ZS7A 2BEJA 5K8LA 3QX7A 3R24A 3D3WA 4A10A 1YA8A 4RTKA 1VL1A 3C5EA 5JLAA 1U8TA 3SS7X 2WIKA 3TR6A 3W2FA 4II7A 4IR7A 3WOHA 2HSDA 4WERA 5CJJA 1E9DA 4BNJA 4YRGA 5LOVF 2JGRA 1MAUA 1NNUA 5K45A 4DQUA 4K0KB 2JAUA 4AI6A 1D6NA 2QX8A 4LUCA 5J2TB 5D5PA 3GLIB 1AUPA 3JV7A 2ECPA 4UHCA 3DW1X 2YVAA 4R69A 2EOAA 2XSZA 3A14A 1P7YA 4ZHQF 4YBRA 2WWYA 3WYCA 4JBHA 5AOVA 4C03A 4GYJA 1XLTA 4B32A 5ALOA 2YL2A 4YP0A 1CB7A 4NPAA 5AVVA 1GFSA 1WXFA 4G97A 4R1OA 2A4MA 1KSJA 1SKUA 5JD4A 4FE3A 1QRRA 5CNKA 4PLTA 2FPIA 3IUYA 1MQAA 1L6IA 1XTIA 3BF8A 2VTBA 2NVWA 1RE0A 4KXMA 3LK6A 4G41A 5BW5A 1HL3A 3O4HA 2P2DA 1MMFB 1X7YB 3INTA 1KDYA 4A2PA 2Q99A 2H4FA 1V1MB 1JKXA 2FZVA 5AI4A 4ROSA 1NLZA 4JI6B 1TCBA 4PS0A 4RFLA 3RYFB 1AZLA 2HK6A 4J9VA 2WU0A 5ENVA 4U9UA 4XPZA 3V7YA 5LMUB 3ZHBA 5KS2A 1TYBE 1CQWA 1R0ZA 2CMKA 2D0OB 3A4TA 1TQ8A 4W4TA 2OKCA 3TCKA 5KTNA 3DTTA 2PLNA 1UKCA 3BG5A 1U2SA 5ALTA 4NARA 4DV0B 3N53A 4LOIA 3FZQA 2WWVD 3EAGA 1JXOA 4DLTA 3OHPA 1F4PA 3UA3A 4IXNA 2I66A 4S1VA 5BR7A 5JATA 5B1DA 1ENZA 1KORA 3KJIA 3CWZA 1PGJA 1GU1A 4RKQA 1OPRA 5B55A 3JQBA 1TM3E 2COKA 2QE6A 2Q8PA 3GY0A 4CL8A 1MOSA 3FYDA 4JLWA 4ZOEA 2FW8A 4JR1A 4I8XA 5H68A 1ZVVA 4A9AA 3H7IA 3ROZA 2WTBA 4LJYA 3WYNA 4Y2QA 1ZRNA 1RLJA 4MEAA 5CP8A 5E1MA 1IZ9A 3D4LA 1OKKD 3KOOA 3PNVA 4S24A 4KDEA 4YCAA 2DC1A 5P21A 1UKEA 2ZTLA 3KB6A 3NAGA 4MWZA 2XZPA 4DLVA 4DSNA 3UJ7A 4CLOA 4YHHB 2ATVA 1FTQA 1UBUS 4P0PB 2Z5VA 2FF5A 2DTXA 4BGDA 3OZWA 2CSXA 2FN9A 2DR3A 2VK4A 3FNIA 4MWSA 3S8MA 1KFEB 1J0AA 1H3NA 1DVRA 4L8LA 1OAOC 4J0IA 5E8JA 3RUAA 4DRXB 2ICAA 3GJ6A 2X58A 1RMQA 2NG1A 2XA2A 3V4LA 3GQBB 3MEQA 4OI0A 4E14A 1GLGA 3LVQE 4C9BA 1SVKA 1V7PC 1CF2O 1ZN9A 3NT2A 2QW1A 4HBZA 3RU9A 3I01M 3WICA 4ZMBA 5EIFA 4JLVA 4AJHA 1OBFO 5LA6B 2YV5A 1ZCBA 2VTVA 3RIHA 1DQSA 4CTNA 1DKUA 3S4YA 5HUQA 3NLLA 4LMAA 1UBEA 1XJWA 4OMFG 2O8CA 4AF8A 4MLPA 1SKQA 3H0KA 1JWBB 4B2LA 3Q2IA 3FPBA 2BLNA 5FO0A 4B35A 5GONB 1QG2A 3GRRA 2R87A 4ZHQA 2J3DA 1A9YA 3TD6A 7MDHA 3EPLA 3M82A 4ATNA 1AV7A 1T4BA 4C76A 1TUBA 4UCFA 3ZE9A 1JQLB 2GAIA 4BVBA 1K8QA 5C37A 2OECA 5HKKD 1M83A 3QNWA 5CD1A 4LKOA 1LPPA 2C2MA 2J7PA 3ICVA 2PZAA 5FLKA 2PNFA 2LKDA 4HFJA 2C5LA 4RNCA 2PGOA 4CT5A 3P2JA 3R4VA 3TNLA 2ZTVA 3SQMA 5ARCA 1BWRA 4RTLA 4GP7A 2CT8A 2ZBUA 3MT9A 1YR2A 2E5WA 2BGTA 1QUFA 4S1NA 5A4FS 4ENTA 1KDTA 1P6QA 2LRHA 3CONA 4QPPA 1U3VA 1C0KA 3I3SR 3WYFA 4GPTA 5HRAA 5U9CA 3WL4A 2GBFA 4BRZA 2LD4A 1TX4B 1YHNA 3UWDA 4Z3KA 1W4CA 4KP7A 3VR6D 1Y8QA 4PHCA 3O75A 3UXMA 5IMBA 3VR3D 1DSSG 3OT1B 3ODPA 4FDMA 4IOJA 3QVGA 4MS4A 4LYYA 4QASA 5J40A 3T95A 1WSAA 5J5AA 1F0YA 1KJWA 2IDZA 3LZ6A 5BVHA 2KWIA 2WG0A 1ZLXA 3IDQA 4HQ6A 1SNYA 2YW2A 4MQBA 4PBSA 2ZYWX 3U1TA 3V4RA 4YJ2F 3UJ8A 3VYRB 2ASEA 3SZRA 1Q3TA 4J1TC 1UXHA 4X90A 4XIIA 2CFSA 1X7HA 4H1UA 2B3DA 3W2EA 5JZ9A 2IZOA 3NVMB 1DEXA 4MWEA 1GEEA 4QUEA 3WA6A 3ZIUA 4KITB 4K5QA 1GPAA 1J8FA 1Z2AA 1NL3A 2WHXA 1MGPA 1B3BA 4LNHA 3D8SA 2ZUWA 1QIIA 2IEAA 4JY7A 1I0IA 2A1UA 4MJ3A 1O96A 2HD4A 2O0KA 3ECSA 2F9LA 3KT6A 2JCBA 1L5VA 1R6VA 2PKEA 2EKDA 4IGFA 4QOIA 2AX3A 4BFWA 1ORVA 1EXDA 2YRXA 3L6OO 3L1HA 3BSFA 5HPYB 5EXDA 1MO6A 3IVMA 2WIBA 2XDAA 4TLDA 4Z86A 4OIMA 3I8SA 3I1JA 3NVDA 4RJIA 3NTRA 4FEYA 2NU6B 2YCLA 1XLTC 4AJJA 2PAAA 3TIXB 2QT1A 2HKIA 5IVPA 2H5JA 1NY6A 2C4KA 3EK2A 5LP1A 1EE9A 2Q6OA 4ETWA 3WGVA 1L8XA 1ORIA 3CZCA 2FSFA 5CVTA 1JEQA 3P19A 3IP6A 4KYVA 4FQ8A 2ZUBA 4F85A 1AHPA 1NP6A 1NV8A 5G0WA 2HXSA 5KKCA 1Z07A 2WAOA 1VSQA 3ZEIA 2AEJA 2DH5A 2HA4A 4WASA 3E7FA 1CY6A 4ZKDA 2QM8A 3TXXA 3H2BA 1ZK0A 1E9SA 2CWWA 3LUJA 3R0XA 2EDCA 2NZ2A 1IXKA 1ULBA 3AEZA 3B52X 3E9CA 3H2JA 3WSTA 3EODA 3OJEA 4C4AA 1H9CA 3JQ6A 4LXTA 4WZBB 1A98A 1IPFA 4MAFA 1J2TA 1GGJA 3TZLA 3WGOA 2IXBA 4YJFA 1XK6A 4W7SA 4BE9A 3BREA 4HDRA 2JAWA 1YK0A 1W36B 1RJDA 4F8JA 1OGIA 3E3LA 2ADMA 3HJBA 3QOWA 3QVKA 5K4HA 5EJFA 4YLYA 1O95A 5K0NA 3VU1A 2NV0A 1CS0A 1UJ4A 5JD5A 1FMTA 2MTBA 5D01A 3V8BA 3OMWA 1QV7A 2BDEA 2C9YA 5K1ZA 1IN1A 5CYOA 5K0TA 3M4JA 3Q5GA 2P79A 2N75A 4CMKA 5HDQA 2NU7A 2FWJA 1BTOA 5ALIA 5KHAA 3FKQA 5EJ4A 1U8YA 1TCVA 3E3NA 4QFCA 3HKCB 2Q5EA 1R8JA 2CJWB 4JROA 4NOJA 5FLXA 1JSCA 3KPUA 3QBTA 1TM1E 2GPYA 3HU2A 2OP0A 2VOEA 1IRXA 4AMVA 3FXAA 3KJQA 2IX3A 1DBVO 4G6ZA 1E3JA 5I9LA 3VH4A 4D44A 3N05A 1T1RA 4OD0A 5E38A 4C01A 2I8LA 2AI2A 1PEDA 4HUQB 1I2MA 1CUUA 3OBBA 2YJZA 1N3LA 2BHRA 4EGSA 5TIIA 3UY4A 1LUAA 1KC3A 4RL4A 5BUSA 4MR8A 1W9HA 2RH8A 5IYZB 2Q49A 1CEXA 3K4QA 3D7KA 2Y0DA 4HGYA 4BS9A 1GU0A 3QIAA 4HN4B 4KRXA 4O2AB 1WXDA 1EB9A 3E9QA 3KQVA 4MRMB 4ZAFA 2DFDA 3F4BA 1UXOA 3DKVA 1PFQA 2EX0A 2FPRA 1E0KA 1W581 4D4MA 3UXHA 3Q2OA 4JJ6A 2V7QA 3T15A 1U0LA 4L4UA 2Q29A 3NI2A 5A03A 1OLUA 1F2TB 1JXQA 1NVTA 2I4LA 4U1RA 2W8BA 1A8HA 4EB6B 4RK7A 4PGGA 1GO2A 2AZDA 2GUWA 2PGLA 3H18A 1FLVA 2EIHA 3I45A 3MS7A 4OHRA 3VJRA 1KI9A 1Z56C 2UZAA 3SM3A 1OHHD 4FBMA 4DUGD 3KTFA 2EG9A 1E1CA 3EWIA 4U6NA 3E5MA 1Y9DA 4B0OA 5T57A 4L0QA 1T9HA 3LNCA 3MGBA 2HXGA 2VAPA 4MMYB 1TPYA 2C2HA 4N0MA 3TIGA 3ZC3A 5JSUA 1FRFS 3ACCA 5BYBA 1I2AA 1RYEA 2Z6UA 4EI9A 4BNDA 4NX2A 2FLWA 1N5LA 3MTQA 1ACMA 2I4OA 1U7UA 3BXXA 4YMUA 4DG9A 2IU3A 5I9BA 3R0VA 4PGMA 4PX5A 1T15A 1JDPA 2DCUA 2YW9A 3G9TA 3PPIA 5H16A 4ZZ1A 1YS1X 3EVGA 4G9GA 3QSGA 3TVTA 4B7AA 2OB1A 3R7LA 4OJQA 4BATA 1K6JA 1YTUA 3L04A 5FD8A 1MRSA 1SXIA 4NDZA 4TLBA 3W6PA 1RP7A 4I6JA 4JENA 1DRUA 3ZGNA 3G9ZA 3LQYA 1XCMA 4P6VF 2ZIZA 1B42A 4NNOA 1R4NB 2Z8YM 2Q6VA 3NBZC 2I4RA 2GCOB 1E5DA 2JARA 1MN6A 3G85A 4Y6SA 1DFIA 1SUIA 4I3FA 1E1QA 4YFVA 1V2GA 3JWJA 5HF8A 1XX6A 5A1TA 4C4OA 3SHWA 1WXIA 3MGKA 3VR5H 2CMDA 3B7WA 4L8YA 3IEKA 1G21E 2Y66A 2WU3A 4D57A 3F5QA 3GG2A 2GEUA 3L92A 4I50A 1D5WA 1PL0A 2QXTA 3L1IA 3W9BA 4FM9A 3LPLA 5JS8A 2RHJA 3IBSA 1A2BA 1IZ7A 2P6MA 2X41A 4UHJA 3AR9A 4HJRA 4IV8A 5TY0A 1GQOA 3H1FA 1XRSB 3IB6A 1VB5A 4NPHA 5EJ9A 3K6SB 5B2FA 1JQJC 3ESBA 3GJ3A 2PUEA 1J33A 3MJ4A 1U8EA 4KV7A 2MHCA 4KQWA 3WJ2A 4YIHA 3GLGE 3OURA 3MA0A 4HXFB 2A35A 1BE6A 4ZO9A 3URMA 4U3JA 3MMPA 1N1DA 2X8JA 3EAFA 5DW0A 3I58A 1JH8A 4G1VA 1D1TA 3OT5A 3WTBA 1E6MA 4H0CA 1NYRA 1R0CA 3C3XA 4P83A 4OJKA 5HRCA 3QKWA 5J4KA 1TZMA 3FAKA 2QQEA 2BMDA 3BWBA 2F3RA 5AM1A 3AF3A 10MHA 2OCXA 1JAZA 3IAS1 2JANA 2IP2A 2W6CX 3HYLA 4UUBA 3VDMA 2VH5R 3QYJA 1WO8A 3V8RA 1WXQA 2Z2XA 3BJIC 3C1TA 5KNDA 2FG5A 1TTPB 4BIIA 4EKIA 4EZIA 3OM8A 1H66A 4DILA 3P9YA 2VNIA 2HMAA 1P31A 3RBZA 1KMHB 3NAQA 3EA5A 4GECA 4R1PA 2QUHA 1Y4ZA 3F5DA 3NHPA 1KHHA 1Z0SA 3LQFA 4HFMA 4XUCA 4AO8A 2QV7A 3CLTC 1U0FA 1C9EA 3L84A 3H3JA 3WL8A 2MYUA 4OMDA 2H2AA 5EWMB 2ASVA 3HM2A 3N2GB 5TR9A 3LDHA 1VL8A 2HQOA 5HKLA 4BCDA 2Y67A 2CHGA 3GD7A 3LY5A 2MSNA 2FDCA 4WA8A 2G5GX 2I6UA 1L5OA 2OO5C 5KOHA 3IIJA 3WL7A 4OF4A 4TMZA 3OO0A 4O1HA 2RJ3A 2H1SA 5EXSA 2PPLA 3RFCA 1V6AA 1EWTA 1L7NA 1LTKA 2BW0A 2ZT8A 3S70A 2OGTA 4MRPA 1I5RA 1E5VA 1G4HA 2E1RA 3KP1A 3VSCA 4JOSA 1DAHA 2DFNA 1V1RB 3C7KA 3GPCA 1X2BA 2VPPA 4TTQA 3DAPA 3UFXB 4X7RA 2WAXA 3KZCA 1K27A 4WUTA 2NOAA 2VDWA 2O2ZA 5IJWA 4MWTA 4RGQA 2D54A 3R1IA 3LXRA 3LQ4A 2PWAA 3EBOA 2GNPA 4Q1CA 2CXXA 2JBWA 1UPFA 3T41A 3ZHSA 1B93A 1CB0A 1GL9B 3DKPA 3RS2A 3LL7A 1XVLA 1LLQA 1ZGZA 2F3UA 2X42A 3OPNA 1A9ZA 4FMCF 1C4WA 5D00A 5EOVA 1AHIA 3C3CA 4RD1A 2ZT7A 1UM9A 3KBBA 4N47A 3G59A 3HRHA 4EW3A 1Z06A 4B80A 1YJ5A 3IDZA 3I12A 1UMDB 1USIA 2GPBA 3VO9A 1KI2A 2IUEA 2XEDA 2WQZA 1BXZA 1C7ZA 2XVAA 4ZU3A 3RG2A 1U7HA 5EXXA 5EJMA 421PA 3HVRA 5CGQB 1AMOA 3E7PA 5BWMA 4PSVA 4FR2A 1XQYA 1JG6A 4QWMA 5HZMA 1P0PA 3UJNA 2IHNA 1ESDA 3K15A 1Z0AA 3FTPA 3EMKA 3V32A 2LXNA 3K53A 4P86A 4PC3A 2FN8A 1YRBA 2IHVA 3AF2A 2V5UA 2WZDA 3EUFA 3GFBA 3WYDA 4AP5A 1N2CA 1OWOA 4MV3A 3MILA 1Q74A 4DLPA 4Z5XA 4XCXA 2V0GA 3FPGA 1NPDA 4OHWA 5EP2A 4NJEA 1GVHA 4M22A 1CQJA 4XD2A 2O50A 1WW2A 1DG3A 3KUDA 3V6MA 4M88A 1OCEA 1NVMB 2J9ZB 4HATA 3HHPA 3VC2A 4HDNA 4J6EA 3VHXA 2OHFA 3F6RA 5KYWB 3ENNA 4Q7KA 2EARA 1EG2A 1G8YA 1NGSA 1MG0A 2RGDA 4JNCA 2AB0A 3BX1A 4MP8A 4DBLE 4HX9A 2IUTA 5EXEA 2XB2A 2M32A 1OIXA 4UMDA 5KYNA 4WOPA 3VRHA 2IHZA 1KDRA 4YDSA 4DIFA 1JG4A 4P4SA 4Q4DA 2WT4A 1W85B 1XZJA 5CBPA 3LYLA 2C83A 3ONDA 5CM2Z 5ICGA 4C7MA 1UM9B 2QIOA 1DC3A 4ML3A 2I7DA 1T8WA 1UH5A 2PY6A 3ZWKA 1JDVA 5AUNB 2FQWA 1RAIA 2GXQA 5D5QA 4B7XA 4OKNA 3ZDCA 3B1WA 2W2KB 1J22A 2VF5X 2YVKA 1CIJA 1VLQA 3H5RA 3JQ9A 3PFWO 4RJKA 3R7DA 3UCEA 3WE7A 5BN3A 4TTPA 1F2UA 4AZ3B 3RC9A 5L95A 3N2KB 5EJ2A 1OFVA 1I1QB 3LX5A 3JZMA 4RH0A 4FDVA 4BX9A 1L2TA 2Q3BA 3LWNA 1L8OA 1W5EA 2G9UA 4JDUA 4CM8B 3E23A 5H4HA 2YJ6A 3CVWA 3C4VA 1HPLA 2ZSBA 2GM9A 2ONJA 5BT8A 2R68A 3FBTA 4NMHA 3Q3IA 2GB4A 3RT7A 4YEDA 3MJTA 4AZWA 3K9HA 3RHTA 5CH5A 4TKZA 3VOAA 1G8KA 1QGOA 4LIPD 1FYFA 3QEMA 1R5JA 4UEWA 4CMAA 1Q19A 4ZZ0A 1DPGA 3L4BA 1GL3A 3SBXA 5J63A 3U7FB 4MRSA 1QIMA 3UUGA 1M6VB 5HKBA 5EZSA 2J4FA 1KEKA 1LQ2A 1RYYA 1YJBA 2X2OA 3U5TA 5LQCA 3DA8A 2CBXA 1ZX1A 3BTOA 1T6BY 4R1MA 4RETA 4OPMA 2J30A 2ZETA 4QHTA 4QSMA 2Y05A 2WJYA 4UFPA 4I66A 1Z12A 2QLMA 2IOHA 4X6YA 3ZD8A 5H82A 3BT7A 2PEZA 2FE1A 2BKXA 5FFFA 3U3MA 5B4UA 4AO7A 4KBYA 1OU0A 4HO1X 3RTBA 1XQ1A 1ZZEA 3M4ZA 1PG2A 1HDYA 2E49A 3F6PA 3MCUA 1ZOLA 4XWGA 1KWGA 4LX0A 4CGYA 2WZCA 1H2FA 4EKGA 1T2FA 3FPFA 1SUEA 3FROA 1JQ3A 5ILGA 1RRGA 2C2OA 1DXHA 4L1KA 4YAFA 4XWOA 3OE5A 3UWPA 1LTHR 4LMBA 1X1TA 3T0FA 5EJ7A 4I9FA 2PUAA 3COZA 2PS3A 3Q3VA 3FG9A 1I4OA 4Q4HB 3G89A 4URZR 2VK2A 3QHAA 1RXCA 4NU6A 1XYGA 4B9AA 3AY0A 5C1DA 4N7RA 3TLYA 1VYVA 2V97A 1XDSA 1EGVB 2HJRA 2GZRA 2PYZA 2RAFA 2CLLB 4WMLA 4Q18A 5ERXA 1VCOA 5EWJB 3UG6A 3O8CA 3PEYA 3OF2A 1SC3A 1A9RA 1T5HX 3FR8A 5BR4A 2QD4A 1HG0A 4R6WA 4Z3DA 1UDAA 4PSDA 4BEJA 2QNRA 2AA3A 2ZP1A 2Y1LA 4M7PA 4AJPA 1NNLA 3DPSA 4PFJA 2RHOA 3EVFA 3EZ6A 5IM4F 5JSHA 3PHJA 5K8VA 2PA3A 4UHDA 1KPHA 5AJHA 2H1RA 3PSHA 4TVKA 5CURA 1KSGA 2N3ZA 3L7KA 3MGCA 4MVYA 4CF6A 4K81B 2WNSA 5JH7F 1C9KA 5EWLA 2A1IA 3GCWA 1DEKA 3FD8A 5A9SA 3QVSA 2VPTA 3GGCA 1WXWA 1KJYA 3GVPA 3HHEA 4B75A 2BDTA 1RIIA 3A2LA 4HRYA 4GMKA 4QATA 3IAM1 1Z35A 1EZZA 4CT0A 3VYTB 3WFIA 2IYRA 5GVRA 3SYMA 1PV2A 2HSZA 4LWQA 3EVNA 2QT9A 5CXSA 3AL0C 4HAWA 1FFCA 1N2ZA 4ZPJA 3R20A 3ZHXA 4RTMA 2NPFA 3LRXA 4B3DA 4YAKA 2BHSA 2FI1A 1SZCA 3DUWA 4EWLA 1Z4IA 5CDHA 3HNRA 2JFYA 4D9GA 2HK8A 1H1LB 5EAIA 1GLNA 5J1SB 5KBYA 3K9GA 3ZDZB 2HFKA 4HL6A 1QHGA 4L8WB 4MWOA 1C1DB 1CUHA 5JAUA 4AF6A 4F6RA 1VL6A 4C4PA 3T1HB 1DE0A 2VSQA 2QIPA 1K8RA 1KVRA 1GCIA 2OGZA 3LYUA 5E6SA 3U3XA 4DHEA 2NO0A 4RY2A 5BURA 2JAOA 3SDSA 4OK3A 1W2HA 1X1CA 2DOKA 5LQKA 5K6AA 1QGAA 2AQKA 3KYCB 1CHNA 5THQA 2QTAA 1V95A 3RRMA 2HYDA 3D8HA 3HB0A 4WXPA 3KAKA 2XB9A 1LK0A 1VKJA 4DCUA 2A1TR 2Q4EA 2NVOA 3ZYZA 2ZG6A 4LFCB 1CEEA 3DOCA 3ISTA 4N5DA 2E1PA 1H8HA 1P0MA 4BUCA 2G9ZA 2PGJA 1FJ2A 4PAGA 1IH8A 4H7PA 4JS0A 5CA1B 3O8LA 5JYBA 5SZJA 4BX3A 1NR1A 2X23A 2A67A 3OMXA 1QE3A 3W5IA 2DSTA 5A06A 5JNUA 1PVDA 5L9AA 2ZROA 1GY8A 4BXOA 2NXWA 4H18A 5KVAA 5TQJA 3O31A 2V7TA 1I7PA 4Z4QA 4Z2AA 1JJFA 1M10A 4EAQA 1LDMA 3EGXB 3IOMA 4MKHA 5CEFA 1CDEA 1X6VA 3ZBTA 3LY8A 3O8RA 4M98A 2PGXA 4A6EA 2GGSA 2IJGX 1CRZA 2X0NA 3SIPA 3P9XA 4JGGA 1TM5E 4EJMA 1PLJA 4FB4A 1T0IA 4PHHA 2WC1A 4ZVTA 1EINA 4L5YA 2PD3A 4F9GA 3AVYA 3QNUA 4H7HA 1ZG3A 3I9V1 5BW8A 2V65A 1L4LA 1KK2A 3DAGA 1C1DA 1XHFA 3HFGA 4KR6A 3FCOA 5EWMA 4EKNB 3BK1A 3VR4D 5LVAA 4MVJG 5IDQA 3N58A 1LC0A 1GAQA 1VYUA 5IM4A 4HLCA 5AICA 3HXPA 3ZKAA 3V4PB 1X42A 3OQNA 1EQ2A 4V0QA 5ICMA 3R7AA 3RBAA 1QG6A 5AKEA 1Q6YA 2ZYGA 2PX6A 1WAMA 3Q3JB 3AIKA 4YQFA 1C8VB 2EU8A 3OPYA 3T0GA 3BK7A 9LDBA 4UVEA 1MAVA 3HO6A 4RPHA 3LTNC 2D2IA 1BOOA 4QVGA 5HFAA 4FDUA 3Q8LA 1ORRA 4KN5A 1M9NA 3RYFA 1A4XA 1BE8A 1G21B 1NA5A 1M2VB 2E4XA 3AB8A 4GQBA 5EL0A 5FNVA 3GRUA 3NU1A 3QTBA 4K1LA 5AYVA 1QPGA 1MCZA 3SXUB 1G8HA 4BP8A 4ARCA 5AI9A 4CL3A 3NKVA 4Z0TA 2PZEA 2J3QA 4ITRC 5P8WA 1I6MA 4O0MA 2A0WA 2D5CA 3VFDA 5C32A 1MEOA 1N6NA 3B78A 5MN5A 3UKJA 1TEHA 4MPRA 2XOXA 1F06A 4MPTA 3DS8A 2VHCA 5DO9A 2WYWA 1PJ2A 1XDGA 3MTGA 3E2PA 2W6ID 1MW9X 5F76A 3K35A 5JZOA 4JWTA 4RE5A 2NUPB 3R3SA 3RK4A 1Z6AA 4WNAA 5KNCA 4ABTA 3K9FC 1Z16A 1AKMA 1WX1A 3D7LA 1HE2A 1C3OA 3STYA 4BJ1A 2O23A 1FVXA 2PLRA 4B48A 3HR8A 4ROTA 1V7CA 1IFXA 2Q2NA 2ZYDA 1XF9A 4P31A 1V8ZA 1KYTA 2P9YA 3LFUA 5B37A 4E11A 1S2IA 3UM9A 3KQUA 4YY3B 5I9IA 4PYIA 2B4TO 3V8PA 1S8FA 1ZUWA 2Y9PB 2QRLA 3BICA 3R3JA 1F60A 4DMLA 1F12A 4IHQA 3P20A 3RYTC 5ADWA 1C3XA 1GKLA 1QANA 1BVHA 1I2CA 2GBIA 4RAOA 1WHSA 1J20A 2C7BA 4RADA 1JFFA 1RWQA 1XCGB 3CLUC 4ZVLA 1M1YE 3DF7A 1KJZA 3IP1A 3T0IA 2XXAA 1TC2A 2RGWA 4D3DA 2V7VA 4YJKA 5GGYA 5HQ3B 2QSJA 3JZDA 3M6UA 1XIVA 4IEEA 5HW0A 1PR3A 1TT7A 3M6WA 3AB3A 4OQ4A 4OBBA 2A5YB 5CA0F 4WECA 1GPJA 1WKVA 1YBFA 2BY4A 2R4UA 1E63A 2H4YA 2G1JA 4P5DA 4CMGA 1OYVA 3GHYA 1ZK1A 3TRHA 5IJZA 3K31A 1C8LA 4KVGA 5LD2C 3S1LA 4KIGA 5IASA 1PKXA 1SUWA 3CTPA 3JD4A 3EC2A 2GBLC 1BMTA 3W6ZA 2W9XA 3RU7A 4P3OA 1ORWA 1T5DX 4LWPA 1JEYA 2AFHB 3PQ4A 1GNQA 1X1EA 2F1KA 2P1RA 4WX2B 1KO7A 3VZQA 4PN7A 5AVSA 3ETEA 5FX2A 4QJ3A 3OFKA 3IE0A 1JHDA 3EGOA 4U00A 3DGEC 3JXEA 1Y8CA 2DVMA 4N8DA 4ZXPA 3AEUA 1SQGA 1BCRB 2FEWB 1QYDA 4DF3A 3A04A 2Z1NA 4AJ9A 2OV8A 2VRBA 4GVXA 1II8B 1L5GB 2OORC 2ZKIA 2E0IA 3Q72A 4JWKA 3RRJA 5AW3A 3U7IA 5AW4A 3KXIA 2NO5A 1TF2A 1VMDA 2G6TA 2QI9C 2ONKA 3NIWA 4EPYA 5C5DA 3KPWA 2GX6A 4XB6B 3Q10A 3K4PA 3WDSA 1JALA 1NSYA 3AFHA 1WXHA 3LS2A 4AMBA 4C0HA 2XQKA 3OQIA 5TVGA 1XA4A 3HWX1 4LYEA 2X19A 1KIFA 3V46A 2ZCUA 4YCDA 2VN8A 1A7UA 1RAFA 4NONA 3RVBA 5HSGA 4IWXA 3CJRA 4WLEA 1KGDA 3QA9A 2P3QA 3QI2A 4IJUA 1HYHA 2OXFA 3DDZX 2ANBA 3QX9A 5J5VA 4KIUA 5FWYA 3Q3CA 4ZQBA 2FDRA 2G1AA 1DAPA 1Z7WA 2PH3A 5HP4A 1WF6A 3PDJA 4TXJA 4RKWA 5DN9A 2C3OA 3G68A 3ICOA 1YQTA 2PV7A 4ID9A 2C29D 2UUPA 2VRCD 3VR1A 4RENA 5GGXA 2JBAA 4LWOA 1MJGM 2WDPA 3D43A 3KWFA 4Y2TA 1HC7A 2O3TA 1GTSA 1F5NA 2CZCA 1JTEA 1EWQA 3GAAA 4Y2UA 3STTA 2VATA 3JAKB 5FR1A 3DR3A 2IS2A 5F2KA 3C3YA 5DBFA 1I1HA 7REQA 3DZFA 4Y6QA 4NVRA 3VNUA 2BMFA 4MR7B 1JHPA 2UVDA 4MVJA 2JIZA 3DL2A 2YWXA 3EDMA 4O33A 2ZU0C 1WM1A 1FY2A 4L0MA 3TUIC 3EOAI 4RQTA 2OBLA 4UCQA 1ONNA 3JARA 3MSXA 4KFTA 1Z15A 3MUFA 4BLRA 1S3GA 3H86A 2X9LA 3IE1A 5GMOA 4LX8A 3HJFA 5ERGB 2GJ4A 1EWRA 3K5PA 4UU0A 4RMHA 2B69A 2GJSA 3OQIB 2REOA 1FTNA 4RJJA 4DLBA 4Q1EA 2XOKD 3V42A 2AX4A 3IQGX 1KVUA 2JFPA 3KVYA 2CVZA 2MT9A 1EIZA 4ZYUA 1QNLA 2AI1A 2YKGA 4UUAA 3U4IA 3VR6H 2FOIA 2VQFB 5KTPA 3KYIB 5BMVF 1E2GA 5EIAA 3WNDA 2JK1A 4WCFC 4Q4LA 5AVZA 5IC4A 5FI3A 3SFVA 2JLXA 5FCDA 3RYCB 4RCZA 1Q0RA 3SY8A 2HPZA 4KR3A 1J8VA 3B70A 3D0QA 4IFTA 2QRZA 1MG5A 1W94A 4J0HA 4NESA 3RS9A 3X1MA 1E1QD 3QRWA 5DM4A 1KNQA 1TO2E 4L4SA 3IPYA 4BJHB 4D9JA 1QAMA 2V6BA 1Z5WA 1PWEA 1QSGA 3MF4A 4RKEA 2G1PA 3DV2A 3OJ0A 3SC3A 1ZU5A 2V54A 4AXXA 3H2IA 5LIRA 2IVFA 1HRKA 5AKHA 4TLLB 721PA 2O8BA 2ERYA 2WD9A 4UD6A 2AG6A 3VR3A 2NU7B 1LLUA 1RMTA 4JOBA 4DIDA 2W4QA 4DWJA 4GG1A 1MOQA 1YACA 3B8HA 3GFTA 4UATA 3ZJVA 1T10A 1Z4OA 2EFDB 1B7GO 1K3FA 2ESRA 2H29A 2M6RA 1E6UA 2WHEA 4OL9A 2FPGA 1QUEA 3TXAA 1SUAA 2PWZA 2E18A 3WYBA 4UU8A 1O08A 2ZE6A 2HV9A 4CV1A 1US8B 5K6RA 3AR3A 3GGPA 4HNRA 3LDUA 4R3UC 5AVOA 4M0FA 4E5DA 3AVWA 1FFEA 2IDMA 4XQ9A 2D59A 1K08A 4GL4A 2OCPA 1CQZA 1T3LA 2WLTA 3P5SA 4X45A 3I62A 1PIWA 4HQKA 3CEAA 5U4XA 1SU8A 4F8YA 2IYXA 3M9XA 1U0SY 2WWHA 1LBTA 2G72A 1M8KA 4WVFA 4NTZA 1NVFA 1TIKA 3EGVA 4K88A 1G20B 2C42A 3LT2A 3WNVA 4NLLA 3TBFA 4GF5A 5FB3A 3REFA 2GCNA 4A73A 4BRUA 4NE7A 4O59O 1ZCFA 4XR9A 3I4FA 4DA9A 1U99A 1L4HA 3QKIA 1YKSA 3WLNA 1NVGA 1PQ4A 4D43A 5EMNA 3UMFA 4G4GA 1OLUB 3QHPA 5ITVA 2FR8A 4MOWA 2J9GA 1PO7A 3DE4X 4EUKA 4XAQA 4PYKA 5SYMA 3H3FA 4CZ2A 1NXTA 3BFXA 4Q9KA 4ZHSA 1H5UA 3H9QA 5DULA 4GKBA 3UGKA 4DUYB 1TJPB 1U7PA 2IH2A 3CRVA 1KZGB 3S2IA 2X1VA 2VDPB 1JQAA 4K2AA 2VH1A 1Q22A 1QP7A 1SULA 1O9GA 2G9VA 4MWCA 1F8XA 2BFOA 1PN3A 1RHJA 1S9HA 2PL1A 4A8JA 3T9BA 1F38A 1JHOA 2P41A 3NHZA 3FFWA 3S29A 2W0SA 1COWA 1C50A 4QXQA 5DTIA 3H8SA 4KIFA 4A2WA 4TN1A 4LYJA 1SVOA 1ZD9A 2QR5A 2QTBA 3CLRD 2C5EA 4E94A 4EG6A 1GNLA 2NXJA 5EXPA 3TQHA 3WJ1A 1ZFNA 3NBAA 1ISHA 1VPEA 2QRVA 5AVRA 3KQQA 2R2GA 3PITA 3KL4A 4UPEA 4CEHA 1IC6A 1GAJA 4MVJH 2C77A 1DAOA 3DZDA 2PRKA 4U7WA 3U1BA 2JZNA 1PZFA 4YT5A 1EFRA 5CHYA 3GEBA 2JCVA 4TV9B 3JAWA 2ZRJA 1BX0A 1MB2A 3H17A 1XEXA 3IV6A 3PLAE 1DJOA 1YB1A 3ITEA 2VYQA 2WPNA 1MX5A 5L4SA 5CB4A 2AMLA 3LHKA 4AJLA 5CR9A 5ALLA 1Y4UA 3KZXA 4JT9A 5EUCA 5FBZA 5GV7A 2MSLA 3R6LA 3B5JA 4KSBA 4KZKA 4EB8A 4I4TB 4X7BA 2AVDA 3OE1A 5EPUA 1DU4A 1YR7A 2GFIA 5ALXA 2E6UX 3L5KA 3QVOA 4DIEA 2BGKA 1USKA 2AWOA 5JPCA 3DEAA 5G41A 2VPXA 3SE7A 3IUQA 1JEDA 1OYWA 3DB2A 3LK7A 3HRKA 1UDWA 1CY2A 2GFQA 3EHEA 2XHZA 1Y4AE 4HZIA 4NULA 4CF3A 1ZUIA 1WZ2A 2HEGA 2E82A 3GAMA 5D87A 5B4VA 3GNSA 4OGKA 5K03A 2FSSA 3LJKA 4Z6KA 2VCHA 4M1WA 3G23A 2LWIA 4AS3A 1H94A 4YR9A 2P2CA 1X7ZA 1JRLA 2AD1A 1GFIA 3BQMB 1TUIA 4TZ6A 2E4ZA 1NJGA 5EKXA 4PPGA 3UB2A 3DLIA 2VWHA 1G4AE 4JEHA 4ZDKA 2OHHA 1UEXC 3CX7A 4U0JA 1FX0A 1NQVA 1R0LA 3JQFA 4YAWA 1YA6A 1QV9A 1MORA 5K8JB 4B87A 1U2GA 4IKEA 3WIDA 3IAXA 1EXMA 4FCCA 3DLTA 3TRKA 4C3ZA 5EKUA 3OT1A 4MS4B 4F1JA 4YYZA 2XUAA 5DNWA 2FB9A 2V1UA 1Y81A 2UZ4A 3GX1A 4TTJA 1CRPA 2GO1A 3ANYB 1B0ZA 2Q21A 1KOLA 4BLSA 4M9XA 2IXAA 1WXXA 2RGUA 3GVXA 5EIBC 4HDMB 1KNXA 3CBGA 4EMSA 5B3JC 4FOPA 3NH6A 3FVVA 3I9FA 4EO7A 3O8DA 4NZMA 1D5CA 5T3YA 4EEXA 4DA7A 1XOIA 2ZRIA 3LYHA 4OK6A 3ZQ4A 4EBBA 2GLTA 1IOWA 2CYAA 2P6NA 2PZ8A 4WOBA 2W98A 5T64A 3PQ2A 1SHKA 4WKNA 3MWGA 3PXXA 4MVJD 4ER7A 3PWKA 4LF6B 1A9TA 2HA3A 2VFAA 5DASA 4RDCA 2NAPA 3RAJA 3KQHA 2VHVA 1A3CA 3AYXB 2FXVA 3KTAB 1RLMA 5FOWA 2GN4A 3MOGA 2O48X 4MI6A 4Y9RA 5CIYA 4YK7A 4QUIA 5JFOA 2OR3A 1RLOA 4QL3A 4RW0A 2R7KA 5FUXA 3F4KA 5JY1A 1VPDA 1O6ZA 3HFJA 3HBFA 4Q4CA 4Z0HO 4L07A 4D8UA 3ETLA 1EDBA 1XI2A 3GRKA 4OV6B 4RV5A 3L7BA 3IV7A 4G3XA 4K9NA 3QUSA 3GUVA 1TADA 3PJDA 4RVOA 1X8LA 1GYRA 1DIBA 4JBIA 4EYKA 1YIAA 1Z9BA 1MKYA 4O5AA 4TTIA 2GAOA 4C6TB 1BGVA 4LS3A 2F8LA 4MQLA 4J49A 3C45A 1JFTA 2D8AA 4ARBA 2GVZC 2R86A 5TEVA 1AOXA 3MT0A 5ITZA 5BV1A 1VCHA 1THGA 3RNOA 2XYGA 2FN4A 2ADOA 3UF0A 4OMCA 4RMNA 4MW1A 4XPIA 1NMEA 2YWHA 2B2NA 2H2GA 3H65A 4O4IA 1YB4A 1ZGJA 3PUXA 4HNHA 4RJLA 1M0TA 3U17A 1YS4A 1NMXA 1T6YA 2JH9A 1Z38A 4KXVA 2ZB3A 3C87A 1ZDMA 2CB9A 5CNMA 4QGSA 2QRJA 3D54D 4KJXA 3OWOA 3OPMA 4YVFA 4EHLA 1GV0A 1XAHA 3UHOA 1CQJB 4RY8A 4QJ5A 2Q3HA 1LVUA 4BASA 4PFSA 3U4DA 4EX6A 1L7DA 1UMBB 2LBPA 2NVBA 1P39A 4S2UA 4HSEA 2BEWB 4W63A 3BXOA 1VJDA 1NIJA 1DMSA 1AUQA 3AUKA 1VLHA 4KPUB 4F2WA 5DM60 1EX7A 1VE7A 2I80A 4RXMA 1S7CA 3OZBA 1L9KA 4NV3A 1P7ZA 5AI8A 1I6WA 5K7SA 3GT3A 4N5HX 4IDAA 4M8LA 4C22A 5KNBH 5IVHA 2HMWA 2VDUE 3U5ZB 1NYTA 2QM3A 3AI7A 4BGUA 4BU1A 3NYWA 4MS1B 4WTOA 3CKMA 2BEVB 4R54A 3RK0A 3ZWCA 1Z3IX 2V5AA 1QVWA 2GTPA 3E05A 5JAOA 1GN9A 2PUGA 1Q57A 1J0BA 2J5QA 3IDFA 4P4NA 4EPVA 4L9RA 1E4OA 4NV1A 4HNAB 2BF7A 1KYVA 1J7JA 4YQZA 1H0HA 2P5UA 4EG1A 3U44A 1K7XB 2GHTA 2DBQA 2O14A 4E7PA 1AGYA 3B1KA 4BRSA 1PZGA 1RM4A 2ZS9A 2RHBA 4MRMA 4A1OA 2YVUA 4TSFD 1H6DA 1TF5A 4PONA 3BOSA 3UAYA 1XAJA 5IJAA 1NXQA 4DMHA 3KFVA 4URVR 3DPUA 2WUGA 3RHFA 2ZT5A 4C0SA 2ZWVA 5K2OA 2X7XA 2RG1A 4Q1FA 4NCXA 4A8HA 4EPTA 1DTWA 3N5CA 4IV0A 1XNJA 3VHRA 4MW7A 1E3TA 1U3GA 2ZEJA 3AV3A 1O4WA 3DFZA 3GEMA 4EKDA 1PI3A 1QXSA 1D9ZA 3KS9A 1IU9A 2FU5C 4ND2A 3RF6A 3UC9A 4AL4A 4BV2A 1GQ2A 4TMXA 2HU5A 2EJWA 3WGNA 1SOUA 1RWBA 2R11A 1Q6ZA 5AM4A 2EGHA 3PTZA 2WKPA 3VGPA 1GJRA 1XMOB 2ZI7A 2UAGA 4XEUA 1OIVA 5EE1A 4G2NA 3N2ZB 4FYHA 4BZXA 3K70C 3AVXA 2EX4A 3ROEA 3JVUA 1QF7A 2NO7A 4HRVA 3T9FA 4FUTA 3QPUA 5EIHA 1Y82A 3B1ZA 3ND9A 4JI2B 3EEBA 2ZRKA 2PKQP 4PZUA 1HZZA 3A6HA 4R8RA 3I0MA 3RD5A 1EG7A 4DCMA 1E9VA 1PNOA 3ET4A 2L82A 2YXPX 4Q3KA 4N7MA 5KNBA 1GTMA 4QOSA 3AVTA 1YFKA 4AECA 2C0PA 2J5KA 3R9KA 3OQHA 4BFSA 1JU4A 2NQ2C 3K0FA 4OFBA 1GTL1 4C0LA 5IYZF 2XYRA 4BCCA 3GPBA 2P0AA 3TFQA 3GRPA 3NC4A 3PT9A 3ESCA 3BA6A 4PZ9A 4ZZ2A 4AC9A 3DHYA 1FSPA 3PUVA 1U1EA 2Z8XA 3FLMA 3GBVA 1P5ZB 4HGOA 3IS3A 5ALMA 1EI9A 4EEZA 2A7QA 3R3ZA 2RKOA 3GFGA 3LT4A 3IERA 3ICQB 4NABA 1AF7A 5HA5A 2K7FA 5JOQA 4OHBA 3L7MA 3HWRA 2AGVA 1Q7TA 3C7DB 4O4JA 5K3EA 2F48A 3ZNPA 1JSLA 5FOSA 4OL0A 1PGNA 1FTWA 5A3QA 2ZSJA 2WKRA 4K9RA 1HMPA 1DTEA 2DPYA 3SBEA 3DCNA 4DLLA 4JP3A 1L7MA 2BKEA 2ZI9A 4DDUA 4NL4H 3ZIDA 1G5HA 1EB8A 1OLSB 1RI3A 1T4DA 1GA1A 1DG1G 4IIFA 4MUBA 4PG8A 2X5NA 3DXYA 1YMQA 4Q5IA 3ZGOA 1EZ1A 3DMNA 3DTVA 3FCYA 5FL7D 3RV3A 4DTIA 2OZEA 5E1BA 2HIHA 4BPBA 4L0CA 4ZV9A 1JFSA 5BWNA 5DGIA 1WB4A 2HF9A 4YJHB 4IHKA 4U2DA 4ARZA 2O2DA 3R8FA 3TJZA 3SICE 2I2FA 2ZIFA 3V1KA 3PGMA 1GM5A 1QQTA 4CCSA 4MVJM 3G5AA 4FZ5A 1URPA 1LPOA 3HA2A 4J4TA 1ODCA 1LW6E 2TMGA 1PS0A 3FPLA 1R4ZA 5A4DA 5K0JA 2EFJA 3QVVA 3G9QA 3FBGA 1W59A 1ICEA 2DHRA 3GYBA 3DT6A 5BQ5A 4CLDA 1J9EA 2JAHA 3W5JA 3MM4A 3RS8A 1H8EA 5LOVB 4LPKA 1JQBA 3IQZA 1CZNA 3V7FA 2G82A 3ESYA 1M74A 1CF4A 3E0XA 4PQFA 2GNAA 3OQOA 1G0NA 5T4FA 4F2HA 4NZ9A 2G63A 4DQLA 3WQHA 4HB4A 3UJPA 3RF7A 1PUJA 2VHUA 5CCXA 4V24A 1CUJA 3RR2A 3I6IA 3LSYA 2EYUA 1V39A 4FWIB 5LYYA 3ZE8A 3EZYA 3MINA 1XEFA 4ZAGA 2Q2WA 5E6RA 1QKIA 3ZE7A 4HDKB 5KWIA 3LZCA 1NF3A 2GN2A 2OC9A 3G2QA 1ODLA 4L76A 3HUEA 4PYMA 1YL6A 3LUAA 4F8EA 4BO3A 4ZALA 5TV2A 3T9AA 2RGRA 4M1SA 3A1NA 1T5SA 1PYGA 4KAXA 3JQQA 2MINB 1P2DA 3PXBA 1NDUA 1M1NB 3BJMA 4I1RA 4RDIA 4X0EA 5AMXA 3T3IA 4E5SA 5IYZA 1FQOA 1A69A 3AHHA 1XCLA 1YRYE 4G5QA 3GEPA 5ECWA 3UJBA 4BQOA 3ZZMA 5H8WA 2Q3FA 3TKYA 3S5UA 3QQ5A 3FFXA 1MO2A 4KU4A 1Q15A 4D45A 1KO8A 3Q7IA 4D9KA 4PC6A 5KNDH 2FETA 2DUUA 2VNKA 4XSVA 1W34A 4P80A 4G26A 3UJDA 3CG4A 4RD3A 4RVSA 4RVGA 2R0QC 3K05A 3BEDA 3THWB 3RS0A 3IT0A 4DSOA 1QLHA 4H2DA 1CVLA 1TFUA 1T5TA 2PSSA 3CUVA 3ZWWA 3KX2A 3KVOA 3ZUPA 4MA0A 4B4DA 1AMNA 2XTJA 1SIOA 2X0EA 1FA9A 2C9ZA 3IJ5A 2VRWA 3PL5A 5JPIA 3KOXA 4QGAA 3W4JA 3ED5A 3CNOA 1L7PA 1WVGA 2JFUA 3CA8A 4LXHA 1ZINA 4CUKA 3GQBA 1CZKA 2C03A 3PENA 4FFOA 3E8XA 1H0SA 4Y98A 4F12A 3VU9B 2XVXA 3VX3A 4TTSA 4OYHA 5DHFA 4YN3A 2B7LA 1BGWA 3JQEA 5KO2A 2JFXA 3JY6A 3WV5A 2WHPA 4Y7CA 4Z7QB 1U8XX 4MB6A 2XT0A 1I32A 4TQAA 4DDHA 1WV0A 3GJTA 3SBDA 5K05A 1UC9A 2OBMA 4ENQA 1DJNA 1W4BA 4IICA 2J9RA 2XYPA 1LS6A 2UYQA 5BSKA 3H2SA 2QTVA 1KGSA 3CH5A 1YRHA 1PNTA 3FA2A 3R5SA 1EHIA 3VR4H 4CTKA 4Y2XA 1F8YA 1KYQA 1N57A 4B7CA 3ABIA 4WZ6A 4ZEWA 4BEVA 4EGJA 1L7EA 3PP8A 1CY0A 5C5EA 1D2HA 1M2WA 1WCYA 3L4BC 3IMKA 3MN1A 3WDKA 3HY4A 3N07A 4Q34A 4JP2A 1SRRA 1C3VA 1X8XA 3GJXC 4QYWA 1XJQA 2C4VA 4GWKA 1GADO 3EJWA 1T1SA 4RGBA 5F21A 4FILA 3W2GA 3HVUA 4TLMB 3H4VA 4J3NA 2ORED 2QN9A 3H16A 3KOZA 2VJNA 5EE9A 2VJYA 1GAWA 4NXMB 1WCV1 2Q4RA 1E4YA 3OEEA 5A6VA 3KSBC 1GZDA 1K7YA 3IBCA 4MQ6A 1XTPA 3ZE1B 4DXDA 1X80B 1G3UA 3H4IA 5M7EA 3GUUA 2CDBA 3ZLUA 1O5TA 4QG7A 1OPXA 5A2QA 1FFDA 1ODKA 3RSGA 4EG4A 4PANA 1ZKMA 1ZNXA 3A1CA 1C3OB 1YFJA 3E48A 4RF3A 3DBLB 5NULA 2HN9A 2B25A 3STUA 3ZLBA 3DBVO 3B6KA 2J33A 2ZUUA 2OY0A 1F8GA 2NGRA 1XTQA 3H05A 4XWTA 4V0RA 3EYAA 3GJ4A 5HR5A 4MQFA 2QX4A 1Z5OA 2ZAGA 1DCMA 4LHYA 5JJCA 3N28A 3OCCA 1KFCB 2X2PA 3N2GA 2P77A 4MIKA 4B6SA 4IMPA 5JCOA 4GNRA 5LIPA 1ULZA 2LCQA 5A4KA 4KOAA 3SZMA 2WYIA 4FFBB 2CBZA 3IURA 1TEVA 2JD2A 4KKXB 3UPUA 2V4MA 1YXMA 3M5DA 5CPFA 1HFJA 2OLJA 4FYWA 1NTOA 3JD2A 1IZ8A 4C7JA 5BYJA 4DLKA 4IINA 1E5LA 3KOUA 3PIDA 4ZOCA 3U9SA 4AD8A 5CT8A 2V0NA 1XALA 2ZR8A 3IHKA 5F9MA 1V3QE 1AZWA 1QYWA 2WAAA 2QTRA 3LBNA 4JUIA 2P40A 2JS7A 4CKWA 5C7LO 2XMDA 3G7SA 2PUWA 1IXZA 4W8HA 3VR4A 4K3VA 3LUDA 3ZX5A 4Y0NA 1XP8A 4BFZA 5BN1A 2L42A 3FFTA 2OCDA 1GHTA 3Q7SA 3P9QA 2QE7A 2Q5IA 1X39A 4JJ8A 4HEA6 3L0OA 4RL6A 3WDMA 2HWWA 2GVNA 2C31A 1HZJA 4LSMA 4CIAA 4MWBA 4P3KA 4UBKA 5B30A 1Q77A 4G4SO 3TBHA 1ZK4A 2FKAA 1S9DA 1MJFA 3CM0A 5G4KA 1E9AA 2ZJ3A 3IAHA 4ZCMA 5BSWA 1ILWA 2H52A 2VZEA 2ZWIA 2PH5A 1G7TA 3F3YA 3HDHA 5FEUA 3KJHA 1I33A 4J1QA 2D3TA 3A9WA 1E2DA 1FFSA 3Q0TA 3CCFA 3HJRA 4KIWA 4G0VA 1BGXT 3JR7A 3ZWVA 4JLMA 4C2TA 1NWCA 3ACDA 3R5HA 3SF8A 1KQOA 2ENWA 2HJHA 4S1TA 3QE9Y 4H7JA 4WXRA 1GUYA 4RACA 3TIIA 3PRYA 2XNCA 1ADJA 4FCTA 1XDZA 2IEIA 2YV2A 3L7CA 2C5BA 2VLBA 3HJUA 3VKUA 3CVXA 3DP7A 2ORIA 4F06A 3QXCA 5EHXA 4E4RA 1JU9A 2GEKA 3H04A 3IQWA 1M66A 2AL7A 2XITA 4CU2A 2ZAOA 3TJRA 1JHQA 2UVPA 4DYHA 2IBMA 4GNKA 1BD4A 4X9XA 1BWPA 1THMA 1YC2A 4FFDA 5IABA 1Y3AA 1PDOA 1FP7A 3ENKA 3H11B 3QVUA 1LDEA 5DKFA 4ZC8A 3C3BA 3E8MA 4I55A 1HNNA 4YDQA 2OCIA 4O4IF 5GV8A 1IK4A 3OIYA 4Q9HA 2KM1A 2WYVA 1EVYA 3DT9A 4WIAA 1DWOA 4TROA 3MFQA 2QW8A 3P4UA 2VAWA 4PZLA 1X7WB 2DKFA 3SHTA 4JI4B 3N8NA 2OD9A 4NJEB 5AVJA 4KR7A 2XZLA 4AKIA 4ETIA 3EVBA 2I1LA 4NDAA 3P1JA 1YQUA 4LHVA 2PLWA 2NTEA 3HB9A 3QKSB 4A0QA 5JSKA 3DNFA 4I99A 4MTLA 2O1SA 3H4MA 3M6MD 4MKFA 2JG3A 2GHIA 2W7TA 4Y9DA 4DR5B 3IMCA 1OWMA 1Z36A 2AD5A 4JBXA 3ZGYA 5KTYA 4XB1A 1ZVQA 4U5QA 1R6TA 1E2PA 1IOLA 2AYZA 2YHSA 3D02A 3PD0A 5KYYB 1M75A 1LLCA 2JC3A 3COPA 2D2FA 4AW9A 1A5AB 3GU3A 1NLFA 1T3GA 2VUUA 2QNBA 1O57A 4FOOA 2HHLA 1JKFA 1N3IA 1NI5A 1XDBA 2NN3C 1JEOA 1DAGA 2WSYB 1JTFA 1A4IA 3OD1A 4BP3A 2HK7A 2A5FA 8ADHA 3G1UA 3VAAA 1QHHA 1WCXA 4FNAA 6REQA 1IEXA 4DMUB 2WK1A 4URUR 3K0KA 3ECAA 4JYMA 4UU7A 4OHZA 3U19A 4AQDA 2JASA 1EUDA 3M5CA 4CQNA 3ETCA 4D99A 2R62A 1Z74A 2BGMA 3U9TA 4UVHA 4C0QC 5KWEA 4M60A 1UP6A 2GZ2A 2PS1A 2DCMA 2PR7A 4MQUA 1CVRA 1LSSA 2WUDA 3OIDA 3HBJA 2VQ6A 3SYLA 1T8YA 4PSAA 2PD4A 4Z9BA 1ULSA 4LC1A 3U7EB 4BDTA 4QQNA 3QELB 2X76A 1RZ3A 1SN7A 2EKQA 3C5HA 4C0BA 1YONA 1N3BA 3EGXA 3D2BA 4K9LA 5LB4A 3PNBA 3TLEA 5CT4A 4CKCA 1FYXA 4V3BA 5F3RA 3Q3HA 3H6GA 1YF3A 2D2VA 1PK7A 2R00A 1IONA 1R64A 2ZZKA 5D85A 2I1VB 4A5SA 2XUKA 1UFOA 2IFTA 3E4DA 2QMQA 3B3AA 2BCEA 2BGIA 1UWVA 2PPVA 1S02A 2BWJA 2WV7A 3B6JA 3CUWA 4EDHA 5I7EA 2C4HA 2WUVA 3ZJUA 3UK0A 4RX1A 2X15A 1Q95A 2W6PA 2NQTA 3PHBE 4QGFA 1NUPA 3NUZA 3ULKA 3FTQA 3P0IA 2XRZA 2H63A 2C92A 4MQEB 3UPDA 4I3HA 2UYOA 4L2IA 4WCFA 2YOGA 3AUAA 3DZ8A 3WKDA 5LQRA 5FTKA 3PQDA 3UTCA 4B85A 4LOLA 3E22B 2ZJ8A 1UBKS 2VUTA 1B00A 2O8CB 4RU1A 1DC6A 3C5VA 3IILA 1UAAA 3LA6A 2FZEA 1I01A 3EJ6A 1QG4A 3VKFA 1C2YA 3G0OA 3GZTB 4KDCA 2UUCB 1OTHA 2FRDA 2VZ0A 3N87A 2VYNA 4YCCA 5CD9A 1G20E 4FGSA 4D56A 4V0OA 2R6ZA 2PH1A 2XMBA 4PXSA 3BGVA 3RVQA 5KTKA 4E22A 3R3YA 3IGFA 4F3CA 3FLBA 2ZUFA 4KUGA 2OHIA 3WLPA 2XRYA 1WLSA 2JAPA 4M53A 2PS0A 4MICA 1PVOA 3FN4A 3T3NA 5I9NA 2HYIC 4EDFA 2Z6VA 1V5GA 1WSDA 1EFVB 1C9MA 4ZRMA 2R00C 2VK8A 3QWAA 4M54A 4OKSA 5AKZA 5IZ4A 2PGAA 1YQDA 5ALRA 3X1XA 1NR5A 2PIAA 1QHYA 5H9VA 2YUIA 3G6WA 1JKJA 3UUEA 4HXYA 4YCNA 4WXEA 1H1TA 4UZSA 4OLHA 3HCRA 3M1YA 5EWLB 1DKMA 4E88A 1VA4A 2NUPA 4KEAA 5IKPA 4EPRA 4DQVA 2MSKA 3S5JA 4UNNA 1U11A 1FP1D 2YZNA 1KQ3A 1MNAA 3X44A 5FLEX 3PNYA 2Q0SA 1CQIA 2ZE7A 3OUUA 5DWDA 3L49A 1O6GA 3PR1A 4GM1A 1PR0A 3KHSA 3UQZA 5JZVA 1TW3A 3HP7A 5AW7A 1GYPA 2BE7A 2PWPA 4JEMA 5I8PA 4ZT4A 1EHYA 1Y3IA 1XR3A 3JVDA 4G0MA 1LZLA 2DUWA 2X4IA 4NHEA 5T6MA 5U4QA 2R9VA 2IYLD 4YJ3B 4E6EA 4EHKA 5C8DA 1X86B 2R6GA 4EG7A 1NF8A 1SD5A 1TDJA 4D8WA 1MT0A 4MV9A 3RLFA 3TQRA 1I7LA 2BSXA 1YL7A 2AEEA 1QIGA 2Q7OE 1O5IA 2ZRLA 2A0FA 2ODPA 2G6BA 2YUTA 3ADOA 3QPAA 4TWBA 4YI5A 4ZRNA 1R6UA 2I6FA 2FUKA 2IYQA 4CI0B 2NZJA 3HU3A 4K6OA 3L8EA 1FDUA 2VNHA 1TT5A 1YHYA 4UFNA 1UPXA 1XD2B 2AF3C 4FC7A 4HUQA 3NGLA 4J0CA 5ES4B 2WTNA 1OGYA 3R23A 1K5HA 2G07A 2CFOA 4Y9SA 1B26A 5E3HA 3B6MA 3L8YA 4TSFA 4GW3A 1ZM2A 3IP7A 4ISBA 5G2OA 3Q87B 4LSGA 1OXXK 4I9NA 4LN1A 3P9NA 4MP3A 4GBED 5IULC 3KEOA 2QSUA 4OB7A 3T3PB 2WM8A 3ZGXA 5H83A 5FADA 3KXDA 1LJ8A 2NUBA 3NWJA 3U40A 1PDVA 1A82A 3U81A 4HPXB 3GO4A 1ESCA 2MR6A 1A77A 1W6UA 3QF4B 1F48A 4DLXA 2QD2A 4GRDA 1LU9A 3MCWA 2RH5A 1TL7C 4I9UA 5AHXA 5EMMA 3LX8A 2P0YA 2PIDA 4XVQA 2CLCX 4IF6A 2AOTA 5JU6A 1WMSA 3OU7A 2GK7A 5DYNA 3RFTA 5DOVA 3TNDA 4TL9A 4DZRA 4Q4AB 3E61A 1RHKA 1SXHA 2C95A 1SUBA 2CL7X 2KBFA 2AC7A 1X9GA 3IH5A 3NHRA 4QNRA 2BHLA 3AOGA 3DDCA 1WMAA 1JYSA 2JGJA 1JR3A 4FSHA 1II9A 4K05A 3T12A 3KT8A 4H35A 2V7BA 3ER8A 3F1LA 1KR5A 2BH9A 4FE7A 3GLIE 4Q1BA 1ZH6A 4C2BA 1HNXB 3TL2A 3RTCA 2X6RA 3L1JA 5DU2A 1GKUB 2DP4E 2XMCA 3QZUA 1NHWA 3N7AA 3VHLB 3UPTA 3L0BA 4DNPA 2OWEA 5FYDA 4EMTA 3HKCA 5GONA 2P90A 3TB4A 3DJFA 3O26A 4WLOA 1WPRA 3TLMA 4EI2A 2WG2A 2EYQA 3L4SO 5FF9A 3I8OA 3U0BA 3CW2A 4IY1A 1GGKA 4DCSA 3T3HA 1LI7A 1U4SA 1RAEA 3C0KA 5JAHA 1WABA 1OT3A 1U80A 3KIPA 1DBPA 4J7CA 4RFSB 3SSOA 4Z4CA 4M8IA 1KH3A 3OFSA 4QBFA 2HTFA 3RUIA 4X94A 3KQMA 5KJ1A 4F96A 5M34A 3ND7A 1YZLA 4YRAA 1R18A 4QE3A 3IXQA 5CX4A 4EA6A 3WFJA 4DDTA 4OH1A 5J23A 4LCJA 1J8YF 2C2KA 1PAUA 2XTZA 3PD1A 5FA8A 4MVWA 3VPHA 1P4RA 2BGLA 3SI7A 1QIKA 4GVLA 1EVKA 5DH9A 2V4ZA 4UMFA 3MS2A 1D1PA 4MKZA 6AT1A 1CJBA 3JWHA 5JRDS 3PTLA 3AEYA 2VJBA 3IFSA 4U6QA 4BMXA 2J41A 4WZAA 3ZU2A 1RJWA 1VFPA 3BRQA 3ORRA 1Y9ZA 1N2GA 1Q1EA 2QEQA 3K9LA 4ZAZA 3NJ8A 4XLZA 2O2EA 3V4VB 3EUWA 3JQ7A 1EE1A 3OOSA 1PZNA 4LJ5A 4Y7DA 3UHAA 2A57A 4DJAA 4PCVA 4AS1A 2MDTA 2JD1A 2MMCA 4R8MA 5DHAA 3W8DA 1MA0A 4KN6A 5C34B 3IT1A 2WJJA 3OBIA 5FTMA 2X14A 4CIVA 2IEZA 2V6JA 4PO8A 4DQ0A 1XELA 1CC1S 1TQ6A 4E0BA 2WJGA 1XQVA 2GZMA 4V0ME 4N76A 3ZGVA 4IZ6A 4IXWA 5DNAA 3W05A 1XXHB 1EEXB 4B46A 1E0DA 4U7DA 1N8KA 1XMPA 3EDOA 4ER3A 1N8TA 1G7SA 1MB0A 4JZKA 1YU9A 3PGKA 5BWBA 3A9RA 3QE3A 3G2JA 1K0UA 4M6WB 4HQLA 4Q3BA 2QW0X 3U3DA 3V7NA 3WGYA 3WYAA 5KC8A 1ABEA 4NBKA 4RUKA 1TKBA 4V0KA 3GW8A 4B6OA 1QNFA 1V11A 3OQMA 4YJHA 5K3OA 4BGIA 4KFUA 4CN8A 2XD9A 1P45A 3AKCA 1JEYB 5EJ6A 1YBVA 1U3WA 2G3YA 1EK6A 1MLDA 1OX4B 3IHLA 2IYOA 2ROQA 3JW8A 3T7KA 2G5TA 3UMJA 1JP7A 4OP1A 3ZHCA 1Y8AA 2W4IA 1Y33E 1K98A 1BMFA 5EZYF 2VJQA 5K0SA 1UANA 1NQ5A 3PJEA 4D4LA 3X2SA 5BMVA 5IXJA 1CZOA 2P9FA 3PRHA 2LNDA 5K0LA 5DBGA 5EYPB 3BD8A 2ZKLA 4IDGA 4WZAB 5C3UA 1YQQA 4QWWA 1FXWA 4ZOLA 1X19A 2CL5A 3OPYB 4EHFA 2J0QA 3F6SA 4ZD6A 1RKUA 2WTUA 1KI7A 2UYHA 3IDAA 1B23P 2AQIA 3N59A 4RHYA 2HWKA 1U0TA 3PRJA 3RHSA 4RD4A 3QUQA 2PQMA 2Q46A 1HFEL 2C98A 3D5EA 1ZBDA 2PKWA 1NBOA 2VF2A 3GMTA 3AHIA 4J0EA 3TSWA 3MTDA 4D9HA 5CDTA 5DBIA 4JUAA 1FC0A 4JLOA 1KI1A 4P5PA 2D4AA 5REQA 4TS3A 3UYKA 2QSZA 5TB5A 3VPBA 3R76A 3NP7A 2XOEA 4JL5A 4DCCA 1EJ6A 2DHQA 3M4XA 3INYA 2OD7A 4XLLA 4BWVA 1YIDA 3BS4A 3PWZA 3KYBA 3R5TA 1Y37A 5JCJD 3OAAA 3P2OA 2DMRA 4IXMA 3SHFA 3DOIA 4EL0A 4M21A 2QRPA 1LGYA 4G1CA 4W5OA 4COOA 1O4VA 4M9RA 3SWWA 1T13A 3BRCA 3PNPA 3K4HA 4KH0A 2QTCA 4N6OA 4UTNA 3BMNB 3UAZA 2GJKA 2J1LA 5I7WA 1O0BA 1EVIA 4JOCA 2RHDA 5SZIA 4YCSA 5EJIA 2ZR7A 3MCZA 3JCZA 2Y2VA 2V1XA 2E37A 4ZAXA 4WKCA 4WKGA 3SJBA 2Q9BA 4C43A 4D4GA 5FI5A 2ZJ7A 5JXWA 1V8BA 5ESXA 3CUEF 3CH4B 1DFHA 3SS9X 2V6IA 2FPIB 1WOYA 2X2EA 3UK1A 2XE4A 4N48A 3NXKA 4UOQA 5D6NA 2ZYIA 3IBYA 4S3MA 4FHZA 4IDDA 4J1SA 4CF4A 3IEMA 4II2A 2QY6A 1CR6A 3P9ZA 4JJIA 3CCBA 4PPYA 1TQ2A 3PQ7A 4E1AA 1KY3A 3C8HA 4H7DA 4M4SA 3VU8A 2YOHA 2H5IA 3ON5A 4D4HA 1NDHA 2IZ7A 4QVIA 2FW9A 4W7IA 4MYRA 1KYYA 3AUFA 1OFTA 1A7KA 1XTVA 2AXEA 4HDQB 3PL1A 3WRVA 3VGJA 1YJAA 2DBZA 4FGZA 3ABSB 5F2OA 4QNMA 1BAPA 4D4KA 5LMZA 1ZSNA 1I3OA 3ZD7A 3GRYA 4E1VA 1M0WA 1QU2A 2BZ1A 2Z8YA 5FV7A 3EIWA 4NBTA 2B1JA 1XWFA 3Q5EA 4KL8S 1AK2A 2FCAA 5DX8A 4UOZA 2OZLB 4O0LA 3MTAA 2Z3WA 3GC6A 3GFRA 4MV4A 4KOEC 4UQLA 1FFAA 1PWHA 3QWFA 3R5XA 5TARA 1EFAA 2H1CA 1BCRA 2JCSA 3A7EA 3T9DA 2FAXA 1NSFA 1Y5NA 4JBYA 2IYNA 4LZWA 4FYPA 3WQBA 3UFBA 3F6YA 3U7HB 3FTCA 4F72A 5KAPA 5LZ9A 2WU4A 3CZRA 2EWMA 2ZSHA 4MUXA 4I6GA 2UYCA 2VNJA 3IPCA 1Z63A 1UBSB 2REQB 2V03A 3A6LA 1BS2A 4Z4IA 1T2NA 3QLVC 4RNDB 2C9DA 3WGIA 2ABWA 1OU4A 3LUPA 4J3FA 4OSPA 3LPMA 1I10A 5EPEA 3UGJA 3L1UA 3E5RA 1VJTA 2PD6A 1KI8A 4LDJA 4RTQA 3AONB 3IIMA 5CEJA 4BP9A 1LRLA 2BTQB 2MSCB 5K8UA 1WP9A 2QRQA 1ZUNB 4HLUA 1WKCA 3ZHTA 4ARSA 2AOVA 5DIFA 2CVHA 5DX1A 2VPZA 1L4MA 1Z82A 5G53C 1U9JA 3VYVA 4TLEA 4M1EA 1MUUA 2W6IA 1QBGA 4N9WA 3A3OA 1HV8A 3CNLA 3IUMA 5EERA 5AHWA 4DCPA 3PEWA 4XUEA 1GPLA 5M2QA 2BUBA 4XD7D 1QYXA 3K8ZA 3QUCA 4DR1B 4KREA 2CJWA 4W5JA 1YRLA 4TXHA 3Q8KA 4OOEA 4RS3A 4U02A 1WR8A 3KKMA 5B7NA 3SFZA 2QL5A 3T3OA 1EH5A 1DO0A 3FNEA 5AKJA 4KGDA 3HSSA 5AJZA 2Z9CA 5HCIA 4KXQA 4KQXA 3SZLA 3ZV3A 4PO1A 2OFFA 5HUJA 4ZTZB 1NVAA 2R7NA 1N6RA 2YHAA 3WBBA 2QXYA 1NC3A 1YOVB 4DM4A 1US8A 1CZUA 2PX2A 2J45A 3FOCA 4IS3A 1L5YA 3HO8A 4TL7A 1T3SA 3EEIA 4TXLA 3THYB 2FRDC 2H1HA 1M6EX 3WJ7A 1FSSA 5AW5A 3RPEA 4TTAA 1JAYA 1B0PA 2YINC 3AM3A 4D46A 5B2ZA 1G2QA 3DV0A 2QM7A 4FW8A 4GMXA 3U48A 4FCWA 1Z26A 1J21A 3Q88A 5BSTA 1TZJA 2BCGY 1ECLA 2PK3A 4EF6A 2M6LA 5HF5A 2VSOA 3FWZA 2G04A 2A5DA 2IRWA 1DC8A 1IMOA 1Y8QB 3GLQA 3F7MA 2HBRA 4QELA 2O3QA 1A5SB 2HRZA 3KAPA 4B83A 2BYTA 1HO3A 3ZVNA 1D7AA 4ABYA 1RM0A 1FP4A 3N9IA 3TL3A 3LVFO 3WSWA 2VHWA 1U02A 4G5SA 2NPIA 3WWCA 2BFBB 3OZDA 4DV4B 1I4LD 3LSTA 1ODFA 2QAJA 4MYTA 3V1NA 1YE3A 3ANXA 2HZ7A 1XZGA 1O03A 2A0KA 1N2BA 1L5WA 2GXSA 2JH3A 5F3DA 4FZJA 5JSZB 2GR9A 1N8SA 3BA1A 1VJCA 1X0VA 8ABPA 2VP2A 2DSNA 1I1OA 2BM8A 1Q1GA 1QGUB 1R8QA 2ZAMA 3FI0A 1XG5A 2BI7A 2ZIEA 4IQ8A 1N2CE 1QB8A 1QV6A 4URWR 4E4YA 3H2GA 1CYDA 5KU7A 4MDYA 5LWHA 3RTEA 2FW6A 2Q28A 4ERNA 2B4YA 4XX0B 3EXAA 3FIJA 1DZ3A 4BN5A 1QQAA 3VO8A 4EJ2A 1UINA 4DJTA 2P4UA 3A6DA 2BR4A 3GK3A 3KJNA 3LUGA 4QDXA 5TMBA 1OFUX 3HVHA 4PYQA 3ZCUA 1Y3CE 4CQMD 4D6XA 3NT5A 3P9SA 3LFHA 4I55B 1J24A 4OHMA 2BKAA 2LUOA 1IY1A 3AGQA 4P9NA 4OQPA 3MCAA 4W1RA 5AIAA 3TYXA 3UT5A 3EISA 4D9EA 2VNAA 1RKVA 4N3NA 5JNTA 4C1BA 2PUCA 1YGYA 2E55A 1P1JA 2A9PA 3FSJX 3G9UA 3BCHA 1C80A 1BE1A 2G1UA 4R5HA 4RELA 2BEVA 3PF8A 1IZ0A 2ZAYA 4EL5A 3F98A 3JSAA 2NUAB 3ZQ6A 5LQMA 5BSVA 5GVSA 2N1BA 1U5AA 2CFCA 5DLYA 1JU3A 1GSHA 2CLEB 1QGDA 1RWVA 4KNVA 3SSNA 4XLTA 3GFVA 4LY9A 5DOZA 4HJXA 1LBIA 1X3SA 4ZP1A 3IA2A 3RVMA 5EEHA 5CG2A 4L3OA 1MH1A 1F6BA 2BFBA 2HU8A 3HS3A 3TMAA 5JISA 5AJTA 3NANA 4MA5A 2XE6A 4XRRA 3ZXUB 4E32A 1X1DA 1GZ4A 1XMIA 1SUCA 5IZCA 3O3CA 4C7KA 5HTKA 4AMUA 4GBMA 3WTCA 5LZ4A 3SHVA 1DOHA 5AQ1A 2OO5A 3Q98A 1PQUA 2AZ4A 3GUCA 2JLWA 4QJIA 1JZQA 4LSWA 4KTVE 4BX8A 1N5MA 1N2CB 3FUWA 4MWGA 1X13A 1E9EA 1X70A 4PLYA 3IAEA 5H59A 1I0LA 4F3KA 2CWDA 2Z30A 1SBCA 3RUPA 3SKVA 4WLVA 2JB9A 4AF7A 2J4CA 1IPHA 1QWSA 4RSMA 3ML1A 1KP2A 1QHNA 2L18A 4K28A 1V3UA 3URKA 4D74A 1IIBA 1D2CA 2Q1UA 1MC8A 1MQSA 1WMFA 2ZRCA 3BSSA 4LBWA 5CVDA 3V55A 5KC9A 2PFKA 4ER6A 1VTKA 3SNHA 3IEUA 2AFIE 2ZRPA 3CR3C 3LUFA 4YMLA 2ZBFA 4ZANA 4FOLA 3EIUA 5DSTA 3BMOA 2FW0A 2V0CA 2PXHA 3I09A 4K9KA 1C81A 4UQPA 1LNSA 1V43A 3UMBA 1Y6FA 1NJ2A 2VP4A 2PX0A 2VDMB 3FPEA 2HRRA 3QNMA 3ROGA 4M0UA 1UIRA 1L7QA 3VZCA 2TMDA 1Q44A 2J87A 2BI8A 1DJMA 3PXEA 1CBUA 1HLFA 1RQ2A 1Q0PA 2IYSA 2ZRGA 4P38A 4RHCA 1ZA2A 2A4KA 5CA0A 2ZT6A 2J0UB 4FI3C 2XCQA 1VCMA 2AXNA 3L0IB 3E4CA 5FRDA 2XNHA 3EC7A 1YZYA 1U0OC 3FMOB 3N2KA 4I50B 4Z2YA 4ZHQB 5INTA 1QF9A 1QR2A 3EZLA 3VTZA 3FZGA 4QUHA 3VPGA 2PFGA 4H1VA 4QDTA 1XCBA 1RE1A 1XVTA 5JWRA 2JJ1D 4OX9Y 1ZH4A 3GA5A 5C5IA 4JQOA 4F21A 2ZPUA 3BWYA 3ILHA 4ENUA 3VR5D 1FUKA 2GAFA 5L53A 3O47A 3QGMA 5CDFA 5DHPA 2NYUA 2FZ4A 1ZMRA 3SP1A 5JCZA 2C97A 1GXSA 1UQUA 2Y0PA 4I36A 1H4TA 4U7PB 5YASA 4MAAA 1SUDA 3ZU6A 3PV0A 3PBKA 1ETUA 1JMKC 1S3FA 3MQ4A 1VIDA 1QONA 2IOQA 4NQZA 3GEIA 4PFKA 3RTAA 1QVVA 3V2HA 4BO0A 2UUBB 4DEXA 1DEOA 1JHUA 1NBME 3CHYA 3DTVD 5ALDA 5FL7A 3CY6A 2BAGA 2VVTA 4H7IA 2V55B 5DYTA 5F1YA 1J8MF 3A4LA 2YWRA 4FHDA 1SZPA 2OEPA 2QTMA 5H02A 4W5RA 2YHBA 4XYGA 1TOAA 2J5XA 3MJFA 5ICEA 4YA6A 2UVPB 4BLWA 5JCOC 2IWRA 3U3OA 1IUOA 2IY8A 2C9BA 5CFRA 3TK1A 4ZDWA 3C7CB 3GI1A 2VDLB 1XCJA 3CXUA 13PKA 1P62B 3OG9A 3TBKA 3ABRB 2RGCA 1NVVR 2VYVD 3E9ZA 3AZOA 4Y2VA 3G0HA 4CKXA 1VP9A 3CZ5A 6LDHA 5KDOA 2FHPA 4HVTA 5DXFA 2P11A 3EOZA 4NU0A 4Y67A 5B6JA 3HB1A 2XGGA 4HWRA 3K3PA 2HPAA 4IIHA 2JKYA 4DA8A 3D5TA 4RXTA 3LXMA 3PC6A 1DRJA 4ETNA 2YIJA 4KYIB 4YP9A 3H5AA 4QYSA 1V1RA 1W44A 4Y2PA 1II0A 1NW7A 1DIOB 3GT4A 3OEED 4URFA 4XGRA 3HPQA 4ZTUB 3T3GA 1U5BB 1W0KA 1IJBA 3MZ0A 5FIUA 5B7PA 4BWFB 4GFDA 1GG9A 2WF9A 1IAVA 3BJEA 4X3OA 1MFZA 3B20A 2R7AA 1SXJC 3IP8A 4PSKA 2F17A 5G1NA 5HJ5A 5C51B 5IUKC 3DWEX 3MFYA 3SXUA 1IQUA 3BCRA 3IXMA 4N82A 4RD2A 3M9WA 3ZHOA 3RVLA 3FLAA 2ZUVA 3QVTA 4X5OA 3WKAA 9ABPA 4NE9A 3QUAA 2X6TA 3PS9A 1T26A 1YQWA 1OXKB 3BTUA 4HB0A 3ZIAD 3COJA 1QZ3A 3NS7A 4G5XA 1TA4A 4Q05A 1XJ5A 1PL8A 2SHKA 3C15C 5FPSA 1EWKA 3JYNA 4O08A 1ZD4A 3PX3A 5FOTA 3TRJA 3UK7A 1ZD8A 3EFOA 1FXWF 4HI0E 3V1YA 5KPDA 1DUIA 4E5UA 2G70A 2HHCA 3KJGA 3TE7A 4M1ZA 4PCAA 1NMZA 4JKYA 4P82A 4IJ6A 1E58A 4QTXA 4BMSA 1B8NA 3KB1A 4Q3CA 1LDBA 1XZIA 5T41A 3NEAA 3DT8A 5G4LA 2RI0A 4AZVA 3OEYA 5C53B 3Q3EA 1J70A 3KWLA 2H06A 5JQGA 3BAZA 2FWNA 1BVYF 1CX9B 4GYKA 5ITSA 4C3OB 3I5XA 1W4LA 1QCYA 2W58A 1QO0A 2X1LA 1IRIA 3CH6A 3SIRA 5IKXA 3W06A 1YVEI 2OM2A 3I76A 3OJCA 4PC1A 1E0AA 1RC1A 2AUTA 1QJCA 4KB5A 4XGKA 1E6LA 2W2NA 5TPWA 4BAZA 1L7XA 1CUYA 3OLWA 4CM1A 4E3ZA 1C29B 2W11A 3RK1A 3V2IA 1FLNA 2CLMB 1RYMA 2FWPA 4XGQA 5DT2A 3HA3A 4LYFA 3VTAA 1ELOA 4LHZA 4Y2JA 3WO1A 5CRIA 4OIFA 3ZDAA 3W04A 2QMOA 2RHLA 3LHDA 1KE1A 3DEZA 2JFHA 4S1OA 4WFIA 3NEJA 4NMLA 1KYIA 2QZSA 3HEBA 1EWYA 4FEAA 5TJHA 1WB6A 3K1AB 4QA9A 1WBDA 2FK8A 3KXPA 1UBMS 1WB9A 2NU6A 2OD2A 4GUAA 4TQ9A 4C88A 5HILA 1GZ7A 5BR1A 4K1XA 2IU0A 1H1LA 4FHGA 4LY0A 5FI0B 4CM9D 2JLAA 2Z0MA 2CVPA 4Q7MB 4LOHA 2ETVA 1NNI1 4J7XA 1C30B 3IYLW 4G09A 4WFJA 3LKDA 4NCIA 3S68A 4S04A 3NQ41 1EFCA 3HR7A 4QJ4A 1YD7A 3JWEA 2FJUA 2EJCA 2QK4A 2QN1A 4OYYA 4OYRA 3ND5A 1DC5A 1JHYA 4LRYA 4X00A 5GOZA 3WGQA 1T9CA 3V4ZA 4FJ2A 4CXMA 2J9XB 5JCJA 5SICE 3N7UA 1KJIA 1KEWA 4MGYR 1WKBA 5I7OA 3DLHA 3F46A 2WUEA 3QXGA 2XUJA 4GOOD 2R97A 2J3MA 4XWKA 5AVTA 5CG1A 1EK5A 1GGMA 4OY3A 5AHOA 5JCPA 1GG8A 3MOSA 1N32B 3HACA 4P7GA 3X1KA 3P2MA 1V35A 3R8CA 2K2WA 3B2EA 1LB1B 1DB3A 2GZ1A 3A7DA 2P9JA 4LCEA 3GN1A 4FGUA 4X44A 5H3CA 1OC4A 3ZJ5A 1HYEA 4F4UA 3BGOS 2NV6A 3HXTA 1OFIA 2UUAB 3HO1A 4H0FA 4IKOA 1N4DA 4PRYA 3I2JA 3A6JA 4QOJA 1ESZA 4JU9A 4LSZA 4Y0VA 5A7FA 4PNEA 4G0XA 3P0EA 4F93B 2QMHA 1XZDA 3AUJB 2WJZB 3OKFA 4AG6A 3TTUA 1A2QA 1F2VA 3FGZA 2QZZA 1BMFD 1A88A 1THTA 4L8GA 1LDYA 1Z18A 1BG6A 1YDEA 2D1RA 4XCQA 2PTGA 1VHWA 1HRDA 4FFLA 4L0DA 5F1PA 4A5OA 2VXOA 3LKVA 5F5NA 1QTRA 1OE0A 2I0FA 1P5FA 4NJMB 5JW6A 3JSXA 5I7HA 2Y1CA 4GKKB 3RU3A 4RMJA 3HP4A 2NT3A 4PZCA 1YUBA 5L8VA 1KVQA 4CKBA 3DVLA 5LXTB 2FMHA 3VVMA 1CKEA 4QQRA 5DLEA 4RVNA 3LUKA 4DAOA 1NN3A 1OX4A 1Y6GA 1DT5A 1Y9JA 5CB0A 2WYUA 2BZ0A 2P65A 1YZHA 2R5FA 3BD9A 1U9YA 4BKUA 1VECA 4BZZA 3AT1A 3SE0A 1N5IA 4KV9A 1SQSA 2HRQA 2R8BA 4MNTA 1VG1A 2ZBDA 5G4KB 3G7UA 5EYPA 4DIOA 3LCVB 4D9FA 3CX8A 3GB9A 1XXLA 3PE6A 4BKPA 3QXHA 2I8CA 3R5FA 3RSSA 1IVSA 1XNHA 4R9SA 4GP9A 3K1YA 1Y1TA 1Y34E 4CE6A 5CDSA 3F5MA 4HDRB 4BVKA 2EKBA 5JAIA 2HCFA 1JFLA 3MWJA 5CK5A 4Y2GA 4O2BF 5I7AA 4EAAA 1E0JA 3BB1A 2A33A 2XX3A 4BE7B 5AW2A 1VXOA 2RGYA 1W0CA 4CNBA 4S2EA 3BM5A 2C8LA 4XUGB 3LF2A 1XD8A 5ALKA 5FFMA 3TPFA 5K0FA 1DOZA 1NXPA 1NQAO 3CW8X 3SHOA 1NF2A 2PSHA 5ALNA 3M8KA 1GNSA 3P2KA 5K2MA 4XIYA 3N6RA 1M6NA 3HB5X 2O7NA 2ZRFA 4KCGA 2H0RA 2QRKA 1QHSA 5KKAA 5JSQA 5LQNA 3FFBA 5C1PA 4HAVA 1KEEA 1SKAA 1Y5MA 2R6JA 1OI4A 5BUCA 2WA1A 1SPBS 2QR2A 1TKRA 4YMTA 3BWCA 4K86A 1DELA 4MS3B 2JIRA 4XIFA 5DW3A 3ZXIA 1E2BA 2BOVA 4V39A 4E09A 2AKEA 3HBLA 4J16A 2PZBA 1M8JA 3G5MA 4L16A 1BN6A 2XZTA 1C9YA 3QXXA 4M89A 5FWXB 1X0XA 4BO2A 1WP4A 3UMGA 3CIFA 1AS2A 1VRWA 1WU8A 2GT1A 1T5LA 4QUBA 3AI2A 3OICA 3WLOA 1IG0A 2YFYA 3ZE6A 4BFUA 4D8VA 2DH6A 4DC9A 1FZTA 3E35A 4Y18A 2VYFA 1V5WA 2D0IA 3GWZA 2JEYA 3GGJA 3W9YA 1O96B 3BXPA 3RC2A 5I3CA 3KLOA 4CM5A 1AGRA 3F78A 5CYFA 3TZ6A 1ATZA 1R5NA 2RIPA 1U98A 1T2CA 2WF5A 2Z09A 4D25A 1NRIA 3IOBA 3HE3A 4MUAA 1RI4A 5LZ8A 1WG8A 3HDQA 4ND8B 3WJAA 3P97A 4D9NA 3INNA 2KMLA 5SYNA 1XJ0A 4H3VA 1MAWA 1YRAA 4BOYA 3TZHA 1CHDA 1CLUA 3DVAB 3IUBA 5JJ5A 2CHEA 3O4JA 2QVBA 4F38A 5IWAB 2QBYB 3Q5DA 2I2BA 3G17A 4N12A 3R0IA 2C7QA 1P77A 2PDAA 3I9JA 4OKIA 2J3HA 4L15A 4BMNA 3ZKWA 5FWYB 2EKZA 5A4IS 2YICA 2DFTA 2Z2IA 3TF5A 2AE2A 1A04A 1HE8B 1RZUA 2H48A 4PRZA 1AX9A 3PX2A 5J2TA 4Z9XA 3W8NA 2NQ8A 5IC5A 16PKA 4MIOA 2NSDA 3BMXA 2ATCA 4DDMA 1YL5A 3E9DA 2BFFB 1Y1SA 3FHJA 4LY3A 4G5HA 5LZ2A 1O95D 2HX1A 1OB2A 1TO1E 4XM0A 4WKBA 1F6DA