3ESYA

E16ke61k flavodoxin from anabaena
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
KKIGLFYGTQTGKTKSVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGKLQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transport
total genus 61
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3esyA00
2QMYA 1RLIA 3NHRA 1WSWA 2OHIA 1YKGA 4D02A 3NHSA 2HNBA 5BUCA 1I1OA 3QFRA 1AKUA 1AZLA 2BF4A 1QRDA 3N39C 5ULLA 1D04A 1YRHA 2BPOA 1GG5A 1RCFA 1AKQA 3OX2A 2R96A 1DXOA 1FTGA 4C76A 4Y7CA 2B3DA 5EMNA 4XDHA 2XODA 1AKVA 4CF6A 3OVMA 1XT6A 5F4BA 2A5LA 4QODA 3ESYA 2F1OA 1ZWKA 1YCHA 3HR4A 1H69A 2OHHA 1CZRA 3NHUA 1FLNA 1JA1A 3OWXA 1TIKA 2AMJA 3W7AA 1AHNA 2FZVA 1CZNA 3QE2A 4N9QA 2FAXA 3GFSA 4Y9RA 2HPVA 2W5UA 2QX6A 1FLVA 1XI2A 5EA2A 2Q9UA 4YAWA 4ZVMA 2X2PA 5TGZA 4FGKA 3KEGA 1CZUA 2MTBA 3D7NA 3ES9A 3P0RA 3N3AC 4GR9A 4C14A 1SG0A 2FZ5A 3HA2A 5FA6A 3FX2A 4GI5A 1T0IA 3FNIA 5F51A 4YQEA 1BU5A 4ZVLA 3QFCA 2D5IA 3ESXA 2V5VA 3KAPA 1C7EA 1CZKA 3FW1A 3LT5A 3B6JA 4YAUA 3B6MA 4DILA 3UXHA 1AMOA 3U7IA 2QX9A 2X2OA 3L9WA 2FCRA 2KLBA 1OBVA 1RLJA 3KLBA 4NLLA 1FLDA 5B3KA 1NNI1 2MWMA 3W77A 2FX2A 4ICIA 4HEQA 2HNAA 2QX8A 3F6RA 3L9XA 1X77A 2BN4A 3RPEA 3NHFA 4H2DA 5NULA 1JA0A 2FLVA 4YAFA 2FVXA 4N65A 4LTMA 3NHJA 4ZVNA 3TEMA 2MT9A 3NHYA 3F90A 2GSWA 4S24A 4F8YA 1FLAA 5B3LA 1DX9A 6NULA 1D4AA 2MOKA 1CZLA 1XYVA 2QX4A 1YDGA 1V4BA 4FX2A 4LA4A 3OJWA 1AG9A 3HLYA 3F6SA 3LCMA 3G5MA 3GFRA 4H6PA 2M6RA 4U7HA 4QOGA 1QBGA 4R81A 4QOJA 5A4KA 2ZKIA 1H66A 2R97A 2Q62A 1KBOA 3EYWA 2Z98A 4NULA 1KBQA 2FOXA 3B6KA 4DIKA 3FJOA 3NHWA 3FVWA 5LMCA 1AKWA 1SQSA 1QR2A 1T5BA 3UXEA 5LJLA 4Y9UA 1ZWLA 3W79A 5EAIA 4GQIA 1OFVA 3O2NA 2RG1A 5LLDA 1OBOA 1RTTA 4QOHA 4LAFA 5LBTA 4OXXA 4YALA 2Z9DA 3OJXA 2WC1A 2BZSA 4J8PA 1DXQA 5LVAA 1CZOA 1XYYA 1J9ZA 1J8QA 3W78A 2M6SA 3ZHOA 3NFRA 4QOIA 1BVYF 2OHJA 1E5DA 1AKRA 3KAQA 2QMZA 1VMEA 3NHPA 4FGLA 3ESZA 1YOBA 2V9CA 3O73A 5JROA 3TZBA 3U7RA 4FGJA 1FUEA 4M0CA 4C0XA 4YAOA 1J9GA 5FUQA 4LTDA 2Z9BA 4ZVKA 3K1YA 1B1CA 4U7GA 3OWHA 2Z9CA 3NLLA 4PTZA 2BMVA 3TE7A 1QHEA 3EDOA 3K20A 4XDGA 1YCFA 4QOFA 4PTYA 5F12A 1FVXA 1FX1A 2FDXA 1D03A 4PU0A 3NHLA 1WSBA 4ESEA 2OYSA 2V5UA 3GFQA 4C0WA 2N1MA 2QR2A 4HS4A 3NHKA 2ARKA 2QWXA 3JSXA 4BMOB 4LTNA 5LJIA 4DY4A 4N82A 1C7FA 4QOEA 5NLLA 3F2VA 3OX3A 3B6IA 1F4PA 1J9EA 4U7FA 4BMPB 1CZHA 2XOEA 5LBUA 4CETA 1YCGA 3N3BC 1ZX1A 3R6WA 3GAMA 1AKTA 5FX2A 2KQUA 1TLLA 3S2YA 3OX1A 3SVLA
chains in the Genus database with same CATH superfamily
2QMYA 5AKGA 4FXPA 2N47A 4ONEA 4RAOA 5K6RA 3NDBB 3AI3A 2R8EA 2WWWA 3H1PA 1VI6A 1XZEA 4HBZA 3FVTA 4LFBB 4GPBA 5KNDD 4DG9A 1WDKA 1L5FA 4FM9A 4U7JA 1Q0QA 1JPNA 3TAUA 1TB4A 1OYWA 2XLBA 3UPDA 4FW8A 3UWSA 5JAHA 3AEXA 4DCGA 5LYJB 3WMGA 1JIJA 4S0ZA 2Q2WA 2OSBA 5DTQA 4MKRA 2R7LA 3G13A 3I2GA 1AN0A 3F73A 2D2VA 5BN4B 3DFKA 2JAWA 4KXVA 1Z0UA 2XIQA 3UWDA 1K3UB 1SUAA 1BCSA 3PQ5A 1OVMA 3RB8A 1DJPA 4P4LA 3GVIA 2AF4C 2DULA 1T26A 1VPDA 2BI4A 1G5PA 2GAIA 4O4LB 2ZTHA 5DNCA 1P5RA 1C9DB 2ZRIA 1P4SA 1E9RA 1TIBA 1GU0A 1W9HA 2AC7A 4K05A 4OU4A 4AZ3A 4I4TA 4U6QA 4PHFA 5F2OA 4LZAA 1LFAA 5LZ2A 2P91A 5F7JA 1ZLYA 4EUNA 3I9JA 3U3RA 3RSQA 1RI5A 2HJHA 4LK2A 4XOIA 1WXFA 4BUJA 3PWKA 4H3KB 3T9BA 1FTGA 1EQAA 3IP5A 1VP3A 1F60A 5EMNA 4F4DA 2AW3A 3Q6MA 2QG9A 4XVQA 3SK0A 2FWMX 4YO8A 5IH3A 2YQZA 1NA5A 2IP4A 2QRLA 3EULA 3C6ZA 3W8RA 2ZS8A 4RPLA 2XGGA 3E27A 4G56A 4U3JA 2PCLA 2YJ6A 3HDHA 3H1BA 3KE8A 5ICFA 5C53B 4NS1A 4KG7A 3KT0A 2CNBA 3KYIB 4QODA 1T10A 1YAHA 1I1HA 2MMCA 3B82A 4FWBA 4OJQA 5SZJA 3T7EA 4YMIA 5A0TA 2NSHA 1UJNA 5IBCA 3SC2B 2MSWA 3H5WA 5AW3A 5HIIA 4KNVA 3QVKA 4IFTA 3V4LA 1NFQA 2VYCA 3JQ8B 4BLSA 5T67A 4MQBA 2IHYA 1OGYA 1UWCA 2GEKA 2X58A 1JA1A 4AYXA 3TO5A 4XCVA 4NIMA 3PZBA 4KO2S 2XTJA 3C6YA 4PS0A 5TT0A 4KVAA 3AZOA 4QGSA 4B71A 5EZ6B 2OFOA 5KO2A 5A4IS 3KNZA 2CXSA 3FPEA 2X4LA 4OFWA 4NENA 1M8JA 5TGTA 4MI9A 5JWRA 3FMVA 1NP7A 4HHEA 3ZYZA 1QIHA 1BJKA 1V9LA 2H29A 3GMIA 1XI2A 1N5OX 4XARA 5B58T 4BMYA 4AZ0B 2C9MA 2XZTA 4OCZA 2OFFA 2CV0A 3O82A 4BBJA 4BTVA 3TFQA 2GBFA 1C1DB 5IJ9B 3JAKA 2B82A 5CW1A 1HH4A 2F9LA 2QP4A 1L5YA 4DUGD 3EGXA 2H2WA 1QIGA 1UZAA 4LSMA 2QBYA 2PGAA 1N6OA 1IBSA 1YB6A 3CF0A 3CSSA 3IUNA 2Q5HA 4GUDA 4MWSA 5LP6C 1W34A 1B00A 1Z13A 2RI6A 3LCRA 1IM8A 3P7MA 4UOZA 5CA1B 1UZMA 5CFLA 4XYMA 1ONNA 4V03A 4B2IA 1K98A 4BLQA 1OLXB 3AUUA 3BL8A 3KC2A 1UKCA 3P96A 5EIHA 4M22A 4YY3B 1N57A 2MTBA 2VYVA 2ZWOA 2DLNA 4LXYA 4PWYA 3X2FA 3QRWA 5ITWA 16PKA 1HDCA 3WL3A 2HF7A 2IV3A 1O95C 1G5QA 4G4SP 2EBFX 1O9HA 2QROA 4Q4LA 4GR9A 2ZJ1A 2VTBA 2NV2B 5SZIA 2FGKA 4P35A 1G21A 3MBIA 3TSYA 1CUVA 5G4LA 3TG2A 1P1KA 4BRWA 4BLVA 1SUDA 1M7HA 3RREA 2C1ZA 1HSZA 1CKEA 2GX6A 2WMNB 3FNIA 3GUZA 4ESVA 4D9FA 1UK8A 1OFUA 1YJCA 2FEAA 3F5DA 4JJIA 4K9MA 5D85A 2O2IA 4DNXA 2H6EA 4K3UA 1E2HA 4ZYWA 1L1FA 4U2EA 3AETA 6GPBA 2H1VA 3CINA 1FFAA 4OX9Y 1WHTB 3A2NA 4OQNA 5AJVB 1V8FA 4QLOA 1U1FA 1XOIA 3C3CA 2WA2A 3JVIA 1G2IA 2NPOA 1RC0A 2E4YA 3AX6A 4R4JA 3DUFB 1JSRA 4CJXA 1ZM3A 5AQ1A 2NXEA 1VHTA 3EHEA 5GV8A 4AN1A 3SM9A 4OUDB 1U11A 1R6UA 4MA0A 1MH1A 2ZR8A 4GXNA 4BUZA 2WYIA 3UMCA 2GO1A 4ASUD 1KMQA 2P2CA 2Q6TA 3BXZA 3G49A 3JQ9A 4EL0A 1CIJA 5HS4A 5L6LB 2XUJA 4HDSA 3AVXA 3FUVA 1HZJA 4ZJUA 3KT8A 5ALFA 1BS9A 2VJMB 2ZULA 4RK5A 1HZZC 3Q10A 4HK4A 4OATA 2PDAA 4PYIA 3W5VA 5BXQC 2H9IA 1W88A 2EWWA 2R1VA 3K32A 1T6XA 4G9BA 4JZYA 7REQA 5F4ZA 2DR0A 4HEA1 3MBOA 4W9NC 4HXGA 5G02A 2XVMA 5D00A 3LI2A 2PX3A 1K2VN 1RLJA 2NXWA 2WAXA 3DV0A 3CZRA 3DL2A 3JS5A 3QNWA 4HVTA 1V1RA 2X8LA 5B3KA 4HDKB 1SUBA 3RS4A 4Y1RB 3VPSA 3AKCA 3FOAA 4JP2A 4F4FA 3ZE2B 2FX2A 5T6BA 4CKCA 1IQUA 4FFBB 4MH0R 2LD4A 2EL7A 1DRUA 1U5BA 3LRTA 4OLBA 2NYUA 3HP4A 3R20A 4N0EA 4N3CA 1GFIA 1JB9A 4O02B 4TLEA 3OQ1A 2PUBA 1G38A 1VYTA 2BTOA 2J7PD 4BX3A 4ZV4A 4I9HA 2V9PA 5CA0F 4FOTA 2CN1A 2D59A 1RQ7A 4ESHA 1LRLA 1Z6ZA 4EB6B 4NC9A 2Z43A 3CISA 1FSSA 1GL3A 4RADA 2CMHA 4BMZA 3PNVA 1VC2A 3VVMA 3PL1A 1RT9A 4FE7A 1YQGA 4UNIA 4KXWA 4DMGA 5D5QA 3DEZA 2VBGA 4ZHQF 3P4XA 1ZOOA 2PS9A 3SXUB 5FLYA 3H87A 4JU9A 2QV0A 1P18A 2JRLA 2RC5A 1FNMA 2WVHA 4F2PA 1N5IA 4A36A 4DDTA 1YUNA 4JQOA 5D8DA 4YCDA 3WWOA 4RTNA 2BOVA 2RHBA 5BV1A 3FKSD 4WECA 5DP2A 4JEMA 1AO0A 3G59A 3NHYA 2VDOB 3IVMA 1KL7A 1F2VA 1HDZA 1RLOA 3FAKA 3A32A 3H18A 3Q5GA 2GPWA 1IVYA 1DKPA 3ESCA 4FGWA 3OECA 5D6NA 5FA5A 3W5JA 3QXJA 5LL6P 1ATZA 3LKBA 3IC5A 5HIAA 3ADCA 3U4QA 1KK3A 2RIRA 4LOAA 2J48A 4N47A 3TW0A 5J2UF 5JJBA 4RV5A 2ZIXB 1PZMA 3GMTA 2FP4B 5HS6A 4CKXA 2H5EA 1QDEA 2C2YA 2A4KA 3GGSA 5JARA 2W58A 1CUFA 3PWZA 4ZOQI 5FTMA 3JQAA 3VR5D 2RK6A 2REQA 3CCFA 1YFLA 3AVYA 3L04A 2JLBA 4XEHA 4D9KA 3EWNA 1PJQA 4K40A 4O2BA 1LH0A 4TL9A 2GZDA 1SKUA 2HIGA 2JKVA 4MVJI 4OGKA 4Y9DA 4B4UA 1TX4B 2Z09A 5AW1A 3DNPA 1D07A 3DW1X 3EVCA 2PR7A 3P5BA 1ILEA 1RI2A 1L7RA 5D1HA 4EMTA 5MHTA 4FS8A 1B76A 2C4WA 4UPDA 3BGOS 1W581 4YREA 4Z2YA 5GV7A 3U6BA 1NKTA 1CS0A 2PSJA 4RMGA 3GZNA 3P97A 4B48A 4C3VA 5K05A 5LUAA 2YOFA 2NU9B 2FPIA 1W0JD 4LXIA 1CQJA 2Q62A 1A71A 1RXCA 1JR4A 1PX2A 4GE3A 5DHAA 2HF8A 3VC3A 2HKIA 3LUDA 4U8HA 3HMQA 4KGXA 5A5FA 5ICEA 2BFNA 3P1JA 1F0KA 2V45A 3HKBA 3LGSA 4EHLA 5C7LO 3HKEA 4EJSA 3AR9A 4HLUA 4PGMA 1VFNA 4WERA 3BK2A 1XMQB 5DGXA 3PQ7A 3P0EA 1VI2A 1T4GA 1XCMA 4DIKA 4EI8A 1GR1A 3NDPA 5EQJB 1FUUA 2XW6A 2ZBUA 2XY4A 3IRUA 3JQGA 3U44B 4MO9A 4EGSA 4R1PA 4J90A 1NU8A 4S1WA 3Q8MA 4EH1A 4Q7LA 2RGYA 1J42A 2Z4SA 4GE0A 1C3OB 1HOXA 1U0LA 3CB4A 3ZQUA 3FTEA 1OKKA 4LV6A 3TWOA 2IRWA 2VNKA 1VSQA 3OIUA 3ZD8A 4L5YA 2LR0A 5JNVA 5LJLA 3VNVA 2Z2XA 1EYZA 1DNPA 4MOWA 5AKKA 4BTEA 3GP5A 2V7XA 3BTSA 2OLEA 1JXQA 2J32A 5EAIA 1KHTA 3SX0A 3EWIA 3ZY4A 5LIPA 3DFMA 1XNHA 3HXKA 4E6EA 3LKZA 5FI3A 4YWHA 4EBFA 1XKXA 3SE7A 1Q1EA 1A9ZA 3E9MA 3EOBI 1KZ6A 1OBOA 4KMMA 4P3XA 4Q1CA 1UDBA 4RK1A 4YQYA 5E3IA 5HA5A 2X9GA 3KJHA 3ST7A 4ZIRB 3UMMA 3MJHA 3O38A 4NSNA 1J0XO 3AFHA 1AM4D 4K9LA 3P9IA 3QLUC 4G1MB 1R4NA 3RK0A 3LSYA 1CJVC 2NUBA 2C03A 3DBRA 4H1UA 1QHNA 1ZCZA 4G37A 4CFSA 5KU1A 2ZKLA 3KOYA 1P6XA 4ZOLF 3TUIC 4B9EA 1PWZA 2AK3A 4BNYA 4CODB 1U7XA 1ENYA 1SD1A 2R6DA 4KQMA 3CVXA 1ZS9A 3PYLA 1NFFA 3RASA 3ZCUA 3KZNA 4JJGA 4F8EA 4HVLA 3H65A 4RS4A 1WW2A 3IJRA 2UVQA 3PITA 4P38A 5BWNA 4J0FA 1XTQA 2ZOSA 1BQ4A 2QL7A 3F9RA 4ZT3A 4H7HA 5LBIA 4KQJA 3ZHSA 3CH7A 3OJOA 3ND9A 3RIXA 2C7RA 3A36A 4WOBA 5K0CA 5JCOC 1CDOA 1T36A 1QGUA 2RHLA 5CFZA 1E5DA 1XL1A 1E8NA 2A9FA 2GHIA 3M6MD 2ZDHA 3QEJA 3WKDA 4C1BA 4ZDWA 4LZOA 1U0GA 3GG2A 3ZDEA 2FXIA 4PC7A 1Y1PA 4NH0A 4BYMA 2XCRB 4HAIA 3LHIA 2HDNB 4D4HA 4QDOA 3FUTA 3ZU6A 2PU7A 4C01A 3HJBA 1AXEA 1NXSA 3C97A 2AF3C 4DDUA 1QC5B 1P7CA 1TEXA 1U4OA 2DPXA 3E3OA 3U7RA 3UA4A 2NZ2A 3GQVA 2AC2A 1XEWX 1SOAA 2Y77A 2GHTA 4J7CA 1C29B 1TYCA 2BUBA 4IMJB 1CVRA 1OZHA 3RHTA 4HWOA 2V7UA 2Z1NA 2AR7A 3F6BX 1P2VA 4XUDA 3DDCA 4OG2A 5B36A 1NVAA 1AGRA 1XV5A 3N6RA 3QUBA 2NO0A 2GXUA 4DRXB 1PVOA 1J21A 1XDZA 5EKTA 3ZLBA 1WWKA 1FUKA 3TSAA 5K3SA 3MWGA 1V5EA 4R7TA 4TVSA 2C5SA 3MD0A 1I7DA 2YHAA 2P2ZA 1T3SA 4EFNA 1O1YA 1P9WA 2HDHA 3QWBA 4TKZA 1A8PA 1GAQA 1FFDA 1TVKB 2AL7A 2QT1A 2XQGA 1L5HB 1NI4B 3F3YA 4M0UA 2DWCA 3B60A 3VPXA 4CEIA 1LUAA 4IRUB 1X8JA 2HRCA 4RK4A 1DOZA 3AOGA 3PF8A 3BX1A 4P0TA 3LTEA 3SBXA 4EECA 5IX8A 1EM8A 3T41A 4JBHA 4BB6A 1AUOA 2C9DA 5ICGA 4QYTA 4TTPA 2ZM5A 3GEEA 4ZANA 5F7ZA 3VU9A 4BKQA 5AJTA 2NV6A 4WBXC 4BCBA 3BCHA 3PPVA 1JQ3A 5TXGA 1WX1A 3TIXB 2FDXA 1G8KA 2NZUG 3BA1A 4IUDS 4L5AA 2A30A 2JCVA 4YRPA 3E7XA 3EEFA 2NO9A 3D59A 5ELMA 1R0LA 4A0GA 2XE6A 2PJZA 3GFQA 5F98A 3X43A 4LOLA 4E14A 3S2FA 3CVWA 4PAGA 5C1PA 3QJGA 5C8YB 5KVVA 1ZY2A 2IU6A 4L4SA 3V8RA 2PX5A 4UEQA 2XTAA 2QMEA 2ZIEA 4MQFB 1GARA 4PPYA 2G4LA 5JPIA 3TNLA 2IU0A 3R7BA 2OOSA 1V11A 3BFXA 1IUPA 3P9PA 1GTJ1 4RZQA 4Y3UA 4YR7A 2PN1A 1LQUA 2VF5X 3C3YA 1C7FA 1HDGO 2NG1A 1FP4B 4G09A 5F5XA 5TRTA 5B4VA 1YA6A 1PYOA 1HNNA 4HNQA 5ALNA 4WNYA 7ADHA 1HT1E 3AIKA 3G0IA 2O0LA 3A6HA 5ECWA 3ZWNA 1P29A 2VPYA 4HLDA 4PYJA 3F2VA 4ZEVA 1DEKA 2YIDA 2RDMA 5LQJA 3RU2A 1EB8A 1UFQA 1ZRSA 4A9AA 4G86A 2LNDA 2OYRA 3SSMA 3K4QA 1SVNA 2Q4RA 2VF2A 2JBWA 4E0BA 1FXSA 3AKYA 4J03A 1LY1A 1I01A 4N03A 4TKUB 3USZA 1WLSA 3C0KA 3LL4A 5F9FA 5AT1A 3V48A 5GADl 1ZIDA 3JALA 1KEEA 4TTSA 2P1DA 2VPPA 3BMNB 2PSSA 4HI0E 5A02A 2SBTA 1Y63A 5D3MA 4DG5A 2KQUA 4YYZA 5I45A 1HETA 1JDUA 1WXDA 3WLKX 1II8A 2O48X 5FPSA 4UMFA 3WB0A 3A10A 1VFPA 2BLNA 4WLUA 1XJWA 3MRSA 4US1R 4XX0B 4W5TA 1GGMA 1RZUA 3VOAA 4GSKA 3VJKA 2W71A 4X8OA 1SULA 5E1DA 1V6AA 4PCVA 4PEVA 2I7TA 4WXRA 5FTJA 3IMGA 3VHXA 1U28C 4BZPA 5EHZA 5LOVF 4P4SB 3U40A 3FHLA 2XB4A 1GGNA 2ZEJA 4XYLA 2CXQA 4U2DA 4CMIB 4WKPA 2WA1A 1KEUA 5CT9A 4M7PA 2WIGA 3R3UA 4BFYA 4AJPA 4D0NA 1NYLA 2IZ7A 3D54D 2XJ9A 1CT9A 1CU1A 1KJ8A 3R4VA 4EIWA 2EKZA 2BELA 2ERXA 1ZEJA 1F6BA 3ONWA 2JPDA 4RLSA 4RGBA 1N0HA 2I67A 5EVJA 1SKYE 3ED1A 2WIAA 3LF1A 3PV0A 2W2NA 4IAOA 3L7CA 4B2PA 4MYSA 1K6XA 1IRXA 2BEVB 3EAGA 2J5BA 3HCDA 4OTZA 1P1JA 1AGPA 3EDCA 3F7TA 2ZI9A 4DWVA 4JUFA 4MVXA 2I2CA 5HCIA 2BR5A 3LG2A 2X0FA 4XB1A 3ROKA 1UUFA 1P61B 2XD9A 4ZMSA 1XTBA 3WLRA 2WF6A 3L41A 1IWOA 1OV6A 2E5FA 2G04A 3CEHA 3UFXB 1PEKE 2F6RA 5A1TA 1XB2A 3IX7A 4IDFA 5BYAA 3T4XA 2HSGA 3EDYA 3O6VA 3RUHA 1VL5A 2JS7A 1VPWA 1BHO1 4DMFA 1GGJA 3IMEA 1RHKA 4G85A 3ZLTA 2Q1UA 2XUIA 4D8UA 1NBAA 2R8RA 4OK5A 4UHFA 5T8KC 5IPFA 1JKJA 3IGFA 5JMTA 1N6IA 4BNGA 1X7YA 1K8ZB 2WUEA 3IV9A 3LC1O 4IJ5A 4A82A 3B12A 4JLKA 5DNYB 4IGFA 5LFAA 2VA8A 4RQAA 3V2IA 2I2BA 4L4ZA 3B5IA 4PN3A 5K3DA 5LQRA 1HNXB 3PFKA 1LW6E 2HA3A 4E31A 4OJTA 4B5KA 1YRYE 5TJ9A 1UANA 1PW7A 4KRYA 2IZ6A 4PLCA 4D41A 2QA5A 2JAXA 2ZCJA 2Z2IA 3H9JA 3K6SA 3H17A 2QYTA 5BR4A 5ESRA 3QVGB 2J4CA 1UIRA 2HSEA 4KLZA 4AQYB 1TA9A 3QVJA 3MD9A 2MU1A 2O8EA 1FCJA 2Q5JA 1NMQA 2DY0A 1E1QD 1MXHA 3NYQA 4DDWA 5IVKA 3VKGA 1XMXA 3QLEA 1RQPA 1Y7PA 5F3DA 3U48A 2H31A 3WQHA 3OWXA 2DPYA 3UANA 4Z4EA 1VG1A 4IS3A 4NDZA 3LXUX 4UHHA 1WD5A 3FCOA 5HM8A 2R5NA 2AG6A 4Q4HB 4M89A 3HABA 3BMQB 1K75A 2W6ZA 3GFOA 4N9QA 3N05A 5FD8A 1HXHA 4GX0A 4FT4A 4ZOAA 4ZCIA 1U80A 2CC2A 1VE5A 2VPXA 4YRGA 1Y9AA 3WNQA 4X7PA 3AUFA 4IOKA 3KDSE 2QJFA 2E87A 4FFPA 4R0NA 3BCRA 9LDTA 4FZVA 2OFWA 3O0TA 2Q4DA 5HHTA 2KM1A 2OSVA 2Q9UA 4X7RA 3A27A 4AY3A 1ZJ6A 3OOWA 2XZDA 1D0VA 4CIVA 1I80A 1GG2A 4UDOA 3QI7A 2QTTA 5IARA 4ABTA 1QYVA 4AG3A 3FVVA 3UMBA 2VTDA 2BJHA 2AI1A 1P6UA 4X66B 1V8PA 2HJRA 2HOQA 5CLIA 3VZCA 1WY5A 2BHSA 3KEOA 3PDIB 1WPXA 1R0WA 4YR9A 1YDMA 4GP7A 5AESA 5I7EA 2KBFA 4JLDA 4NCXA 5LPNA 2WJAA 3U7EB 2WWTA 5ALHA 4B81A 2CT8A 1DLIA 2XNJA 1RXYA 4CIWA 4CHTA 5KOIA 1AS0A 3P0RA 4Z9YA 2YWCA 4KXYA 4M9ZA 2PKQO 2IS6A 4C4YA 3RKUA 2WJZB 3HUDA 5JJIA 2M32A 5M29A 3PQ4A 5AFSA 1Q50A 1GTVA 4BNNA 1O2DA 1R88A 1X94A 3KU1A 3NT2A 4GI5A 4JR1A 3PC6A 4ZRDA 4C03A 4KE7A 3TS1A 4EI7A 4RS3A 5JECA 3IPAA 4O1MA 4INZA 2QM3A 3VM6A 1U9IA 2O3RA 1L4HA 4JT4A 4HAXA 2Y1WA 1TYAE 2D5IA 2ZBGA 1OH5A 4GYKA 2I7VA 4PO3X 3T7AA 4G5XA 1Y1QA 3WMRA 4WFQA 4LWPA 2F55A 1Y9DA 1KH1A 3HWWA 5ESWA 3W3ZB 1MDFA 1RKUA 3IKLA 3CEPB 3OP1A 2EGUA 1DQNA 4WKCA 5F78A 4ACAA 3DBHB 4XAQA 2JKYA 5C51B 3TN7A 3R1IA 1LQTA 4MO2A 4PHTA 3K0FA 2WD7A 4WCDA 3T0GA 1KE1A 2ZRMA 1NUHA 4BFUA 1T2UA 5ALUA 1P2SA 1T6YA 2AJLI 2VH1A 3BMXA 4PZLA 1ZVVA 4MS1A 3TNDA 1REQA 3KB1A 3KUUA 5DO9A 1NXWA 1RWPA 1TUBA 1Q57A 3CCBA 1QU3A 3U61B 2ATEA 3MUNA 4IOLA 3MHPA 4EYGA 3DHYA 3TRFA 4C4RA 1O96B 5HDQA 3EXHB 1SQFA 3AG5A 2W4QA 2IC5A 3OC6A 1XKLA 4XX1A 3TX2A 3RVMA 4EY7A 4M88A 4CF3A 5KOYA 4KO4S 2ZUSA 3I53A 2XGSA 3LK6A 4O33A 1D2CA 2D00A 4UBNA 4MV7A 5JSQA 3ZGOA 4NLLA 4PVDA 3X1WA 1KQ3A 2QD4A 3NM4A 1IZZA 1CEYA 4K7JA 2QZZA 4Y2PA 4RFLA 1OU4A 4RK6A 4WSOA 2QQ5A 4L78A 4CUZA 4YT4A 1PU2A 4XSVA 2AXQA 3AL3A 3N0XA 2C5HA 5H1YA 4BRUA 4B2YA 3T3OA 2YZMA 3OZAA 2HW8A 3WWZA 3GRVA 2FLWA 4KREA 1VXOA 4BLOA 4QAQA 2H5IA 4L6AA 2QEQA 1HMPA 4RKWA 5IJXA 4BV8A 2GZSA 4AJJA 1QE5A 2I78A 3HR7A 4E32A 4AKSA 4FOPA 3PHHA 1J24A 4C6HA 4ZCSA 2NNLD 3K0AB 3UT5B 1W1UA 4C6TB 2OQVA 5JNTA 3TQFA 1F3OA 1JIIA 1D6JA 5KHAA 3EAQA 1VB3A 2WB4A 4H4EA 3ZH2A 4CM1A 1PQ4A 2W6PA 4AY4A 2X42A 2HV8A 3M1AA 4DM4A 5C52B 3T94A 1RRCA 1KJZA 4OHMA 2OUIA 5GVRA 5GINE 1NMXA 1ULZA 1MOQA 3GNLA 3V97A 1NQ5A 3MWEA 5LSAA 4TYNA 2J5QA 1J33A 1CDDA 1YS9A 5JXHA 2ZS7A 2FJPA 5A06A 1V8OA 4F86A 2QTVA 4I5GA 4RY2A 4HAVA 2MT9A 3WIOA 2ZI7A 5LWHA 2AFVA 1ZJ4A 2HRZA 3F90A 3Q7SA 5CLLA 2ZS9A 4PFKA 5JZOA 3OU7A 3MJCA 3DYVA 1WCYA 1TVEA 2CJXA 3CVVA 1PEYA 3LVFO 2AZDA 1K8QA 3BAFA 1UEIA 1WAMA 3SIXA 1Y3CE 2OR3A 1KDTA 2OZKA 3FHJA 4MGEA 3ZNNA 1PUIA 2O7QA 4BJ1A 1Z5UA 4BO1A 3KL2A 2EV9A 5LQMA 1FPMA 1TUEA 2HRDA 3O1LA 5IAAA 1NU6A 4DC1A 2CHFA 4GR5A 4HH1A 4JEHA 2Q21A 1KPHA 3LUCA 5JAQA 3ZGXA 1B3RA 2GESA 4I08A 1P2TA 2J0UB 5C0OE 3AV3A 3R3JA 3WWCA 4HDAA 4PPFA 3VAZA 1F38A 2F8TA 3K70D 4CMAA 1C0IA 1ZA1A 4CCWA 3H11A 1OT5A 2VT2A 4OP2A 1KR5A 2R62A 3KBBA 1SZJG 3NT5A 3EGWA 1R27A 1Z7WA 4JUDX 4JQSA 1YQQA 4UW9A 5EIOA 4D9HA 2DSNA 1MZVA 3CEAA 4KQGA 2IYXA 3NBYC 1OHHD 4KP7A 1XLTC 2ZI5A 4BN5A 4R81A 2PMKA 2WWVD 4CNBA 5B12A 2X3YA 2WJ3A 4UE6A 5IDXA 1ZSNA 3EZLA 1CE8A 1U8AA 3GCGA 3L02A 3MC1A 4UZSA 2YC2C 5YASA 4BGVA 2NUAA 2B1RA 4LI0A 1MJNA 4Q3NA 1JG1A 5JQWA 2FPGA 3WLIA 5K3FA 2HCRA 3RSLA 1B0UA 2NADA 3L8DA 2NO5A 3L82B 3SVZA 5EHXA 1WULS 5M5BA 1QF7A 1RS0A 5KUTA 2CL7X 5IM5A 4RZHA 1RI3A 5D86A 2FOXA 4KZKA 2UYYA 4QJIA 1ULUA 5A03A 3NOOA 2XTMA 4H7KA 2I1VB 3ZOKA 4ZREA 4JVNA 5AM2A 3CVJA 2OVFA 1K7YA 1NPDA 3G68A 4PO8A 1MO6A 4BMVA 5K0BA 5BRJA 2HWWA 3KZVA 5LMCA 1J2JA 1H05A 4YDRA 1YQDA 4HAYA 1RAIA 2MHCA 3RSOA 1CR6A 3C6XA 3WK8A 3DCNA 5H3HA 4B4OA 4LXQA 1UOPA 2REBA 2GAOA 4J7XA 2D0IA 5CK5A 4D3ZA 2ZWAA 4NAHA 3KJXA 1NC1A 1T91A 2ZROA 1Q0RA 3RNOA 1JKMA 1PF7E 4PYRA 2BP7A 2J7KA 2EP7A 2PKCA 3PVSA 4K0RA 4QARA 2O8CB 1QR6A 5AJHA 1SURA 2G8LA 3M1IA 2DM6A 3OD5A 4MZXA 3SEAA 2AG8A 1U9CA 2B1GA 2F7SA 2G67A 1FP2A 2WUWE 3E1KA 3M6IA 3ND7A 3WHKA 4JLWA 4LJ7A 1YJ8A 1EZZA 1LPBB 4MR8A 2QVYX 4XI9A 4G84A 3IAFA 3IIEA 3U1TA 2BVNA 2I8CA 4OXXA 5TQ2A 4WE3A 4D26A 2GBGA 2QNIA 1VIMA 4D9GA 1M6NA 2DFTA 4HDRA 3E2PA 2XHEA 4KPUA 1SBQA 1YB1A 2O0MA 1YR7A 2XWPA 2AIRA 4QGHA 2IUUA 4PTLA 1A7AA 3OJXA 1WIWA 4OREX 5AVJA 4CRWB 3SSOA 3JVVA 1CNEA 1BKSB 4ETIA 1RCUA 2JGAA 1ZVMA 3HB9A 5DFAA 2ZTUA 3P9NA 2W2VA 4S12A 3JYLA 1ADBA 1HE1C 1VXRA 1XYYA 3PNLA 1YGPA 2I22A 1XMIA 2OQRA 1ECPA 4LZWA 1QGAA 5GAJA 3JQ9C 5B37A 2LWIA 3UG6A 2CLHB 5JH7A 3WHPA 4KDCA 1E96A 5CX4A 2H07A 4AKEA 4DMCA 4F93B 1CG6A 3D3EA 3QELA 1A8IA 5DYNA 1MW8X 1EFVB 2TMKA 4RV9A 3ZQKA 2JK0A 4RF2A 2EZ9A 3OCCA 4YJHA 5IANA 3I09A 5A1JA 4RVGA 2O1EA 1JAZA 3TK1A 4TYQA 5MFZA 2XSZA 4C4ZA 1RAAA 3FTDA 2F3PA 2XHZA 4FHCA 4CM5A 5K4HA 3O4IA 4IINA 3MCUA 5J4VA 1Z16A 5DP1A 2O8CA 1TEVA 1JDSA 2CE7A 3QBVA 2GEDA 2WVJA 3WL6A 3RABA 4I66A 1I3OA 4AMBA 1BAPA 1ZJWA 3TLGA 1DPGA 1JHZA 3A3OA 4X9XA 3BBLA 3NGXA 4HYQA 1BXGA 1M73E 1WU8A 4DGQA 5JNUA 1F1JA 4WOCA 4EB0A 2OBNA 5FUMA 2O3QA 4YAOA 1KHHA 1F5NA 1EWKA 3SIWA 3DEAA 1R2QA 3G02A 4M37A 3JPWA 5IW8A 1RFGE 2NSDA 1RXSA 4J1TC 4XGKA 5CB6A 2NVUA 2BEJA 2VHCA 4DA0A 4ARZB 4ES6A 3SOZA 4IXMA 1IOLA 1MC1A 2XQIA 1YS2X 1AQUA 4HPWA 1UBKS 2FMUA 3QV1A 4REOA 4I50B 3NAZA 3FUXA 1NXOA 1OIVA 2ZVJA 2Q5LA 3MZ0A 5HXAA 4C7KA 2VAVA 4E5UA 1GNSA 2GFHA 2ZIFA 3ZBUA 5JWHA 1ZMXA 1B0AA 2GRUA 1H0SA 1X80B 2ONZA 4L02A 4P5DA 4EZIA 4MQ6A 4FU0A 2C57A 1PE0A 3GOQA 4Y9TA 3DP7A 5DBEX 5IVIA 5BVGA 4QECA 5AM1A 2V7PA 2H1IA 1WBJB 3OAAD 4ZZIA 1YVUA 4DE5A 2OAQ1 2PD3A 2X3FA 3DWIA 4DIBA 5F3RA 3GLFE 4EA6A 4F9FA 1FX1A 5C5IA 4N41A 2MSLA 1UDRA 2L42A 1T6NA 1L8AA 3BE5A 5EZSA 3ZWDA 1WMAA 2WZCA 2JATA 1UKAA 3BXFA 2B4YA 2CL5A 4HS4A 5I9BA 1F2UB 1VZ3A 4EYQA 1H3EA 2RBEA 1CTQA 1AUVA 4FBGA 4AS2A 1PZHA 3FDZA 4YPFA 2LV8A 1XEFA 5CX1B 3KAKA 4YDQA 2O7SA 4ZI7F 3IT1A 1PVDA 2R1ZA 4Q1FA 1M1XB 1YZQA 2QLJA 5AM4A 4ZYUA 1JHQA 5FRDA 1JJVA 4DFDA 2GZHA 1A5AB 1TC1A 2R6R1 1F7UA 2AOXA 4LYAA 1QLHA 5T3YA 2IZ5A 2OAEA 5JLAA 4KE6A 5EZYF 3P0HA 4W63A 1V5IA 4QDJA 4R8LA 3P9YA 2R8XA 3B9QA 4J2TA 2QRQA 3BHJA 1QANA 4U7FA 2VS1A 2VBFA 4DIMA 3RC3A 4W7SA 1DBIA 3PDHA 3VYVA 4ZEMA 3QSYA 1QTNA 4Y6QA 1PS0A 2GASA 4L8GA 1PFGA 2HI0A 1BGXT 5DI3B 1FA9A 3ZHXA 4BNKA 3FFTA 4WQMA 2PLRA 4OV6B 3TL2A 4HJXA 3WTCA 5JZBA 2OZVA 4OGLA 1Z4QA 2XVXA 3OFJA 5KPJA 3V6LA 2OEPA 4PN7A 4D25A 5AW8A 2I6SA 4HSGA 3WL8A 2Z95A 4MLZA 2B34A 5K0NA 5BN4A 1EXMA 4HXFB 2CYAA 1ZD1A 2PZEA 2BKEA 3SVLA 1TTTA 3T1NA 1DU4A 4L7QA 4EJSC 3AEQB 4HLUC 5B7NA 3AU9A 5J4YA 3BIWA 2FVYA 5CG1A 3AJ8A 4F96A 1WZCA 3COVA 1Z8HA 2CJWA 3PJFA 4NECA 3R3YA 4O4LA 1SU4A 1NN3A 1UPXA 3AU8A 2V98A 1WDLA 1Q1NA 2PPLA 3A14A 1Z29A 3QITA 4KVGA 1Y8CA 3KKQA 3N1UA 4W9RA 3THXB 1Z4KA 2ZRDA 2EGGA 2CKDA 2G1UA 2ORWA 3B20A 2P9TA 1RRMA 2KHZA 3R6GA 3TXAA 4L3VA 5CDFA 1CHDA 1D1TA 4O4HF 5H0IA 1W59A 5IM4A 2PVSA 1A9SA 3CZQA 3IULA 5FPYA 1P45A 1UC5B 4FGZA 4U6SA 1ISFA 3L8MA 1PV4A 1VBNA 2D62A 1RJFA 4KN5A 4YP5A 4Y6OA 5U4QA 3G2NA 1L1EA 3TW4A 1P2GA 4E5DA 4AI6A 2VJOA 3DBLB 3WDMA 3V8EA 1L7NA 1S1MA 4IIEA 5I7OA 5KNCD 4LG1A 1DV2A 2Q1SA 2XDQA 1XZGA 1T6BY 4G5RA 4HN2A 3GROA 3M1LA 2FMIA 4PSUA 1DGQA 3FGPA 1WLYA 3IB3A 3SC2A 4CKYA 1Z2CA 2NO7A 4EPXA 5J63A 2D1YA 1P0CA 3VYTB 4ER6A 2NO4A 1ZXBA 3QU4A 2WQ7A 1EWYA 1WF6A 4YJ3B 5JISA 3GCDA 2ZDGA 1Y33E 4Y6RA 2VSFA 1JJBA 2B7LA 3G9UA 3PE6A 1Z08A 3OJCA 1QQTA 3AWIA 1F8UA 3WLOA 1J2RA 2B4QA 5AVXA 4PYMA 1L4EA 3KAJA 3ETJA 4XDHA 4A23A 3S8EA 3IH5A 4IXTA 4N8SA 4E2WA 2IE0A 2BGMA 4EK9A 2PS0A 5KVCA 1OZAA 4UOQA 1JR3E 3EQ8A 4JL6A 4I4NA 1E1RA 5F4BA 3V55A 3VMMA 1AZTA 3OOEA 1MQSA 4HMOA 4ZVPA 4HL6A 2FPUA 3BUSA 3D3KA 2PD4A 4ZCTA 1JDZA 1BH2A 1GGKA 1CYDA 2WTNA 4DA9A 1ZI8A 1RWNA 3PEWA 2JARA 2CUTA 3BORA 2FK7A 1UDWA 1C1DA 4WNAB 5IJ9A 2BEWB 4JP3A 5ALTA 3PCRB 5AM5A 1DKLA 5K0SA 3PX2A 3L0PA 2VNJA 3N2IA 3HYRA 5E6SB 3J81A 2EIXA 5DASA 2VXOA 2H2DA 5JMOA 1DBVO 1XU9A 5CA1A 4FD2A 6ABPA 4BO0A 1OLXA 3TG8A 2QAGB 3QOXA 4FE3A 1JHXA 3QBJA 2NGRA 2QXTA 2AG5A 2JJYA 2Q4BA 3QW4B 4JENA 2GTHA 2ZB7A 1OB5A 2F00A 5C81A 4LX0A 4KGZA 1JHPA 1PUXA 3M9XA 4TYWA 1TCUA 4RY0A 2DLCX 2P8SA 3EMVA 2RHTA 3OE5A 3OZCA 1EWVA 4PO1A 1V41E 3V1UA 1ZPDA 4V2IA 2OBYA 2QL9A 5H02A 1SMKA 1ONPA 2G77B 3ZTYA 2WM8A 2DJIA 3BBPA 5EE1A 3SCZA 3H3JA 1PGOA 4OHKA 1A4IA 3FCAA 4QXOA 1UAAA 1L5OA 3PEFA 4XD7D 5ADHA 1VL8A 1KK0A 5CVJA 3LKDA 1S9DA 1NBIA 4TTTS 3K9HA 2OK7A 3HVHA 1UC4B 2BKLA 4FFWA 1H8ED 3WRXA 3GCXA 4N5DA 3A2LA 2YXLA 1WHTA 4IICA 2YVAA 5ALDA 1SCUA 5KTMA 2DB3A 4XIFA 3OZXA 1KAMA 1SUCA 2YUTA 7MHTA 1ZH6A 5K3CA 5H4HA 4DLZA 1M2KA 2F8SA 3U26A 4HNTA 4DB2A 3DUFA 3QUTA 5D3QA 4BO4A 3IIIA 5IS2A 4O1IA 2VL7A 5ISMA 2P3LA 1D3AA 9MHTA 4F72A 3MCZA 3ZY5A 1YD7A 4PFSA 3FGNA 3MYRA 4OAOA 4W5NA 1TO1E 3QEMB 5EXDA 3GP8A 3E5NA 3AEUB 2SCUB 1E59A 3O1IC 1P5JA 3ZDXB 2Z8YA 2IU4A 3UAVA 1LDGA 2LCQA 5KYVA 2IIQA 1C8VB 2PX0A 1MOPA 2JJ1A 3VA7A 1TE2A 3LOUA 1O87A 1RRGA 2OZPA 1D2NA 2DFLA 1HKHA 3IE1A 1N0WA 4GFDA 4PHHA 4XFJA 3DVQX 2BJWA 2PZBA 1JXMA 1NVTA 1WCV1 4ZAGA 6ADHA 1ECBA 5KAPA 4D3FA 3IDFA 2K87A 3LT5A 3UBMA 3RF6A 2QZ4A 4FFBA 5ITZA 2GJ4A 2Y1XA 4XFKA 4AX8A 3DONA 5I9LA 1R6VA 1FJHA 1E6UA 5HX7A 2QRUA 4AUEA 1IY9A 5LIRA 5SY6A 3TRJA 3ZWAA 2ZRJA 3MW8A 4YCSA 4MRNA 3C85A 1V95A 2VQ6A 3L3BA 3BA6A 2R6JA 4EB6A 2AMYA 4AJ2A 1Y4ZA 4LHEA 3TZKA 1FFBA 2EEPA 2HPAA 3I4FA 5LZ5A 3OKPA 3MTQA 4TZKA 1CB0A 4TWJA 5IH7A 4K9OA 2KLBA 4JUBA 2PZMA 2XMZA 5CFOA 3SXUA 3AF6A 2Q2VA 3TZ6A 1Y7HA 1H0HA 3WQRA 4LGCA 3P45A 5BV8A 3AIMA 1Q77A 1SVLA 2YFKA 1EXVA 4BNMA 4LBVA 4BP8A 3KD3A 3KKEA 3H3FA 3W4IA 1H4VB 3PT9A 2HBRA 1P80A 4UJ5A 1J2EA 1GAJA 4YAKA 3ZBTA 2A0YA 1NBWB 3S44A 1KEKA 3WAGA 4L16A 4DADA 1VKRA 5DN9A 1TO2E 1J39A 2J46A 2ORYA 2X76A 1DWPA 3WSTA 2VEOA 3PUIA 1ESCA 5BXYA 2JGNA 4GP6A 2P9GA 4KJZA 2WPNA 1J97A 1DFGA 1XA4A 2WTAA 3HS3A 2RH8A 1JAIA 3LQ1A 3CMCO 2ZIXA 5HILA 1JIUA 1T1SA 1AO3A 2FP4A 4MVWA 1JHOA 3TLYA 1TKBA 2CUNA 5IK2D 4IF6A 3PR3A 4NY1A 3DLPX 1CXZA 4X95A 4FHZA 3EUAA 1CRWG 4M9XA 4YIHA 2WRZA 2WZDA 2HK7A 3H1TA 4LZJA 4DSZA 2C5BA 3W5SA 3VNUA 4G4GA 2ZE6A 3IQGX 1Y3IA 3WWDA 2G40A 4ZQBA 1P1CA 2W2OA 2PTHA 1KJJA 3KWFA 1PAUA 3KPYA 2XWJI 4LNUB 3TTYA 3VQTA 3ER9A 1WBBA 1NXQA 1VCOA 1ZN2A 3ZD9A 2H0AA 4PRKA 5L7YA 4RO0A 1PTJA 2ENWA 5EQDA 5JC8A 5JMWA 4MJLA 3VSBA 3VNSA 5KREA 4EG4A 2F90A 4F7WA 2NU9A 2GK7A 5ENDA 1CJUC 2HGSA 3M3DA 4MK4A 1L4UA 2C2MA 2F59A 3G1TA 2CVPA 1AQIA 4B8ZA 1G42A 1Z7EA 3WLHA 5TNXA 2WWYA 1A9OA 1BIFA 1R00A 2DUJA 3KR2A 1H1TA 1Z4PX 2C94A 2N0SA 3PBKA 4MDYA 4RIIA 5DGIA 5K8IA 4TKVA 5L4NA 4OH1A 5CH5A 3ZNPA 4N0MA 4I2NA 2DQ4A 3ZY6A 4PIPA 4D9EA 2Y2VA 3B3QA 3T3IA 4A6DA 1K7XB 2WINI 4F3YA 1YE8A 3DTTA 2JL1A 3OU2A 4LXTA 4RIGA 4DDKA 1RJWA 8ADHA 1KGDA 1JYSA 5FH9A 2WE8A 5IMBA 1E1CB 1C3OA 2JEOA 3Q8WA 2PNFA 1T1IA 1J06A 2HH9A 3WGMA 2AVDA 3R3VA 1XPUA 3WDSA 1YS6A 1IN1A 4GOND 3QOWA 2OMEA 2FPRA 3QFSA 2O20A 2EARA 2Y68A 2QQEA 4JVOA 3OTIA 3KFLA 1KZHA 1GN9A 1TGVA 1XZNA 3L1HA 3T0IA 3I37X 3CLRC 3C5HA 3K30A 3OBIA 3PRHA 3KXPA 3KXIA 3LDHA 4ZYZA 2V3CC 2R48A 2C92A 3LNCA 3AONB 4Q3LA 3O8OB 3U2QA 3UATA 4L6CA 3SVTA 4ZIRA 3CN7A 5DX0A 3K9NA 3C5EA 1L8OA 1FFCA 3PF9A 3H2YA 4GX5A 5P8WA 3CA8A 1M2WA 5SV2A 1US8B 1GU7A 3DQPA 4TL6A 1VG9B 4NNJA 3RSGA 4EP1A 5AI0A 3QWFA 1Q0LA 1X7XA 5JVDB 1PLLA 4CQNA 3V80A 1SC9A 5JOQA 3GU3A 2Q5EA 2HMVA 2VJKA 1USGA 2W00A 3KKLA 4LHVA 3U4DA 3KFVA 5CDGA 1H8HA 2VAWA 1NONA 3FYSA 5K0FA 2NVWA 4RESA 5JD4A 5CPFA 3Q9SA 2PUVA 3MJVA 1KY3A 1W4BA 3T9FA 2QP3A 5K8CA 2HJSA 2GN4A 3PJGA 5CDSA 3A6GA 3ZKWB 4NX2A 1U9IC 2AYZA 3A3YA 1YR2A 2Y1OA 3EFOB 3NAMA 3IQWA 3D43A 5J9FA 4AZVA 4F11A 4DREA 1IZ0A 5A5DA 5AVZA 2MYUA 1UXKA 4UDNA 1WW8A 1TMYA 4JI8B 1Z5PA 4ITVA 2ZYUX 3FZYA 2WC1A 3KR9A 3KX2A 2NUTA 3Q7PA 5EJGA 1IC6A 4RHEA 3VAAA 2DHRA 1QC5A 2PD6A 1RWMA 1DO2A 4IHAA 3V9AA 3VR2D 5AVVA 2H0QA 1AD2A 2IHJA 4I0WB 5DCLA 2JJ2D 3WP1B 3WFZA 4UM7A 2VF7A 4B44A 1V8ZA 3ICVA 3M6VA 4Z1MD 1LNZA 1QG0A 3WS7A 4L7VA 2A9VA 4DCVA 1UBJS 3QVTA 2DG2A 4YXWA 1PG0A 2H8KA 3FOWA 3MJFA 4TUYB 4LRYA 4G5GA 3STWA 3ZHOA 5HQJA 3BIJA 4JYMA 1FC0A 1YTLA 4KLNA 5EE0A 5A6VA 1NJ5A 3NBAA 4XA8A 2VJYA 5DYIA 3W90A 5KJCA 2W6ID 4PGFA 2VCHA 3MTGA 1XHFA 4QDXA 1SY7A 1TU4A 2O5EA 1U90A 1G5TA 3SBOA 1TVKA 3WLPA 4E6PA 3UMYA 3CZ9A 1NI4A 1QZ3A 1U0OC 3S1SA 1L6IA 2GNAA 3D8TA 2WIJA 1BX0A 3SPXA 1NX6A 1FUEA 3Q3JB 2HQRA 1Z3IX 4G8CA 1RPAA 3EJ6A 3STTA 1DIHA 3DHNA 3LBYA 5KKAA 3IAXA 1UINA 3ZCXA 4BWFB 1N6NA 4C4SA 3PUKA 3E3AA 4G2TA 4MROA 4ZO7A 3D6AA 3K1YA 3KELA 2YJ4A 1B1CA 1B16A 4IIDA 4RULA 2FSUA 2Z9CA 4ND4A 4AL4A 3C3PA 1U7ZA 2DPMA 4PTZA 4ALIA 5C8YA 4ZHSA 3TE7A 2WAMA 3C45A 2QLFA 4B6OA 4YUAA 2PYZA 3T5CA 2B5OA 3KP1A 4EVRA 2J3KA 4FSHA 4MQFA 4YMLA 1PZGA 3G0OA 3EDOA 3OZUA 2Z1MA 3NBXX 3K9QO 2DRIA 2P27A 3RVLA 3VAYA 2XYPA 4B8WA 1UBSB 4LJLA 5K51A 1FP4A 2UZ0A 3U62A 5M2QA 1GUAA 3UICA 2FPWA 2HPZA 4PZZA 5CIQA 3WJ2A 4P22A 1LBQA 3MUEA 2O50A 1XO1A 4LJ5A 2X0RA 1SH7A 3ZJYA 5K3OA 3THWB 5FO0A 1GNLA 2ACVA 1CF2O 3N58A 3CUVA 1D03A 2BW0A 2CZGA 2VHEA 1MA3A 3C7AA 3H42B 4WZZA 1FYEA 3GFFA 3LFUA 5EP4A 5JSKA 1GHTA 3EIXA 3IERA 4TXJA 2HJVA 3I39X 4TKUA 3DE3X 4IV8A 4LKRA 4NZPA 1BW9A 4RANA 4PNEA 5ICSA 2ZBRA 3GJ3A 2CWWA 4KDFA 1YULA 5HQ3B 3P2OA 1IBMB 3PUWA 3H7IA 4YCNA 2LGJA 2GKSA 3BMNA 3QOFA 3WLFA 4BVGA 2Q28A 1AURA 4B17A 5PGMA 1NUUA 5CB4A 5FPTA 4PYOA 1P44A 4P31A 1FXUA 1RCTE 4RVOA 4XX0A 1UJBA 1I1QB 1LPMA 4CWAA 4A15A 2FR1A 4ZVOA 4HT3B 2BYTA 3AR3A 1RWQA 2I6GA 4MB2A 4UE2A 1CUAA 3U1VA 1OOEA 1Z2NX 3B6IA 4KAXA 4P4SA 1J9EA 1YR8A 4CI0B 3L0CA 4Q39A 2GM5A 3BJEA 3BSYA 4CMIA 3EC7A 1Z0AA 2GJKA 2Z4TA 3PKJA 5BPFA 2VA9A 3RS8A 4EG7A 3RM3A 1EWTA 4CL0A 5IF9A 2F67A 3QKIA 4URVR 1LWNA 3O9MA 4TXNA 1HF3A 1JWAB 2PZJA 3FAZA 4CN9A 2C77A 3PD7A 1HA3A 3R3ZA 1K5HA 4L85A 1JEAA 3RIEA 1PJ8A 2I65A 1UIMA 1U2QA 1CEXA 1H65A 2I6QA 2WW8A 2XAUA 1U2RA 3CR3C 3GPBA 5AJZA 5IMSA 3T5AA 2P40A 2PRIA 4DYDA 4YIKA 5ICCA 1ZDMA 4WGGA 3T7RA 4BMSA 4F6CA 5KCZA 3FETA 4DQXA 3I30X 3O4RA 2AN3A 4MV9A 4DV4B 4R3UC 3ER8A 2AFIE 4FMDB 4L8LA 3SYRA 4N6OA 1QNFA 2YWJA 4G1VA 1P0IA 3HCFA 3CPSA 3OE7D 1PFQA 4FHGA 2B37A 4I9FA 2PGIA 2Z83A 2GCGA 3UFXA 2Z3ZA 4KQXA 4AK9A 5FBRB 1KAGA 2YUIA 1JJ7A 3ZWQA 4MIEA 1PR2A 1BO6A 2O1XA 1PS8A 4ZYXA 1YVPA 3MTBA 4DSNA 3OESA 3HVRA 2UXBB 4ND5A 3V1LA 5I6DA 3O2SB 3GLFB 3I2YX 1UJ6A 3FGOA 3R6LA 4QYMA 3RS3A 3LOPA 4K88A 5FOWA 3D6FA 2MSKA 3REQB 4BASA 1IN6A 1I4OA 3PUVA 5KQGA 3MQ2A 3LX6A 1UBRS 3ZHZA 3A3NA 1AQLA 2I4RA 5H83A 2RGRA 4QOSA 2XQFA 5EWJA 1CDEA 5SYMA 5HUJA 2JBAB 1NWHA 1LD3A 1JB1A 2EZ4A 1M2VB 3GPDG 5ALXA 3JYOA 3WE7A 3DMGA 4GUAA 5DM4A 1KQNA 3DAPA 2L18A 4DM3A 3KFXA 2ALJA 3QVGA 3PCXA 2PPVA 5BWOA 1G8MA 3C5CA 5EJMA 3T3GA 3MEQA 2WPDA 2YDXA 3AUXA 1ORDA 2YBDA 2ODAA 1W29A 4F91B 1UXOA 4R84A 4Z4HA 2YRWA 1U8XX 2F3UA 5A5VA 4AXBA 1LRJA 1LBIA 3RTGA 2XMCA 1A4XA 3MS7A 2H2IA 3HB1A 3OE1A 3DMNA 3RHZA 1ZD2P 3BVPA 4LPKA 4CKBB 4YPVA 4YRSA 2D0DA 1DT3A 2OXRA 3O95A 4UM9D 3KJIA 4W1QA 5A5GA 4AIIA 2Q41A 2VSNA 5I4CA 4Q4HA 3C3AA 1G5HA 2WWXA 5JU6A 2BR4A 2PHZA 2XODA 3GT0A 3ROGA 1OI3A 2VDMB 3QVWA 2FX5A 4RY9A 5DM70 2Q2OA 2PZGA 3KYBA 1HGXA 3P0JA 3W9YA 4HRVA 3F7MA 4TMZA 3FPAA 2O8VA 2YWEA 3HMKA 3QIVA 2NYVA 4OQXA 3W5CA 4OBBA 4BZQA 4P7KA 4ARAA 3ZJVA 4H16A 1RBYA 1JT2A 1RYZA 4PG4A 4K9KA 4TGLA 4M8KA 4UASA 2G88A 3V6MA 1OAKA 2Z04A 1VIYA 2CFTA 1NLZA 2H7YA 1W1WA 3CZ4A 3GA5A 3NC1C 4ZQFA 3GLGB 3X1ZA 1HSOA 3V2GA 4R5MA 4FDUA 2CLEB 3GJ7A 3IQXA 2FZVA 1CZNA 1DKQA 2R25B 2XT0A 4LV5B 1QUEA 2AXEA 3DXYA 4FEYA 2A88A 1I33A 1POWA 2KWIA 1Z4LA 3A26A 3WGJA 5DM2A 1KO4A 2XJ4A 3NAGA 5D01A 1PLJA 4FYXA 1MAVA 1J90A 1EX7A 4JFAA 3G9ZA 4ZD6A 4J43A 4S1PA 4OXQA 5D7BA 4DLXA 2I3AA 5FTKA 4J7AA 1J0BA 1T2NA 1Z74A 3QTBA 4NK4A 3V2UA 4B4VA 4LZNA 1R64A 4C4AA 3TRIA 2KI5A 1F20A 4GM1A 3SC4A 5BMVF 5B3AA 3W8DA 2GM3A 2GN0A 4FWIB 4LBZA 3FHOA 3UZUA 3F71A 4R1OA 5IKMA 1PZFA 3PUZA 3A4VA 2XE4A 3KEGA 1LX6A 3NKVA 3B2EA 4M8NE 4X8LA 3K9CA 2YXDA 2WY2D 1S89A 2X7XA 3L06A 4GD3Q 1XTUA 2ZYAA 2VYNA 1YCDA 3EG9B 2FN7A 2R7NA 3C3BA 3PPXA 5K0EA 5JANA 1C1XA 3L77A 4FILA 5J2TB 4XJSA 3DBHA 3IUBA 5FQOA 2DPHA 5FFFA 1KJYA 4IWYA 3N3AC 3V7NA 3J81k 1QHFA 3HBAA 3HNOA 1LLCA 1U3UA 2GK6A 2H06A 1GRQA 1SQ6A 4QJBA 5FA6A 3G9TA 1YZLA 4HX2A 3TI9A 4P7JA 2R6GA 1RP7A 2WILA 3D2AA 2HRQA 1E3EA 1XXHB 1P1RA 1WV0A 4XVHA 1Y3HA 2BFEB 1O96A 4M2LA 3EXHA 2AQKA 4B46A 4OOFA 2FR0A 2RGUA 2JLVA 4CIYA 4K2HA 3B2QA 4G2NA 2EVWX 3FNGA 2PMCA 3UWKA 3F4KA 1S2LA 3R9IA 3VC1A 3B9RA 4KAJA 1JTVA 2C1XA 1SCKA 5DVZA 1GZUA 1DIGA 2XE8A 3STHA 3GMSA 3REOA 2UZ4A 3LT4A 5DHPA 1CZKA 2W2KB 3O2QB 4DY6A 4MI6A 1P0MA 3R5JA 4HB3A 1U5CA 4ODIA 4QO7A 1XVLA 4EAQA 2EW8A 5BSWA 5C32A 1EWQA 1ZIYA 2YHSA 3ACBA 3QVVA 3RFFA 3O83A 4F6RB 4LRTB 1KC3A 3BN3A 1W5SA 4V1CB 5JDCC 1KGSA 1Q2UA 3MG9A 1G2QA 2AUNA 5F2NA 1U6JA 2PZFA 5HIKA 3RRZA 4F1KA 3QYFA 4PQYA 2B9VA 4LCJA 4GG1A 1J5EB 3K0AA 3UT5A 3O3CA 4C6TA 4B47A 4LJ9A 5FCDA 3V7FA 1K3TA 4OPMA 5IJAA 1AGNA 1RWKA 2BFBB 4IJKA 3QEAZ 5IAEA 3LF2A 1G59A 1NHGA 2E37A 1WD7A 3L6BA 1RAGA 5FBZA 3WBFA 2FSGA 2NQ8A 2PVCA 4DWWA 1N5LA 3PPIA 3TBKA 3KVNA 4EF4A 1RYMA 3ZI0A 2AMFA 3JAWB 1USUA 5CP8A 1II9A 3D1VA 3OOYA 2IHNA 4NAVA 2W6CX 3K9FC 3CUUA 2QOEA 1JEYA 1DAOA 1HEYA 3E5MA 3F6RA 3E7WA 1D9XA 4X7MA 4HNGA 4N54A 1HDEA 3DB2A 3ZNQA 4EPRA 4Q4JB 4J0KA 3TOXA 4DLWA 3ZIUA 3Q2KA 2BN4A 1ZC4A 2QLLA 4IQFA 2VHZA 3AVQA 1UFVA 3L49A 4MKZA 3UJAA 1TAGA 1NF9A 3WX0A 2ZI6A 3D7SA 3L1KA 3FNBA 5AKJA 4F38A 2OXFA 5LQDA 3B1VA 3P26A 3FBWA 2OPBA 3AF1A 3P4UA 1K9VF 1JXAA 1ST3A 1BA2A 2J0UA 3OIYA 5TARA 4C3OB 4CXMA 4TTJA 1A96A 4J1QA 1DIRA 1GFZA 2PSHA 2TSYB 3R0QA 4YQZA 5TY0A 4F9TA 5ADVA 2BCGY 4NQZA 1W8DA 4XFDA 2GA9A 1U0FA 1Z7YA 4HC4A 3UMGA 1DC6A 2YDYA 5EIBC 4YI5A 5BYBA 5MDHA 5AI4A 5FXMA 1VYUA 3UF0A 1X1BA 5ALVA 5IHPA 4KPFC 1JSLA 3R6TA 3OQVA 2QTGA 1TJYA 5ITSA 1GZDA 1M8PA 1FLAA 3C43A 3ZIDA 3T1YB 1YOVB 1H9CA 1WOYA 1JQKA 2OOKA 2JANA 4YXFA 4CCYB 1XU4A 3CG4A 3WGGA 4P81A 1FJ2A 3IPRA 4FR2A 1MHTA 2EKQA 3T7IA 1A82A 5G0WA 3Q12A 4CW7A 4RC9A 1XAHA 1RE1A 1BKDR 1U1GA 4H27A 1VLJA 3JRWA 3UAXA 3G9XA 3R9XA 2ZB2A 3EVBA 4XQ0A 1J99A 1GIAA 1DZ3A 1P7YA 3GFRA 4MUJA 4OK3A 2OY0A 5G3ZA 2YN0A 1WZIA 3PHGA 5ALPA 4W5HA 3Q98A 3W9BA 3UBTA 4MWTA 3DMPA 5FFMA 4TWIA 4A73A 6Q21A 1Q7CA 1Z5GA 1OXKB 5C4MA 1XUOA 3IMKA 4UHDA 1Y3DE 4P4NA 2SKCA 1QBGA 1R3DA 2UZ3A 3G5TA 3AMVA 1PT9A 1OF1A 4FMCB 4CBVA 1Z17A 2OBLA 2VHYA 4RVFA 3TZHA 1W9MA 2PAAA 3DBIA 4S05A 3JWHA 3ODPA 2G0AA 1UMCB 3D1JA 3O1JC 4G6ZA 1JE0A 2I80A 4JY7A 4UBMA 4AD8A 4DV2B 3SE0A 3IKVA 1Z37A 4I4TF 4IOMA 4G0PA 3X2SA 3VDNB 1TF2A 5BNWA 1AGXA 3FWNA 1NMEA 1NVMB 2D0PB 3QVSA 4ZU3A 1T34A 4WL0A 3WYBA 2I03A 4HGNA 5BMOA 3H5NA 3T1TA 4QDTA 4ROTA 1EFKA 1LPSA 4MDFA 4E09A 2IXFA 4MUMA 3BQNB 3FG9A 3S1LA 1D1QA 2PKXA 1I5RA 3PSAA 3Q3CA 1CJSA 5LP6B 2A58A 4JODA 4KAFA 1VDMA 5FPPA 3FVWA 4Z9XA 4G5FA 5FOQA 1CUHA 1GPUA 1IJKA 2HCBA 2J4FA 2YJTD 3LPCA 3ZHUA 4CMCA 1JL3A 1FSGA 4IDDA 2GARA 1YQUA 1CV2A 2CF5A 3WHIA 2C8LA 1J0CA 5K4AA 1UK6A 2IEAA 1H85A 1DTWB 5EUQB 1O9BA 3HYCA 2P41A 4WZAB 3WYAA 1AHHA 1VKZA 5GM1A 5SY9A 3T7SA 2Y3IA 4FYPA 4JCCA 5INTA 3IBYA 3E9CA 4RVSA 1UOOA 1MBZA 3AFNA 1R37A 3HZHA 4JLOA 1YO6A 2MJLA 3I45A 3UMVA 4MPPA 4NMMA 5CLHA 2V0CA 2IS2A 2BZ1A 3EN0A 2DBYA 2OV2A 4TN5A 3WKCA 5LNK1 1FFWA 2HK8A 1H42A 2XXBA 4F45A 4MKXA 1U9YA 1L9KA 3N70A 2ZYIA 4CUKA 3I8XA 3D2CA 1MCZA 1UPAA 4UPVA 3EZ9A 1N5JA 4TZTA 1BVHA 3ET5A 1QVWA 1P5HA 4ZC8A 5HIMA 1P5ZB 2RHGB 4J0GA 4LJYA 2H63A 4QTUB 4TLDA 3RODA 3U3OA 3FVQA 2ZITA 3UT0A 1M54A 1LSJA 4G5HA 1PVVA 2VHQA 3BRSA 1OLUB 1XDWA 1NW5A 3BB4A 4RH3A 3E9YA 3EXG1 3LO5A 4RY8A 5A71A 5TS3A 2CL6X 3UOWA 1XDBA 4IIYA 4BNJA 1NASA 4LYGA 4K0KB 2WT4A 1X1EA 2HHLA 1GQQA 2HUPA 5ESXA 3VJMA 1SBHA 3L2OB 1ZKMA 5TF4A 4L8VA 4YRJA 4BATA 3Q1LA 1UBHS 2HQ1A 1LNQA 1EP2B 4XGNA 3WR5A 3FDFA 1KIAA 3TM4A 1XD2B 2B4RO 1YR1A 2GLTA 2ISSD 3B7PA 4XPZA 2TECE 4R31A 3LC2O 4LJ6A 5FNVF 4PZ0A 5E6RB 4MW5A 4ARZA 4CV3A 1ZISA 1ONOA 3RU3A 2F8MA 1AT1A 2VATA 2IYOA 3HXMA 1QTQA 3HG7A 5KEIA 4EVSA 1BHSA 4XQEA 4YRTA 4I50A 3TTTA 5I3CA 1NR7A 1RAFA 1V43A 2VYVD 1P4AA 1KC1A 4Z4QA 2ECKA 2X9NA 2C2ZA 3NIGB 4PYKA 1KAOA 3JW8A 4B1FA 4HDMB 1X80A 5BW8A 1KOFA 1I9GA 2Q9AA 4Q9AA 2F48A 2PV0A 3BXXA 4L4UA 5C31A 1P19A 4FYIA 4AULA 3IXLA 3IEKA 1O4WA 2HT6A 3JVUA 3ZVMA 2RONA 2A59A 1SBZA 1MEOA 2GH1A 2VDWB 4IS2A 4KC0A 1DCTA 2IY7A 1E32A 5D1NA 2ATIA 4OFXA 5KNLA 5CTJA 4HR7A 2FF5A 2X1VA 3ZCRA 3HSKA 1SIBE 2EJVA 3D3NA 3OQPA 3RS2A 1L5QA 2W2QA 2VTKA 3ENKA 4LI3X 3T4PA 1TQ2A 3VZRA 3ZOZA 2B25A 3NALA 4K26A 3LBAA 1F2UA 2W9XA 3NBQA 4RD1A 1IBLB 3T61A 2RGAA 2YY5A 3JZAA 2JFOA 2P4EA 3LA6A 4D44A 5F2KA 3HO8A 3CZPA 3KO8A 4PSCA 1IH8A 4Q5IA 3KQYA 4H1VA 4RVHA 3W1EA 2WJ4A 3ELWA 4JYZA 4RXMA 1O9GA 4QWWA 2LIVA 4PY2A 4MI1A 4LSWA 3R7DA 3BMOB 5GONF 2CVOA 1W4ZA 3GQBA 1NW8A 4P84A 2DKOA 2X6RA 3UOAB 4BQSA 3NC0C 1L5MA 2GD6A 1YMQA 4A91A 4EPYA 1WMBA 4KQ2A 4O4IB 4C0WA 5C7YA 4DA8A 4GKVA 1PTJC 5DI3A 5BSHA 2BFCB 3PUHA 1G9XA 2FPXA 3ON5A 5HRAA 3U4CA 2V59A 3FH0A 3NVMB 3SKXA 1PR5A 3V1YA 2CHVA 1PR1A 5K09A 3HRKA 4LHZA 3OJEA 3BIOA 4AZSA 4DY4A 4JI7B 1GSIA 1MP0A 3DXFA 3W9SA 1AKNA 1XVUA 4DVGA 4EFDA 5BWMA 3FI9A 2J6BA 4UATA 3AEQA 3QLVA 1U2PA 5HWSA 5FF9A 2GN9A 2PZAA 2MYPA 3LQFA 1XMPA 2R6CA 3IQDB 4FVTA 4M99A 4F3RA 2AX4A 1JXOA 1BH6A 1NVUQ 2ZR9A 3I1FA 4FFRA 4H7DA 4A6XA 3ZCVA 1U2SA 3O26A 2ZJBA 1WJGA 3D4NA 1U7WA 4QTYA 2C98A 4HB4A 1KARA 4QPPA 4OJMX 2JLAA 4J9UE 3FPCA 4DIUA 5HKKD 5JNSA 3RJ9A 1TA0A 3CO5A 3PGVA 4RJIA 4D3SA 1Z36A 2AQ8A 2J30A 2TMGA 3N3BC 4INOA 4TROA 4IFBA 1XRMA 3R6WA 4WI1A 5DWVA 3O4HA 1G0NA 4Y6GB 3TR0A 1JQDA 2HREA 3OZTA 3UTCA 3R3WA 2YJGA 4GMFA 3OX1A 1HDRA 4QBIA 3BGIA 3KR1A 2Q7DA 2HZ7A 1PZXA 5AKXA 3DAYA 3TTWA 1N1EA 3IUSA 4N5NA 4XGIA 3ACCA 1NQXA 3PS9A 4Q18A 1YB5A 2RAFA 4MWDA 1I3LA 3UUFA 1RKXA 3DBLA 1LDBA 2I5PO 3FDXA 2AZTA 1ZINA 1G20E 2IYVA 3QY9A 4HS9A 2O8DB 1E79D 2OGZA 4LRXA 1NE7A 1XVAA 3UQZA 2H85A 2XNKA 5HCNA 3ICCA 5J47A 1Q44A 2ID9A 2A3NA 2V96A 4LNAA 2PUDA 4YJ3A 5DHRA 3MPUA 4V0LA 5AVKA 4MA5A 2VK8A 2W98A 1Y5NA 3FROA 3UJBA 1A5ZA 4TRRA 4B3BA 4C78A 3JQAD 1KMHB 2HJ9A 2QB5A 3E48A 2P6NA 4O2BF 4RNDB 3I42A 2ENUA 1RMQA 1L1RA 2G6TA 2XYRA 3R9WA 1W2WB 1Z0IA 1ZG3A 2CZCA 3BRWA 3JZFA 1U99A 1K5PA 4JJ6A 1W5AA 4IDPA 3LFHA 2DEUA 1UK9A 4KWIA 3O8CA 3KBOA 2X9LA 1D5CA 2HT1A 3G2HA 3IDQA 2ZYVX 3T3EA 1D04A 4JI1B 4EI9A 4LSGA 1EG7A 4FYHA 4KFSA 4O2AF 3RUPA 3LBFA 4UHCA 3RAJA 5LDHA 1YRHA 2XQVA 4FHDA 4OA8A 5JHGB 2DPGA 5GJVC 3CUTA 3ETCA 1Q1BA 4TQGA 2HA5A 3BTUA 3F96A 2BEWA 3PIDA 4KBGA 3D8RA 2NPFA 1ABBA 2A9PA 2H1WA 2YJ5A 3DFUA 5I7WA 2OCLA 1TYZA 3GBPA 5E6SA 5FBHA 4C76A 4Q4CA 4KI7A 2ZPUA 3U16A 2YQ4A 3I9V6 2HLHA 5FWNA 3SS8A 1XAIA 4WEOA 2IXBA 2W8BB 4BO8A 2QAGA 2FFBA 3LPLA 1N0UA 4TQ9A 4U5XA 1MT0A 4NONA 2Q6KA 1W5EA 4CF6A 4ZJPA 1DC8A 1P0QA 3FCCA 4TS9A 1YC2A 1F8GA 3H6KA 5J5CA 5COQA 2YKGA 2GQ0A 2IPLA 2QIOA 2C82A 1SUSA 4GMGA 3OFNA 1OKKD 1IJFA 3ZQJA 6LDHA 3S1AB 5JYDA 2PJRA 3BKWA 2VKTA 3I2HA 2IDMA 1K63A 3S55A 1XF1A 3TD2A 4B34A 5CAEB 1M34E 3NM6B 4WN9B 4G97A 2AFIB 2J9GA 1YUBA 3NOQA 4CYMA 5D87A 2AR9A 3C4JA 4IHKA 1GXSA 4EENA 3GJYA 4RSGA 2WB2A 3W2FA 4CL8A 4NZYA 1FDUA 1RYDA 2F9MA 2PANA 1Q17A 4F71A 1C1HA 3P0IA 1CUXA 1AHNA 4U0KA 3WGKA 5JFGA 4II7A 5K20A 5K45A 2EG5A 2REOA 1QGOA 1GG8A 1ZD3A 1ZW6A 4IXDA 4EHHA 1ICIA 1KYWA 1TLTA 1MTZA 1U65A 1UXIA 4IJQA 4QT0A 1PK9A 2P3OA 3STUA 6AT1A 4BXOB 2A5DA 3AHJA 4N7JA 4NHEA 3RSSA 1O08A 1XCLA 3C5WP 1SD2A 1TVCA 2XTNA 3DAFA 3GG9A 3GVPA 4BQEA 4LDJA 2CEAA 1XRRA 3QE3A 4ON9A 5AUNB 1N5KA 1WNTA 3BH7A 5DNUA 1OFGA 2I2WA 4MQ4A 1XNGA 2DVMA 5DK4A 1KZ4A 1XZJA 3T1VA 4G0WA 4NV3A 4WY5A 2CLFB 1WR8A 3QEMA 3FOCA 4HJRA 1TLFA 1XD9A 2RHRA 3AEUA 1QIDA 4HRYA 3EEOA 4TSFA 3SF8B 4BQNA 3G2JA 5T4FA 1DB3A 4DR6B 4KMRA 1YJXA 3W2EA 4GYWA 4IFEA 1V25A 1XZHA 4HQOA 1EEXB 1UFRA 2IQIA 2O2ZA 3DMYA 5B1HA 4DLKA 4KQCA 3PDCA 5FUXA 5FV7A 1NMSA 3DC2A 4WZ6A 1XSEA 1JWBB 4LF5B 4OYHA 4WCVA 4NVRA 4PNZA 4ZKEA 3RQSA 2ZUBA 1USIA 1GYRA 1GUYA 1DX4A 2IZ1A 2XX3A 4IF4A 3QKWA 5DSTA 4Q02A 1KETA 3T5MA 1CEQA 4ZT7A 1H93A 4MTCA 1GAEO 1NOIA 3BL5A 1IB0A 1T2CA 4ZAVA 3WL5A 1SG0A 3CO0S 3Q87B 3ROEA 1NF8A 3HA2A 2IK8A 4RZUA 5C4IA 2OM6A 5I5EA 2G1KA 1N36B 4XQGA 5KTKA 4YLEA 4IV0A 4E08A 2W22A 4TSRA 1KJ9A 1KSHA 1SXIA 2CD7A 5EYPB 5EMHA 3WLAA 1H2WA 1TCAA 1XFDA 2G9QA 2OCDA 4KGVA 2O8BA 2HU2A 1LV7A 4JC4A 4RXTA 3DEIA 5JC1A 2O2DA 3PXBA 4KXFB 2C3PA 3PEUA 1URPA 4L9SA 2BL4A 2VDVE 3QHQA 2XXJA 1GTRA 4FK8A 1KSGA 3H2ZA 3LXRA 3JQ6A 5ILOA 4PYQA 1YONA 1L3CA 2I66A 4J75A 4GGPA 1OXVA 4Q3BA 3TAHA 4MCAA 3HJNA 1C7RA 5GGXA 4ALNA 5BV0A 3S29A 3IO3A 3IUPA 3TEFA 4B32A 2CFRA 5CD9A 1M7BA 4C29A 2F3QA 4EDFA 3I61A 4PAOA 4LXUA 1XZDA 1MB9A 1O5IA 3VDRA 1ZU4A 2O23A 3FYTA 2C7GA 4WADA 1V9SA 4JLUA 3KQHA 2IDJA 4FFDA 1SK8A 2ZRCA 2W93A 3ASYA 2ZBFA 4IOJA 1COZA 3FPJA 4CMBA 1TEHA 3H8WA 2BSXA 2FPKA 2VP3A 4PLTA 4DJDC 5KYGA 4EGFA 2CNWA 2XUKA 3WNVA 4AM8A 1Q0SA 3WMFA 3HYTA 2ROQA 3KLBA 4D1YA 2O4UX 3ZGYA 4Z99A 5FDFA 2VDJA 1VLQA 4ZRMA 3WXMA 2Q1XA 2G28A 3QEKA 4MQUA 4MS3B 2HMSA 4ICIA 5CR9A 2XYHA 1XRJA 4X65B 1ZH8A 4OMDA 4TWRA 3OJ0A 4Q16A 1X8LA 5LA6B 1BS1A 3OUUA 4EYKA 3E7DA 1XAGA 4LNUA 1E61A 1X77A 1NT2A 1GZ3A 3FKJA 1ZQ1A 2AEJA 3V33A 3I01A 4DEYA 1E6MA 2ZBPA 2HCTA 3Q0IA 4P2BA 1HLGA 2GETA 5FOVA 1CBUA 1F9EA 1OZ0A 3OQJA 4KX5A 1KDVA 3U0VA 4GDFA 1KYTA 2HNKA 2ACKA 3WC4A 1ML4A 1VRCA 1Z0ZA 3JCZA 4PG8A 4ENWA 1M2FA 5G3YA 2ZZNA 1G8FA 4KO1S 3Q7TA 1E0JA 3GXOA 2VQ3A 3QPVA 3IXMA 2PIAA 4C1NA 4DXDA 1Y1RA 1I94B 4YAFA 2JI7A 2PVPA 1RACA 2FMHA 1JFLA 2RKWA 3IUQA 3MFYA 4C5CA 1UWVA 2GLXA 4OHFA 2ET6A 3QPAA 1KQOA 5C3MA 4BY9E 4E88A 4JBNA 5BWLA 1E99A 2D7CA 4X90A 3WNDA 4JYCA 4JI3B 3SEQA 4D43A 3NDIA 5JI3E 2Q50A 1QG4A 2GEFA 5AQEA 1IVSA 2XWSA 1OT3A 1E1CA 3IKJA 1Z6GA 4E1VA 4OMFG 4EL5A 1U0BB 2XKBA 2WJJA 1KXJA 4DLLA 1V1MB 3BE6A 3PHLA 4M4SA 4MR7B 1IHXA 2PUWA 4N0PA 3V2HA 5K8JB 1LGYA 1XQWA 3H9BA 3Q8LA 1Q12A 2XYGA 2H5JA 2UYOA 3DZGA 4JP5A 4Y2HA 4K9NA 3V4RA 3UAYA 2G70A 2YINC 4JK3A 1ORHA 5MN6A 4Z7QB 1IJBA 2VTVA 1G16A 1AG9A 1EM6A 3OHMA 4DCSA 2CMGA 2GHRA 2BFWA 1GOTA 4P08A 3RS5A 1CPYA 1KZ1A 1FU7A 2H7VA 2PM8A 1PNVA 3QP9A 2EFCB 4H6PA 2M6RA 3HACA 3O0DA 4HLNA 3CPEA 2WUFA 2E48A 2I76A 4HZUB 1VMAA 4B2LA 2EFYA 2B78A 1J09A 1AZWA 3S8MA 1ZCJA 1YMVA 3W2TA 1T9AA 2BISA 1U0HC 4M55A 2PXXA 4CGZA 4MIYA 4BGUA 3TB4A 4TZ6A 3HH8A 4QOJA 5A4KA 2PQ0A 4Z9BA 1C4WA 3MRVA 1T5HX 1QAOA 4FDAA 4MGHA 3WL4A 2R1TB 3C15C 4AMZA 1CY6A 1W0CA 4Q3KA 5JZSA 3ANSA 3D2BA 4YRMA 5SZHB 4DIEA 2XNHA 4I6JA 1V4NA 2BCEA 2O1WA 2R97A 3B3FA 3BDVA 1OASA 2X1MA 4HMQA 1DT5A 1XGKA 1WB9A 4XIGS 2CLMB 3GLIB 3OHPA 4YMWA 4DEXA 5KQLA 1YS1X 2IPNA 3DFIA 3EDMA 3RS9A 3DQQA 3E9DA 3HXTA 2PKWA 2B0CA 4E21A 3AEZA 3ZKWA 5L8VA 1EFPB 1U98A 3NOXA 2WQ6A 4FEGA 4HQFA 4L8YA 3Q3VA 3HPQA 4MICA 1NJSA 1KQPA 2VJDA 3GNSA 3L7IA 1GO2A 1QR2A 1R1DA 4ZARA 2PY6A 4IIJA 2GCOB 2HA7A 2QI9F 4TV8A 3W5IA 2VC2B 1IQRA 3AZQA 4K6HA 3I8OA 3GRCA 2IUYA 4YCJA 1GUDA 1FY2A 4OLFA 521PA 3DKRA 4BPRA 2DUWA 4RTOA 4JXKA 2IGBA 3F6YA 1R6BX 2ZTVA 3M6UA 4DW8A 5KDOA 1SKMA 1FDRA 1R9MA 3HUUA 4LMRA 4CMHA 1QYCA 4RMJA 2ZSAA 1NP3A 1H9AA 1NVFA 4ER7A 2NQTA 3WLEA 4TUYA 1A9QA 1RTTA 2VPWA 3JASB 3CBGA 1DDIA 2FUKA 1MQAA 3OLYA 5FUWA 1NBME 4MUKA 5LBTA 3VR4H 4WK6A 4IPTA 3ZLVA 1G0OA 1QYXA 1SOUA 2HA6A 2J3IA 2PGOA 3IVRA 4MMYB 4Y6LA 3HQ4O 1Q0PA 3R7SA 4Q0MA 3HJAA 3M6WA 2WJPA 5KYXB 4HAOA 1Y1SA 1EVZA 2A1TR 1E9SA 3VX3A 4DPMA 4EGAA 4MEJA 1MJGA 3DTNA 2VPIA 3U4HA 5DT2A 1TD9A 3AEKA 2CSUA 1XZQA 4PC2A 3CLRD 2ZPTX 1LJ8A 1ZNQO 5L95A 1JS1X 1UT5A 3F67A 4LJ8A 3WO0A 4DBLE 1OFTA 3V3TA 3W05A 2ZJ2A 2AR0A 2ID7A 1M2JA 1WU7A 2G5PA 2M6SA 5I3ZA 3PNKA 4RPJA 1IHUA 2OKCA 3NFRA 4HYEA 4IL5A 3BWYA 3EEYA 1NXPA 3NCTA 5FL7A 2NWQA 2EJTA 2VCEA 3LX8A 5LZ8A 1L5KA 1XRLA 1FOEB 2FMTA 3ZEIA 4DSTA 4OQLA 1V7CA 3WV4A 3RRXA 3E61A 1UF9A 1GT6A 1UMBB 2P6UA 1W4RA 3CLSC 3PGMA 1MIOB 4D96A 1Z4OA 2P0EA 1MB4A 4Q3OA 1UM9A 1X7ZB 3OEHA 2P9HA 4RSRA 4EATA 4EKEA 3WLJA 1S2GA 1SVOA 5HIJA 4EG5A 2QQ0A 2FV8A 2DKNA 3GT3A 4FIDA 1E1YA 5C37A 1P60A 5AK6A 3L0ZA 4J6FA 4AP9A 5L3QA 1VL0A 2HK6A 1JEDA 3THWA 4M1TA 1ZNWA 2GBLA 3UG7A 5JEEA 1RXVA 4LTDA 2OQ2A 4IYRA 4EABA 4YMTA 2ZSBA 2C4KA 2X0IA 2IZ0A 1WG8A 1MQ9A 4V0QA 5C5DA 1V9CA 1YU6A 1SBCA 3OWHA 1ELOA 4EOGA 1K1EA 1QYRA 2HLDD 3QU9A 1ZRHA 4M7RA 4TRJA 3ZGVA 4RPCA 4DV5B 4JSRA 1H4QA 3CJTA 1CR1A 1GM5A 1GPDG 2IPXA 1NM5A 1QG6A 2R84A 5FP0A 2W6OA 4IVRA 3MWLA 3UPTA 1F0YA 3DHVA 1EESA 3DZDA 4KIJA 2F3SA 3FSGA 5J5AA 2WUGA 4FQ5A 4B3SB 2PKYX 4J29A 3URKA 3N0TA 2HQOA 4HEJA 3HY3A 2X6QA 2X0EA 1U1EA 2ZJ8A 3II6X 1EUZA 3ANTA 5I01A 4HWKA 1Z56C 3CEJA 2O0KA 4NCAA 2CEKA 4C89A 4FUTA 2EATA 2AFHE 1KVSA 5COBA 2JAHA 1X1AA 2VYFA 4BLTA 1EFHA 4QQNA 4WRRA 4EFKA 1PBTA 1NUSA 1MJ5A 2VDNB 4HPJB 3NHKA 4EFLA 1CW2B 4JDPA 3SQMA 3UGKA 3DKIA 3LAWA 2BBOA 4XVCA 1QAQA 1Z6TA 2G36A 3CH6A 3ZE8A 4HF7A 3PLAE 1V2GA 3GLHE 3VPBA 5JT1A 2WWHA 3B3AA 4AF6A 2C78A 1SC3A 2E1PA 3IUJA 2BZGA 3NKFA 2JRCA 2C9BA 1U2GA 1FMCA 1SVIA 1X3SA 4RJLA 5DEIA 1I13A 1QTRA 5I7HA 4KQHA 2GF2A 1KWGA 3VC7A 1QO7A 3BFJA 4E3ZA 4J91A 1HI9A 4PG6A 3QIAA 1NBOA 2RG7A 2QZJA 1E5QA 2O6LA 4YO7A 1WQ3A 3K0EA 3ADBA 2P9ZA 3ZWMA 4AG5A 3S99A 4CF5A 3QEOA 3MF4A 4DS3A 3LVQE 3N74A 3IOYA 4X54A 4ENPA 4IJMA 2W6NA 4E22A 1QRSA 5BT8A 1GZSA 1GKUB 1YS4A 2HLNA 2PMFA 4PZAA 1P6QA 3VPHA 3VSAA 5A7FA 2PWZA 2MINB 3GVCA 3GLFA 2J6IA 3DWFA 3GCZA 4ABYA 3C6BA 5FX2A 1PO7A 1GZHB 2ZJ6A 5DDIP 5IJWA 1LWOA 3REQA 5CEJA 1YZ3A 5JYCA 4DGSA 3DBVO 4I5DA 3F9IA 3JZDA 3HCBA 1SZCA 3DHWC 3FSJX 5H81A 2ZZMA 4Q03A 2JBAA 3HM9A 1IZYA 1FIUA 4LUCA 4W8GA 3PYMA 4MGYR 1IB6A 1M2VA 1DQYA 3IOBA 2QUJA 2IKQA 4G1CA 1UZUA 5ILGA 2C9ZA 3M