3FWKA

Crystal structure of candida glabrata fmn adenylyltransferase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
308
structure length
291
Chain Sequence
GAMVMRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FMN Adenylyltransferase
publication title Structure and mechanism of a eukaryotic FMN adenylyltransferase.
pubmed doi rcsb
source organism Candida glabrata
total genus 94
structure length 291
sequence length 308
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fwkA00
4R0NA 4I6JA 3FH0A 5TS2A 1WXFA 1T6ZA 3M5WA 4CQNA 1KP2A 2QTRA 3HV0A 4TS1A 2DXIA 2JANA 4JXXA 1F4LA 1JGTA 3P0HA 3JXEA 2QUIA 4AS1A 2O5RA 4OUDA 5H16A 1JHDA 3KT8A 1J1ZA 3X1MA 3IVGA 1OWPA 3COVA 2E0IA 1Q15A 2X1LA 3CVUA 2WQ7A 4GU5A 2A88A 5HUJA 2XRZA 4EG7A 1U7XA 2DLCX 1GAXA 5J59A 4JYZA 1QQTA 4NATA 4MW5A 4P2BA 2PZBA 3NV7A 1Q11A 2O8VA 1EFPB 3MMXA 2A1UA 4JFAA 1EFVA 3ZXSA 5BNZA 4U7JA 5FO0A 5JBNA 1Q19A 1OWMA 2ZUEA 1WJGA 4CDMA 1WXGA 3TS1A 1N2GA 2CFOA 2A1TR 2ZP1A 3COZA 4UZFA 3GMIA 1NUSA 4ND6A 1QRTA 3CLSC 1GZUA 1MB2A 3IVCA 2IP1A 3IOBA 4WSOA 4ZT6A 2HGZA 1H3NA 1VLHA 2A84A 2Z09A 1TYAE 3GUZA 3ILVA 4NX2A 2VTBB 3G5AA 3MLBA 1KR2A 4K0RA 1XNHA 3FOCA 3LOQA 4PY2A 1YUNA 4HJRA 1N3LA 2GKSA 2J09A 1O6BA 3HGMA 1PFUA 3F3MA 4EGAA 3CLSD 1G8GA 4EG5A 1G8FA 4MWDA 4G5FA 3CLUC 1PG2A 5KWVA 4DDHA 1N78A 2V0CA 1NUTA 4RUKA 5HUHA 3HMQA 2A1TS 3C8ZA 1H3FA 2NSYA 3QTBA 4DNXA 4QBTA 1MOPA 2QUHA 3UK2A 1TYBE 2NZ2A 1I6MA 2BYTA 1I6KA 3PXUA 1JZQA 5LM3A 2CYBA 5FO1A 1JECA 4MW4A 5DEOA 1XJQA 3FY4A 2QUKA 3MLAA 4YP5A 2PZAA 4HJXA 5J58A 3CVWA 3SP1A 1WZ2A 4MUHA 4X0EA 1KH3A 2HMAA 4U8HA 4BWVA 2BTEA 1O95C 3VGJA 5TGTA 5LLTA 2EL7A 3IOEA 3K9WA 3Q10A 4MULA 2AKEA 4JZYA 3CLUD 3N8HA 2XRYA 5HG0A 3P0IA 4MWBA 1O0CA 5K0SA 4EG1A 4Q93A 2WB2A 1TEZA 1IQ0A 3TZLA 2PG3A 2DUMA 1WXHA 1WKBA 1R6TA 3IH5A 1P7PA 1V8FA 3LE8A 1O95D 1BS2A 3TQIA 1D2RA 1TYCA 3KT3A 1OWLA 2A86A 1ZJWA 2ZUFA 4YP6A 1IVSA 1GN8A 3H9BA 3KT0A 1QRSA 3HL4A 3FNRA 2C5SA 1WY5A 1M83A 1J70A 1M8JA 2D13A 4R2MA 4EG4A 1N2IA 1DNPA 3K32A 2IJGX 3RHSA 1MJHA 3FETA 4ZT3A 1K4KA 1NSYA 3ZGZA 1U0BB 4EG3A 1WQ3A 1EJ2A 1UFVA 4JXZA 3UY4A 1EUYA 2D54A 1JIKA 3PNVA 4AQ7A 1WXEA 1QNFA 1I2DA 3OP1A 1NUUA 5DK4A 2PIDA 1OWNA 1J1UA 1KAQA 3E27A 3KT6A 1YULA 1LI5A 4HPWA 3RJZA 5IHXA 1ZUNA 3Q12A 1OBHA 2WSIA 3PNBA 4G6ZA 1KAMA 3ND7A 2X3FA 3LCJA 1SURA 1HYBA 3AG6A 3N05A 3NBKA 1GLNA 1XNJA 3VU8A 4MUKA 1VBMA 3INNA 3H05A 2OV4A 5TEVA 1EE1A 2QJFA 4CT0A 4MW1A 1JILA 2JA2A 1R6XA 1S4MA 1YUMA 1GTSA 4ZCTA 1IQUA 2YWCA 5AHWA 5K0TA 2QUJA 5TEWA 2WQ6A 4MVCA 4XSVA 3IDFA 2OQ2A 1U7DA 2J5BA 4KPUA 2AZXA 2A7XA 3OTWA 1MAWA 3TQOA 1KKUA 1N2EA 4G5YA 1M1ZA 4MQ6A 1FYDA 4ZCPA 2GM3A 1NI5A 3L92A 1PFVA 1N2BA 1X6VA 1OD6A 3X1JA 2PZ8A 1U3DA 1KP3A 1IQRA 4R2LA 1O0BA 4OJMX 4L2IB 2D5BA 3FI0A 3IVXA 3L93A 4I6EA 1B6TA 1O96B 1MBZA 4UZEA 1F9AA 1M8PA 2H29A 3D6UA 1ZH6A 4CDNA 3IUEA 4J75A 1YIDA 3DV2A 1G8HA 4EFKA 4MW6A 1KQNA 4GRIA 3CVYA 1K4MA 1MRZA 5KCMA 4EF6A 2G36A 3NBAA 1K97A 1JEEA 3A2KA 1JIIA 4OUDB 4WNYA 2JAXA 4HK4A 3P52A 1NUPA 1Q77A 2IELA 3RFFA 5LFAA 4YMIA 1KORA 2RE8A 2QJTA 3AIIA 3PNYA 3UMVA 5KHAA 1EFPA 1YIAA 3CLTC 1VL2A 4MUFA 4DDKA 1MAUA 1J20A 1MC1A 1XNGA 1LI7A 2TS1A 4ARCA 4F4HA 1M8FA 3FWKA 3U1VA 1O94C 1R6UA 1N2HA 2X1MA 4PBRA 4ARIA 3RBAA 3AL0C 1JIJA 4NZPA 1EUQA 2A1UB 4DJAA 1EFVB 1KH2A 3FDXA 3Q4GA 4KR7A 4MUJA 3CVXA 4MUEA 4FZJA 1O97C 4YP7A 4EG6A 3AFHA 3VRHA 1T9GR 4J76A 4YBRA 2VTBA 3CLTD 1QJCA 3X1KA 1TFUA 2B7LA 2E21A 3ZXIA 1ULHA 1IHOA 2Z3VA 1TQ8A 1EXDA 3ZJTA 3A04A 3ISJA 1O94D 1JZSA 3SZGA 4MVYA 2DR2A 2CV0A 1M8GA 4H3SA 3ZJVA 1GTRA 2Z08A 4DLPA 1VBKA 4KR9A 4QRDA 2AG6A 4RPIA 1QRUA 2CSXA 3GLVA 3CA8A 2HZ7A 4S1OA 4XFJA 2GOYA 1T6XA 4MLPA 3I05A 1PFWA 4ZT2A 1O97D 1F7UA 4DE5A 2I1LA 3ND5A 3IODA 4ZCSA 1NYLA 3MXTA 2CT8A 1H1TA 1GPMA 2J07A 2J08A 1WXIA 1J21A 1KQOA 2QTMA 3H97A 1PFYA 3QTTA 4MW7A 3G6KA 1N77A 4U63A 3DPIA 3H9CA 1IH8A 1NUQA 1T9GS 3ND6A 3P0JA 3N9IA 4E1AA 3SDBA 3SYTA 1NURA 2A4MA 3FIUA 4ZT4A 1QTQA 1NP7A 4ND7A 4PBSA 2R5WA 4MUNA 2X0KA 3SZ3A 5EKDA 1N1DA 3PRHA 1PG0A 2V0GA 3CVVA 3TNJA 3DLAA 5DB4A 1JMVA 3HZRA 5DASA 3QE4A 2DEUA 1V47A 1U3CA 1OWOA 1QU3A 5FNZA 1I6LA 2H2AA 1KQPA 1T6YA 3A05A 3MUEA 1CT9A 3COYA 1G59A 3SEZA 2DERA 1RQGA 4ZT7A 4A91A 3ZUGA 2QTNA 3AG5A 2CYAA 3CR8A 4PBTA 3ZJUA 4ZT5A 1N2JA 3IMEA 3H99A 1Y42X 3RK1A 1NZJA 2E89A 4ZCQA 1MB9A 5H7XA 4DDMA 4Q16A 3IMGA 1M8KA 3KFLA 1F7VA 3S3TA 4MUGA 1LW7A 1N75A 4EG8A 1O5TA 3FHJA 3G59A 4KKVA 3UOWA 3DO8A 2QJOA 2CV1A 2J4DA 1OBCA 1WQ4A 5F23A 1YI8A 3RK0A 1A8HA 4MWCA 1FFYA 3COWA 2CUZA 3D6VA 4ZCRA 2RD2A 4MVXA 3CLRC 1QU2A 1ZH0A 3IMCA 4MWEA 1KH1A 1IRXA 4NDAA 4I6GA 4MW9A 2PXHA 1J09A 1COZA 4MVWA 2DETA 3SEQA 4MW0A 3A4IA 1K92A 3TZEA 4XFDA 1VBNA 3IUBA 3ZIUA 4MW2A 2PFSA 4KR6A 4NAHA 4MAFA 2CV2A 3ELBA 4F3RA 3CLRD 1ILEA 4NAUA 3HFJA 4K03A 3AKZA 1TYDE 5J5AA 2YWBA 2YXNA 1IFXA 4MUIA 1JEDA 4QREA 2YY5A 2CYCA 3FG9A 2EJCA 1H3EA 3UC5A 2E18A 1N2OA 1X8XA 5IJXA 3N2YA 3BL5A 4L2IA 4KPUB 2DPLA 3IOCA 2VXOA 1O96A 1WOYA
chains in the Genus database with same CATH superfamily
3D5EA 4I6JA 4Y9SA 2RH5A 3F7TA 3EC1A 4AMZA 2XB2A 1JI3A 2EW2A 1JMYA 1LQUA 4H1TA 4FB4A 2UXDB 4CQNA 1JIUA 5KTNA 2SHKA 2ZYDA 4TS1A 1ZN2A 3PHJA 3W2TA 5EJ2A 2RFLA 3OESA 3TLCA 2XDAA 3EA4A 5IYZA 1MX3A 1KI4A 2XGOA 3BGWA 3TAUA 3KPJA 4GQIA 2AFHB 3FYCA 1GSHA 1H2AS 4QPNA 3S2UA 3QP9A 3ROFA 2LCFA 3H8WA 3C1UA 4P3KA 5AK4A 2IYRA 2G9NA 3S8YA 2ICAA 3S29A 5FKJA 1LKZA 4J0JA 2O2SA 3QLTA 5BN4B 1FYVA 4JXKA 4WLUA 3CE9A 3ASZA 3QLVC 4KSCA 2A88A 3KOZA 1HE8B 3RU3A 4HH3C 3A9SA 1PZFA 4Y9UA 4G1VA 3V1MA 1YOBA 3WHKA 1JHUA 1UDCA 1YE3A 4OGFA 5HFNA 5J59A 4YR7A 2R1TB 2YV3A 4MS3A 2QP3A 2VR1A 3B6EA 3IIEA 4I4TF 2VUUA 2PH1A 4K9MA 4Q3OA 2NP7A 4J0GA 1U3UA 3JATB 2D3WA 3M6FA 4A0RA 3LP8A 4U7JA 3SNKA 4B33A 1QJ4A 3R0IA 4JU8A 3PDWA 4TMVA 3TW0A 4I4TB 3HB9A 1QP8A 1Z6XA 4RABA 3T61A 4CDMA 4WZBE 2YWJA 1NNEA 3T1YB 1CK4A 1SFRA 2GMWA 2OFOA 1IEVA 3FCAA 4R1TA 1DT3A 2JGMA 3LNCA 1VJDA 3I64A 1KBOA 2O2GA 1T5OA 3ZJYA 2D7JA 3IUQA 3EBPA 3E22B 3MTBA 5IAAA 1C0EA 1QQAA 1GITA 4WSOA 3CNQS 4MQBA 5EQTA 4D0RA 1QMPA 2FQQA 4QPJC 3PQ4A 3AETA 2TMDA 3RS0A 2IYUA 4RSMA 2Q8NA 3GDWA 2ZYSA 3JWHA 4OKSA 2EJTA 1V5FA 2ZJ8A 3U37A 2ZCJA 1U81A 3A6DA 3QF4B 2JATA 4M99A 3LF1A 3WYNA 1E6KA 4RX1A 1HNXB 1P80A 4XB1A 3MBOA 1UZAA 4WKPA 2BT4A 1E3EA 1XCPA 2OT3B 4HWOA 5F1PA 4OA8A 3GLFE 4BP1A 3HGMA 3NH6A 3PCTA 1V6AA 5C4IA 4BE7B 2E6UX 1P7CA 2GZMA 3OHPA 1R5OA 3DF9A 2WD7B 2CL7X 3H6GA 3EZ9A 4CIAA 2IY8A 2VK1A 3RUEA 1G7TA 4B84A 5JFGA 1YJCA 4RELA 1H42A 3QVGA 2G25A 5AVZA 3I6QA 4H7PA 3ZVRA 1LVUA 5TF4A 1HYQA 2V4ZA 5FJIA 4O4JF 3IO3A 3CONA 3QX8A 4WEQA 4KK3A 1U5BA 3PTLA 1JXQA 1RLIA 3FY4A 1F6BA 3A4LA 5EPEA 4MQEB 2WWRA 4O4JB 3K8OE 3D2BA 4HJXA 2ODBA 1Z8NA 2J9GA 2RHDA 3FPFA 5FWDA 4HNRA 2NO6A 4EHKA 5F2EA 4JDPA 5BSEA 4EKNB 3QQPA 2BTEA 2G1UA 5HE8A 2FZVA 3OPYI 1JFVA 1EGQA 2ERYA 4H3KB 4LYGA 4PGFA 1RCFA 1CQIA 3HL0A 3GRUA 4YJFB 3W5UA 3ZKAA 5HRUA 2EBFX 4XB2A 2IEAA 5B4TA 2YASA 3W3AH 2VYQA 1LLUA 4RQUA 4K9KA 4CKCA 2GAFA 1NQXA 1T8SA 1YR1A 1WV0A 4G1FA 1ATIA 1YU9A 2AJTA 3DDSA 1IU9A 2CNDA 4B73A 3FMIA 3U3MA 2LBPA 3X1WA 3SXUB 2PPVA 1ORHA 4PYJA 4R0MA 1T24A 1B26A 1NPYA 1ZMRA 1HOXA 2ZTSA 1QIKA 5A9TA 3NVMB 4GOLD 3Q5DA 2BOVA 2NPOA 1S96A 2J7KA 2VSYA 1GILA 5C8DA 1RABA 3KQKA 1D2HA 4Z9AA 4M4SA 1BOOA 2GNAA 2BFCA 1K8QA 1SRRA 3ER9A 4AKHA 4MAAA 1COWD 1GZ3A 3ESXA 2ZJ5A 3SFZA 3P96A 4OQPA 3TTTA 1OPXA 1Z2NX 2XSZD 3RCBA 5I4CA 1QFSA 2RGWA 3ID6C 4WXPA 1Y8RB 2IU0A 4ZVOA 3AEYA 5DT2A 5EXDA 2W6CX 3VKWA 5F7XA 2ZAGA 2ZUUA 3B51X 1ZJWA 5E6SB 3BS4A 4NFHA 1QGUB 3A9CA 4P1ZA 3NOVA 1N6HA 2C4TA 3LDUA 1OY1A 2WPNA 3UWOA 2C5SA 2EZUA 2QGZA 4CM7A 3QEMB 1I3OA 4AC9A 3R3WA 2OHXA 3H5IA 1XMPA 3AVWA 3IAAA 1KYQA 3UAWA 2W6ZA 3F47A 4R2MA 3ZNOA 1ODCA 5F7OA 5B6PA 7ABPA 2IJGX 2WPDD 1U6JA 2A0WA 2RBGA 2ZR8A 1DPGA 3BF7A 3EY4A 1A1SA 1KPGA 1LBEA 3HDYA 3NOOA 3CGGA 1J56A 1N2XA 3E23A 4IMIB 5F1KA 5K3SA 4M8NE 1NVTA 1I9CA 4I1OA 5D3QA 4YCAA 1ICEA 5JXWA 4Z53A 1VPLA 3O2NA 1N57A 1PJRA 3OQVA 3OZAA 1E2DA 1YBFA 5HF5A 2O1XA 3BM5A 3GJ5A 4F56A 2PX5A 1NYTA 3RANA 3VKHA 4GL4A 2VUTA 5HP4A 1D3AA 1GVHA 4UHBA 5ALXA 1F8XA 3V6LA 1W36C 5AHXA 1FS6A 2WU3A 1Y5NA 5P8WA 3T7EA 5CK4A 3JARA 1CQJB 4CF5A 3E27A 2IODA 4GFDA 2AOUB 3EDCA 4KHZA 2ZWVA 3WMEA 4CWAA 3H5NA 3HUFA 1VYTA 4F06A 1YFLA 2WOJA 2H85A 2XGSA 3IX7A 1EJ0A 5JDCC 4I5EA 4BO1A 3CX4A 1C30A 1XQWA 1IM2A 5EXEA 2I55A 3BTUA 4IKEA 5JPCA 3A1SA 1BEZA 5DM0A 1V39A 2REQB 1H1LA 1XCMA 2ORED 4X60A 3UKJA 1DKQA 9ABPA 4P86A 3HBJA 4YRIA 2P5UA 1R27A 3ZPXA 1JILA 3HJCA 1SKQA 2ZTUA 4KU4A 4Y2SA 4G2NA 4TRNA 5AH0A 1C1XA 3VKVA 2O0LA 4FD2A 1FFXB 2FEXA 1PZGA 2FWAA 3BN3A 3AUYA 3L41A 4RW0A 3SAJA 3SJCA 3ZZUA 1YVRA 3IR6A 4PZCA 1VI5A 2AW5A 1GNSA 2VQSA 1IHPA 1JFSA 1JSRA 5EEGA 4BJ6A 3DBHA 1E18A 1T2UA 2FK8A 3CQ9A 3DZDA 1H1DA 4EKDA 5C8XA 4FGZA 4QYXA 4Y1RB 2J5BA 2ATCA 1YCFA 2ZJ1A 3E1GA 3MQ4A 3OTWA 3PRKE 3W8NA 4YCCA 5CEFA 1X7WB 1NDHA 3NGLA 2OD9A 3JQ8B 4P93A 1NQAO 2I7CA 3VI4B 4OMFG 3BWMA 1E0AA 1ZZGA 5BYKA 5C7YA 1OXMA 2XNHA 3NJ4A 4PGHA 1EG7A 3DOFA 4R3WA 5BSRA 1PT7A 1VP9A 2C92A 3C7TA 3A6GA 1T5IA 2PZ8A 3EVNA 3I37X 1UM9B 1YR3A 1Z4JA 3KTAA 5ETJA 4X44A 1E3QA 3R7AA 3T1HB 3H2YA 4CLOB 3THYA 3UGQA 2X9LA 4B8YA 1PNRA 3ZYZA 4KAJA 3U3OA 3KAPA 1GUDA 3D43A 5B3JA 4HYTA 3D6UA 4MR7A 5K8CA 4OV6B 4QGBA 3M5DA 2Q5OA 4UXJA 3RABA 4L5IA 1MDFA 4C3ZA 3PDHA 4CKYA 2BE7A 4EHHA 4PX9A 4FNGA 3LC2O 4LJ4A 3N1UA 4O4HF 3TTXA 3ZNPA 1LDMA 2B82A 2HY7A 5DU2A 3D3NA 2LDXA 2P9JA 4C4SA 1BVRA 4R98A 3SK0A 3T34A 4MQ5A 3D7NA 4O4HB 5A6SA 4MB2A 3LQ2A 2IELA 2Q3HA 2ZS7A 3ZK7A 4DIEA 2FN7A 5EKTA 2RE8A 1OI2A 3HEMA 1K7XB 3CNBA 5KHAA 1EFPA 2ZDHA 1TKBA 4J91A 1UQRA 1ENPA 2XWBF 3P7MA 2VNAA 2AOXA 3IV9A 3TTYA 3UWDA 4PC2A 2XUAA 3ILXA 2G80A 5FWYB 5TPWB 2NO1A 3V4SA 4G0NA 3X2SA 1YCHA 4B2IA 1PLKA 2PZEA 1SXJE 5JCPA 4I55A 1M2OA 3F9IA 5FOTA 3K09C 4D9FA 4Q12A 5D6OA 1IAQA 2GS9A 3WMRA 2HL6A 4LDQA 3RYFA 3DE3X 4D6XA 4NZPA 4QJ3A 3R09A 4GXRA 2PMBA 4C01A 1IOWA 1WIWA 2WKWA 3M1AA 3KSDO 3CSUA 5C3UA 3OTOB 1UBUS 1YE5A 4H0FA 1YD7A 2ZJ3A 4A16A 1KJWA 3F4BA 3OWOA 1C9DB 5EZYA 1PJLA 2F7SA 3NW9A 3DF7A 3TEJA 2OP1A 1ODFA 3VRHA 4ACBA 1FL9A 2O14A 4MR8B 3BSFA 2D3TA 4OI0A 1ZK3A 2WLTA 2Z3VA 4QATA 2EFGA 4LZPA 4JAVC 3GN1A 4YFVA 1FLDA 3MJRA 2JFGA 3CZ5A 2VQEB 4HDCA 3GJQA 3TGLA 1YB1A 5B2FA 1MAVA 1M1YA 1XVLA 1Q21A 4Z7NB 2HV9A 1ZITA 4GMFA 2P1ZA 1MFPA 3JRXA 3PYLA 2IZ5A 1X1AA 4MKGA 1X1DA 3AHIA 4HUTA 1SUSA 1Q74A 2YN0A 5LP1A 2EDAA 1J5XA 4W7SA 1FNNA 2WU1A 2VRBA 4OD0A 2QI9F 3I76A 4I5IA 5IT5A 1H6DA 4FDMA 4P7KA 5DYGA 3C5HA 1VKRA 3GLRA 4RO0A 3DEFA 3GPLA 3E9ZA 4G5HA 4AMUA 2TMGA 6ADHA 4JROA 3RRFA 3O31A 3T5GA 3WHPA 2ILTA 3TVYA 3LGXA 2EKLA 1QHYA 4HYQA 3STVA 3PC7A 3N7UA 4AJOA 1NN3A 3PLRA 3CEAA 3RV3A 5TLSA 3BA6A 1FDSA 2OO5C 2MU1A 1QVWA 2Z3ZA 2HWUA 3JYPA 2QL9A 2UYOA 1P0CA 2VH5R 3MFYA 5FT9A 3PEWA 1L8LA 4LXYA 3KKNA 4A03A 2E4WA 3R5SA 1IBMB 4E1AA 1AT1A 2VHQA 3A10A 4RSGA 1ISPA 3ZE0B 4Z0NA 4NS1A 5KNDD 1Y8QB 3AEUB 1XPUA 2XJ9A 1E9AA 1JLKA 4NH0A 4BASA 1X92A 4QE3A 4IIGA 1U8AA 2VAMA 4AXXA 2R7NA 1NMEA 2DKNA 3QBDA 4ZEMA 1TTTA 3FTDA 1TB4A 4FYMA 5M04A 1PBNA 3BE5A 4I66A 1YQDA 3RSCA 2DEUA 2GFHA 4PN7A 1QBKC 2Q0XA 3FGOA 5JAIA 2OC9A 1DO8A 2EJUA 3DOCA 5F5XA 1RI3A 4YJKA 3PFNA 5DI3A 2R6AA 3IUYA 4Q1AA 1SUDA 1Y37A 3LK7A 3COYA 4IX9A 1E4VA 5CPBA 2O8BB 2Z95A 1ZEMA 2J6HA 2QTNA 4KK4A 3CH4B 4D5GA 5KAMA 2YYSA 4I4LA 1C4XA 2VJMA 3GFGA 1ZK4A 4L75A 2MWMA 4AZSA 5JYCA 3BK2A 4FR0A 5FORA 3ZCVA 1POXA 3DMHA 3RYTC 2E89A 3KQUA 4GLJA 4N4AA 5DM2A 5H7XA 1EDZA 1CY7A 2XTJA 3VZRA 2OB2A 5IKPA 3GAMA 2AW3A 2AF4C 2WT9A 3IT0A 3QPBA 4MARA 4Y2TA 3RVPA 3T8YA 4EUNA 2GCNA 1LD3A 2HLPA 3D81A 4MV0A 1V1MA 2P8JA 3EUFA 1YBAA 1SCAA 3KR1A 4BNNA 3OLWA 2H1SA 5KNBD 5EXSA 4DR6B 3UB4A 3Q9UA 4GVLA 3ZHXA 1YRQA 4DXAA 1KGDA 2C4UA 3CEHA 1P0IA 1DEKA 1OBCA 2J4DA 1FQJA 4W8GA 1QZTA 3TTWA 3A36A 3QJGA 1EBFA 5DYNA 3E9EA 3FWYA 3RSGA 3VNBA 1OJ7A 2Z5GA 3V8MA 4K9NA 4RAOA 5AM2A 4HNTA 3DMNA 1S6YA 5ICSA 3GIWA 2IYFA 2Q2VA 1A7KA 3RTGA 4XUCA 1L4NA 1SXPA 1H2HA 1QU2A 5HDQA 4QWMA 1D0IA 3IELA 3G8YA 4GZ3A 3PDIA 5EHQA 2FCRA 3ABZA 2LUOA 5E4FA 5JJLA 2WZCA 1JJVA 2M1XA 1LTQA 1MQ9A 2VXBA 4MW9A 3VUEA 1MGPA 1Z08A 3WL7A 3GBSA 2C03A 1JTEA 4GP7A 621PA 3L6OO 1CTQA 1XXHE 2WTMA 3PTZA 4MVWA 1ZI8A 3WB9A 1NUHA 3NDRA 3DL2A 2OBLA 4XIJA 1D2NA 1S0UA 4EA6A 2ECQA 2RGNA 2E1RA 5EGNA 3GBPA 4L72A 3R77A 3HVJA 4JOQA 1BMTA 2BGRA 4DWWA 4CNBA 4HH0A 4DEYA 4Q21A 3ZIUA 3CKMA 5BN3A 3U4AA 4L4XA 2BMDA 5F73A 2VJAA 1W1UA 3ZCRA 3D4IA 3O8BA 2C5FA 1NATA 3ELBA 4XM0A 4F3RA 5FADA 4D0GA 3II6X 4M8LA 3HGTA 1P4JA 4KO8A 1DTSA 4ZARA 5IEJA 1GADO 3IEMA 1Q3KA 2UUPA 1TF2A 2IPNA 4KQFA 5LQNA 1N4DA 2LDBA 1PJZA 1U9ZA 3RSLA 4BZZA 4HDQB 2R7AA 4EYEA 2E87A 3FG9A 4ZGBA 3MD0A 4LF8B 2D4AA 3R9XB 4C9BA 5A0VA 3VKUA 4NENA 1XU9A 5KOHB 3RRZA 1QHHA 1F2UA 1V3QE 4YP1A 2O3UA 5AXCA 4EMSA 3UMSA 4BNMA 1YV9A 2WJ4A 3AWDA 5AJVB 3WLIA 5CA1A 2YS7A 4KW7A 1KZ6A 1SIUA 2GX6A 3MWYW 5IK2A 3DCNA 2GBIA 1KSFX 3ZVLA 5BVHA 3K9QO 5HIAA 4D26A 3W2GA 1BJRE 2RG1A 4HVTA 4RMNA 3KUXA 2JDIA 2PJUA 2GNOA 2ZUWA 4GXTA 5KVSA 1UBNA 2JANA 4MIOA 4ZQBA 1EDOA 1O6FA 3QV1A 1V4NA 1YASA 3MCUA 2UYHA 2UXBB 5BQ3A 3AM4A 1ISJA 1XA3A 2J7PA 2WJYA 3IVAA 1JQAA 2JJ1A 4J4HA 2XNDD 4P54A 4PG5A 5EOVA 4MZDA 2ZI7A 2HRBA 5JEDA 1XRJA 2CN1A 3PGMA 4A6PA 4BO6A 3MUNA 1S3SA 1TCBA 1SVIA 3HCBA 1TE2A 1X70A 1RAEA 2LVBA 1M0SA 3AF3A 3KHUA 4WZBB 3N0WA 1YCDA 2QN1A 3M81A 5CH8A 3ZU6A 4I1PA 4NYIR 4U5XA 2NVUA 4GPD1 1CRLA 1M2GA 1ONNA 3VJLA 4E51A 5BV2P 4G84A 4FR5A 3R7LA 2XRZA 4LF6B 4KZPA 1Z82A 1PD0A 4Z3DA 3G49A 1EQUA 2C4WA 1CUIA 1DI0A 3UXMA 2O8FA 1ZK1A 1ZK2A 3DO6A 3FROA 4M83A 3RQIA 4EELA 2KJQA 3DMTC 1L1QA 3NKLA 5EJ5A 3AR8A 4M49A 2RJOA 2WUGA 2DJ5A 4ACAA 5FO0A 2GAOA 1JA0A 4L4ZA 3NHWA 4MROA 3ZS8A 3ZW7A 1SVWA 2G9ZA 3GFPA 1W2HA 3BOSA 1F2TB 3PJDA 1R9JA 3D4NA 4HGYA 4NJEA 1QFJA 4OU5A 4TTIA 1YJXA 3D1JA 1U8UA 3GPBA 4IAOA 2JHCA 4W8HA 3EC7A 4JQOA 4ZQHA 2FP4B 3IVCA 1U9JA 3QBVA 3L6DA 3KOOA 3ZDZB 1NV8A 1R8JA 4NI5A 1G5FA 4YRNA 2FRDA 3VFDA 3RU7A 1U9CA 2V8OA 3T5MA 2QD1A 4B48A 3AB7A 4UXIA 1KYYA 1UPXA 1FTGA 1XNHA 1X7ZB 2G9RA 4HJRA 1E7RA 1OOEA 2JGEA 3EXIA 3FVTA 3QE3A 4ESEA 1B0AA 3DD5A 3E61A 1M34B 1SEVA 2JKVA 3L9WA 2YRWA 3WV5A 2P4QA 5EZ5A 2QIPA 2XNSA 1CYDA 5FH9A 4WGGA 3DWEX 1KIMA 3JQCA 1GTG1 3WGTA 2B8EA 3ADBA 5FOSA 4RCZA 2W8BB 2QP9X 4US2R 5CGZA 5ALMA 3WGHA 4ABYA 3PPWA 3DHVA 4O1MA 5FBZA 2ZR7A 1ZAYA 4G5QA 2QL6A 1C7QA 2RCYA 2EHDA 3ILSA 3C8ZA 4EITA 4G0WA 3K2QA 3EMVA 1X80B 4NV1A 1C3OB 4PC7A 3B48A 3NIDB 5E1BA 2IUSA 2ZE5A 4MCIA 4OJTA 4HAIA 1E2IA 3DJFA 1JRLA 5ALPA 5FQNA 5I4IA 1DTWA 2P9ZA 1SCNE 1XO1A 2CLMB 2CLKB 3Q2KA 4YAFA 1WDMA 1Q1AA 5T6BA 3GUHA 4LZAA 3R9KA 5CLGA 3UJPA 4OLHA 4PSCA 4QO8A 4H1WA 3QEAZ 1UKVY 2NTJA 3EJWA 2QYOA 4AX4A 3T7AA 3MBKA 2YJ5A 2H07A 3QX7A 2C82A 3UFXB 1M2HA 1EFRA 1VIAA 2ZBRA 1XPOA 2QBYB 3CLHA 4KWTA 4CM5A 4FFPA 3TM4A 3KLOA 4MYCA 4DQDA 2CE7A 2JB9A 2I67A 4M0UA 1PJ2A 4L9RA 2PKWA 3WO1A 1F5NA 1P81A 3ZI4A 1T3GA 2JEOA 3WLEA 1E5DA 1WB5A 4BFZA 2IF0A 4Q3DA 3IAUA 1LTKA 4I4CA 3QVSA 4XGRA 2WJAA 3P8ZA 3A27A 1Y3CE 4MMXB 2BTQB 4JOBA 1KI8A 3SJZA 4AURA 3GLQA 3LRPA 4GLOA 2AG8A 3OO1A 3BJZA 3AY0A 3U39A 1YDMA 3ZE8A 4UM9B 1JWBB 4RIGA 3NTRA 4WFIA 2EBUA 3CUKA 5HCNA 2QRLA 3CX7A 1IOLA 2GERA 2CVQA 5EE0A 2R0QC 2EP7A 2NZYA 3NBMA 3F97A 2R1ZA 4UM8B 4AJLA 1PWXA 4CHTA 4I50A 1EDBA 1CUDA 2HSWA 1W9HA 3OLQA 4WKBA 1REQA 2J3EA 5AJHA 1KMHA 2Z6VA 1FX0B 1Z4PX 1KEPA 4R1NA 4Y2JA 2QN6A 3OZXA 4QGAA 2MHCA 2XEXA 3FUXA 3O38A 2XY4A 3ZVKA 3V7YA 2R6FA 4R7GA 1N2IA 3SSNA 3RT7A 3HY4A 4RLHA 3T9CA 1TAHA 2F17A 5IAKA 4C30A 1ACJA 3HCFA 4R2KA 10MHA 3DTVD 3V7FA 3QEBZ 2PWZA 3OE5A 5FLYA 1Q84A 5KKNB 4BNFA 4BKQA 1JLSA 4LBYA 2AMJA 1K6MA 1KTIA 3UK1A 4HAZA 5HJEA 5JU6A 1Q16A 2H06A 2R44A 4U3JA 1P2UA 4LZJA 2VWGA 3T95A 1IXZA 1OZAA 4D02A 2JLVA 1QIGA 1W5TA 1Q7EA 2OOKA 1L5WA 1OWNA 2H00A 2V6JA 1Z4LA 3GL9A 4IV5A 3K70C 1LI5A 2RH8A 3PS9A 4KZKA 4I3HA 3I30X 4PG8A 3H5TA 5AIBA 2W6ID 4BEJA 4DILA 3ND7A 1OB5A 4OAQA 4JL5A 3P4YA 1QGOA 4D9EA 4G65A 3KEFA 1NUAA 1XNJA 3TZQA 4CYMA 2B34A 1DBRA 2QE7A 4RIIA 5AW2A 4O1HA 1SVMA 3O8QB 4UASA 3WHLA 1AKVA 1Y4DE 4WNIA 1OH8A 2YUTA 1J8MF 1DKRA 2ZJ0A 3ANMA 2W37A 4ERXA 2GO7A 2IXGA 4WZAA 3KM0A 4C0XA 1PV1A 5HF8A 2GHTA 1ZMTA 1GAQA 3A2NA 1MJFA 2VHZA 4B6QA 3VJRA 2NM0A 3SX0A 1BJTA 1KMCA 5CW2A 3ZXYA 3LUAA 4W8OA 1A9OA 2GD2A 4BB0A 4B71A 5A5FA 1RXSA 2P9QA 4US1R 4XDHA 3QIVA 1ID8A 4MQ6A 2OK8A 3LYAA 3U4DA 4ZMRA 2BC9A 1NC1A 5DCWA 1WXXA 3AK4A 3S5UA 1L6IA 4HT3B 4WDRA 4DN6A 3KPVA 4LJ7A 4UM5A 4X65B 4RTOA 2ID4A 1TM4E 1JLLA 2BUAA 2V7QA 3C6BA 4B5LA 4CODB 4JYBA 2RSLA 2WJHA 2IIBA 2J67A 2Z2YA 3NTLA 4NYMR 1F9AA 1KK3A 4HZGA 4F72A 1T9DA 3GFSA 4JBNA 4YLGA 2CMHA 4QYTA 4CDNA 2QJWA 4DAEA 4TSFD 3HA3A 4TKVA 1Y1QA 2NU8B 4P34A 4B5KA 3H4TA 1MAHA 4J7AA 4IGEA 5I8PA 1BX3A 1DAPA 2P11A 2NZUG 4EB6A 1CNMA 2IV2X 3TSOA 4G0PA 1O5OA 2GZRA 1XQXA 2IEBA 4XQCA 5EIHA 5A0FA 4AJNA 4UDXX 2ONJA 4BBZA 4CIDA 3CH7A 1D0SA 4MJXA 1EK2A 4RVOA 2VJQA 3DP9A 5IBQA 1QHNA 1J0CA 3F5FA 4EEZA 2FPXA 2I87A 3WLJA 5JAHA 3ZGLA 1H8HA 1FNMA 2HU2A 3TLKA 4A82A 4YDHB 3EVEA 3QHPA 3TW8A 4KUHA 2G9VA 2X3UA 1BNCA 2TRSB 2W6QA 2X6TA 1G7RA 4XI9A 3S8MA 3ZYCA 3OI7A 5ITWA 1U28A 16PKA 1U31A 1P1HA 2IITA 1GOTA 4LJ5A 2DHEA 3M6XA 4L0CA 4DIDA 1QGYA 1X3LA 2C88A 4DMUB 3BGSA 3KQNA 2IT1A 3U44B 2FDRA 1ZJJA 1N0WA 1GSAA 2YHAA 2ADFA 3OOEA 2HX1A 5KTPA 5DGCA 4PZZA 1JIJA 5HQ3B 1QK3A 2FY8A 1KH2A 2I66A 3DSRA 2EZ4A 4IIEA 4GX0A 4BUCA 7REQA 5IULC 3I5YA 2QM7A 3QVOA 1RFLA 1U2DC 1E0DA 2EKQA 5GV8A 2AFIE 1GCAA 1UZUA 3H83A 4B4VA 3MRVA 4JDUA 5BRAA 1IBCA 3A6HA 3GCZA 2Q99A 4MLZA 3PR3A 5JZSA 3AFHA 3T06B 4Y2QA 2VTKA 4E5MA 2E4AA 2WF7A 3BCUA 3H2SA 2GAJA 4UFOA 3AF1A 1CY8A 1N8TA 3ND9A 3RUIA 5CYGA 5L3SB 1AUVA 3N2GB 3WLOA 1BA3A 1P2BA 1TQ8A 3FUUA 3K0CA 3VR1A 3K72B 2O8EA 4BN5A 3FI9A 2FMKA 2VF8A 4FZVA 1MRSA 1NU8A 4PZAA 3V55A 3B1ZA 4UVHA 3L0ZA 3UT5B 4RVCA 2XA9A 1U3GA 3V33A 4CMJA 3QKTA 1VIVA 4D4MA 1Y5IA 2QROA 2ISSD 2W22A 3MCWA 3MMNA 4UHCA 4JLDA 4D0SA 2C96A 3E8XA 5G0VA 1NMZA 4FLFA 4W1QA 3VSCA 3K0EA 4K8RB 2XXAA 1C80A 1SKYB 1BYIA 4F3KA 2Y1XA 1PBTA 5IABA 2V6GA 3LHFA 3UICA 3F96A 4DBZA 4R8RA 3H97A 3GT7A 2R00A 3LWNA 3G6KA 2YICA 5FL7D 4X1YA 1OAOC 3TLBA 1GPAA 4GVXA 5KAPA 3ESZA 3R3SA 3UVEA 2MSEB 3Q7EA 4JVNA 3MPOA 2R84A 4MO2A 1DQRA 2IY9A 3ZH2A 5ADHA 3QMVA 2CNLA 3A6PC 4C89A 3RIXA 3O9MA 4JQYA 2LCQA 2XB9A 2Y76A 3PHHA 4DG5A 3MZ0A 1IHXA 3VYRB 3B5IA 4JBGA 1DCFA 2FZKA 3TIVA 4B45A 3BGOS 1OXSC 3GHYA 3WRWA 2BF4A 4L8FA 2XUKA 3U6KA 3VR0A 3KTFA 4HSEA 4MJ7A 4XDGA 3G79A 1V43A 1T26A 4DSNA 1EAMA 3OTGA 1AN9A 1JYEA 1TMKA 2EC5A 4Q5IA 5DTQA 3ZLTA 2RGCA 4H7IA 5FWXA 3ME5A 3MJCA 4J90A 5CB0A 2Q1SA 3UH1A 1RKBA 1F4PA 3UTDA 3SC3A 4ZEWA 1K66A 2VT6A 3G2NA 4FLMA 4MA0A 4MVJA 3EXHC 1CU1A 3TO5A 1KC3A 3DDWA 3AI1A 1KL7A 4BE4A 1G59A 2I8CA 4FI3F 2PKYX 1QS0B 3PPYA 4JL6A 3BAFA 4KO2S 3NASA 2ZTVA 2PRKA 2QAGC 3P71T 4KQXA 3ZUGA 1RPZA 1HNZB 5CB6A 1OLUA 3ORRA 4K2AA 3E9DA 1SN7A 1UKYA 5C7OO 3K1AB 2HRQA 3V8NA 5TR9A 3TLZA 1YNOA 5ARDA 4X66B 5KQLA 4LE2A 2BMJA 2PUBA 1QOZA 2OCYC 4HGNA 3W5DA 2ZZNA 3ABSB 1PUIA 4OLJA 3THWB 4BP9A 4RBNA 4MTCA 1EX9A 1QTRA 4DQLA 5KTYA 2RK4A 3DKIA 4ZC8A 1N5IA 2C4KA 3BCHA 1RQLA 1NAIA 4KIJA 4LJSA 1TZBA 2F55A 4RL4A 2VDRB 3MMZA 3UOWA 2BI8A 5KYGA 3DO8A 1KK2A 3KXLA 1AGNA 4KNVA 4ND5A 1GU0A 5CGQB 1LZKA 4CM8B 3B3JA 4OATA 1DEXA 2PMKA 1HZZA 3UWKA 3QTLA 5AUNB 2WHRA 1URPA 2AOVA 3DGEC 1W46A 2XRFA 3IDZA 2OYRA 4FJ2A 1MOSA 1TLFA 2BFFB 2HC9A 2I0FA 3GN2A 2UYCA 5KX5B 1FRQA 3FOEC 3CUTA 2PIAA 3DQZA 2D0OB 2P0EA 2BP7B 2Z30A 2PXHA 3FJ1A 3MB5A 3OIYA 1P3Y1 4IGFA 3ZDAA 1NF9A 1ESNA 3AYZB 3JQ9C 5KVQA 3R8CA 5B1HA 3Q3GE 1CUHA 2IYSA 4D8TA 4D42A 4YRBA 4C7BA 3AI3A 4RXTA 1K92A 3QSGA 2YFYA 1QC5B 4M1KA 4C0KA 3R2JA 3JSAA 3QSYA 1KFJB 2J87A 3ZCPA 1CRPA 1L5HA 3MXOA 3OT4A 3GZNA 3H5RA 4NAHA 3NM5A 5CIWA 4NCAA 3MMSA 4M1QA 3CURA 4YHBA 3UAYA 2QVZX 3RG2A 2PKCA 4CG3A 1R3UA 3Q0IA 1F06A 3WQHA 2V7VA 5AR1A 3NXSA 2R9VA 3L4BC 3KQYA 4JJKA 2NSJA 4BVEA 5LBIA 5A3VA 2YKGA 4HS4A 1XEAA 3KE9A 1IFXA 3LXUX 2FEKA 2QHXA 3RJMA 3VOTA 2Q9UA 1U9YA 4KIFA 3HV2A 3AINA 4QREA 2ZVDA 5FV7A 4KE6A 1EVJA 3KV1A 1W5AA 1B6RA 2J3KA 1H3EA 4ARBA 4BCDA 1BFUA 1XA0A 1F8FA 3B89A 4E21A 3CUEF 3RVSA 1RYDA 5JRZA 3D0KA 2VPIA 2QUBA 4S04A 2JJ8A 1QK4A 1QG2A 3A3YA 3FE2A 5CTJA 1KU6A 1H69A 3W2IA 5GV7A 2H2FA 4R0NA 5MFZA 1T4BA 1QUEA 2ZU0C 3FH0A 2G9UA 2ZZMA 4Z0PA 5CAEB 2QZZA 3KD3A 3QXJA 3HVHA 3T7SA 1WBJB 4FSDA 2J9FB 1E3DA 4UEJA 1G5PA 3U80A 1CYEA 1XR3A 4JXXA 2GSWA 3HB4X 1LLQA 3HS3A 1ZVVA 4BLQA 5LKRA 1TTHA 3E5RA 3EZ2A 1QKJA 3PKIA 3GFOA 5KYXB 3U7HB 1JF8A 3LO8A 4UMEA 3IVRA 5H16A 4ZTBA 2QNRA 2VG8A 3D4BA 3T38A 4ZI3A 4AP5A 1SUAA 3IVGA 4QYIB 2ZI6A 2IWRA 2WU0A 3COVA 4KDFA 4OP1A 3RS4A 1TGVA 3GEHA 2J4FA 4KJXA 4RESA 3RAJA 3TAHA 3EZNA 3L4KA 3D8RA 4GG1A 4RHCA 1YRAA 3SZUA 3FWNA 3JQAB 3F73A 5KU7A 4WLOA 4GGPA 3SIRA 2ZRGA 3C5VA 4CR6A 5EJ4A 3QFCA 2DLCX 4P80A 4JHLA 1VL0A 3ORHA 1EWKA 5AJYA 3KSUA 4ZVNA 2YXBA 2FX3A 3GUCA 3NTVA 3AF5A 3FHTA 2CLDX 1ABBA 5HM8A 2M6RA 3B70A 4HDSB 3LGSA 4EG3A 3LGAA 1SWVA 2IUTA 3GVPA 4IEFB 4UOZA 5HKKA 4QJ4A 3ZDEA 3GUYA 3DLBA 4BJ3A 5BNZA 1BCRA 1E2LA 1BW9B 1EEXB 3QWHA 2SKCA 4ND1A 3GJ8A 3LDHA 4K9RA 1WVIA 3HB5X 3TS1A 4IMJB 1GAWA 1NWCA 3DDUA 3I9V1 2WTUA 4IIJA 5JADA 3TTSA 4OLBA 2J41A 2P65A 2ZP1A 2WF5A 1BE6A 4EHDA 1E7WA 5JLJA 3KKZA 1V1RB 3LHSA 1U7UA 1T4DA 2I7VA 5AK5A 2O2EA 2Z2KA 2RHLA 1UADA 4EW6A 1IMOA 4EYGA 3C3WA 3TQQA 5I7SA 2ID7A 2OQIA 4EJSC 2CHUA 3RIMA 4RZSA 2GLTA 3DWFA 5JVDF 3EISA 2JLWA 2CFIA 3L04A 3MAGA 4KSYA 4N7MA 4YIKA 3C3PA 3QH4A 2D4HA 4BMYA 1ECBA 1Z5UA 2JGRA 4JOSA 3SNHA 1SUEA 3FTPA 3W04A 1MABA 2HK9A 2WI8A 5JVDB 1W0CA 5FOVA 1GGFA 5JY1A 1E32A 1SHTX 4FJ0A 1UBOS 2Z8XA 2D74A 3GJZA 4A5OA 3RTCA 3DEJA 3FOBA 2CK3A 4IIFA 2GWRA 3AFMA 3HUUA 2YFKA 1Q20A 2XQJA 2BZ0A 2ORWA 3DE4X 4PLCA 1YT5A 4EGAA 1OC2A 4J29A 1YA6A 1Z16A 1CJMA 1HG1A 2AG5A 3G0CA 4IXDA 4BTVA 2W71A 4DDHA 1UZMA 4EY6A 2I62A 3X1XA 5KNCH 1B3BA 4YRAA 4EY4A 3Q2OA 4JI6B 2NU9A 3SLKA 5FAXA 3AF2A 3ZKWB 4YRSA 5JALA 3PXUA 1K0FA 3OCUA 1R8QA 4INZA 1NM5C 3IDQA 2HSZA 1XJQA 1X7DA 3PT9A 4IH1A 4XASA 5T67A 1LLCA 2CWDA 2Q50A 4L5CA 3FYSA 2HMSA 2Q21A 4NHEA 1C8KA 2PS9A 3GEMA 1T1JA 3I01M 1NHWA 2FWBA 2DR0A 3N2EA 4A0SA 1AGRA 5MHTA 1MIOA 2HCTA 3RS7A 2F3PA 3EK2A 1O95C 2YYAA 3FYUB 3KEOA 3Q8LA 1JR6A 1TO2E 3L05A 1AY0A 4EPTA 2QTLA 2WHPB 1EA7A 1Y63A 5L3QA 4DR2B 3ZS9A 2WKSA 4OXYA 1W34A 2AF3C 1X2EA 3SD7A 2VP5A 5JUWA 2OGZA 2P69A 4JX9A 3WRYA 3LXMA 5K0SA 2ZIUB 2ZVPX 4PYOA 3QVTA 1VRVA 1TUGA 3ZY2A 1I7LA 1XZMA 1K5GA 2E3JA 4DT1B 2CCKA 4TLBA 3NOQA 4G07A 3I6YA 1TADA 3I1JA 3F49S 1CB0A 1M7GA 2TYSB 2CJYA 4GNKA 4I2NA 4AKEA 1PX0A 1O4WA 5J4KA 2QZ9A 2DHRA 5TGZA 5BVGB 3W90A 2J3HA 4DZZA 1U5AA 2JPDA 2AOTA 2BY4A 3AHDA 1MZPA 1FSFA 4IJQA 5FTKA 4G1MB 2DFKB 1GU7A 3LPDA 4Q4JB 4GS5A 1PGQA 2JAHA 2HSDA 4R9UC 3PLNA 4YP6A 1V8ZA 1W49A 6NULA 3WLRA 5KC9A 4J1SA 2IU6A 2NTYC 4KXXA 4Y30A 1VB5A 3OZUA 1MGOA 4Z9FA 3FFTA 1LW6E 3FYDA 4G09A 4G86A 4ETMA 1X1BA 2C2BA 1Z73A 2JCSA 3MWEA 5IZCC 2KSQA 3I28A 3KCQA 4LC0A 1Y3AA 3EPRA 3P2IA 3RB8A 3ZWMA 4ARUA 5HIMA 3SKXA 5TIIA 4ZZ2A 3S27A 1Z29A 2B0JA 4A0FA 4JXJA 1S8OA 3LQ1A 4DJ5X 2FI1A 2HPZA 3NHZA 2G07A 2WAXA 2YZMA 3QVXA 3FPCA 3UUWA 6AT1A 1ADGA 1IUKA 1FW8A 1QH8B 2R3SA 3D3EA 2WJVA 3DZKA 3OSZA 4LNUA 4MVJI 4RS4A 2IOFK 1SAYA 4PRKA 4WBXC 5IUJC 1DUIA 1JXOA 1JUDA 1U0EA 1ZOIA 4URUR 5FRDA 3UUEA 1Q0HA 1RFGE 4QEKA 4PYNA 4L57A 5NLLA 3U0VA 1JALA 2W5UA 1PDWA 4PQRA 1J25A 3FPLA 3JTMA 3OSUA 1TA9A 1OU0A 4LJRA 1A76A 3H0CA 4J43A 4WW0A 4MHTA 3H5AA 4RCYA 2F64A 3LPMA 4IF6A 3GUVA 3CF2A 1H65A 5AVUA 3KZKA 2YZNA 5AW4A 3ZE6A 4WXHA 2WC1A 3E3NA 4C0JA 4D80A 3LPNA 4DCMA 5KINB 4YMUA 3WNDA 1BEEA 1QHGA 1X8LA 2W2QA 2R8RA 4LC9A 2JFPA 3I2FA 3RYCB 4PR0A 1LDBA 3FIJA 2EGUA 3LCJA 1SURA 2XCIA 1DBVO 3W3ZB 4XKJA 1MG0A 4F2WA 4B34A 3N76A 4WX2B 4BMOB 1BCSB 2BGNA 3W4IA 2EBWA 2RKOA 2VZ9A 4H7JA 1CQXA 1S4QA 1Z6QA 2WHYA 1YI0A 3OU6A 3W9BA 4B46A 4ESOA 3ADOA 3J81A 1SD2A 2EFJA 3DUFA 1R6XA 4RGBA 1LK7A 2FSUA 2GWHA 3HU1A 2JIDA 4BFWA 5AHWA 2RGEA 3X2EA 1KOJA 2AQHA 3NP9A 3IQGX 1SPXA 4J2TA 4ARAA 1USVA 3VU9B 2GVDC 2JCXA 1MP0A 3IQHX 3Q87B 4RQTA 3BFVA 3OMLA 2IP2A 1DBSA 4QOIA 3TECE 1F2DA 5FWNA 5F4BA 3HKDB 4PFKA 4BIIA 3UANA 3QEKA 1AKUA 1NRWA 4MV6A 1AA6A 2PE5A 1DDIA 4XCXA 4BVLA 1QRRA 4F2DA 1Z3IX 1JB1A 2EZTA 1OZGA 1QB8A 3AGPA 1ZGGA 3OKCA 4OI4A 4EMUA 5ITZB 2XE6A 2JIPA 3OUUA 4RA6A 1R4AA 3EZLA 3W7BA 5C37A 5JI2E 4GF5A 1J00A 1WPGA 4RKEA 1LXCA 1NRXA 3S1AB 3TZKA 4QUKA 4ZCLA 2RC6A 3F74A 3UAVA 2PV0A 1SXHA 3LC7O 2FGKA 1PWHA 2OBNA 2IXTA 1E96A 3I52A 1C1YA 4IHJF 3CNLA 5DT9A 3UUGA 3S70A 1Z28A 4DCUA 3D3QA 2GVNA 4MQLA 3ESCA 1CJUC 5TSDA 5IHPA 2FWRA 3QFFA 3A2KA 4LTNA 4PZDA 1FP1D 1TK9A 1ULTA 1LFDB 1NNSA 2XW6A 4IFTA 4LZZA 2OESA 5AXBA 1EAYA 2IHVA 4XWWA 3KB6A 3THXB 5FLEX 4JLOA 4YI3A 3UNXA 5LXTA 3EULA 2OHJA 3MUFA 4DBVO 2YW2A 1UKEA 4MQFA 1FFAA 1OASA 3QBTA 1M7BA 2UZIR 1MQ8B 1ZGHA 3CRMA 2JDID 4OBEA 2PZLA 1Z35A 3I34X 4N3AA 1ZN7A 4MEJA 3CFYA 4FBLA 4REOA 2DX7A 3WIVA 3ADKA 1AU9A 3E9NA 4M76B 4E1BA 1EFVB 1EZZA 4U9UA 3FDXA 3TCXB 3U9TA 1O77A 4AUMA 2V7EA 2JJ1D 3G1UA 4M9XA 2GXUA 3I2YX 1OW3B 2WWVD 4R0VA 3SX4A 5B1EA 2KW5A 3HBFA 3BUSA 4PR3A 1XTSA 1YQUA 5G0TA 4DLSA 1KC1A 3PUVA 1KJZA 1JTFA 1E7MA 5M5BA 2WAYA 2X6QA 1U0HC 3IP6A 3EF1A 2XDYA 5I51A 5FFFA 3AIKA 3DB2A 3LOUA 3DZCA 3M2TA 2UZ1B 4E03A 2JGIA 1V4VA 4C76A 3ZU4A 1YKFA 2G1AA 4FK8A 2H1VA 4Q6WA 5L53A 3KSBC 3AOGA 4WA7A 4G01B 4RGQA 5C46F 4MCHA 3ZJVA 2X9VA 4BPRA 4D96A 3P2YA 1VBKA 4JYMA 4N5HX 4K88A 4MTLA 5DYWA 3JYNA 1J0AA 2WNHA 3R7SA 5HHTA 1W5FA 3HM9A 1YHNA 1JPUA 4CKZA 1YONA 1T6XA 4MLPA 2BEJA 5IAJA 4B40A 3MPUA 3BZUA 3FN4A 3SZMA 3NM4A 1J97A 4GX1A 4O0MA 4O6VA 5I7FA 4MV1A 3UXEA 3CPJB 2R6R1 1J2YA 1D8AA 2M6KA 2Q9BA 4NU0A 4KAAA 2OL4A 3CJRA 5CDGA 5A7FA 1PYGA 5FUYA 2FOXA 3PFKA 2J3MA 2WSSA 4W1RA 5SYAA 3SYNA 1P1KA 1GG9A 4QLBA 2R1VB 3DFZA 4C43A 1R8YA 2L42A 4YNBA 4AWBA 1T9HA 1WZIA 2BGTA 3VR4D 1RYYA 5DX0A 4YJDA 5AVOA 3VSBA 3KYDB 4U02A 2XUDA 1KYZA 2DFNA 5TY0A 1NURA 2OWDA 4M7PA 3IP7A 4X97A 3WL6A 2J0UA 4JA0A 2IHKA 2VNHA 2H65A 3V8EA 6YASA 2JLBA 5HM6A 1E1RA 1QE0A 1Z9BA 3ABOB 1BMFA 4D25A 3H3XA 3GLKA 4J1QA 4IICA 4JCCA 3UJ8A 1KPIA 3U3RA 2V1UA 1XMIA 3DLAA 1GRCA 3IAEA 2ZUVA 2F62A 2H2HA 3HZRA 3OT5A 3QZUA 4S0XA 3NT2A 1JDTA 3ORYA 5J4VA 4CN9A 1EUCA 1Y6JA 1U3CA 3GT0A 5LB2A 1AV7A 3PI6A 2OHFA 3H8VA 2JIZD 1ZD1A 1M33A 3A7DA 3E1SA 1F20A 1TVCA 3IDAA 4UCQA 5FUWA 1UMBA 4CMIA 4X45A 1W59A 3ZDXB 2B1IA 3I6BA 4C6HA 3QELA 3FHCB 3OQ6A 1JQLB 1KAEA 2G77B 5K0BA 3V32A 1QF6A 1WUTA 3WYEA 4HTFB 1KK0A 1FJGB 4PLFA 4KAFA 4R68A 3U3DA 1MW9X 2V4UA 2YY6A 2ZYWX 3C3BA 3EVTA 1AKQA 4JP3A 4V38A 5FOXA 3ZGXA 2JAQA 4PCVA 1WVGA 2WWYA 2C59A 1Y9JA 3HN7A 4QU9A 2OFFA 2VYFA 3NR2A 3T5PA 4UBMA 2YFHA 3I3OA 3MBIA 4AF6A 3DM5A 1L3BA 1OVGA 3LQQA 4JB2A 5J2UF 3TUJC 5CBPA 4KXNA 2VSXA 1I2MA 1N75A 4U6SA 5H3LA 5SY9A 3QNUA 4EG8A 3IEIA 1AMNA 4UNIA 3HC7A 4FFSA 5J2UB 2FWJA 4XD7A 4EABA 5K0GA 4EQ6B 5JQGA 5GIPE 5TQ0A 1XMQB 1ZJYA 4LI3X 3W77A 1Y80A 2FR1A 2JRLA 2VPXA 4MPPA 4MWCA 5DYIA 4B6OA 4RY8A 4UDNA 3VQTA 3COWA 4CM9A 3ZV5A 5BXYA 2H54A 3PD1A 3LKZA 4ZCRA 5JT1A 5KMGB 1ARZA 1GNRA 1CS0A 2R8YA 1HLGA 1U0JA 4TV8F 3UWPA 2JEZA 5HZKA 2M32A 1M0EA 5IVHA 4BXOA 4OQZA 1MT3A 4C0QC 2AG1A 4NIMA 5CFQA 3M3PA 1TZKA 4FXOA 3D5TA 2V6IA 4OIFA 2XAUA 4P3OA 4TV8B 3SGLA 4AZ0B 5DLDA 3SHWA 1PRYA 1L3CA 2B3TA 2D1YA 3C6MA 5DJ5A 3TR6A 3BRWA 3C8UA 2AV6A 3E9YA 2VJLA 2QVCA 4HUQA 2GVZC 2ZM6B 3R41A 3GT3A 1STOA 4NOJA 4ZRMA 3AM3A 1VSVA 2O2DA 4TL6A 3MB8A 1QLWA 3TLXA 1ST2A 4CKBB 1IY2A 4X85A 1U94A 4L0QA 1IG3A 4Q4CA 3CX8A 1LV8A 3UATA 2XBUA 2VP3A 3E48A 2QG9A 4OPMA 4UBLA 2X4GA 1IN7A 2LPMA 2Y4NA 3SLGA 2CMDA 5DM60 1YL7A 2H16A 4D43A 4Q7QA 4I9NA 4HQRA 4NPCA 1EK6A 3DL7A 2VTEA 2ZATA 2J8ZA 4HDKB 4WACA 3E3OA 2JRCA 3HKCB 5JI3E 4BP8A 2Y2VA 1JB9A 5B1SA 5IT0A 1NP6A 1TYDE 2BEKA 3B9QA 3MS4A 4Q3CA 3DCYA 4G1BA 2XIJA 1QG0A 2OCIA 1YL6A 2ZYGA 5HKBA 2UYYA 3NHPA 3O8LA 1M2FA 4R3NA 3WWCA 4KRGA 4PX5A 4J3FA 3E05A 4TYYA 1XI2A 4B6GA 4A2CA 3VNAA 5G53C 4CQJA 1AH2A 2YMPA 4WCFA 4DA9A 1Z36A 3GOHA 3N2YA 2J9RA 1UKAA 4S35A 4ERNA 5F9FA 2GZSA 2IYLD 2R68A 4Z5XA 1QBGA 2F43B 4JBIA 3O03A 4E2YA 5LBUA 3H3FA 3H7IA 2R7LA 3QNWA 4QQFA 1Z45A 5IAGA 1R37A 4M7OA 2B7CA 1KZYC 4JKIA 1FFGA 1NZFA 1P39A 3M5WA 3AVQA 2QZJA 5F7ZA 4EFNA 3HXOA 1PGPA 2GBFA 2HQRA 2WFLB 4WFJA 4P83A 4Q24A 1ZBQA 3TSYA 2V3VA 4RVNA 2JFXA 2CHFA 1XWWA 4DZRA 4AS1A 4BO3A 3E3LA 1JDZA 2XZDA 1T0PA 4U39A 3N8NA 4CV3A 4IDHA 3BMOB 2W2KA 1OWPA 4KN9S 3LUPA 4LSMA 4C14A 5GQSA 1TVMA 2KHZA 1L4MA 3I45A 5AKZA 1VSTA 3EWAA 1J24A 3WX0A 2GJKA 1A2BA 2J59A 2YUIA 2G5PA 3CGWA 4MRPA 1E62A 2W2OA 3HJAA 5CNIA 3W6NA 3CJQA 1HG0A 2ZITA 3IAFA 4AZ3B 1SOVA 1JPVA 1EM6A 2ZSDA 2ZWIA 3HZHA 5K05A 1UFOA 2HA3A 2XT6A 5HBRA 2ENUA 3VR5H 1SNYA 3FSRA 4W5OA 2WY2D 4JYZA 1L8OA 3U4IA 3BHIA 3WK5A 3K6SB 2A33A 1SOUA 3NV7A 4UMVA 2Q9CA 2EWMA 1O2DA 5EP4A 2IH4A 1OYVA 4K2HA 4LTMA 4BBJA 3QE9Y 3ELWA 1KZHA 3JALB 4CUKA 3A9RA 1ZICA 2OECA 3DP7A 3HWWA 3ZZMA 5L40A 1YOVB 2B8TA 4FIDA 4NWIA 2C2WA 5ECWA 4BO8A 2G08A 3AYXB 1EE9A 2BRUC 5LQJA 3W34A 1LSJA 2HLDA 2P40A 3H11B 1T8YA 3ZDBA 3INGA 5DW0A 2A1TR 4XUEA 5T4FA 2X5NA 5LD2C 1Z33A 2DQZA 3GMIA 3TBKA 3CLSC 2PZKA 2AVNA 5LR6A 2J6IA 3ZOKA 3PEFA 3GYGA 4HZUA 2IP1A 2FR0A 4NMLA 1AQIA 3ANSA 3CBQA 4TL7A 4Y7DA 5CM2Z 1OUMA 5EWJB 4CKEA 1H8HD 4RMJA 5ISMA 1GY8A 2F2TA 1YDEA 4QDXA 4RFLA 5BPHA 5AHKA 3CPEA 3RTBA 1P4SA 3GPCA 2VRCA 1KR2A 3N0TA 1HRDA 1XZ8A 1M72A 2AC2A 3NIGB 4N03A 3VH3A 4P22A 2OHVA 3WQQA 2EQ5A 2GBLC 1B0ZA 5BN1A 3FWHA 3EA0A 1PSWA 2WYVA 1O6BA 3I32A 4LW8A 4BKUA 2O6LA 1CUYA 4C78A 1XQ1A 1S5PA 3MCVA 1ELOA 3BRQA 2HF7A 4OHFA 3W7AA 2ZJ7A 2HMVA 3NHKA 4G5FA 3ZR4B 4BGVA 2IQ5A 3MCAA 1LSOA 1J2JA 1Z4MA 3B3AA 2PXCA 4BYGA 1RKQA 2SKDA 5BV7A 5ECDA 4E2XA 4PPYA 1VKHA 2HU5A 5KSYA 2W2XA 1OGYA 2AOWA 1I1QB 3ETGA 4JITA 4KL8S 4IGAA 3O95A 4MQMA 1NNUA 3E18A 4CT5A 3BE6A 4RY9A 1WZ2A 4LJKA 4OB7A 1ZOSA 4P98A 1PL7A 5EINA 1DFIA 2P4UA 4EO9A 2PL5A 1RRKA 2QRQA 4G0VA 2O4UX 4COOA 4AKSA 1E99A 3K96A 2OWEA 3UJ9A 2YJZA 5C8ZA 3HJRA 5C3MA 4M6WB 1QYWA 4ZAVA 1FUKA 4TYQA 4JJAA 5HG0A 1EZ1A 5E0OA 1HR0B 3AEQA 3NONA 3BSWA 5H81A 2WP8J 1CF2O 2VHJA 2Q49A 3AKYA 1K0UA 2QP4A 1T3LA 3RAEC 4HNHA 5D51S 2G63A 5AW7A 1M1YE 5DGTA 4B3HA 4TYNA 4KSBA 3P27A 1GM5A 1SD1A 1WZCA 2EXXA 5HE9A 5ILOA 1TMGE 4CKWB 1KRHA 3A3KA 1HC7A 1XMOB 1VE3A 3K35A 1HKUA 1PE0A 3ZIAA 3FYTA 4G0ZA 3DVAB 2FDCA 5A4IS 1NW3A 4A8TA 4ZYZA 2EF0A 3PEVA 1Z63A 2C98A 1A5AB 3K31A 4L5BA 3C2QA 4N0PA 2Q3EA 3L9XA 2H4WA 2Z57A 4UE2A 5JQWA 3WADA 3ZE2B 5AM3A 4NNPA 3VU0A 3DOEA 2Y0PA 4XRGA 4XOUA 4PPFA 5D2CA 3WWZA 3R0ZA 1USWA 5L4NA 2KS6A 1SCBA 4J0EA 2PJRA 1SBYA 2RAUA 1QFMA 1XV5A 4J1TC 4P4SA 4URHA 2FX2A 4CQMB 3U7EB 2Q4TA 2PRZA 4EF4A 2YOHA 1KQ3A 1U1CA 2IW3A 1J70A 1M10A 2DVMA 2OB1A 2VP0A 3AR9A 2D13A 4FMDF 4B35A 1ISGA 1D4ZA 4AWAA 4HL6A 2RAPA 3A70A 3DFFA 3G5TA 5HA5A 1CD5A 1LDNA 3RHSA 1Y6FA 3W1WA 2FG5A 4UXHA 1A8IA 2O7NA 4FMDB 1T5DX 3H1FA 5JASA 3GLSA 4NC9A 4QU8A 4ZODA 1KI6A 1J06A 1XZLA 4QXPA 4NARA 1PK9A 2HQBA 3D6HA 3LV8A 4MEAA 2VF4X 4JYAB 1QONA 3OIWA 4HQKA 3RBXA 2CL6X 3TSCA 3EZYA 3V6MA 1OFUX 3JZIA 4YRPA 1AO3A 2GJ8A 3TOVA 3K5WA 4JJ7A 5C4MA 2Z2JA 2FJPA 5ALTA 3BL8A 5F51A 3KT6A 3ABQB 5LDDC 1TTPB 3W8DA 1KDTA 1DKOA 1ZUNA 4A27A 3LPAA 1ZI9A 2PT9A 4A4DA 4OUKX 3DR5A 3G02A 4CEJA 4NV0A 4RENA 1A82A 1XRSB 1J49A 1K7FB 1VHDA 2QN2A 3R0XA 4QAJA 4GOXA 4M55A 5LIPA 3DAGA 1RWKA 3NETA 1EKXA 1PKXA 3I9MA 4AS2A 5KJCA 1J90A 3FXAA 1GTL1 4CT0A 3TFWA 2JA2A 2HJWA 5LQDA 2QPOA 1EFHA 1YUMA 2BEWA 2Y77A 3CUUA 4X93A 4ZCTA 1XF9A 2C97A 3BMXA 4TVKA 3U61B 4N40A 4P3NA 5DXJA 1XZJA 4HTAA 3WBFA 4FYVA 5FPHA 1H93A 3NATA 3CPSA 2A92A 3JQPA 1V5GA 3IP3A 3Q0EA 4LDNA 4ZAXA 4EKIA 1ZNQO 4ZYTA 4IV8A 1XT6A 4TQGA 1G98A 3EXHB 4NOLA 4CW7A 5AW3A 2UZAA 1RXYA 3M5PA 1BXGA 2I4NA 4ZCPA 1Z47A 3N3AC 3SU8A 4EIWA 4GC9A 4DJTA 1S1CA 1U80A 3ITNA 4YLYA 1H4TA 5IVPA 1F60A 3NNDA 4KMOA 2OM6A 2PKEA 4ZVLA 5C5IA 4X1KA 1OT3A 3OLXA 4DV3B 3LECA 3TAXA 4BNLA 1AQJA 4YT5A 5WRFA 4DSTA 3SYRA 3H9UA 1IWBB 2XTMA 1UMCA 2QIOA 3A9WA 2PLRA 4DPMA 1GFWA 2FPUA 3NWBA 4HD8A 5CVCA 2BELA 1AX9A 1NMSA 3T3IA 2QY9A 4H6VA 5B53A 1N8NA 3RODA 4DMMA 2DHDA 3ZBPA 1KJYA 1RYFA 4B6PA 3NBAA 3QA9A 3KXDA 4DJDC 3PE6A 2P9YA 4DWJA 4L16A 2JAXA 3GLIE 2X76A 1R0YA 5LL6P 3EYWA 3WGLA 5KYUB 3QWAA 2ANCA 1WKVA 2ZBDA 4NJMB 2QSJA 1V48A 4NQRA 4EGQA 3RNOA 2PL9A 4OQQA 2NSDA 2E6KA 5E3HA 1GL7A 2FZCA 1YDWA 3HLTA 3M1LA 4F3TA 3CEMA 1XTJA 1QZUA 3WRXA 1W0KD 5JSQA 3FCSB 2RGGA 4KR0A 2BEUB 1DTEA 1FPQA 2AR0A 4X6UA 4ARSA 2E55A 2A0XA 1LPPA 4GI3A 4YMGA 5KS2A 1VMEA 2DFDA 4JJ4A 4NBKA 2ID8A 3PA6A 4ALJA 2Q5FA 5IJ9B 3MCZA 5E9WA 2GZAA 3SBDA 2IYEA 4FT4A 4ENVA 1J2UA 3F2IA 3NDJA 4HGQA 3WQBA 1I80A 2V65A 5ECGC 1LJ8A 2HJVA 3A1FA 1LX6A 2IIVA 3BRCA 3M4YA 4TLCA 5M2QA 3UBTA 1MCZA 2QM8A 3DC2A 3DE1X 5AKGA 4LZOA 3KEMA 3Q1KA 3ZCQA 3B3GA 2O06A 2Z1MA 2CNWA 2J3DA 1ZRHA 2NG1A 3L77A 1P91A 1ULHA 3M5CA 1HZJA 2IZZA 4H0NA 5AI5A 1ZQ9A 3NDIA 5D3KA 4DADA 4YMHA 1GKKA 1UOPA 5IF9A 3I2IA 1AIPA 2Z2IA 4RTMA 1T25A 3TEFA 1LDEA 3VYWA 4H9GA 1LFAA 4IMPA 3C3CA 5LMZA 1A69A 3PHLA 5EUMA 4DLPA 4H3VA 1Z2AA 4OKNA 1A88A 4KQHA 1G2IA 2AFRA 2G04A 1Z34A 1KAGA 4G41A 2ZJBA 4MINA 2DULA 2EKBA 2HZ7A 3GMSA 2WWWA 2VPQA 4J0CA 4DLVA 2XNKA 4CETA 1PV4A 2H9YA 1J23A 1NXOA 1PFWA 1JHXA 1BVYF 3EGDB 2YIMA 3QYJA 4MP8A 4NCXA 2RKWA 4ZD6A 2VLIA 1YQXA 4MUBA 5ES4B 3OM1A 5C51B 2EFYA 1GV1A 4X8HA 4BB6A 5LUBA 2Y93A 1PG5A 1PFYA 2OGSA 1XC7A 3UHFA 2CFSA 1IY1A 3NGXA 3WLMA 2I5PO 4JB3A 4LQ4A 4CF3A 3Q7RA 1NUQA 1Z6TA 4JI3B 4G4IA 5FL3A 2YNMC 5IX8A 1R88A 1W88A 4F4JA 1DC5A 3N9IA 4V39A 1CJKC 2OD7A 4QHTA 4KPYA 2I8AA 1XLTA 5DRYA 2G3YA 2QZPA 4ND2A 2PUGA 2VDMB 1QTQA 1Z4IA 3AXSA 3ESRA 1U7OA 3OAAD 4N5DA 4XGQA 3RS2A 2VBGA 1G7CA 1YZFA 1SRQA 1BHJA 2VJNA 3MWGA 1ICIA 6ABPA 4RA9B 3GGDA 2ZEJA 2NV2B 4MX8A 4PNZA 2QPAA 1CUSA 3K2IA 4BRSA 1M6NA 2P6PA 3UENA 3B1KA 4RZXA 2E4ZA 4MPRA 3VDNB 1K5PA 1GPH1 1UXIA 2Q6IA 5G0UA 1G20A 4TV9F 4E7OA 2REBA 4FKMA 1EX1A 3J7AC 1SCKA 2H2IA 3A06A 1EVLA 2H2AA 4MV4A 3TPFA 3ULKA 1L8XA 3K2BA 4JQZA 4TV9B 1GGKA 3VX3A 3LT5A 4QXOA 4J4BA 3TQCA 4A91A 2F3QA 2Z0MA 1HSZA 2QG6A 4PBTA 1XD2A 2ONCA 3KKLA 4N6NA 4G5SA 4ZT5A 3RUFA 4WZZA 1Q7CA 3PEEA 3LK6A 4XZ3A 4YALA 2E7ZA 3C6QA 1LEHA 3CW2A 1DKLA 1NZJA 3BXFA 3VZDA 1U1GA 4Z4CA 3QUAA 4N5LA 4H17A 2ST1A 2VH2A 4ITRC 3HXQA 1C7FA 4R81A 4QIHA 4YJ2A 1E6EA 1Y9DA 2Z4TA 3IBGA 3GQVA 1D9ZA 1YF3A 3D7MA 1FSSA 2G88A 1BEUB 5JD4A 3JQBC 5FHQA 3NAMA 3WISA 2BSQA 1N5RA 3FHJA 1KY2A 4FOTA 4KLCA 4L8WB 4F9TA 1Y48E 4BNKA 3GVIA 3O21A 3FTNA 5DOZA 2W6JA 5B7NA 2Q07A 2R8ZA 4BV8A 1JKFA 2RBEA 3KZCA 5DBOA 4YR9A 5LP6F 4I08A 4JZKA 3G82C 3MTEA 3RC2A 1RW4A 1MVOA 1CR6A 1YK0A 4UCWA 4ZRNA 4N8DA 3LPLA 2FPIB 2WSYB 1E4EB 4LRSB 5ALOA 5A2QA 2QMZA 1PW7A 1XDGA 4CL0A 2JCGA 1C7EA 2B4AA 4DA6A 2JC3A 4TS3A 4HGZA 5B64A 2IX3A 2Q5HA 1HE4A 4Y98A 1EBUA 1E6MA 1G2QA 2DTXA 2GKOA 3LIIA 4P38A 2V55B 3REQB 3UMBA 1SQ6A 4ISBA 3VO9A 4JNKA 2R1UA 4A3SA 2XYQA 4PIMA 1AB6A 1BGXT 1B0UA 4OBXA 4WY5A 4V02A 3ZX4A 4L5AA 4HNUA 1XJ5A 3CZAA 5LWHA 2XVYA 2AK3A 2QRKA 1GVNB 1D4OA 2YMMA 1OYYA 2G5TA 4XFDA 4B83A 4EVQA 1WMBA 1LDYA 1GR1A 2YINC 4MVJP 2Z1NA 4TWAA 4MH0R 1BVHA 3SBEA 1G7SA 2XUQA 1XTUA 5F2KA 4PVCA 5LQMA 1EFLA 1N9KA 1YR6A 1TUBB 3L06A 3TF5A 3SS7X 1XKLA 1MU0A 4JU9A 1DEOA 4BVHA 2VDUE 1GFSA 1SXGA 1A9YA 2AE2A 2J5XA 4HR7A 5BWOA 4HNAB 3AR7A 1OBFO 1ZZEA 2UKDA 1V25A 4LQCA 5DCYA 1L7NA 3TTVA 2H1HA 1Y33E 3JZMA 4LWZA 5DTJA 3SN6A 1T9KA 3T1VA 1JEDA 1VMKA 4GICA 4N47A 4A8JC 5E7IA 3FZNA 3OFVA 1E8MA 3LYLA 4Q4HA 2EJCA 3MGCA 2BFOA 4KWEA 3JVVA 3LLVA 4ZDWA 2ZRJA 3P9KA 3HXPA 1N2OA 3U0BA 1QLHA 2HJHA 3IEVA 1PQWA 2LCIA 5K3AA 1PF7E 3RI3A 4R4JA 1OV6A 4CKXA 1ULAA 2CMKA 4RDCA 2I2XB 2IC5A 4LXTA 2WHEA 2FMTA 3P2OA 4YV0A 4ZPXA 3QPAA 4IS3A 3OEEA 3ZWCA 1CERA 2VSOA 5TS2A 4IJ5A 2ZXFA 4ILKA 1BE1A 4WKGA 4DQUA 2XB4A 1ZW6A 1KP2A 5EMKA 1TA0A 1ZJ5A 3IV6A 4FD3A 1AJEA 1PQPA 2BCJQ 2WR8A 3V1TC 2HTEA 4KO3S 5J1TB 4ZICA 5EIWA 5GVSA 1UBKS 1P45A 3Q0TA 3Q7IA 2WM8A 1CEYA 4J49A 2JZNA 1XBTA 4GKBA 4IDNA 3NTQA 4NQZA 1PS0A 4RZUA 2A9VA 1H9CA 5J23A 4EI2A 1XLWA 4KMSA 3EBLA 1NFRA 4IYRA 1ZU5A 2VSNA 2RAVA 4QELA 1XRPA 4N5MA 2HBYA 3S2YA 4TN1A 3UK0A 2J9ZB 1T4CB 1AK9A 1K8YB 4WZAE 4Y2PA 4BX0A 2IHNA 2OBBA 1IUNA 3AP3A 2X8JA 3PIIA 4PV7A 4EG7A 4BNWA 2MSDB 4ZC1A 4EPXA 2C61A 5AJTA 2QD4A 2IFTA 3M6LA 4O3FA 1I2AA 4P2BA 1S2LA 4PYQA 3EEIA 3AILA 4NOMA 2DUUA 4ZV9A 4HV4A 4YCSA 5KTSA 4EFDA 2ZIEA 3D0QA 1Z0DA 3PFBA 2BISA 2Y1FA 1DKNA 3GJSA 4QUEA 1Y4SA 3W5VA 3WJ2A 4PG4A 4ESVA 1TZMA 1JFFB 4S05A 4RH0A 2IXFA 4ID9A 3WDKA 5LJLA 5JWOA 5JXJA 1W85B 1WXGA 5K3OA 2PZGA 2W11A 1IIBA 1ZCJA 4Q3KA 1ABFA 2Y1EA 2ZGVA 3THRA 4EVSA 5EE9A 1JLMA 2ODWA 1RVDA 3GQBA 3QOXA 1J4AA 2BJWA 3GD7A 3L8GA 2O23A 3D64A 3EVBA 4R1PA 4D3XA 4ZHQF 3IKLA 5HJ5A 4EF5A 1QAOA 3N39C 5ESXA 4H7KA 3ZWAA 4LCJA 5HKLA 4S0ZA 4NZMA 2BGMA 4FQ7A 4CL3A 3E7DA 4ZHQB 3RSSA 1QCDA 1R4MB 2P79A 4RY0A 3OCYA 4LE0A 3UMFA 4MLCA 2VTBB 2KMLA 1DO2A 3HU2A 5BV8A 1A7JA 1QV7A 2XZTA 2GPBA 5KVCA 3IAM6 3GAAA 1N3LA 3AESB 1QQBA 3SS9X 3WL3A 1QH1B 4G1EB 1M1UA 1R16A 2NN3C 3GDOA 3HBLA 1SVOA 1GL3A 3QPUA 4XVQA 3TI9A 5DP2A 2CVPA 4BU0A 1DIOB 1WS6A 3FTFA 5GGXA 3TTUA 1T2VA 1JWLA 2PAFA 3BTSA 3MYRA 1YBVA 2OAEA 1MJGA 3AI2A 1PJTA 4HRXA 2OENG 4F60A 4IWNA 1G291 4N7BA 4WKNA 1XDUA 4QEDA 5GWXA 1BDBA 1Q7GA 3LHDA 3LUBA 5JO0A 5K8VA 5ALWA 2HUPA 1N0IA 5BSMA 5L4LA 2YQ5A 3B7WA 3GEEA 3JZAA 4AMYA 1SVLA 4RF5A 5GM2A 2Q3CA 1KJJA 5AXAA 3VPGA 1PU2A 3JPYA 5DBFA 3OZ7A 4R83A 1T36A 5DHQA 4E14A 3TGPA 4MHSA 4KYVA 1XVIA 1V71A 3U16A 2J5QA 2XT0A 3GLFA 1XALA 2WYWA 3F1KA 4U6NA 2BW0A 1XE3A 3OPXA 4BDSA 1G60A 3VH1A 1Q17A 3G2OA 4YDQA 3H5WA 3DO5A 3WIEA 2VYVD 3IJ5A 4BQIA 1LPBB 2IA5A 4GOOD 2NTEA 4YJHA 2QWXA 2QT9A 1V2GA 3F98A 4L08A 3WK7A 4Y6LA 3GP5A 2ZPUA 3ZNNA 2AD5A 1KZ4A 3AL2A 4YDRA 3IA7A 3A25A 1AKEA 5GAJA 2JIRA 1L5LA 4JI8B 4NECA 2WSSD 1E2MA 2PD3A 1XYVA 1WA5A 4ZMBA 3M33A 4EB0A 4PYIA 4WK4B 1NRIA 4KX3A 3DJYA 3ONNA 1R4NA 3H9EO 2I7DA 1II8A 1YS6A 1E3LA 4FUTA 1D2RA 3RJTA 2HMWA 2QV0A 3KT3A 2FLWA 3PVZA 4FKBA 4KQ2A 4LVNA 4KWHA 3HA7A 3D6AA 1EVZA 2XZOA 3AUAA 3W6OA 5HJ2A 3TVTA 4ZOCA 3EGOA 1IVSA 1GN8A 2MIIA 3K94A 2ACKA 1E1RD 2O3TA 2YCBA 1JAXA 3KKPA 3QBJA 4RFVA 4AMGA 3R3HA 4EHJA 4F4UA 3HJFA 2EGGA 1VCHA 3EZXA 1FFWA 3AU9A 5DHFA 3GLGE 1M8JA 1DIBA 3B1WA 4Y1EA 3AR3A 4LY3A 5K4AA 3SYLA 3WIBA 4ZYXA 1OR8A 2WG0A 3PFGA 4GW3A 1E7SA 1PJAA 2H5EA 1EDDA 3U4QA 4PHGA 3FETA 4ALLA 3O47A 4PGAA 4KR3A 3WLFA 3L5KA 3TVDA 4RTLA 5DNEA 3NXKA 1FOEB 3E03A 3LCCA 4PG6A 4V0NA 5TPZD 3V2IA 4DKXA 1EUYA 4WWHA 1GRRA 4BMVA 2J85A 3V4FA 3HVKA 4BQFA 4A5SA 5EZ6B 4F6LA 4IO0A 1V7PC 3JAWB 2D5CA 3KQVA 5FTLA 4I9GA 5CVDA 3CR3C 1PQ4A 4C04A 1HYGA 3PIDA 2X8LA 4YXWA 1H5UA 5F2OA 3UG6A 3HYTA 1X19A 2DJIA 4CE6A 4GBJA 3NBYC 4LBZA 1OA1A 4NZNA 4W5WA 3LOPA 5IC6A 5K2MA 3PG5A 1Z0ZA 3GBVA 3P5BA 1T8TA 3OKFA 2Y9MB 5A3SA 3RREA 2QMEA 1N7GA 2CE2X 1ISMA 3NBKA 3N5KA 5AOCA 1VLQA 1DJQA 2I22A 2ADOA 2IYWA 2VP4A 2LP4Y 2K4MA 2V5UA 5AJXA 2VP2A 1N34B 2WTBA 4LOIA 2X40A 5IARA 5CJJA 3ZK9A 4B4KA 4EHFA 2NZJA 4G0YA 5DBHX 5JR3A 2C83A 1E5QA 1S4MA 4CM9D 3SJAA 2IIPA 5TNXA 1QIJA 2L17A 4RY2A 4LQLA 3HPRA 4B3GA 3SQNA 2VCYA 3AKEA 4QSHA 2PR7A 2OZKA 3MWDA 1U7DA 1RQPA 3E9QA 2RHCA 2P77A 1JNYA 3LDGA 2YJ4A 4TM8A 4ED9A 4UTRA 2ZWPA 5HRAA 7AT1A 2B6HA 1IE3A 3JWJA 1WHTA 2QRVB 2HA5A 2JF0A 4GBMA 5FIUA 3JWEA 4L8LA 2II6A 3HA5A 2G76A 3Q8MA 1C0PA 4L73A 4PNPA 4MDFA 4A15A 1J99A 4R41A 1BD3A 2FA9A 2P6MA 4L51A 1SQGA 4L2IB 4OJMX 1PJ4A 3TOZA 4AECA 1XJ0A 4RULA 2C9YA 2NW6A 4FPXA 2XTAA 1GXSB 1V5EA 1M8PA 1K7YA 3CCFA 3NG1A 4OFZA 4YYEA 3BXEA 5H8WA 3ENQA 1JKJB 2AFIB 4KI7A 1MNQA 3R5KA 1E0JA 4EYOA 1CEXA 4DIOA 3ASVA 3HXMA 1FFSA 1C5KA 1P0FA 4C5AA 5I45A 3Q3VA 5EE5B 1KQNA 5JWRA 1MB4A 1ZMBA 1K4MA 1PLJA 2B69A 2G36A 3C5EA 2R6JA 4IQGA 4Y6PA 1W35A 1V6CA 4WBNF 2WINI 1X8JA 4OHUA 1IPHA 4RXUA 1CVRA 4PHTA 4E5YA 4OUDB 3ILHA 3TE6A 3UJAA 3NV9A 4WBSA 2ZU6A 5IDWA 1NUPA 4WBNB 3L6UA 1SC4A 4RD3A 4E3ZA 4EGFA 3IURA 4MRNA 2FWNA 1YNSA 4YMIA 2PUEA 3MS2A 5BW5A 5HRCA 1G41A 5H1YA 1LF5A 4EW3A 1I2ZA 5EXTA 3ZTTA 3HSYA 2JI8A 4RKQA 4A0HA 1DKPA 1LI7A 3DLCA 5JOQA 1HORA 4M1WA 4EUSA 4C4TA 2BGLA 3RRBA 3U2QA 5BSVA 1N8SA 2H3HA 4LFBB 4HYYA 1GQQA 1N7JA 1VTKA 2FCAA 2C42A 5DBGA 4UTXA 1K3FA 3L1HA 1FQKA 2PJDA 4GPIB 3SVLA 2A1UB 1QVAA 3R8FA 5A0TA 1AF4A 2ZIXA 3LWDA 5CU7A 3K16A 4UEQA 4AY6A 1MH9A 1JJ7A 2NO5A 1W48A 5HIKA 1BTOA 3IQDB 3O3CA 4WRRA 4L0DA 4ZEXA 1B93A 2W70A 1IBSA 5BRJA 1NF3A 1N0UA 2D1SA 2SCUA 4RNDB 5LLSA 3QYFA 1N5OX 3OA0A 2XYHA 5LQCA 2IHUA 1IHOA 1AB5A 1EU1A 3R44A 3SFVA 1NKVA 4CM1A 2C7OA 5AICA 2KX7A 3UQYS 2OVBA 5DM70 1T2NA 2HJSA 1SXJA 1O94D 1VIDA 3HKBA 4WJZA 4XTRA 5GJVC 1UFQA 4L4YA 4EX7A 1Q1ZA 1J2RA 1VJ1A 3DAFA 4IQ0A 5B2ZA 3IDOA 1SHLA 4ZOLF 2VDQB 3OKPA 4MWTA 2VI5A 3CA8A 3Q8WA 1WEKA 3HQ4O 4M86A 1ONBA 4R16A 4XPZA 4XCQA 3LUDA 4EGJA 1D0VA 3Q6IA 2GEKA 5FEMA 1O97D 2EWVA 1WCYA 4ZOLB 4TQAA 5PNTA 1VMDA 2BCEA 2JK0A 3QLUA 3RJ9A 5K7SA 4RQAA 2HLDD 4PWZA 5K0NA 4ZVPA 4RTJA 4ZCIA 2DY1A 3RFTA 4O2BF 2NUPB 3N07A 4Q9KA 1RPAA 2ZIGA 1TDJA 4HLQB 4RD1A 1T5TA 2FWIA 3QTTA 4NBSA 4TMKA 5BWNA 4UBNA 3TINA 3B9BA 3QY9A 1N77A 2I2AA 4O2BB 4TXNA 5EJMA 4Z1OA 1NJ6A 2GEDA 3V2UA 3TE7A 3V34A 1MEJA 1N2ZA 3EG9B 1NF8A 2ZB3A 4W5TA 5FNVA 3W2FA 4BWGA 3HKEA 3RUHA 2VRCD 4Q4AA 4DB2A 4GOMD 3VR6D 3D1VA 4FMBB 5HS4A 4GZMA 4C6TA 3VKGA 5FBWB 3INYA 2J9XB 4HKTA 1E3IA 2KPOA 2X0KA 4JLUA 1N5KA 5TB5A 2EYUA 4G0QA 2YXDA 1PG0A 3SMVA