2IXDA

Crystal structure of the putative deacetylase bc1534 from bacillus cereus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
232
structure length
232
Chain Sequence
SGLHILAFGAHADDVEIGMAGTIAKYTKQGYEVGICDLTEADLSSNGTIELRKEEAKVAARIMGVKTRLNLAMPDRGLYMKEEYIREIVKVIRTYKPKLVFAPYYEDRHPDHANCAKLVEEAIFSAGIRKYMPELSPHRVESFYNYMINGFHKPNFCIDISEYLSIKVEALEAYESQFSTGSDGVKTPLTEGYVETVIAREKMFGKEVGVLYAEGFMSKKPVLLHADLLGGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LMBE-RELATED PROTEIN
publication title Crystal Structure of the Bczbp, a Zinc-Binding Protein from Bacillus Cereus
pubmed doi rcsb
source organism Bacillus cereus
total genus 79
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 2ixdA00
4XM0A 3DFIA 3WL4A 4XM1A 3WE7A 1Q7TA 2X9LA 5B2EA 3DFKA 2XADA 3DFMA 3WL3A 5CGZA 4XM2A 1Q74A 2IXDA 5B2FA 5BMOA 4EWLA 3DFFA 4XLZA 1UANA
chains in the Genus database with same CATH superfamily
1FP4B 3KYBA 4HAZA 3R7DA 3W9BA 1FP4A 3FBTA 3WI7A 1FMLA 2E37A 3ZWWA 4COOA 1SG9A 3HZOA 3O7MA 3B6MA 3EFHA 3EWAA 2ZRGA 3P0RA 1SXPA 5TC4A 4J1TA 4XWAA 4UXIA 1JQEA 1T13A 2Q99A 3C6QA 4BY9E 2XECA 3L0ZA 1JSXA 2FSUA 1Z0FA 3EZ9A 5EWLB 5EWLA 1IBRA 2JEOA 2O19A 3UAXA 3F9RA 4LPKA 3ZHOA 4D0GA 4MYRA 5EIAA 2V6MA 4ZAFA 2CNBA 1T3GA 4LVNA 1V4NA 4DIOA 3LKZA 1GARA 1VLVA 3OEHD 3DEAA 3FVVA 2YNMD 1NLUA 4BE7B 3FB1A 1Y7HA 4KQCA 2ECOA 3A10A 2XMCA 1GA4A 3KKMA 4BJ1A 5LCXA 4ISBA 4MICA 2P9ZA 3KCNA 4CMJA 4RHCA 1ZS9A 5DTQA 1JWBB 1QYXA 1OD6A 3ZS8A 4ZMBA 4YUVA 2P2DA 3L40A 4GI3A 2ZUFA 1WDMA 5H81A 1AOXA 5DVZA 1TAUA 3P0IA 1W5FA 1ZC4A 3EG9B 3EG9A 5DU2A 3L07A 1FFBA 3SQOA 3UICA 4Z8XA 2WTAA 4P4SB 2W6CX 4B6FA 2JH9A 5DSXA 3GO4A 5LB2A 3RWOA 3JSAA 3GYGA 1CJKC 2J5BA 3RYIA 5K0ZA 4I4IA 3QVKA 1MPTA 3PA8A 2H9YA 5DTRA 3WMXA 5D87A 3G8YA 1SUPA 4HYQA 3NT5A 4IYJA 2QQEA 3I9MA 3LOUA 4DUPA 1JUDA 1AVTA 4JUDX 5KYYB 4XEHA 3ZWQA 5KYYA 3V4SA 3QFCA 3C3MA 3RTAA 3AEZA 4ZIRA 1UC9A 3S2EA 3R3VA 5CNKA 5J9FA 4UFOA 3ERCA 4BTEA 4OI1A 4ER5A 3T7RA 3BB3A 3P9RA 2B4RO 4ZQCB 4ES6A 2V7EA 5BV8A 2IHKA 3O2QB 2PAFA 3KU1A 4K40A 1EXMA 1NE2A 3ONEA 4LTMA 2OV3A 4UCFA 4R7GA 3TQQA 2X7JA 4ZJPA 2K2WA 3IAFA 1BFKA 4IDNA 2UUOA 3O5AA 5FULA 5JHGB 3HBLA 3GQVA 4JX9A 1OYYA 1M2HA 3VTZA 4FHGA 4JKIA 2PSFA 3JTMA 1QO7A 1U4SA 5T3UA 2A57A 3K96A 1KI9A 2Q5FA 1N36B 5BSVA 5K4GA 1PV1A 1YRBA 1YZVA 2BUAA 4JOCA 5BNTA 3UUWA 1QFXA 1TO6A 3AIMA 2B20A 2VKTA 2WAMA 1JDZA 4LOJA 4PHHA 5ENDA 4PG8A 4IVNA 2P1ZA 4C78A 3BRQA 3OLXA 3QUSA 1RPAA 3DPUA 1B26A 5H3HA 4HNAB 4UNRA 4NV3A 4HNAA 1DSSG 1XN4A 2YY5A 4OVKA 5EZYB 5DYGA 5EXXA 2WR8A 4K6KA 4PZEA 1L5FA 5GGYA 5B2EA 2QQ0A 1KQNA 3MFQA 4JOSA 4M86A 3OLWA 4BYGA 2VAVA 4WASA 4AMVA 4CT0A 4NYJQ 1OH7A 2IX9A 3HUEA 3KLBA 3GAAA 3L2OB 4Q9DA 3AUAA 3WB9A 1OWNA 2I1VB 4GEGA 4GR5A 3PQ8A 3UK7A 1COWA 5F7ZA 4ER7A 1VKZA 4JLBA 5C8DA 1XNQB 3V4LA 3HCBA 1KK2A 1WJGA 1QTNA 1GTMA 1O2DA 1AHNA 1XVUA 2VJCA 3G82C 3LPDA 2WF8A 2QT0A 3B8HA 4ND7A 3Q40A 5DM2A 3UFXA 4OI4A 5CVDA 2H2DA 2Q5LA 3M3PA 4CFZA 3PRJA 2WV9A 4HB4A 4EG5A 2B4QA 3KQTA 4L8VA 1H8HD 4YV0A 2QV0A 3JYNA 2RB5A 5LLSA 3M83A 3B3JA 2ANBA 3GDWA 3WA7A 2XZLA 3BXEA 1XUOA 3ND7A 3DAPA 2GJ8A 4HLCA 4N6GA 1C29B 3SYNA 1PN3A 1RMTA 4DARA 2XNDA 1YTUA 4BN0A 2ZRJA 4BP1A 1LCIA 3Q10A 2YW2A 4CV1A 4XWWA 4HFNA 3FFAA 1TZJA 2EBHX 3IKVA 3DFFA 1IJFA 2ILVA 3RTCA 2WVAA 5KREA 4CR8A 3FGZA 2O20A 1EWKA 1L4LA 1XN1A 4NBTA 1II9A 2NXEA 3A4VA 5CHEA 3ZX4A 5BVGB 4L5YA 5BVGA 1D2AA 3KKKA 3HZZA 3T41A 2CEAA 3N39C 5KWVA 5AXBA 4Z7QB 2ZZMA 3OUTA 4IX1A 3DO6A 4CG2A 3DKVA 3DEZA 2AVNA 3DFKA 3VJLA 1XE3A 3G9QA 5F9FA 1XV5A 1XLUA 3FNGA 5FXMA 4A7PA 3FBGA 3IGFA 1GGKA 3I72A 5JRZA 3K94A 4DLLA 3ZDYB 2WPDD 2CLKB 3FPBA 1VSTA 1X8LA 3PXEA 3U09A 2VQ3A 1CIJA 4DE5A 3TIFA 3CJRA 4L72A 4PYJA 4DCSA 1COZA 2OBXA 1XZHA 1M9NA 1SBQA 2VDOB 4EY4A 1N9GA 2FN7A 4EY6A 3EZGA 3GRPA 2GWRA 2R62A 1IE3A 3VOAA 2BRUC 5BQPA 1Y8RB 4UEQA 5KOYA 3PEYA 1Y8RA 3FIUA 1FYDA 1W75A 1L4NA 1IEQA 3W4KA 3GRRA 4AS1A 3FW1A 3V00A 5BW5A 1YQUA 5BSEA 2EFCB 2V1XA 1N2CB 3U3OA 3A6PC 1TAGA 1N2CA 3U7EB 4C21A 2P6UA 4RCZA 5ULLA 1ZRSA 4K87A 2PK3A 1DU4A 3ZWBA 3H5WA 5DULA 2VT6A 1J97A 2YL2A 4IIDA 3UHJA 1J9GA 4B17A 1QYVA 3F6CA 1SKAA 4IDDA 3U4GA 4MDEA 2ZUEA 2RGDA 1BU8A 4BVHA 1SPBS 2GXSA 2QTNA 2RK6A 4MQUA 3WBJA 4A91A 1YS9A 2Y1FA 4TT3D 3OJOA 1T10A 1H9AA 1WW2A 2WMOB 4BMDA 5KDDA 1TM5E 5FPHA 4RQTA 3R41A 4C43A 2D6FA 2O7NA 3M6AA 1Y42X 2C8LA 4CZ2A 1ADJA 4AXXA 2E0IA 3RFTA 1A5SB 2EFGA 3LHFA 4YJKA 3U31A 3ZCXA 3DHVA 4WBXC 2OYRA 4W99A 2VDRB 5IBQA 4KDCA 3RIYA 3Q0EA 2ZRAA 4PAQA 5ILQA 3ROEA 1WQ1R 1WXIA 2FE4A 1SY7A 3DOIA 4ZVMA 1TIBA 2ZTHA 5JIBA 1ZJYA 1DKLA 1HY3A 2FR1A 4C9BA 3LTEA 3VBEA 3DLCA 3GFSA 4EPWA 3GUCA 3IP5A 1YZTA 1NJ6A 3HABA 4HK4A 5DO9A 2Y9MB 4EW6A 5BMOA 2VHVA 1RKBA 3DFZA 1P1CA 2QD5A 2FZVA 3QI2A 3ADBA 1O87A 5AKGA 5TJ9A 4Z8YA 1F06A 5TNXA 3UWSA 4OPMA 4DGQA 3VNVA 5HE9A 1QHYA 4ZI2A 1E58A 1U3CA 2H1IA 3C5HA 4FSDA 4NCXA 1CVIA 2PQ0A 1Y1KE 2QL5A 3Q7RA 2RGXA 2ADFA 2WIJA 4IZIA 5IRCD 1R0RE 1GRVA 2AZTA 3ZZ0A 4NY1A 4N8DA 5HA5A 2Z6AA 3IUBA 4RS4A 1D1PA 2QM3A 3M6XA 2ZYWX 4RK7A 1WHSB 5DEOA 2BKAA 1WHSA 2CMFA 3QVMA 4B33A 5HP4A 1Z5UA 3GLUA 1VPEA 3CSUA 1LRJA 3DLTA 5HZKA 2D7DA 4KWCA 5CA0A 4TGLA 1VPVA 4KQJA 2CCGA 4YNBA 3V7WA 4XQGA 2HZ7A 1F8GA 2X8BA 4DPKA 4LF9B 1PEKE 2C5GA 2EQAA 3F5MA 5C8YF 4V38A 1CF4A 2EF1A 3KSZO 1PZGA 3CZCA 2FXIA 3L05A 3SEAA 3ZXSA 5A5DA 1WETA 2R48A 3E7DA 2X2PA 4PRKA 3SKVA 1K0FA 3ZKAA 2OBLA 3KWJA 2BFDB 1NF9A 2UKDA 5LMNB 3I37X 2XYQA 4HEQA 2PR7A 3D1VA 2EBWA 4YACA 3GFGA 5BQ3A 2VZEA 4XEUA 3V2HA 5AUNB 1P7VA 4YUXA 2PUEA 1TTPB 2JZNA 2Y93A 2ZYAA 4PYOA 4RV5A 4YHBA 4ZOBA 4D8WA 4ENSA 2O14A 3F71A 3VTKA 5BWCA 4F56A 1E2EA 4UTRA 3TZEA 4IIEA 3VO8A 4WBNA 1T2EA 2I2WA 5E4YA 4BWYA 4MHTA 2ON6A 3BHIA 2J3JA 1THGA 5J4KA 1Z26A 2R6R1 3G1TA 3QYAA 1LSSA 2B4YA 4D97A 1ODKA 3C0KA 4ZOAA 5H02A 5LM3A 2OBMA 1D8AA 2R9VA 1DWOA 3OX4A 3H5AA 1BG6A 3IXLA 1XWWA 1FJ2A 4QJ4A 5DB4A 3TI9A 2YRFA 5BURA 1MTOA 2YR0A 4MVYA 2P6MA 2XCUA 1S3GA 3FF4A 3G17A 1I94B 3O73A 2H48A 4YRSA 4KQMA 2Q07A 5B6PA 2FGJA 3SKYA 3KSBC 2O2CA 2P9QA 3A06A 1AUXA 3EY4A 3D2AA 2HQSA 2OBYA 3QQ5A 1LDMA 4BKQA 4YCSA 2FW9A 3L1JA 5LU8A 3AOGA 1JVNA 5KTNA 1G55A 2XVYA 5LWQA 2VF5X 3TCXB 5KVSA 1HL3A 4LF4B 2Y71A 4EA9A 4ZRMA 1JR3A 3Q4GA 2XKAA 5JR3A 4DIUA 2JCGA 4HZGA 2YJ4A 3I52A 1JJVA 4XM0A 5KC9A 3F7OA 5FQNA 4ER6A 4CL2A 1V47A 2I3BA 1B42A 4RJKA 4JEHA 5AKHA 5E2AA 4FYXA 1E3IA 1ORTA 1E3TA 2IRWA 2W90A 4R83A 5A4MS 4CJXA 1UFOA 4J0GA 2C0CA 4Z86A 3TX2A 1XMOB 4RK5A 5DNYB 5IDWA 1NTRA 1EJ0A 5LDDC 4EHJA 2YWRA 1GPLA 2O07A 5JSQA 5EQDA 3C8DA 4FZRA 2BGJA 2WWWA 3PE6A 2HNAA 3TF5A 1KJJA 2HUPA 3EXG2 1KA9H 4WKPA 3BDAA 2FZLA 5G0UA 1TQHA 4KIGA 2J7PA 3A32A 5ALNA 3L7JA 4ND3A 1MEOA 3CF0A 3Q15C 5E7IA 621PA 3ONNA 3RF7A 5EAIA 2XE4A 3SM9A 4EENA 3RE1A 2GFHA 4PYMA 4CV3A 4PRYA 2C8JA 4G85A 3H84A 3MD0A 3KSRA 5AKKA 3ZHRA 1HX7A 1JHUA 4A6EA 4HQKA 5MHTA 4KXXA 1YFZA 5JOQA 4JUAA 4IJQA 2COEA 1NQWA 1VBKA 3ASYA 5B3JA 3OFND 3WVNA 1GZDA 2JZOA 2Q49A 1OBOA 1UPUA 1DEOA 1DC6A 4DV2B 1JN0A 4XCVA 4S1PA 1LLFA 4EVIA 1WXDA 4O59O 3L0BA 1QE5A 3GJ5A 3WK4A 2RGGA 4GOOD 2EQBA 3HWX1 4NP6A 3UW1A 4RKFA 4GYJA 4MKIA 3VRHA 3L8YA 4DIBA 2AW5A 1LZLA 2JFXA 3PYMA 1LPNA 4LYYA 4MUEA 1Y5IA 4MW2A 1VCOA 3BWCA 4Y30A 1TTTA 2JIPA 2H9IA 3RRFA 5EMHA 2HDOA 3G5AA 4J2TA 1FFYA 4LOIA 1XI2A 1E6LA 3AILA 4AMYA 3IO3A 3PIDA 4Q4HB 1ZU4A 4KQEA 4Q4HA 3WGZA 5CA1B 4PGMA 2VK8A 4AJNA 5LYYA 5CA1A 5A2QA 2WMYA 1WMBA 3DT9A 4IQGA 5ALDA 5L4NA 1L1EA 1PK8A 1U1IA 1BZYA 3T5MA 4EH1A 3C6KA 3UQYS 2IGTA 1BA2A 5T57A 4Y3UA 1YNSA 2B98A 3F1LA 4B6PA 3BHNA 4DLRA 1GRQA 4FXOA 4HDQB 3MRXA 4HLUC 4G5HA 3OE7A 1Z2PX 3ZJYA 4GKVA 2GA9A 2C2OA 4I0WB 2VBGA 3HYNA 1P6XA 4EHBA 1QGYA 4LY3A 3DHEA 3T3MB 1I10A 4KBGA 4DJAA 1O7JA 3VYUB 2HWWA 3TKYA 3A0UA 4J9UE 3M49A 4H6WA 2R44A 3TQCA 3UGKA 3AI2A 3O84A 4LAFA 2BT4A 4Z7JA 3IPYA 2JNWA 4MV6A 5HF6A 1QGED 2PG3A 3C43A 4UUPA 1I6WA 2G6BA 1GYQA 2APJA 3OJ0A 5EWJB 5EWJA 1KVSA 1NSFA 2YIJA 3SM3A 1DHRA 1JEAA 5HQJA 2QP4A 2EL9A 3EF3A 4JGGA 3DC7A 1Z13A 1E3LA 4RTMA 4J8PA 3K1AB 1D2RA 1LBHA 3FR8A 3L49A 1WVMA 3K1AA 1KZ9A 3CY6A 3V6MA 1NGSA 3W5IA 4PNZA 4R41A 5ALXA 4INPA 1TJ5A 5EP4A 1U28C 3E23A 3ZBQA 2BKUA 4YUZA 1ZL2A 3PDHA 4UCWA 4N8EA 5LA6F 3FPKA 4LDRA 4N8SA 1EFDN 5EMNA 1EWQA 4CLXA 4BC0A 1UWCA 3D3KA 4FPXA 2FQXA 1JVSA 4I4CA 3X1YA 5JY1A 3SBXA 4ESVA 2OCIA 1EB8A 4XOIA 2G8LA 1HDZA 4DLKA 4TMVA 1BQEA 1LA2A 3ABQB 2IF2A 3NETA 4U2BA 1VHJA 4EW1A 5CT9A 1DOHA 3KL4A 1JI0A 3WP0A 5KDLA 4BUZA 3BIWA 3ENKA 4K03A 5FOTA 3IBFA 2R00C 5AI9A 5WRFA 3S8YA 4EHKA 4D3ZA 1T2CA 3UC9A 5EHZA 3PFKA 3AGPA 2HF8A 3RVQA 1DJNA 1TVKB 1EDZA 3IQEA 1TVKA 2HQOA 3EVNA 5EIOA 2YWJA 4X64B 1VIAA 1XZAA 4CFYA 5JS7A 2NSLA 5B64A 4BNDB 3ISTA 4BNDA 1ZD4A 3F78A 1KZGB 1QF7A 4LXQA 4OQQA 2OEPA 1UOQA 4A4DA 4DLYA 1KEUA 3OOEA 1HFEL 4LJ6A 2G07A 2OXIA 3WXMA 1T4MA 3E9RA 4A92A 3KVRA 4RULA 2IBTA 3JZIA 4JBIA 2ODTX 4CKBB 4WLFA 1C4KA 1U7XA 4CKBA 1YK0A 1WUIS 4FNGA 5E9JA 4DLWA 1VP9A 5FBHA 1HT2E 4HPWA 2E48A 2VHZA 2ZPUA 4OI0A 1NW3A 5KU1A 2W2PA 2YZ7A 4L78A 6Q21A 2HHLA 1KIAA 1U90A 2JFHA 1D04A 4P4LA 3BH6A 1SHZA 2QD3A 3D8BA 3G2PA 4JC0A 2Q0HA 4CDNA 1L7NA 4CMEC 3G2NA 5D3QA 4IEIA 4CM4B 1SPXA 2CE7A 2PO5A 3JRNA 4CM4A 2XIQA 3P9PA 1RE0A 2PJRA 1C80A 5K6TA 5CYFA 2ZRKA 4BNJA 2QEQA 5AJXA 1XXLA 4MARA 4BU0A 3MCZA 1NM5C 1CZOA 4KO2S 3C8HA 3QTLA 3L7YA 2WHRA 1IPHA 3GAZA 5CX1B 5ALTA 4MVJA 5CX1A 1GCUA 1KP9A 1YL6A 3ND8A 1DX6A 4OD0A 4R54A 3W2TA 1I2MA 4IG9A 2B69A 3NATA 4PSCA 1W9HA 1LBEA 3L5KA 4AUNA 1GCAA 4P22A 1X13A 4LDZA 2ZIUB 1KEEB 2XB8A 4O02B 3DE0X 5K3OA 2C42A 4WI1A 1KEEA 3L4BA 1SEPA 3O2JA 1BRMA 5JI3E 4ROTA 4DILA 1FDRA 1G7CA 1USWA 3X43A 1G8GA 3CW2A 2J0UA 3B8EA 3HH8A 2XNSA 3F67A 1QG0A 3QEMB 5ELLA 3HN7A 5IVKA 3QEMA 1XMIA 1W47A 4O4JF 2WTUA 4OHPA 3AFNA 3BRWA 3E5HA 5GQSA 2LXNA 2PJDA 3B38A 5L7YA 3OECA 5EZYF 1DPFA 3T5DA 1YCGA 2D0DA 1YDFA 2AG6A 3B1FA 4MLDA 2Z1DA 2H2WA 4G6ZA 3CNHA 1H2FA 4S2UA 1V45E 5TMEA 4ARIA 2FJPA 3D3EA 4PLWA 5EHNA 2MCFA 3QYPA 2DQ4A 2JKVA 4M7PA 2PSEA 1BMFD 2X5JO 5AESA 4DDWA 1RYYA 2CLLB 1AKQA 5FWDA 1TU3A 2BI7A 3GVHA 4MCHA 3L79A 4AZ0B 3KQUA 4KLCA 1FYWA 1A95A 4U6SA 4AZ0A 3CZ4A 2CUTA 1AO0A 3ETJA 4DM7A 4R81A 3B1ZA 4FONA 4OXQA 2VRWA 1M1NB 3UJ9A 1M1NA 1FFAA 2OD9A 2ZI4A 4TV8B 1FYXA 3Q8WA 3KYCB 3WIUA 3KYCA 4AY6A 3QKTA 4F4DA 1R6UA 3B6KA 1E6KA 4I1PA 3VNAA 3R0VA 3MOSA 3WP1B 2YWFA 4F4JA 4KPEC 3R76A 1R0LA 3IO5A 2I8AA 4TWIA 1F12A 1FUUA 1BFUA 3VPGA 4B81A 1CBUA 1CY6A 3I92A 5J2UB 5ICCA 4NVRA 5J2UA 2Z9BA 3ROTA 3SEZA 8ATCA 3BCHA 1ZD2P 4DMMA 2AVDA 2YQZA 2YXBA 5GP1A 4ZTZB 1TCAA 4OHCA 4EECA 3WK9A 1WQ3A 1H8ED 2NXJA 3P26A 1T5SA 1ZGZA 4KB5A 1EG7A 3M0EA 3KALA 1KJ9A 4TMWA 3VUEA 1ESEA 4B80A 1U11A 2HFJA 1NN1A 4S35A 4UTPA 5BR8B 4EP1A 3HU2A 4BO3A 4F06A 4UXJA 5HNKA 1ZU5A 4GYKA 1NVTA 5THQA 1E6MA 3ELBA 4K8OA 2D1SA 2I87A 3MT8A 4LE0A 4UUBA 3AC0A 2IUUA 4EB6A 4EB6B 2PX6A 1IBKB 2ZT6A 3KCQA 1N78A 1OIXA 3R24A 2EZ8A 2I2FA 3LQYA 4FINA 3KR2A 3QJ5A 3WKAA 3I9NA 4JASB 4YR7A 1D8TA 3OPYB 3RSGA 1IY2A 3T34A 2XQJA 3OPYA 3FCEA 3IAXA 2IEYA 1QV7A 2ODPA 2PX5A 4ZO6A 1K97A 4BFLA 2EATA 2WD8A 3NEPX 4OH7A 5TRTA 2QX9A 1EQ2A 3WGIA 4NLLA 1CF9A 2J0EA 2ODWA 5K2OA 4MK4A 1XTKA 2VRNA 2GBCA 3IV7A 5FBLB 5H70A 3GLFB 4BO1A 3C1TA 4D57A 4KK4A 1TLFA 3WRXC 2JLWA 2D4AA 3CB4A 4Y0AA 3WGKA 5G3YA 4LK2A 4J2OA 5E6UB 3KM0A 2HLDD 1EUDB 5E6UA 5A3JA 4Z4EA 1EUDA 1Y9EA 3LZDA 4BU1A 2WE7A 5H4HA 4MW0A 1POXA 2ZPTX 3CQ9A 4EKYA 5KEIA 3F4LA 1O0SA 5HJ7A 1IL0A 4HLDA 1W5TA 1R27A 3ZY6A 3ETHA 4YGYA 3B60A 4HGNA 1NJ8A 3QVWA 4KPFC 2H52A 3HB1A 1W4RA 3FE2A 4J94A 4C7OB 1WD5A 2D0OB 3INTA 2UV8A 4RDIA 2G9ZA 4O5AA 4EW3A 4C7OA 2PWZA 1YQXA 5KNCD 2WUFA 4AF7A 3AW8A 3P19A 3GGJA 2H2FA 4K9KA 2ZBDA 1M6WA 4EL5A 3KAPA 3NLLA 2CMKA 1IOLA 1H0RA 1NQ5A 4KE7A 4MQLA 3VZSA 3PYXA 1JGTA 5H82A 3WLEA 4EZBA 2FA9A 3AFGA 1OVMA 4HV4A 5AVSA 3V4RA 3OI7A 3Q9SA 4KJXA 3TLJA 1Z18A 2P8JA 1P8AA 2ZIXB 3EVTA 1XCOA 4K28A 2ZIXA 1CYDA 1LDNA 3U60B 5CIYA 3WL4A 4A26A 5GOZA 1XELA 3UWOA 4B6OA 1J06A 5HOQA 3OCJA 4R2KA 5FRDA 2RGNA 3T7TA 4PX5A 2XMGA 1U1GA 4DLUA 4ZAZA 5EUQB 4D8TA 3BL6A 4FGUA 2O06A 4XDZA 2VP3A 1S8NA 1N0HA 1S8FA 4OQEA 2VVTA 3U17A 3KQWA 3DOUA 4YWJA 3U39A 4IRMA 1HOTA 3O91A 1KU0A 1Y63A 2ZEJA 4HYEA 1AKUA 1EVJA 3FGPA 5JYEA 1T3LA 1YB1A 4MS4A 3VR5A 4EKGA 4JLAA 2O8CB 2DWCA 4MB2A 4AY5A 1LVHA 1Y3CE 4OHZA 2O8CA 3GJ0A 1MJNA 4BP8A 1EWYA 1Z6PA 4H3KB 2G04A 2Y8EA 3LUBA 5I9IA 2NN3C 3WGOA 2YUIA 4NE7A 5JWOA 3VR1A 1HNWB 4FHCA 4ZN6A 1TB4A 4RVGA 3WFJA 3EQ2A 1SQSA 3PC3A 2AFHE 2GSDA 2NO6A 2C3OA 3BGDA 2I33A 3Q88A 1ZISA 4L08A 1SC4A 2ZXUA 1DO8A 1KKUA 1PQ4A 3JQAD 4L9AA 3T9CA 3V1MA 1NWHA 4YMTA 3R6GA 4V1CB 4ZQGA 3EHDA 3GGSA 1CULC 4V1CA 2Y0PA 2DPMA 3NBMA 1QG6A 5IUKC 2GNOA 1XA3A 4DJJA 5EJ7A 2BGKA 2YBEA 1XMJA 3G02A 4URFA 5E7JA 4ATNA 3CISA 4DNPA 2AX3A 3EUAA 3LFUA 3DZKA 1UXKA 3ABRB 3KTFA 3PQ4A 4HY3A 4YO7A 1SBYA 4A6DA 5K0TA 4TZ0A 2WM8A 3AF5A 2ZBPA 5DM70 1P5HA 4KXLA 3KD2A 2MIIA 1FYFA 1M5TA 1MOSA 3VC1A 4EB8A 5GZ1A 1UANA 1DFIA 5CVCA 4DCCA 5H9WA 3I5YA 2DB3A 4IYRA 1M2VB 5FWNA 2Q9UA 1NLZA 2WVHA 1M2VA 1Q1QA 2YDXA 3MCWA 4O1HA 4PBRA 4TUYB 5KWEA 4TUYA 1EK1A 2CL6X 1NUQA 2IPXA 1OI3A 4YWHA 5JC8A 3THWB 5GTDA 4QBTA 3THWA 3AKYA 3OPMA 4IJVA 2WYIA 1HFKA 1BVYF 1XF9A 1KHTA 2HWXA 1UKCA 4FQ8A 4MVJG 2REXB 1PWXA 3TMKA 4DC9A 3I53A 2BZ1A 3PXDA 5AK3A 4ZU1X 3I8XA 4B2IA 4BOYA 2HSWA 3M9WA 5JV5A 2XA9A 3FDFA 4WNIA 3ACCA 1Z0JA 4WZBB 5L3RA 3PXCX 2B37A 4LE1A 2CVFA 2I2DA 3D6TB 4YPVA 1CQJB 3BQ9A 2H2GA 1CQJA 5AJZA 5ERXA 2IPNA 4LZWA 2CXHA 1PK7A 3NM4A 5KS2A 1OC2A 1XRNA 5MF6A 1C8KA 1DT5A 1MJ5A 2VJKA 3WO1A 2RAUA 3ZDRA 3ISJA 3PJGA 5B6JA 1K66A 4L15A 2AE2A 2A5GA 1IHOA 5EKSA 2R79A 3ZE6A 1AV7A 2FG5A 2IKSA 5E4FA 3AL0C 1M83A 1XTPA 2JLSA 2OGUA 2OYCA 4YMUA 2AT1A 3C7AA 1SM4A 3F0TA 5LUBA 4K6MA 5E38A 3UN1A 2PKQP 3IDZA 3EC1A 3FUUA 3E7WA 3KX2A 1UJ5A 2LDXA 2RHWA 2LPMA 1DBQA 1H69A 3ED5A 4R7TA 4U02A 2RCYA 3B2NA 1GG9A 1UZUA 4WWHA 4ZT6A 4BDTA 4MSUA 4L27A 1KYTA 1N9ZA 2CZQA 3QKIA 1XWFA 5AI6A 4ENUA 3D6HA 3ROPA 3N1UA 2VHJA 3NR2A 3WLQA 4F2GA 1QLJA 2PDAA 2OZVA 3LY8A 1ML3A 3MTAA 4QIHA 2WKWA 1XAJA 4NU0A 3O9VA 3QPCA 1MHTA 2CFSA 4UTVA 2Q9BA 2CKMA 3INYA 4QOSA 3D4NA 3V97A 3IHLA 2OKGA 3L6RA 3EXIB 2BBTA 4XJSA 4FOPA 4RFSB 4FYKA 4RFSA 2ID7A 2H7CA 2NZUG 1G20E 3OC0A 4WY2A 3E70C 1BVHA 3GJZA 4WDRA 4D41A 3OEWA 4D9EA 1R16A 1PJZA 1T5IA 2AMJA 4UQOA 4CI9A 3S81A 3GFFA 3KB1A 4U9HS 3KHSA 1PQWA 5KNCH 3ESRA 2HV9A 3QVSA 3VYVA 1C1XB 1N92A 2HIHA 3JQ8B 3MJVA 1C1XA 2QJWA 1I2BA 3JQ8A 2V7QD 1U0NA 1OXBB 4C01A 3JQFC 3PNBA 4Y67A 5FOWA 1J39A 3HP7A 1QCZA 2AN5A 1M2OB 2Q2VA 3UJDA 3W8DA 1M2OA 4YV2A 5DOZA 2FTKE 2ES4A 3PTAA 1K8QA 1UKVY 1Y3BE 1C1YA 3PXXA 1N9KA 5TF4A 1IHYA 1SCIA 5K6AC 4AY3A 1MO4A 1JG3A 1OI2A 3C4QA 2AG0A 3K09C 2XGSA 1ZJ5A 1VA5A 1CFZA 3JD0A 1SBTA 4JROA 3M2TA 4H4CA 5DT2A 2WQ7A 4GKKB 1AQ6A 1MC8A 3CMMA 1PSWA 1NVDA 4YEDA 4P08A 4BAUA 3PL1A 3L8ZA 2QYHA 1Y8CA 2IIBA 3WGJA 3QU7A 4B4OA 4LF7B 1MFPA 5DLEA 1WCXA 1DBPA 1EPUA 4PAOA 3N8GA 1PZEA 1SQ6A 2AUMA 4QPJC 3UCEA 1A5AB 1UBNA 4NYIR 4YRIA 1G2IA 1ISPA 1VG1A 4YYEA 4C89A 4HWOA 1DJPA 2R1VB 4JJ4A 1LPBB 4MQ5A 4G0NA 1QM5A 4NH0A 1XHEA 2W6ID 4R9NA 3VVBA 4P3PA 2W6PA 4FFLA 2WNSA 2FGKA 1PDWA 4DTIA 2YJTD 2G6TA 4MW7A 1VC2A 1RBZA 3KJIA 1AN9A 1FU7A 5ITWA 4KWTA 1MJFA 5BRNA 4UNIA 2VOJA 3HEBA 1F7UA 1M2KA 2ODQA 4B7AA 4EFNA 1FDOA 3A6HA 3EDCA 3VOTA 4KCGA 2OAEA 1WCIB 3VSAA 4F6RB 4M53A 3QV2A 1WCIA 5IW8A 1E1QA 1XU9A 1BQ4A 2UYHA 1BW9B 3PGMA 2PMKA 1BW9A 4UUNA 3P5SA 2BM1A 1SG6A 2ZUVA 3KKOA 2PGDA 3QXXA 4GVXA 4EHFA 1PNRA 4ILEA 2BCEA 2YICA 3WLFA 5C53B 4JJKA 1XIVA 4B0OA 3JCZA 1NQAO 4ZO7A 1K5HA 4EG6A 1CSEE 1SCDA 1ZSYA 2P6NA 1IIBA 4WIAA 2EKLA 5AJHA 2OAGA 1R8YA 2R66A 4M0DA 2Z5LA 4KDRA 3L1KA 4FKZA 4YAWA 4NATA 4L3VA 1MAVA 3OQOA 3K30A 1M34E 2P30A 4HXFB 4ZVLA 3WQBA 3H5RA 5GM2A 1UBOS 3IKTA 1ZN2A 2NQ2C 1YA8A 5CJPA 1P0CA 3O3OB 3U4QB 4PGFA 1ICIA 1KAMA 3RW9A 3WY9A 3U4QA 4GHWA 3KZKA 3VH2A 4EHIA 2VSXA 4IWYA 2JEYA 3S29A 4DC0A 5JMOA 1RRKA 4G84A 4FFRA 3DEFA 3RC8A 2QTVB 2Z09A 2QTVA 3H0CA 4JL6A 1O95A 1P1BA 3FVQA 3LLUA 1C7FA 5F78A 1EA5A 2PS9A 2WLTA 5F5NA 1UCFA 3RRZA 4BVJA 1EDOA 3W9UA 3PE4A 2ETVA 2I6FA 4KOEC 4BNKA 1QH8B 4M2LA 5GZ6A 4F60A 3ZTWA 2YIVX 3OKCA 3T7KA 1YGPA 2JFWA 5REQB 1IN5A 4Y1RB 5REQA 1BFDA 4IY1A 1C30B 4Y1RA 1AQYA 1L8QA 5BNFA 1C30A 4KUHA 2ZIVB 3LBIA 4HWPA 3DHNA 1XRMA 1F0PA 2G8NA 1ZVMA 4OP3A 2MSDB 5ESXA 3REGA 4E22A 1JPNA 1QSGA 2ZBVA 5EIHA 2WTXA 2GPNA 4W8GA 3QZUA 4B09A 2MYNA 2ZTMA 4DLSA 1RQXA 4ALNA 3NRBA 1K3TA 2IYSA 5AOCA 2AN4A 4TLMB 4CKZA 1BKDR 4K9LA 1G63A 1CF2O 1K7XB 2CF6A 2YYYA 3NHLA 1D6SA 3H86A 1C9KA 3PNYA 4JYAB 1BDBA 1QH0A 4TQAA 1QDLB 4YJGA 2WIAA 4QJ3A 3OFVA 4F3KA 1T2NA 1ACJA 1X15A 3HBJA 1HURA 4XFJA 2P5UA 4ZVUA 3RO7A 5AM1A 2JJ2D 2ZYHA 1XTJA 4M9RA 1E2JA 4KSYA 1B0ZA 3DVAB 4EVRA 2PO7A 3CIOA 4N5NA 1YFLA 1RXWA 2GZAA 1JFVA 2QK4A 1ILWA 3D31A 2W6ZA 1YZYA 1OLOA 3AR3A 4IJ5A 2J9GA 4LRWA 3NTLA 2JGRA 4HWRA 3QW2A 2JAWA 1VJTA 4M54A 3KB6A 1CDOA 4DLNA 3F8WA 1HL7A 4KX3A 3AKCA 4LJSA 5B3LA 3AVVA 1VPLA 4IIYA 4L3WA 2GH1A 1EFRD 4HS4A 4RCYA 4TV8F 2C07A 2I6TA 2Y1DA 5BSKA 2OP1A 2Q21A 4YRFA 2VLIA 3DTVD 4MRAA 5LDGA 3OC6A 1JAHA 2XH8A 2VJAA 1JAZA 4PO3X 4PHFA 4BVFA 5A02A 4Y9SA 1DTWB 1LU9A 2BHNA 1JQJC 2DUNA 1DTWA 1DAHA 5F33A 4A8HA 3UJNA 5DH9A 1KZHA 3ZXXA 4GWLA 5M29A 1NVWQ 4A2WA 1NBEA 1T8RA 1P2DA 3G2QA 2XZDA 1NW5A 1E2LA 2N1BA 4V02A 1GTRA 1FTWA 1ZZGA 1JQ5A 1EFVB 1EFVA 4R8SA 4WHMA 3CVXA 3U4MA 3PK0A 3RWMB 3KEGA 2XJ4A 1Z08A 2ZR8A 3B1KA 4P80A 1Q95A 2I9PA 2JB9A 3BILA 3ILVA 5C2JB 4FNMA 1QX4A 2SKCA 4DR7B 3LDHA 2NW6A 1WTCA 1TECE 1I7LA 4R1MA 3NDJA 5CXSA 4R0NA 2BMEA 3Q6IA 3F3MA 5K7SA 2AR0A 4ZARA 2OQVA 4BWVA 4DAOA 3GRVA 4J0IA 2Y4OA 2CXTA 2QV7A 1V25A 2EV9A 2ISCA 5ALVA 3GRYA 2FWMX 1DRKA 4BO0A 1ENOA 3ZI0A 4HYYA 4QLOA 1NBME 1A5ZA 5DDIP 3ZCUA 2PXHA 3PXUA 2W2LD 1YJQA 4G5SA 4Y6SA 4NZYA 1E9EA 1F38A 3IP3A 4Q15A 4RU1A 2PH1A 3UM9A 1GA6A 4Z4IA 5K0JA 5J59A 4UVGA 1M3SA 2IYXA 4A16A 1Z0AA 5ALQA 4YT2A 3P9YA 4TTJA 4TYPA 1Z7EA 5KQLA 2GZSA 1X70A 4CDMA 2XUKA 4KGVA 3LM8A 1OJLA 1U81A 1S96A 2NZXA 5PNTA 3TSCA 4NZZA 4YXFA 2VWQA 3DOCA 1P3DA 5DNVA 5EE3A 1RYDA 1F2DA 1BH6A 2PX3A 4NBWA 4C0LA 3N7AA 3TLGB 4PO9A 1DEKA 4Z7NB 3TLGA 4QNNA 1Z83A 4Y2RA 1XNRB 1WABA 5B53A 4MVJI 1IVNA 1OWOA 1Q1NA 3GFBA 2HRZA 3OO0A 2HMYB 1FZQA 4URWR 4CRWB 1Q0QA 3B5JA 2BEJA 4ER3A 1JDVA 5EIBC 1N1EA 9ATCA 5H80A 2ZE7A 1MZPA 2NNLD 2NUPB 2NUPA 1DVRA 4AZ3B 1C9YA 1DEXA 1FTQA 2C1XA 3S3TA 1K6JA 4GSYA 4I7EA 2F3TA 4KIFA 4L50A 3WLLA 3ZZNA 2VCEA 2Y1OA 4KO1S 1WULS 2AXEA 2QRQA 3EVAA 5GMOA 2D2IA 1IM8A 1BKYA 4AZWA 3NIDB 4MPTA 3G5LA 3LWDA 3R0JA 1LPPA 3T7SA 3ZIDA 1AGNA 1N0WA 4N6NA 2WIKA 4HUTA 3A9RA 1F1BA 3K0BA 4PG7A 5DASA 1TPZA 5BUCA 1YUMA 5FBRB 2V0NA 1N6LA 5I6DA 4E31A 3MUEA 3ENWA 4HEA1 1DAFA 4Q16A 3H87A 1RQNA 4Q48A 3KYJB 2RARA 4YJ2F 2WM9B 1M67A 4CPDA 1AKYA 3C2QA 3EQ7A 1LBQA 4K1XA 3LWNA 4KMRA 4M76B 1DAMA 4D8YA 1O4VA 1F5SA 1NPDA 1Z5VA 1ZMOA 1CHNA 5DGCA 3WGYA 1VHTA 4ZYZA 2OL4A 4INZA 4R2JA 1XVAA 2D4HA 3VSBA 2ZU0C 2P27A 2YWBA 4YRJA 2OORC 2WJ3A 2YMMA 3OIFA 4PLZA 2FR0A 1W4ZA 2NG1A 5AT1A 3ZWNA 2UZ3A 4A6PA 4E4YA 2I3GA 3V9AA 5HX7A 1RC8A 1F9EA 1WMAA 4CLDA 4PTLA 3MTGA 2BTQB 1Y4SA 2W37A 4OO3A 3NWEA 3CX7A 3O7WA 3X1WA 1R0YA 3MS4A 4ARVA 3KO8A 4A8TA 1GFWA 5I5EA 2CE2X 2ZITA 3L5OA 3V8BA 1PGPA 2Y99A 4HGOA 4HGZA 3GRUA 3QMVA 4KVFA 5ESDA 2I2CA 2ZQYA 3OTHA 5DM1A 2CXXA 3SSNA 3TLMA 1A2QA 1EVIA 1NXOA 1TQDA 2MINB 3VDQA 3F5QA 2MINA 3HO1A 3Q3VA 1DQNA 1CX9B 1UDBA 1XMXA 4B76A 4JYPA 1RABA 3ZGOA 1X1BA 5MFPA 4J43A 1TRKA 3U3ZA 4D74A 2ODEA 2CK3A 4DCGA 4QNMA 3IPRA 3HYRA 3GP8A 2Z58A 3TLCA 4DZRA 2ZROA 5HS4A 2B8WA 3EJ6A 1TXGA 3NFRA 5A5EA 1VMDA 1ZIDA 3VMFA 3EUWA 1FDUA 3T7AA 3RUCA 1TCCA 1KK0A 2C99A 2DC1A 3HU3A 3WGMA 4G0UA 1J25A 4RTLA 3KPYA 3EZ6A 4DR5B 3DONA 3VQTA 3CSSA 2PSHA 3ZV6A 4N48A 5E1DA 3A26A 4BQQA 4R51A 1DT3A 3WHPA 2R5WA 1T4DA 4RGQA 2C9ZA 2WHYA 2OGTA 4OJKA 5C5DA 4FE4A 3OPYI 3BJMA 4G9EA 1YZFA 2HA3A 1Y3HA 5CVVA 4JBXA 1NDQA 1YS4A 3EVDA 5J1TB 2QTZA 5CFZA 3K70C 3C3BA 4REQB 1G9XA 3SS7X 4K86A 4REQA 4WY8A 1HNXB 3AL2A 1T1JA 3MTJA 2NYUA 3DO5A 2V54A 3DVRX 4QZVA 2XY4A 3NTUA 3K8ZA 2Y1CA 5AM4A 3OHMA 4ITRC 3RRJA 1VI2A 3FTCA 4UUOA 2GDJA 4N9QA 2M6KA 3WIEA 4FSHA 1AGYA 1NT2A 5C3UA 2IYEA 3ZE7A 4F12A 5IUNC 4AKHA 1W36C 1QE3A 4ZVPA 2A94A 3BZBA 3J7TA 1I4EB 4G1FA 5LOVB 2XYRA 4EAQA 5LOVA 2X7HA 2M1XA 2W00A 3MG9A 3OFNA 4F96A 4ACBA 4Z0TA 3EC7A 4EQZA 3I28A 3MN1A 3NEJA 4A9AA 4V3BA 1T8WA 2QRVB 2J9YB 4XUCA 3H1TA 2BUCA 2QRVA 4D6XA 2PX8A 4JA2A 1KYIA 1OQAA 1YTLA 3WV5A 4UM9D 4I1YA 3RASA 4NS1A 3IPXA 1E2IA 2XLBA 1G7RA 3KUXA 5D5HA 1YA4A 3PRHA 3OCWA 1IY9A 2JARA 4F4CA 1VYVA 1NXPA 5DRYA 3PUIA 4PFJA 5TARA 1UT5A 4N0DA 1XEFA 4V24A 4NCJA 1UBFA 2VHCA 5AFSA 2AG5A 3AR7A 4L8GA 4BBAA 3B5IA 3NBFA 3IAS1 5IXYA 3CCBA 1OLXB 1O94A 1R0CA 4F04A 1E2PA 1OLXA 2RAVA 4DZTA 1NP3A 4D4GA 5EIEA 3V32A 5AK5A 1PW5A 2AC7A 1I2AA 2OWEA 1U8EA 1ZITA 4D3YA 2B5OA 3ZVRA 2BGNA 2J5QA 2A3RA 1F0KA 4XE5A 3DXYA 4ZA2A 1ULZA 3EGEA 3T0IA 1RQ7A 1I0LA 3QPBA 4Z1OA 2ZRMA 1FQKA 4R8KA 2Y1WA 2IHZA 1QRAA 4RD6A 4MQMA 3A6LA 1L5WA 3UWPA 4P7KA 2GCIA 2IHVA 2H51A 4HUJA 4IQ8A 3I04A 2SKEA 1PLLA 1Z47A 4B35A 5L53A 3KAJA 3QUTA 1O77A 1Q1BA 3CEJA 2CV2A 3RLIA 4OCZA 5DE3A 2F9LA 4FQ7A 1P61B 1W52X 5CEFA 4IHJB 1P4AA 4D8UA 3HG7A 5CEEA 4IHJA 3OWHA 3N3BC 2ZSJA 4MIKA 4U00A 1RRVA 1YRAA 2EEZA 1CB0A 3WL6A 3LL4A 4KV7A 4U2DA 2BGMA 2HJVA 1N6KA 3ZWXA 2WTBA 1C8VB 1KDTA 2EERA 3W77A 1JW9B 2EBUA 1MR3F 2GBPA 3ZV7A 1V9CA 2FFQA 2WWIA 5FTLA 3BRCA 4QQ8A 4L3OA 4MUJA 2F62A 1Z4KA 2X2OA 2R85A 1RWVA 3CRZA 4AIIA 4V1CI 3T1HB 1U0BB 3ZHBA 4UVEA 4ZDJA 3EEIA 4HBZA 1UBMS 2H07A 3Q2OA 3C8MA 4GMXA 1RPZA 2ZB2A 4US0R 1WA5A 5ALGA 3R8XA 2Z6VA 2V7TA 3T54A 1BEUB 4Z0NA 1R4ZA 1VLHA 4P7FA 2L17A 3OD1A 3P20A 1H65A 2QJFA 3BQMB 5F51A 4PXSA 2C7PA 5JT1A 1N2SA 4MP8A 3IUQA 1ZA2A 5LU9A 3ITEA 3OBBA 1UC8A 2DE0X 1JIJA 4DKXA 2DEUA 3L4KA 1V1MB 1V1MA 3QIVA 4NYIQ 2HAEA 4WCVA 2O8BB 3VKHA 2P8SA 4XTRA 2O8BA 1Y37A 2GAIA 1U2TA 2ZJZA 5ABPA 2CL7X 1G4AE 2FPSA 4QGGA 3UCXA 4U7WA 2O4CA 4EF5A 3S68A 5M04A 2BM8A 1BHO1 1RI4A 3TB4A 3AUYA 1O5IA 5M3BA 4JUIA 4QLBA 2IDZA 1IUPA 4XDHA 3IQFA 4H18A 4GX5A 5AJUA 1RBMA 1W5BA 2A1TR 3DOOA 3F6YA 4G8CA 1U0HC 3SQLA 2J4FA 4HVCA 2ORYA 5JDIA 3CS3A 2AKEA 5EHXA 1CE8B 3E53A 1GO2A 2RHMA 3SZUA 1CE8A 2C97A 3P94A 2JAQA 4NENB 4G2TA 3B1WA 1C81A 3AUUA 4Y2VA 2NP7A 1NNSA 2VF7A 3T94A 1ODFA 2I2BA 3SNKA 1V7PC 1FXSA 2NUTB 1D9XA 2Q5EA 3F6BX 1UBLS 2NUTA 4I1UA 1T1EA 3OY7A 1PTJA 2OGZA 3VHQA 3ZY5A 5KB3A 1EEXB 2GNAA 1G5FA 1DX4A 2V9CA 4GW3A 2OCPA 3AEKB 3JVEA 4ZGWA 3I6MA 1QFMA 2YRXA 3AEKA 3IBSA 4JJZA 4OEHA 5EXSA 4A2QA 1JU3A 3OCUA 4UHKA 5KX5F 1F2VA 4MR7B 1JALA 4G0YA 4X41A 1SRQA 4BMNA 1XU7A 2PWPA 4LZJA 2ZAGA 3LLCA 5FUMA 3PWSA 4WINA 3TJZA 1S2LA 4IMJB 5EWMB 5EWMA 1T3ZA 3LECA 3VISA 5AIBA 3RS0A 4A2PA 4MWTA 3CH6A 3UY4A 3ZU3A 2FUG1 4BCCA 2C4HA 3KQOA 3GFVA 1Q7TA 2HLHA 3AVPA 1KC1A 4PQYA 2OBFA 4UZSA 1Q77A 5GJWC 2A1TS 4HN2A 4M1QA 4BV9A 1T3TA 4K9MA 1PKEA 1H9CA 2PMFA 2GEBA 2AMLA 3MJCA 5ALJA 4AO7A 3GA0A 2WG0A 3KUUA 4HJXA 2ZJ7A 3RYFB 1U7DA 3GLRA 1XQYA 1PLJA 4L51A 4BLRA 2FPIB 2G09A 3GEIA 2FPIA 3F97A 3HBFA 5JNUA 3K4QA 1Z22A 4KPGA 4NJMB 3DQZA 4X8MA 4NJMA 3UJ6A 4N5HX 1TM2A 3EUFA 4JI5B 2FH5B 4D02A 4MQEB 2PBRA 3ZIAA 3I5XA 3TS1A 4MQEA 4KYTA 4OUDB 4OHVA 4OUDA 1HE3A 3NHYA 2IP2A 4L0DA 4HX9A 1N8SA 3JQPA 5ICGA 5H68A 2J9RA 3KETA 2A9FA 4ANFA 2BR5A 3JYHA 1CQPA 2GFQA 3P2KA 1P4RA 4UDNA 1DO0A 1NVAA 1OYVA 1Q22A 2GYVA 5IC6A 1EHCA 2VPZA 4CU2A 2ERCA 1RM4A 4BZWA 4PZ9A 5EIBD 5TLSA 1L5ZA 4QODA 3JZFA 4F3RA 1ZH8A 3DG9A 3MSCA 2XB9A 4DMHA 2KWIA 4IP0A 2ZDQA 4IXMA 3OIYA 4ZKDA 3NBKA 5FDFA 2HR1A 4UXHA 4DB2A 5LP1A 1XD9A 1UQUA 5IWCA 5TIIA 3HXTA 2QVCA 2XNHA 1RWKA 4DJTA 3GF4A 3M7IA 3NP7A 1A98A 4J0FA 2GCNA 2VF4X 1I1NA 1ONOA 3OLQA 3SHTA 4QPZA 2WMDA 5LYJF 5DWDA 3TXAA 4LY0A 3TUZC 4Y7CA 2EGHA 2GSWA 3BZWA 3W2IA 2IC5A 2RC5A 1LLCA 1MC5A 2V7UA 2YZGA 1UPTA 3OCCA 5FUXA 4ZYVA 1CCWA 1ULSA 1JDUA 5C32A 1JBQA 5C34B 3GUVA 5A4AA 2JFBA 4P3KA 4KPUB 2E55A 1QIGA 4GOXA 4U7PB 3PX7A 3OLYA 4XLZA 3I05A 4RGVA 4MGKR 4XRGA 3SP1A 4L8LA 1NW7A 3Q1LA 1GILA 1Z39A 2PD3A 1CK4A 5DNUA 1VQ1A 1I80A 1LW7A 2CYCA 3EWNA 3L1VA 1E2HA 4WK0B 4XYGA 3AU8A 1G6Q1 2RJNA 3M4YA 4U0KA 3NQ41 3RYFA 4W5OA 1OAKA 3HQ4O 1AK2A 2HV8A 2WA1A 2F8MA 3LVRE 2ZBRA 3G2OA 3PWTA 1X1DA 2CXRA 5AHRA 1BJKA 1C7RA 1T1GA 1WXXA 1Q0LA 2Q4DA 3HVUA 3UMMA 1UKAA 2UYOA 4QG7A 4JT8A 3SC6A 3WSVA 4F7DA 5SZIA 1VDMA 3PVCA 2C03A 2GF0A 2C5AA 2FWIA 2YV4A 3IJ5A 3KXIA 1V8PA 3SX2A 1XVVA 1E99A 1Q7GA 4ND1A 4LRQA 1ZYUA 4G8BA 4JH0A 4KQ6A 1M6NA 5CVJA 3SZMA 4AJ1A 2O8NA 3HV2A 3PZBA 3SDSA 3S1SA 1GTZA 2HLDA 3RKRA 5FA5A 4V0KA 2VTBB 1S7CA 5K4HA 2OENG 2R96A 5TMPA 1PUXA 4KTVE 1FVFA 1W4AA 1FU8A 3RRBA 1QU2A 1FVXA 1PI3A 1SXJC 3BGVA 5CGQB 2MWMA 1U5AA 2AEEA 3HO8A 3NJ4A 2F9FA 3M5DA 2V7XA 4Q66C 5FEMA 5FYQA 4EGCB 2ZJ4A 3WADA 1ATIA 3V55A 1TM7E 4R3NA 4HH1A 3V33A 3GMDA 4IRXA 1EUCB 1Y1TA 1EUCA 4H16A 1KFKB 1HE2A 5A3QA 2QUIA 3YASA 2ISSD 1CFJA 2O4UX 4HFJA 4X3PA 4KLAA 1CR1A 1O6CA 5DT9A 3K70D 1L7PA 3KSDO 5GIOE 1J2JA 2I9KA 2ZS8A 5DCWA 2VPTA 1I4LD 1HDCA 3IVAA 3L0YA 5AWFC 2HI0A 5EN4A 1N6RA 3ELUA 3T7IA 2YYSA 1Z4JA 3UV7A 3M5CA 3DKPA 3ELWA 4Q6BA 2JFVA 4EELA 1RDFA 2PFGA 1EAYA 1Y3DE 3ZQJA 4R1LA 5IFKA 2CCJA 3GRKA 4CGYA 3FOFC 2FV8A 3MQ2A 4HEA6 2BLLA 4OKNA 4ZV7A 1W36D 1RC1A 1U8AA 2G0TA 4PX3A 1HPLA 2DQZA 3GNSA 4YIHA 5JJBA 2GESA 3ETCA 2C7OA 1YF3A 4LDAA 4X8LA 1IXKA 2QZ4A 4OA8A 4YAGA 5LZ2A 4JN6B 3OF2A 2GN9A 1QDUA 3CRW1 3WISA 5KVVA 2WK1A 1C2YA 2VS1A 4N12A 4QGAA 3U7HB 4RKQA 1BDHA 4NNOA 2A5YB 3PCRB 2P79A 3NC4A 3SR0A 2EHJA 1HOXA 1D4FA 3OSZA 2FWAA 1KVQA 3CGGA 3B1XA 2B6HA 3PPXA 1X2BA 4BQEA 4YCCA 4IKPA 4M7OA 4R2WA 5PGMA 7ABPA 4OMDA 2NT3A 4M8SA 5SY6A 4BFTA 3JRXA 2NSJA 1Z5GA 1J5EB 1NBAA 4JD5A 3IEMA 1JH8A 5AW3A 1XDSA 4W5JA 1QHEA 3UMJA 3DQPA 3PPWA 2B92A 3U37A 5FJIA 3VHXB 2DKFA 2X1HA 3OE4A 3P9XA 1ZD3A 2TMGA 3PHJA 4LYFA 4TRNA 1UWLA 5JAZA 4ZTBA 5IC5A 1AV6A 1OJ7A 1JA1A 3HLTA 3X1DA 3PJRA 2IUEA 4OP1A 2H0RA 3UMGA 3M6UA 4IAOA 4LYAA 2KLBA 3NIFB 4G67A 2HEIA 3QBTA 4IDGA 4CMKA 4EKIA 2YDYA 5DHFA 2HIGA 3EFEA 5JLAA 2X6RA 2ASVA 3VV2A 2AFIB 1N2EA 4EPRA 4RL4A 3PX3A 2FR8A 2J87A 2FETA 1SU4A 4IXDA 1MW8X 3E5RA 4B6RA 4GPEA 1JAXA 2YXDA 1P9WA 3C1UA 3NM6B 1KI4A 3COSA 4R6WA 5FPYA 4J0JA 1Q0UA 3SLRA 5FLXA 4P98A 2QG9A 3JR7A 1H42A 4MJLA 1JFFB 2A5LA 2VYFA 4LXTA 3SG0A 1JFFA 4BKMA 3NZEA 1Y34E 1P7WA 4MAFA 3A9CA 3CZRA 2W2OA 4K2HA 4M1ZA 1OXTA 2IY8A 1KE1A 5FWXB 4Q7QA 5ESWA 1E1YA 2NSHA 3HYLA 4HCJA 1T15A 4F86A 1I4OA 4B4KA 1HZZC 1U9JA 2HPZA 2VJYA 1R4MB 1RXIA 3A7DA 2K4MA 1R4MA 4G8DA 4PYKA 4W63A 3NKVA 3UB3A 4ESOA 1P60A 5KQSA 2C7VA 3HEMA 1CEYA 1NFFA 2H57A 1WXEA 4M0EA 3CYFA 3OY2A 1X1RA 2AL7A 2CBXA 3E4DA 1DHTA 2IEIA 2ZXEA 4MKXA 2WSIA 1J99A 3P9NA 2OXTA 4G2NA 4JT9A 4NV1A 4IDBA 4G4IA 1Q44A 3TTVA 4J7XA 1BXKA 3QVVA 4WKNA 2QUHA 4J2HA 4LYHA 3T9AA 4BB0A 4EHLA 3RBVA 3C24A 5HE8A 1WB6A 1RAHA 3IEUA 4UQPA 5FQOA 2FW0A 4ZI7B 3QQPA 2EKQA 4ZI7A 5JJ5A 1SCAA 2D5IA 2IL1A 2ILTA 4IXTA 4AUKA 4ZJUA 3BXOA 4UM7A 4Q4CA 3D54D 3JQ9A 3VPAA 5JZSA 1MJGA 3HN6A 5B55A 5ADUS 5LBIA 3PQ2A 2ZJ1A 4I9GA 1S02A 3BE4A 4TRMA 2H1VA 3VX4A 5CG2A 3BD7A 4BQNA 4PR0A 1JG6A 2CCKA 1NFQA 2IQIA 1ZM4A 3HFJA 3MAJA 3ZK7A 2DAPA 5FX2A 3RUIA 2GK7A 2JI8A 3IHKA 4W5QA 1LX7A 1XRLA 4FBLA 2IGBA 4O3FA 3RVNA 2OCYC 1PWZA 1QOPB 3ASUA 1QYCA 1VE7A 1JAYA 2MR6A 5CW2A 3NEYA 4FOOA 3IAS6 3PITA 3HSKA 1GL3A 4ZOLF 3DJYA 1XJCA 3L7CA 5EY5B 5K8CA 3FJ1A 3G9UA 4MR9B 1T1IA 4FLFA 5FUYA 2QBYB 3DGFC 2QBYA 3LVBA 1H2XA 1CUXA 2GCPA 3V7UA 4C05A 4CN8A 1ZONA 1QH9A 2X8AA 2RCNA 2GEUA 1L5HB 1XTRA 2Y76A 2JJ8A 4BMZA 3ZWMA 2GBLA 4QSHA 3LVFO 4YCBA 3V7YA 3RG8A 1FY2A 4KMMA 5EXTA 2QW8A 2ZRDA 3ZQ6A 2J3HA 1RXYA 1ZY2A 3TCKA 3DEJA 4MI1A 1W48A 5GAJA 1DIHA 5AQEA 2QR3A 4ZOEA 1FFSA 3K9GA 4MTLA 1NHWA 1T1SA 3QFTA 5EINA 3GLQA 3SIPA 3G0HA 1FNMA 3MIZA 1A50B 1TO2E 1Z12A 4Y9DA 1J9EA 2G1KA 5F12A 3OQ6A 4A0HA 2CHEA 2NO1A 4GKBA 1MABB 4ZANA 1CRZA 1MABA 2GRJA 1ORRA 3TD9A 3OZCA 2CXPA 4HGPA 4N7JA 3WLMA 5F9HA 4D5GA 4E07A 1B8VA 1WZIA 2PZGA 1BMDA 1XRPA 4BBJA 3OOHA 1R4AA 4FMBB 4Q12A 3JVDA 3WLJA 3MTEA 2CXOA 4BLWA 4Z4GA 3NNNA 5ELXA 5IASA 5AYVA 4JX8A 3NOVA 4HAYA 3SFVA 5FHQA 1JWAB 2JATA 4IPTA 1IHXA 1XD2B 2Q4BA 5FNZA 3ZGXA 1PR4A 1XD2A 1YJCA 4E94A 1RM5A 4NXNB 2PANA 2Z8YM 4DW8A 4WW0A 3ZKWB 4D9JA 1RWXA 4R2LA 3ZKWA 1RR6A 3ESYA 3JQ9C 1WP9A 4DIMA 4KFCA 3AF3A 4AJOA 4BNGA 1IY0A 4MGZR 3X2EA 4TS3A 5LXTB 4EUFA 4ZO8A 3TR6A 3I2KA 1ZXXA 5DN9A 4IHJF 1QVAA 4JMPA 2BD0A 1KPGA 1AHPA 3EZFA 1NI3A 3GVXA 4J4TA 4L8WB 4XH9B 4LJRA 1MO2A 1T2DA 2R8BA 4C4TA 2FOIA 2O2JA 4O0LA 1CJBA 3FKSA 4EPTA 5K8TA 4REOA 2QX8A 3DMTC 1QH1B 1E6WA 5B36A 4HC4A 1CY0A 2GARA 1GEEA 1VMKA 3GQBB 4V0QA 4RY0A 2ZSIA 1NONA 3NHBA 4NPCA 1M0TA 1AC5A 5IK2A 4QD3A 4B47A 3NORA 4HDNB 2RDMA 4HDNA 1CKEA 1WIWA 1PFGA 4PZ0A 3N74A 4EA7A 4F4FA 4WEQA 4D92A 3OSUA 2MOKA 1M6EX 3AKEA 3QF4A 1DL5A 1QG2A 4QU9A 1P75A 1WPQA 1Q20A 1KBOA 3W1EA 3L93A 4AECA 4IIUA 2WMNB 3FD8A 3WNDA 1ZD8A 1QZXA 4JBLA 4PHCA 3HCFA 1R5OA 5LJIA 1R4NB 3R2JA 2NXNA 1R4NA 3VAZA 4EYEA 4EQ6B 4F8EA 1J7KA 1R7RA 4EQ6A 4JI8B 1QZUA 5AP9A 5AW7A 2ZBEA 2M6SA 4OLHA 3DWGA 4FD2A 3GHYA 1GQQA 2W2KB 5DXFA 1LK5A 4X1YB 2IZ7A 2W2KA 1C7EA 2O1SA 3C1OA 2FUG6 4O2AB 4KACA 3EXG1 2GZ1A 4O2AA 4X1YA 3TE6A 3CNNA 5I51A 1YR2A 2PGJA 4WFIA 4C76A 4LMRA 4PX2A 1FFDA 3HFGA 1U0TA 4E5UA 4RJLA 1SOWA 4QPPA 3VI3B 5CAEB 1KFJB 4P81A 5CAEA 3AZQA 4CMIB 4FEEA 4HTFA 4JFAA 4CMIA 3QXHA 2QVGA 3FMGA 5DNWA 5DGHA 4P4UA 1A5BB 2R4QA 2BR3A 2IDMA 3RYCB 1YJ5A 3ASVA 3RYCA 3F8TA 1O4WA 1VL0A 1W0KD 4W9RA 1YFKA 1LNSA 4QRDA 4AAYA 1SNYA 1FDSA 1R00A 4G1UC 4G25A 3DCJA 4Q05A 5BW8A 1EFHA 3TK1A 1A82A 4X6XA 1TYDE 4IDQA 3T7EA 1SXJD 4AL4A 2Q5JA 5I4IA 4YMHA 2ZXFA 2KW5A 3D5TA 3RAGA 2H7VA 1ZOIA 1ZOOA 5FTMA 4BYMA 3K73O 1E2KA 1USVA 2J31A 2GZHA 3KOZA 4X8OA 4IV0A 3KQKA 2PLFA 4OYLA 4XJXA 2WSBA 3V1YA 3ZHYA 4GQAA 2GA8A 1P2VA 3IC5A 4NC9A 3W7BA 3IR6A 3PTZA 2CJXA 1NN0A 1FFWA 1VECA 2HF7A 2PGNA 3D7RA 1N1DA 3BTUA 4P38A 2R6JA 4CKWA 3EGOA 2WRZA 2JLXA 2WLSA 5T8KA 1RYEA 5ALHA 1E8NA 3DMNA 4XIFA 4KGZA 2A58A 3A1TA 2R8OA 4N1AA 4GO1A 1D3AA 4AG6A 5BR1A 3BWXA 1D0SA 1EVYA 4M8NE 3FTQA 5CIQA 3HA7A 1AO3A 2JLCA 3K9WA 3A0RB 5HM6A 1V8ZA 4PINA 4QPCA 2A9QA 3TEJA 3T3DA 5JATA 4A15A 4MQBA 3BTVA 3D6MA 2WHEA 3I3OA 2WT9A 3ADKA 3M4NA 1XHFA 2FPKA 3QVUA 3ECAA 4IVRA 3UAYA 4NOMA 5DTEA 5AM3A 5HEKA 5FJJA 4IHAA 5L9AA 1U2QA 1Q21A 3ZV3A 3CLSC 4RHXA 5T41A 5AVJA 2WQZA 2DUUA 4BV8A 5K09A 2Q2NA 3KBOA 5E2BA 2GZMA 1CEEA 2QM7A 1EFRA 3PCTA 3R75A 2L0XA 3O4IA 3TRDA 1R0SA 2YH2A 3K1TA 4BHTA 3IKJA 1HDRA 1J33A 1BHJA 4IZHA 1CJVC 1T2AA 3DEIA 4X1KB 5TF0A 3ONVA 1SHKA 4AWAA 5BV7A 1Z68A 4C4AA 4GLOA 3LX5A 5G0VA 2PRSA 1DIOB 2RGRA 2WAOA 1BOFA 5DBIA 4S04A 2F4VB 1FCJA 1Q2UA 1QQ6A 1RXSA 1W6RA 4UCQA 5KOJB 2XF2A 5KOJA 1S2IA 1Z4IA 1OV6A 2EJTA 3KC2A 3P2JA 3C3PA 3W3AD 4MPRA 5INTA 1MA3A 2P3OA 3OPXA 4PX9A 5DF1A 4MS1B 3ZLBA 2FN8A 2QL9A 3GU3A 4MS1A 4P58A 5FI1B 1O58A 3UOWA 2FWJA 2O6HA 3RK1A 2O7RA 1D2CA 2JGMA 2V7VA 2X9NA 4R9RA 2JIZA 2C2WA 3GCZA 1U0RA 3I09A 4DYVA 5JLJA 3A6GA 2ZANA 4ZHQF 2NZYA 3KLOA 2Q3HA 2C4MA 3JTEA 4C22A 2ZSUA 1NR1A 3PSAA 4WXHA 1N77A 2JI4A 3KYIB 2G06A 3O38A 3OZIA 1QZTA 3LA6A 1F3LA 1E79D 1VB5A 4M0KA 4P2GA 1P72A 1Q7CA 4RZ3A 3VPFA 4CCSA 1CIVA 4ND8B 2J59A 4ND8A 1V0JA 1YIAA 2G76A 2ZUTA 1GSOA 4NCIA 4OXRA 1NVMB 4BMSA 1E96A 3D0OA 3DJFA 2CFCA 3SPXA 3D8HA 2W6NA 4H0CA 4GX0A 1PWHA 1E1NA 4YR9A 1PHRA 2G83A 4Q34A 3CKKA 4ASUD 4MWZA 4Q7JB 5JQGB 5JQGA 5ALUA 1I4WA 3WNCA 1HG1A 1HLPA 3VTFA 3PLAE 3P2MA 4O4LF 3H65A 5HDBB 3I1FA 1RP1A 1NJ2A 4DJFC 1SD1A 1E0JA 2C61A 4BTVA 3RSQA 2MSWA 3QKWA 5TX7A 3NAMA 2NU7B 2IJGX 1RI3A 2FSIA 2NU7A 2QNBA 3UQZA 2VWGA 3I2YX 3F3YA 2ACVA 1YKSA 1D0IA 3B82A 1F1JA 1YI0A 4M0PA 5LL6P 3KXLA 1RAFA 3EAGA 4HDAA 4U2GA 4TWRA 3BN3A 1E9SA 1ZD1A 4C2UA 4ND6A 3ZHXA 5KYWB 1TF2A 1V16B 1ZUHA 2IHBA 4LGYA 1V16A 4UNSA 3VH4A 4B9AA 5KYWA 3OJWA 4DLTA 1VIVA 4DLZA 3VKWA 2QTGA 3UTCA 3N7UA 3U4AA 4BO4A 1B00A 2XQIA 4AG5A 2VYVD 5EKUA 2AYXA 1T0IA 2I5PO 3N0WA 5LZ8A 4FWTA 4C2AA 3I6YA 1Z3IX 1ML4A 3F7MA 4CW7A 2O0MA 2OPBA 5DHPA 3O26A 5L40A 4PTZA 3WMGA 1QUEA 4C6SA 3TSYA 3O8BA 1SRRA 1VG0B 5EC8A 2ZWMA 3A11A 1BEZA 3ETLA 2QLJA 4Y2HA 3UW3A 1V6CA 2GDZA 3QTTA 2J33A 4HQLA 4JHXA 5BUQA 1CV2A 3UXHA 1M5UA 1JJ7A 4CQJA 1E2FA 5LKRA 3Q3GE 1E0KA 2Y9PB 3H2IA 1LD3A 2C0QA 2D74A 4RPLA 3CCCA 2G40A 1OKKD 3MWYW 1KEVA 2DWUA 3DYVA 5H59A 4CFSA 2VJMB 1Z6AA 3GC6A 4ZMRA 4AMZA 2AOTB 2VJMA 1WM1A 1FS4A 2AOTA 2IYQA 3H4IA 2GEVA 2R8YA 3AUTA 3LQ1A 1U2GC 2FNAA 2QMZA 2QPLA 4IXWA 4PZYA 4W7SA 3H3FA 4H7HA 2FDXA 3KZNA 2P2YA 1JFSA 4IDFA 4LI3X 4MKFA 3UMRA 3VZPA 4EF4A 5JMTA 1S7GA 3C4VA 5TB5A 4YQFA 3KT8A 4A82A 1AA9A 5KNDD 2GM3A 4CIYA 4QO8A 3GLGB 3II6X 1V35A 2DVMA 3I1JA 1WP4A 1PJSA 1OAAA 1SQGA 1NP6A 3IP1A 1RWNA 5TGZA 1J09A 4QYMA 1EP3B 1UH5A 3P4YA 1JQDA 1YS2X 2FMXA 2PBLA 3JYPA 1IH8A 2CBZA 5FTJA 1MZVA 3AJEA 3NBYC 3F8SA 4DV7B 1YI1A 4GZ6A 3N8NA 2PUWA 2R97A 1PR0A 1X7YB 4S1NA 1R8XA 1X7YA 4TYWA 2G88A 1CDZA 2GLTA 3PDUA 3PKJA 1U9CA 3VPDA 4LZAA 1PGNA 1Z2CA 4QOEA 3K0HA 4QXPA 1ONSA 3ZE9A 1R3UA 4EPYA 1I3LA 1RJ9B 3PPVA 1MVLA 1RJ9A 4FMCB 1CUWA 2CXNA 4LMAA 4RACA 4PYQA 2PKYX 5FYDA 4Y2QA 4BXOB 4BXOA 1JDJA 2FDRA 2GETA 2I6UA 2XDQB 3HBNA 2YHUA 4MW1A 1ZDMA 2XDQA 2ZYDA 2ADMA 4RSRA 1B3RA 3GJ7A 4CTKA 4NZNA 3FPEA 1A9QA 1LK7A 2OHIA 4J9VA 2XOKA 3BIXA 2VRCD 4XIYA 4LQ4A 4TLDA 2ZP1A 5KHLB 1I13A 3A6ZA 5HUJA 2I3AA 2I7TA 4R8LA 1LFAA 3V48A 3D6UA 1MVNA 4B6JA 1IXSB 1ZCJA 5BNWA 1UFRA 3DUFB 1ZWLA 3DUFA 2WM2A 3OM1A 3QWFA 4U2KA 5FD8A 1A2KC 5KNBD 1DG1G 1FA9A 3SK0A 4M8IA 2IYRA 2PT5A 5D86A 1GLVA 1M0EA 2D5BA 2FZKA 2CDBA 2B21A 3NKLA 3ZVLA 4LNAA 1P3JA 3K0KA 5CJ2A 5SZHB 1J42A 3AY0A 1SJ9A 4PPGA 1RXVA 4EARA 1ODLA 1CZKA 1X74A 2Q2QA 2JAPA 3EIQA 3W3AH 1NF2A 4Z2AA 3O8RA 4QDJA 2TMKA 4DCMA 1P31A 1R9JA 1CU1A 1EP9A 2AHRA 5DOVA 2NWQA 3PWKA 1KZ6A 5FLYA 4B84A 3WYCA 1BYUA 1GZ6A 2X0KA 1WPRA 2I62A 1N5OX 1P6QA 2VNJA 2ZVJA 4FR5A 4KVAA 4K9RA 2AFHB 4U9UA 4BNFA 2AFHA 2B7LA 1F6BA 3ONDA 2BONA 1B15A 1QRSA 3IUMA 5FUQA 2Y67A 2F1KA 3N5CA 4ISCA 1XJQA 1J49A 1DPGA 1POWA 1W5SA 2F1OA 4G65A 2E4WA 2PRJA 1VZ2A 3BXFA 4UW9A 4K6GA 2PSDA 2QL6A 1ZIPA 1A9OA 3DLIA 1MQAA 4QATA 1KI2A 3VZBA 3MMPA 1N5DA 2DG2A 3FHOA 1LNQA 4CF7A 4UM9B 5JZ9A 4IGIA 4ZPXA 5H5JA 4DQLA 2NYAA 3RS9A 3RU7A 1L0BA 4D1YA 1G7TA 1UT6A 3A04A 1S2MA 1XRQA 2M6RA 4G4SP 4Y0NA 1O6GA 5JQWA 5HMMA 3TFOA 1BX0A 4WVFA 1S9HA 1RM3A 1CUJA 3MWDB 4I3GA 3MWDA 3PQEA 4QQFA 5KAMA 3EG5A 3F5SA 1TA0A 3EDQA 2IYYA 1HTTA 5K0LA 3HJGA 4D43A 2PUJA 2J1LA 4QHYA 4CNBA 1GNLA 1VBMA 2QAJA 2R751 3B70A 3D6AA 4IKOA 7MDHA 4R1UA 3WTCA 3W1WA 4KXVA 5JI2E 4KHPB 1EVLA 2R84A 5CDFA 4QNRA 2F2TA 3G5UA 5A0VA 4RZQA 2B1QA 4DDVA 1I8TA 2I99A 2QD4A 4ZK6A 4TSRA 3LXXA 3AHFA 1JDBC 1E7MA 1OBCA 2XWJI 2WYVA 4CLEA 4Q4JB 1GU0A 1YC2A 5IAKA 2VI5A 4Q4JA 4C1BA 1IM2A 1W29A 1LTKA 5ALSA 5ENVA 3IR7A 4GI2A 3BSYA 3KXKA 4CV0A 1VB3A 3AU9A 3NJRA 1G8MA 1XCGB 3MJTA 1VLLA 2QMHA 4MYUA 1JT2A 2YZKA 2ZPAA 4RY2A 5DYIA 3PQ5A 3AY3A 1CUCA 5JCOC 2IZOA 2JFZA 1OBFO 1GGMA 2KMLA 2BFWA 4TN5A 1ZM7A 4DA6A 1NXWA 4Q1FA 3NI2A 1DMSA 1SUCA 1PQUA 2FOXA 4QA9A 5AVXA 1R12A 2XCTB 2EWVA 1SKMA 1RPTA 3LCVB 4HDOB 4M4SA 4G24A 3QNWA 1TLLA 4GQBA 4N3NA 4WV3A 4TKUB 5H0IA 2PRYA 4JLNA 4TKUA 2LRHA 1EWTA 3VV3A 5ISMA 1RI1A 4JXJA 3X1ZA 1ZUD1 4ZVNA 2XB4A 1V3TA 2AGVA 1QANA 4XTCS 1RKXA 1Y6ZA 3O95A 1EM8B 5T3YA 3RBZA 1YULA 3ANYB 1EM8A 4DADA 1RFLA 4C7KA 1OU4A 3QXCA 4C3UA 3BF7A 5CDGA 3PTLA 4RWEA 5IS2A 1R50A 5HF8A 2G9UA 1H2HA 2BMWA 4Q3OA 4YN3A 1H6BA 2NYRA 1GXSB 3IIEA 5AHOA 4BMYA 1GXSA 5KNDH 1ZRMA 4Y9RA 3BK7A 3K0CC 1GQ2A 4UU8A 3TR0A 2JJMA 1GITA 1EFCA 2XUGA 1JR3E 4JA0A 4DREA 2O1XA 3H05A 4ZU3A 2WKSA 4HQNA 3UOGA 3RT7A 1F8UA 7GPBA 3MHTA 3LYAA 2D59A 1UKZA 2VPQA 4LDJA 4YREA 2G63A 1WAMA 2PY6A 2Q4OA 3LWBA 4YC7A 3VR3A 4RZSA 1SHTX 1YJAA 2XUHA 1I5EA 1GWNA 3CKLA 1QCCA 3CUUA 3KJZA 3ND5A 4HNQA 4L5AA 4OJYA 5E3HA 4AKGA 5LXTF 1M6YA 5H83A 4EG0A 3CLSD 2JIMA 2YHAA 4N0EA 1NBIA 1PEDA 1VLJA 3TQSA 2HIMA 3V4FA 3D8RA 3NTOA 3SJCA 2A35A 2BSXA 2WKRA 3GNQA 1AGPA 4L6IA 2PX0A 4LN1A 3F4KA 2QLLA 2X76A 5JZBA 1L9XA 2ZJ6A 3P9IA 4Q47A 1QLHA 5IBPA 4XWOA 3DFMA 1SC9A 3DLPX 3M4ZA 4AWBA 4YDQA 2NV0A 2VNSA 5CURA 4HPXB 2WFLB 3CU5A 2WFLA 2WEKA 2AW3A 5DTIA 2DTXA 5C4IA 2QNRA 1J0DA 1R3DA 3W06A 3AUFA 2UXDB 3TL3A 4MRNA 1A2BA 4PC7A 4RTPA 4M9UA 3ZLVA 4WNAB 4YUAA 2ZLBA 1U1DA 2B1IA 4W8OA 4MO2A 3PKIA 1GVNB 4WNAA 5F1YA 5ENZA 5IYZF 1AHHA 2AK3A 1QFSA 1FRNA 2F90A 1O1YA 3DSRA 2HCFA 3JR3A 3QBJA 3LZ6A 1Z5PA 1EUQA 3G7UA 3TRJA 1UMBB 1N5JA 3T3GA 1DDGA 3HPQA 5KNBH 3B9PA 3WRYC 5C5CA 2GPSA 1L7EA 1FS5A 5TGDA 3FCOA 3HJRA 3M9XA 5AW6A 1CZLA 1DC3A 3U7QB 1VSQA 2FEWB 1N5MA 3U7QA 3E3MA 5L7WA 3LUGA 1ZESA 2PWYA 3IAHA 1IXYA 3JVUA 3SHFA 2FKNA 4B1FA 13PKA 3CUKA 2C3UA 2XVAA 1NKVA 2I4MA 1O97D 1FMCA 4L4RA 2YV1A 3GFQA 2VF8A 3RRNA 1P3Y1 3OQNA 4NFSA 5L95A 4CEJB 1UBUS 4CEJA 2IU0A 4KWIA 3CTPA 2P2CA 3FNIA 3MLBA 5CUQA 3F46A 1QCDA 1G21B 1G21A 2Q62A 2JKYA 2QS9A 4Y6GB 3T3NA 1ZZEA 4BPRA 4C4ZA 4NONA 5HYVA 2WBLC 1Q6ZA 3H2YA 3KDPA 4GIBA 2ZAOA 4H0FA 2J6IA 3RSOA 1LDEA 4LOAA 3BE6A 4QHSA 4E14A 3PT9A 1O0CA 2Y0CA 4FBGA 1EX9A 16PKA 3O3CA 1VYHA 4PANA 3IH5A 2OV8A 3D6NB 4PGHA 3OQHA 3LYUA 4GUDA 2JJ1A 4OQPA 1P4SA 3JYQA 2H8GA 3NDPA 3W5SA 1WCYA 4Y1FA 5FHRA 3EGVA 4GG1A 4GRAA 1DJMA 3UB4A 4INAA 1ZI9A 2BGLA 1Y5RA 2XKJE 1NOKA 3U4HA 3UXMA 2R86A 4UATA 4BNHA 4CQNA 1K7EB 3RGGA 4EA6A 2FY8A 2HJHA 2IV2X 4N0MA 1UWKA 3A28A 3MJFA 4J49A 3ESDA 3IAUA 4RQBA 2K87A 3CKMA 4NRDA 4QGBA 3W7AA 4R69A 3LY7A 5BMVA 1TAQA 2A86A 3PUYA 3S70A 1C7QA 1QYDA 1RHRA 3KE9A 4IFIA 4RIFA 1UMCB 2GK3A 4C87A 1UMCA 4HDRB 2EL7A 4HDRA 5DISB 3MC1A 2ORIA 2PXXA 1TYAE 2QNIA 2PEZA 4ZT5A 1ZLXA 2GPWA 5BV0A 2BPOA 4YX9A 3IUYA 2GD1O 4YRDA 4U7HA 4MPJA 3L8HA 3AVYA 2AKAB 4KBFA 5EE9A 4CTMA 1ZCAA 1PP4A 1CEQA 2DHDA 3L8MA 4CKCB 4CKCA 1E9RA 5BYKA 1YACA 4E21A 1X9HA 1AZSC 4MHOA 1I4TD 4PRZA 4AZSA 3C3AA 3A6FA 1C0LA 4OLAA 4J16C 4M7WA 5DLYA 1T0PA 4FGZA 2BFNA 3FM9A 3VHLB 5ECGC 4BX2A 5EJEA 1SD2A 1HT3A 5L3QB 5L3QA 5B3KA 3CLVA 4R71A 1M7HA 5EMJA 4LOKA 3RWBA 4MUXA 2VAXA 3IELA 1FLDA 1E1RD 1CJSA 1H1TA 1NI5A 1YGYA 3OMXA 4GMDA 1RQRA 2GEFA 2WWXA 3GT3A 4Y8VA 3RVKA 3PA6A 3ICOA 1XDZA 4AG3A 4ZMSA 3NRCA 3U56A 3DH0A 3HA5A 1MX3A 2KYRA 1AKEA 2WY2D 1Y3IA 1G17A 3HV0A 4LI0A 4MUMA 4LHVA 4OFXA 1E69A 3OAAD 2X5OA 1L3CA 3SYLA 3FYCA 3Q9LA 1Q15A 2V9PA 3UGTA 4I4TF 3N2IA 2FPWA 1IK4A 4KXFB 5JCJD 1BS9A 5AKZA 3KNZA 4F6LA 3ILHA 1NVGA 4WXEA 3RS2A 3IB3A 1WW3A 2B2CA 2Z2JA 1BGXT 1KQPA 2A9RA 2BF4A 3AESB 5AKIA 3AESA 2UZ1B 2UZ1A 1XKXA 2LIVA 3ZH9B 3ZI7A 2HRRA 2CHVA 1EK0A 3L84A 3TVTA 3ZI4A 3QBEA 5DCLA 3W4IA 2V74B 4FDVA 2ERXA 1X3LA 4G5YA 4ZAYA 4FCWA 4N5DA 5AO9A 5LQKA 4ALJA 5GJBA 4Q01A 1N5RA 3BXPA 4KLZA 4ZZ3A 2EJVA 3H7AA 3H11B 3HFSA 3H11A 1FBNA 4NG5A 1CR0A 2EJWA 2PS3A 4QXQA 1G19A 4J7UA 2QU8A 4ZCLA 5IBRA 1KVRA 2XD9A 2Z2KA 5KJEA 1A3CA 2A0UA 5IULC 3MGCA 2VQFB 4Z49A 4J6FA 2CVQA 1AXRA 4DUZB 3B89A 3N7TA 2OILA 1F4LA 2ICAA 1ND5A 3KUKA 4MLZA 1TZCA 3FMVA 5TE9A 5JSFA 2CSXA 2RBEA 2BZ0A 1CERA 5B5SA 2Q3CA 3AEXA 2H8KA 1O8CA 4NDAA 4C08A 1WU8A 4LGVA 2G1PA 4KWEA 3AIOA 4DQXA 9MHTA 4ZT2A 1YHYA 2LTAA 1H6AA 2G17A 1B3BA 3FNQA 4YASA 3TOVA 3ZCSA 1WBDA 3EW7A 2XMBA 3U4IA 1SOMA 5J4LA 5C3MA 1NN3A 3E9ZA 1N57A 2O48X 1PR6A 3EH2A 1X0XA 1E5TA 2QZJA 3CX3A 3I6ZA 4RORA 4N7RA 2CFIA 2V6FA 1CJUC 3BFXA 4MEBA 5HMLA 4L57A 5CCXA 3LUPA 3TI7A 3G49A 4IDHA 5U1PA 3GLTA 5CLFA 3U5ZB 1QP7A 1ZGGA 5HFAA 4U7DA 1AJEA 4BRWA 5CNIA 1XYVA 1TU4A 1UFQA 4E0BA 1NBMA 4XYEA 3JWIA 2XQFA 4DNQA 3G0GA 2RSLA 3MWGA 3DDCA 4H7JA 3BJEA 1XLTA 3FFXA 3RB8A 4A0FA 1L4EA 521PA 3DE1X 5MGBA 3U2QA 4OQ4A 4B82A 5F7JA 3HPRA 4DCJA 4E03A 1NMSA 5E95A 3FY4A 4FBMA 5ETJA 4P36A 2WUWE 4CHTA 1XRRA 4WXPA 2R68A 2XTMA 4KQ2A 3X2FA 1EBUA 1OH6A 2O2ZA 3WWYA 4XPZA 2GHRA 2DWOA 2QF7A 4Q93A 1X92A 4TWBA 4BL5A 1EDBA 3HB9A 1U1FA 1AMOA 1U99A 1KDRA 5DBFA 4OJQA 4A10A 4DV5B 4WMLA 2P4SA 4TSFD 1M73E 3I42A 2ID4A 3N70A 3PFCA 1NKTA 1P9NA 2Q3DA 2RGWA 2JLZA 4EPXA 2OY0A 3C5WP 4LV5B 5LP6B 3GUZA 1N6OA 5BPHA 5LP6A 1DOZA 1U7HA 2XWQA 4FOLA 2GPAA 5AXAA 4QWWA 4FZ5A 4E08A 1ESNA 2QTRA 5COQA 1OV4A 2DBZA 3AYZB 3TIGA 1REQA 4DA9A 2BKEA 5A5VA 5KDOA 4HLNA 1DKMA 3DDNA 5JPDA 1Y5LA 2O5VA 2MSEB 3E2IA 3W2FA 4JLVA 4BDSA 3QLEA 5MDHA 3SXUB 3AK4A 2H1SA 3SXUA 2FXVA 4UTXA 5G0TA 3ZNQA 4WLNA 3AUXA 3KDSE 4WZ6A 4CVNA 3GELA 1HDYA 4YMSA 3GW8A 1W9MA 2VIIA 3FUWA 3LQQA 1AKVA 2YKGA 2WHPB 4FMPA 5DW0A 2WHPA 4P3NA 5FI5A 1T29A 5A71A 2GF2A 4UJ5A 4UJ3A 3ZHTA 4MKZA 2HA7A 1I51A 1GPBA 2QI9C 3HGMA 3M70A 4G37A 1NUTA 3KWLA 4M87A 4M8KA 5DX1A 1JXAA 3I9FA 3TR5A 3DMYA 2NIPA 3NVMB 4OYYA 1JG1A 1JQKA 1IDOA 2PJZA 4WX2B 4YRBA 1AA6A 4C2TA 1P19A 2WP0A 4JVOA 2R8PA 3LWZA 3PU6A 3L8FA 1R2QA 1M8KA 1VZ3A 2Q50A 4WKGA 5TV2A 3GLFE 8AT1A 1FB5A 1TM4E 1Y7IA 2BFEB 1C4OA 2VZ8A 2BFEA 1EE2A 4Q00A 2OO5A 4QO7A 2Z4TA 3EBLA 1JIXA 4JFRA 3ANNA 4MV7A 4OMUA 5EFZA 1JV2B 2EP5A 5BO5A 3VKUA 4F8YA 1YR1A 2W2TA 2JZCA 4IGEA 4YXWD 1C2TA 2QPOA 4JL8A 2GHQA 3U7IA 3VKVA 8ABPA 4G8JA 1ZOSA 2J4CA 3GEGA 4K9OA 2X77A 3HLKA 4C4PA 3DLBA 2BZSA 2HSZA 1Y9DA 4Q3LA 1K7FB 2BDUA 3RJZA 4CKYA 3K16A 3W78A 3GLIB 1C41A 4KODA 3V8NA 1HH4A 2EGGA 3UFXB 2FUCA 3E3OA 4N7BA 5BRJA 1OFUA 2RJ3A 4CEHB 3CWCA 1EMDA 4CEHA 1E7RA 5HKLA 1D7OA 1NA5A 3ECSA 3HE3A 2R65A 5SV2A 3G68A 3ESAA 4M9XA 2QXYA 2OSBA 4D4JA 3W5AA 3ZDEA 1FP2A 2I7DA 1CRWG 2QA5A 3OZBA 4JJEA 3AM3A 3T6KA 3LBNA 1D7AA 1NXXA 4S0ZA 2FK8A 1RTKA 3LO8A 2JGKA 2Q5CA 2VF2A 3FNRA 2HW8A 4JBNA 6LDHA 4FJ2A 4FJ1A 4GMHA 5D8DA 4F71A 2RGYA 4D4HA 1N2XA 4AP5A 1M74A 1VYUA 4X44A 1IZ7A 5IMSA 1DAKA 3CG0A 4I6JA 2Q3FA 1E60A 3KAKA 3R23A 4M49A 5I7SA 4YRNA 1MAWA 1WV0A 2G3YA 3SZGA 3SD7A 3UAWA 2FPUA 5CB4F 3OM9A