1SD1A

Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
268
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-methylthioadenosine phosphorylase
publication title Structural Comparison of MTA Phosphorylase and MTA/AdoHcy Nucleosidase Explains Substrate Preferences and Identifies Regions Exploitable for Inhibitor Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 268
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd1A00
1ZL2A 1PR1A 1B8OA 4GLJA 4DA0A 4L5AA 1Z5OA 1RR6A 2A0YA 5K1ZA 4LZWA 5CYGA 4K6OA 1V48A 2QPLA 1Y6RA 3NM5A 1ULBA 5I3CA 1T0UA 4PR3A 4D98A 1Y1QA 3UT6A 1JDSA 4BMXA 2ISCA 2IQ5A 3PHBE 1CG6A 1RCTE 4F3CA 1B8NA 3K8OE 1U1CA 1RFGE 2AI1A 3KUKA 3GGSA 1V41E 4OGKA 5JPCA 1JDZA 1YQQA 5EUBA 1ODKA 4WKOA 3ONVA 3LGSA 4I2VA 4E1VA 2AC7A 3OPVA 5F7ZA 4MARA 4H1TA 1U1FA 5IFKA 1PBNA 3LBAA 1VHWA 1TD1A 2PGAA 4L0MA 1SJ9A 4NSNA 1Z35A 4WKPA 4F3KA 4PNPA 3DPSA 1JPVA 1OU4A 3OZCA 4MCIA 3K8QA 4TXLA 2HWUA 5IU6A 1PKEA 1RSZA 4QASA 2QSUA 1Y1TA 1RXYA 2XRFA 1JE1A 1YR3A 1LV8A 3KVYA 1ODJA 3FOWA 1V2HE 1K3FA 4WKCA 5CYFA 4ECEA 3P0FA 2HSWA 1JYSA 4F1WA 4P54A 1A69A 1PR0A 1Z39A 5F7OA 1PF7E 1Y1RA 1Z38A 3IEXA 1OTYA 4U2KA 4TTJA 5F78A 1ODIA 4L5CA 4D9HA 1N3IA 2ON6A 5CXSA 1Z5PA 2RJ3A 1Z33A 1PWYE 4TXHA 3NBQA 4BMYA 2OC9A 1Y6QA 2BSXA 1Z37A 1ECPA 4TTIA 4L6IA 1OV6A 2I4TA 1OUMA 4QFBA 3QPBA 2HN9A 3INYA 1TGYA 1Z36A 2AI2A 3P0EA 4JWTA 3BGSA 5KB3A 1CB0A 4M1EA 4MCHA 5ETJA 4DAOA 1PR4A 1OVGA 1A9RA 4TXJA 1PR5A 3PHCA 3FNQA 1T8WA 3OOHA 1U1DA 3EEIA 1ZOSA 4RJ2A 4OF4A 4YJKA 5CXQA 4WKNA 2A0WA 2QTTA 1Y1SA 1C3XA 3FAZA 3E9RA 1SD2A 4NS1A 1VHJA 1YQUA 4TTAA 3UAZA 4L5YA 1T8SA 3LA8A 1RXUA 4TXNA 3F8WA 4D8YA 4DABA 4OGLA 4D8XA 4D8VA 4TYMA 1LVUA 4DANA 4DA8A 1M73E 3O4VA 1Z34A 5F77A 2QDKA 3O6VA 3TL6A 5F7XA 4F2WA 4LKRA 3ENZA 3DDOA 3BSFA 3E9ZA 4QATA 4M3NA 4GMHA 4F2PA 1I80A 1PK9A 4YNBA 1LX7A 1A9SA 4TS3A 2Q7OE 2OC4A 4LNAA 1WTAA 3FB1A 4OJTA 1TCUA 1JP7A 1T8RA 3OF3A 4R2XA 3T94A 1A9OA 1PK7A 3OCCA 3UAYA 2A0XA 5CCDA 5B7NA 1ULAA 5F73A 3OOEA 4WKBA 1U1GA 4LNHA 4QARA 3PNSA 4DARA 4EB8A 3GB9A 1Q1GA 4G41A 4YO8A 2GUWA 3DP9A 4OEHA 4G8JA 4NY1A 5EPUA 4DA6A 4TXMA 1XE3A 1RXSA 4BN0A 3SCZA 5F76A 5C80A 4YMLA 2P4SA 3FUCA 5B7QA 2H8GA 1A9TA 1QE5A 4M7WA 1G2OA 3MB8A 1U1EA 3EUEA 1NC1A 3UAWA 1RYZA 2OECA 1A9QA 1RT9A 3NM4A 3PNPA 3KVVA 5F7JA 5FAKA 3E0QA 1SQ6A 3KU4A 4TS9A 3DJFA 5CCEA 1PR2A 4R31A 4EARA 2QTGA 1T8YA 1V45E 1TGVA 2B94A 1JE0A 5EFOA 1TCVA 1A9PA 1K9SA 1YBFA 1JDVA 1YRYE 3KHSA 2AI3A 1NC3A 1RXCA 1VFNA 4BMZA 1V4NA 4DA7A 5B7GA 4JOSA 3U40A 3UAVA 3ODGA 3IOMA 3KVRA 4G89A 4OY3A 4LDNA 3OZBA 4GLFA 1Z5NA 5B7PA 4JP5A 1ODLA 1JDUA 3EMVA 4R2WA 4KN5A 1FXUA 2OXFA 4FFSA 1PR6A 4X24A 2I8AA 4QAQA 2HRDA 3UAXA 1K27A 3NM6B 2A8YA 4DAEA 3EUFA 3OZEA 3FWPA 1NW4A 4QEZA 1VMKA 5DK6A 3D1VA 3OZDA 3MMSA 4GKAA 3BL6A 4UC0A 4IP0A 3DF9A 1PW7A 1V3QE 3C74A 1JDTA 1SD1A 3BJEA 1OTXA
chains in the Genus database with same CATH superfamily
2C20A 4HOYA 3CH4B 4EI9A 1FNNA 5ALSA 4FWBA 1GTRA 2BKXA 2X4LA 2KMLA 3C3AA 4DA0A 2GASA 5LP6B 3GUZA 1X19A 1AKVA 4C04A 3EIFA 2H1WA 2TECE 1J0AA 1Q0HA 1X9HA 4TMWA 4DDVA 1R00A 5GJVC 4BEVA 1XLTA 1ZN2A 3ZJ5A 4YIHA 4C6TB 5C53B 3DMTA 1PUJA 1UKVY 5CDHA 3CC8A 1P0FA 5BMOA 5CFZA 2JLWA 2DR3A 3X1JA 1ULZA 2I3ZA 4WX2B 3W2TA 5KOYA 4N41A 4FNAA 2VTKA 1WDLA 3UT6A 2EKBA 1GKIA 2YV5A 3UTDA 1IJKA 4PGMA 1XKXA 3U56A 2G63A 1DC3A 1P0IA 5DHFA 1GRQA 1I7LA 4BTLA 2Z5LA 3PHBE 4PU0A 2OFFA 3WYBA 2RHLA 2BBWA 1AKNA 3VHLB 1RQLA 3NBKA 1E0KA 1LC0A 3ANSA 3OFVA 1WQ4A 1EDZA 4CL3A 4ZP1A 2NSHA 3MYRA 3SLKA 5JPDA 2AKYA 1RI1A 3E9MA 1C8VB 5IG2A 1Z0AA 4UNRA 4V02A 1XWFA 1QCZA 1KRXA 3ZXXA 1JHMA 1UJMA 3I0ZA 3SEQA 2DUUA 1RM5A 1L7AA 4FFDA 4XQ0A 2X3FA 3R0VA 4QYTA 4CIVA 2FJ0A 5BY2A 1KQGA 3ZDBA 4KZPA 2P5TB 1PTJC 3CRVA 3KQYA 2EJBA 2PH1A 4EPTA 3KVNA 3RYTC 4ZOLA 2IF2A 3RI3A 3HK2A 4IIGA 1MX9A 3MSXA 2BFBB 1UEJA 3K4PA 4MS4B 3L18A 3LGAA 3H2GA 4L5BA 1RM3A 2ZCUA 3W5IA 2N0SA 2NAFA 1WXIA 3FWYA 1Z82A 4M36A 4MARA 4MIYA 4OAPA 4WLUA 1W0JA 2XT6A 4NU6A 4FFLA 5D1NA 3L84A 2Q45A 1V6AA 1NW8A 2R4UA 5AYVA 1DZ3A 2YWHA 3BDIA 3PHIA 3NV9A 3VSEA 4F6RA 2I6TA 3OLWA 5HOQA 2WB2A 3ER8A 4B4WA 3G59A 4R5MA 3RU3A 3U9LA 3ZDQA 4HDRB 5JS7A 3R9XB 1ZK3A 2DY0A 4Q0MA 1ZMOA 5F2EA 5P21A 3VR5D 3GLHA 4KQEA 2V6JA 1SJ9A 3W8FA 4AKIA 2E89A 3P0HA 1PV1A 1R4MB 3DUWA 4MGHA 4AM8A 2UAGA 3H13A 3QSYA 1HPLA 4X8MA 4RVFA 4F3KA 2QUZA 3F0TA 1IOZA 1SUEA 1YL7A 2XNHA 1ZH2A 2XXAA 3EGIA 4IO1A 4B31A 3LHIA 5KTNA 1NP3A 4CN9A 4J4BA 4M1TA 4YRPA 1ZJ4A 3VVMA 1GL3A 2ZVQX 4X61A 4BLSA 2ZSHA 1GLNA 2RAFA 2YNMC 3FLEA 2RAPA 2J0UB 2J3JA 2XOKD 4MRMA 1RWNA 1W85B 4IX1A 2QSYA 5CM9C 2LVBA 4H9GA 2VG8A 2C9ZA 5IH7A 2P65A 1NDHA 2XUHA 1CP3A 5GWXA 3NYWA 4TZ6A 2B30A 3AERB 1Y1TA 3W6UA 5JBNA 4YDSA 1H2BA 1JE1A 3V7NA 1H1TA 3R3ZA 1F48A 3T41A 4QPCA 4EATA 3KFXA 3H5RA 3U4HA 3UOGA 1Z5UA 2FPMA 3N8HA 5AXCA 3RYIA 1ODJA 5JEDA 1SIBE 3V34A 2ZIAA 3PKIA 3WGTA 2C4WA 2MU1A 1T5IA 3B36A 4EKYA 3AFGA 4D0GA 5LLTA 3BWXA 3LUBA 1GZSA 3FCOA 2HX1A 4MRSA 2GBLA 3FLBA 4B40A 2GEVA 1X1BA 2PQMA 4IS3A 1Z39A 4C29A 1G8JA 1A8SA 2B92A 1IN6A 3FE2A 5DI3B 3RBAA 3W06A 5LQUA 2F9MA 1ZIYA 1UKBA 3T5PA 3VSAA 1XZGA 4TUYF 1T9KA 2RCYA 3Q11A 4JKOA 3WP0A 3FTCA 5JCZA 1JR3E 3PCTA 4AZ3A 2K7ZA 3JD1A 4CI9A 2VDPB 4Y2PA 4M6WA 1HZJA 2XNCA 1E5VA 2RHCA 4A6PA 1Q83A 4CMAA 2C2HA 4ZZ1A 1B0ZA 1HFJA 4MUMA 3S2YA 3QK7A 1Z5PA 4FN4A 1BOOA 1X7XA 1WUJS 3UHAA 3GLIE 4EFNA 1T4BA 3AU8A 3COYA 4HQKA 3KJQA 1V5GA 2YASA 5FJJA 4BBZA 2HI0A 2P62A 3FWHA 2XMRA 4E5UA 2JGFA 2IYPA 1O95A 1KK1A 2AJBA 1BS2A 1ZMTA 3EXFA 2C0PA 3NU1A 4B3DA 1VOTA 2HRZA 4D3SA 4C2UA 1KEZA 2GF9A 1Z37A 1ECPA 3N28A 1U1IA 4MQFB 5ALUA 1S9HA 1S2MA 3ZWKA 1AMNA 3X2EA 2NSJA 1EGVB 1IEVA 1DO2A 4D9NA 5JHHB 2X5JO 4B6RA 2H57A 3IV9A 4MQLA 3INYA 2PNJA 4FCCA 1RWMA 1W5SA 4QVGA 1ODFA 3KZOA 4UARA 5F2KA 1OI3A 3RBXA 2FLKA 3OCYA 4HPJB 4N0EA 1R4ZA 5E4TA 2R4TA 5K4GA 2Q4TA 1UJ4A 2ONKA 4KVGA 1NZFA 4KTTE 5SYMA 4B75A 1EIWA 2YFKA 5JAZA 3UATA 3F7NA 5ICFA 4B47A 4EHDA 5KWVA 1MIOB 3ZUPA 2ACKA 1A8PA 3A26A 3EISA 3RNOA 1E1DA 3T7CA 2NO7A 3Q3IA 2QVXX 1A50B 2FN4A 3Q0TA 3FN4A 4I8XA 1NW5A 2AWNA 1C8LA 3SSAA 3DZIA 5K7SA 2I6FA 4HH3C 4KK3A 2PLFA 5CHEA 4HY3A 3HWWA 4WPGA 1UXHA 4MHSA 2XKBA 1BKYA 5TXGA 2BFCB 2NO1A 1OAOC 4KTVE 4PYIA 4RHYA 1DL5A 4WZBE 1O97D 4CU2A 2J3DA 2XADA 1GGMA 2C1EA 2Z56A 3D1LA 3ZLTA 3KQPA 5JOQA 4TUYB 4FJ1A 5IRCD 1G8SA 1PYGA 1ZR2A 3UBMA 4NS1A 4QATA 4AMUA 4XDHA 4ID3A 5EHXA 1J5XA 2PSHA 2WT9A 4HNQA 1C0PA 1IK6A 1GXSA 4HHEA 3OO1A 3ZZ1A 2CV2A 3KKPA 4X20B 3W2EA 3EVDA 1MQ9A 2W2QA 1CQIA 3RVSA 2QB5A 3R5XA 1T25A 4ZRMA 5A05A 3AUFA 4PC2A 1RWWA 2C3YA 3GH3A 5I7RA 1QR6A 4EAQA 1JVSA 2E7ZA 3PQ4A 1KVRA 2PSDA 1HORA 2ZVPX 4O5AA 1TZMA 5ITZA 2CLSA 2C3UA 1QHNA 2IYVA 4UBNA 4D8VA 5IM4F 4HPXB 2WA1A 4ND5A 1L8QA 2O48X 4JWKA 1UKZA 4WFIA 1QH0A 1VSVA 4JK3A 3KPWA 1A9YA 5K8VA 1YR9A 4C7JA 3IAS1 3TSYA 3IHWA 4DV0B 1G63A 4OHCA 3FI9A 3CLVA 3FFTA 2W7TA 3AHHA 2GD0A 2OCXA 3DTVB 3WLFA 5EJ6A 1KEEA 1PJBA 3C7CB 3IELA 3JQAA 3K53A 2WZBA 3OZGA 4HWRA 4IYRA 4V2IA 3U80A 4E12A 2V6GA 4KQ9A 2Q9CA 1KYWA 2I99A 3VSDA 1D9XA 2HU5A 1P5RA 1O77A 4FYJA 2WIFA 5GGYA 3RS5A 1K6XA 2BELA 1S3SA 4MB2A 2IWRA 1G5RA 1XZQA 4CKEA 3W77A 1LJ8A 1Z17A 2H2WA 1QWSA 1VIVA 3WQQA 3D6VA 5F1KA 4G1MB 2R7MA 1GUBA 2ZYAA 3AF4A 1QDUA 3HVKA 3NTLA 3HCEA 5ALOA 1HQYE 1ZUIA 4GMHA 4N9WA 1V1RA 2OV1A 4L8GA 4BYMA 4DM4A 3EIWA 3FMGA 1PK9A 4K81B 4AN4A 4YP9A 4OHPA 1IVNA 1QF7A 3RVBA 4GX0A 4ZTBA 2VLIA 1GAXA 5CEEA 3A0UA 1PZGA 2WILA 4TMZA 3CLKA 3T3OA 2Q4RA 1XKLA 5EMKA 1CFJA 5J4HA 2GBIA 1FYEA 4HFJA 3UWOA 1H0RA 2H9AA 4LCEA 4QOFA 2OC4A 2WSBA 4U02A 1FLNA 4R98A 1J2TA 2Y1CA 4RWEA 3KTFA 3LQ2A 1P6QA 3VC3A 1HMYA 3D3QA 1JWBB 1YIOA 1N6LA 4J0IA 4P4NA 3ZHRA 5KKNB 3L4SO 3CN7A 2CMFA 3WK7A 2R00C 5B1IA 5BORA 3K70B 1IY8A 1XL1A 4UKDA 2O2XA 4OBXA 2BHRA 3DOUA 2AFHB 2EIXA 3IIJA 5C7YA 3UIEA 4QKQA 1Z73A 3URMA 4G23A 1BVYF 2ZYWX 1R5JA 1XRMA 3G0IA 3TSWA 1ZGAA 2K4MA 4X94A 3EZXA 1CQZA 4XAQA 1DRUA 1WD5A 3R3VA 1HR0B 5F2OA 4DARA 5F35A 4EZIA 1K0UA 3IIMA 1QFMA 1Y8RB 4RE6A 3D6AA 3T1OA 1E7SA 1YS2X 2GFHA 3OFSA 4HLUA 3NKFA 1QQ5A 4IH9A 3U3OA 3EB9A 4YO8A 3U09A 1D4OA 1K63A 3H1BA 4RANA 4BGEA 2Z6QA 1CRLA 3OSUA 4RWZA 2J0EA 3CNEA 2C03A 2DFNA 4B4DA 3HGMA 3Q3JB 2CNNA 4M76B 4CLRB 3O74A 4U00A 4RTKA 4EB3A 4EI8A 2J1LA 3SD7A 4W5HA 5HIAA 1OTHA 2EWVA 1YXMA 2PZBA 4EKGA 5E7JA 1UFVA 2BFNA 1JAXA 3QUQA 4QNMA 5G4KB 5M04A 1ECGA 1JR4A 3E4CA 4ALMA 1DOHA 3VYSB 1NV8A 4POAA 2PMBA 2JW5A 1U1EA 1OBFO 3DMRA 2PX0A 4MRPA 5B1DA 2DBVO 5IAKA 1ZLYA 3ZWDA 4BNDA 5DN9A 4QDZA 4ZJYA 3AF6A 4Z9XA 2C4HA 2XDYA 4LYHA 4AF8A 2DFKB 2O57A 5IARA 2CDCA 3W4JA 3I5XA 4KRFA 3JV7A 1VBNA 3BJMA 4QLAA 1YKGA 2JL1A 1FXSA 4MWBA 4FHFA 3KVVA 2VRBA 4P36A 4P4GA 2PU5A 4GZ5A 1M1YB 3VAAA 5LCXA 3WL8A 1I14A 5FAKA 1P6UA 1KSFX 2IPXA 2Y3IA 3IA2A 4UBKA 3N2GB 1BX0A 2I9PA 1UAGA 2XVZA 3KHUA 4J1SA 4JLSA 5E38A 4CTMA 3KU4A 2C0QA 1JQKA 3O3NB 2L2QA 10MHA 3DJFA 4TWIA 2HXYA 4P8RA 5I9SA 3UMVA 5HE8A 3AZPA 3ROXA 2ZPAA 2IP4A 5CB0A 2GRUA 2Q5LA 1H0HA 2CD9A 3NRJA 4OQEA 2WSSD 3NAMA 4DNQA 2WWRA 5AD1A 1KZ4A 1P19A 1Z7EA 1M6VA 1DINA 4HYTA 2YZGA 2XT9A 1NMQA 3OIUA 1B3BA 4NBTA 1QANA 4C6RA 2BEVA 4Z8YA 2ATVA 2BFFA 4U4AA 2OG2A 3KJNA 5LMZA 3GDFA 3LY9A 2G71A 1H2XA 2P9JA 1AG9A 1MEOA 3BL8A 4JITA 3SICE 4K2AA 3NVKI 4G9GA 2NLOA 4P0PB 1DXOA 1WE2A 5B7GA 1AKYA 2BTQB 3IERA 4UPVA 4MUBA 1E1QA 4NI5A 5JRDS 2BR5A 5EKDA 1T9HA 4D4JA 3W9UA 2Q07A 4IQFA 3A1VA 4JOSA 4MULA 2WMNB 2B69A 4KODA 4DIBA 4KAJA 3V4PB 1NKVA 3RASA 2IEZA 2NVOA 3R6WA 4G89A 4UXIA 3UENA 4W5OA 1SUPA 2GTPA 1IXSB 1UPXA 3NUGA 3OZBA 4GMKA 1KOFA 2C5AA 2MINA 3KV3O 3BCHA 2O7QA 4DPMA 1SEPA 1XCMA 3KLNA 1T13A 2TMGA 4LGVA 4N8DA 4CKYA 4EPXA 3G13A 3K6RA 2OYCA 5E1MA 1BVRA 1K66A 3PSHA 4DUPA 5DWQA 5T41A 4MS3B 3I58A 1I4WA 3LMKA 4Y2QA 4GKVA 2HV8A 2DEUA 3TX2A 1YB6A 3KYBA 2XWJI 3LBIA 1EFVA 2QXYA 4LXTA 2ODNA 2D2FA 5BQ5A 4KN5A 3MS4A 4AZ0B 2Y1KA 3IE1A 4YRJA 5A3QA 3WGGA 4B6JA 1LBTA 5FBZA 2W6QA 3HZZA 1CNMA 4RQAA 3GWZA 4EG1A 5FOWA 4J0FA 4R7TA 4KGXA 4DLZA 1JFFA 1R6XA 2GVDC 3WP1B 4U39A 4ZEMA 2BCEA 1Z15A 4NLLA 5TDHA 1HE4A 1CR6A 3ZU3A 4MO2A 4RC9A 2CHEA 2ADMA 2GD6A 3FMIA 4YRBA 2RD2A 3EXG2 3C8ZA 4MA0A 3ZCXA 3KYDB 3CH7A 5AVKA 1GSHA 3ABOB 3NM6B 3ZWOA 4YV7A 2ZUFA 4BC1A 3OZEA 1GEEA 4UNIA 1V7CA 4HX5A 4IDQA 2P9QA 1UINA 4J91A 4QEZA 1G64A 3E9DA 3H9CA 4NNOA 1RHRA 4M1KA 4D46A 1UPAA 4FU0A 2P41A 1WZUA 4RL6A 1XV5A 4GD3Q 1JFSA 3L7JA 4TT3A 5DGHA 2H63A 3BRWA 1GA6A 1G20B 4CEIB 3GYBA 3O8DA 1Y5MA 4LDRA 3I6YA 4FR2A 3DFMA 3AVUA 1DIBA 5CJPA 4ZQBA 2Z8YA 2VWGA 3S6JA 4RL4A 2V4MA 3DWGA 3GRUA 4GC9A 1MV8A 2CJFA 3DF9A 2YHAA 3K9BA 3V6LA 4DG9A 5LOVA 4CEHA 2RDMA 1TYZA 3I6QA 5L95A 3EOBI 3G49A 2WF8A 3FF1A 3L8GA 3K0KA 3BJEA 3W7VA 2HA2A 1L5GB 4DDMA 3HTXA 5LZ4A 4QM7A 5KWIA 3IUJA 3VJLA 1KH3A 3P9KA 3PFGA 3FR7A 1DJQA 2D7DA 3KQQA 4C4SA 4EMSA 4LZWA 1KF0A 1VMDA 1PD0A 4NMMA 1Y82A 2HK7A 4QQFA 1MB0A 1CT9A 2VJDA 3PNMA 5FHQA 3WRVA 1NVBA 4I6JA 2IOQA 3IXQA 3GGJA 9GPBA 3OLYA 2YN4A 3SBOA 4CKZA 5I7VA 4Q48A 1BHO1 3O0DA 4PW0A 3U62A 2JG3A 2B4QA 3PEWA 1YACA 1IAVA 2CLLB 5K3AA 3WLAA 1TA9A 4AYXA 5C5DA 3UUGA 1QGYA 1T2DA 5SZKB 1N2XA 1JB1A 3PD7A 3JVEA 1P4HA 2QMUA 1ZW1A 2WT8A 3IUSA 1GY8A 1NI5A 1GO2A 1RABA 3IV7A 3HO8A 4KSBA 1TKBA 2Q6TA 2ACEA 2J3KA 4JS0A 2EAUA 3CJTA 1JFTA 4W5NA 5EY5B 1QHEA 2IYLD 3RVQA 1HC7A 1XTRA 2OR3A 2FI1A 4YO7A 5DHSA 2J3HA 1P1CA 1GCUA 3I1FA 4KV9A 4TN5A 1QLHA 1E9DA 3KUKA 3GGSA 1BX3A 4TMTA 2WWTA 4HDSA 4JLKA 3BFXA 4FB4A 1QOQB 3NEYA 1AVTA 5L6LB 1C9KA 2PD3A 1U5CA 5EUBA 2W5UA 4ZPJA 2GXQA 1XI2A 3HLYA 4M83A 1FDUA 5A71A 5BV7A 4URXR 4D3DA 5IKOA 4JEMA 3A9SA 1FJHA 5F4ZA 3PXBA 4FTWA 1NSYA 2SICE 3LQQA 3OLQA 3PD0A 1J0EA 4GBJA 3JD4A 1JAYA 2SKEA 4JVOA 2FRVA 1X3LA 1KI2A 3EG9A 1JJ7A 2CUNA 2Z4RA 3KOUA 3L92A 1N78A 2PTGA 2UYOA 1GYRA 4D41A 5K03A 3CVVA 4YQFA 4CCYA 4FWTA 3ZJYA 3OQMA 4HQ0A 3BHIA 4PANA 5D5PA 1LBIA 3ZJTA 2V0NA 5TJHA 3L1KA 2ZUTA 4JL6A 3B6EA 4PVDA 3ADOA 1NNEA 2RKBA 3BMCA 1GZ5A 3DYBA 2C59A 5ARBA 1CQJA 3KSMA 3L49A 1OXSC 4RH0A 1I4OA 4AULA 1HY3A 2C4NA 3H1PA 4JXJA 3CKLA 1SOWA 2ZR9A 3HCDA 3SJZA 2ZW9A 1Z35A 3BXHA 4WKPA 3UJCA 1SVIA 2CEKA 3OEHA 4K8OA 1RYYA 1U5AA 2DUJA 3HCAA 3HKBB 4U7HA 4E5PA 4K6MA 2J6HA 3PUIA 2CLEB 5BWOA 3OURA 1CF4A 4RVOA 3NHPA 1YOBA 3LCJA 3K16A 1Q7RA 2CFSA 3WB1A 3OJEA 1RQNA 1R0SA 5CDYA 4MQ4A 2RHWA 4ZICA 3H42B 1DPGA 3D7LA 4BQQA 3Q9NA 3A6DA 4JI1B 1P0QA 2JCXA 4PHTA 2FPUA 3W34A 3WRYA 4B48A 4QVIA 4GEKA 4UMDA 2BTOA 3L43A 5BSWA 1UL1X 3RC1A 1L7OA 3WLRA 4GL2A 3NBFA 5A4AA 3TIFA 4V1CA 2C9OA 3EZFA 1LV8A 3OKAA 4W1SA 2DHRA 4ZVLA 3KVYA 3GIWA 1GRRA 2FWJA 1YJAA 5FA8A 2IHZA 3GEBA 3BK7A 1JBQA 2LTAA 2VUUA 1U7HA 2I34A 3DFFA 3HL4A 5IBCA 3V8NA 1ESZA 1NVFA 4CM4B 5ALHA 3NHZA 1N3BA 4YAOA 3E8SA 1LJUA 2M98A 4LJKA 4X44A 4X64B 5DCWA 4O0MA 5CT5A 1P77A 1GFZA 2GPSA 3A31A 3QE0A 4LRTB 5F7OA 3RKRA 5A3VA 2PX5A 3TFOA 1E1CB 2IYQA 4FC6A 3X1MA 1B6GA 4TQGA 5CVEA 1LTKA 5M29A 1RI4A 1S1CA 1WO8A 2G06A 2Q6VA 4TN1A 4UNSA 2PL5A 5FWYB 3V8BA 1U3VA 4D57A 3EPHA 3KPJA 3KB6A 3WQRA 3EFOA 4BVJA 2NTVA 1Q12A 3U0BA 1HV8A 2GZ3A 3Q8KA 3LQ4A 3DQQA 4KYTA 4PM4A 1E18A 1VRCA 1XQYA 3BGOS 3CA8A 1RHJA 1ZJJA 2WD7A 1BHJA 4L08A 3BHNA 2X2EA 4QQRA 5E0OA 3VR2A 1PJTA 4RTJA 4AS3A 4XGNA 1E2JA 2FPPB 5DASA 2QQ5A 2EBFX 3ZY5A 3IGFA 2O3RA 2O3JA 3LT2A 1YFJA 2PRKA 2OXRA 2YVKA 4MA4A 4K0KB 1QG0A 4ZREA 4B82A 4B4UA 2QOEA 3ONWA 4Q7KA 1L5KA 4CMEC 1L4FA 4DR2B 5JZOA 2R66A 3SU8A 5DNCA 1SWWA 2QAGB 5CLHA 4R2LA 5ADUS 5M34A 1WNTA 4W4TA 2QL5A 3F3KA 3OPYB 1T4MA 4RVUA 1DBSA 2EGUA 3WGKA 4L0DA 4ZK6A 2G9ZA 1AQ6A 1SXJA 2AJTA 4KACA 2WUVA 4P31A 4ZD6A 2GM4A 1G60A 1JQLB 1FRNA 4LNUB 5ENZA 4HXEB 1ND5A 4IV8A 1C3OB 3IAM1 4F56A 1YUBA 3FKJA 4G1EB 2EOAA 4D8UA 2B0CA 1NUHA 3C8DA 4FR0A 2B4AA 2H5IA 4KX5A 4Y1RA 3SQMA 4HTFB 4KGZA 1PR4A 4YWHA 1GQQA 2ID4A 2WJ6A 3HY4A 4TXJA 4W5JA 2UUBB 2F4VB 2CWWA 2YOHA 1QNFA 1YI8A 1PT9A 2GUGA 1YB7A 2EKZA 5HA5A 2W8ZA 2EX4A 3QTBA 4QO7A 3QWFA 1N2HA 1SHUX 3IO3A 2B2XA 3OOHA 2I6SA 3B3JA 4FEAA 4RD2A 3IPYA 4Z7OB 5JV5A 1V8DA 4QU0A 1QYCA 1XRPA 4ND4A 5JD6A 2ZBGA 2HJSA 4R2HA 3WG9A 5E9WA 1ZOSA 1CJMA 2VRNA 2Y1DA 5LD2B 4JR2A 3IAFA 4C87A 4DZTA 3BXPA 2RHDA 1CSEE 1GPNA 1V35A 1Z08A 2GHRA 3G8BA 3LKDA 5FX2A 5EG5A 1J0CA 4KCGA 3EIUA 2AKAB 2QQFA 1E20A 3L05A 1VCNA 1J9ZA 1O6BA 1TYEB 4UVIA 1YOVA 1Z0FA 3NV7A 5GM2A 3Q12A 3ECAA 2B61A 4G5GA 1XEFA 1CCWA 1T9ZA 4KPGA 4QJIA 2J9FB 4DMCA 1XLTC 4S1WA 2BMEA 4CMHA 4MVXA 2IYEA 3DMTC 3EGCA 2NUTA 1DE0A 1JHOA 1ZGGA 3GHHA 4KLZA 4WCDA 1VGVA 2C2XA 2X0EA 3RLFA 4BNVA 4DRZA 3D3JA 5IN5A 5FI1B 1LFAA 4NENB 1UP4A 2UZ1A 1Z8FA 4QGBA 1PD1A 4MJXA 2QW0X 4WFJA 2GN1A 4DQUA 3OCWA 3K6KA 2PR7A 2ZPTX 3EWIA 3HPRA 1VJCA 3RS0A 5E1OA 1F7VA 1O7JA 2VAPA 2WSIA 3ENKA 1LXCA 4E11A 3C5CA 5J5AA 4KRXA 3IDSA 4HRAA 4O1HA 4P22A 4WBSA 3TZEA 3T9EA 4BQSA 3TQQA 4TSRA 1DRJA 1FUKA 5F3WB 2FP4A 4E7PA 8AT1A 3V7WA 2ORWA 3EHEA 1Z4IA 4BTEA 2HUNA 3I5UA 3F6RA 4CTJA 4DEYA 4O8ZA 4JLBA 2BDEA 3NCHA 3TR5A 3ZI7A 2EARA 3IALA 1X42A 4Q4JB 4BO9A 1FYFA 4Q3AA 4Q9JA 2W2LD 2IYFA 4RDXA 1QVRA 1XXHA 4FXOA 5BYJA 3VV2A 1J4AA 1NN3A 2ZYVX 2XTAA 4GPBA 1NXOA 4DMGA 4DQDA 4ZGGA 4CEJB 3N7UA 2E0IA 3NC0C 4H1VA 1IFXA 5BR1A 1S6YA 1T6YA 1GG9A 2ZQYA 3IAHA 3K32A 3N2KA 2G3YA 1EFPA 3KPYA 1LQUA 1U6KA 2BAGA 3H17A 3OO0A 4NL4H 3E05A 2ZBEA 5AWFC 5BN1A 2JCVA 3ZHZA 3SIWA 1FJ2A 1TM3E 1GVHA 3HB4X 3R7FA 4LG1A 1SOAA 1PZEA 2PUGA 1SIOA 2AMFA 2A9OA 3SM9A 3I2YX 1E79A 3OF3A 2B2NA 3B1KA 3T34A 4EVRA 2ZAGA 2OBLA 3ROPA 2IGBA 3UZUA 4DB2A 5B36A 4JJIA 2NMVA 4CIWA 4EYOA 4BNUA 2GCOA 4LZZA 4WVLA 2FCRA 4LQCA 4BEBA 4XPZA 5AVSA 2NV6A 5AFSA 5E6SB 2XTJA 1Y1PA 5JAUA 2VZLA 1I01A 4N8SA 5KSZA 4R9UC 5IJ9A 2GD2A 3LDHA 1O0CA 3T5AA 1OMOA 3QF7A 2E48A 2F67A 1WEHA 1Y81A 3GB9A 4IDDA 4LBWA 5YASA 4WQMA 3AWDA 3GQVA 3OCXA 4IJ5A 4C07A 2I7VA 4EMUA 2AOWA 4LJ5A 3NHKA 4IQ4A 5C3MA 3O1LA 1QIGA 1PI3A 2G1AA 4JD5A 5TPWB 2R62A 1EE2A 5H70A 4HB2A 3HKEB 2J6IA 1CHNA 2AHOA 2UXCB 4UHBA 1W5EA 3CW8X 4W8OA 3TK1A 1MVNA 4B6GA 2HF2A 1E7YA 2IE8A 5LIRA 5J1TB 3URKA 4L16A 4LY3A 1D6MA 1E89A 3A1DA 1OF1A 4I5GA 3EW7A 4PLTA 1E2UA 5C7LO 4O2BF 4AO7A 5IYZB 4RIHA 5L3SA 1XDWA 2J85A 3GEHA 4JBIA 4EX6A 1TVEA 2Y6UA 2GBLC 2R11A 3UUFA 4BQOA 1QPBA 2OGTA 2WNSA 1W4CA 3DMYA 3PNPA 4JLJA 3CG4A 2R6AA 1GQ2A 2Q3CA 1WMBA 5REQA 3AGQA 4P34A 1ANKA 2Y0PA 5FPQA 1ZA2A 3T5GA 2BFEB 4JMPA 4GOLD 3WSWA 2C4MA 1O1YA 1PK8A 2IZZA 3QVOA 1UM9B 5JASA 3U16A 1KKUA 2AFIA 1HYGA 2H85A 2IPOA 1BDMA 1KBZA 3PFCA 1ZRMA 4CDGA 4L8FA 5KNDD 2QVZX 1MJGM 5JNRA 3DW3X 4JVNA 4GM0A 1UPUA 4QBTA 5ALVA 3I3OA 2FU5C 3N0VA 3OPXA 1ADBA 2B4YA 3HN2A 5HEKA 4DJTA 1GCGA 3A0RB 2H07A 1S3GA 3GBVA 2VBIA 1MJFA 4BAGA 3AEXA 5M3BA 4E5YA 2K2WA 4YCLA 1UPFA 3DH0A 4K9NA 2DAPA 2GAFA 1O95C 1ZK1A 1DIHA 4HH1A 1GHTA 4GG1A 3F5MA 2FMXA 3K9CA 2WSMA 4IZOA 2XDWA 4JQSA 3AYXB 2X8LA 4MROA 3WYGA 4BLTA 5CW1A 2PD6A 1QX4A 2JLQA 5HM8A 2HF7A 1YK1A 3IUYA 1W36D 3NTUA 2JHCA 4EI7A 2J5RA 2C07A 3ELDA 4J0GA 3QITA 4NG4A 4X54A 3WLEA 5FWXA 5KX5A 4PFJA 3BWEA 3NYQA 1XU7A 4KIUA 4BFCA 4IBOA 2OV4A 3PPVA 4G1UC 2R8OA 2X7JA 1E3IA 4U7GA 4I1OA 3C41J 1Q6ZA 2DHEA 3KJFA 4R2IA 1HURA 4URZR 1JWAB 5ITVA 5CVCA 2Y1WA 1Y9AA 4LWZA 2OXTA 4FEYA 4ARBA 4E6EA 2Q5JA 1GQSA 3AVWA 3A1TA 5FO1A 3BRCA 2B9EA 1O95D 3SJUA 1B76A 3KQNA 4E46A 1J0XO 1X7GA 4O2BB 2LR0A 3WZ2A 4JKIA 4HAWA 2VUTA 1AXEA 2BGWA 1TW2A 2ES4A 4PG5A 1JDUA 4GPZA 2QRZA 5B37A 4EQZA 3F9IA 4RVGA 5U4XA 5DM4A 3V8QA 3FROA 2PZFA 4EY8A 4UTRA 1WUIS 1XF1A 2Z4TA 4JB8A 2Q8PA 4E2WA 3BULA 1I5OA 4K9RA 4MUEA 3FNGA 3TTSA 2F2TA 3P32A 3UM9A 4D82A 1ZM7A 5B57C 2JGLA 1XLVA 3IQEA 4G07A 3OUZA 5CNKA 4NH0A 4A2QA 2IX9A 2F1KA 5JNTA 1Q91A 4KC0A 3M70A 4AS2A 3B6IA 3D4PA 4QHSA 4EUNA 1DJMA 5DE3A 4RF3A 4OH1A 4XUGB 2B2CA 1GLGA 1MAAA 1OXXK 4Q1BA 1HRDA 4MB6A 1KAEA 2OCDA 3MRSA 1C0KA 3X1DA 2YH2A 4OGFA 2ERCA 4DIDA 2C31A 2G0NA 3TBHA 1HDOA 3CZCA 5AI4A 3G6WA 3FWPA 3DSRA 1R0ZA 1EA5A 1XL0A 4MUKA 5DBEX 4BNLA 1RRCA 1Q0QA 3U0VA 3MTBA 4RX1A 4MTCA 2ZSEA 1S7GA 3PUYA 4L6CA 5BNIA 3INRA 1NU8A 2W2KA 1N5JA 3N87A 2PKCA 1YWGO 1CUSA 1UADA 3O8RA 3DKVA 4LPKA 4L72A 1GTL1 1LZLA 1Z4PX 2AYXA 2AG5A 3DV0A 3KEFA 4KWHA 2H16A 2NG1A 3KDPA 4EJ0A 2XPCA 1KDRA 2DGDA 2HJRA 5J59A 4LHSA 4DSNA 4CL0A 2UU9B 1H9BA 2PDAA 4ZV9A 1N25A 3G68A 1VPLA 1SUSA 3EQ8A 1T4CA 2B6HA 3A2NA 4PGFA 5AJXA 2P3SA 4OGWA 3D6NB 3H2BA 4ZHQA 3CCCA 3OKCA 1XZDA 3MG9A 4II2A 3VDNB 1M1YE 1NVGA 5HNKA 5DBOA 2W2PA 1CS0B 3MPOA 4DLPA 3RVRA 1UBFA 3UFBA 3EDYA 5KQPA 2NXEA 1SCDA 4UMFA 2G5PA 5D85A 4CM8A 1IZ0A 3HNPA 1JLSA 3EC2A 3DAHA 3ZZUA 1MC8A 4CFZA 1W73A 5BV2P 1GV1A 1RQXA 1Z2OX 4IKOA 3RYCA 2PE5A 3EVZA 2GZDA 5G0VA 5K45A 4CZ2A 3OUUA 3PLAE 3VU9B 1JDSA 1K8XB 2DLNA 3AWIA 4WERA 3M6MD 3UOWA 5BV0A 1H2RS 4DREA 4FGUA 4HDKA 1E9EA 2D62A 1LS6A 3OMWA 3BGIA 4B46A 3G5MA 1CG6A 5IC4A 4LDJA 3ITEA 4A2CA 4BAUA 4LI3X 3IPRA 3VDQA 1VBKA 4D7AA 2ACVA 5ITWA 4YJ2B 1FFYA 2WSLA 1U5BB 5EVCA 4R0NA 3BK2A 2O8DA 3CLSD 3O84A 2VPPA 4U6QA 4ZOEA 5I9LA 4YPFA 4PRZA 3ZOKA 4OUDA 4U2DA 4UW9A 3OPMA 2YV2A 2JF0A 4WLVA 1SAYA 5ELLA 1K5GA 4I1RA 4ETNA 2JIDA 3A4IA 1PGNA 3IODA 3SIPA 3JQFA 3TLEA 3L8FA 3TRHA 1AZWA 1XMOB 3MTAA 2Q1YA 4N0QA 4CLDA 4I99A 4PNZA 1LX6A 1C9JA 3VR3D 5FPKA 4PCAA 4HLUC 1KAMA 1UPBA 2ZSUA 3GJSA 3ZV5A 3LBFA 3UA4A 2J3EA 3ZE7A 3KEMA 4QBGB 1UXOA 2GJ8A 3RDPA 4UHCA 2V8OA 5KYTA 2JI4A 4UOEA 2NP7A 4WVFA 2QY6A 2AUTA 3CM0A 4QGGA 3JR7A 5G3YA 2P30A 3ILYA 4D6PA 1CZNA 1FP2A 2QHXA 2ENUA 2ZBDA 3INTA 4A1FA 3D81A 3F8SA 1IY9A 2G5CA 3NWBA 4ZYZA 1PGQA 2PQ2A 3C5HA 3W2IA 1WZIA 2E2WA 1MUUA 1QYRA 2Z2IA 1QQ6A 4K1LA 1RBQA 5B6PA 1SIUA 2H48A 3BWBA 1ZUHA 2O2GA 4UE3S 3RT9A 2C00A 2M2IA 4R8MA 3RTBA 4AT1A 5JFGA 4YT2A 4BO7A 2J08A 2HK9A 1WCIA 1CJKC 1UM8A 1YB4A 5FBKA 4WCFB 4EHAA 3I5AA 1NE7A 3L6UA 5D3MB 3B6JA 5WRFA 1R0XA 2PAAA 1QU2A 1PS8A 5GJCA 5JECA 2P9TA 5JNVA 1VI5A 3QEBZ 2AX3A 3BMQA 5AJZA 2CXNA 4IIHA 1FZTA 2R68A 1EJ0A 4M9QA 3HYNA 3GLFA 2WJ3A 3FVRA 1ONOA 3RYHA 3GWGA 4TQUS 1E3LA 5EQDA 4C06A 4ARZB 5JSZB 3W9SA 3EIQA 4MKZA 2G9RA 5IJZA 3ETGA 5HBRA 4BJ5A 4RADA 4RULA 1O6FA 1JLMA 1U0JA 3LF2A 1EH5A 5TF0A 3SBDA 1L5FA 1CR1A 1N2ZA 2XQKA 4N5DA 4U63A 1E1LA 1D0IA 1XTTA 2VHYA 1C0LA 2AJLI 3G2NA 4U9UA 3H5OA 3HCRA 3IOEA 2D1QA 1A77A 4CL8A 5B4TA 4A36A 1NXPA 1AB5A 5DW3A 1KI9A 2WWFA 3CLHA 1PUIA 3I9JA 3N0TA 4XJVA 2GS9A 3AGPA 3F78A 3CRMA 4E7OA 4ZI7F 5LMCA 4Z3OA 2YHIA 2R96A 2PMWB 1CX9B 4C3VA 4MCAA 2PTHA 4AMGA 5EEGA 1MJNA 4F85A 1A69A 4E08A 3O3MB 4UAUA 1XTKA 5K2OA 1II8A 1ZD1A 1SCIA 3EOAI 1SWVA 1W4RA 3M1LA 3MCVA 4HQRA 1Y1RA 2ZT8A 4KYIB 2BR4A 4H6XA 4RMJA 3CKMA 2CXUA 1U0FA 2I4OA 2A9RA 3G2KA 2CNKA 4FEGA 4GRAA 3NDBB 5CUQA 3U31A 1IZ8A 2QZZA 4MAAA 3FVQA 1T1IA 4S12A 5L7TA 1V16A 4Y67A 4Z4CA 3OY7A 4IIXA 2M6LA 1U4SA 3RJZA 1PNRA 7ABPA 4EB0A 1XNQB 2MYNA 3DZ8A 3M3PA 3BFKA 4LTDA 2I1LA 4CMJA 3OECA 3TCKA 1GT91 2RJ3A 3CRRA 9LDTA 3VO2A 1IH8A 1HFEL 1KZ6A 3HKCB 1A71A 2EBUA 1PG0A 3IEIA 3PRJA 5LQRA 3QVVA 4MW0A 2I5PO 4IQ0A 3EXAA 2EKQA 4X6XA 1UJ6A 3RSQA 4LGMA 4RKFA 1D2NA 3NBQA 4QWMA 1ZH8A 3JAKB 1DEAA 3RSGA 3VPDA 3HMKA 2ZSKA 3KHKA 3WKCA 4E2ZA 2QVBA 4FHZA 5C8VA 1JAZA 1Q11A 2JKVA 4BNYA 2WM2A 4BIIA 3IQDB 2JFQA 1BXKA 1KSGA 2P90A 1DPFA 3PEYA 4ND8A 4P5EA 2R1TB 3NHWA 2HN9A 3I28A 3MJDA 1RRKA 2GR9A 2JJ2A 3CINA 5HCNA 3P0EA 4MK4A 4I50F 1Y0BA 3JY6A 4R6WA 1IM5A 4R1LA 2X8BA 4FIDA 2BZ0A 4X1KB 5KYKA 1FBTA 3KG2A 4OI2A 3RSOA 1T3LA 4PO9A 4G8BA 1GGFA 2ZJ2A 1WRBA 5AKGA 1CJCA 3ZJUA 2W6CX 4R4JA 4Z8XA 5JCJA 4XOUA 3FTNA 1YQWA 3A2MA 1L4BA 2F8LA 4GF5A 2HA3A 3MS7A 3H8JA 4GE0A 1MKYA 2ROQA 1P0PA 4ZI7B 2H5LA 4GI1A 4IEIA 1QHIA 4NAUA 5HIIA 3RRYA 4G4GA 3UGKA 3HO6A 2QU8A 3PGJA 2HLHA 5LKRA 1DC6A 4KAFA 4PRYA 4B3BA 3SX2A 1LLDA 4UTNA 3O93A 3W2FA 3M81A 3F2VA 4UM8B 4R2JA 3H0EA 4Q24A 1P9WA 4FFWA 2ASEA 2I66A 1C3XA 4QDJA 5CG1A 3HNRA 4C7VA 2VJNA 3FCUB 1SD2A 2BF4A 8GPBA 3HP1A 3K72B 2C5GA 2VHVA 3CUKA 1D04A 2JI7A 2IHKA 2YXPX 4GPEA 1PFUA 4UJ3A 4M88A 3PF8A 3U13A 2GQ0A 3IP5A 2BFWA 4WK6A 1TMOA 1CJSA 2GERA 1R66A 2E85A 3KS9A 2GEUA 1WY7A 3I52A 3P0JA 2QD2A 2JBHA 2CE7A 2QYOA 1U9IA 2XE7A 3DTNA 4HZIA 5FKJA 3S3TA 1PGPA 3HGQA 4A8JB 4DJJA 3NPMA 4EGAA 2FK8A 4P83A 1V3UA 2MSLA 3OHPA 3PC3A 3ZZNA 3W6OA 1U11A 1W47A 1IWBB 1XO1A 3MGAA 2CXTA 2NVUA 4NS4A 5ALXA 1H4SA 1Z6GA 4O2AF 5CMLA 1K06A 1VPVA 1U6IA 1CW2B 5JNWA 2OKGA 1KC3A 2C7GA 2NO9A 1B0AA 3E1GA 2GAAA 4UREA 4OP1A 2YUTA 1ZUNA 4AY5A 5LWQA 2Q3MA 2VWHA 4I50B 3TKLA 1FDIA 1I3OA 1GL6A 2E87A 2VF8A 4R1QA 3VPCA 1JIJA 4FQ5A 4NNPA 4O63O 1XTBA 4QT4A 1KJZA 2GN0A 2MSKA 2KPOA 4DMMA 1XF9A 4F91B 1KQ3A 1PEYA 2DCUA 1NG9A 2C29D 1L0BA 4M3NA 2HF9A 5G1NA 3O1IC 5C3UA 2L0XA 4DTIA 5L8VA 1HLGA 3NVMB 1GAJA 2YMMA 2QP9X 1TNDA 3GZNA 3CONA 4MWSA 5F1PA 3OHMA 4JBLA 2YWEA 4FOOA 5CX1B 3WLSA 3OIYA 2AR7A 2JJMA 4FB5A 3NWJA 2R1VB 5EPEA 3U7HB 2QMZA 2JCYA 2KW5A 1VCMA 2QYSA 3C0KA 4BB5A 2AW3A 5LQCA 4RQUA 2PRYA 1IE3A 1XG5A 1HYHA 3AEKA 5H81A 3RGWS 4IFIA 3PR3A 2GMWA 3CJRA 1Q95A 3SYRA 3ZWAA 1TCUA 3QBVA 4L9AA 4PFSA 4MYRA 1R74A 2H8KA 3ELBA 2OPBA 4MHOA 4Q47A 1NVWQ 1JP7A 1L6RA 3IP8A 1BSVA 2OD2A 4QGAA 4BFSA 4HDMA 3SOZA 4YJFB 2QD4A 3SQDA 4BN5A 4CCWA 1GN9A 5CK5A 5HM6A 2Z1MA 3EF1A 4FZJA 4LBYA 5B7NA 4Q3OA 4PSVA 4DT1A 1KO1A 1PL7A 3AVQA 3WMFA 1UDRA 1EHCA 3PG5A 2IHVA 1YL5A 3AKZA 4I1IA 4CHTA 2RK4A 2BEWB 2AK2A 4WI1A 5G0UA 2Q50A 4FP9A 3TS1A 4MWTA 3KYCA 1QVZA 2UZ4A 1QZZA 1M1XB 4C5CA 1WOMA 2BHSA 5FUYA 4IKPA 4W7IA 2BI4A 4FYMA 4OG2A 4WASA 4YT5A 2Q5CA 2GKOA 3TLBA 3LX4A 3ZCTA 1JQ5A 4BO1A 5IBQA 3TPZA 2NXNA 1MXFA 1RXSA 1UFRA 2JBAA 4O2AB 2P4SA 2NUPA 3H1AA 5KYUB 3BH0A 2IEAA 3REOA 4BBAA 5LPNA 1RBMA 5IS2A 3Q0EA 2PXAA 3VZDA 2O5RA 5DIZA 4RKRA 1KMNA 3U4AA 2ZT5A 1IBSA 1X7YB 2GJ9A 1MD9A 2XY4A 4UQOA 3PEEA 3EF0A 5ECDA 1V5EA 3TQOA 3G0CA 4URWR 3TCXB 2H1RA 1ISFA 3OTIA 4OXQA 3K6SB 3A1EA 1KYXA 5BW6B 5D01A 1WMAA 2C2BA 4CQMA 1C7FA 5LWHA 4QXQA 4WLFA 2O1XA 1WHSA 2SKCA 1L8OA 4PLZA 3V32A 1R8QA 1ZP6A 3NDRA 4V0KA 1V47A 3HWRA 2RHJA 3T5MA 2WJZB 4CWAA 5BUCA 3LXXA 3RU2A 5CBPA 1EGAA 2PJRA 3USCS 4EL0A 1O0BA 2V65A 3C39A 3VSBA 2G1UA 2OAP1 1XZBA 1IM8A 3MRXA 3K0FA 4PXSA 3RIXA 1EAMA 3VRHA 3E1SA 2GYUA 4E94A 3U44B 2JK1A 2QTGA 1KO8A 5EWLA 1T8YA 3NHBA 4KPUB 3UWDA 2DTXA 1M8GA 1QP0A 1YJ8A 3SEZA 3AF5A 2ZRNA 1ZSNA 4KK4A 1EWQA 1DUSA 3LL4A 5TX7A 2NNWB 4GZLA 2IOFK 2G7MC 3C97A 1JZSA 4DM3A 1KOGA 3D59A 1E2DA 2L42A 2BTEA 1A8UA 1B6SA 3D64A 3P26A 1BXZA 2Z95A 5DSTA 3VO8A 3KIPA 3IR5A 1HEYA 5F23A 3FBGA 4X90A 1CERA 2VXYA 2VYCA 1EP9A 4BGDA 3UB3A 2GBFA 2PS0A 4JLPA 4A26A 3EWNA 3ANLA 3TLJA 2VP4A 4ZAXA 3E9NA 2MJLA 3EVAA 4BMZA 1M2JA 4RKQA 5E6UB 3R7DA 2Z5FA 2J7PA 1BJKA 1U2SA 2FPGA 4LZOA 1SXJC 4QU8A 1MOSA 1SQ5A 3UAVA 1BJTA 3HWSA 4ENSA 3S2ZA 1YRLA 2QL6A 3VR2D 2Q62A 3OZAA 1KWKA 1KO7A 1E6LA 3RF7A 2O8CA 2P4QA 4HLQB 4DGQA 1J9GA 1IYZA 1W59A 1H0SA 1NE2A 3HZHA 4R0MA 3A58B 4C1NA 2FY8A 3CZ9A 1AK1A 3PRHA 1SHZA 3OZWA 3KBOA 3QYJA 4XI9A 5LNK6 4NJMB 1BXGB 3AFOA 3CXUA 2WU1A 2IIVA 5LB4A 3PENA 4OFZA 1RJ9B 1ABFA 3DP7A 4HQFA 4F12A 3FIJA 4JJZA 1IUPA 1NY6A 2IHJA 4WGFA 4J3NA 5SYAA 3PHHA 4ID9A 1AT1A 2O05A 4ESHA 4F38A 3OLZA 1CQWA 2HH9A 3E8XA 1JIUA 2IYZA 4R2WA 2G67A 1XOIA 1DX4A 3ZJVA 1SXJD 1FDVA 1KP3A 2O7SA 3QEOA 3GP5A 2XHZA 2JGMA 2XNDA 2G9QA 3MQFA 1P9NA 1RXIA 4XLZA 2OHGA 3UA3A 2VH2A 1O2DA 3M4YA 1NDQA 1Z63A 1XALA 4OQDA 3EGEA 4YRLA 2WIBA 4X24A 3PT9A 3SIRA 5J4YA 2RGWA 3BF7A 4NABA 4GBMA 4DKJA 1GFWA 1QV7A 1W35A 1X0VA 1DRKA 4KG7A 3UB4A 4I4NA 1Z7WA 4LX8A 2IYRA 3FUWA 3H8SA 4RH1A 4ZAZA 4O59O 4ZRNA 3L2OB 4B81A 1NJGA 5KQLA 1DLIA 2XZPA 3PQCA 4IRMA 1QIJA 3LPDA 4PLGA 3ZDYB 4QGSA 3MS2A 5DTEA 3F90A 3VJMA 5DK6A 2C83A 3CZAA 4YMHA 5KTPA 3OX2A 4RDIA 3DBOB 4E5MA 5C8DA 3ND6A 2BM0A 2J0QA 4XX0A 3ZS8A 3IEVA 1XMXA 1FBNA 2IT1A 1U3TA 2JLRA 4C0HA 3DL0A 3R3SA 1Z4MA 3GJZA 2X9LA 1T2UA 2B4RO 3FTPA 4HC4A 1PE0A 3RC3A 3ZY6A 1ZGJA 5DWDA 1E2PA 4ALIA 4BASA 1REQB 4BV3A 1BAPA 3GR6A 2JLVA 2QZPA 1QK4A 3SNKA 3KZKA 2C5SA 1QQBA 2CK3A 1V3QE 3BQMB 4CQNA 3B70A 4KGVA 3AJRA 3MW8A 1NT4A 2PBLA 4FDVA 4JYZA 4PSCA 4HVLA 4R81A 3SHTA 5AM2A 1FUIA 2ZIGA 2UUAB 2JD0A 3TXXA 2Y67A 3E6AA 2WTAA 1O57A 3L1VA 3CWCA 5CYGA 2HO4A 3K9NA 1P9LA 1A5BB 3Q10A 2AOUB 1H3EA 4X65B 1V48A 5E8RA 2LCIA 4KN9S 4FNGA 4BBJA 1R12A 4H08A 1EVKA 4M38A 2COUA 1N6IA 1T29A 3IVCA 5D87A 1WB5A 2JEOA 1T0UA 1PVDA 1A4IA 1HRKA 2Q4BA 2WYVA 3FETA 4GWGA 3NAQA 4FOSA 4Y9SA 3M6FA 5HQJA 1ESDA 4O3FA 2F3RA 4O08A 3SI7A 2HT6A 2UKDA 1RJEA 2WYHA 1O3YA 3QW2A 2V3CC 1J0DA 2BFDB 1XXLA 2XLBA 3QKRA 1V7ZA 5ULLA 1HQCA 4QOEA 2PGNA 1YQDA 3ORHA 4E3WA 4MR8B 1MRSA 4PX2A 1JS1X 3OY2A 4JEUA 5EUCA 1P9RA 1VTKA 1YR1A 3F3SA 4FJ2A 1A0OA 4BEWA 4Z5XA 4PTZA 5I7AA 3U48A 1HZZA 2QG4A 4EG8A 1HWYA 1ENYA 2VUHB 3DZFA 1UPCA 4BLPA 1OPXA 3BSYA 4N82A 2VJMB 5FUMA 4YRZA 1G8AA 3TGLA 2G07A 1D0SA 3KQHA 4RA6B 3GA5A 1GITA 3VU3A 4F5YA 2P2LA 1ZGZA 3B6MA 4WXHA 4MQ6A 5ERYA 5T57A 1HQKA 2JJ1D 3AIKA 3E7DA 3LC2O 3UGQA 3WNCA 4D9FA 3CEMA 2CYBA 2GZHA 1GCAA 3WMWA 2WPDA 5LJIA 1SELA 3P2OA 1E4EA 2AC7A 4JY7A 1YMQA 1I5RA 2AOVA 4E22A 2RHTA 4IIVA 3ZEIA 5DLYA 4HDQB 4PGHA 3OPVA 3EVFA 1FP4B 4EUSA 3EXHA 1XMVA 1FP7A 2XTZA 5C51B 1MP0A 2ZAYA 4K6GA 1HNNA 1GPWB 5AJYA 4QICA 2FPIA 2DWQA 1B1AA 3SKYA 4RZ2A 3BX1A 1RJFA 3RWBA 3UMGA 1E6EA 4I3FA 1E2LA 2ZBRA 3OFNA 4LJAA 2QM0A 3WZLA 4HNTA 2AYZA 4KRGA 2XA2A 3TW4A 5FL7D 4A6EA 2XZTA 1QSGA 1WCXA 1L1FA 4MH0R 1TQHA 4L8WB 1L5HA 4B7CA 5E4FA 1T8UA 5J4KA 1IATA 1TADA 5H3CA 4BFZA 2FZLA 4YUYA 1KIAA 4JT2A 1UIMA 5KVCA 2Z2YA 3KEGA 3GELA 4YPOA 3RRMA 1Z8HA 1U8UA 2WTMA 4FD2A 1JR3A 4NG5A 4X93A 1H8EA 2FR0A 4RCZA 3UG6A 2VA9A 3BMNB 2E4VA 1H4QA 4ZVUA 4F84A 3DS8A 3ANYB 4FGSA 4IV5A 2CLFB 2HWUA 2IDMA 4TXLA 5L45A 4C7OB 5BWCA 4MQUA 3EFBA 2EZ9A 4GMDA 4LMBA 1W5AA 1LPOA 4CRWB 4IZHA 4IHJA 3LPMA 2DWOA 2OBFA 3ZGNA 2OAQ1 4NCHA 2I55A 4YN3A 4Y6OA 4ZC1A 1KDTA 1RJDA 1JHZA 2B7BA 1EUCA 3SC2A 4X63A 4RD0A 4XH9B 2LW7A 5CA0A 1T8TA 2HADA 2OUIA 3T3GA 3U4GA 4EHIA 2WU0A 4XQ9A 5B6JA 1JN0A 3K0BA 3CNOA 4G5HA 2M32A 4EB6B 2JAOA 2J7KA 2QR2A 2GYVA 1ULTA 4BO8A 2ZLBA 5DIFA 1QGOA 4CQJA 5ED0A 1L1RA 4X1OA 1GDDA 5CAEA 3YASA 4F1WA 4XD2A 3L8DA 5HF8A 2I7DA 1L7QA 3FYSA 3ROQA 2IBMA 1UMKA 3OCJA 3X3HA 1G7SA 1D1PA 3HRKA 4NBKA 2CXOA 1Q3TA 3FKSD 3KAQA 4WJZA 2RHMA 1N1EA 1Z38A 3D3WA 5EKSA 3VPGA 3VKUA 4BO2A 1OTYA 4DNXA 4QPPA 1WVGA 4EWLA 1U3CA 2I7TA 3GGPA 3JQGB 3FCCA 1WXGA 1Z47A 3DHYA 3ZU5A 3RUIA 5E8JA 3P9RA 1XLWA 5BP7A 1GZ7A 2N1MA 3C70A 3GPDG 4FE3A 4V2UA 3HP4A 1H9CA 2NSYA 4HZUB 3QMPA 4QJ5A 2VYND 4LF9B 3MCWA 2BHTA 2ZSDA 1QLJA 1YC2A 2OK8A 4K5QA 4NJEB 4UEJA 1E4VA 1QFXA 2Q1WA 1XRSB 3CHYA 1O6GA 3UF0A 1EAYA 1ZD2P 4DYHA 1HFKA 3NHYA 1GU1A 4DUGD 4RMGA 2ZITA 2RGGA 3TM5A 5JROA 4KR2A 2XUDA 1AC5A 4WZBA 1J2RA 3BAZA 4TYPA 1TCAA 1W8IA 3QOYA 5E1DA 4FYIA 3G2HA 4KXVA 3UFXA 1R4NB 2J6BA 4EO4A 1NIJA 4JU9A 5K6TA 2QRLA 2RIPA 1B2LA 2G9UA 5IJ0B 3BE4A 4P0QB 2W98A 3KOWA 4PHGA 2C58A 4YJ3F 1YT5A 1CNFA 3AEUA 3D8UA 1DIGA 4IIJF 1G7TA 3PKZA 1ZESA 1AUQA 2P9EA 2PMKA 2NU8B 3T4EA 4DWJA 1U8ZA 2YWGA 5KCZA 1TEXA 3II6X 1SKMA 2HFKA 3PR1A 3NJ8A 3PI7A 1PJSA 1IEQA 3UHPA 5FOUA 1AX9A 3P2IA 121PA 1VE5A 2D8MA 1MX3A 5JT1A 3VJKA 4CIXA 3PXXA 3R0IA 1B0UA 1NVVQ 3TPFA 3ZCVA 1EU1A 4IVQA 2HIMA 5JZSA 5FOQA 1DAIA 1FUYB 3BREA 1D09A 2R4QA 4E32A 3DDUA 1W48A 1YHZA 3RUAA 3C1AA 2H52A 5CP8A 5AW6A 3OM1A 3UMSA 1SKAA 1GU0A 2QPAA 1M8PA 5FB3A 3RAPR 4RBNA 3SBXA 2BI8A 2OZLA 2QTTA 4KWEA 4ZT5A 5CLJA 2WY2D 1TYBE 1TFUA 3J7AC 1CV2A 4MYSA 1N2CE 1NI4A 1U0OC 1XRJA 1R0KA 3AVYA 1ZI6A 1II9A 2WJJA 3JARB 3QH4A 4I4IA 1Z2AA 5PGMA 3VR6H 1E2IA 4QO8A 2Z83A 2OG1A 2Y05A 4TTAA 2AC2A 1X7WA 3ZW9A 5DBFA 1IK4A 2PUAA 3I72A 5JJIA 1YA8A 3TBFA 1J24A 3DBRA 1TTHA 4B71A 1EXVA 4WKGA 1FQWA 3X44A 1MH1A 1Z3CA 2AFRA 3B1XA 5FBHA 4GM1A 3A9TA 4E1BA 3AL0C 2CXHA 3PDWA 1VFPA 1D4AA 2BY4A 3LP6A 5IT5A 2C77A 3EZ7A 3P1JA 3W8EA 2FETA 5L4SA 1CRQA 1VE7A 2G1JA 3GRKA 1U9YA 1ZMBA 3H1FA 5EGSA 4A0RA 1M73E 2A67A 4YYEA 3NXKA 4G97A 4BKUA 4C3UA 2OSBA 4JB2A 2X0JA 1HDGO 2DVMA 3E7XA 3F6BX 3OE4A 4UTXA 4CIYA 5CH5A 3CLRD 1R0CA 3F4LA 3SNHA 3CW2A 1YB1A 2EVWX 4BE9A 3CMMA 5TPZA 2JFFA 4DLBA 2E4WA 4DCTA 5KJ1A 1XDGA 3FJ1A 1KNQA 4YJ3B 5A4IS 3AIOA 2WZDA 4IIJB 4K6HA 4J0DA 1SVMA 4NCKA 3GUUA 4BJHB 2OCAA 3KQMA 4I6EA 4XVRA 4BDSA 4IMIB 2A7QA 2HC9A 2HSDA 3OE7D 3UG7A 4QTYA 2FQ1A 4EA7A 4Q1DA 4G0OA 1KSJA 4I1PA 3HEAA 3TMAA 1IHPA 3G0BA 2WP8J 3RIEA 2DOKA 1VRVA 1S0UA 2Y27A 3AHGA 2VXOA 1O96A 4CKBB 3R0XA 3L06A 5TB5A 2OT3B 1P91A 1R6BX 1V71A 2V6BA 1EFHA 1D2MA 1NPTO 3IMKA 3MILA 4KWTA 4LGCA 1BEZA 4NAVA 4PLWA 4RF2A 3MIZA 5BMVA 5JZ9A 1EBFA 1M66A 2WTNA 2WA2A 3O91A 4HAZA 3NBXX 1A5AB 1MCZA 1TYCA 4R9VA 3SK0A 4HNAB 1XROA 3GJ5A 5KI6A 5FPTA 1BW9B 1CPYA 1BC5A 3WK8A 4HT3B 3QLEA 3S81A 2AXQA 1ZWLA 4H15A 1SG0A 4RVDA 5DRTA 3L8MA 1KO4A 3DNFA 5ALLA 5FORA 1ETUA 1RYEA 1XCJA 3H2IA 3RM3A 3ZHYA 4MITA 1ZCFA 1U3WA 5FCDA 4ZT7A 5CCDA 2PKWA 2NV2B 1NYQA 4OYRA 2JLAA 4FLMA 4MINA 1NV9A 1QR2A 3OOEA 3UMFA 4XD7D 3QXGA 3DOHA 1OX4A 2H51A 2IJGX 1CXZA 2EFCB 3K2EA 2FWAA 2WIDA 4MEBA 1JEEA 1WPQA 3CLTC 3PA6A 4O1MA 1P2FA 1TZKA 1P3Y1 1E8NA 2QD1A 2B0JA 2JFZA 3F46A 4P86A 1N8TA 3ZX4A 4XDGA 2VQEB 3QXSA 2AG0A 4J2OA 4ESEA 4BWYA 3HBNA 1TO6A 3W05A 3IIEA 2XMSA 3E9YA 1YFZA 3ZE1B 1M8KA 4QHYA 3FTEA 2V45A 3ZGOA 2AQ8A 5CJJA 4DXAA 5FHRA 2H5JA 4JLMA 4TMXA 1PNOA 1LPAB 2PK3A 2QNIA 3TQIA 3VGPA 3VNBA 3TQHA 1TUBA 3QA3E 1GU7A 1E3JA 2GK4A 3KDSE 1AKQA 2F43B 2YIVX 3DR5A 1L8AA 4DJEC 1LFDB 5GIOE 3CS3A 3MJCA 2F1JA 5HZHA 2V1UA 2JAPA 4UJ5A 1KVUA 4NXNB 4BB9A 2FFAA 3U7EB 2FPOA 3CBQA 3NVDA 1M5RA 4A8HA 1VB3A 5HJ2A 1P2TA 1RT9A 1P4AA 2XR1A 2ZI3A 2VK1A 1XQXA 5HCIA 1G2QA 3UJBA 5JYEA 3EZNA 2FQXA 3J81A 4RK5A 2EYUA 3ZGVA 3DLBA 2P2ZA 1T3TA 2IL1A 1G5QA 3FDZA 3JYPA 2QGNA 4KLNA 5JS2A 4KN6A 3WKEA 2F3PA 4QUHA 4CDMA 3KTAA 2CD7A 3REQB 5NULA 3N05A 4DLKA 3KXKA 4RDHA 5BNWA 1LDGA 1UOPA 1O94D 1F8YA 1YC5A 3GEDA 3Q87B 4EYEA 3LHSA 2BMAA 4LJ7A 4X91A 5JSYA 5A4MS 4RFSB 1G5TA 1EHYA 5IVHA 1WU8A 4MRRA 5LBTA 5C5EA 5TT1A 3I53A 4WDQA 1SKQA 1U7XA 2WAMA 1KI7A 3EXIA 3TEJA 1M2VB 3V3KA 4EEKA 2VAMA 5BQXA 2CSXA 1A4RA 3THWA 1LA2A 4MJ3A 4FFRA 4UBJA 5L3RA 3HCNA 1EA7A 3LX8A 1CUWA 1DJPA 4IX9A 2WFAA 3S1SA 2W6IA 2EQAA 2JGDB 4Y9UA 1NN5A 1JYEA 1EFLA 1MABA 1F4PA 2CMKA 2N46A 2RC6A 3OPYI 1MIHA 2NU9B 4BUJA 5DM1A 5K8UA 1UXKA 5I9NA 2AZTA 1TMKA 2B34A 4JP1A 1SHLA 5JRJA 3AETB 2EFGA 1M34E 5JXIA 2NYVA 4QREA 1NP6A 1W0KD 2XXBA 4H0NA 2BDTA 1GL7A 1TMGE 1GFIA 1D1SA 4HYQA 4M2LA 3B5IA 1RIIA 3C6KA 3PQ7A 1RI3A 4PYLA 3KVRA 3L0DA 4D02A 1JA9A 3ET5A 4OP2A 5TE9A 2WABA 4AWBA 1P2BA 4XWAA 2NUBA 5CB4A 3RRZA 3U4QB 3C48A 2VF7A 1C81A 1QTIA 1MB9A 3D0QA 1R15A 3F6CA 3N2ZB 4O4LF 4R9SA 2FW1A 3OAAA 3QX9A 2QMQA 5A7FA 1XA0A 1SA0B 2QE7D 4UFPA 3O4GA 1ECFA 3AEQB 5LA6F 4BN4A 3E2PA 4ENVA 2OXFA 4Y0AA 2ZM5A 1I9GA 2JJ2D 1TC2A 1HYEA 1ZJ6A 1DIAA 2FLWA 4L2IB 2PBFA 4J3FA 4LXGA 4LYGA 4QDTA 1F06A 3E2MA 4HEHA 3UAGA 1KEVA 1OH5A 2QK4A 1SPXA 2E9SA 2B1GA 2WYOA 4PRLA 4MVJF 1TB4A 4J94A 3H19A 4XCXA 5IT4A 3Q8MA 4QAQA 3PPWA 3PC4A 4QNRA 4I0WB 5AK0A 3RIHA 1Y8ZA 5JCJD 2V1XA 3OQBA 4LYAA 4A73A 3FFWA 4ESOA 4U6SA 1BEUB 2GNPA 1EQUA 4WOCA 2K87A 4UUOA 2A8YA 3JVIA 3UT0A 1YNSA 2GTHA 2AV6A 3DAYA 1NATA 2DLCX 2EX1A 2CHVA 1ADCA 1NW4A 4HGOA 4LDPA 2P6UA 5E4JA 4OTZA 4NCNA 4ZQCB 2V8BA 5JI3E 2FZ5A 3IQIX 1L6IA 4LV8B 1E8DA 2IPMA 1U9IC 4NK4A 1GNSA 4HMPA 4PQYA 4IAOA 4INJA 5DHUA 2HEGA 2RK3A 4GKAA 1ISPA 3SQNA 2WM8A 3JALA 3SS8A 5LB2A 4JENA 4ZV7A 2JAXA 3GNLA 3TLGB 1ZW6A 4DPLA 2GKGA 2ZROA 4B2YA 1I7SB 1DBPA 3LQYA 3WIEA 5EIBD 5AIBA 1DTWA 4OIMA 4KXFB 3UGJA 4A8PA 1HTWA 4KO3S 1HE1C 2OAGA 3C3MA 1ZVVA 2ZR8A 4DEVA 1ZN9A 4RFVA 1XYVA 1ELOA 4WADA 2D6FA 4P4TA 2XOXA 2OHXA 5CYPA 1P2GA 1N6HA 1F8UA 2ODWA 3D4OA 4PBSA 1P7YA 4XARA 5K1ZA 4TTVA 4CM7A 3IMFA 5CVTA 5JY1A 3DC7A 1USIA 2OCPA 1K89A 2ZS8A 3HXPA 5DOVA 3PYMA 1KJ9A 2A7XA 1BCRA 3EZGA 4WZ6A 3A3PA 3ZE9A 2CFTA 1X1AA 3CT4A 5AUNB 3O8QB 1Q84A 4WL0A 2V5AA 3RW9A 2CFCA 2PD4A 2QN2A 2CEAA 4DRYA 5H5JA 1PT6A 3C85A 2I3GA 4KPYA 1MO4A 3F8TA 1UZMA 2W8BB 1DAHA 2I4MA 3A3NA 2X0FA 5BN5B 2Z3ZA 3TH5A 5LA6B 1E1RA 1FFXA 3BTVA 3NKVA 5ALWA 1AIPA 3V4RA 3DKKA 3ZVMA 2LXNA 3RRJA 4J0EA 4BLQA 1S2LA 1KYZA 1QZTA 5F5NA 3KEOA 1E3WB 3R6LA 1JBKA 4I8DA 4NZYA 1MOQA 5EYPB 4PVCA 5EXXA 5B1HA 3U81A 2GJKA 2P9FA 1MTZA 2X0KA 3L0IB 1CUEA 4F3CA 4WY8A 3HJHA 2VTBA 3V4VB 1ESCA 1FUEA 3G8DA 4CR7A 2O1SA 3NJ4A 1RCFA 1HGXA 1T5TA 1LH0A 2F1IA 1RLTA 3HA5A 1A2BA 1W49A 2AI1A 1RCUA 1WMFA 2GAIA 3ANTA 3QV1A 4HI0E 2PPLA 1RMQA 3LUHA 1UBTS 1V41E 1X8LA 3EQ2A 3HV0A 4HTAA 4A5SA 1Q0RA 2WOOA 3G2LA 3DO5A 1CETA 3H05A 4J90A 1UMCB 1UDWA 4ZO7A 3G0DA 5B3AA 1NT2A 2HU7A 1KORA 521PA 4F71A 3TMKA 2XDQB 1XA4A 1ZISA 3GVXA 2YFHA 4MZDA 3ECCA 3T4XA 1BD3A 1JG6A 1TVCA 3EGDB 1T1EA 4QHTA 3FTDA 4HUJA 4W8GA 4ZHSA 1EBBA 4RIIA 1B8UA 1J56A 1NTOA 2GN8A 1JEYA 2FFRA 1LV7A 2ODPA 4X41A 3WE7A 3TSCA 4Y2SA 2I2XB 3K92A 5KTKA 1FU4A 3I6IA 4PLFA 2YDXA 3UMRA 3PE3A 4YUAA 1ZITA 4L95C 4WXPA 2JIZD 2XA9A 2GB4A 4HQOA 3VH2A 5ELMA 1ZUWA 1Z5VA 3CJQA 4H7EA 4K26A 4YRFA 2RH8A 2IS2A 3K3PA 3OZRA 4AECA 2GA9A 1YVPA 5HZMA 3IESA 4TSFA 4D0NA 3DLPX 5C8YA 5CEFA 1E1KA 1DKNA 5HKKD 4F3TA 1XSEA 4ARVA 4C6TA 2Y77A 5AM4A 2XQIA 1TJ5A 2D8AA 1RLMA 3UMYA 2W9XA 1FTGA 3V8EA 1IHOA 1RZ3A 1E2QA 3LVFO 3OU2A 2EV9A 2QROA 2V9PA 4JLAA 1LCIA 1P4SA 1JFRA 3GVHA 4QUAA 3QFHA 3I2HA 1D0VA 2NIPA 5B5SA 2BGKA 1XKQA 2C9DA 1TQ8A 3ZWPA 2VPIA 4P84A 3E5MA 1RSZA 5D3ZA 1O5OA 4AY6A 1LLFA 3D3EA 1MFPA 1X1CA 3S0JA 5AW4A 1T2FA 3FBWA 4W6QA 5KJCA 1VDMA 4JGGA 4MZXA 2A0UA 2FAXA 1R8SA 2ZU0C 2Q21A 1YR3A 2FZ4A 1E66A 1R0RE 4ZU1X 1GILA 1G5FA 2OBBA 3R23A 1X7ZA 5AI6A 9LDBA 3FYCA 4CQMD 1R9GA 2VNHA 3KJXA 3H97A 2Y99A 4F04A 4R83A 3QUTA 3AVXA 1CZHA 3DC2A 2DJIA 3R5SA 5EHQA 4V3CA 3CVUA 1TUIA 1IZ7A 2DMRA 3FZQA 1N7JA 3LT4A 5FI0B 1IDN1 3BD7A 4DLLA 5EP1A 3IPXA 4NARA 4AZTA 1XP8A 2O2IA 3PP8A 1JPUA 5LU8A 1DVRA 3NX4A 1G3QA 4IUBS 4QFCA 3LTEA 2PWBA 3TTVA 4PFQA 5ALJA 1AS3A 4W1RA 3UK2A 3V7YA 2PA0A 2VK4A 4TTJA 1KDZA 1ODIA 1KAQA 1E3TA 2HOQA 2YJ4A 5TGTA 1NYTA 1CU1A 4PZYA 1RMYA 4M1WA 3RBZA 3SKXA 3O3OB 2QTVB 4R0VA 2XSZD 4XQCA 5TQ2B 2O0MA 4FOPA 4UHDA 1N57A 4Q7EA 5K0NA 3UWKA 1I2CA 2A5JA 1MXHA 4HDRA 5FOVA 3R9XA 4MUAA 4O0LA 2WTBA 1QCCA 1M10A 1N0HA 4LAFA 4ENUA 3IOCA 1R8JA 2R1UA 4Z7QB 3T12A 1H65A 1OLUB 1R4MA 1Z4QA 2BGIA 5IULC 5E7QA 4M9ZA 3RQIA 1E92A 1P6XA 4BVEA 4YLYA 3K1AA 4P3XA 1PKXA 1VDZA 5A4KA 4P93A 5E4YA 1SCQA 4BB6A 5FL3A 2QX4A 4EBBA 1CDZA 2C8JA 3GJ4A 1AZSC 1Y4DE 3NALA 2QR5A 1BEEA 2VR1A 1H8HA 3QVJA 3OP4A 1XQWA 1H05A 1YGYA 5IWCA 1ZLXA 2RI0A 1OUMA 2J0UA 2Q5OA 2BLLA 4OX9B 3GRPA 2GARA 1ICIA 4QQNA 1AGPA 4OAOA 2KX7A 2OORA 2ECFA 3ZV6A 1YZQA 3N70A 1I1NA 4M1EA 4CM9D 1P62B 3I61A 3RVLA 1JT2A 1MZVA 1ZD4A 5EHGA 1JXOA 4TOIA 2HQ1A 1TKCA 2WHYA 3KR9A 1XEXB 4S1OA 3RS4A 1WF6A 4BP1A 4LJ8A 1N6OA 4O33A 4Q3KA 1KQNA 4TQ9A 3EZYA 1ECLA 4G1BA 5HJEA 1EFUA 1P73A 1Y1KE 1YDMA 2BZGA 3KWFA 1BA3A 3D8RA 1KE1A 1YRAA 4PHFA 4DG5A 4EI2A 3IV6A 1Z83A 1LSSA 3M5DA 1G21E 1OSNA 1RNLA 2YS7A 3ZN2A 4JYCA 3N3BC 1K5HA 4II7A 3G8YA 4RJ2A 1GPUA 1B6RA 4NBSA 4UBLA 2R9VA 3VR6A 3UMJA 3GFOA 4MPDA 3KB1A 2IU0A 3BXFA 2XAUA 1S5PA 4EW6A 4MV0A 1XTUA 4REMA 1OZGA 1SZCA 4WKNA 5DI3A 3VPHA 2PZGA 3UQYS 4B34A 2XBMA 5L7YA 3IXMA 1RVDA 1N1DA 2BUAA 2O2CA 2Q9UA 2QMEA 3FZEA 4CCAA 4AI6A 3R3UA 3TSZA 4DCPA 3BFJA 2GAOA 1KXJA 2I7CA 3HB9A 3Q98A 4MI9A 5C4GB 3E27A 3LIPA 5H3LA 3FMPB 4MUJA 1N6NA 5DYYA 1ZCJA 1F1BA 1JA0A 1SIWA 1QAOA 1AMUA 3WNVA 1GQYA 3F8WA 1WP4A 1EX7A 3TUJC 2D2XA 3RQSA 1HTTA 4G0QA 1JQAA 2PLAA 1QUFA 2DUMA 4QSHA 5LXTF 2WYWA 1KMQA 4N0DA 4XWKA 5F98A 2FZVA 4H7DA 2BJVA 4KE6A 5EP4A 5HDQA 4LVUA 3JQ9A 3PXEA 1GPMA 3ZDXB 4BV2A 5TQJA 4D44A 1DIRA 5CFLA 2D5BA 4MQFA 1D07A 3O4VA 1OW3B 3Q3EA 4C0XA 5IZCA 3MINA 1HZZC 3UT5A 2QTFA 1C9EA 4RTQA 1E7MA 3EIOA 5J1SB 1R7RA 4UFNA 4NQZA 2CXRA 4F4JA 5JCOC 2XRYA 1ST3A 2A30A 3AG5A 2II6A 3GA0A 3KKQA 3LV8A 4A4DA 3BT7A 4C22A 4F2WA 4OX9Y 1M8FA 3RC7A 1H23A 3BDAA 3TX6A 2HMSA 1J25A 2ID8A 3E9ZA 3WAKA 4CGYA 2KLHA 1T43A 3HR8A 3M6WA 5LZ9A 1C30B 1FL9A 3GGGA 3KLOA 1G8YA 1GNQA 1MNQA 2FW0A 2GPBA 2VVTA 4K03A 3WLOA 2ZIVB 4IGAA 1H85A 1OKKA 4BVKA 1V11B 1DT5A 2H1HA 1NXVA 1YZFA 2OP1A 3NYRA 1UEIA 1UANA 4KB5A 4OU4A 4NICA 1F38A 4TTQA 3F5SA 2GT1A 3EEQA 3RU7A 1M72A 1UOQA 3EXHC 3M34A 1J5EB 1C50A 2G4VA 1FX0B 1YHNA 2YBDA 4DV1B 3WL7A 1FPQA 3SAJA 2JFXA 1MC5A 3EH1A 5A5DA 3ODPA 3P9PA 1T15A 2Z1DA 2WP0A 3EWAA 1KZGB 2BFCA 4PN7A 3PU6A 3L4KA 4QEKA 1PW5A 1NQ5A 3GUHA 1QF9A 2H00A 2UVDA 5GGXA 2GBPA 4LWOA 4M86A 2VDQB 4WINA 3TJZA 1TJ4A 3TKYA 2OCYC 2VRCA 4F4DA 3G5TA 4H0CA 2JGNA 3OU6A 1QFSA 4E6PA 1Y8QA 3VZSA 5IMSA 1OLSB 2QGZA 4K1XA 3OT1A 1GKUB 2CZGA 3IUQA 4X20A 3T15A 2YYAA 1ULAA 5E2IA 2HDHA 4GYWA 4J0CA 2V5UA 5K8CA 1H2AS 2ZYTX 1S2NA 5K0LA 3W5AA 3A4MA 1LNSA 2QYTA 2WB4A 4DY6A 2X5OA 5LXTB 1WCWA 4P32A 3ZOZA 4REQB 2A5LA 5EP3A 3MUNA 5BXYA 5I7UA 1X8KA 3JWPA 1MJGA 3G9ZA 4G9EA 3F4KA 3F96A 4JV5B 4FGZA 2VJYA 3MFQA 4FYHA 2Y4OA 3DTVA 4IR7A 2PCJA 3EVNA 3H1EA 3LZCA 4KBYA 5AR1A 4F3NA 5C80A 1I0LA 4M0KA 3P27A 2AC4A 2HSGA 1QO9A 5C31A 1RAEA 1NG1A 3G82C 3H5LA 2GK7A 1BWQA 1E8MA 4M9CA 3AQ4A 5A2GA 2N42A 4M7WA 1RYHA 1LW7A 3RWOA 3TL3A 4BZQA 1MB2A 1H8ED 1ES9A 3QF4B 4EDFA 1KVTA 2C4VA 4LSZA 1P2VA 5COBA 3FSGA 1WU7A 4R01A 3WL5A 1F51E 3EA5A 3MXOA 4LDAA 4UVDA 5FRDA 4HWTA 3V8PA 4DLRA 5JNSA 3PX7A 2E49A 1NJFA 2WC1A 3DEJA 4WLEA 3ZK9A 2BONA 4YDRA 3WFJA 4CTKA 1PQUA 3ZIUA 5FD8A 1YK0A 3PWTA 5D1HA 1B4DA 3DD5A 1R18A 2HDNB 3HFSA 3MPUA 1TLTA 5IVPA 1TDJA 4F9TA 5K0ZA 5LQKA 2H4FA 1MC4A 2W58A 4M8SA 3TO5A 1SKBA 2YY7A 2QXUA 1THZA 2CFOA 2RGBA 4XSVA 4B8WA 2YWFA 4CKCB 2X5XA 4EARA 4ALLA 3LCMA 5JRZA 1NM5A 2R8PA 2PR2A 2V7QA 3JCZA 1S02A 1X2BA 3LUKA 1DDIA 1ICEA 1SHTX 3PXDA 4LRUA 2WK1A 4CT0A 3TE6A 3LYAA 5F9MA 2DFTA 2Y2VA 4BVAA 4DJAA 1TCVA 2XGSA 3T7IA 4FFMA 1WB9A 3CCBA 4TZ0A 3MMZA 3MBOA 4JUAA 4RESA 1VKNA 1WLYA 1AV6A 2VDMB 2DUNA 1CS4C 3RCBA 5KSWB 2XBUA 4NBWA 4UUBA 4AJ2A 2HJWA 1YB5A 4YHBA 4M8NE 5AHWA 4BMSA 3IOBA 3HDTA 5K99A 1Q2XA 3GUCA 2ZIWB 3V6MA 4AJOA 4D80A 2ZRKA 2QD3A 3PJEA 2XD9A 5IJAA 3UMCA 1V4NA 1Y8RA 3AQIA 4J7AA 3VR4H 1N0WA 5IM4A 1DQPA 3RFTA 2KBEA 4DQXA 5K20A 1Q1ZA 3ND8A 4MAMA 1OAAA 4BP9A 5DM60 5JYDA 2OOKA 2X0RA 3AHDA 3COWA 3TAXA 4CUZA 4BS9A 4CLRA 2RH5A 4IJKA 3TSOA 2UUCB 3KYJB 4MKIA 1CB7A 1G291 3PVZA 3ZQJA 2XWBF 1XZJA 1SCUA 4UEWA 4BFWA 4LHWA 2UZAA 3IRUA 1HDXA 1JJVA 3HEBA 5DISB 4EHKA 4GBED 2PBRA 3A2LA 3O21A 5KVVA 5JTTA 3D2AA 4KQWA 2NU6B 3PXGA 1RU3A 2IV2X 1T0HB 2FN3A 2ZSBA 3GAFA 3V2UA 1IIBA 2ZE6A 1N1GA 2JFGA 4BVHA 5ERGB 2A59A 1NKSA 1VG1A 2GBGA 2PCLA 3OJLA 2MDTA 2ZREA 4OQZA 5CW2A 5H1YA 1RS0A 5F1OA 4R40A 4TKUB 3IFSA 4TV9F 3CRZA 5BW4A 3NBYC 1AGXA 1OR8A 1M1YA 1P4GA 2ADFA 2DTEA 4C30A 1KJYA 2OHHA 3N2GA 3OWHA 4WN9B 3U6KA 4NCBA 3B1VA 3MFYA 4HVTA 5FYQA 5B4UA 4XOIA 3A2KA 5EIXA 3AZOA 3HVJA 4G5QA 4CLOB 2EL9A 2Y93A 2ZTMA 5DGTA 1J2EA 2AEEA 2XVXA 4QPNA 1C4OA 5MN6A 1I4DD 3I2FA 3QVLA 1TLFA 1RIFA 3L8YA 3FD8A 4PPGA 2PQ6A 4MHTA 3M6VA 1NWHA 3HR4A 4BKRA 1O8BA 3FZGA 1VMKA 3V7UA 5DXJA 4UFOA 3Q3CA 2AN3A 3QA9A 3IB3A 3HACA 3NNSA 2Y76A 3AF2A 5SY6A 3AF3A 3WGNA 4EG0A 1A7AA 2ZQZA 2BBTA 4FKZA 4MSUA 1OFIA 5ALEA 3RSFA 4DDTA 2V59A 4UD2A 3KQKA 4MPPA 1APBA 3TD2A 4DRXA 2PMFA 1GL9B 4G25A 2AB0A 5I7WA 3ZNQA 2Z8ZA 1EDBA 2NZYA 4QRDA 1K98A 1U2ZA 3H9JA 1GADO 4MQEB 4TL7A 4UDYX 4X1YA 2ORED 3WTCA 1KIFA 1V8OA 5JPIA 4URUR 1J33A 2GOYA 2P5UA 2ODAA 1IZZA 3MJSA 3P0RA 4H7KA 4LIPD 4OGGA 4W8HA 5EJFA 3TL2A 3CVWA 2I1QA 3ANXA 4GLJA 2HO5A 5BVGB 4M0EA 1U8YA 2H31A 2I1WA 2GZ1A 5DKFA 5BSRA 4LK3A 3OQNA 1U99A 1U2QA 2PN1A 5HFAA 4EX7A 5K0CA 2RGEA 4O4IF 4ZKEA 3WQSB 2UYQA 1VKHA 1W5BA 3U61B 4HLDA 2XI4A 2B3TA 1CZRA 4TMVA 3ESAA