1V95A

Solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
130
structure length
130
Chain Sequence
b'GSSGSSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor coactivator 5
publication title Solution Structure of Anticodon Binding Domain from Nuclear Receptor Coactivator 5 (Human KIAA1637 Protein)
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 30
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1v95A01
4YRTA 4YRKA 4K86A 2ZT8A 5C51B 1ATIA 1H4TA 4G84A 2Q5IA 3A32A 2ZT7A 1FYFA 4YRRA 4HWPA 4YPFA 2PMEA 3HRIA 1KMNA 1NJ6A 4YRLA 1G5HA 4EO4A 4TTVA 2I4MA 4YRPA 4TWAA 4KR3A 1NJ2A 4NCXA 1NYQA 1NJ8A 4YREA 1NJ1A 4HWTA 1H4QA 4KR2A 2PMFA 4YDQA 4YRIA 1QE0A 2I4OA 4YRSA 4X5OA 4HWRA 1NJ5A 1HC7A 2ZT6A 2I4NA 1GGMA 1H4VB 3NETA 3A31A 1KOGA 5C52B 4ZTZB 4YP0A 5E3IA 3UGTA 1NYRA 2J3LA 2ZXFA 4K87A 1H4SA 4YRQA 2I4LA 1EVKA 4YRMA 4YRFA 4YRJA 4P3OA 4P3PA 1V95A 2ZT5A 1EVLA 4PHCA 1HTTA 4P3NA 2EL9A 4K88A 1WU7A 4Q15A 3IKLA 3HRKA 4E51A 3IKMB 3UGQA 1ADYA 4ZTUB 4HWOA 4YRNA 1ADJA 4HWSA 4YRGA 5C53B 3UH0A 1B76A 4WI1A 4OLFA 4HVCA 4G85A 4YRCA 2G4CA 2J3MA 1G5IA 4KQEA 2LW7A 2Q5HA 4YROA 1KMMA 3IALA 4RDXA 3LC0A 4YYEA 1QF6A
chains in the Genus database with same CATH superfamily
2C4VA 3C3CA 3NHKA 1I3OA 3DOFA 4J07A 3ESYA 4L72A 5FOWA 2BJWA 4MR7B 1KVQA 1PO7A 2K5UA 3JQAB 2OZLB 4HEA1 5FX2A 1G2QA 4MUAA 2Z2KA 1PS9A 2PZBA 2FP4B 1NXOA 4FC7A 2A9KA 4PQGA 5KYXB 2QJFA 2LNDA 1UQRA 3N0TA 3NTUA 3FF4A 4GLJA 3EMKA 3G2PA 4RQTA 2XYVA 4TTRA 1G0OA 2HK6A 3UV7A 4H31A 2C0QA 2F55A 4GMXA 4ZVQA 3VSCA 1AKTA 4C3ZA 1V3TA 2F62A 2O0JA 1SHUX 5G3YA 1KYWA 4BVLA 2G88A 3I45A 2GAAA 4F11A 3AR6A 5CXUA 2NO9A 3BFJA 4MCAA 2HDNB 1GPNA 4RKEA 3EWSA 1NJ2A 3QIVA 4AC9A 1WKCA 3OCUA 1H2HA 4BVAA 1VZ2A 2GJSA 3BJMA 3TLXA 3CEHA 3WKCA 2WBLC 3HY3A 2ZYTX 3O84A 5J2UB 2DX7A 5EE3A 5LXTF 3G89A 1GG2A 1DIHA 2WG1A 2WI8A 2HPVA 3FDXA 5EWJA 1UFQA 2Y0EA 4QQFA 2WJAA 2JB9A 3P45A 4TTTS 3K53A 3SOZA 3SQOA 4DIBA 5I51A 2QI9C 4I2VA 4AMBA 1L4GA 2XA2A 3AC0A 1XAIA 4I0WB 4FE4A 1XK6A 2AZ4A 4HI0E 4LV8B 1JAYA 2PSDA 3RFTA 4F6RB 3DMTA 1AKWA 2CHGA 3LBYA 4RH0A 1VC2A 1NG1A 2YCBA 1AKYA 1X7GA 3K9GA 4G9BA 2OQ2A 3NVAA 4NYJQ 4IW3B 1KO8A 1UP6A 1P61B 3BZWA 4Z53A 4IVQA 1KH2A 4U6SA 3E81A 4D6PA 3MF4A 2YMLA 4QDZA 1XF9A 3OLVA 1IZZA 1SVMA 2E37A 5DM2A 4OI4A 3AEKA 3B52X 4CU5A 2IYWA 4LRXA 2NT4A 2RBEA 1N5RA 1KBQA 4BNDA 3B7GA 4E7OA 4I5FA 5BSEA 1O0CA 3LDAA 4WXHA 5CYGA 4RBNA 1O58A 2HV8A 3G2HA 3D4IA 2Z58A 5F76A 2QYTA 3FZEA 1YS2X 1II8A 2BDEA 2VT6A 2ETXA 3AUUA 3LX4A 3IUPA 4RFSA 5BSUA 3K2QA 1BX0A 3FZGA 4P3NA 3AHJA 2FFQA 4MB6A 4WERA 1A95A 1CB0A 1HETA 1QHSA 4BO6A 5HKKA 5FI5A 3RT1A 16PKA 2CK3A 4XGQA 1KI6A 2Q3LA 3ZGZA 4XUCA 3WGYA 4B44A 3PUWA 2CCJA 3F74A 5IDVA 2GSWA 4EHIA 1KZ4A 3U6BA 2IIBA 2B9EA 2PSHA 1MJHA 2PGNA 4BNMA 3FKSD 2QTRA 3HSKA 1QLJA 3KDSE 2NYVA 4R1PA 4DSZA 4R8LA 1N3YA 1H1DA 1UJNA 3EYAA 3ICWA 3QI2A 4X41A 5HZHA 5IAJA 3ISTA 5C0OE 2FPWA 4UFOA 4IQGA 1ECPA 4MUYA 2NTVA 4QEKA 4UUMA 1KOLA 1LSUA 5EE0A 1H2XA 1NUAA 2HZ7A 3QOYA 4N0MA 4Z0HO 2XT9A 1DBQA 4AMVA 1Z5OA 4HVCA 3HC7A 3AXTA 3KE8A 2FR8C 4Z7JA 3LF1A 2A0FA 3RIYA 3CUEF 3O2NA 4ER7A 3VKVA 2WVGA 2YC2C 1BXKA 3N0WA 3TGLA 4JA0A 4P5EA 2KE5A 3GK3A 2ENWA 2XIJA 1SG6A 1E4VA 3K1AB 4ESEA 4J49A 3K0EA 3VV2A 2VPQA 4AKIA 1YZKA 2FUEA 2FPIB 2RGNA 1CZOA 4Z1MD 5JT1A 1JU4A 3MJVA 1H4TA 4KKVA 3KT6A 4MI3A 3F6CA 4DLKA 1XZGA 2XDWA 1IM2A 4NZZA 2GSDA 5FL7D 3O4JA 3KUCA 3IQZA 1H23A 3LT2A 5FDFA 2GXUA 5LQMA 4FR0A 1QTQA 4A92A 1WZNA 4DSAA 1SKUA 2V97A 3GBSA 1RRKA 3PPIA 4FXOA 4L57A 1ZIOA 4B31A 4YT2A 3W7VA 3PLNA 3UAGA 2AQKA 3TX6A 2MYPA 1A2QA 2QPTA 1VE9A 1PW7A 4OB8A 1M8GA 4Q3NA 1NHWA 1IY1A 1FJGB 2OM6A 4LJYA 4X93A 5A3SA 1JLHA 4X95A 1YR7A 4TVOA 1V6CA 1A7KA 1YL5A 4XQ9A 3RSCA 3OEWA 2ZVDA 1KJJA 1EWVA 1SULA 3B70A 4LZZA 3I72A 4ID9A 2HQSA 2ZQ5A 4MXDA 5HIIA 3L8ZA 1GHTA 5SZKB 2HD4A 1VG0B 1H4QA 2BGJA 4GOXA 2IBMA 3I2HA 2FKAA 3ROMA 2E89A 2OHIA 4RVNA 1OBCA 1MA0A 1R64A 1J8DA 5E7IA 4EB8A 2VTKA 3GCXA 1EVJA 1QHYA 3PGKA 1SUPA 3FZNA 4HWRA 2P77A 4HLDA 1YNOA 3CF6R 3C0KA 1Q57A 2YWHA 3LXXA 4YJGA 4HDAA 3SD7A 2DB3A 2IEDA 3L79A 4I5IA 1ZCJA 1TU4A 2C5LA 2V1UA 2NV0A 4D0RA 2C8VA 3HA5A 1YFKA 5TMBA 4IIFA 3SEZA 4A6EA 5IS2A 1TMOA 2QU8A 2P2SA 1OA1A 1OT3A 4YJDA 5H70A 5CG1A 1Z3CA 4FLFA 2JLUA 2ILVA 2ZPAA 1DRWA 3INNA 2L69A 4CMBA 5B12A 1SCQA 4RX1A 4MQLA 2PKCA 4TV8F 3FSRA 4UXHA 1SQ0A 1VXRA 4MWBA 4OFBA 1U2RA 2PYZA 2FPXA 4PG5A 3C1AA 4UJ3A 4C22A 4MRNA 3ZHTA 2JIDA 2OCDA 3GYGA 3B1VA 3EHEA 3R8FA 2HUPA 3A06A 3ISJA 4PSDA 5LIRA 1X7WB 2ZYGA 1JIIA 3CONA 2H4WA 2ID7A 5FFMA 2P6NA 4EG3A 3NOOA 1RAHA 5IARA 1P1HA 3T61A 2XOKD 4OBEA 3WLPA 3HCWA 1PEAA 1GPYA 1S6YA 2IHUA 2UUCB 2G5GX 3BIXA 4J0KA 4BFUA 1G1MA 1T9ZA 4GKAA 4F60A 1G3MA 4O4LA 4FX5A 2VUIB 1KY4A 1JQBA 1NT4A 3FYUA 5FPSA 5ADWA 1E3IA 4OXNA 1UK7A 4K6GA 4OYRA 4W5TA 4Q19A 4X00A 4ZPJA 4ASUD 4DLTA 2SKDA 3DTTA 4U2CA 3N3BC 5LVAA 4H7PA 2ZJBA 5F21A 4BIIA 3A6JA 1NLYA 2B4RO 4JJGA 4UU0A 3EQ8A 3MNFA 3H16A 2RH5A 4LFBB 1FXSA 4FIZA 4P5DA 1QQ6A 1HDGO 1HV8A 1J23A 4HMPA 5K0FA 1W7AA 4Z0TA 5HMLA 4KQEA 1JR6A 3RC7A 4BB0A 3ANSA 1XCGB 4WGGA 3RFVA 4TN1A 10MHA 2Z4TA 3A10A 3DH0A 3EQ9A 4U2FA 4AULA 4E2ZA 3H5AA 3O75A 3HXQA 4BJ3A 2ZT8A 2VPTA 5ALNA 3TTYA 1WULS 2LCFA 5CVDA 3RAJA 3T5TA 4UPVA 1US8A 4B8WA 2IXBA 4R2IA 5BXQC 2J0QA 1EJBA 4HNVA 2ATEA 5BVGB 5AOCA 1NR5A 3CH5A 1B2RA 3D7RA 4NAHA 1DFHA 4UDOA 1S3GA 1XNJA 4L2IA 3DEAA 1NJ6A 3OMWA 4L75A 4LWZA 1I3LA 1OI4A 1W85B 3B53X 3VA7A 2FLKA 2Q27A 3GRAA 2PKWA 2PM8A 4PG8A 4EA8A 5K8JB 1U81A 4AYTA 1CYEA 3AT1A 3RSLA 1ZMOA 4AX8A 4EFMA 2X1MA 4NS1A 3AH8A 1U7XA 4XCQA 5FQNA 1HT1E 2H54A 2YXLA 3K8OE 3W1EA 5E1BA 1SVIA 5I6DA 4IH9A 1NBEA 4JB8A 3WMEA 4YONB 5E4YA 3KQQA 2D8AA 3WHLA 3Q11A 2Y99A 3GEBA 1GTSA 4LGYA 3PDHA 4CXMA 4D25A 4GX5A 1G4UR 2HCJB 2O8DA 1SC3A 3SS7X 4YAIA 4P54A 4WN3A 1WMDA 1XXHE 2Y67A 3QE9Y 5DK6A 4Y2TA 1F7UA 1LPOA 1OGJA 1X1TA 4HDRB 3B85A 2SCUB 2VNAA 2ZANA 2ZIAA 4X7BA 5BWOA 4WZZA 4J7CA 1NA5A 2OBLA 3WDKA 3PE3A 5IH7A 2HIHA 3W5AA 5BQXA 1MIOA 3TDKA 1U4NA 2Z5GA 3EEFA 3ZCRA 4EYKA 2A1UB 4MW7A 3GEPA 2PAAA 2DXIA 1R6TA 5AHRA 3IUJA 2E6UX 3OJFA 1ZUD1 1ICIA 4M6WA 3K0CA 4HAOA 5FF9A 1ZRHA 1YB2A 4ZVNA 2QAJA 2RH8A 4FMCF 3HDTA 1AQIA 1DLIA 3M5WA 3NHPA 4CQMA 1X0VA 3G2MA 4PYMA 2LVBA 3ERCA 3D02A 4R05A 5JJ5A 5YASA 5K0LA 2WF5A 3VDRA 1OYWA 4HG2A 3C4QA 3QKTA 4AT1A 4MUGA 2PX8A 4EAAA 3TOSA 4DDWA 4C30A 3RWMB 2E85A 4S12A 5D3KA 4LDAA 4BQIA 3K9NA 3KVVA 4UD6A 4Q15A 3RS3A 1QIKA 4PLGA 4B75A 4MV5A 2JFZA 3OLWA 3PKJA 1XDDA 1AS2A 4Y9DA 3QEJA 4RD1A 4B71A 4BFZA 4HB4A 4NC9A 1B6TA 1DG1G 1TVCA 5G0VA 2IGBA 3SPXA 1EK6A 1WMSA 4U8GA 4HAYA 3BDVA 2CWDA 4NG5A 4W1PA 3HUEA 3ORQA 5DE3A 2WUEA 2Y1DA 1V8FA 3E3LA 2Y8EA 3MW8A 2W7TA 3ER6A 4A0QA 5A4FS 4RVDA 1E0DA 1SU8A 2X2FA 3LT0A 4FTWA 2Z30A 4AYXA 5JD3A 3GJSA 2FK8A 2AXQA 2PZGA 2WV9A 3OKPA 2O2YA 4IKPA 5K3DA 1NMQA 5L4LA 5REQB 4S2EA 4UREA 2Q1YA 5F5LA 1T4CA 2OFXA 1I6KA 4IY1A 1ESNA 4X63A 5A04A 3IXQA 3QXCA 1PZEA 1QV6A 2J5KA 2P9ZA 3JVIA 4AURA 4B84A 2BKLA 4G84A 5I7HA 2HDHA 2W4QA 4Q3LA 2XXAB 2ZIFA 3BWEA 2Q5IA 2ZIUB 1PR0A 1F0PA 1N0VC 2MU1A 1XRPA 4MNTA 3R7BA 4W6ZA 2QG9A 3PUIA 3SSOA 2I9PA 3WGIA 3S2FA 4D0SA 4FFBB 4KVFA 1UMCB 2YHBA 1G5HA 5LYYA 3WBKA 3IEVA 1UXHA 1ZGZA 4C2BA 1GLVA 1KP3A 2XDYA 3CNOA 3SZMA 3WGUA 4PAOA 4EBBA 2VDVE 4X20B 4EJ2A 1AKVA 3KR2A 1WDTA 2II6A 4DV5B 2A78A 3IP9A 4DMRA 2ZUFA 3T3PB 1FCJA 5T3UA 1IDOA 4ENRA 2V7PA 2JH8A 1E0SA 2Z5FA 4M4SA 4LQLA 4TKZA 5EXSA 1MX9A 5E4FA 1JXMA 1CUDA 1OI2A 2FPIA 3GLUA 4DNQA 2OV2A 3I1JA 1SOWA 2D1YA 1Y1PA 3HDGA 1ZJZA 4DBLE 2DY1A 1UQUA 3LPLA 4QOSA 4B6QA 3W4IA 4FB4A 2PO7A 1XMVA 4AUEA 5FBLB 1R2QA 3OKFA 5EEGA 2XQIA 2PGAA 3NHUA 2YJZA 3ETLA 2XYQA 3FW1A 3KQTA 4FFMA 4DNOA 1AKEA 2I7CA 2YOGA 4JC5A 4COKA 1H2FA 2CUZA 2QW8A 2TECE 3PXEA 2JLCA 5AI6A 1Q1EA 3JR7A 3VTZA 2FPPB 1X7HA 2JH9A 4ZJYA 2RHWA 3TS1A 2HFJA 3DOOA 3FDZA 3WIDA 3ANLA 2B36A 5AH0A 4CLRB 1X7DA 2XKKA 3EXHC 1K98A 3USES 5AKKA 2C1XA 3AKYA 1ACJA 3TO5A 3NYRA 2B5OA 4B81A 2ZXUA 3CZPA 4KX3A 1FXWA 1W47A 2R8XA 4CHTA 5JIBA 2ZYIA 4IRXA 3UMCA 5KYYB 2FYTA 4G09A 3LIIA 3OJCA 1Y98A 2PUJA 2ZS7A 2VRCA 4X1OA 1ZH6A 4HDSA 4NPHA 2PU7A 3QFFA 4O4HB 4P8RA 5ILGA 4CFYA 4F4UA 5JAZA 1ADYA 1IUKA 3G5LA 3PSAA 4OQNA 4F8YA 3T3NA 2FWNA 4YIHA 3WXMA 1A9TA 4DXDA 5ESWA 1KAOA 1XD2A 4WCFC 4IILA 4GW3A 3UJAA 1J70A 5CFPA 1FDTA 1ID1A 3CWQA 3HKEB 4YT4A 1CEYA 6ABPA 1S8AA 2Q5QA 4M1WA 5HBRA 1ESDA 4IFBA 4ZDJA 1II9A 1JWAB 1KZ6A 4HNAB 4IRMA 1QGYA 1WQ3A 1JEOA 4K9NA 4PQYA 4YP1A 5F51A 2G5PA 4YCMA 5CIQA 1Z4IA 2ZOSA 1RXVA 2HOQA 3D8TA 3HKBA 2FEPA 2ZTUA 5E9QA 2JGFA 4YXWA 4W5WA 1Y5NA 2Q5JA 1WDWB 4K26A 4N65A 5CGZA 3O1LA 1YA6A 4UVHA 1V8DA 1TM3E 3FHOA 5IZCC 2Z5LA 3AX6A 1M7GA 1ZVKA 1U1FA 2VHCA 4YACA 3ZE8A 1LFDB 4DV4B 4ZZ2A 1UBHS 1WXWA 1YRLA 2IUEA 4HDMB 4B3SB 3KYIB 3RVPA 4FMBB 1DC3A 3BHMA 4JX9A 1PQUA 5J5AA 1VFNA 3U4MA 2Z8YA 1W19A 4E2WA 1ZWLA 4LBYA 4PZLA 4UM8B 2OKCA 1E62A 1JQDA 1X42A 2CJPA 2HUNA 3DV2A 3WGLA 1Y6FA 1VHTA 1WB4A 1N4DA 3S28A 4HH4A 2A3NA 1MO3A 3VU1A 5K0CA 1ZD1A 1NDQA 3O0DA 3ONWA 4QTZA 3RVRA 1KJZA 2AFVA 4H0FA 3V8BA 4AXXA 2P4SA 3PX2A 1IHDA 1GCOA 4P92A 5IXYA 3KHKA 1A5AB 3DHWC 3L40A 1DBVO 1RKVA 3DEJA 2CZCA 1XD9A 3QWBA 4M1ZA 1DB3A 4AJOA 3GLFE 1F7VA 4E5UA 5HKKD 3X1DA 5DNYB 2WNIA 1FRFS 3QHAA 2BF4A 2QXTA 3IS3A 2HIMA 2JHAA 2YQ4A 3CJQA 3GYBA 2X0JA 4J6EA 3VPSA 4R4JA 3R8CA 3Q0IA 1GA6A 1Q7TA 2PZJA 1PR6A 3QWHA 3QOXA 4IM7A 4AF6A 1EFDN 5HE8A 4YJFB 3EFBA 3N2YA 4A5OA 3A3PA 3BWDD 3O0TA 2OQIA 4IF6A 4LJ9A 1SXPA 2J6HA 2P6PA 5DI3B 521PA 1FVOA 2B82A 3UENA 1F1JA 1CQIA 1YKFA 4NE2A 4C4SA 1M5RA 1N32B 1SKYE 4AJKA 4DG9A 2IH5A 4BLTA 3GWZA 1DRVA 4DAEA 4EAQA 4EG1A 2MT9A 1UZUA 2DOKA 4QE3A 4XZ3A 5J4HA 3ZDQA 4ZOEA 2IXEA 3MZ0A 5TPWA 3S2GA 5L3SA 1JQKA 1FS5A 1XZHA 4YAKA 1C30A 2AMJA 1JE0A 3OJOA 5ULLA 1EDOA 1FJXA 4A5SA 1E0JA 1W5TA 2ZGVA 4J0HA 3M4XA 1EE9A 4DYDA 4UFPA 5DHUA 2JAUA 2JBWA 4G97A 1LTQA 4XX0A 1FSGA 2OXCA 2QUJA 1U2PA 4XGNA 5DGDA 1BS2A 1LRJA 2PYIA 4D96A 5A1TA 5I45A 5BSTA 1M9NA 3RYIA 1EXVA 4ZOCA 1IN4A 1Z7GA 1N8KA 4L8VA 1ABBA 1I7NA 1C9EA 3J80A 1QFSA 1L5ZA 5LL6P 3L01A 1E9CA 5HFNA 5BOSA 2CXXA 4NNJA 1U7PA 3SF0A 3HB1A 5B1HA 3EQ2A 2B1JA 2OE2A 2VDKB 3O94A 1MOSA 1H8EA 1HURA 2SCUA 2R8PA 4J0GA 1RXIA 1ZK0A 1IXSB 4RFVA 5TNXA 4BX9A 4E51A 5EJ9A 4PLWA 1Q74A 4DJDC 2BFEA 2VKTA 4TLAA 1M2HA 1P1IA 2NU6A 2FFJA 2ZRFA 3E58A 4DLNA 2AV6A 2P2ZA 2WFLB 4GBED 2IA5A 5KSYA 4KVAA 4PX9A 2FQWA 1QP0A 2I7DA 1Z74A 3PL1A 4U7HA 4BGIA 2F3TA 5THQA 1D6NA 5J2TB 4REQA 1AIPA 4OAPA 4C08A 5B2FA 1ODIA 4U00A 4R0NA 3KQWA 2M6LA 5FAKA 5LBIA 1A97A 1O7JA 4RJJA 2Q9CA 1XZEA 5KVVA 3TQSA 4YGXB 2XRYA 1RT9A 3NDRA 3SDSA 3DDWA 2PFSA 4J29A 2FW7A 3EGWA 4G23A 3LLCA 5JVDA 3MD9A 2D1RA 4YA6A 3M82A 3U5TA 3CINA 2EFEB 3HDHA 3IBSA 4MVJH 3UIEA 3WV4A 1BMFA 4FBGA 4HGNA 3GL9A 5LP6F 3KZMA 4UTRA 5AJHA 1S9HA 3KALA 1H66A 2A5GA 3NBAA 1ZZGA 2KLBA 3QI7A 4BEWA 3BFVA 4KR7A 1W30A 3OQNA 3TFWA 2PKXA 4E31A 4JUFA 4GG1A 4QBIA 3T1HB 4NSNA 4M0DA 5T4FA 1ZNQO 2NSLA 2QSZA 4KZPA 4L4YA 3NJRA 5B3JA 5C1IA 5JCJA 3T94A 5FYDA 4D92A 4K2AA 5HK9A 3PFIA 2WOJA 3A37A 4R6WA 3VH2A 4RSMA 4BWVA 3MOIA 2JASA 1JHPA 1OGIA 3T5DA 4MWGA 1PT5A 1UBEA 1YRAA 4HLNA 4S1PA 4QFDA 1DKOA 2EBFX 3PJEA 1RCUA 2X0EA 4OSPA 1H85A 2C2OA 3LG2A 2WJWA 3SNHA 3ZOZA 3AEZA 3VH4A 3E9DA 1GZ3A 4ND4A 4KH1A 2DERA 1G3QA 1WVIA 1T2UA 3N76A 4N0EA 2Q49A 1TZMA 4G65A 5SYNA 4BO8A 2CFIA 5IT5A 3KOXA 1IXKA 4WINA 1ZH8A 4BLVA 1NQTA 3FFBA 4IG4A 3AKCA 4C0AC 1RC8A 1HDRA 2GK3A 4DWVA 2TSYB 2Q3MA 4U7JA 4DUZB 1FDRA 2JFFA 2B4QA 2AOVA 2I4IA 1V48A 2JI7A 4IEIA 2YVQA 2ZCVA 4TL6A 3LT1A 1P91A 4GPAA 3L8GA 1ORDA 2RHDA 4QDXA 2GFIA 1ZI6A 3KQVA 3LKVA 2J3LA 3L9XA 1XTSA 5AK5A 5B53A 4XSHA 2OYRA 1Z06A 2D2VA 4GAEA 4QWMA 1XEAA 2H2DA 1Z6YA 2UV8A 4G0NA 4UBLA 3FJOA 3UTCA 2CNNA 1IZYA 3JYOA 4Q7EA 3NXKA 4HN4B 4C7JA 1Y42X 1ZA2A 3A2KA 3I6ZA 3WA6A 3X2FA 1MT3A 3UUEA 1U7TA 4OHFA 4YAJA 4C4YA 1V95A 4D1YA 4QGSA 4FFVA 4V39A 5DM70 4EHAA 2PPLA 2R751 2GN6A 2H08A 2GYWA 1TTPB 5EJ7A 2IXDA 1AH2A 4YJHA 5CB4F 1PLLA 3AY6A 4YGYA 2IZ5A 1NVXQ 3GA5A 4ETWA 2O0LA 1I51A 5JH7B 2HPHA 3AZOA 5IN4A 3GT0A 2BTOA 1PBTA 5C8ZA 4QL3A 2J4CA 2IELA 4JODA 4QO8A 2FXVA 1KEWA 1BA3A 3B38A 2C07A 2JLQA 3I6BA 5E6UA 4RCYA 4OOEA 1UDRA 2QP3A 4PXYA 4ECEA 4GGOA 1HYQA 4O1MA 4TSKA 5FUVA 3T1YB 1UBLS 1O87A 4BQPA 2QROA 3MB5A 4LCEA 1XJCA 2BFWA 1KK0A 1CLEA 2J3IA 3HA7A 1CRQA 4RK7A 1QUEA 2VLBA 3ND8A 4RK6A 4DADA 1AS0A 3OIGA 4FGLA 4B73A 2QUHA 4WOKA 4BB5A 5FPKA 3K96A 4B43A 5IXJA 4CM6A 4B3IA 1IWOA 2J5BA 5LZ4A 1VXOA 4QBKA 3EARA 1U4OA 3MGKA 4RK4A 5E7QA 1J8QA 1R8XA 3UW3A 1OH8A 2GEJA 4DQXA 2WQZA 5D5HA 5A05A 3BWCA 5AW6A 4O3MA 5JCOC 2O2IA 1I33A 1ZEJA 3CBGA 3K5PA 3LXMA 3O2JA 4JQCA 1K2WA 2BE7A 1L1QA 2DFTA 2KLHA 4DTCA 3IE2A 2NT3A 1JFTA 1WX1A 3TR5A 2BLNA 1E4OA 2OV1A 1GYRA 1WRBA 2GZMA 2ZSIA 4O4HA 2HO4A 5LFAA 3GCDA 4NPAA 5CIYA 1QQAA 2QPLA 5LLTA 1RKXA 3AJEA 1MJGM 3N2GA 4CQMD 1WPQA 4JBGA 2R11A 3FSGA 3RNLA 2HBZA 4Q34A 4A6PA 1KEUA 5BORA 1TE2A 3G9XA 2PO5A 2DM6A 4J7AA 1W93A 4R9UC 3VC3A 4B2IA 4M83A 3FWPA 2GYVA 4LDRA 4U7TB 1LS1A 1TCAA 4IDOA 1YRHA 4B3BA 2YBEA 3DFZA 4D3XA 1DAPA 2VH2A 3KJNA 7YASA 2WDPA 3VR5H 3WIOA 2H57A 2RGGA 2H5IA 1PF7E 3H4MA 3L7LA 1Q0PA 3MLEA 3HE3A 4KN5A 4MA5A 1HL7A 3SQNA 2EP8A 1AS3A 1YZYA 1QO7A 2MSKA 4Q6WA 5CNKA 1Y5LA 3HI6A 1HNZB 1XLWA 2CLCX 3CF4G 2VP5A 1W0CA 3A7EA 3WL4A 3UGJA 2ZETA 4KYUA 4RIEA 3C3WA 4FEAA 2EKLA 3LP8A 4HDMA 3RJ5A 1ZPDA 2C2GA 1DXYA 4UUNA 5LQSA 3UKOA 2Q5EA 2Q4BA 1KDYA 4BVBA 4YRSA 3V80A 4E15A 2P91A 1ZISA 2A9QA 3K2EA 1FNCA 5E6RB 3KJFA 5EG5A 1PDVA 3OQ6A 3HM2A 4IDGA 4ZRDA 1T2CA 2ZRIA 2FRDC 3JYNA 2AEEA 5A0TA 1W73A 5DYTA 1BDBA 4Z3OA 1TK2A 3O1IC 4P82A 2XE7A 1XHLA 3ZWVA 4IH1A 4KK4A 1I4EB 5B7GA 1U1GA 5C1DA 2ZS8A 5JXHA 1WDMA 2AD5A 2JLRA 4IGIA 5AI4A 4CG3A 5BN3B 1QUFA 2R1TA 4F12A 4ZJZA 2BH9A 2Q2VA 4HPJB 3ZW9A 3STYA 1MUUA 2QRQA 3Q7SA 1I2ZA 2OV6A 1N2BA 5TJ9A 4C87A 3K0FB 2H4HA 4WOPA 1S1MA 1Z12A 2B1IA 3EXG2 5TPZA 4P3PA 3O8BA 3TXXA 2BMVA 1K1EA 4QYIB 2NXWA 1ZH2A 4YJFA 4CKCA 5JS8A 1WZEA 4RZSA 4J16C 4OCZA 4OBWA 3B12A 2R6HA 1IY0A 4UHEA 3B2EA 1USUA 4IIBA 1BQEA 1F12A 4CWAA 2W6QA 4IIGA 4M53A 1ACMA 4R0MA 1RFGE 4F46A 2OBXA 3JW8A 5TQ2B 2FSFA 1YU9A 5ENZA 1CJMA 5CPFA 2W2QA 4UE2A 3JQ9A 5FR2A 1WCIA 4F8EA 3IKVA 2JFUA 3ADPA 4C29A 3V46A 1P74A 1H6CA 1QG2A 5HF9A 5DO9A 2W71A 3P2JA 3FTCA 2QI9F 1U3GA 3Q15C 1X8XA 1IN8A 4H6PA 1A0OA 4XIIA 4XVUA 3OIUA 3Q0TA 2X9NA 5D1HA 3TFOA 2H2WA 3ZZMA 1EFTA 2HDWA 1FLNA 5FL3A 3CRQA 4DBZA 4L9RA 4K6MA 1LU9A 1TC1A 1CNFA 3TQHA 1TLFA 4KTTE 1UMKA 5DXAA 4TZTA 2ZJ0A 1KDVA 3LT4A 3IL2A 3DAPA 4YAEA 3U26A 1VG8A 4HNUA 1FNSA 4D74A 4QVIA 3QELA 1VYTA 4JHLA 5HOEA 2R25B 4WNAB 4QUJA 5DGIA 1MV5A 1OQAA 4LNUB 4YRTA 1ZO8A 4BMDA 3GLGA 4CUKA 4FS8A 4C7BA 5AUNB 4L51A 3VGPA 3ADDA 1DC4A 2AFIE 4KGXA 3ZZ1A 1A77A 3TSAA 1YB7A 2IOYA 2ZRCA 3QFTA 4J0IA 4OQMA 3HR4A 4UASA 2ZYRA 3PIIA 2YYYA 1Y7PA 3G1WA 4QOJA 3WMGA 3DGEC 3P9IA 4UPDA 1NLFA 2CEAA 3ZDFA 1O6ZA 3QKIA 4R6XA 3ZU6A 3O73A 3K09A 5IFKA 1ZM4A 1XDZA 4MR9B 2DH6A 4DLYA 3KJHA 4A1FA 2JHPA 2Z6QA 4IO0A 1M34B 1JAZA 5CDFE 2FWPA 3TRJA 2CN1A 1EJ2A 3LZCA 1MNAA 1YH3A 3VRHA 4EG4A 1DAMA 2JJ2A 4RTMA 1IQ0A 2Z0MA 1N36B 3V8RA 2NOAA 1LEHA 3KVRA 3ISVA 2PMWB 1SRRA 3OM8A 3QF4B 3T5MA 4BL5A 3HP1A 1V25A 1QF7A 1XTKA 3N6XA 4QOHA 4WOCA 2GJ9A 3KYJB 4I55B 3I62A 4XPZA 3GGOA 1MH9A 5G1OA 4AROA 1RYHA 3HXTA 1BYUA 4H16A 1G5FA 3LX5A 3IEUA 4FLEA 2XXJA 1NTOA 1NNUA 5AOBA 2QY6A 5FWDA 3UF0A 4ARAA 4JWTA 5J1SB 4EGSA 3L1UA 1F2VA 4L5IA 1PJRA 3U9SA 4ZU1X 2OLKA 4ND5A 2J59A 2YUIA 4TXJA 1W88B 4IH4A 2ET6A 2PEYA 5IVPA 4TMVA 5T4EA 3BT7A 5IUNC 3PNOA 4PEVA 3CBQA 3ZHBA 2NQ2C 4YXWD 1QCDA 3A31A 4ZALA 1F9AA 3K1YA 4UVGA 3AW8A 2AHOA 3HKDB 3QPBA 4FIDA 4RENA 2IV7A 3EGEA 4NX2A 4BE7B 1UFKA 1L5KA 1UJ2A 2VJQA 2HGSA 2H1LA 2ZRLA 3NAQA 3FPBA 1JHVA 2UZ4A 4LWOA 3FSJX 2R87A 1FTWA 4K87A 4KXXA 5A3JA 5K0ZA 2B8JA 3HB4X 1L3IA 1MAWA 1GU0A 2HK8A 2JIOA 3ETEA 1XUOA 4OK6A 3W4JA 2ADOA 3RKRA 7AT1A 3UATA 3G23A 3IVRA 4EATA 3COWA 3TVYA 4B4OA 4M7WA 3JVUA 1JSCA 3S27A 3LUCA 4Q18A 5E0OA 3FOEC 1BO6A 4OH7A 1L7DA 1HG0A 2AC2A 3OPQA 2FEMA 2V7VA 2JEOA 2J0UB 3V33A 1HPLA 1K66A 1L7VC 3CFYA 3TWOA 3UGQA 5HPYB 1GITA 4DR4B 1EE1A 1P7VA 3UT5A 1Q0UA 3G2IA 2YV3A 3C8DA 4K3VA 2G0NA 2VOEA 2VLIA 4WZAE 3ZV7A 1C4WA 3DL0A 2QNRA 1VE3A 4MMXB 2RHLA 4PV7A 4E5VA 1L5NA 1Z35A 1BKYA 1PLKA 3EXG1 1G59A 3FTFA 3B51X 5F98A 1Z47A 3D2BA 2QEQA 2VK8A 2MINB 3OI7A 5DI9A 4EI7A 5C53B 3CVXA 4QZVA 5EHQA 5DXFA 1OAOA 2YKGA 3PFGA 4D3SA 2G8NA 3E5MA 2QD4A 4OIMA 5K3FB 2R8BA 3RIEA 4IFTA 4WZ6A 2IC5A 4ZO8A 2CE7A 5CA1B 3GEHA 4OHYA 4KIGA 2VWQA 5HS4A 1UBGA 2YNMA 1XFDA 3L4JA 4M8LA 3FX2A 1CR2A 2CD7A 3TAHA 4U9UA 2V9ZA 1P2FA 3V00A 3VYSB 1MVNA 3GJ0A 2QTFA 2DHRA 1X7XB 5C5CA 2MDTA 2YZGA 3CVYA 1LK7A 3EDOA 3G9QA 4M54A 4UHFA 1JNYA 2B94A 4ZI2A 2EJBA 3M33A 5CDSA 5JH7A 2VDQB 5HQJA 5E7JA 1G8PA 5C1BA 3WYFA 3REGA 1EHIA 4I1VA 1KK3A 2RGBA 4I4CA 3KR9A 4LK2A 1DZ3A 1WMFA 3PHGA 4NOLA 2EU8A 5IN5A 5CDFA 4TS3A 2OORA 4W1SA 5JJIA 3HCRA 3NVKI 4I1IA 1SQFA 1XEXB 1C3JA 1VPDA 4RMHA 3X1JA 1VE5A 3BFXA 4WY8A 4OJKA 1N1DA 5F9HA 1OV6A 2WWTA 3TJMA 3MG9A 2DR2A 1NHGA 1C3EA 1DBIA 5CLIA 4HT3B 1DJLA 1HQKA 2D00A 4LHXA 4BLUA 1H8ED 2WSIA 1GQYA 1W49A 3TLBA 3WXBA 2I54A 3QEMB 2SKCA 4I5DA 2GEVA 2W6JD 4ND7A 5EIAA 3N6RA 3ZZNA 2P78A 4M8IA 3G9TA 5IM5A 3B8EA 4RY2A 2GUGA 3G68A 4RDCA 3KUKA 4QXAA 3UHPA 3NHSA 1HGXA 3MWLA 5DU2A 1X13A 3C6XA 1Q7CA 4DNXA 2B7BA 3A2MA 3EDCA 3I8SA 4MICA 3S6JA 1DTWB 2H2IA 3H65A 3LUJA 5E2IA 1DX9A 1KJ8A 1XCBA 2A3RA 2QQ5A 3TZ6A 4EY3A 1VL0A 1BVHA 3PHJA 1CUFA 3LOUA 4R69A 4G0UA 2XV1A 3QW2A 2IEGA 2C2KA 2P62A 1O9HA 3C1OA 1U7WA 3RGGA 1JLKA 1YL7A 1IOWA 1E2QA 1MZVA 4YP9A 3PPYA 3QOFA 1Q17A 5BUSA 2DFVA 1FYWA 4GL2A 4QUEA 4V0SA 2ONKA 1UPAA 1GOTA 1MT0A 3RVBA 3DMGA 3T3IA 3WVNA 3DDUA 1RHKA 3W5VA 5AMXA 3TTXA 5D7BA 4BWYA 3GZJA 1E1RA 5EMMA 1YZQA 1PNQA 1ZZEA 1PYGA 4MWZA 2Q2QA 4QEDA 2VWPA 1U6IA 3T1NA 5BSVA 4N8DA 1J7JA 3VXKA 4UTPA 2D74A 2VR1A 4DCUA 1L2TA 3MPOA 13PKA 3BBPA 1JG2A 4NS4A 1Y9DA 4Y2RA 3THOA 4BYGA 4CN8A 5I9MA 5K99A 4OSEA 4QFBA 3TIGA 4YCLA 5JCJD 5A7HA 4EENA 4OGFA 4AO8A 4WTOA 1T9DA 1VLJA 3UJ6A 4DBVO 4HWOA 1E64A 2Y2UA 3DYBA 4DM7A 3IE1A 1XWFA 2JA1A 3CN9A 4CT5A 1E9BA 1VL8A 3K92A 1NJSA 3FUWA 3Q72A 3JYQA 2OL4A 3I37X 1QH1B 1Y6JA 3EZXA 2QN8A 1SIWA 1FQOA 2ZJ5A 5JPIA 3UH0A 2ZSAA 4ZVTA 2FW9A 5BN3A 3FFAA 4UMVA 4UEJA 4J6FA 2VK2A 4QTXA 4X1KB 2DT5A 3RIGA 5FEMA 1LFAA 1MMFB 1YJXA 2AKYA 2EGHA 2V74B 4JBNA 4KYIB 4BU0A 2V55B 1KQ3A 4C76A 2QR5A 3PRKE 2QLTA 3K0FA 4MR8A 3T4UA 1WUTA 4LKOA 3DJFA 1K4MA 5T7BA 1G21B 4FC6A 4C0XA 4ZVPA 3UHOA 3IB6A 3WYBA 3AEUB 1OLOA 1SO8A 4R2MA 4ZI3A 3BTUA 3SXUB 1KZGB 3GELA 1LD3A 2XA1A 2JGDA 3H2JA 5EMHA 5K2OA 1L6IA 2QRJA 3PFNA 1DKRA 4GRIA 2X5NA 5DOZA 5TQ2A 3V4OA 3B60A 4EUEA 3HL4A 4BCDA 4EEKA 1XPOA 1J00A 4TQUS 2CHUA 1K0UA 4OHPA 4EB0A 3LBFA 4M88A 1Y4AE 5CFNA 1UMBA 4PM4A 1XFAA 3AJ8A 4F4HA 3RHFA 3V3KA 1RM0A 1WMBA 2B34A 1RAFA 5JS7A 4MW6A 5JDCC 1SXJE 2OHGA 2HDOA 4WZBB 1SOUA 3EUEA 2QG6A 5ANRB 4BBJA 1FFHA 1LH0A 1Q19A 1DVRA 1U8TA 1WCXA 2XJ4A 5KC8A 1NPYA 1RI3A 2YL2A 2PRYA 3N74A 4LY6A 3RGWS 2ZJZA 4PC3A 5F7XA 3PFWO 2GBLA 3ZVNA 3OPYI 5ARBA 1W36C 3PDIA 2PA3A 3I0MA 3C3PA 3TDMA 2FCAA 1HG1A 5BR4A 4HN9A 4QPNA 2N3ZA 3FCSB 4LNUA 1EB9A 2YHSA 1RYBA 5H02A 1L5YA 1DQZA 4C7XA 1O94C 4EECA 4DUYB 1FP4B 1DAGA 5SY4A 4XYMA 1LDEA 1IIBA 3P9RA 4JI1B 3HR7A 2BAGA 3HUTA 3RUIA 1G6HA 2WAYA 3OIFA 3ZX4A 1RADA 1V9CA 2DBQA 2XNDA 3BCSA 1WV0A 1Q1AA 2ST1A 3B3QA 4HDCA 3HP7A 5F35A 3WHKA 2ZWMA 3V48A 5KNBD 1N1MA 4LXYA 4V38A 4RE5A 4DJJA 2V3CC 2WABA 1PNTA 4JWKA 4V02A 2RSLA 3MGCA 5B55A 2FEWB 3RYHB 2V6JA 3IAM1 2YVUA 4NBSA 1ECJA 3TRFA 1Y34E 3TW6A 4LBWA 4C5BA 1Z83A 2JRLA 4AP9A 3QP9A 2QMOA 5CH8A 1WF6A 2VAXA 2CNBA 2I4RA 1LKZA 1FNBA 4K1LA 4DILA 2X19A 1R5JA 4S2UA 1T5HX 3Q3CA 5E6SB 4EPRA 4KWHA 5DHAA 3TZEA 5INTA 1F06A 4I55A 1EA7A 3DDHA 4RIIA 5EWLA 4DCPA 5I4KA 2EF1A 2NXJA 3L6UA 3OCVA 3AI1A 4I81A 4ZARA 1CY1A 2I67A 3FSGD 4MRMA 1TYBE 5EZ5A 4V0QA 3QTBA 1JEDA 2PDAA 3KL4A 3R20A 4EDFA 2XBUA 1KJ9A 1L7RA 4ZMRA 4GLFA 1R18A 4JLAA 2O2XA 1V7ZA 5HCIA 2H4JA 1TPYA 2OFPA 2G40A 2WWXA 5G0SA 3LNCA 3OPVA 4ZHQB 1VI6A 3THRA 4CCSA 3VPGA 5B2EA 4GC5A 4N47A 2Q4TA 1N3LA 4BTLA 3EIQA 2V65A 1QVRA 3Q3VA 5C37A 3DLHA 2WILA 3CPHA 4ZOLF 4H17A 5HUHA 3SZGA 2GRJA 1DTEA 2JKVA 2CKDA 4Y30A 1D2AA 2EIXA 4IXDA 1Q0HA 3M1AA 1IM8A 2J87A 2XE4A 4MPPA 3GZTB 4MW9A 5JSHA 4FYXA 5LP1A 1VCNA 2QNIA 4XQCA 1AHHA 4RZHA 2NSDA 3I9NA 1L4YA 1YE3A 3LPMA 3WK8A 5FWNA 3CCFA 4MCIA 1TADA 1YVRA 4YTEA 3DLTA 2C5FA 1K4YA 1W9MA 1J0AA 3CNQS 5L95A 3VR4D 1YK0A 3ROFA 5AVXA 4QGFA 2C4NA 3CH7A 2R3SA 3LYUA 5L6LB 4HX5A 3IAEA 4PYQA 5JNRA 3EPKA 4WFJA 4K9MA 4N9WA 4AG6A 1F1BA 3OPYB 3KZNA 3NUQA 1JFLA 2FTKE 3JQ8A 3UCXA 3M4NA 1SNYA 2HYDA 1SXJA 3ZNOA 2WB4A 2YWDA 1TEVA 2UUOA 3N53A 3ZWCA 4NBKA 3LUDA 2EYQA 1FU8A 2XHZA 2OK7A 2EWMA 4ZU6X 4D57A 3F78A 4UM7A 1L5QA 2GFHA 4MKIA 4QJ4A 1TQHA 4PIMA 2MINA 2WYWA 1LC3A 4YRLA 2GEKA 1JKIA 5TPZD 2A8YA 2JFQA 1I13A 4Q4AA 5KKAA 3ER8A 1IQRA 2D2EA 1IN1A 1K3FA 1NR7A 3LGSA 3TZBA 5K3FA 1WXQA 2PBZA 3D3EA 1P2TA 3GG2A 3A0UA 1G8HA 4OHVA 4Y0VA 1VIYA 1GNLA 1E8DA 5LN1A 5JS1A 2O0KA 4WESB 4WK0B 2A57A 2XTMA 4O4JB 5KYTA 3DMFA 4RVFA 3QU7A 4BNLA 4D9KA 2XKJE 3A25A 4HWTA 4XJVA 2QU7A 4Q24A 4G8BA 5FJIA 4B76A 1X7XA 3WYDA 5LOVB 4FILA 1EAMA 4DCSA 1QE5A 4MWDA 3HCFA 5JD5A 4L6CA 3AKDA 1N8SA 2B3DA 3MGAA 1VKNA 5IANA 1QS0B 2YC4C 2E18A 3P9PA 1PUIA 3M5DA 1K9VF 4Z8XA 1YFJA 1HC7A 3ES9A 1NIJA 2ID8A 2FG6C 3I8XA 1Z0IA 5AVVA 3UOAB 3OT1B 2AZDA 5IK2A 4R7TA 4ND3A 5E1MA 2XD9A 3GDFA 4Z99A 5GADl 4B5KA 1R9NA 2OO5C 2ZRGA 3U7QB 4POOA 4NHEA 2H2GA 4ARCA 2XGJA 1RMTA 4F93B 2PTHA 3CVJA 4TUYA 5J4KA 1F4LA 3BHJA 3RTAA 1R74A 1Y89A 3H6HA 3OX4A 4KI0A 3VX3A 4Q1CA 4A27A 1YSCA 4KQHA 3ANMA 1Q44A 2BC9A 1FP7A 4LMRA 2WZCA 2HSGA 2EJTA 2KM1A 4WE3A 2DWCA 5JQGF 1OTXA 1TD1A 1M83A 3FCOA 4TV9A 1AURA 2D54A 4EOGA 2QTTA 2UUAB 4R8SA 4ZKDA 2EX1A 2QLLA 4FYWA 2ZYUX 1AKQA 3ZK7A 3ZKAA 1G8FA 4DSNA 3OESA 1A9XB 4MUMA 2FG7C 2J09A 1OLSB 3EH1A 1Z2OX 2V59A 3M6WA 5K1ZA 2BUCA 2RK4A 4JT9A 1NU6A 1WVMA 1T5DX 4IO1A 3ZGXA 5DPMA 4NJOA 5FA5A 4WNIA 1RJ9A 1O9BA 1DTWA 3HA3A 3LQYA 2O8EB 1HLDA 4NYIQ 1O4VA 2GTIA 1ECLA 1E1CB 3IVAA 3R6LA 4M1SA 3H2YA 3PG5A 3ND9A 4OI1A 1UFVA 3T34A 2WIKA 1KC3A 3ICCA 3CW8X 3CVUA 2X5JO 1E7YA 2J9ZB 4HAVA 1X87A 1X9IA 1IG0A 2VP6A 1GAXA 4NWIA 1QGAA 4WBNB 2EC5A 5B6IA 1NVEA 1XZCA 5C81A 3B6KA 4QU5A 4OLAA 3T9FA 2WU1A 5AKYA 4OI0A 4XVHA 3TECE 3QKSB 3R24A 4K40A 1C3VA 4J0QA 4GMGA 4U9HS 5EIBD 3ZDEA 3CW9A 4OXXA 1D8TA 4RM2A 3ZWXA 1DXQA 5AVKA 5JFTA 4TL7A 4MDHA 4Y7CA 4G2NA 4OG2A 4PXSA 5DLYA 1ZICA 2ENUA 2DPYA 4O2LA 3GPDG 1Y8RB 2X1VA 1TVEA 2ZUVA 4GOKA 4OH1A 5K3CA 2YYSA 1Z2CA 2ZIEA 5BNIA 2EQ5A 1B43A 4OAOA 3QMWA 3DKPA 3JASB 1UBFA 4N3BA 3RQSA 4MEBA 4PGAA 2JAOA 3NVMB 4EF5A 2HHJA 2F1IA 4FGUA 5T57A 2VZ0A 4AICA 4UQLA 5LMZA 1CUGA 2EKPA 4FYIA 3P4XA 4U1RA 1DCMA 1SGWA 4O4IA 4PTLA 3USZA 1JR3E 3UFXA 1CB7A 4IHJF 4MV9A 4IL5A 5GOTA 3BK2A 3C6KA 3I23A 3OLYA 5CDUA 2QW0X 1Y9ZA 3KXKA 4TVSA 1JECA 3AVYA 5D3MB 5LLSA 2H2HA 2SICE 5HOQA 3R9XB 2WLTA 1E5XA 1W6RA 4BFTA 3U9TA 3MXOA 5L3QB 5EIEA 4TKMA 8ABPA 1W8DA 3KZXA 5KAPA 3IBTA 2WC1A 3D59A 3O93A 3K70D 4PZAA 3LJKA 5GMOA 4D8UA 4JSTA 1DKNA 3HG7A 3AEUA 3FVRA 4A73A 1WOMA 4OYHA 4CQLB 3HVRA 2XSZA 5LQUA 4KPYA 2GCOA 5JISA 1RSZA 3LL4A 2Z43A 1YMUA 4TGLA 2JGJA 3K20A 1RRMA 3OQ1A 4P4NA 5IKEA 3LI2A 1U3WA 2E4ZA 2EKBA 5CD9A 4KG7A 4XE5A 2HSDA 3UWMA 2NW6A 4A8JA 3CZRA 3M70A 4QREA 1M6VB 1RCTE 2W22A 1TF2A 4RS3A 5B4VA 3TLCA 1X1SA 2BMWA 3FDIA 3C85A 3OFNA 1UDAA 1XVIA 4OHRA 3QXHA 4YFYA 4ENPA 1AJEA 1NL3A 3IUYA 5CA0F 5HKOA 4MUJA 3R3SA 3R3YA 2YNMD 1XXHB 2AG8A 3H97A 3FKQA 4RY8A 1DKQA 5AK0A 2OGSA 6ADHA 4FHDA 1FP6A 4GI2A 2BGUA 2BMJA 3C5EA 5BQFA 2PUCA 3MYRA 3W8FA 3AF1A 1UPCA 3GEEA 4MX8A 3HZRA 4O2BF 5K3OA 2VJPA 3PLRA 4KPUB 2H07A 5EUMA 3JWJA 2PPVA 1E9AA 2EZUA 4KUEA 1Y82A 4X7RA 4EW3A 1KJQA 4AYWA 3MOGA 1HUQA 4PAWA 1RYDA 3K0BA 4KWTA 1EDBA 5D87A 2C31A 2ONZA 3JARA 5IAOA 2OHFA 2JZNA 2Q5FA 4UCXA 4MRAA 3HVUA 1FP4A 3CUKA 1N0UA 1XSEA 3DDZX 3U3RA 2HXSA 2L18A 4MROA 2WJVA 4Y18A 4Y2VA 4X71A 1GLNA 1QYDA 4Z4QA 4EUNA 2ZKLA 4PNZA 2ERYA 3S1AA 1NMXA 3HB0A 3LWZA 4HS4A 5DJ5A 3ZH9B 3F7TA 4DRXA 1M7BA 4CEIB 1JQ5A 3CX6A 3GBPA 2A94A 2ADMA 1LPBB 1WU8A 5GONB 2KPOA 1RWVA 4BX2A 2PU5A 1ORHA 2HRQA 3KU1A 1N8NA 1T8WA 3GCGA 1X70A 5C31A 3WYNA 2NYRA 4E11A 4PYJA 1ZLYA 5AI5A 3IDOA 3TI9A 5HKBA 2UUBB 3TNFA 3B6MA 5K09A 1RMQA 1E4EA 1T5SA 2PUWA 4G1EB 3ZYZA 1W59A 4OLFA 4JXXA 1G19A 1HRKA 5TSDA 1KMHB 1P5FA 1LW6E 2GESA 1J7KA 3E9EA 2GN1A 3IOEA 3IUMA 4OKIA 4RORA 5GJWC 4N03A 1JEYA 2R4TA 3ZHQA 4X65B 4CIAA 4XSVA 4V1CI 4NU5A 1E3EA 3NHYA 4JLMA 4QLOA 1RHQA 1V3UA 2YRFA 3S2ZA 3CYFA 2XVYA 3OMLA 4LJ5A 3T41A 1SK8A 3FB4A 3OQPA 3IBCA 4LVUA 4UHCA 4F04A 5LM3A 1VPVA 2CBZA 4G5XA 5J5CA 1JR3A 1PZNA 2QZZA 1U2DA 2G8LA 3AR4A 3P0FA 4HTFB 4RL4A 2NPOA 3I5MA 1Y6ZA 2WU0A 2D5AA 1XMQB 2C58A 2LKCA 3UY4A 4JEHA 5A5FA 4DV3B 5K8IA 1CULC 1E5QA 3QWAA 4Z8YA 1KWKA 1LA2A 4DQVA 2G1JA 5CT6A 2PWAA 2WJJA 1E1RD 2E5FA 2PX6A 4YUAA 1O57A 1E2HA 2LCQA 1X2EA 3QHQA 1B8OA 1JDPA 4NZPA 2G9NA 1ZA1A 1Y1QA 2YXEA 4NFSA 1BNCA 2WHPA 5DIZA 1V7PC 4DHEA 3CZ5A 2HNAA 3SC4A 4DR3B 1JX6A 3NM5A 3DMHA 1T0JB 4D4LA 2EJVA 3S3TA 1YULA 2FW0A 2PTGA 2ZDHA 3I5AA 3ONNA 4G5OA 1I9GA 3BH0A 5A5EA 3TL3A 1GPAA 3QVGA 1ZKDA 5AVSA 2C0CA 3LQ4A 3QTTA 1KSFX 3C7CB 1QVVA 1MXFA 1BROA 3D6TB 4KLRA 1ULZA 3RUFA 1M0EA 1NF8A 4ZDWA 3MA0A 1FTQA 5CURA 2GARA 1W0KA 4N0PA 2JIPA 1D1TA 1O96A 1GTL1 3GD5A 4RPJA 1EVIA 1SQGA 1TC2A 3R1IA 2VQFB 1I2BA 4MQFB 4ZHSA 1ZMRA 1RS0A 2OZPA 3Q3HA 1BMQA 4H3HB 4NU0A 5CXQA 3TNYA 1N2EA 3OP4A 4FI3F 3VOSA 4ZP1A 4DCMA 4MWOA 2G06A 3CX7A 2P1RA 1V8BA 3IR7A 2CEKA 1QOPB 3H18A 4QOIA 1GUDA 3I5YA 5LWHA 3P0EA 4OFZA 4KDFA 5CW2A 4JYMA 3IPCA 1Z17A 1UOEA 4OL9A 5HP4A 1RI5A 1DQPA 3SBDA 3T7CA 4AW9A 4WDRA 4YRMA 3D5QA 3NT4A 4AVYA 3VAZA 4D45A 2QVXX 5LMNB 1CCWA 1TMKA 3W1WA 4PIPA 2G04A 5EHZA 4XTCS 5LOVA 2QTCA 4W9MC 4R2XA 3DCJA 3P9KA 1RYYA 4ID3A 4MWTA 3BL8A 5FBQB 4MZDA 1GYPA 4E2XA 5JXGA 3OTGA 1A9ZA 1FDWA 3SBOA 4JJ7A 2NVBA 1KAGA 4JZYA 2HLNA 1MC8A 4TKVB 3C7KA 1TQ6A 4Q6BA 4XEUA 3ZJTA 4V1CB 1RM5A 1T0BA 4Q7QA 2DVMA 1ULTA 3TLAA 5CVTA 4XLLA 3D1VA 1GNTA 1DC6A 2Q21A 4JL8A 4LDNA 1H42A 3O3MB 4MUBA 3TE7A 1Q1ZA 1BX3A 4NMWA 4P4UA 4II7A 2BSXA 3NASA 1DFGA 1T91A 4P81A 4M1KA 5DSXA 4AZ3B 2FK7A 4K46A 5I7AA 2CFOA 3TRHA 4M21A 421PA 2IZ1A 4W6QA 3O31A 1QR2A 1I3KA 1MPTA 2N0SA 3GLQA 3SDZA 1PS0A 3ZDAA 5F1OA 2ZRQA 1TEXA 3WIVA 2C5SA 1XTBA 2AX3A 2OSVA 1AGNA 2O1EA 2ODNA 4MVJM 3W4KA 3K2BA 2Z4SA 3TXAA 3DFIA 3C6ZA 4KNYA 1CDOA 4KE9A 2XWQA 5EUQB 5LA6B 4EA7A 4TWBA 4A8PA 3ZZUA 4MPTA 1JAHA 4PHHA 5EJ5A 1Z34A 2NV2B 4DDHA 3U4HA 4AWBA 1A8UA 2AFHB 1JG4A 1E1CA 4S3MA 1QQ7A 4XGIA 2VCHA 1FFGA 4CMIB 2XGGA 2NO0A 4HYQA 1HEUA 1R0KA 1SH7A 2AC7A 3LGXA 3V8NA 2BGIA 2KYRA 4IKOA 1AZLA 1OPRA 4MAMA 1LVGA 3BEDA 3RIHA 2ODPA 3FYCA 4CCYB 4YAUA 4WBNA 3EVDA 4GT1A 3SLKA 2ZWPA 5CX4A 2C04A 1ND5A 3REOA 5JAUA 4UVDA 1U0TA 1TVKB 1P1CA 3FB1A 2DMRA 3R9WA 3BB4A 4C01A 1J33A 3GUCA 3TZCA 2QS9A 3AP1A 4Z9XA 3NONA 2R0QC 4AFNA 1A2OA 1P1JA 2CVPA 1IU9A 4NLLA 2V7QD 3PP8A 3DE5X 1TNDA 5JMWA 3F1LA 5HIMA 4RHUA 3I4LA 4C4XA 1Q6ZA 2PWBA 1Y33E 3GLFB 3VNVA 3Q12A 5EXDA 1Q12A 4WH0A 1DHRA 3RUEA 1CUXA 3JQFC 4JR1A 1L7NA 1D0SA 3BWMA 1CQPA 4GLOA 4ZO7A 4MKGA 3ECAA 3F6SA 5BN5B 1YIAA 1O6BA 3AEQA 1KO1A 1N5KA 3O9MA 1W2HA 2MHCA 1XAHA 1OXTA 1HEIA 1RAIA 2BZSA 3QEBZ 3ABRB 1Q83A 3T5BA 4PSCA 3MWDB 3UHJA 4YP0A 1Y0BA 1KDZA 3R76A 1L7AA 1JEEA 4EB6A 5LXTA 2Y93A 4M7OA 2I6TA 4CYMA 1AV7A 4URZR 5L3QA 1GO2A 3RU3A 1VCOA 1QFJA 1W5SA 2QLNA 3FKJA 4MPDA 1L5RA 1EFHA 4XSGA 1S2DA 1XB2A 1JG6A 2JIRA 2OHJA 2VSQA 4TZ0A 1JA0A 3H9BA 5KI6A 1PD0A 2ORVA 3MMXA 1Z13A 3THXB 4B4UA 5CT8A 3AV3A 4DGSA 2QXYA 2VRBA 5FULA 3FLMA 2OD9A 3L5OA 4X84A 4F2WA 3CN7A 4K9OA 5HUJA 2BFBA 5E7MA 2OO3A 2F00A 3QXJA 4GH5A 2QNBA 3DFMA 4R2LA 3STTA 3BXGA 1YQTA 2LBPA 3EASA 3O8NA 4GHWA 4PO1A 4Q3EA 5T5QA 4YH1A 2A9RA 3CX8A 3PDWA 5BNFA 4B6FA 4BNIA 5FWYA 3N5CA 1SZJG 1R4ZA 1TD9A 2AEJA 5ITZB 4S04A 3DUFB 3GAFA 3EXAA 1SPBS 2N47A 1SUAA 1SFRA 3P7MA 2BBSA 3KYCA 4FPXA 1Z5WA 1G4HA 1FBTA 1Y6QA 2UZAA 4Y2XA 5AHWA 3UQZA 2IUSA 1UKYA 3FZYA 1B4DA 1IQPA 4B35A 3JV7A 1KHTA 4JYAB 5IDXA 5K6TA 1C4KA 3TQOA 4RULA 4KPUA 2FQ1A 4HL6A 4DY4A 3ESBA 3FMPB 3ZD9A 4DCVA 5DOVA 9LDTA 1RI4A 3AF4A 1AZSC 2CB9A 3CLKA 1OOEA 3L49A 1XMSA 1XO1A 1UODA 4GSKA 4KO8A 4OF4A 1DWPA 5ENDA 3KXLA 5BOVA 5IK2D 4Q9HA 5EJMA 4TMZA 3JQBA 1NXPA 4FFNA 4MS4A 3SEQA 1MG0A 2PIAA 3SHWA 2QL5A 2B5VA 2QZ9A 4X1IA 5AICA 3RSSA 3S44A 4CUJA 3E5NA 2C03A 1X1QA 2R1ZA 2VA9A 2IPMA 2BUAA 3Q9UA 2GERA 5GONA 4QPZA 5LQCA 4RKWA 4INPA 2FSVA 1KK2A 1ODSA 3AFGA 3PQDA 2FMXA 4IYRA 2WFMA 3ZV3A 3QLJA 2ODWA 2Z5VA 1IWPB 1WTCA 1Y8AA 3BA6A 3B6JA 3BJRA 3WRWA 1HNNA 4CM9A 4DT1B 2X2EA 4GO1A 2IY9A 3LKZA 4NJMB 4TWAA 5ERXA 4GQIA 1IM5A 3MJSA 1M1YE 1D8AA 1JE1A 2X8LA 3LFTA 4KMSA 3UICA 3ZGLA 2JCBA 3QGMA 1P5JA 2NGRA 2FHSA 1QFXA 4G5FA 3KBBA 4KITB 4E1BA 4RSRA 3T9DA 3PFCA 4O8ZA 1N2CE 4L0DA 2Y27A 3LDFA 1K89A 4G5YA 4B3HA 3WL6A 4C5CA 3UH1A 3OJWA 3EIWA 3GUYA 5BVHB 5BR7A 1M1UA 1SU6A 2IOHA 1X92A 2AOWA 4Q4DA 5HK8A 3DWFA 2HPZA 4AI6A 4NCIA 3RC1A 2CUNA 2ZPUA 1CNEA 5CK5A 1KRWA 5EIBC 2YWEA 3TQCA 1XJQA 3M6VA 4IMRA 1Z4OA 2PKQO 3KT8A 4KMOA 2QOEA 4EHDA 5IKPA 2C4KA 1U7UA 3JD1A 4DCGA 4ZGBA 3MN1A 4QXRA 1VSTA 1DUSA 3FNEA 5KB3A 2H9AA 3S55A 5KU7A 4R2KA 1FF9A 3UK6A 1P0IA 3OZWA 2FI1A 3IUQA 5FWAA 4LF7B 4X45A 5ALXA 4D26A 3I34X 1TRKA 1UMDB 2C88A 2OVFA 3GLRA 1U28A 2CNWA 2F3PA 3ZWYA 3VPHA 1FFXB 4GGMX 1RJFA 1SKBA 3NHJA 1E79D 1MN6A 2ZIWB 3E4CA 4AU1A 2HA7A 2PS9A 3MUOA 2HO5A 4LJLA 4ZMSA 1P0FA 2C5EA 2W2KB 5BSRA 1EVQA 1Z37A 3QLVC 4DIEA 1PFUA 2IXTA 4FMDF 5DMXA 5FO0A 5AW2A 4MQFA 1DBSA 1BE6A 3IAXA 2PLWA 4EUKA 2ROQA 2HA4A 4FDVA 1N92A 1QH8B 3ESCA 3MXTA 5HYVA 1U2ZA 2WSSA 4TQGA 4XCVA 2F3RA 1EFAA 1C7QA 1JP7A 4Z2YA 1OREA 2I55A 1I0IA 3LBNA 4NK4A 1QIJA 3A9CA 3DE7X 2XSZD 1H5UA 2J3DA 3GLHB 1HMYA 4UDYX 3SJCA 1JNXX 1FZTA 4G41A 1CE8B 3F3YA 4XFJA 1GWNA 5CCDA 3CKYA 4PC2A 3FHTA 1QANA 3DOJA 1DIBA 5DNUA 2VYQA 1YJAA 1C0PA 1WG8A 2SKEA 4L9WA 5HQ3A 4CL0A 5I9LA 3GLIB 1P6QA 3OFVA 4C14A 2AG6A 2YNMC 2AJTA 4KOAA 3UMRA 2FF5A 2Q4DA 3OFND 4M37A 5LQRA 1HQYE 5MN6A 2WD8A 3L5KA 3DFUA 3K6JA 3KG2A 2WB2A 4FR2A 3NHLA 1X8LA 4A2CA 2IP4A 1G8GA 3GFPA 3AG5A 3CF0A 3UNXA 5C7IO 3T4EA 5BUCA 2VBGA 3AUKA 3C87A 1NM5A 4AF8A 4ZDKA 4FEGA 1NI4A 3ME5A 1JMVA 4QFMA 3TH5A 3ZIUA 2DT8A 3NIDB 1U1DA 1UT5A 2X9GA 4M9QA 1E89A 3ZXSA 2WWYA 1HE5A 4HWPA 1CJBA 1SM4A 2RHRA 4EKEA 1SXGA 1M1YA 1VCMA 1IN5A 1YJ8A 1QDLB 4UNNA 4PYOA 5A9TA 2ABWA 4HQKA 4KQKA 2OGTA 1NY5A 4QG7A 3TLGB 2BEWB 2A84A 4YR9A 3C5CA 4IIJB 4GSLA 3B3GA 1SMKA 1CRZA 3IBYA 4BFLA 4JI8B 1N2CA 2GASA 1SN7A 1C9MA 1OAAA 3BEOA 4INJA 4RD2A 2OHXA 5D3ZA 5DGTA 2X8JA 1PJ8A 5SZIA 4BNGA 4EMBA 2PUGA 4HS9A 1WEHA 2RAVA 4IFIA 4ZAGA 3UYKA 2CYCA 1U8ZA 2XR1A 4GUDA 4BVJA 3ZVMA 4FP9A 1CK4A 3T12A 4IPTA 3QXGA 4NTZA 4I4IA 1GQRA 1H1LA 1KYZA 3NGLA 1N6KA 2YHIB 4BAUA 5AD1A 2J9XB 3A9SA 2VF8A 4IVPA 1NF2A 3GZNA 3RKSA 1VLLA 2HRBA 1NQAO 1MQ9A 2YMQA 4QICA 4HUQB 3EIFA 4WADA 3PUHA 2D7JA 3TCNA 2AFHA 1CR1A 1I14A 4Y6PA 3VU8A 4I50B 4CHGA 5DN9A 4QVKA 1WMAA 3ZXUB 2F8TA 1T24A 4IJKA 4RKFA 3PYMA 2CCGA 1O1YA 2ZWVA 4FDLA 3G3EA 4RKYA 1H93A 1TFUA 3KXPA 4P2GA 1ILEA 5CB6A 3M6FA 5DW0A 4N82A 3JALB 4ZEWA 4E30A 2CE2X 3RS0A 3KKPA 3OPMA 3ELWA 4FHCA 4YO7A 2F8LA 1XV5A 2C83A 1XQVA 4JB0A 1O89A 4JLBA 1MEOA 3AVOA 2DPMA 2VSNA 2OV8A 1QQBA 4L0MA 1RACA 4P7FA 1XPJA 1E1DA 1FVXA 1ZH0A 3SFTA 4MQ5A 1MGOA 2D1TA 3K05A 3PIDA 4ALMA 1Y6GA 1T9KA 2O7RA 3ZHZA 3I6QA 4E5SA 4YJ3B 2G4VA 5DGHA 3QX8A 2QM8A 4B7XA 4EITA 2IH4A 3UAVA 2VPWA 1E7QA 4XWWA 4EZBA 1RKBA 3OLXA 1XRSB 4RTLA 2RE8A 3USCS 3REFA 2E7ZA 2H2FA 4EGQA 4UD2A 5ESDA 4JLOA 1IK4A 4BN4A 2VNIA 3GJXC 1E5DA 1YB5A 2WINI 2GWRA 1M74A 1JHMA 4QBGB 3W3ZB 4ZV4A 2F1OA 3Q7QA 3NWEA 3R5FA 3HXKA 1C7ZA 3RSHA 1PV2A 1EXMA 1FFAA 3U7GA 1MOQA 1MBZA 2RGYA 2AI1A 2NUAA 5FRDA 5DHSA 2CF5A 2AT1A 2QN2A 2H7VA 2NU8B 1A96A 5F7ZA 5A3RA 1VL5A 4C0JA 4PBTA 3T7IA 2NADA 4MS1A 4H6WA 1FRVA 2FG5A 2G4CA 4MLZA 4EGFA 1SVOA 1W0KD 3FUTA 1HDZA 2NP7A 3I12A 3L43A 4RJLA 1I1NA 3AJAA 3K0AB 4YMTA 4RA9A 1LUAA 5CLGA 3GT4A 3OQIA 3E61A 2NXEA 2J45A 5EN4A 2M1XA 5K9ZA 1NVWQ 2ZJAA 3KZKA 3X0DA 4C6TB 2BFOA 3DB1A 3GRZA 1NI3A 4FZ5A 5AJXA 1NV9A 5IEBA 1VHWA 3DM9B 4MQEB 1LDNA 3DUFA 3L7CA 2QYHA 2ZSKA 4UHJA 4ZO4A 3R77A 3B5EA 4A15A 2BHRA 3M49A 3HM9A 1YR9A 5J2UF 1E5LA 4OUDB 3NI2A 1J07A 1WHTB 2FOIA 4B7CA 1XEWY 2AFIB 2BI8A 2GCIA 3EGDB 2B83A 3ZK8A 3DZBA 2IS2A 1V3VA 1ZIXA 2JFWA 3DAFA 1DP4A 3JYHA 2G6TA 3N0RA 2DTEA 4EY7A 2AG1A 2I87A 2M9MA 2EFGA 2MMGA 4W1RA 3BREA 4BJ6A 1U3TA 3MJEA 4AUMA 3L7IA 3E3NA 1KU0A 5ER9A 1M8KA 3TQTA 4ZYLA 4YREA 3SWWA 4YWHA 3UK0A 4D02A 3OO0A 3ZWAA 2O8VA 4S1NA 3KO8A 4LC9A 5MHTA 1NJ1A 3KJEA 3L82B 3OCYA 1BS9A 1W1UA 5DEIA 5B1SA 3VZSA 2QYSA 1Y8ZA 2H7YA 2AXNA 3OZAA 1IONA 3KKMA 4KH0A 1KVTA 1BN7A 2BW0A 2IZ6A 1GPDG 4JC0A 1DJNA 3T9BA 4XJTA 4RZ2A 4D99A 4HCJA 1M67A 2G28A 5UKDA 3RQIA 1LZLA 1ZD8A 3P9SA 4RMNA 4ARUA 1U8XX 2R96A 3F6BX 2Y9MB 4Y98A 4GR9A 4Y9SA 2BE9A 2NQTA 2JHGA 3E2IA 3E84A 1CZNA 1YQXA 1F3OA 2O23A 4Q4HA 4EQZA 3IXMA 1WW8A 2WYIA 5H8WA 2NTEA 1YZ3A 3LX6A 1CJCA 1ZGHA 3ZJVA 3CO0S 1UKVY 3FMGA 3MINB 2C92A 4O5AA 4ZT7A 4GQAA 3U7IA 2VCEA 2HY7A 3NTQA 4V2UA 1KORA 1SBYA 1V5FA 4JIGA 3WJAA 4CVNA 5C8YB 4A82A 3PUXA 5KKCA 2B69A 1MAAA 5JSZA 2EJUA 1G9TA 2AVDA 3QBJA 1C9DB 4JLPA 4MRVA 4E09A 4E14A 2NXCA 4B3JA 1BIFA 4DSUA 4H7JA 1KY5A 3GA7A 5K8TA 2CXUA 2O52A 3EG9B 3OZRA 3ZYCA 1N57A 4FUTA 1C3OA 5FTJA 5H83A 4CIXA 4RJTA 5C7YA 2BR4A 3E5RA 2WKQA 3T52A 3S2UA 1DTSA 5TV2A 3EA4A 3F7MA 1JU9A 4DMHA 1IUNA 3D5TA 4ZXPA 5JS6A 2O2DA 1WLSA 2WPDA 2Z3VA 1U0OC 4N3NA 3E7FA 5JY1A 4U6QA 4ZK2A 4Z4HA 1F51E 4EI2A 1HDXA 4U3JB 3UZUA 3SF8B 4LSZA 2ODTX 2KW5A 2VJMB 1P3DA 1OFTA 5K51A 4X66B 3LQRA 2QRVB 4YRGA 4K1XA 2X2OA 4WEQA 3NIGB 2PXAA 5DTMA 3VUEA 2HBQA 2Q6LA 1WBDA 1ZW6A 2ERXA 3A4LA 3GFRA 4YUXA 4QBFA 4CG2A 4M36A 2A0XA 2QQ0A 1QO0A 2REBA 4FN4A 2YR0A 5ECGC 4O5OA 1ADCA 1TIKA 4HXYA 2VXCA 4YRCA 1XG5A 3M6UA 1VHDA 1D6JA 4D4JA 3J7AC 1NP7A 3A3YA 3SZRA 2OGUA 1QAOA 4QQRA 1LDMA 1ISFA 1I8TA 5I3ZA 4OLJA 4B9EA 3H2ZA 1T4MA 3LX8A 2ZK7A 4FGSA 4GUAA 5ALEA 5EIWA 4LXTA 2W2KA 1EJ0A 3ZLTA 2F8MA 2QORA 1IY2A 2HRCA 2QTZA 1TQDA 1UWKA 1Z08A 5B57C 1RAAA 3HRHA 2HTFA 1SD5A 4Y67A 2G6BA 3JQRA 1S9DA 3AUAA 4LHSA 3PE6A 2BCGY 3H3JA 1JN0A 1F2UA 1P7PA 2DR3A 3EZ7A 1ZITA 3FYDA 5IUJC 3JZDA 1UKEA 1APBA 4LX8A 4TVBA 4B32A 1L4LA 3VJLA 4CKXA 3A1CA 1HDCA 1DJPA 1RLIA 1Z75A 3H1GA 3D31A 1O77A 3D9QX 3FHCB 3V2UA 3ZDDA 4P0QB 1CE8A 1L8LA 2VH1A 1T35A 2Z3ZA 2FWJA 4RPKA 5FOSA 2N75A 1JR2A 3HNRA 4EL5A 5CLFA 3EMDA 3GLIA 3COSA 3Q8WA 1N0IA 4GYJA 4QBTA 1KHHA 1VIAA 1VE1A 4GOOD 1U2SA 3RG8A 4RVCA 2ZE5A 2BTEA 2Y0DA 3ESXA 5JALA 2XE6A 4KVZA 2VF7A 4PPQA 1A8IA 1EFRD 4ERXA 2DF8A 1OE0A 1LLQA 1V37A 2DTDA 3A2LA 2UZIR 5KC9A 4DA7A 2TMGA 1C50A 3DNMA 1BHQ1 1Y4SA 1YOBA 3H13A 3R0XA 4XPIB 2XWBF 3SCZA 3IV7A 3FI9A 1BD4A 3K94A 3WNCA 1UL1X 3KC2A 1OC2A 1Y81A 3Q6MA 3RF7A 1CY7A 1RVV1 3VSBA 3SZUA 1OJ7A 4UE3S 2P2CA 4RABA 4A4DA 4FYPA 5L4SA 3TLGA 1XROA 4FW9A 4CRWB 3L1IA 2IHNA 3RYTC 1GCAA 1RVDA 4YCCA 2E4UA 4C2UA 4P7KA 1QIFA 3L1HA 3CUYA 5EGNA 3TQIA 4L5CA 4WVFA 1W44A 1ODTC 3AR2A 2HL6A 3B2QA 4DKJA 3WZ2A 2QN6A 4HQNA 4RHCA 4HBZA 4CF4A 1YDFA 2YHIA 3NTLA 1X19A 4FZJA 1DXHA 4V24A 2ZIVB 3VYUB 3WWCA 1JDUA 2YZNA 4LOLA 2GPYA 4A0SA 1SRQA 2GBFA 3K31A 2CDRA 1UK8A 1C0EA 3CRRA 3TSCA 2QX9A 3H17A 2XNJA 4ZDIA 2C94A 4ZVKA 2HJGA 3Q3IA 2P3OA 4P0PB 3GGCA 4CM9D 4FUQA 5CX1A 3B6IA 5LYJB 3QG1A 1ITZA 3F5FA 3L7MA 3ENNA 4O02B 4PX3A 1H2RS 1R4MB 4IUYA 3L8HA 5DBHX 5DRTA 4Y1GA 2FN7A 3CLUD 1ZSNA 4GU5A 3QWFA 4GGPA 4JJZA 4LMBA 2QAGB 3JZMA 4RNCA 1TGYA 3ZIAA 3DKKA 3GMDA 2EFDB 5MN4A 3D3KA 2O8CA 3S40A 5DN6A 2AIRA 1GP2A 1JDBB 2ZJ7A 3IDFA 3M1YA 4BNFA 4F9GA 1C1XA 4MV3A 1V1RB 2VEDA 4L7VA 2FUKA 2YY7A 2QLMA 1CY0A 1P1BA 4OD0A 2HMAA 2H1RA 4YV7A 4Z3KA 2BEVA 4YROA 3KQYA 5CFRA 4WNCA 4LDQA 3GFFA 1PJZA 1V6SA 1QMGA 2H4FA 3EXEB 4G4SP 4UEKA 2NX2A 2NVUB 3UN1A 5KNDD 1U0GA 1FUKA 1KMCA 1TM4E 4AS3A 4CG1A 4XD7D 1VYHA 5DULA 1P0PA 5JRJA 3GAMA 4JEIA 1SCIA 4NOJA 2VTVA 5F9FA 2XRFA 3F5QA 4XRRA 1VHLA 5K2MA 1D7AA 1MDBA 1OH6A 4CKWB 4DTIA 2PJZA 4MKFA 2IXFA 2CW5A 2ZTHA 1U04A 4O25A 1ZK3A 4RDIA 4YI5A 2WD7A 3JPWA 3BWVA 2FVXA 4Q4JA 4UEWA 4YBZA 3O92A 1E1YA 4J76A 1F4PA 5M04A 5EJ6A 4R41A 4F56A 3L8EA 1E3TA 4M46A 2XBMA 3CTPA 3ASUA 3O4RA 4OJQA 1B1AA 3PPXA 5IC6A 1KY3A 4A0RA 3FTEA 621PA 1F6WA 3FOFC 3ZLVA 1G3UA 1XTIA 3TPFA 3G9UA 2IIVA 3JVEA 1GEGA 4NYJR 3NJ8A 4OBXA 1ZU5A 3KSZO 3ZPXA 5HQTA 4RF5A 3LSYA 5LP6A 1QPBA 1F48A 3K0AA 1K63A 2ZBPA 2H4ZA 1MX1A 3GRCA 5GVRA 1Q92A 4JDPA 4RCZA 3U3ZA 4E1VA 4TYNA 1CZRA 1T6BY 3V7UA 3W05A 4A0HA 1GARA 4AX4A 3CW2A 4PCVA 2NO7A 4MQEA 2H1CA 3QUBA 1HA3A 4IMPA 1XDBA 4UUAA 5BSGA 2XDQA 1RZUA 4A26A 3EXFA 1FS6A 2CFRA 3DE3X 4NQZA 3GDGA 4MYTA 5FOVA 1NP3A 2KI5A 1DX6A 2D1SA 3OF5A 3FHJA 4GPEA 1ZVMA 1YGYA 1XZKA 2YV4A 3EGDA 4I6GA 2QN7A 3HJTA 4AJ9A 3H2GA 4ROSA 7REQA 1A5SB 1ZMXA 3HFRA 4JGGA 1WCYA 4G5RA 1ZK2A 4KFSA 2P4HX 2FFRA 2VYVA 3LYLA 4BRSA 5J4YA 3AP3A 3PGMA 4AS1A 4W5JA 2F1RA 4Z51A 4X3CA 2QRUA 3KK0A 3OF3A 4L50A 2F9FA 5I8PA 3LQFA 4D8VA 2JJQA 4PU0A 3RAGA 3AFOA 1I32A 5GAJA 3V1LA 4BC1A 3EA5A 3E82A 4ZWNA 6YASA 1QGUB 1SK9A 3GGGA 2ZT5A 2QGNA 5F4ZA 5TMDA 2CUKA 1UPUA 3QXSA 3RIMA 3IPAA 4CV0A 3S2EA 1SBQA 1P73A 4DCJA 3Q7EA 5TGTA 1DX4A 4I14A 5EZYB 2C5BA 3KV3O 4PLVA 3WADA 5LNK1 2IGTA 4QQNA 1E6CA 1E7MA 2PRIA 2WJ6A 3RSZA 4R71A 3UMGA 3WWZA 1IY9A 4BLWA 1E8MA 2HRRA 1T0IA 4LC1A 3SN6A 2P9FA 3G2NA 4OI2A 3V8QA 2ZBVA 4BNZA 5CD1A 1LJLA 3MMSA 3F8TA 1V4VA 1N77A 3D3WA 3QVXA 5C8YA 4COOA 1UINA 4UM9B 2P4EA 1M72A 4PAMA 2GK6A 1K06A 1V96A 2OKGA 2G0AA 4P3YA 3VOTA 2F4NA 4ZYXA 3ROPA 5CB4A 3CZ4A 3AOEA 2ZCUA 2C2HA 2ZUDA 4QDUA 3SIWA 2AJLI 4ITVA 5I7FA 1CQJA 1QFMA 2QP4A 1J8YF 2AYZA 1TLTA 2MYUA 3ABOB 3LHSA 2Z8ZA 2VDUE 4QRIA 3UAWA 2Z8YM 1SUCA 2XITA 2FUG1 5IJXA 2W4IA 1CQWA 3WGOA 1E3LA 4RS4A 4UAJA 1QZTA 3BUSA 3U9LA 4KBGA 1H5NA 2ASEA 4RA6B 3BG5A 1D2RA 3L0IB 5TGZA 2XX3A 3QU4A 4PZDA 2JPDA 1OLUB 4YJ2B 3X1KA 2VQ6A 1JTFA 5EKSA 1YDMA 3S4YA 2DSNA 3WGJA 3EXIA 1FMTA 3IOYA 4N7JA 3U5ZB 1GSIA 2JFGA 2XQKA 4YRAA 1NUTA 4RWEA 2X8AA 2YJ4A 1K0FA 4RQAA 2BFAA 2YJ3A 4J4TA 3T7RA 4PYNA 2ORYA 4W9NC 4MA0A 4PAGA 3QEAZ 2HCRA 3BK7A 4OQQA 2F3UA 1FFWA 3I09A 3MJDA 3ESDA 5ITWA 4MRRA 1OHHA 2R00A 5BMVB 1JR4A 3IUSA 5BQPA 2CV1A 2W5UA 3VO8A 3NXSA 3GEGA 4M0FA 4KFTA 3RLIA 5L7YA 1JJVA 2WT9A 3D4PA 3UB2A 4Q66C 1DWOA 1YZGA 4DJAA 4E5KA 1F9EA 3ESRA 3EY4A 5K5EA 3ZNPA 3V7FA 3I83A 4MAAA 3MQ4A 5A7GA 3ND5A 3L05A 2BDTA 2GEUA 2O20A 3DNFA 2G76A 4H27A 2FNAA 1DMRA 5M29A 2XYRA 1EXDA 2IEAA 3E7PA 1P5RA 1DEOA 1GPKA 4IXWA 1L7XA 2GN2A 1NKTA 4ALNA 4W8HA 2I5PO 4HGOA 3BGWA 2XLCA 4C2AA 4PLYA 4UBMA 4RLHA 3WWYA 3X2EA 5SY9A 3W90A 2BHTA 5EEHA 3HDYA 4E5YA 4JYCA 2I8CA 3KWJA 4D80A 3Q2IA 2Q3HA 2QRMA 4FEEA 4BFWA 4BGEA 2GX6A 3N2EA 3A05A 3CRVA 1ZMBA 1Q15A 1Q14A 3JRNA 4YJKA 3WP1B 1LBIA 4HAXA 4O4HF 4MDFA 3T6KA 3L0SA 4ZAYA 3OQBA 4IHQA 1YFLA 3NYIA 1N5MA 3HCEA 2VATA 4H1HA 4IGAA 4IJ6A 3MTBA 2BBTA 2FPOA 3KWMA 1XCJA 3PC8A 4PE5B 1BQ3A 4OQPA 5EJFA 1Y80A 3PCXA 2GCPA 3H42B 1B23P 2IOFK 1JJAA 1UC5B 2L42A 2WHXA 2YY6A 3K9BA 5ESRA 2YWJA 1QYRA 1G38A 1PZHA 1YQGA 3V7WA 1QRSA 1EUDB 1FP1D 3BJZA 4EH1A 1P2BA 1U9IC 2ZUBA 4DUGA 4B33A 4NENB 4GI5A 3UK1A 2WA1A 4HQOA 1ZESA 4EG7A 4IDCA 2BBWA 2IXGA 4TWRA 4HZIA 4AK9A 4EK9A 4YUVA 1Z2PX 5E9WA 3IAFA 3FCUB 1QRAA 3CURA 3SX0A 3V2HA 1X80A 4QSMA 1Y8CA 1G4AE 4L0QA 3DBRB 1NQUA 3MCTA 4AY2A 1J39A 3L7JA 5TQ0B 3ODGA 1GUYA 1WXGA 1JG7A 2A1TS 3AR7A 4J8PA 2JFOA 1XQYA 4L1KA 1EAYA 1Z39A 3W5BA 3HKCB 3QEKA 3LF2A 1T36A 2Q07A 2XHEA 3RVNA 1VRCA 1UJ6A 1B8PA 2Q41A 3ROKA 3VZBA 1WD7A 4BNHA 1PEDA 1SKAA 1GTMA 4B3CA 4EQ6A 5LU9A 2Q1WA 4I1PA 1Z7YA 2WG2A 3L02A 4C6HA 4CDRA 5JEEA 2PL5A 1LPAB 3F6YA 1YO6A 4O0MA 3EIOA 5H9VA 1P4RA 3CNEA 3G59A 1LSOA 1VG1A 1DSSG 1YBHA 2HBYA 3HN6A 4O3FA 4Q5IA 4F3KA 4H1WA 8ATCA 5JO0A 1I7LA 1XA3A 3KZOA 1GTVA 4EJ6A 1QB7A 1GSHA 1XHEA 2HA3A 3QJ5A 2OXTA 2PUDA 4C4PA 1H0KA 1GILA 2YN4A 1RQXA 1M8FA 1R88A 2V58A 1FMCA 3QXXA 4J1SA 4L6AA 4D0GA 5AM3A 1OWPA 3B1XA 4PXAA 5IYZB 1BJRE 1D5WA 2QE6A 2YOFA 3KSAC 5JCPA 2BI7A 3PJGA 2AXEA 3NOXA 4NDAA 3VX4A 3JATA 1BFDA 1PWZA 2CLMB 1T9AA 2DWOA 4ABYA 2O2EA 3GA0A 5J43A 2VDLB 2QZ4A 1TW2A 4YP6A 1WPRA 3ZWNA 1L5VA 1XKLA 3EWIA 3P26A 1GFWA 4KREA 3SVLA 2GF9A 1K5PA 3L07A 4CEJA 2O14A 4URWR 1QVWA 1GZHB 2CHVA 4ZI7B 3B1WA 3H9GA 4YECA 2IJGX 1FS4A 4D9MA 1WABA 1LBTA 3JVVA 2W70A 5LB2A 1OWMA 1PCXA 3W9YA 1IHUA 4X62B 2C7QA 2GZSA 4YO8A 5JPCA 1EP1B 1E77A 1GIAA 5EUCA 1SC6A 3IPYA 1GJRA 1V4NA 4XX1A 1W581 1SIUA 2ECFA 3IAS6 4IIYA 4EELA 5IBRA 1W4CA 5I48A 4PO9A 4LJRA 2Z1NA 3FH0A 2G7MC 4C2TA 4E2YA 4HQLA 4TM8A 3F4LA 2WKRA 3B8HA 4Q3DA 4B2YA 4PZPA 1QO0D 2G71A 1ZAYA 2VDJA 3PCRB 1Z6AA 2K2QB 1JKJB 2MOKA 1ZX1A 2Y68A 1XZAA 4KB5A 3WGMA 4BX0A 2OCBA 3AIIA 1AHNA 1MEJA 5KIAA 2B21A 2EZ8A 5AK4A 1GV1A 1TUBB 2FDXA 3CLSD 3H9CA 3BGIA 5I9TA 3TLMA 2BHLA 3QIAA 4IWNA 3I3OA 3DBLA 3L0OA 3D4LA 3HJAA 2VTBB 4IEFB 5BSHA 2VHEA 2PANA 1JSZA 1K6JA 2FZ4A 5H4HA 2ZXFA 1QQTA 3U4DA 4DE5A 2AB0A 3BIJA 3QVUA 2XUZA 5EPOA 1N5DA 5HKAA 2F1JA 1FC0A 4OATA 5LDGA 3DPIA 3QRWA 1B73A 1EGVB 2FR8A 2R65A 2VS1A 3UT0A 1YQDA 4R1NA 1EXWA 3NC4A 4FDAA 1QYIA 2DKFA 3O8RA 1ISMA 2GVDC 2DUWA 4ZVRA 1RPZA 2QN9A 3D8HA 3OZIA 2QLFA 4XLTA 3UMYA 1I80A 1UOOA 1YAHA 1GRNA