3ESYA

E16ke61k flavodoxin from anabaena
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
KKIGLFYGTQTGKTKSVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGKLQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin
publication title Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Anabaena sp.
total genus 61
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3esyA00
4U7GA 1AZLA 1CZNA 4YQEA 3GFQA 4QOJA 2ARKA 3ESXA 3NHSA 5EAIA 2N1MA 4XDHA 2ZKIA 4H2DA 5JROA 3LT5A 4N82A 4YAUA 2D5IA 2M6SA 4ZVNA 3ES9A 2Q9UA 4YALA 3P0RA 2Z9BA 4C14A 5F51A 3SVLA 3NHUA 3B6KA 5F4BA 1J8QA 2KQUA 2QX4A 5NULA 5B3KA 3QFCA 2QMZA 1AKQA 1XYYA 1H66A 1DXOA 1CZKA 4ESEA 4FGLA 5LBTA 1DX9A 2XODA 2XOEA 5LMCA 4FX2A 4LTMA 1XT6A 4DILA 1YDGA 1C7FA 4GI5A 3KAPA 5A4KA 1D4AA 2BZSA 4QOIA 4LAFA 3W78A 1AKWA 4U7HA 2Z98A 1FUEA 1RCFA 1YKGA 1D03A 1SQSA 2FLVA 2MWMA 3K20A 1OBVA 2QWXA 1QBGA 4QOHA 1FLVA 1JA1A 2Z9CA 3FNIA 1X77A 1D04A 1WSBA 2HPVA 2FVXA 2W5UA 4OXXA 3B6MA 3B6IA 5FA6A 5F12A 3NFRA 3L9WA 4FGJA 3HLYA 1FX1A 3NHPA 3F6SA 4PU0A 4C0WA 3NHLA 2BF4A 2FDXA 5LJIA 3KAQA 1GG5A 1FVXA 2OYSA 2RG1A 5FX2A 3L9XA 3TZBA 2OHJA 1J9GA 3F90A 1AKRA 3OX3A 1AKUA 3OWHA 5LBUA 4Y9UA 3K1YA 3KLBA 3N39C 3O73A 1YCFA 3FVWA 2B3DA 1DXQA 1ZWKA 3FX2A 3R6WA 2FCRA 4BMOB 4F8YA 1FTGA 4R81A 1V4BA 4N9QA 4M0CA 2FOXA 3OWXA 3JSXA 5EMNA 1AMOA 4QOFA 4ZVLA 4XDGA 1KBQA 2QR2A 4LTDA 2Q62A 2FZ5A 1TIKA 1H69A 3B6JA 3OVMA 1YCHA 3FW1A 5NLLA 1E5DA 3FJOA 4S24A 2FX2A 1QHEA 3U7IA 1AKVA 3NHKA 1YCGA 3QFRA 2M6RA 3OJWA 4H6PA 4HS4A 4QOGA 1RTTA 4BMPB 4FGKA 1CZHA 1J9EA 2A5LA 3UXHA 3UXEA 1ZX1A 4DIKA 4QODA 3NHFA 4D02A 1AKTA 2MTBA 1WSWA 2AMJA 2HNAA 4Y7CA 1FLNA 2OHHA 2BN4A 2FZVA 3N3AC 1B1CA 1JA0A 2MOKA 1RLIA 4ZVKA 2R96A 3N3BC 1AG9A 1CZRA 3S2YA 1BU5A 2X2OA 3O2NA 3OX2A 2QX8A 2X2PA 4U7FA 3OX1A 4DY4A 3TE7A 3HA2A 1NNI1 5LJLA 2BMVA 3GFSA 3NHYA 3F6RA 4C0XA 2KLBA 3QE2A 4ICIA 2BPOA 4C76A 5ULLA 4HEQA 2V9CA 1XI2A 1J9ZA 4Y9RA 4YAFA 1T5BA 1CZOA 4QOEA 3GFRA 3OJXA 1F4PA 1AHNA 1BVYF 5TGZA 2QX9A 1KBOA 1TLLA 4NULA 2HNBA 3ZHOA 3F2VA 1OFVA 4YAOA 3D7NA 3GAMA 1SG0A 3EYWA 3NHJA 1RLJA 2WC1A 1FLDA 2R97A 2FAXA 1CZUA 3NLLA 4J8PA 3W7AA 1T0IA 2V5UA 1YRHA 1QR2A 2V5VA 3ESYA 5LLDA 1CZLA 4CETA 2F1OA 1FLAA 4PTZA 4N65A 3EDOA 2Z9DA 4ZVMA 4YAWA 1ZWLA 3LCMA 3RPEA 1VMEA 1C7EA 4PTYA 3W77A 1XYVA 4LTNA 5FUQA 1YOBA 3HR4A 2QMYA 3NHWA 4GR9A 4CF6A 3U7RA 4GQIA 4NLLA 4LA4A 3TEMA 1I1OA 6NULA 3NHRA 3ESZA 1OBOA 3G5MA 3KEGA 2OHIA 1QRDA 5B3LA 5LVAA 3W79A 5EA2A 2MT9A 2QX6A 2GSWA 5BUCA
chains in the Genus database with same CATH superfamily
4ND1A 3ZQUA 3QF7A 4JP3A 1BS9A 2WBLC 4N6NA 4PO1A 1AZLA 4Q48A 4EA8A 1YSCA 2AW3A 4HWOA 2H5LA 3C8DA 2VJAA 5M5BA 3JWHA 1E2MA 2F8LA 2ZP1A 4HLUA 3F6EX 4QUBA 2MYTA 4BCBA 2QVLA 2HO4A 5CH8A 3BSSA 4RFVA 4OQZA 2ZYAA 1PYDA 5EZQA 4RZ2A 3TXYA 1WW3A 1SRQA 3CLVA 5KIAA 3AUJB 4KQIA 5IARA 1WXGA 3WWOA 4EJSB 3H2KA 3LCRA 1VG9B 1QFSA 4YRAA 4JLBA 3ES9A 1X1QA 2IS6A 4FFSA 1QF6A 3WLOA 1P9NA 3HYRA 4MUNA 1L1QA 3IBCA 3PPWA 2BUBA 2FLKA 4D8UA 1QHHA 1FQWA 3DNFA 5DHRA 1ZD5A 1KYWA 1N9KA 3I53A 4FS8A 3FMPB 4DLXA 2FF5A 2ZIVB 4DLBA 1DADA 3L6RA 1TZKA 1J70A 1V43A 4MJLA 1JKJB 2P9EA 2UVPB 5K99A 4A8PA 5ENVA 2DM6A 1TM4E 4DLLA 1PN3A 1YAHA 5M3BA 3S0JA 2HBYA 1J2JA 1WKCA 2XDWA 3L8ZA 2O1WA 2JLXA 2P4EA 2IYVA 1N5IA 3RYIA 4O4LA 5CB8A 2FZGA 4R7ZA 2ODEA 4H3HB 1ADBA 4X6YA 3GJTA 5ES4B 1TI7A 2WA2A 1JB9A 4DCUA 2IYRA 3G2IA 3N6XA 2BGNA 2P2YA 3A32A 4OV6B 4WSOA 4GU5A 1Z22A 1N92A 3DOJA 3HUTA 3U0BA 1LTHR 2X4LA 1BD3A 1X92A 1XTVA 4MP8A 1ORWA 4BNVA 1Y6GA 1BO6A 2DU8A 1N2ZA 1D07A 3D6HA 1MGOA 4L2IA 3F2IA 4RV4A 1DWOA 5DI3A 4BB9A 2EFYA 3SJ7A 4EQ6B 4HT3B 2BP7B 2PGXA 5JFTA 1Z2PX 1PKXA 2C07A 2WP8J 3OCYA 4PQRA 1ZVVA 1NYRA 1NJFA 2XCOA 3OLCX 5CGQB 2R7NA 1SC9A 4DYHA 1Q0PA 2G7MC 1JR2A 2HA5A 4MXDA 3D8NA 2QVYX 3NWPA 4MYCA 2IPNA 5KDLA 3CGGA 1N9GA 2DQ4A 2VP9A 4IKOA 2EWWA 3DB2A 4YO7A 2ABWA 3E03A 4PC1A 1CJBA 5TQ0B 2BEWA 4YMWA 3FA2A 3U5TA 3LKVA 1BAPA 1JG4A 4KE8A 3AC0A 4O5OA 1R0RE 2HSJA 2CFCA 3JD1A 1ONBA 2J4DA 2QMQA 4PCUA 4BNYA 1H2WA 1TECE 3TQQA 3AI2A 2ZJ6A 3SYTA 4EITA 4RTMA 3G9XA 3UMGA 1M2WA 2R1TB 1EINA 5IDYA 3QWHA 4WJKB 1QK5A 5TE9A 5F23A 2NUAA 4GMFA 4Z0NA 2YBDA 2HGZA 1VKJA 4DCOA 2BEVB 3LVFO 4I5IA 4OQFA 4RA6B 1LSSA 3IBSA 2AV6A 2P9BA 3HEMA 4FOSA 3MCWA 4HUQA 2D2EA 3KT3A 4AICA 3SU8A 1G291 4N5LA 4QTXA 2HO5A 5EE0A 3WQRA 3MINB 4W7SA 4S0XA 1OBVA 1ISMA 1D2MA 3NRJA 2H3HA 3P9ZA 4XB2A 2PHZA 3M1LA 3MHTA 1E6WA 1FLVA 2PEZA 3QTTA 4Y1RB 5B1EA 4D5GA 1CR0A 5JAQA 1KDVA 3PUJA 5C37A 4LK2A 1BWPA 1VBKA 1GG8A 5T4EA 2Q07A 3QSGA 4GAEA 4UULA 4RIIA 1LBIA 2ZAMA 3I6YA 2ZI3A 3P9NA 1MX3A 1P4JA 3N8DA 1C8LA 2BHLA 4RQTA 4GX1A 5FA5A 2C83A 2JC3A 4E2FA 4YJHA 3CW2A 3K09C 4DMUB 5AVYA 1G3IA 3HACA 1TCUA 3WB2A 4HH0A 4JBIA 1WCYA 1RBZA 3JALB 4F6RB 2ZSEA 1I2ZA 4LDQA 4AFNA 4BIMA 1H0KA 2GKSA 4HB2A 5DMXA 2RHJA 1U9YA 3OP1A 2OC9A 2CJWB 3RC1A 1JPJA 1VBFA 4G0NA 1ZUD1 4M88A 1YFZA 5H83A 5AYVA 1GL6A 3JYPA 2FRXA 2GYUA 4HDMA 4R1QA 4CV3A 1R7RA 3NFRA 2VAXA 2ONCA 3KZ1E 4QVIA 3EIQA 2G1UA 4OLJA 2HRRA 5A0VA 2II6A 2DHRA 3C74A 2GQ0A 1J1UA 4AJ1A 1AOXA 2RHDA 4EJSA 2VWPA 4H27A 3SDZA 4XDZA 2BGJA 4DZZA 3H4MA 5HE9A 1KJ9A 4B7AA 4QPPA 2AXEA 3H11B 4KLRA 2H07A 3KU1A 1QO9A 3LBIA 3LY9A 3COWA 3Q6NA 4YJ2F 2RG1A 3FYUC 4LYFA 3T4EA 3Q40A 1OUMA 4BLUA 2JIDA 2P2DA 2XUJA 2ZT5A 3A3NA 3R3SA 5YASA 1JKJA 2UVPA 1IG3A 1Y9DA 2FDCA 1AKRA 4BO1A 3HJNA 2XGJA 1KARA 2XZOA 4I1UA 4NCXA 2V65A 3IKMB 1V16B 3VI3B 5H5JA 3PDIA 4E2XA 3ZJ4A 4I9UA 4Z54A 1AD2A 3HJUA 4UPEA 2OCGA 1IRXA 1JKIA 1RYYA 3CSUA 2PMEA 3OEED 1TKBA 1W59A 2B4QA 4AMGA 3A1UA 5DNYB 4J4HA 4Q9NA 1U9IC 1E58A 3I45A 4FYVA 4BNNA 1C3VA 1LW6E 1W0KA 5AKXA 3T7TA 2VBGA 5D6NA 3WGUA 2FI1A 5BMOA 1SEPA 2Z5GA 4DCCA 4Z4FA 5EI5A 5FBQB 3U48A 1R0LA 4AY2A 3FJ1A 5FTMA 4HATA 4DM7A 4HUTA 1EFCA 1IK4A 1D5CA 1NF8A 3VPDA 3AQ4A 2BP7A 2JRLA 2Y1EA 1KDZA 5GAJA 4RHCA 2YVQA 3GNSA 5CD9A 4RH1A 3LPAA 2XUGA 3ADCA 4X7MA 2WUDA 4BV3A 3DBRB 2KJQA 4BMOB 2Z1DA 4I14A 2LCIA 4P34A 4F8YA 5K0ZA 2DBQA 1GO2A 3PNPA 3WP1B 4C03A 4DT1B 3CR3C 3C1OA 4AP6A 3GLIE 5J2TA 5TQ0A 1SCBA 3H5WA 2XNCA 3DM5A 3W3AA 2FOXA 5ELMA 1DKQA 5FPQA 4IKEA 1QZTA 4QKQA 1YH3A 5JZ9A 3D3QA 2BI4A 2BTQA 3HNRA 5GV7A 1DEKA 2Z2JA 1EDEA 2VHYA 1E1RA 3BM5A 4HQRA 4HRXA 1NZDA 4EI8A 2I3DA 3IUSA 3EA0A 1KBQA 8OHMA 1FOEB 2QUIA 3F97A 1XIVA 1CBUA 3PDHA 1T0JB 3DKVA 4JLMA 1DBRA 3C3DA 1MOZA 3MT8A 4FILA 4QA9A 4JS0A 4RA6A 3FKJA 3RTDA 3RT1A 4B4OA 2Q9BA 1R9JA 5DCLA 4BCCA 1I10A 4DW8A 1O9GA 1F9EA 3B12A 3RFFA 1YQGA 1NNUA 1FP6A 2WG1A 4PONA 3I42A 1BEEA 1KI8A 3U3MA 3IVAA 1XHEA 3E1KA 4TSKA 3ZX4A 1J24A 1RMTA 3ANMA 4Q16A 5SZJA 3RFCA 2DJIA 4QO7A 4Y1RA 1YI1A 4HOYA 4KIGA 1P75A 5JASA 3RNOA 4Q1VA 2Z1NA 2Z0MA 3PNSA 3F5MA 2G08A 1M66A 3EVDA 4L6CA 5EUMA 4RACA 2DTDA 2IYXA 1HTWA 1V5FA 3O75A 2Q3CA 4H6PA 2JZCA 4P36A 1PBTA 2Q1XA 1V47A 5DXJA 5LOVB 3H16A 4ZI7B 3BE5A 1PS8A 4FR2A 5KOIA 4BFVA 4DEXA 1JAHA 3TD9A 3OO1A 4ZC8A 3RHSA 1X42A 2Y76A 1ZSYA 1ULUA 2VWHA 4D4IA 3BD7A 1MJHA 1WEKA 1XKXA 3A9VA 4ZVPA 2CJWA 5H3LA 2YDYA 5BPHA 1YS7A 1EB8A 2WF9A 2O1EA 2CEKA 2JGEA 4BE4A 5BXQC 3H3XA 3BFVA 4OLFA 2PO7A 4E30A 2AYZA 1G5HA 1SQFA 5K0LA 1O1YA 4TKMA 5H7XA 5F9FA 1DHTA 2P65A 1RAGA 3HWRA 1SFRA 3OQOA 1C14A 1Z13A 3W5BA 2X0FA 4YDHB 5ALXA 2WWGA 2QK4A 2P3SA 4QU0A 4QWWA 1GNSA 2IZ1A 3ELWA 2QPAA 1LDYA 5AK4A 1H23A 2O06A 1IK6A 3C3EA 3JQDA 3NWJA 1VL1A 3P9SA 4I4TA 4YWJA 1U0EA 4NBSA 3FBTA 1K92A 3M6UA 4M3NA 4QFMA 5ALIA 4EB6A 4WE3A 3E53A 3JYQA 1L5OA 1MQSA 5E2BA 3RG2A 4QJ5A 3L6EA 4I50B 3W90A 4UE2A 4YMHA 1HE3A 5I7OA 1MJGM 2MSNA 2EYQA 3K92A 4UDOA 3BGSA 3T15A 4DRZA 5H4GA 3MTIA 3AVQA 1EAMA 3W2GA 1ZDMA 3RAEC 5FI0B 5C8YB 1X1CA 2IPAB 1OC4A 3IGFA 3I2FA 4UTVA 1CRQA 4U9IS 1JX6A 5EQDA 1EMDA 4RFSB 5BWLA 3S27A 2CMFA 1UIRA 1DAPA 1F5SA 4ZTUB 5EMJA 4HADA 5EJIA 1ENPA 1TK9A 4KFTA 3MQFA 4DN6A 2D3TA 4HNAA 1DNPA 4PHHA 5GONB 2P30A 3OX2A 2ZW9A 3HJGA 4INPA 2XQIA 1KYZA 2PS1A 2Y66A 4BU1A 2FSGA 2J07A 5J2UB 1OHHD 2BISA 4JROA 1YJAA 3NBUA 3V1NA 4JP8A 5D5PA 1YKSA 2CXPA 5G4LA 3L4BC 5JXHA 3AKCA 4XSGA 3VU8A 1FFHA 3MPOA 4R5MA 2DFLA 2VK4A 1KMQA 1JZQA 1L7RA 2W22A 5DEIA 2M6KA 1PW5A 3UCEA 1ZC3A 3L0DA 4G5YA 4NCNA 3AILA 1JEJA 4QQRA 4UNSA 2OHOA 4YJ3F 4PLFA 3D81A 3N2KB 1C3EA 3LLSA 4QARA 4DT1A 1QH8A 3EARA 5EG5A 3UJDA 2VH2A 2AKYA 5FWYB 3WSTA 1BFKA 2E1PA 2RARA 5JSYA 2IGTA 4XWWA 2A14A 1CQXA 4QIHA 5EPEA 2RHOA 4XVUA 3FCYA 1PV2A 2QI9F 3NTRA 4LHSA 2ZM6B 1NUTA 4AULA 5JALA 4HTFB 1NBIA 3ZJVA 4P2BA 2HTEA 3L1KA 3BJMA 5GJWC 3LYAA 3ZBUA 1RS0A 4DL9A 1WPQA 5D3QA 2IA5A 2UUAB 3VR6A 4L5BA 4X62B 2FZKA 4Y9RA 1VIDA 4I46A 1U4NA 3GLGB 3N2YA 1CETA 1VJ1A 1YR7A 2W6NA 3IEXA 4YMIA 4TV8B 2QM0A 2OBLA 2QM8A 4CNQA 3JAWB 1O6ZA 5DO9A 2H1OA 3NATA 4V0OA 1STOA 3OEHD 4RD1A 2ZI9A 4TT3D 5JNVA 2QVCA 5C5DA 4O4LF 1J0BA 3AGPA 4JL5A 4KSCA 1ECFA 1SQ6A 2IZ0A 1AQUA 1X8LA 1A82A 2I7CA 2LTAA 3HDJA 1CIPA 2HU5A 3K15A 3K73O 4R40A 1WLYA 1RWXA 3DFZA 1PL7A 1ZISA 2PD6A 3L05A 4Q9HA 4KZPA 3IKTA 1V3TA 2WD7B 3ZBPA 1KQFA 3N74A 3TLCA 1SBTA 3F49S 4NZMA 3K35A 4MUAA 3U13A 1NVEA 4CW7A 1PS9A 1OFVA 4QNMA 3VAZA 2EWMA 4K0KB 1PR6A 2WU4A 4RDHA 1KVUA 5DGTA 2JBAA 4F3TA 3GFTA 2XNDD 5DHFA 1M75A 1Z0ZA 2ID9A 3LWZA 3M3HA 3PVSA 1BTOA 4TRNA 3BXOA 3IUNA 2XA1A 4LSWA 4D9GA 2PRSA 3OHSX 5KYKA 2OPBA 2NYRA 1ESZA 1FLDA 1T9HA 2WZCA 3IB6A 3Q3EA 3QX9A 5EKTA 4RAQA 1A2BA 3D6TB 3TIGA 1QRSA 2GBIA 1B8UA 5G40A 3BMNB 3F3MA 4X91A 5E4YA 1C0KA 5JQGA 1HT2E 1NT4A 2FPXA 2GZSA 4RH3A 3OJEA 3AVPA 5HCNA 1L5QA 1AK2A 4L73A 3JQ7A 1X1SA 1C50A 2EEZA 4LI3X 5BSUA 4EHFA 2EZ4A 3EQ9A 2CC2A 2VRWA 3AFNA 3P1JA 5CJ2A 1GUYA 2G8LA 4INZA 5G3YA 3BMQB 1U02A 3UT0A 3CNOA 3JAKB 2YFQA 1WXQA 3SVZA 4FFPA 2AJBA 1RRKA 5G41A 2XCTB 1TZBA 3ANXA 3A58B 3EF1A 1XG5A 4JYPA 3PRKE 4I50A 5AKIA 3W34A 4D2IA 2WB2A 2PGDA 4NVRA 1XLVA 4J76A 3E22B 3C6YA 3ISJA 4N3AA 3M4JA 3LCMA 2FETA 4NENB 4CRWB 3RUFA 4QG3A 2G4LA 4RFSA 3KL4A 4PTYA 2YL2A 1QHNA 3LUAA 3PF8A 4QBKA 1XYVA 2WHPB 1QE3A 4MO2A 5DDIP 4ER3A 2XZDA 2JIZA 3OPYI 3L07A 3ONNA 2AG5A 2XVXA 3EXHB 4CT5A 1GGKA 2QMYA 1AMNA 2X58A 4G63A 4O4HA 2PSFA 2TMKA 4G65A 2Z5LA 4YBRA 3D3WB 4RKEA 5F1OA 4AZ0A 3D2BA 3PJRA 3SHFA 5IAEA 3FOEC 5E4FA 1RAEA 1RHUA 2OLKA 3EBOA 2VIIA 2JFHA 2QZSA 3QVVA 4DA4A 4U2BA 4QXAA 1N78A 3KHTA 3P52A 1F6BA 1RI3A 1X80B 3W1EA 4D80A 3D8HA 1IZ9A 2QAGC 4ZN6A 3M9LA 1GD1O 3E0QA 4JZYA 1BWRA 1QGZA 2OQ2A 1QQ7A 1TZCA 2Z8YA 4ZALA 1RABA 4G5RA 5IW8A 4CDNA 3KALA 2FB9A 2I2AA 2WG2A 5HF8A 4YP6A 2C2HA 2MT9A 2I6GA 3GT7A 1LZKA 1TVMA 4WPGA 1EK5A 1FNBA 2H2DA 3BL8A 4XAQA 1EDOA 3KYCB 1Q0RA 5DFAA 1ISGA 4ZMBA 3JV7A 1UBJS 1CRLA 4F1KA 5C2JB 4MVJP 4X61A 3UMVA 1TT5B 3F5FA 2B0CA 3BICA 1OFUX 3COZA 5FF9A 3IE2A 1U8TA 1NU6A 2WNHA 5JSKA 5F7ZA 4WNCA 1ND5A 1T10A 3JYLA 4Y9DA 2XLBA 4L6AA 4EUHA 5BN3A 3AEUB 2DECA 1TO6A 2QR3A 3IXQA 3OKPA 4A0GA 7GPBA 1GRNA 1SVIA 2FWIA 1A72A 3M9WA 4KQ2A 4O1HA 4ARVA 4BNDA 1PVVA 4OI0A 1FFSA 1P6XA 3WIVA 4X85A 2FVYA 3BA1A 1IQRA 1U28C 2NXWA 2Q9UA 3ICPA 3PUWA 1ZSNA 2LBPA 4RJJA 4Q24A 4C4AA 3GLGA 1FUIA 2WMOB 3T4UA 4TV8A 2QZ9A 3AR6A 4PXAA 4UDXX 1E7QA 1I2BA 3FPBA 5FOXA 4FPXA 2CCJA 1Y8RB 3AR7A 1IVSA 4ZOAA 5TQVA 1ODKA 4V1CB 4F5WA 3DL0A 3TN7A 2RG7A 5EIOA 1BJTA 3IDQA 2ATIA 3D6NB 4PAMA 4XGIA 1I0ZA 2WD7A 1F6DA 4AS3A 5LQAA 3WBBA 1SHZA 5MFZA 4EEKA 1DKRA 2W2PA 5FOTA 1F0NA 1NQWA 4MWEA 1YI8A 1H66A 4DHWA 5A4IS 2DERA 3NAMA 5FWNA 3FVVA 1H8HA 3C3BA 2QTWB 2QM3A 4P82A 4CMAA 1CF9A 1WDWB 2OG2A 2G6TA 1EBBA 1ULSA 3HVUA 5LBIA 2BH9A 2YQZA 4RTRA 1EA7A 1FS6A 1IJEA 2BM1A 5BW4A 5DHUA 2JLVA 3CUUA 4UUAA 8MHTA 4D96A 3MCUA 3CG0A 2Q0HA 4QRDA 4ZAGA 1PSDA 4PC6A 1XDGA 1SQ5A 3DULA 1UZLA 3BD9A 4L4ZA 4AZWA 2IXGA 1F14A 2XODA 1U8AA 2AFIE 2QG6A 3DAGA 3MUNA 3PGVA 4FEGA 3HVKA 1KI9A 1I3OA 2E5FA 2ZBPA 1QIDA 4LNUB 3ECAA 4PX9A 5ER9A 4JVLA 1GIAA 2J5RA 4O0MA 5J58A 3I6BA 3I28A 1M1YE 1IEWA 2Q5QA 3BMQA 3HXTA 3I58A 4NJEA 3V3TA 3EXIA 1NY6A 1PUJA 4HH4A 4NFHA 3RSLA 3GP5A 2Y68A 3SC3A 4BNGA 3HDTA 4MV1A 1DG3A 2PAFA 2X8LA 4ZZ2A 1T25A 1SOUA 2FR8C 3G0CA 3M6XA 4CKCB 4QC2A 4GF5A 2ZB8A 4IF4A 3VO1A 3A4TA 3CWZA 4FYIA 5D87A 4PW0A 4ABYA 3FGPA 5GTDA 3GROA 3IA2A 1O8CA 1Q3KA 1WF3A 4NENA 4YRSA 3PUYA 1TIPA 4TLEA 4K03A 1E92A 3LJKA 3VR1A 1F6WA 5IZCC 2W2XA 4GI2A 2WHPA 2B3TA 5KTPA 1GFSA 5EGNA 4BJHB 4BZXA 4X5OA 1DBWA 4ARCA 1RYBA 1ZM9A 1EQ2A 4JLVA 1XA3A 2XITA 1XCMA 1XR3A 2ENWA 1VYVA 4H7PA 4Q7MB 5B1DA 2EKBA 5ELLA 1QBGA 4FTWA 3TTYA 1YNOA 2O2ZA 1IYZA 1AA6A 3TOVA 4R69A 3R24A 4B3TB 2E4WA 5K0EA 3QMWA 3GU3A 1Z0UA 1KNXA 4U1RA 4R0NA 4WZBE 1KHTA 3EC2A 1GLNA 1LBTA 2CLDX 3PC6A 1DXHA 5A1TA 5DI3B 3FCUB 4TYPA 3AR4A 1YDWA 3ZKWB 3PD7A 4MICA 4ESHA 4EP1A 2BFDA 2YCLA 3RF6A 1Y4AE 2I22A 5DGIA 1AQYA 1V7QA 4IIBA 1KDYA 4ARSA 1ULTA 1DCMA 4HDKB 1L3BA 3Q5GA 3QMMA 1DJMA 1CUXA 1E1QA 4PICA 1DTEA 2QUJA 3B6MA 5E7IA 2PSHA 2DSNA 2KBEA 3PNVA 2WI8A 1QCZA 3FUWA 5TV2A 1XRLA 4AAYA 2P90A 3NAQA 4YLEA 1TT5A 2PT5A 4G67A 4MYTA 4AIIA 3PE3A 2XRFA 4NNOA 2RAPA 4Q3CA 3CRQA 1XRJA 3DMRA 5TT1A 3AEUA 4IJKA 2B4TO 4X63A 3IE0A 2VN8A 1S4QA 3O2SB 1B1AA 1L4UA 1JIJA 2OHFA 4FBLA 4L6IA 4QT4A 2AI1A 4ZJUA 3EGEA 1JYEA 1QH1A 4G0WA 2IRWA 2GXSA 2OA0A 2H6EA 2JI4A 1YDHA 1V8OA 2VNHA 4UXHA 3L6OO 2QE6A 3BXZA 3TZHA 2C7QA 1EG7A 1RI5A 5CIYA 1A8SA 1DWUA 2V6IA 4I4IA 4KYUA 1SOWA 3NP9A 3O8QB 1TK2A 1KYTA 2BUAA 1C1XA 4K2HA 1AKMA 1BVRA 4RIEA 3UV7A 3WYBA 5FX2A 2X42A 4EELA 1Z29A 3I9LA 2JZNA 3I9OA 5CBKA 4EI9A 1NQOA 2W6QA 4OQEA 5EXPA 3UZUA 5C31A 4OAOA 3UJ8A 5IUJC 2B8WA 4UVIA 4DTCA 1C0PA 4XFDA 4YXFA 4L9AA 1EE2A 1OBCA 2I2DA 1K89A 2TSYB 2ILTA 4OYRA 2C2BA 2RGRA 3MLBA 2H2FA 1U3TA 3NI2A 2CVQA 2POCA 4JYCA 4R7GA 3LWBA 2WU3A 4BOYA 2ZBVA 3IQXA 1PSZA 4BEJA 3EMKA 2PA3A 4MW1A 4YGYA 2C3UA 2O3RA 2ZU6A 1Z0IA 4N49A 2KI5A 3QTBA 2BEUA 4HLNA 3TGPA 2HJHA 4EENA 4XEUA 5E0KB 1YCFA 5FPPA 4Y1EA 1E32A 5EXSA 2JAWA 1PAUA 2OV2A 3FPEA 5FR1A 3ACDA 5F21A 3KAKA 3H6KA 4YPFA 1HMYA 2E2WA 1ZGHA 1EQUA 4YUZA 1L3CA 2PH5A 2ZBFA 5D84A 1FP1D 5TPZD 2YV2A 5JY1A 4IIJA 2ODAA 5IHPA 3VKVA 1U0GA 1O77A 4JQZA 2GT1A 4EZIA 1DKOA 2HJVA 3ENZA 5IJ0B 1GAWA 2OEPA 5DHPA 1ZOIA 1VFPA 1H2BA 4BLOA 5AXCA 4ZTZB 1OGJA 1XZIA 4R05A 2HOQA 2IUSA 4HP8A 3B1JA 3SBOA 2K7ZA 2HDNB 3HADA 2EZ9A 3HUFA 3TCKA 4KR0A 2Q5IA 3AONB 5C46F 3DOCA 2Q5OA 1CQZA 1PBNA 3M5DA 2G71A 1L5VA 2QF7A 5TVGA 5KSOA 5P21A 2GJ9A 1GRCA 3WLFA 4CE6A 3AHHA 4I4LA 1XELA 3Q85A 5DTIA 2J7KA 5KTTA 4G9BA 2LCQA 5ALZA 4ZAFA 3TQIA 4XQCA 2PX6A 1EXNA 3Q0TA 3VC3A 1I3KA 1E3JA 4FFBB 4DQXA 4CMGA 3O47A 4Y2HA 2XAAA 2NO6A 1N2CB 1DC7A 3BVPA 1EP1B 1KKUA 1H2FA 2FZ5A 1L1RA 4YC7A 1XZ8A 3DZDA 1JFTA 4YRNA 1AF4A 1NN0A 1QRUA 2AJDA 4UE6A 1IUKA 2PBZA 3I3SR 4HAUA 2RCYA 3NASA 4MHOA 3TEFA 2AVDA 1J09A 3AEKB 4FB4A 5E4TA 1LPPA 4WH0A 3PXCX 3BB4A 4RL4A 3D0OA 1XZCA 3QFRA 3JSAA 5BNZA 2B82A 3R5KA 5TR9A 5FDFA 3A6LA 2C4TA 4P0PB 4RESA 2Z3ZA 3BJIC 4L4YA 5A5DA 4I19A 2DR3A 4D3DA 3PPIA 4A2CA 1JV2B 2ZE8A 5CPFA 4HS9A 3SNHA 2M32A 5FIUA 1NWCA 3E9MA 4FGKA 3P32A 3PNMA 4EHAA 4OQ4A 3CLSC 4L51A 1GV1A 3ORRA 4EPYA 2I54A 3EXG1 1I4TD 2YC2C 3OQHA 4MQBA 5I8PA 1HYHA 5JQGF 1UWVA 1I7QB 4UHBA 1DEOA 3UXEA 3B7GA 4GMGA 1R0BA 2J32A 2G04A 4A0QA 4D9BA 5CCXA 3JAMA 4L5AA 3RI3A 1QDEA 3GR6A 3MCZA 3LPLA 3QELB 4B6EA 3NAGA 2P2GA 3QEMB 4GC5A 2QE7A 4LZAA 2P2NA 1KEEB 4HXFB 3P4XA 1U2PA 3RYCB 1BWSA 1LPBB 1GSOA 1UXGA 3EOBI 2AR7A 3QFHA 1NIJA 3KEMA 7MDHA 2WKPA 1Y42X 2MJLA 4Y6GB 2DCMA 5AW1A 2ID7A 5DYGA 4I50F 4CTOA 5ALRA 1KY3A 1AKTA 4X3CA 4B2PA 2EARA 3ZJ5A 2PQ6A 3NETA 1IN4A 3AUUA 1RRMA 3N8KA 1SG9A 1NYQA 1RTKA 2Y05A 4CLDA 3ENVA 3HKCB 1PW7A 5FUBA 1GRRA 3P0FA 1U9ZA 3WK4A 2OUKA 1Z37A 1CDZA 1QGOA 2VP5A 1B1CA 4NBUA 4RSGA 4YJGA 5DGCA 4BNJA 4F3CA 1RQLA 4AJHA 5IKMA 2ZUEA 4RELA 2AX4A 2IQIA 2RCNA 3VDRA 2ZRIA 3IDFA 4M1YA 3GEBA 4O4HF 1SC3A 4O3FA 4AP5A 2CKDA 1T9KA 4ZAVA 1Y82A 3FLEA 4EKIA 3DE2X 4OGLA 2UYHA 1E79D 1I7LA 3HM9A 2W48A 2V6FA 3AFHA 3QSYA 3GPIA 2FQ1A 1XKLA 1LPMA 4RORA 5BYBA 5TRTA 1P2UA 3ZE2B 1JG2A 5LWHA 4MWTA 4LFAB 1A77A 3A2LA 4R9UC 3ESCA 4KX3A 3TTVA 5C5CA 1PWXA 3QX7A 4YCAA 1F2DA 2W2NA 2F4NA 3RVBA 1G8JA 5DCYA 4DY4A 1WCV1 4DSNA 2EZ8A 1WZIA 2Y1KA 2WKWA 1ECCA 1P8AA 4LOAA 3OZEA 2HLHA 3A4YA 4IS2A 1K8RA 2BKLA 1TQHA 2CUNA 2FSVC 2XY4A 5DXAA 4QREA 5EEGA 1RYEA 2Y1OA 2BKXA 3OSZA 4NBRA 4BO5A 3T9FA 1GZ6A 2B4RO 5IJ0A 3U80A 2QW1A 2X9VA 2YUTA 2HIHA 3CKKA 1N36B 1GZVA 1GPWB 1G21A 3V42A 3DB1A 4EPXA 1AKEA 4OM8A 3SX2A 3LU1A 5TS2A 4W5NA 1NQUA 4NZYA 1UZAA 4ZXFA 2DHEA 3PR3A 3CNHA 3LOQA 1C9EA 5ESWA 3RUCA 1OW3B 1QDUA 2VBCA 3BPSA 1SQ0A 4H4CA 1YMQA 4D82A 2IEBA 4U2GA 5JTTA 3OBIA 4Y2TA 2BPOA 2BZ0A 4KBFA 4B7UA 5JANA 3R3ZA 3VMFA 2QN6A 4P86A 3HRIA 3M83A 3HJBA 4TV8F 1HLPA 3KXPA 2AFRA 4FFBA 2GDZA 1OFHA 4BRZA 4LJRA 2VJOA 4EZEA 1CS4C 2P4QA 1NJSA 2RFLA 3HKDA 5DHSA 3RRMA 3U3DA 2V98A 1KS9A 3OPQA 3WL8A 3WXBA 3UUFA 1OH6A 1EX1A 1IHPA 3ZHZA 2EU8A 4B5LA 1IEVA 1M1NB 1K68A 4BO0A 4BEBA 2CSXA 1NRXA 1JQAA 3DMPA 3ETCA 4Q4JB 1TJPB 3NC0C 1CJSA 1XEFA 4Q18A 2J0SA 1A5SB 4UJ3A 1JDZA 1R8SA 1C9KA 3HZRA 4MS3A 3UPUA 1YJ5A 1F2UB 3CNNA 2Q6IA 3L3BA 2FPUA 2P77A 4JGBA 1IAQA 1PEDA 2G28A 2HPAA 1XVLA 4NHOA 5J47A 4Q3OA 4DV1B 1C7RA 3O8LA 3DLCA 1J0XO 4X6UA 1TE2A 2JBHA 2VJCA 3OTQA 5IHXA 4MUGA 3VUEA 2DLNA 3ZDDA 3BBLA 4LMBA 5EIWA 3CCFA 1Z68A 4X45A 5CT5A 4WZAE 1JKXA 3KSUA 4TWIA 4HDQB 1OI4A 4U6QA 1RC0A 2IOFK 3OLXA 2BFOA 5IJ9B 6YASA 3NOXA 5IJWA 3SQDA 5LXTA 1SG0A 2DQKA 4ZU1X 2F9FA 2YZMA 2BEJA 2YWHA 1U98A 3Q1KA 4H4DA 1W6UA 4MUJA 1G9SA 5FHQA 4PRKA 5HFJA 4D4JA 1SXJD 3UGJA 1VA5A 1XAIA 4QDJA 4XCQA 4Y6RA 4Y2RA 3QELA 3UOAB 1NSYA 1ECLA 1S2NA 3QEMA 4LZLA 4PIPA 3KELA 3WLSA 3ZC3A 4DIUA 4DV3B 2YOHA 2V5UA 3FTNA 1RRFA 3N5CA 5BNTA 5KWVA 3KX2A 3IP6A 5D85A 3KQHA 4B2LA 2HLDA 3TKLA 2J5QA 1Y3AA 1A2OA 2PPVA 3R7WA 2FU5C 1TD1A 4JBGA 1TM3E 5K0GA 1KTVA 2AG6A 1B0ZA 4DCNA 2FPLA 5THQA 2BSAA 1AA9A 5AUPB 1MW9X 2GOYA 3N5KA 4JC8A 1S7CA 2CYBA 3HZZA 4YJFB 5JVDB 5AJTA 1II8A 4BJ1A 4IOKA 5C3UA 4BN5A 3Q7PA 1IUOA 4KCGA 4YAIA 4BFUA 4HAVA 3AF1A 1GUZA 2GETA 2YH2A 3WS7A 1JE1A 4N5DA 4G25A 3IR7A 3D2AA 1XXHB 1YB7A 1Z7WA 3CB4A 4HQ0A 2R86A 4OIMA 4Q4HA 4AMZA 2GD1O 4I9HA 1JHRA 5ABPA 5FH9A 4NU6A 1QP4A 1FUYB 2CHVA 3QVSA 1J20A 4E31A 3CYFA 3CX6A 4KN5A 3U7FB 3QFFA 1YO6A 4NIMA 1OLXB 4RKYA 4GR9A 1NVBA 1OZAA 2XQJA 3H17A 3QW2A 2MR5A 4UNPA 5LDGA 1CRWG 1UBNA 3ZK9A 5B5SA 2PQ0A 1SBQA 3GRAA 1JVBA 2JFGA 1O2DA 1LPSA 2FPGB 2R00C 3QU5A 1THGA 1L7VC 4EY7A 1BS1A 1H94A 4O4JA 1BW9A 5TDHA 2IVFA 2HUPA 2Q4EA 3N0XA 4EG8A 2FEOA 3AY7A 5ALMA 3P2KA 2EC5A 3QYPA 2GHTA 4ZIRA 2Q0XA 3PNQA 2H7CA 1P17A 5IBRA 3SI7A 1UADA 4LHXA 3A1TA 1QV9A 1YZHA 3RJMA 2WTNA 5ALFA 3DG9A 4YMVA 3BT7A 5HOQA 1JXOA 4UM8B 3PFFA 4MZXA 1NM5C 2A94A 1D4ZA 4BO2A 3S1AB 1NUQA 4Z49A 2GJ4A 2V59A 4BRWA 2V0NA 4ITUA 4OOEA 3WTBA 5KOHA 4H7IA 4EM6A 1EVKA 3MBIA 4L3OA 5FEMA 3TOCA 1N6LA 4BAUA 1GN8A 3BIFA 3WDMA 4F3RA 3N7TA 3THOA 4A92A 1DT5A 4XR4A 2OXTA 4HNUA 4S1PA 3QEBZ 2GF0A 4XM1A 3U6KA 1NFQA 1CIVA 1OTYA 2H48A 3UUWA 2YS6A 4CMEA 2OCIA 1SCDA 3RRNA 2PJRA 2GILA 1M1NA 2VH1A 4K26A 2MYNA 4LKOA 4DV2B 3QUTA 1D2RA 1P1JA 1X7HA 2X1VA 3K1TA 4WZZA 3T5GA 4HGQA 3ER8A 4PO8A 2H1VA 3TEJA 1LJ8A 1SQGA 4DUGD 4MGKR 4D57A 4FHFA 3Q8XB 3BWCA 1L5FA 3IX7A 4URYR 4B8WA 3RWBA 2R84A 2X0RA 1V5IA 2PWAA 4EARA 4NMHA 3FTPA 5SYAA 4IIGA 2Q3MA 2LXNA 2E6KA 4YMGA 4I5DA 1QG2A 1JNYA 1XAJA 4MLDA 5SYMA 5CFMA 3L7OA 3D59A 1J8FA 3K9BA 5J1TB 3TS1A 1C8KA 4I1IA 5JIBA 3LXUX 1PNOA 4ID3A 4LXHA 5IJ9A 5EWMB 3QGMA 1LWNA 1T34A 4WY8A 5IVDA 2P35A 4P93A 5E7QA 2Y1XA 4IIJF 1EVLA 2H2GA 3ZU5A 1W4CA 1N6NA 3F6PA 4Z9XA 5KNBD 5C51B 3D4LA 4BFYA 4TL6A 1SKUA 3GZ4A 3FWNA 2B7LA 2VZ0A 5LBTA 2D2VA 2QRPA 4J1TC 4KPFC 3RIGA 4BECA 3QG1A 3NXSA 4ZO4A 3UENA 4EB8A 4ZWNA 1G8YA 1KYIA 5CYPA 2G63A 2VJPA 4JZKA 1W8DA 2A7QA 2DZDA 3NCHA 5BSMA 3T7DA 1T26A 1J8DA 8ADHA 3PTAA 4LHYA 1MT3A 3ICWA 3PV0A 2YW2A 3R3YA 5ALYA 3CH7A 2AXNA 1XQ6A 2A1IA 1FNMA 4JJ7A 4P2GA 3QIVA 1XT6A 4Z3KA 1WWKA 2RGWA 3R3XA 3N2GB 4FZ5A 1XKTA 4H60A 3BK7A 1A9ZA 4R31A 4WXRA 1AKNA 1H2XA 1ZN9A 5BSKA 4G85A 1DCFA 4POAA 3OHPA 4Y2SA 3LK7A 1TUBB 4XA8A 3R9IA 3O3NB 4J1NA 1U2QA 2BZSA 1C30B 4L16A 3EJ6A 5CHYA 4ZAXA 3JQ6A 2NU8A 5ISMA 2QPTA 1YK1A 1Y33E 4YJFA 1EPUA 5B6PA 5JVDA 3DVSX 1G42A 1RWQA 1V41E 4WLVA 3JQCA 5FJJA 4B48A 1D2HA 3R6LA 1HTBA 4KE7A 3CZ4A 3E8XA 3GWZA 1P81A 5CB6A 1NLZA 1ODFA 1CUHA 3HJTA 1SQSA 5K8JB 2NZVG 2HFKA 3DV9A 1NBHA 4KC0A 5L7WA 5LKAA 1POXA 5CDGA 2C9BA 2IQ5A 3PC3A 3Q9LA 1I7DA 1AS2A 2GVZC 1UXHA 1TJ4A 1E3DA 1PWHA 3A31A 3R9WA 3G3EA 2FPGA 2XKBA 4BB5A 2FW8A 3TZEA 4AM8A 3BRWD 3A2NA 3IOCA 4Q6BA 4AMUA 3KQMA 1ZLYA 3MCAA 3WGVA 1VGVA 2J41A 3DE6X 4FJ2A 1ZI8A 4LDAA 3IUJA 1O4VA 1VKHA 2JAXA 2WAMA 2ZDGA 4ZAWA 3KOMA 3P5SA 4K9LA 4TXJA 1VPVA 4ZV9A 1FNDA 2PGNA 1ZOOA 5JJCA 5KU7A 5LZ5A 2P4UA 2NG1A 2WUEA 5TLSA 4OFBA 4R9RA 1GGJA 1DC3A 2C5FA 4LF6B 4M89A 1UZUA 1JPUA 3T3PB 3T0GA 2A58A 2BCEA 3KFXA 1Q20A 3QH4A 1G5TA 4MIYA 4AY3A 4BX3A 2C20A 1SZPA 4IOMA 4X90A 3E15A 5DTJA 3ZHXA 1OZGA 3EXFA 4WN9A 1VRVA 2BONA 3GJXC 1DQSA 4YNBA 5E6SA 3X2SA 2XKAA 5FO1A 4J75A 5KBYA 2XQKA 4DSUA 4WFKA 2HC9A 3WRVA 2VP6A 3GPLA 3WLMA 4KOEC 5CB4B 1P2TA 1AQIA 3RTGA 3CKMA 4HWGA 3L8FA 3VJLA 4FDAA 1Y6FA 3RK4A 2NQTA 4RK6A 4DAOA 1TL7C 2XB8A 3D7LA 3FROA 3C45A 2FF7A 2WFMA 2ZBRA 1OQAA 4XTCS 3L9XA 3G7UA 1P61B 1IM2A 3NKLA 2CUZA 3SYLA 4TVKA 3AF6A 1NAHA 4XI9A 2VYVD 4KAXA 1V2HE 3KJQA 2BKAA 2CFSA 5F1PA 2SCUA 1GTMA 2P5TB 4MTCA 1DEHA 1P1CA 1RZVA 4ADSG 1XLTC 2WHEA 5KNBH 1EFPB 2FE1A 2W2KA 1RRVA 1RPTA 4GOOD 4AKGA 3LFTA 3PF9A 3WI7A 4Z9YA 3ZKAA 3KXKA 4GSLA 2G1KA 4AIRA 1U0OC 5EWMA 2I71A 1R4MA 1T36A 5EZYA 3ZY4A 1PWYE 1FMJA 1HDEA 2JAHA 3ESDA 4R8SA 3AY3A 3CVUA 1E6KA 4I5FA 3ZI0A 4DKJA 1WO8A 1BRTA 2J9YB 3DXXA 4IHAA 1FE8A 2A5GA 3JVDA 3VV2A 4YV1A 2WFZA 1RLMA 4DCTA 4QO8A 4CEJB 5CJJA 3SBEA 1Q1QA 1ZWKA 2FPPA 3QV2A 2CNLA 2F62A 3ITDA 1E9EA 4QRHA 1O57A 4AMYA 1DPGA 3HU1A 4F1JA 1Q1GA 1YK0A 5I9SA 3OEEA 3FVTA 1HQCA 4PCAA 3O7WA 3G2QA 3U4DA 4AY5A 4LXXA 4KH1A 3U7HB 2D5AA 1PVOA 1Z6XA 4R2WA 4Z1OA 4JH0A 2R8ZA 4S1WA 4NECA 3A0RB 4TKUA 4WRRA 3RK1A 3ZWWA 3K0SA 1N34B 4F6LA 1NASA 1V3QE 2O2SA 2XMZA 2XWBF 1A1SA 3WLQA 3COSA 1BQ3A 2ZUBA 4TWJA 3M2PA 4ZVLA 3LF1A 5KVVA 3EEOA 3P8ZA 1Z0SA 2JGFA 1SC6A 3O4RA 3CJRA 3OESA 2CF5A 2OMKA 4U3JB 1RXCA 5SY4A 3BWBA 3G5LA 1TM2A 4FOTA 1IWPB 3ADKA 4I0WB 4IOLA 4DCSA 2Z6QA 1N7JA 1UMCB 2EBWA 1KZ1A 4OL0A 1LB1B 2EFJA 4KDCA 2BR3A 4R2IA 1QOQB 4HHEA 4WCDA 1GDHA 4D6PA 1QIMA 4O2AA 2VJMA 1DAHA 1YZFA 3ETEA 1M2HA 3RROA 4MVYA 3TJRA 1E5DA 1IZZA 1KI2A 3WG9A 2BYTA 4GOMD 1E1YA 1VYHA 1EM8B 4LOKA 4ND8B 1KMNA 1YIAA 4LJYA 4RM3A 4FR5A 2V4ZA 2OK8A 4EYGA 4D8WA 3IDZA 3OJWA 1UMDB 5LXTF 3OQPA 1ZGJA 4BATA 2Y67A 5HHTA 3UAGA 3HHPA 1RTTA 3E5NA 1OXBB 3JU3A 4BASA 4HGPA 3ZWOA 1GVNB 3BIWA 2OLEA 4CMBA 3WKBA 1S01A 5F73A 1PS0A 1WHTA 1OLUA 3GGGA 3HCAA 3DDZX 4TQ9A 4B3MB 1SUPA 2ZUWA 2C8VA 3WWEA 4IDHA 2W6ID 4B6JA 3FHOA 2R44A 3PS9A 4QVGA 5LD2C 1TZ2A 3PR2B 2SNIE 5IN4A 4QTTB 1EIZA 2W70A 1E2BA 4MRMA 5JD4A 4TWAA 2B4YA 2WWYA 5K3AA 1RXEA 1L7QA 1WXDA 2IZOA 1K0FA 3AGQA 5ILQA 1T1GA 4P4TA 4Q4LA 2J9FB 5CFLA 1XB2A 1DUVG 3D9QX 3B9BA 3EXEB 3FN4A 4L75A 3FFAA 5FI3A 4RY9A 2RGNC 1N0VC 1BU8A 3M6FA 3AUTA 4X7BA 3U3OA 3Q7IA 4IRUB 4ES6A 3PYXA 3TTWA 4E5DA 1G3UA 4FUTA 4UCQA 4TMXA 3AH8A 1QIJA 2IHTA 4RHFA 1E59A 3GL9A 1UQUA 5CB4A 4TLMB 3ZE8A 3KQSA 4CIBA 2H2HA 4A27A 1QH9A 3HRHA 1Z36A 3JS5A 3EQ6A 1KO5A 2CUKA 2QRNA 3KYDA 4FWIB 2YVAA 4TMFA 2IU3A 1U8EA 5A71A 1CUSA 1ECPA 2DWOA 2DY1A 1TRHA 2BFBB 2QZPA 3D0QA 5CPBA 4DCPA 1KOGA 4RQUA 4LYDA 5K3DA 3EVFA 3HDHA 3G2OA 3EJWA 1Z39A 1V6AA 1ZK3A 3KDPA 5AVJA 1W96A 4FW9A 5JJLA 2E18A 4L8VA 3GT4A 2XCSB 4ZEVA 2RGCA 2X8BA 1NIPA 3WQSB 1GNLA 3RS2A 2RGBA 1FRNA 4LECA 2OYRA 3NCTA 3EHEA 5CYGA 2VHQA 2SKEA 1UBCA 1BU5A 1GNTA 1Z08A 2ERYA 2PKCA 3N75A 3V1MA 5KS2A 4BPBA 4A82A 3KHUA 4J6FA 3ZZUA 4KQEA 5AKZA 1V4VA 5BORA 3DFFA 3INTA 4QZVA 1YU9A 1HV8A 1YQQA 3PQDA 1NNI1 1LFDB 4YV2A 2G5GX 2X5JO 4I9FA 2G9RA 1TCCA 1VLMA 4P3YA 5EP2A 3BH6A 3UV3A 3O4JA 1RE1A 2J3JA 2JGDB 3LX5A 1HM5A 1MC8A 2HSWA 3HEAA 3Q0IA 4J16A 4LJ4A 3VSCA 7ADHA 4R9SA 1O9HA 3DYBA 3HP4A 4ZGBA 4FSHA 4AS2A 4ONEA 2ZE6A 3DT8A 5E2AA 1LBHA 2LIPA 1NLUA 4DNPA 2CLKB 1HQKA 2OHVA 3QBJA 3UB4A 4MHTA 1OHHA 2R751 1OJLA 3SZOA 4ATNA 3GP8A 1XWIA 1E69A 1J33A 1F17A 2HWXA 3H1FA 4Q15A 3TGWA 3T3IA 4KO2S 2Q5JA 1QYRA 5HYVA 4AYTA 2X19A 2F1HA 2GNPA 4U3JA 4C76A 1Z0AA 5DNCA 2EKZA 3R23A 4IJMA 4NSNA 4ZEMA 5J4YA 3H18A 3PE6A 1A5AB 3FSGD 3N6RA 2HSDA 3CLTC 5T4FA 3ZU2A 5AKEA 2Y93A 1KK1A 1U80A 4C3OB 4CV0A 3T9EA 4KGZA 4DLUA 4FJ0A 4UTOA 4ZT4A 2Q5CA 2PYDA 4XFKA 4ZOQI 1KWGA 3ZGLA 1S8NA 2AW5A 5H1YA 4UDNA 3BWDD 4KXWA 4OHMA 5COAA 2WJWA 3BQMB 1DAGA 2J33A 5CLQA 4PG6A 5INTA 4D9HA 4C0QC 3W3ZB 5K3EA 4HAYA 4YHBA 5EMKA 1EM8A 3QVJA 3W5IA 1M6VB 4ZGWA 4A10A 4YMLA 3TJMA 3CVXA 1PK7A 1ZH0A 2FMKA 5KO2A 4V0MA 4C08A 4C4SA 2HAEA 1OAOA 3IAM6 3IQHX 4JUFA 3VV3A 1MN6A 1UMDA 1UT5A 3GMSA 1G3QA 1M73E 2NT3A 3E7DA 3KUDA 4JLWA 4QOSA 4TTSA 4ZOEA 2E5LB 2HNBA 4OHRA 1R88A 1AO3A 1RAIA 2EL7A 4JQOA 4MAAA 2XUKA 4ODIA 3WRYC 3ST7A 3FMFA 5DN6D 4M8SA 4YDQA 3M5WA 4MLPA 2J6BA 2WIBA 3OKFA 3OEHA 3TQOA 2XWPA 3EGOA 4TT3A 5KOJA 1U4OA 1JHOA 4OQMA 3TFWA 3PJDA 2P41A 3UB3A 3H87A 4V24A 1MCZA 3B1XA 1T6ZA 1ICIA 5EE3A 1XROA 2XJ9A 3H1GA 4DMFA 1LBEA 1M8PA 9ATCA 4LC0A 1WBDA 1ZK1A 3I4CA 3INRA 3ZX5A 3EXEA 1YA8A 4FHGA 3DEHA 4EUSA 1NVXQ 4M1QA 1W9MA 5IH7A 1PZGA 2VRNA 2WHRA 4LVNA 4TSFD 4FNAA 3DYIA 2I0FA 2QXUA 2WUWE 3OEYA 1R0KA 4RADA 2J1LA 4JKYA 1YWGO 2TYSB 1M34A 2XNDA 2OMEA 2YNMC 3B3JA 2C0CA 3LVRE 4M21A 3V80A 3VVMA 2Y6UA 2H57A 4EFKA 4OXIA 5JVDF 4BE7B 2OTCA 4KMSA 2CE2X 2CFIA 3T3MB 3CC8A 2GEUA 5LPNA 2OB1A 2POQX 3ZHYA 1JFFB 1MENA 2BFBA 2YMQA 2O48X 3LA6A 2Q1SA 5DBGA 3O9MA 3GAFA 2AK2A 3ZCRA 3BTUA 1BCRB 2HY7A 2GLUA 4YAWA 2PFKA 2C1ZA 4OGKA 4HWPA 3LQ1A 4Z5XA 1J1ZA 1M6EX 2FUCA 3OEWA 5BR1A 1C7EA 2JK1A 4BJ3A 3VTAA 2FQWA 2GZAA 2EDCA 1Z4NA 5ALPA 3EFOA 4FQ7A 1RJWA 2OBYA 5A05A 3I9FA 1SVSA 3W2HA 3TRHA 2AJCA 2ID4A 1Y3CE 4N0DA 3ZHUA 4ZMSA 3B7PA 2BRUA 3AY6A 3ZV3A 3AI3A 4RDIA 3RH0A 5HJ2A 4M7WA 2F3UA 2QMEA 2H18A 4U00A 3IPYA 2QD3A 4O8CA 1WD5A 5TNXA 1Z28A 4X8HA 3HM2A 5CX1A 1FS5A 4M49A 5HMMA 1H85A 5CDHA 3V48A 3VI4B 5LUAA 4I3HA 4H7FA 2QJWA 3VJRA 3HO6A 3RD5A 1F12A 4JL6A 1SCNE 5HA5A 2JGDA 2Q4TA 3KJHA 3V8BA 4B3HA 1PT7A 2A0KA 1CNMA 4M0PA 1K88A 3OLQA 3GMDA 3MYYA 1AO0A 3VNQA 2WHXA 4E1VA 1YJXA 2RBEA 3IJ5A 5F33A 1QKIA 4OO3A 3EPJA 1DIRA 2ZS8A 4XVQA 2VP4A 1EB9A 4OI4A 5DISB 3U4HA 3ZDYB 5DX0A 4OMDA 4LSGA 3ESXA 3FTDA 4P3OA 1XF1A 4UNIA 2I4LA 1U8XX 2OXRA 4G5OA 4YTEA 5HIKA 1XD8A 4H2DA 1F0PA 1US8B 2P6PA 2PS9A 3LT5A 2UUBB 4NKRA 1FVHA 3ET4A 2Q6OA 4ALNA 3H19A 1CUAA 1F8FA 5F98A 2F8SA 5EHXA 3AR8A 1U7UA 3C5VA 3GB9A 5IKPA 3HVHA 3VR2A 3O1LA 4G01B 4K6MA 4YALA 5DCUA 4CM6A 2ZSJA 1XMPA 4DZRA 1ZNZA 3F5QA 2FKAA 3VKFA 1A0OA 2NO7A 3SVLA 5AVVA 3G17A 3MPUA 3OF3A 2DUUA 3H8SA 4MQ6A 1CJMA 1M6VA 4RCVA 1OLSB 4HQNA 3DEAA 4U7WA 1K7XB 2OP1A 4AJPA 4B71A 4WESA 1MV5A 4EYEA 1KVRA 5ECGC 2KQUA 3B5IA 4TPKA 1RQPA 1VM6A 1YIOA 1BHSA 3QLJA 5EZYF 1PGQA 1IN5A 1REQA 4E6EA 1TEZA 4KLCA 4CKBB 3T1QA 5JYBA 1RZUA 2ZSFA 1CQPA 5LZ9A 5AKKA 4KNVA 4N03A 2FYTA 4G07A 4JVMA 3ZGOA 2X8JA 3OOHA 4GS5A 5CX4A 4GD3Q 1NFRA 1VG1A 3IMGA 3SAJA 4FE4A 4F9TA 4N5NA 1NBEA 5I4KA 1Z5NA 1FSSA 2VXYA 3FLMA 3UIEA 2XV1A 3I9V6 4IVQA 3VHLB 2TRSB 1TQ2A 3FWPA 4HG2A 5SZHB 4DPMA 5BMVB 1NP6A 1HL7A 3UYLA 1LK5A 1M8JA 1XTZA 4P7GA 4PS1A 1P0PA 3KTOA 4DNQA 1E2LA 4IGIA 1GPBA 4BFLA 1RJGA 2C9YA 1DKMA 1HMPA 4Y6PA 3UJ3X 4ZT7A 3ZE0B 1KJ8A 1ECGA 3OP4A 5IT5A 1IM8A 1JIUA 1T2FA 1XOIA 2C3PA 5BW6B 3MJDA 4UQLA 1XF9A 4YLYA 5T4HA 2GK6A 5K7SA 2RKOA 3CNQS 1XPUA 4JV5B 1NRIA 2FWPA 4KV9A 2QRHA 3H2ZA 5B6JA 1EFLA 1S7GA 3ZEAA 2I8CA 3JQFA 2IPOA 3ZV5A 1D2CA 3KD3A 3ROKA 3ABIA 1P0QA 2X1MA 1BCRA 2YN0A 1WBBA 4D42A 4JJKA 3VHXB 1T0BA 3A6ZA 1CJTC 3V9PA 2I8AA 1R0WA 3VC1A 2VTBB 3I23A 1EVJA 3FB4A 2NVOA 1JBKA 4EBFA 1RWKA 1XVAA 3QUSA 4AO7A 1WB5A 4OHYA 1P7VA 3JZFA 4HPJB 2WWVD 3HFRA 5BURA 1ZD1A 3DDHA 4K9RA 1WU7A 2GI4A 3PG5A 3HCDA 2DGDA 4DMKA 3G2HA 4Q1CA 1DEXA 4HEA6 4M9QA 3GGSA 3KUXA 3SEZA 3ZIDA 4B84A 1E9VA 4Q4CA 3VVBA 1XLUA 1DG1G 4XYBA 5EZ5A 7REQA 1UT6A 2JKYA 2QZZA 1U0JA 3V5NA 4ZCMA 2AI3A 3L7JA 3PDJA 3TW0A 2Y2UA 2I2FA 2JIPA 1ZA1A 2JPDA 3OE4A 4H7HA 2PXCA 4L0QA 2GCIA 1UT8A 3IOMA 1E94E 4RPGA 2WDPA 1PJLA 2GEJA 2NLOA 4LDNA 1Z2DA 3MZ0A 4B76A 1GXSB 5BRNA 1PEAA 2QIOA 4WNYA 4UUQA 1KRHA 2BFFA 5IDXA 5LNK1 2ZJ2A 4MMZB 4MW5A 3T7SA 2HEGA 3IL2A 1N6KA 1BROA 5FA6A 3FUCA 4JUDX 1T6XA 4NDAA 4RHEA 3JTEA 1V71A 1PWEA 2BM0A 1T1IA 2ODQA 3A37A 3NOOA 4NE7A 3GFFA 4QUGA 1GA6A 4ENUA 3UATA 2RHTA 4GM1A 4G0XA 4Y98A 5BOSA 1SULA 1UJ5A 1PJTA 2AWOA 1QLWA 2N47A 3EXG2 1CTQA 1N9ZA 2WSBA 1J8VA 3PUIA 1HYEA 1DQYA 4BQNA 2IJGX 3CU5A 5AP9A 3QKTA 2IU6A 1NN3A 3UC5A 4EMBA 4GUAA 4PG4A 4CTNA 3HWX1 3L01A 1AGXA 3KZKA 2AE2A 1MOPA 1A5ZA 2QAGB 5H82A 3ZW8A 2HRDA 2A0FA 5CFOA 5CYOA 2FDXA 3DVAA 1E3WB 1MC4A 3RAGA 1XPJA 3PFKA 4HB3A 5EJ5A 4QU9A 2X0JA 1RZ3A 2AFHA 1H42A 2PKWA 2VXOA 3HXPA 1G16A 3QKIA 3NEYA 2X9GA 4ZQEA 1PX2A 1H1LA 3D54D 4E5VA 3FR8A 1C9JA 1KC1A 3L2OB 5CXSA 4BZQA 1MORA 3U37A 2R6JA 3JTMA 3PPVA 5EZ6B 2DF8A 2L17A 2UZIR 2LUOA 3SMVA 1HYGA 4N54A 4GVXA 4I1PA 2PUFA 5CFNA 3UWSA 4F96A 2CVOA 3CXUA 1L5HA 1XMVA 3O38A 1GCIA 1R4AA 2PU5A 3O73A 4HDOB 4FYKA 3NTQA 2ZG6A 1Y7TA 3IP7A 3VMMA 4MWBA 4RKFA 2FV8A 5BW5A 3GJQA 2YZ7A 3D8SA 3LFHA 4PBTA 4WN3A 4X1OA 2PGOA 2W90A 4U7DA 2NWQA 1UPBA 4FZJA 4KR6A 3DEZA 4EG3A 1SXPA 4BNIA 3U3ZA 1LRJA 4BWFB 4UMDA 2YIJA 6REQA 3QXGA 3ZWAA 4YUYA 4DM4A 3T8YA 3EB9A 2FCRA 5KNCD 2ZTVA 5ARBA 1ORIA 3ROMA 1NMXA 3DMFA 4NBWA 1QHSA 5JAMA 5JDIA 3A1WA 3KAJA 3SOZA 5CLHA 2DH5A 5KVCA 5KPDA 1JEYB 3U4MA 3PFCA 1Q92A 1ZCZA 4QUJA 2L82A 1VZ3A 1W49A 3BGWA 4UM5A 3PB3A 3RV4A 4PRZA 3RTCA 1YJQA 1GTG1 1QB8A 3NTVA 1YHNA 1X39A 2H4XA 2OD7A 3DOIA 3LO5A 2FK7A 3OIDA 4KQ6A 5TPZA 5ITZA 3E3OA 2XMDA 4Z8XA 4X8OA 2IYOA 2DPYA 3VH4A 3P0IA 3BWEA 4OXKA 3QEAZ 2VTBA 4M1KA 5AVUA 2EQAA 1Z4IA 1V8DA 4J0IA 4KW7A 4ZCLA 1KO8A 3WL6A 4BEVA 2XAUA 1TU3A 2V7QD 5C7LO 2F4VB 3HHEA 1VGRA 2E3JA 1MO6A 2IUYA 3D7MA 3VYTB 3WLTA 4XVRA 5CNJA 4WK6A 1A9YA 4XZ3A 4Y18A 3HUEA 3R5SA 4FFLA 5K4AA 4KR7A 3T7CA 3FH0A 1EFTA 3OZVA 4XWGA 2DX7A 3FW1A 2EJWA 3DLPX 4A0FA 5JH7A 3GLRA 3PEWA 3X1WA 2VZLA 4CKZA 3SIXA 1QNLA 1Y1KE 3PT5A 4IRMA 3H42B 5M7EA 1SBNE 1X6VA 2G07A 4J7CA 3Q72A 3WYGA 4DSTA 2M6RA 4OFWA 3VO8A 4WLFA 4UVGA 1QGUA 1ZBDA 1Z3IX 4HS4A 2Y1WA 4YRRA 1SWWA 2XIQA 1NULA 1RM3A 4FFOA 4RVHA 4TUYB 2OYCA 3EDYA 5KSPA 3RYHB 3GRZA 5C8VA 4M6WB 4JT9A 3W5HA 1W4BA 2XIJA 4LZWA 1ORRA 4BBAA 2GBFA 3E7XA 1PX0A 1ID8A 3G02A 1ZVJA 1E3QA 3HJAA 4R16A 1OI7A 3UXHA 4EY6A 1V9LA 3V1YA 3DFIA 4ED9A 3GYGA 5K01A 1JQJC 1EGMB 1X9GA 5DT2A 4Z2YA 3CUVA 1F0YA 2ZANA 1XMQB 1Z12A 2DULA 2IT1A 1X7XB 1P9RA 3C3YA 1Q0UA 3QUQA 4MUEA 1ZM3A 2ACEA 4PFSA 4Q9LA 2VSNA 2FUG6 5EP3A 4BNZA 5AT1A 4F2WA 2O54A 3JASB 4QYXA 2NU6B 3ZD8A 4G86A 3O92A 4EYKA 1AXRA 3QBVA 5H70A 3HKEB 3OZ7A 1HNXB 2FWNA 1S2IA 2X4GA 4XGNA 2Q8PA 1N1EA 2ISCA 3BMCB 1GRVA 5H4HA 1IVNA 5FTWA 1CNFA 2CBXA 2YY6A 4XVCA 1EUZA 1Y5LA 3MOGA 3CUSA 1E3WA 3L8YA 5HF6A 1AN9A 1SXJB 3ROPA 3SR3A 1FLNA 1MTOA 5EHNA 4C7KA 1COWD 1KDTA 3T54A 1VB5A 3AG5A 4OLAA 3CZAA 4A8HA 4UVEA 3PCRB 2ZUFA 1A9RA 4MGHA 2M6LA 4FN5A 2XGSA 2VJKA 2EP7A 1L7NA 3H4TA 2CEAA 3TMYA 4A6DA 3K0AA 2PMBA 3OECA 4KE9A 1RCUA 4RGVA 4Y7DA 4YIKA 1ZY2A 1ZVQA 1AVTA 2JK0A 3CX4A 2QQGA 5AW4A 2NYUA 1XFAA 3E84A 4DC1A 1KDOA 3CFYA 1OC2A 2IEGA 4CU5A 1N5LA 2ERXA 5AHKA 4DA9A 1GM5A 2VFAA 3Q3VA 1GPUA 1LLDA 2E48A 3EEBA 3QJYA 4ZHQB 3MWDB 4I2NA 2IIBA 1BXKA 2B98A 1MPXA 1E4YA 5DYTA 4E5MA 3ND5A 1NQAO 4KLZA 3R7LA 4I2VA 5KNCH 1MOQA 1T5OA 2FXIA 2OV8A 2P8SA 3SQNA 4KXLA 2HRZA 3G0IA 1U1IA 3A4NA 3CPHA 1VKNA 1LLCA 1C3OA 1C7ZA 1R66A 5IS2A 1KKMA 1TU0A 1DELA 2B2NA 2V6GA 3C3JA 2P27A 1E79A 2GZHA 3EN0A 3LSTA 4M9RA 4IUYA 1S2MA 4XSHA 1WP4A 1L5RA 5HIJA 2PMKA 3RASA 4DMHA 3ZY6A 4OJNA 2PPLA 2DPGA 1GUAA 1PDOA 3HCCA 3PSAA 4GYJA 4NJMB 4JKOA 4YAKA 4Q3KA 3OJCA 4HAXA 1DIOB 1JSCA 3F7MA 1Z0FA 2BY4A 1AIPA 4CMKA 4EUEA 3BHIA 3H8VA 4GYKA 1I3MA 1LF0A 3GBPA 4J7XA 5K8IA 3HB1A 3ABSB 2GBLC 3IR5A 4HEQA 3X43A 4ZARA 4OUKX 2XD9A 1LKZA 2EHDA 2YBEA 3LQ4A 2D7DA 1YQEA 4N6GA 1NKSA 1XZMA 3JZDA 2AOXA 4OKSA 1MDBA 1E63A 4GOJA 5BT8A 3HP1A 4X3OA 2AZDA 2EGGA 3FCEA 2LGJA 5AUOB 1UDWA 3D3JA 1PV1A 2FPWA 2GPSA 4QICA 5EHIA 1X13A 4MWGA 1QP8A 3SZLA 2YWDA 2QA5A 1NLFA 2JCYA 2WF7A 3K6JA 2Z8YM 3C7DB 3D02A 4PNPA 3WOHA 3CN9A 1U3VA 3K0KA 3T4PA 1NQTA 3DPSA 1WRBA 4CKEB 2B9EA 4Z4GA 4OP2A 3K9NA 5DBFA 3MT9A 2P6UA 3UFXB 2HSGA 4IDCA 5JC1A 1FRFS 5E0OA 1WV0A 3MTBA 3GLFA 1QQTA 3LFUA 1FYEA 1EUDB 3V3KA 1GJRA 3REQB 3RYHA 5HK8A 1HKHA 1GRQA 3JPYA 2RGXA 2PH3A 3AXSA 4DA6A 1HR0B 3TTSA 1R64A 4PLGA 3PDCA 4N3GA 4JAVC 1QONA 1YS4A 3QYAA 3WXMA 1QIHA 1YJCA 1AU9A 3DZJA 3NNDA 4N8SA 1USVA 1EX9A 4HC4A 4TGLA 2NP6A 1GQYA 1YRQA 5DNUA 3EULA 4DJJA 5ICFA 1GADO 2Q6LA 1WL8A 2GYYA 4V39A 3IULA 4YONB 2O2IA 3DOOA 3IAS6 3OKAA 2J3LA 5LQCA 4QYIB 1P5FA 2H52A 4JWTA 3M5CA 2NU6A 4EY3A 2PMDA 3JQBA 1HZZA 3U9LA 2WFLB 2V5VA 1UOQA 1GKUB 1Y34E 2GRJA 3L1VA 4CCYA 4D92A 4KU4A 3FDZB 1JU9A 3UUGA 3BMCA 4MROA 1WW8A 1ZM7A 1EGAA 1YB2A 2C82A 2Q45A 3QWIA 4MKIA 3EGIA 1ES9A 4PGAA 1TAHA 4MPJA 4NXMB 1P39A 4TVBA 3RGWS 821PA 1JTEA 3EDOA 1FQJA 2EDAA 3FTQA 1NY5A 4CM8B 3NBFA 4KBYA 2ET6A 3AHGA 5B2FA 5AW9A 2F9LA 1UWKA 1KA9H 1GL7A 4IH9A 3RBAA 3THXA 3AFGA 3ORQA 1Y7IA 1KQPA 2YXBA 3HU3A 3L5KA 3ZCVA 3IDAA 3K5IA 4N7BA 4KAFA 1BXZA 1WTCA 2CYCA 3BXXA 2XOKD 3GLQA 1GPDG 2ZIXB 4OREX 5IULC 1N0HA 3CZ5A 5GGXA 1L4LA 2QYSA 4DA7A 3AR3A 4DDUA 3YASA 3SBDA 4J0GA 3ZGNA 4D99A 2N46A 2B34A 3A36A 2B2CA 1TJ5A 3NHWA 3HCEA 4ZHQA 1J0EA 4JEHA 5ERYA 4LY6A 4MWCA 2W43A 3G2MA 3MWDA 4J91A 1GQ2A 1FRQA 4JQYA 4LV8B 2CV2A 3Q7TA 4MEJA 4EJ6A 3RC2A 4C6TB 1UJ2A 1SKBA 5G0VA 1KZ9A 4BQQA 1VLZA 4ND3A 2OXIA 1CERA 4FHDA 5DH9A 5K8TA 2JARA 4LKRA 4BU0A 4DS3A 1KJYA 2EIHA 2OFPA 5FOSA 1K63A 3G5MA 1LTQA 5FI5A 4FGUA 1B6SA 3PEYA 3O91A 3WLLA 1Q44A 1Q7GA 2BFEB 4OBBA 3VTKA 2X3FA 1E9AA 5JS7A 2D4AA 4G4JA 5EA2A 4B34A 5BNWA 3CUKA 2WSMA 5HP4A 4NJMA 4NYMR 2XYQA 2XI4A 2IS1A 2WK1A 1I14A 2JLQA 5IJXA 3AI1A 2JCGA 1RWMA 3GFGA 1BE8A 3OBBA 2OZPA 3UT6A 3WZ2A 2CNBA 3AZQA 4RX1A 4CTJA 4MVJE 1PUIA 1N3IA 1PQ4A 3RVRA 2RKWA 4NY1A 1K97A 2PEYA 3K2BA 3HVRA 4QFDA 1LZLA 3R0QA 2F1IA 3R8XA 1EHCA 1HT1E 1QK4A 3AMVA 4O4IB 3Q8LA 1QP7A 3EHDA 1CP3A 3AESA 1OWLA 1L4MA 1WMFA 2PNFA 3AY0A 3GAZA 4GLJA 5HM6A 2LWIA 3LUBA 3SHVA 1KSFX 4LEIA 4KLAA 5EJ7A 4UNQA 5F51A 1N2HA 3WMRA 3TSAA 2ZIWB 3FZEA 2BCGY 4KMOA 5TGDA 1MQ9A 4HLUC 4PLPA 2RDMA 2JGNA 2JD1A 1FL9A 4C2BA 4R1MA 4O33A 1WXHA 1USWA 5F2KA 2GN1A 2AXPA 1XZKA 5I7HA 3RNLA 3ZE9A 2C5HA 3FYSA 2QI9C 3E9QA 3TLEA 4CKWA 3LM8A 2J0UA 1EUDA 2AMFA 3IQIX 5DTRA 3REQA 3WYEA 5GWXA 2Y8EA 3QW4B 3OM0A 1E1CA 4LYYA 4F4FA 2WKQA 1A4XA 1CZKA 1HYBA 1TMOA 1G20B 2ZRDA 3KU4A 3RC3A 3V32A 2I7XA 1W52X 3ORFA 2NW6A 2FG5A 3K5WA 4DJAA 3CQ9A 4W8HA 3MJ4A 1QK3A 3CKLA 1U7DA 2JVKA 3GGJA 4MRRA 2PZLA 1R0CA 4KWTA 1NPYA 3EY9A 3K8OE 5FNZA 1MC1A 1D0SA 3SICE 5KPJA 3Q88A 1BEUB 1IMOA 2FN7A 2QL9A 4NI5A 4K05A 1OBFO 2C2YA 1ODIA 4ZVVA 5HPYB 3ZVLA 3VTFA 3ZVMA 2NP7A 2WFLA 3KB8A 3F78A 2VEOA 5BUQA 2YFHA 3H9EO 2BV3A 3OT1B 1OPRA 5I9LA 3FF4A 5C8ZA 5KU1A 3AB7A 1TYBE 2GVDC 4OXYA 2JEOA 4AZVA 2FOIA 4OG2A 5CLGA 5KNBA 2E89A 1FX0A 2ZS9A 3R4CA 1E6EA 4EWLA 5ECWA 2FEWB 2YV1A 2DHQA 4H1HA 2XUOA 3QK7A 5FL7D 4QUAA 3LOPA 3BS4A 1RKQA 2CXHA 2WINI 4J3JA 5EUQB 4PWZA 4B6GA 4DXHA 2JFXA 3W9SA 4U7HA 4WBSA 1E8NA 4M46A 5BQXA 4MW0A 3KS9A 2G4VA 3ENWA 3M6AA 3IIEA 5AW5A 3LXRA 1YKGA 3ZCTA 3WYCA 3JZMA 4IL5A 4LX0A 4KKXB 5KZMB 6ABPA 1RM4A 2O3QA 1G9XA 2Q4RA 1QHFA 1FP4A 1VPDA 4XCVA 2CVFA 2EJBA 4FZ3A 2WQ6A 4BQSA 4AVYA 4FD3A 1D2NA 2CD9A 2CMDA 4LK3A 4D8VA 4RA9B 1JWLA 2NUTB 3ZV4A 2QRQA 4HYQA 1JA1A 1U2EA 2PZAA 4JITA 4JR0A 4XCXA 5KINB 1WIWA 3GK3A 4FFMA 4Y6LA 4UCXA 2K87A 1IMJA 4K9PA 2Q3BA 1VMIA 4R8KA 3SZRA 1X70A 5DLEA 3ZGVA 1Z83A 1W85A 1DB3A 5G4KB 3DV0A 4P4SB 1K5PA 2OZKA 4FIZA 2HPVA 4RDXA 3AUAA 4V0QA 4TYQA 2BFEA 1V1MB 2G1JA 4MV8A 2FN9A 2C42A 3RG8A 1S5PA 2HD4A 4KVZA 2QORA 2FSHA 2YYZA 3TSCA 4X60A 1Z2AA 2K7FA 4X8LA 4QHSA 1KDRA 4XASA 3USCS 3V9AA 3WYNA 4IIUA 3AOEA 2FFQA 4I6EA 3RSQA 3K16A 3THRA 3GEMA 4C0LA 4YCDA 5LA6B 4Q7LA 3BRWA 3SHQA 1SKQA 3M3DA 3WAGA 2WWXA 5JV5A 1TTTA 3TL2A 1CLUA 2PQ2A 3OZUA 4Z3DA 5I9NA 4X44A 2D4HA 3DC2A 2QIPA 4G81A 3TLBA 1K0UA 4M86A 1DJQA 2V74B 1NVFA 4KSYA 4MNTA 4O4IA 1SHLA 4Q39A 3DAHA 3QLVA 3CSSA 4DGSA 4JI7B 1BG6A 1Y89A 2P9FA 1CY4A 1MX9A 3ILHA 1QIEA 1UANA 4NL4H 4QTYA 5C4MA 3H5OA 3GCXA 3CPEA 5DHTA 2I6XA 1BX0A 1KI6B 2DAPA 4IRXA 4UAVA 3S2UA 1X3SA 3BF7A 4DTIA 3PQ3A 1GG5A 3CBGA 4YYEA 4RQBA 1E6LA 2OYSA 4KH0A 1IOWA 3FSRA 2VRCA 3E8MA 1JE0A 2VDRB 1TUEA 2DR2A 2BMDA 1DL5A 5TMDA 5ERXA 4ER0A 5JISA 1ODTC 3C70A 3ETLA 1LBSA 4MUXA 1TZMA 3OM9A 4YVFA 1ZJJA 2V0CA 4FYPA 1ZQ9A 1I5OA 3I8OA 1Z15A 1IL0A 3B20A 3U4IA 4OK5A 4Y9UA 5LBUA 4BKQA 3GJ5A 4GKAA 3W7VA 4EJSC 3HDYA 1FSFA 5KYXA 2GPTA 2O3SA 1V6CA 2AOUB 3RJ9A 2B6HA 1MX5A 3N39C 3D6MA 3DUFB 2XH8A 4V3CA 3O26A 3OLWA 1Z5OA 3PWKA 2IBTA 3BG5A 2EFDB 3FAKA 4TRJA 5CH3A 1VZ2A 3R9XA 4KODA 3PKJA 3B38A 1JQBA 2DPMA 2INGX 2QL7A 4YI5A 1GCAA 4N41A 4UOEA 4EYQA 2WU1A 2R7AA 1QC5B 2VYVA 2E1RA 4O2BB 5CHEA 5BSFA 4B3SB 1NQVA 4HD8A 1DXQA 2VT6A 1KMHB 2F48A 2WWFA 3TI7A 4YX9A 2AEMA 5L45A 1ZJ5A 1N6OA 1T1RA 2O8CA 2EIXA 1HE4A 1Y1PA 2CE7A 1WOMA 1KXJA 3O4FA 3ZY2A 4A16A 5DM70 2R6CA 4HZIA 5CVJA 4D4GA 1HA3A 4B3XA 2P79A 2ZU0C 2H4FA 1OXXK 3I2GA 3CF6R 5I47A 4DUPA 1Y6QA 1Z2CA 2FFRA 2HCTA 1XTIA 2YYSA 3DTYA 5ICEA 5KB3A 4NCBA 2R68A 4OBXA 2Z8XA 4KB5A 1U7TA 4RENA 3M6MD 4RANA 3PA8A 3SY8A 2AIRA 3QXXA 2HN9A 4FHCA 2HTFA 1POWA 1XRNA 3D6AA 2WSSD 4YRGA 3A4VA 2DKFA 3L0IB 2PBFA 1QHYA 1V8BA 2CZQA 3PNBA 4B74A 5BVHB 1I7NA 1L4HA 1YUNA 5EJ6A 3KYIB 1BXGB 1DC6A 2X23A 1I3CA 1QDLB 4ZVSA 4LRUA 3TW6A 2LVBA 2FJPA 4NESA 1L4GA 4CQMD 1JHVA 1WB6A 2E85A 3DBIA 1XMOB 3DBHB 4WKCA 4WFJA 1CF4A 4QYWA 3KDAA 3WK7A 1XZFA 2UDPA 3F6BX 5KYVA 3IPRA 3RVNA 3A4LA 5GY7A 2UZ1B 3ILSA 3DDCA 1KK3A 4RA9A 2AYYA 2FX2A 1QHEA 3L4JA 2NSYA 3DS8A 1KR5A 1TYAE 1UOPA 2W71A 3H6HA 4N7RA 4TUYF 2VLIA 4PFJA 4NRDA 1UEXC 2D5LA 3CMCO 2HHLA 2BWJA 2XGGA 4QXPA 4RVCA 4GMXA 3AHFA 3WLRA 3WLNA 1T2AA 2C7VA 1K66A 2HI0A 3I5MA 4KPUB 4DG9A 4S04A 2O0HA 5JWRA 1H1TA 3S70A 3SEQA 1BDIA 5D3KA 2PZ8A 2QL6A 4LBZA 3HLTA 4MJ7A 1RQXA 3DLAA 4RS4A 4ZO8A 3QPVA 4NDNE 5D3MA 1VDMA 2QSYA 3QHPA 4GE0A 1FJ2A 1DO0A 3BDVA 4TLDA 4UCWA 4UW9A 5K45A 2Z1MA 1GZ3A 1PFGA 2OFWA 1JDVA 4CZ2A 2H1FA 3A1FA 3HBNA 5AMXA 2B37A 4XD2A 5FQNA 4ZT2A 1FSZA 2A3NA 4ERNA 1XZNA 1AUVA 1XL0A 1GTRA 2CN1A 5LA6A 3P5BA 1JJVA 2IUEA 2GD2A 3NBQA 5HGJA 3WIBA 4ZDKA 1O3YA 4BXOB 4DIKA 1E2NA 2WP0A 3GEPA 3I37X 1C8BA 1ESCA 1B2RA 4NCHA 1JI3A 1SXGA 2AOTB 3NORA 2Q3DA 3HXQA 1UUFA 5IABA 3I1IA 3Q1LA 1NLYA 1K2VN 2C3MA 2PAAA 2FKNA 2CDRA 2W9XA 4K6FA 2BBOA 2PZKA 2ZIEA 4BAZA 1Z8FA 3JARB 621PA 3EUEA 3K4HA 3ZWNA 3B3FA 2O52A 3IUEA 1S1MA 1R18A 2QJOA 1WUYA 2V6JA 3NHBA 4YIHA 3QWBA 3RREA 1CRZA 1NXVA 4OFZA 4Y7CA 1VECA 4DDHA 1KAHA 3GLGE 3AM5A 5BWOA 3U5ZB 2NIPA 5L7TA 3ROFA 1T3HA 5EHGA 4KVAA 1EDZA 2DT5A 1DC5A 2WVAA 5A5GA 4V38A 4RD4A 5IFLA 3BFJA 3UTCA 5JS2A 4YPOA 1IEXA 4ZHQF 1FFWA 1H93A 3L8CA 3OZFA 4R68A 4P4NA 1FVFA 2JFOA 2IYTA 4F91B 4C5AA 1QRTA 5K3FA 2EFHB 4D9IA 2IYPA 5J4HA 2X2OA 1IHYA 4C7MA 2JD0A 5JI3E 3IJRA 2XXJA 1E7WA 2QX8A 4TN5A 4EFLA 5C80A 1U7ZA 2FK8A 1C8VB 2R11A 1VPTA 3CO0S 2BHSA 1GTSA 3ZZNA 5IF3A 2F1RA 2C61A 5I7AA 3H13A 3ZY5A 2QVZX 1G1AA 1I4WA 1VJTA 1E64A 2EX4A 3B13B 5CDYA 1WB9A 4G5XA 1BKYA 2X7XA 1LI5A 1MOSA 1QO0A 1YMUA 2YY7A 1KMHA 3H3FA 1Y8AA 4GFDA 4K6KA 1M6WA 4TTVA 4ZK6A 2ZVQX 2YN2A 3ETJA 2XF8A 3ROQA 3L8GA 2D1YA 3WOVA 4P38A 4EFDA 2WB4A 3QU4A 2J46A 4QPNA 3ZXYA 1UXIA 5DBEX 1ZI6A 1K2WA 2I5PO 1TMGE 3ABQB 3FSJX 3LWNA 4Q82A 3T9CA 3PHBE 3UMBA 1KY4A 2PM8A 4IO0A 1ZZEA 5C4IA 2NU9A 1Z5VA 3ELUA 3I0ZA 3NH9A 5SZIA 1EGQA 2UXDB 1KH1A 1WXIA 3B1WA 3QOXA 4KMRA 4L50A 1FS4A 1UDRA 1U3CA 3M6LA 4FNMA 4J4TA 2PLRA 1JEQA 4ICIA 4BPRA 1CQIB 2GPJA 2P2ZA 5H68A 4KN9S 5ULLA 5HKBA 1GPJA 1HE5A 2BI7A 2EGUA 2GPYA 3FNHA 3O4GA 4FEEA 5J59A 1XALA 1DI0A 1ILWA 2BGTA 1KK2A 2PSSA 2Y71A 3REFA 2QJFA 2GHRA 1P2BA 3I8XA 4OJKA 4BMYA 2G76A 3OZAA 3EY4A 4UAGA 3UJPA 4YCMA 2CL6X 2LR0A 4IFEA 1FQOA 2HR1A 4M8LA 4DQUA 3GVXA 1LS6A 3NBAA 3FGOA 3LD9A 4EX6A 4MINA 2V8BA 3KZMA 2EBHX 1DOZA 4MPPA 3UW3A 4Y2QA 1FFXB 1F38A 3R75A 2YJTD 3UG6A 3VR0A 2PWZA 1E4VA 1DJLA 5TGZA 4YRDA 8ATCA 1TYDE 3FSGA 4JBHA 3QM1A 4DR1B 4KPUA 2VJLA 3ZVRA 1TCBA 1AXEA 1WZUA 3TINA 1UKAA 1PGNA 2X3YA 3RODA 5MF6A 3EEYA 3EZ7A 3WV4A 4Y1GA 1AF7A 3MRTA 2HEIA 4OFXA 4PYOA 4GNKA 1T6YA 1G6HA 3DJFA 3F2VA 2FMIA 4RPLA 4WDRA 4YT2A 3EZ9A 3TLXA 2PLNA 2V1XA 3T1YB 1E2JA 1VE9A 3OQJA 3QNWA 3R44A 1TFRA 3F7OA 4G3XA 4ZKDA 2QUKA 2WC1A 2R66A 1I94B 5JRDS 5B36A 2ROQA 2OOKA 1MJ5A 3JQQA 2R97A 1O0SA 3K9CA 3RYFA 1ZGBA 5E9WA 5K6AC 4TTAA 1EUQA 2RIPA 2F8TA 4DLAA 3TQRA 4QYSA 2OCYC 3RS7A 2ZAIA 3DMHA 2J5BA 1PJAA 1XZDA 1ZFNA 4PPQA 4AJOA 4MPDA 1L4FA 5DN6A 2A84A 4HYEA 4F11A 2GARA 2PFGA 3JARA 1PRYA 3RJ5A 3ZD7A 1VE3A 1ZZGA 1RBYA 2HMYB 1G4AE 4YREA 5DK4A 1I3NA 3E48A 1U9JA 2DHCA 2G36A 5KSZA 3K0CA 1SU8A 3AERB 2YUIA 2Q7DA 3EGVA 1J0AA 3CTMA 5LU8A 3HB7A 2OZLA 1CVIA 1QB7A 3GGCA 3DM9B 2VQ6A 1NXOA 1NYLA 1Y5NA 1Z88A 5B3AA 3C8HA 3QENA 4IKPA 4TQUS 3AIKA 5FUVA 2XGOA 4HJXA 4TSFA 4TXMA 3RFVA 3ZS8A 5DP1A 2X1HA 5F7JA 3UGKA 5TX7A 3RWMB 4UM9B 3GFPA 2BUCA 4IZOA 1SU4A 1OY1A 4J9VA 4IVNA 3UK7A 4ZMRA 1A2KC 1YVDA