3FWKA

Crystal structure of candida glabrata fmn adenylyltransferase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
308
structure length
291
Chain Sequence
GAMVMRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a eukaryotic FMN adenylyltransferase.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Transferase
molecule keywords FMN Adenylyltransferase
total genus 94
structure length 291
sequence length 308
ec nomenclature ec 2.7.7.2: FAD synthetase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fwkA00
5TEVA 3G6KA 4KPUB 1J1ZA 1GAXA 4MW5A 4RPIA 2JAXA 4CDNA 1JHDA 1QU2A 4MW1A 3G5AA 1GZUA 1TQ8A 3CLTD 1JIIA 2X1LA 3LOQA 1Q19A 4JZYA 2WQ7A 3TS1A 3SYTA 1NI5A 4AQ7A 5HG0A 2HGZA 1M83A 2QJTA 3COYA 2ZP1A 3LE8A 1NP7A 2RD2A 1PFUA 5IHXA 5KCMA 2VTBA 1EE1A 1WJGA 1LI5A 1GLNA 4YP5A 2J08A 1EFPB 4ZT3A 3CR8A 2E89A 4YBRA 2E0IA 1PFWA 4G5YA 4ZT2A 1VBMA 2R5WA 3COVA 4DNXA 4EG6A 5LM3A 2GM3A 1R6TA 4XFDA 2YWCA 1NZJA 1NUPA 1JECA 2QTNA 3ILVA 4MULA 4NZPA 1Y42X 1GN8A 5J58A 3L93A 1GTRA 4JYZA 3BL5A 1RQGA 2HZ7A 3MLBA 1G8HA 2WSIA 3UC5A 3KFLA 3OP1A 4Q16A 1N78A 2QUKA 3MLAA 4ND7A 4EF6A 4ZCTA 2PZ8A 1WXGA 3S3TA 3M5WA 2IELA 3IOCA 2I1LA 4GU5A 3TNJA 1N2GA 1KKUA 1UFVA 3CVXA 1KQOA 3DV2A 4EGAA 1N2IA 2CYBA 3AIIA 4KPUA 1Q77A 3RK0A 3K32A 1I6KA 3CVYA 2CYCA 4S1OA 1WQ3A 2A4MA 1MOPA 3TZLA 2CT8A 2EL7A 2AG6A 3U1VA 1OBHA 3ND7A 4NAUA 3TZEA 2CV1A 4K0RA 4MUNA 2X3FA 5AHWA 3UOWA 3IMEA 3CLRD 1N2EA 3SEZA 3IVGA 1Q11A 5HUJA 1GTSA 4KR6A 4QREA 2A1TR 3JXEA 2J5BA 1QNFA 1KQNA 4DDKA 3C8ZA 3KT8A 4QRDA 4MLPA 1PG2A 4HPWA 2GKSA 1T6ZA 4PBSA 1M8PA 4MUJA 4TS1A 2WQ6A 3F3MA 3UMVA 1MBZA 2V0GA 1KQPA 2NZ2A 4MVCA 3D6UA 3L92A 3PXUA 3VRHA 3ELBA 2QUIA 1VLHA 3D6VA 4ZT7A 1MB9A 4MWDA 1KH2A 1IVSA 3IVCA 3RHSA 1OWMA 3INNA 3IUEA 3ZJUA 4RUKA 1O94C 1G8FA 1O96A 1VL2A 2D13A 2J09A 5J59A 2CV0A 1N2BA 1QRSA 4MW9A 3IODA 1LW7A 3VGJA 1JILA 1PG0A 3CVUA 2QTMA 2J4DA 5DEOA 4EG3A 4ARCA 4CDMA 5H16A 3FETA 2E18A 2IP1A 2PZAA 1ULHA 3COWA 1QRUA 4MW2A 4ZT6A 3TQIA 1WQ4A 1OWNA 2OQ2A 4U8HA 4EFKA 2DXIA 2H29A 4HK4A 3N2YA 1O95D 4XFJA 4K03A 2X0KA 3NV7A 2EJCA 1MB2A 4MWBA 4F3RA 3HGMA 1X6VA 3HZRA 2A86A 4I6EA 5IJXA 5LFAA 2PG3A 5DASA 5KHAA 1WXEA 3GMIA 2RE8A 4G6ZA 3N05A 3A4IA 4BWVA 1EFVB 2X1MA 1N75A 1H1TA 3I05A 3SP1A 1MRZA 3P0IA 1HYBA 3RBAA 4JXXA 1M1ZA 3UY4A 4ZCSA 2AZXA 3HV0A 1I6LA 4P2BA 3SZGA 1M8GA 4FZJA 1QRTA 3COZA 3IMCA 4OJMX 1YI8A 4UZFA 1PFVA 2CV2A 3Q10A 4EG4A 4MQ6A 5JBNA 3AG6A 3FHJA 3MUEA 3LCJA 2J07A 4OUDB 1U3DA 2DLCX 1H3NA 1TEZA 2CFOA 4ARIA 3AG5A 1KAMA 1EXDA 1OBCA 3CVWA 3ZUGA 4ZCRA 1QQTA 2DETA 1TYAE 1T6YA 4PY2A 4HJRA 1IHOA 2Z08A 1J70A 2ZUEA 1KORA 1EJ2A 3NBKA 2A1TS 4ZT4A 1WXIA 1TYBE 1A8HA 2A84A 1T9GR 1JIKA 4ZCQA 1O95C 3A2KA 1YUMA 1J09A 1H3FA 3P52A 1KH3A 2PFSA 1J20A 3IUBA 3QTBA 2XRZA 1VBNA 3ZJTA 3K9WA 1YUNA 3FG9A 3H9BA 4GRIA 4KKVA 3CA8A 3KT6A 3DO8A 4J76A 1QTQA 3HFJA 2C5SA 1K4MA 2CSXA 3HMQA 1COZA 1WXFA 3FWKA 1R6UA 3PRHA 3IOEA 3ZXIA 2DR2A 4JFAA 4MW7A 4MW6A 3H05A 2YWBA 3P0HA 1V47A 4R2MA 3CLSC 2GOYA 4YMIA 1T6XA 3A05A 1FFYA 4E1AA 4R2LA 3SDBA 1NSYA 1NYLA 1JIJA 1EUQA 1JEEA 1F7UA 1JZQA 2D5BA 1K92A 3P0JA 3TQOA 1G59A 4EG7A 2DEUA 1WY5A 1XNGA 2QJFA 1IQ0A 3KT0A 1IH8A 4NAHA 5EKDA 1XNJA 3IMGA 5TEWA 5DB4A 3SEQA 1XNHA 3RFFA 1N2OA 4U7JA 1T9GS 4NDAA 3VU8A 4CT0A 2YXNA 2QUJA 3X1MA 2BYTA 3IVXA 3OTWA 1VBKA 1IQRA 1F9AA 1O94D 3ND6A 3ZIUA 1D2RA 1NUSA 3FNRA 2E21A 5LLTA 1J1UA 1KAQA 3FOCA 1NUTA 3N9IA 4ZT5A 1N2HA 1ZUNA 4Q93A 2DPLA 3SZ3A 5K0SA 5FNZA 1NUUA 1TFUA 3AL0C 1YIDA 1N2JA 4A91A 1JEDA 4JXZA 1P7PA 1CT9A 1U7XA 4YP6A 1JGTA 1O0BA 3DLAA 3CLTC 1DNPA 4ZCPA 1MAWA 4NX2A 2Z3VA 3H9CA 2V0CA 2AKEA 4MUFA 2CYAA 4R0NA 4H3SA 2WB2A 3NBAA 5F23A 2TS1A 4MVXA 1J21A 1IFXA 3CLRC 1WOYA 1XJQA 3ND5A 1ILEA 1EFPA 3CLUC 1MAUA 1V8FA 2O5RA 1OWOA 4QBTA 3RK1A 4G5FA 2G36A 1WXHA 3FH0A 1O97C 4MUKA 1N1DA 2OV4A 4OUDA 2ZUFA 3FIUA 1WKBA 4WNYA 3H97A 3IH5A 3AKZA 4HJXA 4MW0A 1O96B 1N3LA 5FO0A 4DJAA 1N77A 1JMVA 1YIAA 2DERA 4L2IA 2H2AA 2BTEA 1I2DA 5H7XA 2QTRA 3MMXA 1K4KA 4YP7A 1QU3A 2Z09A 1O0CA 1R6XA 2HMAA 1I6MA 1LI7A 3Q12A 3A04A 2DUMA 4EG8A 2QUHA 1TYCA 2NSYA 4MUGA 4MUHA 3N8HA 4PBRA 1F7VA 3PNVA 3E27A 1SURA 5J5AA 4PBTA 1M8FA 4J75A 3AFHA 4ND6A 3MXTA 1EFVA 3ISJA 4MAFA 3ZJVA 3CVVA 3Q4GA 4X0EA 3X1JA 1O6BA 3GUZA 5KWVA 3QE4A 2B7LA 3PNYA 4MUIA 4WSOA 1O5TA 1EUYA 3G59A 1X8XA 3FDXA 3HL4A 1BS2A 1H3EA 5TGTA 1O97D 1S4MA 4MVWA 1OWLA 1QJCA 1JZSA 1NUQA 3H99A 5K0TA 2PXHA 3ZXSA 2QJOA 2YY5A 2A1UB 4DDMA 4MUEA 5TS2A 3X1KA 4EG5A 3PNBA 1U3CA 1ZJWA 4MWCA 1WZ2A 3DPIA 4I6GA 3RJZA 3IDFA 1U0BB 4I6JA 1KH1A 2JANA 1B6TA 3ZGZA 2A7XA 2D54A 3KT3A 2IJGX 4CQNA 1OWPA 1KP2A 5BNZA 2JA2A 5HUHA 4KR7A 3QTTA 4MW4A 1YULA 3FY4A 1MJHA 1F4LA 4F4HA 4MWEA 4MVYA 4UZEA 2VXOA 2XRYA 1IRXA 4NATA 4DDHA 2VTBB 4XSVA 1KP3A 1ZH0A 3GLVA 3IOBA 1IQUA 2PIDA 1ZH6A 1M8JA 2CUZA 3FI0A 4KR9A 1FYDA 1K97A 4L2IB 3CLSD 1GPMA 1PFYA 1OD6A 4DLPA 4EG1A 1NURA 2O8VA 1Q15A 1MC1A 4DE5A 4U63A 3UK2A 1U7DA 1KR2A 1M8KA 5DK4A 5FO1A 2A1UA 1TYDE 3CLUD 2PZBA 4AS1A 2A88A 1G8GA
chains in the Genus database with same CATH superfamily
1OX5A 2XB8A 2ADOA 3H8JA 3WGTA 4UW9A 1GCIA 3VPCA 1GAXA 1G7SA 3R0ZA 2AV6A 4BMYA 1SUDA 2H5IA 2V3WA 1NJ6A 1H22A 4CDNA 2JFBA 2Z6UA 2XRMA 1OBOA 2GEFA 3HG7A 3PRJA 4YAOA 5FYQA 3V3TA 2OHFA 2A5LA 4R1QA 2I4NA 3VSEA 3TXYA 4B82A 3RYHA 3SQLA 3WRWA 4HRVA 4QU9A 1KI6B 3EZLA 3KD3A 3SNKA 2NO7A 4QDKA 1D2MA 3VR4A 2QL9A 4JQZA 3MT9A 4AQ7A 3Q6MA 1C7EA 4IIBA 5GM1A 1AZTA 3RKRA 3FUTA 2XYHA 5A5FA 5FR1A 5CUQA 2RG7A 3K0AA 3CBGA 2B7CA 4YJ2A 4LF9B 1HE1C 3WWZA 3D8SA 1PT7A 4E33A 3HXMA 5IT9A 5HQ3B 3PIIA 3TSAA 1VCOA 4IR7A 1EE1A 5KCMA 2VTBA 1WJGA 4GD3Q 2FRVA 2WC1A 1ZZGA 3T3PB 3LNCA 3R5TA 2FPIB 4CYMA 3U7QA 1GLNA 1Q95A 3SHQA 4QOSA 3KQLA 4HN2A 4OKSA 3GGSA 4FINA 2R96A 1E9AA 1BXZA 2BEVB 4ACBA 4Q9NA 4G0ZA 3MAJA 4S1NA 1EM8A 2P4SA 3OPYA 4P4GA 3X3HA 4F93B 4HMPA 4QGGA 2HA5A 1Y42X 1GN8A 4XIGS 5H4HA 3PTAA 5HIIA 3RSGA 2SKCA 1GADO 2XQKA 2P91A 4UBIA 2VSFA 1Z8HA 1TZKA 3FF1A 1JFFA 5FWXB 2ST1A 3KLPX 5LL6P 4JL8A 4YAKA 1UCFA 2AFHA 1LWNA 3B1JA 4UPDA 1OYWA 1ADFA 1TVCA 2K5UA 3FTNA 3CUUA 1UK8A 4HYTA 5LA6A 2IW3A 3M5WA 3OJCA 3UGQA 4ZVQA 2ZE7A 4KXLA 2RIPA 3EXEA 4RDIA 2EIXA 3I5UA 4H59A 3NONA 3W3AA 1JHAA 3CVXA 2R6DA 5C8YB 2YY7A 1OVGA 4I1OA 2QSJA 4EGAA 4QGSA 3ZLJA 3DAPA 3R9XA 3U9LA 5KVSA 5BQFA 4Q6BA 2IGTA 3RK0A 3T7KA 4MMYB 1INLA 1E5VA 4BLTA 1IJFA 1C0EA 1NW6A 4RD6A 1WQ3A 2PZJA 4Y6OA 2ZJYA 3PCTA 5I47A 4OHZA 1JJIA 3DWFA 4J16C 1P5ZB 4TM8A 5DXFA 3WHKA 2GSDA 2XZLA 3DONA 2DVMA 3OE7D 1KU6A 1MVLA 2UV8A 3RGWS 4IFEA 1W59A 4YCSA 4FR0A 4HUQB 3RVKA 3AU8A 2GAOA 4FFBA 3NFYA 2EYUA 4EO4A 3I1YA 3OLYA 3B5IA 3BH7A 3P19A 5AKIA 4AJ1A 1K9VF 2GYUA 1GV0A 1KQNA 4DDKA 5JJKA 4QL3A 4QRDA 4MLPA 3KQVA 2IXGA 1KJWA 2ODNA 3Q1LA 5E6UA 1T6ZA 1FFBA 5K4GA 4G4SO 1II0A 2B78A 4F1WA 1TVMA 3D6TB 5ES3A 4H0CA 3UMVA 4WFJA 4L78A 1I1OA 1TPYA 3JAWA 3WLNA 4MVCA 1KK3A 1R00A 4XB1A 3BWBA 1CRLA 1T5BA 3A6KA 3EXG2 1H94A 3SJ7A 1AGRA 1XOIA 4NBSA 4XTRA 3TOSA 1W36D 1CRWG 4ZT7A 2BDTA 4K9SA 4IMIB 4DAEA 3F5SA 2P2SA 4INPA 1PX0A 3DLIA 3KKZA 1SA0A 2L82A 4E2XA 1VMEA 4LJAA 5DSZA 1IK6A 1U0OC 1YUBA 2V4MA 3AF2A 3OIUA 5JI2E 1L7VC 2VDNB 1NIPA 2FFAA 2VATA 1MD9A 2PLAA 3NM5A 4NJEB 1CUAA 1QDLB 3A06A 3SR0A 4BV3A 2MYPA 3O91A 2PY6A 2CCJA 2ZSHA 3VKHA 1WABA 2BM8A 2JJ2A 2C2KA 3SFVA 5DEOA 3JAKB 4HDSB 5CX1A 3SD7A 4XWKA 2B1RA 4O4LB 1T24A 1E2IA 4KEAA 2NYRA 4D43A 4QASA 4WNAB 3AZPA 4O2BA 1PTKA 3FYUC 4TXLA 2UXCB 1R3DA 2C98A 2CZCA 3A3PA 3EB9A 2I22A 3RG2A 1ZVJA 3TI7A 1DCMA 4CLDA 3NANA 3K94A 3TD6A 3L46A 2Y3IA 3WYGA 5B3AA 3ZE8A 4RVSA 2Y93A 1FDRA 1D6SA 1OTXA 2JAWA 2XI4A 2P2DA 3BF7A 3GA7A 3SDZA 2I6SA 4WBNF 2HQBA 3BILA 3EHDA 1MC4A 4N40A 4EF5A 4E46A 4F3RA 5JNUA 4BGVA 1E1NA 4ES6A 2SHKA 2D1FA 3FNFA 3LM8A 2PUGA 1RI5A 4QXMA 1XD8A 1L1RA 2NXCA 1IK4A 4S2EA 4CKBA 3VAYA 4CMIA 2G76A 3MWLA 1G55A 2D00A 3KR1A 2GTPA 3SQDA 1X80A 3X1DA 1P33A 1TZBA 3BK7A 4TWJA 1B8UA 5KYNA 4P7FA 2DPHA 1H1TA 4KBYA 1PVDA 1ZEMA 2WR8A 4XGNA 3OI7A 4ZTUB 3Q41A 4LQDA 1NG9A 2CUNA 4M0FA 1X7GA 1N0VC 1NXQA 4JBWA 3V1TC 1KYVA 5KDLA 3RNOA 1G19A 5ED4A 1OH7A 4UEQA 3U7QB 4JJ6A 4V0SA 2IHTA 1MQ8B 4IIFA 2AK2A 3ON5A 4P3XA 4TWAA 3VM6A 1SR8A 3B3GA 3PQ8A 3DEZA 2VJLA 1OZHA 2HHJA 1QH1A 1QGAA 3HFGA 4X60A 4QM7A 5A3JA 4BJ3A 4PWZA 3PVZA 4ID3A 1WUTA 1CC1S 2J48A 2AYZA 3G5LA 2CMGA 3O3NB 3Q87B 5KC8A 2PXCA 4COOA 1WTAA 4EVSA 1N5DA 4KYTA 1U3DA 4EPWA 3IHWA 3GLFE 3ZI4A 4IRXA 1UADA 1F17A 2C82A 5C37A 3L7MA 4AF7A 3HC7A 2HAEA 1EXDA 1OBCA 3KX2A 1YL5A 2VJOA 3HU2A 1GHTA 2QRUA 1DQNA 1R0KA 1N2ZA 1QGED 2WDPA 2ZRBA 2ZRJA 3NBXX 2XOKA 4GBMA 4OJQA 4Q7EA 1LRJA 3RKUA 1QRDA 2SICE 3V8QA 3ZCXA 2C9OA 4I9NA 1I5EA 3CT4A 4B6OA 3G1TA 1UWVA 5REQA 2R97A 1T1IA 3R5HA 3LV8A 1CR2A 4MWZA 4NE2A 1LU9A 3IEMA 2DFNA 2JBAA 3K8YA 1J7JA 2ECQA 1PKXA 2R751 4CCYB 3N28A 2OG1A 4TXHA 5LB4A 5BV1A 3V2HA 4IVPA 1DXYA 1KH3A 3ZH2A 4DSTA 5E9WA 3HZHA 3OCYA 5IAJA 4EFMA 1UINA 5LPNA 2H2GA 5HQJA 3T34A 3X2EA 4B2PA 2ZBPA 1F8UA 3E9QA 4NBRA 2JI8A 3ETGA 1AGNA 3PNKA 2FZVA 1S2IA 3WKCA 4FN5A 4P84A 3JATA 1V6SA 5PNTA 1ABFA 1QTQA 1E3IA 1Z34A 2AC7A 1XKLA 2J4FA 2PUHA 2RGAA 3MOIA 4WHMA 4QULA 4FFDA 5DNEA 5KPJA 2PVSA 1HQDA 1FS4A 1R0LA 2AQHA 4Q9JA 4C07A 4POOA 1UM9B 3QE0A 4GWGA 3RK4A 5D3MB 1JL3A 1P91A 3DKRA 4B6GA 1AX9A 2CVHA 3BIWA 3HFSA 3GRKA 1IJBA 4V1CI 2YASA 4BVHA 5IEJA 1BMFA 4TRMA 4PRKA 1DBSA 5HFNA 3L7JA 2DH6A 3LHFA 3IAXA 3ND8A 4WIAA 2YWBA 3CRVA 8AT1A 5F2EA 5DPMA 3NQ41 1Z25A 4OQXA 3ASVA 2GXQA 1UBFA 4UHCA 4ZICA 1YASA 2MT9A 3CGWA 4LE0A 1HFEL 16PKA 2D5BA 4ZTBA 1O6FA 2YWGA 3Q3IA 3NGLA 5HBGA 1WHSA 4BX9A 3GWZA 3F6RA 1VIVA 2OZLB 1GR0A 1L3CA 3D0QA 1AXEA 3HHEA 3IBFA 2PQ6A 2VDRB 1WY5A 2X1HA 5AHRA 4ZOEA 1VKJA 3S2EA 4B7CA 2GEUA 1IH8A 2VA8A 4AKTA 5AVRA 5LQDA 1L1QA 3QWHA 1L5KA 4BQFA 3JVEA 4M9ZA 2I3DA 4EMSA 4NEHB 5EJGA 3EHEA 3NJRA 1E96A 2B82A 1MO5A 4NDAA 5JD4A 4UDOA 2WJHA 3GDHA 1IQPA 3K0KA 3KK0A 5JZ9A 1AUVA 1II9A 1Z7EA 1NVBA 3E8SA 2C94A 4A6XA 1UEXC 2YBDA 2RAPA 5GJBA 4IQFA 4G41A 1V71A 2AC4A 3FOCA 2CGEA 2QUBA 2JFNA 1AO0A 1KRHA 1LS6A 1TYEB 1ZUNA 3H1FA 3NHSA 4J4TA 4ZOLB 4JI8B 1Y8ZA 1JR2A 3KLMX 3MG9A 4A91A 3NEAA 4G0YA 5IC6A 4RK7A 5IFKA 4B4DA 2FMXA 4L75A 5IBRA 1Z5NA 3ZXYA 5CA0A 2FVXA 4GXTA 2I6XA 5K01A 2EHDA 3VHXB 1BX0A 3DLAA 5IT0A 2RGEA 3I64A 2YNMC 5K8UA 1MAWA 1U1CA 2C31A 3SLKA 4A16A 4NFHA 1JKIA 3DBHA 1M6HA 1P9LA 2IF0A 3FZNA 1XZPA 2H2WA 4Q1BA 2G9NA 3S1LA 5FPHA 4D1YA 2PWZA 4ZRMA 1XAIA 4MUFA 4MEBA 2H9YA 3KU1A 1QYVA 4LKOA 5FAKA 4YMLA 5DHAA 2ZZKA 3CEHA 3NBAA 1T3ZA 4W9MC 4YFYA 1CUEA 3JS5A 2BGTA 4NBLA 3OA0A 5DV9A 1Z16A 1H2ZA 3UAOA 3QLEA 4Z4GA 3C39A 1ILEA 1EFPA 2IHZA 4I3FA 2CXQA 1QH0A 1ETUA 5HKBA 5P21A 3KCQA 1ELOA 4QBTA 4LF5B 3ZWOA 1JU3A 1ZNYA 1AV7A 2HEIA 2BD0A 4WAUA 3PYMA 2DB3A 4Z4HA 2XMRA 4Y1EA 3DWEX 2JFWA 3CW9A 1U28C 3FIUA 3AR9A 3VC2A 1EE9A 1U0TA 2FUEA 3IJ5A 3JQ7B 3P26A 2P5SA 3DZFA 3DFFA 3M4JA 1Z0SA 2GGSA 2JCXA 4RGQA 4QOHA 2WOOA 5IX8A 1L4HA 4U2EA 4JC8A 5JFTA 5TLSA 1CJVC 1S9HA 3I01M 3ZHOA 1TIKA 4OYRA 3T35A 2JFHA 2BI7A 5DX8A 1M7HA 3WWCA 4WCFB 3STVA 2GCEA 4J29A 2DPGA 1SCJA 3MRXA 1QQAA 4KDCA 1C30A 2WSBA 3E8MA 4OHXA 1U0NA 4Q3BA 5FTJA 5LQAA 3QXCA 3IQWA 1MNQA 2C77A 1QLJA 4EG8A 3B2EA 5KAPA 4H35A 4CE6A 3T9FA 1D7OA 1E1QA 2RCNA 4GVPA 1F7VA 1TIBA 5E7IA 4WLFA 1X7WA 3QMVA 3A6LA 3PNVA 1LPPA 4XRRA 1SFRA 1E0DA 4HDRB 4TWBA 3UXMA 4X1YA 2RGNA 3AFHA 4HDCA 4D99A 3BTOA 3FOBA 2DFLA 1IB0A 3MN1A 4C5AA 2P2NA 3ISJA 4YJDA 5JQGA 1JSXA 2XADA 2YHUA 5J4LA 4XJXA 3EXHA 4O3FA 2PT9A 4Y6QA 3VJLA 4DLLA 3EZGA 3L82B 3EVCA 3MRSA 1O9GA 2HKIA 3N2NA 2HK8A 2J6BA 2YV5A 3K16A 4QATA 2JFPA 5JTUA 4WVFA 3T8YA 2R8YA 4P4NA 1HGXA 1QWOA 4G1FA 4LRTB 3UWSA 1Q6YA 4HQ0A 4OXKA 1L5RA 3A3KA 3VFDA 2AN4A 1K6IA 1OWLA 3KXDA 3ORHA 4MVJG 4DMUB 5GZ3A 5G0WA 1ZJZA 1TCVA 3BE4A 1TMYA 3BG5A 5CYGA 3V33A 3Q3CA 4MGYR 5IAOA 1RSZA 1QOZA 2QPOA 4ZVMA 4JWTA 1OC2A 3MQ2A 2IOYA 4P31A 3LFTA 1QYRA 3Q9SA 4P2GA 5DP1A 4BQPA 3ABRB 2OV1A 1UWKA 4PLYA 4F5YA 4DR1B 2WE8A 1BSVA 3DXXA 4I6GA 3ZWWA 5IS2A 1BZYA 2H1VA 1L9XA 2HV8A 3EFOB 4EHIA 1DO0A 5SY6A 2HJ9A 1ZXBA 2C2MA 1ULUA 1KJ8A 4QUIA 2CMHA 4JT2A 3A27A 3FKSA 3V9AA 3H2HA 1GTMA 1LDYA 1GVHA 1UEJA 2BCEA 1NDHA 5DM0A 4KWEA 4RDCA 3HGQA 2Q8QA 3PWKA 4TSKA 3JQQA 2JA2A 1JEOA 3ECAA 5C53B 2XODA 2X5XA 4UOQA 4MPDA 2F4VB 3OOSA 2ZK7A 1YS9A 4WUTA 1VI6A 2Y8EA 2B1GA 3HCBA 1KY5A 5FULA 5HCUA 3QOYA 1YR8A 1V7PC 5A3QA 1A7KA 1GPUA 2FQXA 1TO6A 1NRWA 3EBLA 4QVGA 3U60B 4L6AA 1R0CA 4ZAFA 2ZI9A 3FMGA 5ALMA 1GGMA 2OCXA 3RKSA 4JLMA 1A27A 4JMLA 2G8LA 4GEGA 4DUGD 2R9VA 4QSMA 2YZMA 1ZNXA 4IQ4A 5KWEA 1H4VB 3PBKA 5KQRA 5I9MA 2OZEA 1XWFA 3C6ZA 3HB1A 4Z9YA 4IUCS 5BQXA 1B41A 2LDBA 2QPTA 4MMXB 4MQLA 2Q7OE 3WMFA 3VHXA 2VUIB 2B35A 1WDKA 2M1XA 3NHMA 1V1RB 3IOMA 3H18A 3RG8A 3ZWXA 1MC1A 4KLNA 4QFCA 4EKEA 4ISBA 4X92A 1I7SB 5DHQA 3UV6A 5A04A 1ESCA 1Z0UA 3M6IA 5DK4A 4OU4A 1G17A 2DUJA 3ZOZA 1VJCA 3PFIA 3U9TA 3TW4A 2ZZMA 2WWXA 3WIVA 5I45A 4M0EA 2O8CB 1BOOA 1ID1A 1P61B 3EXHC 3IO5A 1LQTA 5I7WA 2VHWA 4BOYA 3JAWB 2QZZA 3TMKA 3OWHA 3AEXA 5A2GA 4L28A 4OQDA 3AR4A 4K88A 5TIIA 2VO1A 1C9DB 1QAQA 1D4ZA 4HLDA 1FUUA 4LPSA 2ZB8A 4MIYA 4NWIA 1ZH2A 3KVNA 2VKQA 2C7OA 3C43A 5JTTA 3UAXA 3TVTA 1KTVA 3QI2A 1QG6A 4GNRA 3HVKA 4B3BA 5A6SA 2DWOA 2QTFA 5BUCA 2JRLA 3AVPA 3THRA 2AJCA 4HNTA 3BFJA 2UUPA 4AN1A 3E9CA 2GJAA 2OWEA 4EKGA 4R71A 3GZNA 4LSMA 4RFSB 4JJ7A 2A9FA 2NNLD 3UF0A 5IUJC 3O2NA 5BMVA 5LC1A 3KLNA 1PZFA 1HUQA 3GL9A 3T7JA 2XBMA 2GX6A 2OGTA 4AJKA 2DPYA 1K7EB 2NM0A 3A3YA 1DDGA 3O7WA 3WBBA 1LI5A 3EY4A 4OXIA 4JENA 1I14A 4N18A 2GASA 3KJQA 5FNVA 1FOEB 5J43A 3GAZA 4WACA 2IEZA 4DNXA 2R00C 2QE7A 4NU5A 2AF3C 3EIXA 1XXLA 3N5KA 2M6RA 3TEMA 3LHIA 4MULA 3LFHA 3WK6A 4J1TC 3L93A 3MWDA 3R6GA 2G5GX 4DR6B 2J30A 1HT1E 2QMHA 3I6IA 1CIPA 4K3UA 4EHLA 2TYSB 1CY6A 1EFKA 1NBWB 1WAMA 1ZGBA 3DLTA 1QKKA 2W0MA 2OTCA 3DXZA 3L0CA 4L5BA 1WXQA 2KMLA 4Q16A 4Y9TA 4CM5A 2VP6A 1ECPA 3NUZA 3UFXA 1YHYA 4EMBA 3ANYB 1BJTA 2JFYA 2VPXA 2OESA 4RA6B 3T1OA 1EWQA 3CSUA 1C8BA 4O5AA 4UCQA 3L0BA 1X1DA 4ON9A 4CT5A 3QOFA 4E2WA 2G9UA 2Q5EA 3CNBA 1Y8QB 1I4EB 1NSTA 2Q6OA 1QHEA 4RGBA 4LY3A 1U04A 2ZSKA 4H1WA 3RVRA 5CXUA 1ZM2A 2B1IA 3EEFA 4DRXB 4N41A 4TV8A 2X14A 3FDZB 3TBHA 1U65A 2H7VA 4ZGWA 4JXKA 2XSZA 2Q1SA 2JEZA 3AOEC 1WUKS 4I66A 4XYEA 5BSRA 1MMFB 5IHPA 5EZSA 3TX6A 4ZI7F 4N0MA 5LU8A 5CB8A 4D44A 1Q0ZA 4MRMA 3GPCA 2HF2A 2XBUA 4I1VA 5A3RA 3ZUPA 5EI5A 5MGBA 3KKNA 2BJVA 3CX4A 2OMEA 2I4TA 4I4TA 1KBQA 4PO3X 1Q11A 3DAOA 3X1ZA 4KR6A 3DR5A 3ESZA 4ZAGA 1PR9A 1WMAA 3AEKA 4Q9AA 5DZSA 5IKEA 4N7JA 5KYUB 2Q3LA 4U5QA 2H11A 1T8TA 4TQ9A 4W7SA 1QHFA 4CMEA 1JX6A 4BNTA 3MF4A 1L4GA 2RGGA 5F21A 2V7EA 3FCXA 1ML3A 4JHXA 4M0CA 3CKYA 4Q1EA 1PZEA 2KI5A 2C4TA 3HY3A 2PH1A 3F3MA 3L6OO 1H5QA 2XNDD 1MBZA 1OI2A 1TD1A 2J5XA 3S27A 5AK3A 5MN6A 2NU9A 4QE3A 1ZQ1A 5B64A 3HVIA 4MICA 4YV1A 5AVWA 4BP3A 3OE1A 3SQWA 4PO9A 4D81A 1RWNA 1JP7A 2G17A 5JNSA 4HTFA 1KY4A 2QUIA 1Q1BA 4FLMA 5E4FA 1SC3A 3QY9A 5I7FA 4G25A 2G71A 3MWKA 1ZM7A 2GBGA 1YZTA 3CX7A 3GLKA 1T0HB 3L0DA 3AB8A 2I2DA 1JNYA 3AK4A 3VKVA 3VR6A 1DSSG 3RHSA 4DXDA 3EIEA 2VQ6A 2F48A 5KYTA 4CNBA 2V96A 3A1WA 2VOEA 3LZCA 4Y7CA 3FGZA 5ARDA 4F4UA 3UJDA 1RBYA 3ZJYA 4URXR 2B0JA 5LQCA 2VQEB 1G3QA 4RD2A 1FJGB 3EN0A 2FSVC 2PNJA 4EB6B 3ENVA 4X1KA 2YKGA 4YAIA 1TX4B 4QBKA 3HDYA 1YA8A 3BFVA 3IP9A 3A28A 4NENA 3Q3VA 5ITZB 1G20E 1V96A 2O3RA 3EUAA 2XVYA 2VSOA 3IP3A 3NVAA 3ODGA 3RTBA 4LGMA 3DW3X 3TDNA 1O6GA 4IWXA 4KXMA 1Q1GA 4Y2RA 4DJ5X 2A33A 1CQPA 2XNDA 1TZMA 1E2UA 2BHNA 4LRQA 4F4CA 5IFLA 3DDZX 1FNMA 4F2WA 1T4DA 3DCNA 3HWRA 4WK4B 3KG2A 4PGMA 4C29A 3G0CA 1WVGA 3GRFA 5KREA 4D3DA 5L8VA 3OPVA 1OE0A 3ECSA 1BYIA 1DKRA 1H5UA 3SHWA 2MSLA 2H29A 4BB6A 1GZHB 3N2YA 4BMCA 2HT1A 1PLKA 4M7RA 2BFEA 5J3JA 3I0MA 4BPRA 2QD3A 2FDRA 1BROA 4ZHQF 4XFKA 5DASA 2WKQA 4OOEA 1VGVA 1NFQA 1ZN2A 2QQGA 3UW3A 4DV0B 3N05A 3FGPA 2BAGA 1EFVB 1R4ZA 1ECLA 1N75A 1RM3A 2X1MA 4C1NA 1IOZA 5JC1A 5GMOA 5G0VA 4BZZA 4N3AA 2PX2A 2V9CA 3T3DA 4YWHA 1DQYA 3OFVA 3OX4A 4B5LA 2QNIA 2WPDA 4P2BA 4M53A 2YJ5A 5EIOA 5HCNA 5KWIA 3SZGA 4BX2A 4AX8A 3KYDB 5JRJA 3PKZA 1RPJA 5JMPA 3MJ4A 4LRXA 3AP2A 2R85A 3HFRA 3THXA 2R86A 2GBFA 2RKWA 4JBLA 3SC6A 3M83A 4Y0NA 3AG6A 1KI1A 3ZCUA 5I9TA 1FMCA 4G0UA 4ZIRB 3GT4A 4QFDA 3WO1A 2W83A 1ZESA 4CIXA 4MDEA 3AJEA 5HJ5A 4QOIA 4BNNA 3IULA 1RXVA 4IHJA 2P4UA 2YZ7A 1KEUA 5EIBC 4E51A 3PC2A 4PY2A 1X7ZB 4LI3X 3HR4A 1B8VA 5AVJA 3IDQA 3B1FA 4K46A 4NF2A 2BP7B 5C4IA 3OLVA 2HA7A 1KORA 3NIDB 3M33A 2EX4A 1BXRB 2NPOA 4IIUA 1PT8A 2WUDA 1S2OA 4LNUB 5THKA 2I0FA 1JUDA 2JRCA 2G4LA 3GCZA 2UYQA 3LPNA 1L5OA 4B4VA 3FDZA 1T2UA 2GWHA 3QM1A 4L0DA 5DHUA 5E6SA 3TL2A 3CNLA 2IS6A 3PC8A 4RIFA 5AQ1A 3KS9A 4O3MA 2QQEA 2ZT5A 4FQ5A 5F7XA 1M0WA 5HM6A 1K9SA 3QTBA 1GV1A 1U98A 2OZVA 4HDOB 1IEVA 1S4QA 4RORA 3RVDA 4B8ZA 3TRKA 1T2DA 3CKLA 2ZKIA 1J9ZA 4ADSG 4WI1A 1QVWA 3V00A 1SXJA 1GXSA 3CA8A 3ZGYA 1ILWA 3DGFC 4KAXA 3A6JA 2JLCA 3K0CA 1L8AA 3S29A 4FFLA 2PZEA 1R0WA 3AEKB 4ND1A 4OTZA 4AZ3B 2C5SA 1XKXA 4NXMB 1K2WA 4QAQA 4KNYA 1Q0SA 3S40A 3IQXA 5K20A 4WXRA 4HV4A 1Q1ZA 1EUCA 1RE0A 1U0GA 2VVTA 1RPAA 3BGDA 3IOEA 3PRHA 5KTSA 1N1MA 5HP4A 2RAVA 4CR8A 4MW7A 4PNZA 3DT9A 5FBZA 4MW6A 3GU3A 1FMTA 1RJ9B 3SXUB 1OB2A 3P0HA 4CDRA 4KFCA 4CR6A 1PUIA 3HEMA 3NTUA 3Q8WA 5DH9A 3OIWA 3GJTA 4TL6A 5HKLA 3SDBA 2FEXA 3T7AA 4FCWA 1TKRA 2OPBA 5HDBB 2JCBA 2Y76A 5K0BA 1CLUA 2WZDA 5GOZA 2GEDA 3DH0A 3FJOA 4RSMA 4AYTA 4L5IA 3KUDA 3U4MA 1N7IA 4QHTA 3O4HA 3Q15C 2ZFUA 4AN0A 5EMNA 1P2FA 4LDAA 4KSYA 1JQKA 5TGDA 1NQOA 3ZWDA 3Q11A 4GQIA 5TEWA 4BV2A 4RYLA 4B6JA 4G5GA 4U7JA 4CGYA 5EWJA 2J31A 1LPAB 1T4MA 2C0QA 5CBPA 1E2EA 1U1GA 3LO8A 4HI0E 2CBXA 3LKDA 1FDTA 2P9TA 2XIJA 3HPRA 5IULC 3P9IA 5HKOA 1Y6FA 2JHPA 4NCAA 2OM6A 4MR8B 3CPHA 1J56A 3QVGA 5C32A 3K1AA 2JIZA 1YQEA 4CW7A 1FA9A 4H3HB 4EI2A 2ORED 1F14A 1E69A 2E5LB 3N75A 3K0FB 2DPLA 3FNQA 3NFRA 4TYPA 2NZJA 3EASA 4M0DA 4JBIA 4D41A 1GQFA 1JLLA 3HWX1 5J2UF 3AL0C 2LIPA 3O73A 2FWRA 1U7PA 4R3WA 3NP9A 4U1RA 3TLGA 3VNSA 4EYQA 3FHTA 4F4IA 1IN8A 2MOKA 3BWEA 2HSZA 4B17A 2YMPA 5CDSA 4MS4A 5BSFA 5EPOA 4ZVLA 5I3ZA 1RQLA 5EXPA 5KQGA 4FYVA 1IBLB 1P0IA 4OQLA 3HVUA 3WWDA 3WGJA 2VJCA 1UMDB 3A4MA 2ACKA 2XYPA 3ONEA 3CG0A 1HFJA 2G0TA 1JLRA 3OZCA 3EJ6A 4YIKA 2OP1A 5I8PA 1VYTA 4TN5A 4W1QA 3EPJA 5F23A 1NW7A 3ZKWB 1OZGA 2DKFA 1W2HA 3ABSB 2GO1A 2QL6A 4K2HA 3RVSA 2BISA 2PUAA 3G2HA 2GEKA 1YMQA 3GFVA 1M6VB 3ND5A 2C2HA 3LG2A 2Q41A 2W4QA 3FUWA 2IXDA 3NHBA 1UODA 1DKPA 3AHJA 4Q4JB 4QELA 1UM9A 4N8SA 1NX9A 1W2WB 2X2EA 1RXCA 1Z7WA 5IF9A 2PXAA 2PFKA 2JFZA 3KXLA 2WJ6A 3QENA 4CGZA 3QITA 1EM6A 1JDJA 3FJ1A 3ZQ4A 1PW5A 4I55F 2HC9A 5CM9C 4ZYVA 2BEKA 1Z06A 4L9AA 3LX4A 1UF9A 4ESVA 4OL9A 1E6EA 2OE2A 5C8XA 4XDHA 4RIGA 1Z6AA 1W44A 4KQFA 2PD3A 3AR7A 2BGNA 4V0LA 1E6WA 2JFXA 4OQQA 1NONA 1NULA 4LJLA 3MHTA 1ZJJA 4YP7A 5B58C 5C1BA 4DNPA 4J1SA 4BNLA 4YX9A 1RBQA 2YN0A 2ECOA 3FPGA 4KQXA 4W1SA 5EJ2A 5JJCA 1LDBA 3UGTA 4MPRA 4D9IA 1SUIA 3PLNA 1P5HA 2WMYA 1NFRA 4XEUA 1S8NA 2UZ3A 1LF5A 2XWPA 3ZV6A 2EFEB 2P6MA 4P7GA 3FWPA 5JAOA 3PJDA 3TQRA 4JV5B 3KR2A 4K2AA 3IXQA 4LY0A 3D6JA 2Y6VA 2DHCA 2YZNA 3T41A 1UAGA 2X9QA 4YH1A 3FDJA 3I1JA 4J2OA 3PC3A 2I2FA 3OM9A 4G86A 3QYJA 1J7KA 5LKRA 4IDEA 1D2NA 5KVCA 4FMBB 4RWZA 1FP6A 2MSWA 1R6DA 3BB1A 4HB2A 5CB4A 2I78A 2QMYA 1S9DA 5KINB 1DWPA 5AW5A 4BP1A 1MHPA 5F64A 4K6KA 3DF7A 2PRZA 1Z4JA 4GLOA 1T29A 4DR7B 2NU6B 1G41A 2PSFA 4P93A 4YAGA 2AMVA 3MK31 3EVFA 5JWOA 1CY4A 2GSWA 1N0HA 4ZO8A 2JFVA 2WYOA 4RKFA 1D4AA 3IIJA 2VYFA 4C0KA 3ZWPA 1XIVA 2A9JA 3HJAA 3T5TA 1GQOA 3BKWA 5COQA 2G5CA 1KPIA 3GLUA 4DFDA 3PGXA 4QA9A 5DLPA 1PGPA 4UD2A 2VP0A 4ZAXA 4CMCA 2D54A 4GR4A 5FF9A 4BWGA 1JDTA 3USCS 3W06A 1AUQA 2PR7A 1I2ZA 4OHOA 3D02A 2CNWA 2HYDA 4F84A 2NXEA 3NNNA 1MOQA 4OA8A 1UJ2A 2CJWA 3J80A 2JKVA 3VSAA 1C9EA 1XTBA 1DIAA 1VPTA 2UKDA 3PLRA 4GUAA 2ZYSA 5KYXB 3WLTA 3ZDFA 1AH2A 2REQA 4KR7A 2QM8A 4FMDB 1L6RA 4NAVA 3OAAA 3DMRA 3FY4A 1E98A 2EVWX 1T2NA 2W93A 1D3AA 2V97A 2WQZA 5D87A 2POCA 1HDCA 1K98A 2O23A 4ENTA 1NWHA 5F76A 4JLVA 5E1BA 4CLRA 5ALTA 3LSTA 3Q1KA 3R9IA 3MILA 5KSWB 4MIEA 3GNQA 3M89A 1UKEA 2BT4A 1M8JA 3KC2A 2N3ZA 4R0MA 3B9RA 1JJ7A 4HVAA 1JA9A 4JI7B 1GSHA 2ZRIA 1PJ4A 2NXJA 3OM8A 3LHDA 4JASB 3UGKA 2Q1WA 3HA3A 4WDRA 2CLKB 3PC8C 4CQMA 3Q8KA 3KXIA 4OIFA 3VZBA 1H2RS 3SF8A 2C2OA 2X2OA 2ZAMA 3B7GA 4O4HA 5FBLB 5TY0A 3ZY2A 5CFZA 1J2JA 1JG7A 1XE3A 2FH5B 3R6LA 4KQ2A 1SUCA 3TJRA 4CWAA 3BXHA 2Y1GA 3ADCA 1TA9A 2QSYA 4O2RA 4EJSC 1N36B 4ZO7A 3L7YA 3GP8A 2VNKA 1MZVA 4IIVA 5K8TA 5EPUA 1DUVG 3CC8A 3RYTC 3W8NA 2NXNA 5CDGA 3IR5A 4HO1X 2W00A 3EY9A 5EIBD 1SMKA 2YWEA 2HO4A 1T1RA 1KPHA 4INJA 4PAWA 3K9QO 4PPGA 3QVJA 2AXPA 2NPIA 4PHFA 4EGFA 2VK2A 1SCUA 1U81A 4LUCA 2IHNA 1L4UA 2XTJA 2WQ7A 5FH9A 3FLEA 2OY0A 1YCGA 3CUYA 4P33A 4HLNA 3GEDA 1ZNWA 4ID9A 4Y6GB 5BN1A 1WUIS 3OZUA 1EDBA 2ORWA 3REOA 4IOLA 4UNSA 5H5JA 3PX7A 1KDZA 1HV8A 1SHUX 4O59O 1EESA 2VTEA 4YJ2F 1DMSA 3CNQS 4JMPA 5DN6D 2W6MA 1BE1A 3JZAA 3C16C 4FILA 3LW8A 4A0HA 4DBZA 1WB9A 2RGUA 1QF6A 2NTYC 1E0AA 4HUTA 1HA3A 2XDYA 2ZJ7A 4KNVA 2D2XA 5L6MB 3L9WA 4BAUA 3RJMA 3R0QA 3S28A 1AE1A 4TLLB 1EFPB 4ZT3A 1U5AA 4N5HX 2BRUA 5KNDH 4EG6A 2Q3JA 1QDEA 3EWAA 4IW3B 4J0GA 5E0OA 4Q3AA 5AR1A 4A26A 4K40A 5A1JA 2QL5A 5FOVA 4CLHA 2GO7A 5FBWB 1FXSA 1II8B 4U5XA 5BNIA 5HQ3A 1AGXA 2Z9CA 3DEFA 2WIKA 3M1AA 1GTRA 3LS2A 2ZITA 4J3JA 1J06A 1G8HA 2G09A 5EE9A 4NMWA 1NDUA 1UKZA 1K08A 5FFFA 5DNUA 2I9PA 3FWYA 5BWCA 1PF7E 3FFWA 1MPTA 3QA9A 2LKCA 4DADA 1DG9A 2GPTA 2BFEB 3S3TA 5GADl 4XLTA 3B7WA 3L4SO 3OEHA 3ZV7A 4MPTA 3AONB 2ZKLA 1IM5A 2CHEA 2I1LA 3IDSA 1EVQA 5ICEA 1JKJB 2EQBA 4BIMA 1C3VA 1P7ZA 5FOXA 3U5ZB 1FLAA 1F2UA 1PJ3A 1GCUA 2B9EA 2O4UX 2P9QA 3NDIA 4I50B 4TTPA 5EXDA 4DG8A 5B6IA 1DCTA 4Z4IA 5JSUA 1IY1A 3S44A 1DTWA 1G6Q1 4IDDA 1H9BA 1QG4A 1EP3B 1YQGA 2WYWA 3BIJA 3GYBA 2OBNA 1KAGA 2YDXA 4FD3A 4S1OA 4URVR 5JEEA 2WSSD 1QG0A 2EL7A 3FMVA 3BXFA 1QV6A 1YQUA 1HL7A 1Q0TA 3F7MA 4EK9A 1AKWA 3U49A 4F06A 4RMJA 4MUNA 3X1XA 2X3FA 6ADHA 4HQOA 2JGEA 2B3TA 3SYKA 4GL2A 3HI6A 5AJVB 3H4MA 1TB4A 2QX7A 3EXHB 4M1QA 3GZ4A 1MIHA 2QRNA 1R8QA 4QYXA 2WWGA 5FI3A 4P54A 1GTVA 1TU4A 2CUTA 1D0IA 1W0KD 5EFOA 1C7IA 3NIBA 4M0MA 3PLAE 2LD4A 1EHIA 3ELYA 5JAIA 5LUBA 4MRRA 3ZNQA 1R18A 3PA8A 1E1DA 4M22A 4OHCA 4EJFA 3IEVA 1E9CA 2ZAOA 3HU3A 1ULZA 3VR4H 1LDMA 2J9FB 1JHZA 3L04A 4YRTA 4E3ZA 1QP8A 2C58A 5TSDA 4UVIA 3T3IA 4QOGA 3HA5A 1EGHA 2DOKA 2MYNA 5FQOA 2QL7A 4K28A 3PB3A 3DBOB 2CF5A 3PX2A 4KCGA 4R9UC 2OILA 3NS7A 4H31A 4IJVA 3TLZA 1EWKA 1NYQA 2BLLA 1WY7A 2XYRA 1AG9A 1T91A 4RGYA 4DOMA 1FNBA 5JYBA 1AKQA 3KL4A 5EUMA 2A9QA 1EQUA 1M1YA 3M2PA 4A6DA 4BQSA 2VRBA 3O92A 1WV1A 1U90A 1WHTA 1Q20A 1VKNA 2FWJA 3LY5A 2NWQA 5AJHA 3I2IA 3T3GA 2PK3A 2ZYDA 4KO3S 5KJ6A 1U7ZA 2Q29A 1ZRHA 2UVPA 2NO5A 4X6LA 4CQMB 3KTFA 1XNRB 1Q1NA 1U9YA 5BVGB 1CZHA 1MIOA 4Q12A 1SXPA 3MWEA 2PX5A 2VG8A 4EUNA 4DQKA 3MOSA 3GVXA 3SPXA 3OOEA 1ZP6A 3TSOA 1EJ0A 1WNTA 2BOVA 4XCVA 3KBBA 3QH4A 1VBFA 4TWZA 4ZI2A 3JD2A 4CDMA 3D4OA 3KEOA 3PZBA 4EATA 2ODWA 2IP1A 1N5MA 1QQ5A 3THWA 3VNQA 1Y9DA 5HHTA 4Z9FA 1KRXA 3JAMA 4G0XA 4GKKB 4Z51A 1GNPA 1M2KA 4RPLA 3LXUX 1QRUA 2C1EA 5CR9A 1NYTA 1FFGA 3PJGA 1FC0A 2ZI5A 4IDNA 4EP1A 1S8FA 3NHAA 4Z0HO 4B80A 4HWTA 1CNMA 1E6LA 2EJUA 5AJXA 3PPWA 5B57C 4KW7A 3HXPA 1LJLA 2RHHA 5CM8B 3QKSA 1IPHA 1SU4A 3GGOA 4MWBA 5ELXA 1SGWA 1IZ7A 2WBLC 2P4EA 3DDWA 2ALJA 2VSXA 4JBHA 5G41A 4CM1A 3KUCA 1K68A 2CFTA 5IKOA 4RZSA 3VR3D 4QQKA 3GPIA 1QIGA 1YAJA 4QARA 2ZCVA 5ALVA 1C14A 4ZI7B 1GZVA 3RLIA 2GQ0A 1GZ6A 4MYRA 1IRIA 3R7SA 2CK3D 2JLYA 1IM2A 3I4CA 4FS3A 4EI9A 2H7YA 1E61A 3FCOA 1LRLA 1W5FA 1WB5A 4HEQA 2Q50A 2QVGA 1I6LA 3QLVA 4Y9SA 3TFOA 3HYNA 4E5MA 2DHRA 5E9AA 3Q5EA 1QRTA 3GGDA 1GGFA 1TXGA 2XD9A 4N01A 2AE2A 3CE6A 1GTG1 3DLBA 4UZFA 3HVRA 1RWBA 2JAQA 4ARZB 1JE1A 1MABB 3R8XA 1GYPA 1PJCA 3LCJA 1ZXXA 4LOJA 3ZNOA 2ONCA 3A6GA 1XDUA 4N5IX 5A9TA 3AHIA 4KU4A 4QUJA 4RJLA 2GETA 5DGDA 1B3BA 3AG5A 3P2IA 4BUJA 1RLUA 3AHGA 5FI0B 5K3FB 3C6MA 3EFOA 3CPJB 4KSBA 4LYAA 3VR1A 5IYZF 4TUYA 3ZG6A 1OXKB 1FTQA 1QR6A 1JWBB 2HMWA 1B73A 3E9YA 3CUSA 1A98A 3ISTA 4FEYA 3LC0A 4JODA 3H5IA 2MSCB 4H17A 4YUVA 4P0PB 2GLUA 4TZ6A 4LZLA 3WX0A 1K27A 3OIVA 1JAYA 3EQ9A 4YAEA 5D3KA 2O59A 3BE5A 3NH6A 4ZCQA 3RFVA 4O33A 1EFHA 2IU4A 4JI5B 1IXSB 2Y99A 2ZVQX 1E60A 1RADA 2C5GA 2IPLA 3PEFA 3ZIAA 1E7MA 2GAFA 2JK1A 3FROA 4KVFA 1E3LA 4UBMA 1KVRA 4GPEA 4JYBA 3ET5A 2BONA 4OYLA 5CW1A 3U13A 1OXSC 1J00A 1I7NA 3DYBA 1XQYA 3OOHA 3MGGA 4UTZA 3MAGA 5J4KA 4NZ9A 2KJQA 4R2HA 3GRYA 3ICWA 1PR1A 3THOA 3I01A 3IIKA 2G0AA 3ZEAA 1E6KA 2R7AA 3ZW7A 4CKZA 5F77A 2IUEA 3AEQB 5AI4A 3I2JA 1PS0A 2OOSA 1JF8A 3DPSA 3NX4A 1PBNA 1OKKD 3HMQA 4X3OA 3PNMA 1COZA 1OW3B 2P0AA 1Z6ZA 2WY2D 3UANA 3CO0S 5A5EA 4AMYA 1MJGA 3EH1A 1GFIA 3ZIAD 4E09A 4BGDA 1VJTA 4B2YA 3KB8A 4KIGA 2WHPA 2P9HA 4UFPA 2O52A 4WZZA 2FPOA 5HTKA 1G2OA 4TKLA 1HPLA 4FI3F 4HNVA 2GTIA 3A05A 2GWRA 2ZUUA 1BRMA 3BSSA 3UMRA 3OWXA 5JHGB 3NBUA 2VAXA 1G5RA 3KKOA 5E9JA 2GPNA 5DISB 4GI5A 3UJ7A 1KA9H 3H84A 4FKZA 4QXQA 2HSGA 1TAQA 2M2IA 2WWIA 2INGX 3SR4A 2VHXA 4GMKA 1IQ0A 1XRRA 4C0QC 4QOEA 3BAZA 4R2KA 1TTHA 4RFLA 1H6BA 3G7SA 5BVGA 2C4MA 1GDTA 4HN4B 1TUEA 1QM5A 3HHPA 1A9XA 3IKMB 5DW0A 3LT5A 1LFDB 3R4VA 4PLGA 3ZGNA 1T9GS 1ZJ4A 2WTAA 1KR5A 5D3QA 4CM8B 1T8RA 4FZVA 1KZGB 1RKXA 2YQ4A 5E1OA 2LPMA 2TMYA 2QZJA 1L5HA 4ABYA 4DBVO 1QE3A 1VIYA 1WIWA 1EZ1A 1TVKB 3L84A 1PNOA 5IWCA 4NU0A 1W4LA 3OZRA 4NU8X 5HBRA 4FLFA 2VNIA 4RMNA 3VO2A 1DL5A 1NUSA 3OOWA 4JX8A 3I9NA 3OQMA 3PHBE 4K6OA 1EKXA 2J3DA 2P9ZA 2VTKA 3IKLA 1EIWA 3AUTA 4KUGA 5HE9A 5D3ZA 4QFBA 1DQZA 5FNZA 4Y2HA 4G65A 1HH4A 1N2JA 1DAOA 5BW6B 4R9SA 5DHFA 3VXKA 5CDHA 4IHAA 2R44A 4KPYA 3K9NA 2VDMB 1DHRA 5JMOA 2FPLA 3LX8A 3ZHSA 2WNHA 1ZUNB 4JLDA 4ZOLA 1A5AB 4FZ5A 2WJWA 3LUDA 3QZUA 4ZQIA 2GEVA 4FGZA 1E1YA 2O0MA 1RI1A 4BLSA 3DDHA 2AKEA 4LYEA 3MNFA 1Y7HA 1AKUA 3BSWA 4DNOA 1CY7A 1S2GA 2PUVA 2ZPTX 5ILQA 3SZUA 4PHTA 1RHUA 1SQ6A 2YVUA 1QBKC 1DKLA 4KN9S 1KAHA 1H9AA 4GDFA 4NNPA 3V7NA 3WNQA 4ZOAA 2D3TA 4EO7A 1N6NA 4AF8A 4G0NA 1MORA 2DU8A 4GMDA 5EZ6B 2VF4X 4RLFA 5LIRA 3MJFA 2OLJA 3BAFA 5FPSA 5KSPA 2OCGA 3H4TA 4U9IS 3SJAA 3ICEA 2ZUFA 1DBRA 2HIHA 5KNLA 3UOGA 5KNBH 1HEUA 1ISIA 4CU5A 2WVJA 5JOQA 5KTPA 3UFBA 1T0PA 1ONNA 4L2IA 3JR3A 1KMIY 4BKUA 1CEQA 4EI7A 4BV9A 1YQ9A 2QX4A 5H7XA 4E5YA 3RV3A 4Z5XA 1G4AE 1CQJB 1K4KA 2AG5A 1QU3A 2OXRA 2IRWA 4GGPA 3UAZA 2G67A 4D8WA 5ENDA 4UCXA 2O2HA 4Q39A 3SMQA 1XK6A 2WAXA 1I6MA 1OIVA 2V8OA 4FGUA 5JO9A 3E61A 3ABIA 1E8DA 1Z6TA 1TYCA 2YNMD 1WU8A 1OZFA 3EEQA 4MUHA 5CMLA 5AI9A 1H69A 1LSSA 1ZOPA 1E1KA 3N59A 3HCFA 3OLXA 3RT1A 1F12A 4YMTA 1EP2B 1OLSB 5IXJA 3A4LA 3GLHE 5JS1A 3ENWA 3S2IA 1KOLA 1E2HA 2OD9A 2P65A 2FR1A 3VPXA 2ZIZA 1UPAA 2ASVA 1BTOA 1ZSVA 2EFYA 2G5PA 2MU1A 1M1YE 1ND6A 2NT3A 1H8HA 3BIFA 3BQ9A 4M1SA 5ALHA 4YPFA 3S8EA 1ULBA 1ATZA 1Z2DA 2VBIA 3P1JA 2PSDA 1N6LA 4TZTA 4F2GA 3V2GA 4OATA 1H0RA 5J1SB 4LF7B 4NKRA 3PQFA 2O8FA 2BFCA 2ZRNA 2HCJB 2R8RA 3II6X 4RY0A 4A0SA 2C4NA 4D4HA 5HOQA 3ZXSA 1GGVA 1W0CA 1OA0A 4CU2A 2ZWAA 5IRCD 2Z2IA 3LPAA 2EJBA 2JVJA 3L6UA 1THZA 1EIZA 1GGNA 3EXFB 3N39C 3P96A 3UAVA 1KETA 3PWSA 1OKKA 4FS8A 3A1UA 4IDPA 4LHXA 4PGGA 1DKUA 4PPYA 5K0CA 5FB3A 5HKKD 2RH9B 3DHWC 2IEGA 3JQBA 1CNFA 1CZUA 4LSWA 3E5RA 3FYUB 4ZFNA 2AR9A 3PFGA 4LZPA 5IUKC 2AS0A 2CJXA 3G2IA 4DNQA 4F1KA 3U16A 4PGAA 2A7XA 4LHEA 2O1WA 3O8QB 4AYWA 3IP8A 2WLTA 3NKLA 3LDGA 1D4FA 5AKKA 5BQOA 5AJZA 2UUBB 3AEUA 3BRSA 3HO1A 2JH3A 2NADA 3WYNA 1W47A 5EMMA 2ZU0C 4EGSA 3B8EA 1UIMA 1PJRA 2JCSA 2P3OA 4KE9A 4FSDA 4JQCA 2AUTA 2LE0A 1JDVA 3LIIA 4QOFA 3W9UA 1ONOA 1RAHA 3I12A 4NCKA 3T06B 2I6QA 2BMWA 1DI0A 4XOUA 4E6EA 4J0DA 2FGJA 4B76A 1GUFA 1QUFA 1EE2A 5AI5A 4NZZA 1X1EA 3CR3C 3JQBC 4AD8A 2O8BA 5FA8A 3K09C 2MHCA 3BMXA 1EK6A 2XWSA 3O4JA 3PI6A 3OMWA 1FS6A 1SB9A 2PEZA 3FXAA 1POXA 1CFJA 3I76A 3IRVA 4IJWA 4IFTA 4JEMA 3SK0A 2VTBB 5JPIA 4RK6A 3U7EB 2XGSA 4WV3A 3ZH9B 4CUZA 1FJ2A 1TI7A 4NHOA 1IQUA 1V1MB 2PIDA 2ZYTX 3TLXA 1ZH6A 4KXNA 3V4RA 4YT2A 3A6FA 3LT2A 1PJQA 4O25A 1ZK3A 2CJYA 4DG9A 1RVV1 2O8EB 2V6BA 2NZWA 5BO5A 4V0NA 3LDHA 3PGKA 1PFYA 4OP3A 1WVMA 1XL0A 3L41A 1LQ2A 1CHNA 1NURA 1RE1A 3A2MA 4FWIB 1TU0A 2QRQA 3T7DA 4LV8B 4R5HA 5ERXA 1QORA 2PPLA 5B3JA 2A5JA 3C3YA 3GT7A 2ATEA 4G4JA 2MDTA 4CHGA 1JYFA 1S0UA 3KVOA 4BO2A 4EGJA 1U94A 5SZHB 3QA3E 2ZJ0A 2PWAA 2UUCB 2EKLA 1KJQA 3G9XA 4WOPA 3GXOA 1KYXA 1KKLA 1T3LA 2Q3MA 2BP7A 2QG9A 1FVOA 1WUYA 2ZS7A 1IU9A 2IX9A 1J8VA 2FOLA 3G2LA 4FDTA 4IDFA 2OT3B 4FUTA 4YT5A 3OZAA 3ZI0A 3BZWA 3HVJA 1GZUA 4DBLE 3LVFO 2YJTD 2X1LA 3I0ZA 1RFGE 3W8DA 1XUOA 1AC5A 4ZO9A 4MCAA 4ZK2A 2M6SA 3BF8A 2XMBA 2R4QA 3RVJA 4WK6A 2X23A 3TXXA 5FJIA 4ZJPA 4DA8A 4RKYA 3C2QA 5JCOC 3ZDZB 3OF5A 3NMUF 4KXWA 2PQ2A 1CJKC 2JKYA 1YI1A 4URHA 4YUWA 3PJFA 1KE1A 1ESZA 1B93A 1SOWA 4II2A 1XDZA 1NBMD 1XQXA 1JEQA 4OHFA 4D79A 1XMVA 3T1HB 3UZUA 4EDFA 4NICA 4UMDA 3OG9A 1QZUA 2B8TA 1BGWA 4G5YA 4ZT2A 3G0HA 3TRDA 1PD0A 4X94A 4C0BA 4F9FA 2GM3A 2C2XA 3VTZA 1J8YF 3GHHA 1L5MA 1L7QA 3GW8A 4P8RA 3WP1B 4ML3A 2F64A 1RP7A 4Z2AA 4XR9A 1SXGA 1XZFA 2O1EA 3TOCA 1TC1A 4CV3A 4ZN6A 1P0CA 5KO2A 5DCWA 1ZD9A 4BVFA 1T0BA 3LTEA 4S1VA 3MYRA 5HF6A 1R0RE 1XCOA 3AY3A 4X84A 5BUZA 3ADDA 4HFRA 1M5TA 2H1FA 3WB9A 2J3QA 4PM4A 3K15A 1V41E 3UJAA 1JYEA 1QP7A 3CH5A 4JVMA 4L8LA 4B32A 4M21A 2HK7A 1CS0A 3H42B 4X7PA 3UT5B 4O08A 3K9BA 1EJ6A 1K88A 1OVMA 3D5TA 4Q1FA 3SSNA 4C0WA 4X91A 2FUKA 1UC5B 6REQB 4GX0A 4RMIA 2WF5A 1DEAA 5G2OA 3D31A 2PL9A 2KB0A 3S1SA 8LDHA 4MKGA 1VMKA 2A4MA 3AUAA 4KYUA 1FQOA 4JLSA 1SZDA 1GDDA 4X20A 3RUAA 1PT5A 4KRXA 2ERYA 3JAKA 5E4TA 4ER0A 4WCVA 3PK0A 5KNCA 1V9SA 1RZUA 4XUCA 3W04A 4E13A 2RHGB 1GNTA 1SG0A 1ULAA 1I3MA 2Q1TA 1S3FA 4BECA 2CE2X 2WU0A 1ZR2A 4I4TF 4LHSA 2GCOB 2R4UA 2RH5A 5MDHA 5A1TA 4U39A 4YDSA 4HDNA 1CBUA 2NOAA 3V42A 4ZOQI 4GP6A 5K0EA 1UZLA 4HLQB 3DFMA 3GAMA 1K7YA 4P53A 4FJ0A 3V55A 4JVOA 3IQIX 1PS8A 3QE2A 2Z5LA 1SKBA 3R0IA 4IGKA 5DYNA 1Z08A 3CPSA 2OCLA 2ZRFA 2Z30A 1HT3A 2Z0MA 2ZDGA 3I58A 4EO9A 4BNGA 1YZNA 3DEAA 2X4DA 4KPGA 4PO1A 3EGWA 4ZVPA 5IVPA 2H4ZA 1VLHA 2R6HA 2QYHA 2AOWA 4M1OA 5FUBA 1Y4SA 3PFBA 2Y6UA 3R76A 3WFJA 1UOPA 4GP7A 4RANA 4XVHA 4A0FA 1URPA 5DN6A 4BGUA 1QE5A 1Y81A 1NKTA 3BB4A 1PL7A 3IT1A 3KV1A 3MGBA 4IYJA 1VCMA 1FYXA 3Q8LA 1XDSA 1R27A 2FZ4A 4LZAA 4O4JF 3GDGA 3W0LB 5DLEA 3L7KA 4YUYA 4GXNA 1KJYA 5AUNB 4GHWA 3U31A 1QHIA 1AKTA 2J09A 2OO3A 4G5XA 4LGYA 3U7IA 1XZMA 4HAVA 4TTAA 1GZ4A 4Q01A 3C7TA 1OR8A 4LIPD 1GA4A 2NVWA 3RQIA 3VNAA 1UUFA 1ZLXA 1ESMA 5HRCA 5ERYA 4KQKA 4UPEA 1JR3D 1VSTA 2J33A 2N0SA 3IEXA 3BPSA 3H19A 4HL6A 4J7UA 3CJRA 4J90A 2OHGA 2CDRA 3BH0A 3I45A 5FOTA 4B35A 2EQ5A 5IAKA 3HGTA 1K2VN 4DLWA 1ODKA 1K8YB 4TV9F 1Y8AA 1DGQA 4DEVA 1LPOA 3M5CA 3KQKA 1LTHR 3WNBA 1HE3A 1BE0A 3Q2IA 4JEHA 2NXWA 6ABPA 4Y2GA 1JJAA 1K5HA 1PO7A 3IILA 3P32A 4IF6A 4PZAA 3ESAA 3H0CA 4NENB 3SX4A 5ITZA 4E7PA 1FSGA 1BHSA 2ZWPA 1HNZB 4C04A 3OA2A 1GRQA 1ISFA 4HK4A 5B37A 3RS3A 5IDWA 4XQGA 3NV7A 1YSCA 1CVLA 1DZ3A 3TWOA 2ZWIA 3QPUA 3WSWA 4PG5A 1Q21A 3DYVA 3LH5A 3TTVA 2OCIA 3CB4A 4FOPA 2RSLA 4XIIA 1Q50A 2PMDA 3CB2A 3QKIA 1W30A 3C1UA 5JH7A 1F38A 3ZNPA 3TTUA 4HS9A 4W7IA 3FLMA 4F9EA 3MTIA 2ATIA 2FN8A 5CYPA 3ZBUA 3QGMA 2QWXA 2FMHA 4M9UA 4AK9A 5JXIA 1R5NA 4AM8A 4EW2A 1E7SA 2IEBA 3OQJA 5JXHA 1XYYA 1JSZA 4I9FA 1A9PA 1L5HB 3E22A 1A1SA 3RC7A 1E2FA 3EPHA 1T6BY 4OMCA 1GVNB 1F48A 821PA 4QVIA 1KMHA 3ORRA 1WSBA 1QQ6A 3CN9A 1Y34E 4MA5A 2ZRAA 3T5CA 2ZBEA 3AWIA 2GZ1A 2EZTA 5DEIA 1U0LA 3OIDA 1P31A 2WT4A 1R7RA 2RGBA 3IX7A 4HH4A 3TD2A 5DNYB 1H1LB 1ICIA 1H3NA 4XR4A 4BAGA 2OFXA 5HOEA 1EFAA 2UYOA 1C4XA 3KQOA 1V3UA 2IIPA 1SVMA 4D9MA 1TEZA 4ARIA 4PX9A 2ZYIA 1U9ZA 4UU0A 1PV1A 3PI7A 1WCV1 1HEIA 2DETA 2P4HX 3OCWA 3ILHA 4DABA 4JT4A 3EMVA 4ZQCB 4Z8YA 521PA 3EX7C 3ZE2B 4O8ZA 5F12A 1H2WA 4PANA 5JFOA 1F0PA 4AI6A 1EJ2A 1OYYA 2WZQA 4R51A 2IWHA 2AVNA 1TM5E 1WSDA 1F8FA 2ZJFA 3BX1A 3KP1A 4JJ4A 5JDIC 4X7RA 3W9BA 5BVHA 4ZOBA 2OQVA 2Q7XA 4AQDA 3QLUC 3DP7A 1ATIA 5ISMA 2AK3A 1LNZA 1GQ2A 2F59A 1AUXA 1GNRA 1PEAA 2Z5GA 4G5RA 4NABA 1MG5A 4QECA 4U6NA 3L7IA 4F60A 1CUSA 2I66A 3KOXA 4WKCA 2P2CA 2GCOA 3M9XA 3VH2A 1VHWA 1MT0A 2CXUA 3FD8A 4GSYA 4U2KA 3ROMA 1A8IA 3ZD9A 1A5BB 2GZRA 2QN3A 1CV2A 1PVVA 2VK8A 1WXXA 4JITA 4YJGA 1QIKA 1HQKA 2C5LA 2X0IA 2XCTB 2I2BA 3QVTA 3WIDA 1UMKA 1SCAA 1Z26A 2YXLA 5L51A 5L95A 4HMOA 1YK1A 2KPOA 2AUNA 1VPDA 5B5SA 2GCIA 4P08A 4DV2B 2WUVA 3L7DA 2PHZA 4B48A 1ZMBA 2QA5A 2FB9A 3ACDA 1E62A 2J4CA 2JGKA 3LY7A 4F6RB 4RD1A 2EOAA 3L77A 1G3MA 3O2SB 3KJNA 4NV1A 5JCOA 2JL1A 1C7RA 4L3OA 4V0QA 4KN5A 2P7HA 5JAPA 2V3VA 4MR7B 4RLHA 3VDXA 4JB3A 3JD1A 1P80A 1NSYA 2C2GA 4E1AA 3RANA 4F56A 1NJ8A 1E89A 1AM4D 1U2EA 4IIHA 3VA7A 1PIWA 3P0JA 2FQ1A 3R0VA 4EB6A 1ZKMA 2WIFA 4GBJA 3DBIA 4IOMA 2UU9B 1L0BA 2Z2JA 5TF0A 2ZPUA 3MLEA 4PC1A 3IT2A 4RZIA 2L17A 1TYZA 5LP6B 3CXUA 1YRAA 1LJ8A 2GERA 1FSFA 3SQXA 1FVFA 2F3PA 2HDHA 1QCZA 4RHYA 4Y6SA 2JG3A 3NXSA 2J0QA 4GQAA 4QJBA 1OI3A 3HCEA 2ZI7A 1OLUA 2RHBA 4MHOA 3QG5A 4MARA 3UIEA 2E9SA 4DZZA 1K8XB 3LW7A 3O0TA 1SULA 2QUJA 5JYCA 2RHOA 1WDTA 4QPJC 2ZE5A 4DQLA 1SQSA 2EEZA 3IVXA 2VP5A 1SBIA 1XLTA 5DCYA 3NKVA 5C0OE 4A7PA 4US1R 3ND6A 1DIBA 2J67A 2VUUA 3AWDA 1MO4A 4EARA 2OG2A 4MI9A 4M60A 3G6WA 1CUHA 1NLMA 1VL8A 2IYLD 1AF7A 3MJDA 5G0SA 1RJDA 1G42A 1QFMA 2VAVA 3H2BA 1OHHA 4QC2A 2BZ0A 3ZZ1A 4DLBA 2H52A 3AKDA 4M98A 3W1EA 1J8DA 5T67A 3W6OA 4BDTA 1V2GA 5CX4A 4K9NA 1WA5A 3ZOKA 4OYYA 3DO5A 2ZT6A 3JVVA 4I5FA 3QVMA 3QW4B 3I9LA 4BZXA 1G5FA 2IHVA 4EJSB 2QNBA 1IMJA 3AB7A 3GQBA 3OM0A 3WYFA 3NASA 1XLTC 3SKXA 4CLOB 3EZFA 4D6PA 2WYIA 4M0LA 4R9RA 1OFVA 2NSJA 4LPKA 4CTMA 2VXCA 5J2UB 2OV3A 4GNKA 5BURA 5E8RA 1KDTA 4HNRA 4MS1B 5AW7A 4FKMA 2G88A 2ZJZA 2IXFA 1UT8A 3L01A 2CWDA 5EZ5A 2F3TA 2EBHX 4G1EB 3WWYA 1YGYA 1KFBB 1BHQ1 2TS1A 4BYMA 4CM7A 4CEIB 5AD1A 3QXHA 3LLSA 2R1TB 2D8MA 1X7YB 3R75A 4MYCA 2SBTA 5KI6A 2BFDB 4C5CA 2XB4A 3CLUC 3OEED 1C80A 5IABA 4BB5A 2C7VA 1M9NA 3C41J 3LKVA 2JC3A 1P3Y1 2ZCUA 4N49A 3PX3A 4NOLA 2WUWE 2G36A 3ENQA 3RK1A 2Q1YA 2D5AA 1GGKA 2A6PA 2WK1A 3D7RA 1W87A 1UL1X 3H04A 4X9XA 1J0XO 1X86B 3VX4A 1DFGA 1VOTA 4IKPA 1Z4MA 1O9HA 3IH5A 3WYAA 3GLIB 3PU6A 3WWOA 1RLTA 4QDOA 3BS4A 2J6IA 3PF9A 1YIAA 4Q4JA 3OQNA 3GLGA 1TCUA 4M9RA 3DL2A 4OFBA 1QLWA 4WN9B 3WL7A 2IYUA 4RPGA 3ZNNA 1KVQA 3MWDB 4CF7A 4EMTA 2HT6A 3K5WA 3SKYA 3A1SA 5BWBA 1K6XA 1OBVA 1NLUA 1RFLA 4HNSA 5LBIA 2RAUA 2EFHB 4F3NA 3WQBA 1G9SA 3G2QA 3LMKA 4V2UA 3H7IA 3IHKA 4F5ZA 2HH9A 3A1TA 1KDPA 3JYNA 4A10A 5MN5A 3E7FA 3G17A 4AS2A 2OV8A 1JU9A 5C51B 2V55B 2DP4E 2VH1A 3STYA 3J7AC 3VR3A 4W6QA 2Q4RA 3IR7A 3Q4GA 4CFYA 3G9TA 1O6BA 4F3YA 5KTOA 5KWVA 2C95A 5G1OA 2XPCA 4TN1A 2DYKA 1JEAA 2HA6A 2DSNA 4YHBA 4IS2A 3CCCA 4KO2S 4BRUA 1EUYA 2X4GA 4KIFA 1SBNE 4KXYA 1XCJA 1QOQB 4EEZA 4KLCA 4OOFA 1EEHA 3RJ5A 1QJCA 4OF4A 3RO7A 1Z5PA 1F1JA 2I8LA 5L3ZA 5TMDA 1D09A 4DM3A 1DT5A 1IN7A 5ADUS 1XROA 2L69A 3I2KA 3GPDG 3OZIA 4UVDA 3UHOA 3AFGA 1CUCA 4LRWA 1HKHA 1ORVA 3DD5A 5C8YF 1C0IA 4U7WA 1UDAA 1U1IA 1XJCA 2YYSA 3K2BA 4B3CA 4DL9A 4U7DA 2ISSD 4CDGA 5KHOC 1HRKA 2F43A 1CUBA 4KFTA 3FDIA 3JQRA 3LVRE 1DVRA 2YZKA 3WHIA 1J90A 1AO3A 4E07A 4I36A 5BRJA 2AW3A 3KOWA 1WZIA 1UDWA 1X0XA 4Q3OA 2W2KB 3RJZA 4YAWA 4L6CA 4O2AA 4QO8A 1X9GA 5HYVA 1FW8A 1FUIA 5EMJA 5EIEA 1GY8A 2D5CA 2C9MA 3I6ZA 5DM2A 1JLKA 4WECA 4AAYA 3VVLA 2Z1DA 3WSVA 2AUMA 2FNAA 3RRZA 1QHNA 1GNLA 4QTUB 5IBCA 1X1AA 4G37A 3DDUA 3QU9A 5BR8B 4CQNA 4JA0A 1FUEA 5FBQB 4X8MA 2AI2A 4Q03A 3C97A 3HKDA 3WICA 4MLDA 1NLZA 5SYMA 4KSCA 3ESRA 4ZZ3A 1VA5A 1GU7A 4W9NA 3FTCA 2RGNC 4H7PA 3G2OA 2QSZA 1XC7A 3IB3A 2WYUA 3NIGB 3RUDA 4DBLC 2PCLA 1WMSA 1X38A 3MS2A 4PE5B 1MHTA 1L1FA 4PTLA 1RLOA 4DDHA 4PLTA 3R6WA 4OLJA 4EITA 1LLUA 2BW0A 1OASA 2VL7A 1YCFA 4PR3A 2HF7A 1K0FA 3QG1A 3RC9A 4CL2A 3GDFA 4HY3A 2YW9A 1HDIA 1XTSA 3RFXA 2IYZA 3MWYW 2XOXA 3VR0A 3L5KA 5DGTA 4J1NA 3RC3A 1FYDA 1IB6A 2MMGA 1FSSA 2DR0A 3FLBA 4JBXA 4PVCA 4BBPA 5I4CA 2C92A 5MF6A 4EG1A 1K6JA 2PBRA 1HEYA 1QYXA 5IP5A 5DHRA 3K9LA 2HXYA 1S3SA 4O4HF 3AEZA 4OLAA 5LZ4A 3E82A 2GI4A 4N6NA 1KR2A 1M8KA 5F5LA 2IF2A 2B2XA 3R2JA 3EIWA 2ERXA 4NC9A 4CKEB 1XK7A 3CRQA 2D5LA 4H4DA 1BAPA 1P19A 2E4YA 3G6KA 3N0TA 4Y1RB 5I9NA 4FGWA 1W0JA 2V6MA 2QTWB 1P1KA 2MSDB 1GA1A 4TTJA 4ZEVA 5CG2A 3Q3EA 1T2FA 3DV0B 3CLTD 1M66A 1DKOA 1OSNA 1JHVA 1Q19A 1SVIA 3DP9A 2DFDA 3CFYA 4IIJA 2UYCA 2CMFA 5EGSA 1F9EA 3R7WB 1PR5A 1G4UR 4DVJA 1VXOA 1KYTA 1XA4A 4LZZA 2VQDA 3WIBA 4F97A 5GP1A 5I48A 2HGZA 1YDHA 2Q5HA 3H5OA 4C6TB 4MNTA 4TLBA 4HKTA 2Q8NA 3U56A 3FUVA 1P17A 4Q4LA 5FPYA 2AN5A 2GRJA 1HNNA 3D9QX 5EHZA 1FSZA 1NXSA 1VJGA 1W4AA 4KK3A 1QFXA 3FFBA 2JZCA 3LHKA 3UT6A 4C7KA 4MDHA 5IVKA 3QEBZ 3EARA 4PSVA 4EY7A 1HE8B 1MXFA 5B55A 5TDHA 1NBHA 2X22A 5CFNA 1L8QA 4HVCA 1ENZA 1I2BA 4YMUA 1XD2B 1I9CA 3KSAC 2RBGA 2BCJQ 2QYOA 3I52A 13PKA 2VYVD 1OAOA 2Y67A 3NOXA 2JJ2D 3RI3A 3HACA 2ODAA 1CFZA 1PD1A 3GEEA 2GN2A 3FAKA 1FTWA 4BNFA 5DX0A 1NV9A 4G26A 2VWQA 1L7DA 1T9KA 3HUDA 1GKKA 4ZVKA 4PFQA 5FORA 3BL5A 3PSHA 3QPVA 1E9DA 2YWFA 4IVQA 1U4NA 1X7XA 2JGFA 1WLSA 2WJ4A 4LC0A 1PYOA 2YHIB 1BKYA 4JC4A 1ZOIA 3ELDA 3MWFA 4LHVA 1SXJB 4MKIA 4UM8B 3QFFA 2K7FA 3EF3A 3FZEA 3A14A 2P5YA 4CM4A 4I1RA 1Z0ZA 4OGLA 3S1AA 2AHRA 1V6AA 2QN6A 1L8LA 2ZBUA 5EHXA 1XZDA 3RFTA 1X15A 2XZDA 1FP1D 3DV2A 3GG9A 1PW7A 1GZSA 4UQLA 3QE9Y 1UDRA 3L7LA 1VXRA 2HZBA 1CJUC 2QTGA 3UJCA 3T0GA 1G4HA 4WADA 4BY9E 3F8WA 1JBQA 2CY0A 3KDAA 5IK2A 3S2GA 4WJLA 1DAMA 4QYIA 3W1WA 5KKCA 2XMSA 3KWLA 5I5EA 1IIBA 2R79A 4UBOA 3HA7A 5ALLA 4AFNA 2FWAA 5ED0A 2R11A 4G1CA 3I1FA 5AHWA 4GH5A 4JUCA 2QY6A 1QHSA 3KPJA 3R5KA 5T5QA 2RC5A 3GFGA 3ZLUA 1U31A 1UAAA 1Y63A 2A0UA 1IY0A 2FSUA 3ML1A 3BJRA 4LY9A 1SXHA 5JATA 1T4GA 2ZYHA 5KJ1A 2Q2WA 1FP4A 1AQ6A 3I09A 2F8LA 2YHBA 4NBNA 5ELLA 1T5DX 3GJ4A 4N5MA 3RYFB 1TCBA 2VFAA 3E35A 1Z7BA 2IQ5A 3JTEA 3F3SA 1SM4A 5K8VA 3BMOA 3CLVA 4RY8A 1LFAA 1Z22A 3Q7RA 5IK2D 5L6LB 5ARCA 3C3CA 3I4LA 3BTUA 1ZGAA 5G4KB 1LBIA 2ZRLA 4RSRA 1KY3A 1C1XA 1YQDA 4I99A 1V9LA 3SC3A 4LW8A 2Y1OA 5TARA 1M1NA 2ZUSA 3CUWA 4MGZR 4P4SB 4WD3A 1MB9A 3ZWMA 4CN8A 1ZC3A 1ACMA 5IWAB 4BO5A 4M8NE 1SC4A 5CBPB 1Z2CA 1AS0A 2WTUA 2VHZA 3IVCA 1SOAA 1IEXA 2WMDA 1TTPB 1CETA 1WM1A 2GN1A 3FMOB 3N07A 4RA6A 4JX9A 2AJBA 3O8QA 2CL0X 1SIOA 2AJLI 2G6TA 3NT2A 3UK1A 1V3VA 2W4IA 4DKJA 5ALYA 3N6XA 3BM5A 1ZRSA 3NTOA 4MGKR 4WY8A 4YJFB 3FTDA 3NKFA 1JJVA 3CS3A 3U7HB 3BT7A 1PR2A 2OZLA 3HRKA 4A6EA 5HKKA 1QRSA 2IHBA 1SVSA 3UH0A 2P6RA 1CIVA 4MW9A 2RONA 3LECA 2ERCA 2H3HA 3GG2A 4GZLA 2OSBA 4I5EA 1ZJ6A 4L5YA 4A6PA 4C7MA 4GMXA 4GOMD 2Z4TA 3A6HA 4HDAA 4U3JA 1D1SA 1T1JA 3AF4A 3ZY6A 4AECA 1IBSA 1RHQA 4LYFA 4X3PA 4G01B 3VSCA 1HTTA 5HIKA 1Z5WA 4AICA 3VC1A 2D5IA 1Z4QA 4A8JB 5LIPA 5C3MA 4JOBA 3RF7A 4WLUA 2F1JA 5M3BA 2RKOA 4KP7A 2IT1A 1C3XA 2DBYA 1DADA 1Q17A 1XMIA 4M83A 1Y1PA 1O87A 4TSFA 4QJ3A 4XFJA 4K03A 3VPHA 3UGJA 3S2SA 1JHRA 5LCXA 3SE7A 3HZRA 2QBYB 2PZKA 3T99A 4AY4A 5M2QA 4EY6A 4EYEA 4G8CA 3E5HA 4J91A 3ZBPA 2HQOA 3R3HA 1G20A 1GPJA 4G6ZA 4GKBA 4Z8XA 2J3JA 4MKZA 1KDOA 1MQSA 4Z3OA 1PN3A 1J23A 4HTFB 4R9NA 2WMNB 3AM5A 1L7OA 2YC2C 4IP0A 1U2TA 4B31A 2BR4A 1MO6A 3E58A 3I8XA 5U4QA 2IZ1A 4D5GA 1ISPA 3X43A 4ND4A 2XZOA 1Q1AA 3CV3A 2WVAA 3IESA 3PENA 3JW8A 4II7A 4LEIA 5GOTA 2YVLA 2H4XA 2VAPA 3NHKA 3RAEC 4RQTA 2ZPAA 2VDLB 3LPCA 4RIHA 3HA2A 1JLMA 1YCDA 4H6VA 3DO6A 1N1EA 5LYYA 1OYOA 3F7NA 3ZWKA 1YB2A 4EJ6A 3FHCB 2OMKA 1U2QA 1SWWA 3HNPA 4LNHA 5F5XA 4DR4B 4C7OA 4JT9A 3WK9A 2JLUA 1NNLA 3PYXA 2QTBA 3FNBA 4YRJA 5CRIA 1JVSA 1UJ6A 2HSWA 3IKVA 3KTAB 4K6GA 2XT0A 5IJ9B 3GYGA 4IY1A 3D1JA 3ZE6A 4RL4A 4D9JA 2Z2YA 3ZYCA 2WLSA 3VPAA 2WU3A 1RT9A 2CFOA 2OM2A 1R15A 4YRCA 1F6WA 1LD3A 3EPRA 4A8PA 5FEUA 1UBGA 4PCVA 4YREA 4DCTA 3TTTA 2QTVA 4TUYF 3ED1A 1LS1A 2P2LA 4IQ8A 3U7JA 4PN7A 2ZUEA 2PUCA 1E8NA 4I14A 4CKWB 1NVVQ 1UBHS 3OPNA 4ZVNA 5I6DA 1RXYA 5CDFA 4ZT4A 5KCZA 1GTL1 1Y33E 3ZGVA 4C2BA 3KWFA 5BN5A 1VP3A 2A84A 1U9IA 1KI9A 4MR9A 3TW0A 1SELA 1BMFD 1ZK1A 5KX5A 1UJCA 3P71T 2COKA 1YDFA 3P52A 4P3NA 4P81A 1ZU5A 2VNHA 4IWNA 3QWAA 1JR3A 2YJ3A 1ZH4A 4KAFA 1R0YA 4NULA 4YRDA 3QPAA 2FRXA 3U1BA 1VSBA 1XTKA 2HQRA 3GNLA 2P5TB 1QH8A 1AHIA 2XDWA 3N0VA 3WKEA 5JROA 1ORHA 3QUSA 1Y4AE 3PHIA 1USIA 5KWJA 1DT3A 3ZK9A 3PGA1 5K0LA 4DT1B 1T0UA 2XCOA 2OHJA 4QLOA 3TLJA 3TSZA 4D3XA 4DXAA 4KVZA 5FHRA 4E03A 1F1BA 4YK7A 1UFOA 2CMDA 1R6UA 1REQB 4HF7A 4KUEA 2NYVA 4R7ZA 1GUDA 1Y37A 5AW6A 3TL6A 1Z38A 4KACA 3U1TA 4TYNA 1RP1A 1VMIA 1UIRA 4Q1DA 1RABA 1ZX1A 4NONA 1TM3E 3GPLA 3Q0EA 3CLSC 3T5AA 1XQWA 2AQIA 4G1BA 2ZRQA 5FIUA 3UAYA 2V7BA 1GN9A 1USKA 4YALA 1L3BA 1BCRB 1SKQA 2JVKA 1AZSC 3L0OA 1XMOB 2PT6A 1Y89A 1FYVA 1G59A 5FTKA 3EODA 2AMYA 3C8MA 2OAEA 3SLRA 1SUPA 4DWWA 4ND3A 4ZCLA 1M0EA 3MHPA 3UMSA 1EK2A 2PR2A 4A5SA 4RZ3A 2IXEA 4PCAA 1YO6A 2RK6A 1Y80A 2X7JA 1JFTA 1XNHA 3RFFA 5FPQA 5CPFA 4MUAA 1OBFO 2IUYA 3HJCA 5EQDA 3E4DA 3ETNA 4HDKA 4HQ6A 5CPBA 3K53A 3X1MA 3C5HA 3GLQA 2CVPA 4UUBA 2Q5QA 3GCGA 5U1PA 3H5WA 1I3KA 3H6GA 4JP3A 1GM5A 1KVUA 4K7JA 5FOQA 1AGPA 4LZOA 2LVBA 4B0OA 1EQAA 3QU4A 1N8NA 1QB7A 2F1OA 4QPDA 1JDBB 5H70A 4XWGA 2GBLC 2X5OA 2FW6A 3EJWA 3TRIA 3I5XA 5TV2A 4FLEA 3QELA 4TGLA 4DV3B 1RWMA 1TGVA 2G70A 4PLPA 4PZZA 3L1UA 2Q2NA 1SU7A 3M4ZA 5TS3A 5E38A 4KQ9A 3CX8A 5JQWA 1BA2A 2AOXA 3GFRA 1K6EA 5AKHA 2XJ9A 4Q4DA 3E9NA 5K3BA 5A3SA 4YXWD 1YL6A 4GPAA 1WMEA 4W5NA 3CZCA 5C7OO 1O95A 1G1AA 1QO0D 3ESXA 3KYCB 4Y18A 4A9AA 5I7OA 1V6CA 4OXQA 2AZ4A 3H9CA 4ZQHA 1NN0A 3ESCA 2CN1A 3GRRA 3KEGA 5AOCA 1TPZA 1JPNA 3O38A