1SD1A

Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
268
Chain Sequence
b'AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine phosphorylase
molecule tags Transferase
source organism Homo sapiens
publication title Structural Comparison of MTA Phosphorylase and MTA/AdoHcy Nucleosidase Explains Substrate Preferences and Identifies Regions Exploitable for Inhibitor Design.
pubmed doi rcsb
total genus 93
structure length 268
sequence length 273
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sd1A00
4D9HA 4F1WA 4TXNA 3F8WA 1B8NA 1K27A 4M3NA 4YJKA 5CCDA 3SCZA 1Q1GA 3P0EA 3FUCA 4RJ2A 4L6IA 2I8AA 3E0QA 1Z5PA 3NM5A 2QPLA 1SJ9A 1V2HE 3OZEA 4UC0A 4DAOA 4DABA 1WTAA 5F77A 2GUWA 1RXYA 4QATA 4G8JA 1U1DA 4KN5A 3DF9A 2H8GA 4G41A 4OY3A 5FAKA 3PNSA 1U1GA 3NBQA 2RJ3A 1VFNA 4YNBA 2OXFA 4DAEA 1PWYE 1CG6A 3E9RA 3QPBA 4MCHA 3EUFA 1I80A 1JDSA 1RXUA 3KU4A 1OTYA 4LNAA 5DK6A 2BSXA 1TCUA 4U2KA 3INYA 1T8SA 2AI2A 4MARA 1OV6A 4GLJA 3D1VA 1TD1A 2AI1A 1M73E 3T94A 5EUBA 1N3IA 1PBNA 4F3KA 1T8WA 3FOWA 3C74A 3EMVA 4TTIA 5EFOA 1OTXA 1NC3A 1RT9A 4TXJA 1RXSA 3NM4A 3KHSA 4BN0A 1V4NA 3FAZA 4R31A 2XRFA 3E9ZA 2I4TA 3UAZA 3KUKA 3IEXA 4OEHA 4DA8A 5CXSA 2AI3A 3DDOA 4L5AA 1NC1A 4MCIA 4TXHA 4WKNA 1ZOSA 3UAVA 1JP7A 2QSUA 3O6VA 4NY1A 5F7ZA 2PGAA 5F73A 3UAWA 1ECPA 5F78A 3U40A 4DANA 1PR1A 1V45E 1JPVA 1SD2A 4YO8A 4F2PA 5C80A 4D8VA 1YR3A 4OJTA 5B7NA 4F2WA 1RR6A 5F76A 4OF4A 3PHCA 3DJFA 4NS1A 3MMSA 1RXCA 4R2XA 5JPCA 4L0MA 2HWUA 1K3FA 1TGVA 1OVGA 1Y1RA 1K9SA 1ULAA 1V48A 1XE3A 1G2OA 3TL6A 1PKEA 2OECA 3DP9A 4K6OA 1A9QA 3OPVA 4TS9A 4TXLA 3KVYA 1JE0A 1U1FA 3ENZA 3GGSA 4BMYA 2HSWA 3BJEA 5CYGA 2OC4A 3BGSA 1U1CA 4TTJA 4DA7A 4H1TA 2HN9A 1ODLA 4FFSA 4L5CA 2P4SA 5ETJA 1JDZA 2ON6A 1LVUA 1ODJA 5B7QA 4BMZA 5F7XA 1U1EA 1OUMA 1Y1TA 3OZDA 3K8OE 4PR3A 1Z35A 1Z33A 1T0UA 3LGSA 3K8QA 2A0YA 5CXQA 1B8OA 2HRDA 3PNPA 1CB0A 4TTAA 3IOMA 1VHWA 2B94A 1PR2A 3LA8A 3UAYA 5CYFA 1C3XA 4X24A 4ECEA 1Y1QA 4JWTA 4F3CA 1LV8A 3EUEA 2QTTA 1PR0A 2IQ5A 1Z36A 4LDNA 3OOEA 4TYMA 3DPSA 1PW7A 1A9TA 1Z5OA 3OOHA 1YRYE 1NW4A 4QAQA 4NSNA 1PK9A 4LKRA 1JDUA 4PNPA 5F7OA 2A8YA 4TS3A 3OCCA 4GLFA 4P54A 4QEZA 3FWPA 4JP5A 1VMKA 5F7JA 4D8YA 3MB8A 1TGYA 3OZBA 1PK7A 1V41E 4EB8A 1TCVA 1YQUA 4DA6A 1V3QE 1ODKA 5IU6A 2Q7OE 4TXMA 1YBFA 4M1EA 1A69A 1PR5A 1ULBA 1PR6A 3EEIA 4L5YA 1ZL2A 4OGKA 4EARA 5IFKA 3OZCA 4I2VA 1RFGE 4YMLA 3PHBE 5KB3A 2A0WA 4D8XA 1A9PA 1Y6RA 3O4VA 3KVRA 2AC7A 4G89A 4BMXA 3FNQA 4DARA 4QASA 1FXUA 1YQQA 1Y6QA 4DA0A 3ONVA 4QARA 1T8YA 1Z39A 2ISCA 1RYZA 1SQ6A 4IP0A 2QTGA 1PF7E 1RCTE 1JYSA 4LNHA 1A9SA 4JOSA 3UAXA 4WKPA 1Z37A 1Z5NA 1PR4A 2OC9A 1LX7A 1A9RA 1A9OA 3NM6B 4R2WA 1Z38A 1SD1A 2QDKA 3UT6A 3FB1A 3LBAA 1VHJA 4WKBA 3ODGA 4WKOA 3OF3A 1Z34A 5CCEA 4GKAA 5B7PA 4OGLA 4E1VA 1JDTA 1T8RA 3P0FA 1QE5A 4QFBA 4WKCA 5B7GA 5I3CA 3GB9A 1RSZA 5EPUA 3BL6A 3BSFA 4D98A 1JDVA 2A0XA 1Y1SA 1ODIA 1OU4A 5K1ZA 3KVVA 4LZWA 4GMHA 4M7WA 1JE1A
chains in the Genus database with same CATH superfamily
4KB5A 4QQNA 2NADA 2GBLA 2PM8A 1XZGA 1D2MA 1KYIA 2O4CA 1TL7C 2P27A 3TVYA 3VC7A 1A50B 2HPZA 1V9LA 4LRWA 2JZOA 1CY1A 4BKRA 4IVQA 2NTEA 2BFFB 4AUKA 1MG5A 2O2ZA 3RUHA 4DCGA 2Q5OA 2H06A 2MINB 3CUWA 1T0IA 1QPGA 1LNZA 5EQJB 5HKLA 4RTPA 3GMTA 1MB9A 2J3HA 2XA9A 3QMMA 2A7XA 2AOUA 2AXQA 2LW7A 4Y6LA 2I2XB 5FO1A 4S1WA 1EDDA 1D04A 4UE2A 5AVXA 5LNK6 3OWOA 3M33A 4CU5A 2YVKA 5CR9A 2JFYA 4TUYF 1HR0B 4TUYB 1N9GA 4IQ0A 2Z4RA 2WJAA 4ZC1A 2IHBA 1BKSB 2H08A 1Z0UA 4X1YB 5JY6A 1C0KA 4JJ6A 2AF4C 4RL4A 3DGEC 4F96A 1ARZA 3JPWA 3I1YA 2J7PA 3UJHA 4C4YA 1YC2A 3ZZNA 2O19A 2CXOA 4J4TA 3TDKA 3ADOA 2EFCB 1MQAA 3S40A 3UB3A 1VFNA 5BOSA 3EIWA 1DWQA 1A4RA 1GTG1 3G5UA 5AW4A 4P0TA 5EZYA 1M76A 2V55B 4GI7A 2E6KA 3TTVA 3V7FA 4U3JA 4C29A 4CIWA 5CA1F 3Q9NA 5CX1B 3WA6A 3S1SA 3AETB 4O4JB 3EEOA 3BRWD 1P74A 2B4AA 3HVHA 4JL8A 4RKRA 3CPJB 2B9VA 2CKDA 2IXEA 3DG9A 3ENWA 2ZG6A 3ISJA 3NORA 3OX1A 4MP8A 2GTPA 5JZBA 4LF4B 2C77A 3CF4G 4B4UA 1YJBA 1FS5A 3ZBPA 3B20A 2JHGA 3B6MA 1JLHA 1UADA 4KQ9A 1ADBA 1SB8A 3HZZA 4NJMB 4C5BA 3HXOA 1YACA 3FZQA 1EHYA 1JLKA 1C9KA 1RS0A 1X7WA 2CL6X 1FQOA 2NU7A 2Q9AA 2ZE6A 3INYA 3KEFA 4M1QA 4OXYA 4GE0A 5M7EA 4Z4QA 4PZ0A 1OV6A 3CW2A 3GD5A 1TD1A 1BU5A 4IXNA 2IHTA 1QV9A 4RU1A 3S70A 5L3QB 1JL3A 1XU9A 2A5JA 5CFLA 2VP0A 5HJ5A 3EEQA 1YS1X 4PSDA 4WDRA 5JOQA 3DAYA 4O2AB 2PKEA 1L1EA 1AS2A 2X3YA 3QPDA 2CDAA 4QGAA 2BV3A 2FX2A 1VB5A 2C1EA 1GFSA 3GFBA 5B6PA 3Q8LA 4BZXA 2UUPA 2ZSUA 2PUFA 3N3AC 3JAMA 3CZQA 4GLLA 4QAJA 5BUQA 3SS9X 4BIIA 2UZ1A 1IQUA 1NLMA 2ID9A 5CVEA 5ESXA 2ECOA 4C0KA 2R3SA 1W5TA 4R5MA 3MAGA 1O6BA 2ZBVA 9LDTA 1U0BB 3U62A 5D1NA 1KVQA 1E92A 4MV7A 5HOQA 1ZPDA 1LLQA 4DA8A 1JJBA 4WBNA 2Q21A 3DDOA 4PEVA 4HV4A 1LGYA 4XIFA 5B4TA 3H8VA 4G24A 1GNLA 1UMDB 1AB5A 3NX4A 2QUHA 4MQLA 1Q0ZA 3CURA 4N0QA 5G3ZA 2RMKA 5J43A 2V65A 2IHYA 3F1KA 1Z56C 2B36A 2DP4E 3BGWA 3JALB 3ETGA 2P78A 3UKDA 3UOWA 2PLFA 3ZKWB 2XECA 1JG6A 4ND3A 5NLLA 1F60A 2Z98A 2LWIA 3IP1A 3BDVA 3RUDA 2IUTA 2PKWA 3LCCA 1K4YA 4DDHA 1C1XB 3PQDA 3K9LA 1QXSA 1MQSA 2FMIA 4C7BA 4ZVPA 3H2HA 1YBAA 2FSHA 3HYSA 4B17A 2PGAA 5ITZA 3KQNA 1PNRA 3IMFA 4UD6A 4PZLA 4OSOA 1ECPA 3DLBA 5D84A 2HB6A 1Z6PA 4BO8A 3GAZA 4DDMA 3JRWA 3OT1A 2O2SA 3INNA 1CQIA 3N2GA 4OQNA 4EMUA 2CBXA 1XZFA 2V9ZA 2V7QA 3JWPA 4DY6A 3EZ6A 1KQFA 3CWQA 2J4DA 3MRTA 4NJEB 3QVUA 4KXYA 1YR3A 4AZ3B 1WSWA 3O7WA 3VXKA 2FZ4A 4YRRA 4DV3B 1RR6A 2EGGA 4M0UA 2X2EA 4R8KA 5JMPA 1L5ZA 3QBTA 1M0EA 3EISA 3YASA 5EP3A 3H9QA 1KC1A 3P2MA 3KTAB 4AZWA 4EEXA 5K0TA 3E3OA 4R2XA 3WYFA 3CUSA 1SHZA 1CY0A 3IXQA 4JBWA 1GAWA 4RY2A 1QOZA 1AZWA 3ITDA 3SS7X 5B4VA 1JT9A 3S2IA 1MEOA 3FXAA 5GONA 4DBLE 2JK0A 3DE5X 4O0LA 3IOYA 4PCVA 5H4HA 4UULA 3RBAA 3BFJA 1U80A 3SQNA 2R9VA 5LBIA 4XR9A 5EE0A 4IUCS 1ZZEA 2BLNA 4ZOAA 1N57A 1NJSA 4MUGA 2VSOA 4IS3A 1RVDA 4IIJA 4Z1MD 1BX0A 2B6NA 2Y2UA 3ANLA 2BKAA 2HNAA 2OGTA 3NAGA 3W05A 4CM8A 4JZKA 1UWCA 2W6PA 2GUGA 4YT5A 1KJ9A 3AU9A 5KNBD 2QT0A 4QXQA 3UJCA 5SY6A 1E2PA 2VYND 1B76A 2JAWA 1EGHA 4DQDA 4B85A 5G1NA 3RVPA 4BC1A 3SC2B 4OXIA 3SS8A 5CFPA 1IQPA 1OH6A 2PWPA 5CT5A 4RM2A 2Q5EA 3VO2A 3KVYA 4HMOA 2UDPA 1T4DA 5KWJA 1CDOA 4GU5A 4JFAA 4L22A 4PHTA 1RJDA 2B83A 4B3MB 3CZ4A 3PD7A 3QWHA 3IIKA 3KETA 1KYVA 4QBKA 1PG2A 2VQFB 1I7PA 4PXYA 2Z83A 3HLYA 1SR8A 1VE3A 5KTPA 8ADHA 2QM8A 3QNMA 4KKXB 5GGYA 3BJEA 3L0PA 4LC0A 3RIEA 4CT0A 4ENWA 2WFMA 5LQNA 4K6KA 2CN1A 1M2WA 4PWYA 4FHZA 4UAUA 5HCIA 1QVVA 2RC6A 4MI6A 3SM3A 1QQ6A 4CR7A 2R6FA 4QD3A 3R6WA 2Z5VA 3LBIA 5HS4A 5BV8A 3VX3A 3HVKA 3HYLA 2P4QA 1JECA 2VOEA 3CBGA 4WNCA 1ACMA 3DWEX 4MV4A 3CLKA 4H1TA 1AKEA 4MRNA 1UF9A 3FSJX 2YNMA 3K4PA 3U09A 4Q9LA 1CIJA 4D4LA 1VJ0A 3GLIA 4H0FA 2RCNA 4ZO4A 1XUOA 4S35A 2OZEA 3TZHA 3C4JA 1L2TA 4HDSA 1T2EA 4YY3B 4RESA 3LQ4A 1DQPA 4E0BA 3ROMA 1QFJA 5EHGA 3AWDA 4HYQA 2I7TA 3TNLA 5AVWA 1CEYA 3O1IC 1V71A 4L2IB 4N5MA 3E9CA 4BFSA 1U2GA 4TYYA 5B6JA 5A0TA 3KALA 2CY0A 4ALKA 4V03A 1US8B 1NN0A 4W8OA 4J7XA 4EX6A 4UNQA 4B6EA 3BXHA 1YS7A 3KAPA 4KDEA 4BEWA 3BK7A 1EX1A 4XGRA 4G0ZA 3SJZA 2R7AA 4MR9A 4QE3A 1G18A 1XAHA 2FSIA 4DFDA 1NMSA 3E3NA 1YCGA 2YS7A 4XOUA 1P80A 5THXA 2BFNA 5CD9A 3B1FA 5G0UA 3WLNA 4BOYA 4M4SA 3WG9A 1VHWA 5CH5A 1ENZA 3PUYA 4G5OA 2PR7A 3RYFB 1U3FA 1U5BB 3LYAA 1RRCA 2QOEA 1VMAA 4H15A 5J63A 4D5EA 1E7MA 1JR2A 1CVRA 2R7MA 5KJEA 1TJYA 3D3EA 3HI6A 2H6EA 4BVLA 3JY6A 1ZH8A 4Q7KA 3GAAA 2RONA 4E4RA 3D3WB 1Z0IA 3TSOA 1CX9B 2EEPA 2HCRA 4Y9UA 3WLIA 1XKQA 3NIDB 3M6FA 3QU2A 4JI8B 3A2KA 1KEEA 1X9IA 4AZ0A 1F9AA 2ACWA 1M2JA 1ZGHA 1ZC4A 1VJRA 4U5XA 2BCEA 5EAIA 1WR8A 3E7PA 4OI1A 1P5FA 3LX6A 1V5GA 3OOEA 2EV9A 3BH6A 3FDFA 3DCNA 3FNBA 4RA6A 1JQ5A 3VPSA 1RM4A 4D3DA 1RWNA 3ZK9A 4GKKB 5LWQA 3CNEA 2O3SA 3A6LA 3FOZA 2G8NA 4U7FA 3P5BA 4LWPA 3A04A 3DTVD 1A7UA 1Y8CA 1EQAA 3DUFA 1RKBA 4DLKA 4RZIA 4GO1A 4DLAA 2YNMD 2Q4DA 3I83A 4IR7A 5H59A 3UBMA 2GVZC 5HQ3A 3CPEA 3OZSA 3IFSA 3KJQA 1L4FA 1WZIA 5AKKA 3N8KA 5IAKA 4Q7QA 2ECFA 2VHZA 4H3KB 3UAGA 3LXMA 3T3HA 5B36A 2EYUA 1IN7A 3T1NA 1HXHA 2R7LA 4LF9B 2YMLA 2J33A 5HCNA 1XJ5A 3ROFA 1N77A 2HEIA 3DB1A 1ULUA 1L6IA 4R1MA 4Q4LA 2YH2A 3MRSA 3RKSA 3NBKA 2YL2A 2HRRA 3UB2A 2XUKA 5KOHA 2GPSA 1FFWA 3RNLA 4ZCMA 1VMKA 2HSZA 2XWBF 2P62A 3MNFA 4R69A 1XL0A 2Y1KA 1RJFA 3KQSA 5AKIA 2ODAA 4A1OA 2YMPA 1UBSB 1KIMA 3HBMA 3H83A 3QX3A 4I4TB 3VR1A 4DMKA 5JNTA 1KQGA 3VC2A 3VM6A 2CV0A 3EUAA 2POCA 4DVGA 2X4DA 5JMTA 1YE3A 4MK4A 4O4LF 3HYCA 3WICA 2YHSA 1KETA 3E7FA 2FOIA 1EIWA 3GJ3A 4ZI7B 5BY2A 4D8WA 1VGQA 3HPQA 3M89A 2GBCA 4YQEA 4ON9A 3RUAA 2XZOA 4BLVA 3NQ41 4BGDA 4GZ6A 4OTZA 3NVDA 3H5OA 1L5MA 4R05A 1R0XA 4COOA 3I2FA 1AURA 2O7QA 4X44A 1T9DA 4ZKEA 4H7FA 1M0TA 1ZU4A 1YJQA 3VPFA 2FMXA 4B6RA 2QRMA 4ZQBA 4KXUA 1E2FA 1XDDA 4PG7A 1JHZA 1YZKA 5E3JA 5FPYA 2Z6UA 3WDMA 2YUTA 1AUPA 2YY5A 4LC1A 2JKYA 3T6KA 4L0DA 1QH0A 2JJMA 1N6LA 4GL4A 3TSWA 2I2CA 4TRNA 4QUJA 1GR0A 4DIMA 4I55B 3MJEA 2XDAA 2GCPA 3NVMB 2NO4A 1QRRA 4P83A 2O23A 3RHZA 5LKAA 1J20A 5EJAA 4EA9A 1QAMA 1C30A 4JBXA 1A7AA 1J1IA 2A0WA 3NWEA 2PY6A 4D2IA 1A76A 4KI7A 4DOMA 5JQWA 7YASA 4OLBA 1M8KA 1SA0A 2DKNA 2DBQA 1B14A 2AR0A 5B3LA 3EOAI 1O87A 4M1OA 3OU6A 1PWEA 4PU0A 5C8YA 3T9EA 2E5WA 5KUTA 5LMCA 1A5BB 3AW9A 4O59O 4HNHA 1TVEA 3NIWA 1NMZA 3OMWA 4JUIA 5EHIA 1SK9A 4EP1A 7AT1A 1ZKDA 1UEJA 3VNUA 1L6RA 3D02A 2OKGA 4M1SA 3BWDD 5DCWA 4B3SB 1OWLA 3BIJA 4R2MA 1X7XB 4PTZA 2GCIA 3HP1A 1P1BA 3QMWA 1BRMA 1H2ZA 1QGOA 5KJ1A 2VDVE 3UQZA 1VIYA 3HXMA 3PUJA 1W4CA 3N6XA 5IAEA 3QWAA 4W4TA 3UVEA 1E69A 1PJ2A 3PC4A 4J43A 3ILHA 4XEUA 3WHLA 2G63A 1C0PA 3WWEA 1D4FA 1XX6A 3QOYA 2GZDA 1PF7E 2NZWA 4IP0A 2E82A 2P35A 3MWJA 4JLNA 3NC0C 4XFKA 3BWEA 2R751 2HWYA 4ZVTA 5HF5A 1Q15A 5EPEA 3PQ7A 3TLZA 5IP5A 3SNKA 3AP2A 2QJFA 2CUTA 2D5CA 2SKCA 1N2XA 4LNHA 4EI2A 3O4JA 4D26A 2D5AA 2CXNA 1CQWA 2WEKA 1C2YA 1BDJA 2VNKA 4CLOA 3WI7A 3GPDG 3LH5A 3PICA 3QWBA 3OH8A 1F4LA 1SHLA 2A5YB 2IEYA 4HLDA 3EWNA 4PLFA 1JAYA 3ZY5A 1K6EA 3WK5A 1WF6A 3H13A 5DYIA 4F71A 1KJWA 2NZ8A 5DYYA 4KXMA 4C21A 3GJXC 1W96A 3BORA 1B0PA 3DVSX 4QQ8A 2QIPA 4XX0A 4IGIA 2ZJ1A 3HJGA 4ZT7A 1TUGA 2XUZA 1D1SA 1S1MA 3O4RA 5HQTA 2VK4A 2FWJA 4W1QA 3A0UA 4NICA 5L4LA 2PJUA 2B4RO 4G85A 5IYZF 1Z74A 1LPAB 1RPTA 4Y9TA 4I19A 5FUQA 5KTTA 3ZDBA 1WW3A 1U0LA 2B7LA 2NNLD 3J7AC 4BMNA 1SVWA 3OY2A 4Q3KA 4K88A 2XEXA 1BWRA 1CHDA 4OJNA 3I3OA 5BR7A 1XPRA 2Q45A 4P2GA 3A4TA 4YRJA 3RTGA 1VLJA 3G2OA 4EYQA 1TX4B 2QV7A 1JI3A 2AGVA 2G5GX 1MJGM 1TJ4A 2GA8A 3H9GA 3ANYB 4CWAA 4HF7A 1XNGA 2FPIA 4H4EA 1SXQA 3AKCA 5ALZA 2P2CA 3EC7A 3OF2A 4UXJA 3DT8A 3F98A 4URFA 3LSYA 3TW8B 4B3HA 2CFTA 3A1TA 3EVFA 1DCTA 1V5FA 5GM2A 4WKCA 4WJKB 3QUSA 4EL0A 3ISVA 4HQNA 3AGQA 2OQIA 2NSYA 5BWCA 2BFDA 4RTSA 1Z15A 3I76A 4JIGA 5EPUA 4FMBB 1QOQB 4B80A 1RQLA 1F2VA 1XLUA 4MGHA 4DJ5X 2ZSKA 3W2GA 3JQGA 4D98A 3KAQA 4JXXA 1RDFA 5B3AA 2BFCA 2J3JA 1Y1SA 2OQ2A 5I4KA 3DDNA 1FFHA 2CLIB 1BE0A 3EZXA 2ZIWB 1MJNA 3H4IA 2WJ4A 4IHJB 3FCEA 3RAEC 1UMDA 1YZYA 5EHNA 5JZVA 4WDQA 4YJ2B 3EVEA 1UJMA 3I73A 4CLHA 4B4WA 2NVWA 5C46F 4F9EA 2BEWA 2C8VA 4M3NA 4HMPA 1TJ5A 4AO8A 4DMCA 1CR1A 4TLAA 3FTFA 2GARA 5COAA 3NZEA 3RPEA 4PGHA 4F60A 1JIUA 5JJCA 1E7SA 1QRTA 3VTAA 3GJZA 3DR5A 2D13A 2IGBA 5MN5A 3RFUA 4MQ6A 4ZZ3A 4XDYA 1SJ9A 3WGYA 4RJIA 1JDBB 2L42A 2MSCB 3CMMA 1NVBA 3JYOA 3BTOA 3OZEA 1U0RA 1X8LA 3GQBB 3LOUA 1WQ3A 2BOVA 4UUAA 4C1BA 4TSKA 1MJ5A 1VIDA 2V6GA 3RJ5A 5CDHA 5F77A 1XN4A 4MIKA 3ZH9B 1IAQA 4J4BA 4KYUA 3N59A 3GCDA 5KTYA 3CEJA 3DEHA 1H1LB 3NETA 2M6SA 1P29A 4GGOA 2BM0A 3MJRA 4NDZA 5AK0A 2CHFA 4RZ2A 3RBZA 3DB2A 1NVVQ 3BJZA 4UMEA 2I3GA 1AKTA 4KWCA 2WQ6A 3HDYA 5FAKA 1WP4A 4B81A 3GT7A 3W5VA 1D2EA 1QGAA 2QTWB 4MWGA 5DWVA 1ZGZA 1U1GA 1XK6A 2CJFA 2H7VA 4MJ3A 4NMLA 2VAWA 2ZB4A 4E5PA 1KAGA 2X3UA 2DAPA 2ZVQX 2AOXA 2RHLA 1EX6A 1RHQA 2FEOA 2W2TA 1JYFA 1DEAA 4POOA 5JZMA 3V4RA 4FSDA 4RGYA 3RM3A 4DLZA 3CNNA 2ECPA 4MCHA 4OXXA 3ROTA 2EYQA 3AHFA 1UC5B 1F8GA 2D1SA 3S2ZA 4BNYA 4YHHB 1IM2A 1OZ0A 2WU8A 3EC2A 3MJTA 2Q7XA 4FONA 4XGIA 3Q6NA 5FBKA 4CM9A 4BO1A 4F45A 3TG8A 2WV9A 2VDJA 1U8XX 4D9BA 4UHHA 2WKWA 4PIMA 4MVCA 3UC9A 4ZVSA 4JCOA 4ZCPA 5JALA 2YIVX 4PC1A 2ORVA 4CEJA 4Q18A 3A4IA 2FX5A 1Z5VA 2GJSA 3C3KA 4RADA 1BVUA 2PLRA 3FA2A 4LZNA 3TX6A 5H3CA 3DXXA 3T9DA 3AL0C 1YRBA 2NXWA 3PUIA 4A6EA 1U3CA 2H3HA 3DOEA 4WLFA 2LBPA 5LQDA 2AXEA 3NWBA 3U3OA 1M6WA 1FZQA 4DC0A 3MFQA 3EW7A 3PRYA 2QYTA 2DTEA 4L7QA 2H9IA 4RCYA 3URMA 5H3LA 3DDHA 3FI0A 1JWLA 1U4OA 5EJFA 4RKQA 1RT9A 4RV9A 4BBPA 1OKKA 1T3LA 1E18A 1U0EA 2C03A 2VK2A 2W6ZA 1N1DA 3H7IA 1XPUA 1UOEA 3HJRA 4RJLA 5FQOA 3ZGZA 1V0JA 2FQYA 1RQGA 1QIIA 3P9IA 4KPUB 4L0QA 5FEMA 5ICSA 5LQKA 3A11A 3MWEB 5FOQA 1Q7RA 5KTNA 2VBFA 3VR5H 4YLGA 3FDZB 1IN4A 3R9XA 4GG1A 1P9NA 4MYSA 4HWKA 3U7RA 2PUEA 3K6JA 1WDLA 5KIAA 3T1HB 1KJQA 1T4BA 5CPBA 1H8EA 3TYXA 2VSFA 2H1HA 3PV0A 4IKOA 3FJYA 1S1CA 4JB8A 4NBKA 3VZBA 3OM1A 3LZDA 3WS7A 4ZOLB 1XRJA 3KOZA 5IJ0B 1VI5A 2LR0A 1M2GA 3KB1A 4LZZA 1AGXA 1UXIA 2ZRHA 2O5VA 2TMDA 1WMAA 3B7PA 5AHWA 4ER3A 1HG1A 4OB7A 3AF1A 1R8SA 3HJAA 4M8IA 2G76A 2ZWVA 4XVCA 2ZJ5A 4P4SA 1BQ3A 2EQAA 2ZYWX 4PC3A 5DNEA 2XUAA 4PTYA 5EXDA 5IBPA 1RI2A 3SR4A 1YXMA 1RBMA 1GZSA 3E58A 4FFRA 2VT6A 3QMPA 4J1TA 3JQBA 3GRRA 1B2LA 2VYVA 4FTWA 5SYNA 3F73A 3FFXA 1WB5A 3BTUA 4Q3NA 2VDKB 1E79A 5HVNA 3MJDA 1SG6A 5ALNA 4F8JA 4RW0A 3VGPA 2C88A 4HAZA 1QYVA 2C95A 4AUMA 2W2VA 5AW7A 1NOJA 1SCDA 3IKJA 4HQRA 5JHHB 1WMDA 2I22A 2OO5A 4Q4AB 1ZVVA 1ZH2A 1K7FB 4RH3A 2GJ9A 1C81A 3V00A 4MPPA 1OTHA 3O3MB 4FZJA 2O3TA 4A73A 2VO1A 4YAUA 1MAWA 4ZJZA 4AKSA 1KMNA 5CLQA 5SZHB 3T35A 4ZT2A 2ZIAA 1OXBB 3LQQA 4OF4A 3O0DA 2YFKA 4WAUA 1U7TA 4F1KA 4R8MA 1HNXB 1RLOA 1QTQA 5B30A 3MMSA 4HDNB 1EYZA 3Q1KA 5EWJB 1DP4A 2Q5JA 1O6ZA 3GH3A 5KVQA 2IXTA 3L05A 5TPZA 4KR9A 2R6JA 4Q39A 4FYMA 4NAVA 1EGQA 3A4YA 1GL7A 2OBLA 1JHAA 3O94A 1PLJA 2RAVA 1GCIA 2FW6A 3WLTA 1P7YA 5DDIP 1GAQA 4DV0B 1EFVB 4YRZA 4UMVA 3IEKA 1IXKA 1IUPA 5TARA 1EFVA 1T9BA 1JN0A 3TZKA 4B83A 2VHWA 3V42A 5LUAA 1SOAA 2F1JA 2NT3A 1ZK4A 2FWMX 1H4TA 2W22A 1C9EA 4XUDA 1PKEA 1VJCA 3DP9A 3DE4X 3ZDYB 5K9ZA 5LQAA 3G0OA 1LWNA 1F14A 3GUVA 4O8CA 4O4IB 4EJMA 3IMCA 3HXPA 3QU5A 5IJ9A 3OKAA 2W0SA 5AR1A 3ZXUB 7ADHA 2CDBA 3KYDB 2PUTA 2VHYA 1GG5A 2ZRQA 1PI3A 4Z3KA 5JI3E 3TEMA 3OUZA 4JX8A 4TN1A 3E2PA 3AR5A 4GMDA 4WZBE 4ZAZA 2G4VA 2EKBA 4BFZA 3L46A 2WIDA 1RW4A 4M38A 1G3QA 1WY7A 5G1PA 5DM60 2QLLA 2FJ0A 4MNTA 5EMLA 1U8AA 4R1PA 3Q8XB 1G8GA 3KTAA 4KR3A 2O7SA 1WPRA 3TLXA 2G67A 2XYQA 1SXIA 3AR3A 4GKBA 4IPTA 2JAXA 5EA2A 1EJBA 1N32B 1U7PA 4ZANA 3PCTA 1A5ZA 5JQGA 5EIAA 5I48A 1MX3A 3VOTA 1VA4A 3IMKA 4WXPA 1HQCA 1T2DA 1AMUA 1YK0A 1M54A 1FYWA 5A06A 1WKVA 5C1PA 2OZKA 5CA0F 1A3CA 2NZXA 3TI7A 4M46A 1MH1A 1FVHA 4JBHA 1NX6A 1GZ6A 1IZZA 3AG6A 4EKIA 2XCOA 4MQFA 4EVSA 1PJSA 4YDHB 2QTMA 1R74A 3SEZA 1UQRA 3GD7A 2GCNA 3JQDA 2LDBA 1KSFX 3PWTA 4BMVA 3I34X 3WGQA 4G0YA 4DA7A 2AG5A 2RGDA 5CDFE 3PQ3A 1XOIA 3N2YA 2IOYA 1SM4A 2A1IA 2XWJI 3L4KA 4C7MA 2XPCA 3QX7A 1UMKA 2ID8A 1S8OA 1OWMA 1S9DA 3ENVA 4YRCA 3VR4A 3PEWA 2AG6A 5KC9A 3SZGA 2CUNA 5D5PA 3M1AA 3LRTA 2JCVA 1JQAA 2QGZA 4H7PA 4QYXA 4V0RA 4ND7A 4XVHA 4DBVO 1DIRA 4YMUA 3K6SB 1VI2A 2BMVA 1KXJA 2PCJA 1R6AA 2BELA 4F21A 2HADA 2OFFA 2PAAA 5F12A 1OUMA 4KC0A 4D3YA 5IJWA 4LYYA 4E46A 4R2LA 3FBWA 2IYPA 1SCBA 2HWKA 4AF6A 5HPYB 4KDCA 1ISRA 4ZEVA 2V3VA 4EBFA 1P0QA 4KAAA 1IZ8A 4G26A 1WX1A 1TIKA 4JKYA 4BMDA 1SAYA 4EGJA 1T8PA 3PE6A 2UUAB 1VL1A 5DXJA 1RYYA 3MM4A 1Z0KA 3FDIA 2WF6A 1ISPA 3RO7A 5AUOB 3LX5A 4OHBA 4KMOA 4A9AA 4C5AA 1JKMA 3HDJA 4II7A 3NR2A 4PQYA 1QF6A 1PUIA 2H5IA 4RD4A 3WJ7A 2YZMA 3C3WA 2ZDGA 1G98A 1QWOA 5JH7A 2ZFUA 1Y4AE 1RABA 4YDRA 9ABPA 4CIYA 1THGA 1EJ6A 3PFKA 3QLTA 3KPYA 3UAYA 3ZZ1A 2I1QA 5CYFA 3G9ZA 1QKIA 5D87A 4O3FA 1VE7A 2GI4A 2OV1A 4EG1A 4JLWA 3R4VA 4YRFA 1DRVA 1KZ9A 5J5VA 2XWPA 1G38A 3GGJA 4WLNA 5CNJA 1IUKA 4LSZA 4ABYA 4B8YA 1H0SA 5CFOA 1VMDA 2ZJFA 2CXTA 4Q4CA 1R4NB 4JVNA 1EXNA 3PFWO 1E9DA 3PVCA 1EUZA 1T15A 2YMQA 2I78A 1Q5PA 3A6FA 4HHEA 5KS2A 4LFAB 1YI1A 1O1YA 4XD7D 3TX2A 1QM5A 3WZLA 2BI7A 1NMYA 3ZUGA 4QTUB 4CQJA 1E60A 1WDKA 4PZUA 3UFXB 1DAPA 3ND8A 2EGUA 1PJLA 2AF3C 4LHYA 4C3UA 1OBCA 4OFXA 1ULSA 4L9RA 1TEXA 4IDGA 4HDQB 3TVDA 2H54A 1EZ1A 3RS2A 4DNFA 1W5SA 4MUNA 3VJMA 4PGAA 2FFRA 1GNPA 1BU8A 3FTQA 4IMIB 4EX7A 1EVIA 2MHCA 4H3HB 3W5DA 4TQAA 3VGJA 1ZN2A 5INTA 3PUXA 2RKOA 2TS1A 3DVAA 3P2OA 1VYTA 1XTKA 3L77A 4IDCA 2ZRCA 3DVAB 3H6HA 2NM0A 1Z6YA 2Q2QA 1DNPA 3DKPA 4D46A 3HJBA 5SZJA 4BAGA 2AK3A 4BVKA 3AFMA 1EZ4A 1WZNA 2BFPA 2C0PA 5DHQA 5DF1A 5DKFA 1YZFA 2GHQA 3A9CA 3NDIA 2VG8A 1SCJA 5I9MA 4B6GA 2EGHA 3G8DA 4CR8A 1PE0A 3N53A 1T25A 5K05A 4Q3OA 4PG5A 3AEQA 3KV1A 1RBZA 4EB8A 4F6LA 3ZW9A 1HQYE 5JH7F 1RC1A 5KQSA 2OGSA 4PYIA 3VNBA 5IUNC 1YJCA 3MD9A 4YP1A 4RHCA 4FLEA 2D7DA 4N5HX 2QUAA 1BD4A 5E6RA 1E32A 5BYKA 4MRPA 4NRDA 1HE4A 3I5AA 2JLWA 3E3LA 1YBFA 2EFDB 2VL7A 3DV0A 2XH8A 3N1UA 3SY8A 3UXEA 3GG2A 3UO8B 3AVUA 2HIGA 2HMTA 3SPXA 3CKMA 3JYPA 1EM6A 1RQNA 5IFKA 2H65A 3U5ZB 1BG6A 1PVOA 4AJOA 1KI9A 3IERA 4J4HA 4RPKA 4L4ZA 4MVJD 1SHUX 1Q92A 1ZD1A 4NNOA 5H4GA 3AJ9A 1O96B 4LCEA 3R0QA 3UW3A 5LQUA 5IM5A 4BASA 1SUBA 3UWPA 4ARSA 2A0KA 5FL3A 4J0JA 1JA0A 5HCUA 2I3ZA 2G9QA 3SYRA 1WXDA 3DEAA 5AKEA 1GGVA 4PGFA 5KSYA 5JT1A 3QHQA 4UMDA 4XD7A 2H1IA 1P7ZA 1CV2A 3MTGA 1QTRA 2VJDA 3PUKA 3EGCA 1MABB 4RK4A 1NUPA 4Y1EA 1TW2A 4EY7A 4NCBA 3EIFA 5KINB 5JCPA 1L0BA 1NNI1 4F0JA 4M0DA 2K4MA 4Y1FA 1X9HA 4TT8A 3UWKA 4HH4A 4X84A 4M0FA 3TRDA 1C14A 1M1NA 4EI8A 3MINB 3STVA 2ZBPA 1QHYA 3IAS1 5ALIA 3BQNB 3CLSC 2MT9A 1NUTA 2ENWA 4HUQA 4E2XA 1E3IA 3GRAA 5L45A 2PT9A 1GUAA 1T8YA 4KE9A 5TGZA 1GNVA 5DHSA 3RT1A 3AQIA 1I3LA 3CGWA 2FPXA 3KZNA 4UHJA 4AIRA 2HGZA 4UEWA 5JQGF 1I4OA 3BN3A 5DPMA 3DE6X 2ZI9A 3DBRA 4Y9SA 3D9QX 2MIIA 1P2SA 5GV7A 4L50A 4G1MB 5LP6C 3RREA 1YV9A 2WWFA 2C58A 2XWSA 4MVJM 1F1JA 1PL6A 4MV5A 1J0CA 3T38A 4BTEA 4C2BA 3OTIA 2NW6A 4L2IA 2Y0BA 3LWZA 2RGNC 3TZ6A 3WMRA 1NI3A 1PS9A 4HGOA 1G2QA 2VHQA 2CE7A 1V7QA 1YJAA 1Z28A 3H18A 5JBNA 5T8KC 1FP4A 2WD7A 1BMDA 4J91A 3WTCA 3KZ1E 1A5TA 4B3GA 5EUMA 2PX3A 2R8BA 3OUTA 3P7MA 4E94A 2C54A 3AHIA 3W0LB 1O7JA 3CU5A 4L78A 4QOGA 4XEHA 3GRKA 1NXOA 3LD9A 4F97A 1OXTA 3IUMA 4E1BA 1ZW1A 5ALFA 5A4AA 4MQFB 4P2BA 3L0CA 1DEKA 4PICA 4ATNA 2PS3A 4LXQA 4PC7A 5BSRA 1HLGA 3E1SA 2JFWA 5E6UB 3GRUA 3R5KA 4WRRA 4HSEA 3JQQA 3A1FA 5AKXA 5EGSA 2RK6A 2ZRKA 3DEKA 2YZGA 1PSZA 4MDYA 4Y1RA 1MR3F 1NNSA 3EA0A 1DKQA 1M8GA 3KDAA 5KI6A 1UXKA 3U26A 3B85A 5H7XA 3TD9A 1Q0SA 2HXSA 4MIEA 1RCFA 4NPCA 4P53A 4W99A 4CG3A 4NEQA 1ACJA 1W581 1ZHOA 1QRDA 2WTXA 1WXWA 2ZK7A 3GLIE 4YONB 1HWYA 5CBPA 1QE5A 1R18A 3KWJA 2ZSFA 1QBKC 3W7AA 3LE8A 2AW3A 2WILA 2ZYDA 3QXSA 1T2VA 1DJLA 3BGIA 4ZAXA 4ZAYA 5G4LA 1RRPA 3GB9A 1FFBA 3ICPA 3L8GA 2Q7DA 4O5AA 3U1TA 2ACEA 2PR2A 2WABA 3GYBA 4BVHA 1J24A 3ITKA 5U4XA 5JAHA 1C8KA 2P9EA 3GP8A 2RI0A 1MG0A 4LF6B 4FYJA 1JX6A 1LLDA 2D6FA 3LDHA 1IONA 3O4GA 3BREA 1SG9A 1MPTA 3NIBA 5G0SA 2OM6A 4TKUB 2L17A 4LK3A 4DCOA 3HDHA 2OOKA 2IZ5A 1B8NA 2QP3A 5ESRA 1Q12A 5DNCA 1C7JA 4YAFA 1TU0A 1HQDA 2CDNA 2JA2A 3DEFA 3IO3A 2ZR0A 4P08A 1F38A 1YIDA 5DLEA 1V5IA 2JFNA 3ONWA 5CCDA 2QD4A 1THTA 1VPLA 2V3WA 3UMJA 1J0XO 4W9MC 5ARBA 2RIPA 1Z63A 2VJYA 3A9UA 3M3PA 4MUFA 4E7PA 2A5DA 2PEZA 4C4RA 4I9NA 5IDXA 3SIRA 1V6AA 4CLXA 3LI2A 5BR4A 1AD2A 2VDRB 2WQZA 2AVDA 2GOYA 2Q1UA 2ZRDA 4FOOA 2ODWA 2P6MA 3VZDA 1K8RA 5EMJA 1AA6A 4DABA 1FP2A 2X2FA 3EXIA 4E22A 1M2VB 1T5TA 1PGJA 4J0EA 5CB8A 4IG4A 4RF5A 2WWIA 3CRVA 2A1UB 1UIRA 1N5JA 1ISHA 1YJ8A 4DHEA 1EDZA 2VNIA 2EZUA 4G6ZA 4UHCA 3S28A 2W2MA 4FD2A 3L93A 4NBRA 4JUAA 2B21A 1NTRA 2ZSBA 5LNK1 1W29A 4PO8A 5B2EA 1E77A 5LM3A 3Q8KA 3K32A 5FUXA 4BQNA 1KRHA 2B1IA 4R1SA 2PGXA 4OHRA 1E9CA 2F3UA 4P7JA 3VH3A 1FVFA 1K97A 5B1YA 1E2HA 2E5FA 3K1JA 2KE5A 4WEQA 4ZEXA 2X5KO 1XAIA 1DWUA 2C9BA 2NQ2C 4IX1A 5IC5A 3X2EA 2WNHA 2FY8A 5JTTA 3IIIA 3HUFA 4DF3A 4XTRA 4TYNA 2N42A 3OQIA 5E38A 3H1BA 3N7AA 3I2KA 5I7VA 1HTTA 4P5DA 2OHJA 2QJWA 4ECAA 1KFEB 3EUFA 2XE6A 3KDSE 4HC4A 1QCDA 4OK5A 5FT9A 5JS2A 3LP8A 5EJ2A 3KU4A 3SOZA 5CA0B 2DETA 1YQDA 3AESA 1NLUA 4BJ5A 3FKSA 3E48A 4RJKA 3L8HA 1GD1O 1WUIS 2FR8A 2PEYA 2N47A 1QYXA 3K53A 3L0SA 3R0IA 3F5MA 5AK5A 3NDBB 1TYCA 1E2LA 4HLNA 3N07A 1I5RA 3NFYA 2BWJA 3LRXA 4IGAA 3LKVA 3KKLA 2NV2B 1Y42X 1DKUA 1FDRA 1X8JA 1QVRA 2AOUB 2QRLA 2XT6A 1TADA 3AX6A 3EXEB 3FCOA 2EBWA 3O31A 4TPKA 3V1MA 4ZMBA 1A97A 2GNPA 3MYRA 2J0SA 2FG5A 1H4VB 4XW2A 4EVRA 2WU1A 4KQEA 5IDYA 2QZJA 1JXAA 1S5PA 2OXEA 2YY6A 5FTJA 4N76A 1Q22A 5AUQA 5FJJA 3RJ9A 3FZGA 4EW3A 3L5KA 4TMKA 4N6OA 1QKKA 2HCTA 4XSGA 4TYWA 4MRAA 3RQSA 1MXFA 1QANA 3IP6A 1TTQB 2X8AA 3PZBA 3K7EA 4C3VA 5BV7A 5MF6A 4DBZA 2NU9A 4L4UA 3K16A 3NO4A 4RIIA 5LMZA 3U16A 2FPSA 4LXXA 4YFVA 3GO4A 1R12A 3M3HA 1JG4A 4IVPA 4L4YA 4MUYA 1I10A 3UCEA 2VTKA 2BHSA 4G9EA 4N49A 2FW9A 4M37A 1YZNA 1ZUNA 2G1KA 2AI3A 2R85A 2WU3A 2XMRA 1QR6A 3BK2A 4MSUA 1LFAA 2QRKA 1HI9A 3ECCA 4LFBB 3O26A 1M34B 2DCUA 4DCTA 1UKEA 4TXHA 5IJXA 2XCSB 4GC5A 4PVDA 2F3RA 3ND5A 1V3UA 2Q41A 3QP9A 1P0PA 1G6Q1 3BMNB 5EJ7A 3C14C 4RPCA 4AG6A 1KYQA 4Z4HA 5FD8A 3T7AA 3T12A 3BMCB 1C1YA 4PNHA 1PG0A 4YT2A 5FOXA 2GB4A 1VKZA 2EDCA 1KIAA 1OIXA 3CISA 3SX4A 2NU8A 2ZUEA 2DYKA 2P67A 3RLIA 3B1WA 5C5IA 3A6DA 2IZ6A 2O8DB 1LJ8A 3K1ZA 3E84A 1DAIA 3QLVC 3LWNA 3N2EA 1N2IA 4YJDA 3P5SA 1YJXA 3JS5A 1H1LA 5TQ2B 1HDIA 1QH1A 3S4YA 1PEDA 5AI6A 1P7WA 3FKSD 5LKRA 1J56A 3R23A 1OA1A 2P9BA 4DM4A 4XB2A 4AJ4A 5FRDA 5FV4A 4RY8A 4KUEA 2VJCA 2YWGA 3PHCA 3Q3JB 4MR7A 4AQ7A 3WL5A 4M86A 1CB7A 1JLSA 5JI2E 1RXCA 3TTSA 3T7CA 1I3OA 3IPXA 4XIYA 3OCWA 1HYGA 2WD7B 4RZQA 4ZU3A 3VPDA 1EUQA 1ISJA 2IYUA 4MRMB 2J3DA 4NZNA 2DB3A 4LK2A 3AI1A 1ADFA 2GVNA 4NQRA 2F3QA 5JCJA 3KTFA 1R0WA 2AN9A 1F12A 2BHRA 1GU0A 1PJAA 4CFSA 1K9SA 1ULAA 4EGAA 2Q5QA 3RWBA 1QHSA 3JQCA 3RTEA 4BXOA 1JLMA 2PVSA 2C7OA 4G1FA 3IPYA 1HE2A 2BJVA 2OECA 3EVZA 4HDNA 3VI4B 4OYRA 3NASA 1GAJA 2J0UA 5A5EA 2G8LA 1W85A 1ZJ5A 1TMYA 1TQ8A 2G06A 6ADHA 4V0LA 4I1SA 4TT3D 1JAHA 3BE8A 3FVRA 5CGZA 1U6JA 3SZUA 4BMCA 2XA1A 3E15A 1SZJG 4BYMA 1YOBA 4I1OA 1YGYA 5FFNA 1M1NB 2AXPA 5AJXA 2GPYA 3PR3A 1PBTA 4QPJC 4BCDA 4EJFA 2BGNA 5L6LB 3ZIUA 5I8WA 5DBEX 1U1FA 2QP4A 3GJTA 3O8OB 1GA1A 2OGUA 4UCQA 4G5QA 5DV9A 4H17A 2HMSA 1QKJA 2IELA 2LZ0A 5DSTA 5CDUA 4ZVVA 1RBYA 1QK5A 4EKEA 1L5QA 2W6OA 2M6LA 4XWAA 4TTRA 2BBWA 2QL6A 3DEIA 4LJ8A 3A2LA 3D1LA 2OHVA 3D8TA 3QNUA 1Z75A 4ZKDA 2J6CA 3RDPA 2FW0A 3UH0A 5KHOC 5A4JA 4AXXA 3EZ7A 1XZIA 2GN8A 1JR6A 4KRGA 4LMRA 1OH7A 1TD9A 3ZY6A 4HDRB 3W6ZA 2PX8A 3FPGA 3ZDRA 4FFSA 4RMNA 3HR7A 1CZRA 4WESA 3IJ5A 4CMBA 3B5IA 3LECA 2CFIA 2PYZA 4H7EA 4PTLA 2M98A 3CO5A 5F51A 4B75A 5KCZA 3AXTA 2XKJE 4XPZA 3OOYA 3DVQX 4JMPA 1YQ9A 3EZGA 3EPRA 3NOVA 4G1VA 2PA0A 3B13B 1YWGO 4M49A 4NFHA 2IU0A 3AKEA 4OUKX 1G21B 1UAGA 1B43A 2G08A 4IUDS 2R4UA 1C50A 1HORA 5CUQA 4GBMA 4MYDA 5FBHA 1DBQA 5JVDA 4FYWA 4MQUA 5CXQA 2X77A 1J0EA 1JHYA 5EL0A 4MP6A 4AG5A 4FHFA 1Z4QA 3N0TA 4REOA 2ARKA 3MJHA 5CEJA 1T0BA 1VP9A 3I6IA 2IHZA 3Q6MA 2WZCA 3N70A 4MROA 4U2EA 4F9GA 5AKHA 2G88A 4JQCA 1E2GA 4TTAA 5DGTA 1TQHA 5SZIA 4HN2A 5BWNA 3HO1A 1JT2A 5C1DA 3U4AA 4ZPXA 1H5UA 1Y6GA 2J7PD 1EZZA 3ZU6A 3VYWA 3F9CA 3IQWA 3AINA 5IH3A 2GILA 3MRVA 5A4DA 3TMYA 4X95A 3RCBA 1XXLA 1XXHE 4K1XA 4UVHA 3WRYA 4OX9Y 4L07A 3UW1A 3BMCA 1E2JA 4E13A 3RUPA 4FHDA 2QUBA 3OT4A 3VTKA 3BMNA 1UJBA 2ZBUA 2JL1A 3GUHA 4F3CA 4HAVA 3DFIA 3VNAA 4JEMA 1D5CA 4NI5A 4ZODA 3CV3A 2OG2A 3UCFA 4OFWA 4CM3A 2D0PB 1ZAKA 2J67A 1Z36A 1HG0A 2JFXA 2VF4X 4MULA 1WW8A 3I37X 4Z9XA 4IH9A 3STTA 5AI8A 1KTVA 1AG9A 2ZTMA 3PLAE 1EPUA 4H1VA 2VH1A 3QXGA 4GYJA 1O6FA 4F2DA 1HH4A 3IP9A 4FW8A 4ZMSA 4A0GA 4QQKA 1Y4SA 1A9TA 3FYHA 4GOJA 2JIRA 2IWRA 3QVJA 4XDZA 2JG3A 1BJKA 2BI4A 3P9NA 8ATCA 3OLZA 1T0HB 4LBZA 1M75A 3JAWB 3MILA 1THMA 5E2BA 2GEVA 1G7CA 5KSOA 2VUIB 3DFUA 1SIBE 4R1NA 3Q41A 2YHUA 2XCIA 3H2KA 2PV0A 3ZWCA 5KKAA 1LDBA 1ANKA 3BJRA 1WHSB 3TBKA 2QLMA 4RCVA 3D5QA 2GYWA 3GZJA 3EG9A 1OZGA 5HS6A 1JSXA 2HTEA 3AEKB 3JZFA 3NWJA 2Q3BA 3O3NB 1JHRA 1CYDA 4MCJA 4RSMA 4TKMA 1N8TA 5TMEA 4YHBA 1K8QA 4YXWA 3UKJA 3S68A 3ZCRA 4AECA 2I7XA 1OH5A 3BFKA 4DR6B 2NUTB 3F5FA 4IHJF 4YJ3F 5B1IA 1AKQA 3AKYA 2HJRA 3WGHA 3A6PC 3WLMA 2AZXA 1I4EB 4TV9F 4UDOA 5AJWA 4IMPA 4Y6OA 3RB8A 2IXBA 4N3GA 4HXGA 3CUUA 1WE2A 1TZ2A 4IKEA 1VIVA 1GVNB 3GV0A 3QIAA 2ZUWA 4IQ8A 4OIFA 2O0HA 2Q7OE 2W93A 3L4SO 4B82A 1G60A 3TNYA 3P4XA 2AYZA 3F6CA 3IULA 3STWA 4C9BA 4DIOA 2H5JA 2IYYA 1L7RA 3W8NA 1DC6A 2YTZA 5JEEA 2PL3A 2H57A 2JVKA 3DV9A 3ZWOA 2OCAA 3C4QA 4Z7QB 1O54A 2G7MC 2FB9A 3T9AA 3D8HA 4HLUA 5HG0A 1CJVC 3AM5A 4FPXA 1FYEA 3NTXA 3Q0EA 2GHIA 2D1FA 3WL4A 2VQSA 4BFVA 2Q49A 3GROA 3NGXA 1J90A 1EWRA 3B3JA 3RIYA 1XT6A 3BXZA 1CZKA 2IX9A 2HF9A 4YP5A 2X8JA 1IDOA 2HWWA 1P2DA 2JANA 2BDUA 2CVFA 2XZLA 4JYPA 4ZAWA 3SVTA 1PCXA 5DX8A 2BEJA 4KMMA 1X7ZA 2A67A 3WTBA 2WTUA 1APBA 3JWEA 4JKIA 2EF1A 1GQQA 1W75A 4D8XA 1O95C 4XSVA 5HDBB 1QHFA 4MWTA 2GD0A 1M6VB 3HR4A 2F1OA 5KNBH 5AK4A 2AJCA 2AE2A 2INGX 4FGZA 1XDZA 5J59A 3T9CA 1QB7A 2WIAA 3BB1A 3O2SB 3UATA 3IDAA 1XTZA 2AB0A 2RHHA 3U0VA 5F5XA 3R3VA 3EGWA 3DEYX 1BQ4A 3FI9A 1GO2A 2Q3EA 1KK1A 1FDTA 5K6RA 2PUJA 3DAPA 4GQAA 4C6TB 5CFZA 1NX9A 1XP8A 4XZ3A 4GOKA 1V39A 2R8EA 1M5TA 3HS3A 1Y33E 4PLTA 3RVMA 5JCZA 1MIOA 4DLWA 4EQ6B 2ZI6A 2XUDA 1SCUA 2YJ3A 4JBLA 4JI1B 4F8YA 5IRCD 1C9DB 1CKEA 2FK7A 2O7RA 1CCWA 4C07A 1HRKA 3SKVA 1U04A 1SGWA 1H2FA 2G70A 4AULA 4D44A 3DHEA 3WWZA 3FE2A 5CFRA 4LHVA 3OZTA 1A9SA 4D8TA 3MFYA 2A9KA 3GFSA 4KQFA 4NU6A 1IXZA 1DAOA 3A0RB 2D2IA 2C31A 3UFXA 4RD3A 1USWA 2F9LA 3LVFO 5D6NA 3WLSA 2FZVA 1NUHA 3L8MA 2OGWA 4Y6SA 4ZGGA 1AQJA 1DEHA 2L82A 5F5LA 3LO5A 1FTQA 2IHVA 3QUQA 4HB0A 4MA0A 4E15A 3CCFA 3HSYA 3TLAA 3V4SA 3T1VA 1LQUA 1U9IC 3JU3A 3MLBA 4C0AC 1DCKA 3FVVA 2X42A 3F97A 4OQQA 3ZI0A 5AESA 1E1CA 1Y6FA 2P90A 4HB3A 4G5HA 2IS1A 4H0NA 3PNOA 2C7GA 4HWGA 2JLUA 3BBLA 3PNLA 4RPGA 5GTDA 4RX1A 5HRCA 1Z7BA 3CNHA 3VPCA 4FUTA 1IY0A 1SHJA 2X5NA 3GEMA 4UBNA 2YXNA 2OV6A 3GMSA 4QPZA 2VPTA 4ZCIA 3G1WA 4NF2A 2V74B 4G1BA 4AJEA 3SDBA 3OU7A 1LRJA 1BDMA 2YIMA 3OM8A 3BE5A 5LMUB 2P91A 1RQRA 1YB2A 2X0IA 5LB4A 4D4JA 4EELA 5C8XA 3SVLA 4YJFB 3PNMA 2KBFA 5KTRA 4E1VA 4ZYUA 3DZBA 1JDTA 3L4JA 2O2GA 1QQTA 1XQ9A 3NDPA 1UBFA 4AJ2A 3FJ1A 3G9TA 3H7AA 4FLFA 1UZAA 1IHUA 3G0CA 6CHYA 5B7GA 2VK8A 2VPZA 5IZCC 4D3ZA 5IAGA 4B5KA 2QQ5A 3MJFA 3BL6A 2BVNA 2GFIA 4LZAA 4U39A 2CHGA 2B4KA 1LSOA 4Q1BA 4UVGA 4Q0MA 3CCBA 4X71A 1SBHA 4PXAA 1DO0A 5E4FA 5M2QA 1MO5A 1L5SA 1TB4A 1WD5A 1II9A 3DMTA 4ARBA 3T15A 4PYLA 4EPYA 4AZSA 5D5QA 2O1EA 6ABPA 2JBWA 3VC3A 3WBFA 3M70A 4X20A 2D62A 4F4IA 3EWSA 1GGJA 3WISA 4TZ0A 4BMOB 2JEZA 1SOMA 3RT9A 1P9RA 2WWXA 4NAUA 4OBWA 1PWHA 1DG9A 1PS8A 1YASA 3QLVA 5IULC 5KPDA 4G0VA 2B30A 3SHTA 1OXXK 2X5OA 4Y9DA 3F8SA 1KEWA 3K31A 3R4CA 5EWLA 3DT9A 1V25A 3NP7A 4OATA 4V38A 2JGMA 2Y1WA 2V03A 3IYLW 4M0KA 4ZQCB 4HFNA 3WRXC 2D4AA 3D4NA 1YB7A 3OE1A 3DZIA 5DYNA 3USZA 4GOOD 2F9MA 3OT1B 3TLGB 4P7GA 1HE5A 2RGWA 3MLEA 5FYQA 5IZ4A 2WHXA 1U1IA 4BNGA 4JDUA 5FI3A 1YB4A 1U8CB 3PC2A 3ZLTA 3EFOB 2ZDHA 3WLPA 2LPMA 1NSFA 4UNNA 1S3FA 1E66A 5ALDA 1W7AA 2E3JA 2XJ4A 2YV5A 3D31A 1HZZA 2QU7A 2XB4A 1DL5A 1XRMA 4QOJA 1QF7A 2RJ3A 4EOGA 1C0EA 2BP7A 1DT5A 2PGJA 2OXCA 1JJFA 1ONPA 2OCIA 2PH1A 2RHWA 1DRWA 3K8ZA 3L7YA 4FDTA 2G1PA 1LK7A 3AR6A 4QODA 4P7FA 1ONNA 2O2YA 4DAEA 2HSJA 1NFRA 1H1DA 1WF3A 3OA0A 4W5OA 5IBRA 3GJQA 3K09C 4LY9A 3O8LA 5K8UA 4A0RA 5F3DA 3PPWA 1TT5B 4AJNA 4JNKA 3TJMA 2R0QC 5FO0A 2ZBQA 4EJ2A 3EC1A 4LNAA 2QVZX 3RTAA 4B6QA 1XEWX 1I9GA 3HJCA 3LHKA 4ZO6A 3SZLA 4NC9A 2WFLA 3UXHA 4B76A 3QHAA 2QM0A 2W6ID 1L4BA 4U2KA 1T8SA 1PHPA 1J2UA 2AI2A 5AH0A 2W42A 2YXDA 3B6ZA 1FSSA 2GK6A 3OSZA 3P26A 4E1AA 2UZ1B 4NBVA 1MAVA 1NXVA 4G5RA 5MN4A 3TAXA 4Q02A 3HMQA 1FSGA 3EVDA 2Q8NA 3JQ6A 4WERA 4BGVA 1MRSA 1MFZA 2DY0A 4NWIA 4P7BA 3N86A 2Y6UA 3V8BA 1YO6A 3ZYZA 2H92A 4QDKA 3DPIA 5AOBA 2GS9A 2VP4A 4E11A 3ZHYA 3V1UA 4HQKA 4RK0A 1YTUA 2AT1A 1FRQA 3B2EA 5LXTF 4O25A 4YAWA 3GJ6A 4MTCA 4UMFA 2CK3A 4HNUA 3TOZA 2RK4A 3M6XA 5EHXA 2R68A 3ML1A 5LA6B 5CAEA 3G5AA 3UGKA 4LRXA 3OC6A 4H9GA 4OSPA 2GLXA 3K5HA 2XRFA 3WKEA 4JSRA 2A9QA 2D3TA 2EWWA 1G4UR 2G9RA 3LQRA 4LOIA 4NZMA 4HZGA 4JNCA 1I36A 4JVOA 1HMPA 2ZTLA 1EWKA 4OU5A 3RANA 1TF2A 1RYFA 1E9BA 1JKXA 1E7QA 4EUSA 4XYBA 1LTKA 1XD8A 5A9TA 5JAOA 1ICEA 4MINA 3OZUA 4ZCLA 3KAJA 5LIPA 1ZCZA 5EJ5A 2ZU6A 3PCRB 3T95A 2CLDX 2JATA 4MQEB 5C8DA 1E1LA 2QXYA 1KI6B 2ZSIA 1UMCB 4BN5A 2FSSA 2ONCA 4NIMA 1EU1A 4I55F 3WLEA 4MVYA 5IMSA 4AU1A 3W2EA 4LYHA 3DTVB 3RVQA 2ZU0C 4J2TA 1QZ3A 4Y9RA 2N9UA 2PXCA 4BU0A 4NARA 1W9HA 4YRDA 3U7IA 3OLWA 3P9RA 4MMYB 1IQ0A 2QZZA 3ET5A 3OIGA 4KO2S 4UZFA 3ZWAA 1N2CE 2HEGA 2E0IA 3EZFA 1K3UB 3U40A 2NU6B 1V45E 3M5DA 3R41A 4PAQA 4E09A 1ZSVA 5BQFA 4N0MA 3HUEA 4QJ4A 2RBGA 2RKWA 4AO7A 4Z9AA 2BMJA 5TX7A 5BR8B 2UZ4A 3PYMA 4JJEA 5KKNB 1FMLA 1V16B 1CUEA 3TM4A 2ZJ6A 5ALPA 1N6HA 3VTFA 1IN5A 4IIJF 1GSHA 1E3SA 5FLEX 1FMJA 1FXSA 3ESAA 4HPWA 1WABA 2DH5A 1V9SA 5IKEA 1TQ2A 2QRVA 3FYDA 2EW1A 4OMUA 4URVR 3Q7TA 2EU8A 2H1WA 2JGAA 3TBFA 4JUBA 3SEFA 4IJUA 3S7ZA 2XT9A 2ZPAA 1JQKA 9MHTA 4PZPA 1EP2B 2EW2A 4JC8A 5HHTA 1VZ2A 3WQQA 5HK8A 2HPAA 4GSKA 3KOXA 1RHKA 5T4BA 2XIJA 4PQEA 1EFDN 2HMUA 4PRLA 3WR5A 3CVOA 4HTFB 1QDEA 3NPAA 3RROA 5DM1A 1E94E 2VCEA 4W6QA 3JVDA 3HU5A 5JNLA 2NMVA 1RE0A 4GR5A 4DNQA 2H4FA 1IJEA 3WKDA 1EESA 4L72A 5JAIA 4RLFA 2X1MA 5DOVA 4ZWNA 3H3FA 1I7QB 3I2IA 4FFBB 4LJYA 2O8CA 4TS9A 3WLRA 2OO7A 4WSOA 1NF9A 2Q3CA 3LT5A 4GM4A 4X7MA 4C7JA 5DTJA 2GBIA 4NG5A 4CEHA 4MW2A 2ZS9A 4IO0A 4N01A 1AKUA 2IPLA 4HSGA 1T0PA 1N6KA 1UZUA 3DH0A 1NUAA 3NT5A 3AW8A 1Y7TA 2FSGA 1GKIA 1CZOA 3EJWA 4BNHA 1I9CA 2HSWA 2QQFA 2RARA 5IT0A 2KX7A 1OREA 3I04A 1RZ3A 3AF4A 4JUFA 2VWGA 4KX5A 1RVV1 3EWAA 3ZVKA 2OM2A 2O5CA 2H59A 2VI5A 3GGOA 1JLLB 4LXTA 5A0VA 2FEXA 1WY5A 3CZ9A 3HP4A 3JQBC 3KXKA 3O84A 5KYUA 5EIXA 1VKHA 2OLKA 2OHOA 1M7HA 2Z6VA 3RYIA 5BVHA 4IOKA 3VDQA 1AU9A 3KO8A 1CZNA 3WDSA 4DSTA 3W34A 4FXOA 4Y2VA 4BUCA 2HN9A 4B44A 1PX0A 1F7UA 5AVTA 3KJHA 1QHIA 5T4EA 3JASB 3L9WA 1NMEA 2VAVA 2Y1GA 4N6GA 4O8ZA 3TS1A 5JCJD 1Z5UA 1VTKA 2YWXA 3G0BA 5CJJA 2XNSA 1P9LA 2VF8A 3DOFA 4UCWA 3VO8A 2BUBA 4D0SA 5LP6F 3T1YB 3ZGLA 5B7QA 5LYJF 3KE9A 1Q7TA 3BJMA 1PTJA 5ENZA 2HZ7A 2C2YA 4XQ9A 3STYA 4AROA 3SDSA 1U8ZA 2CLFB 2CXXA 2DKOA 3QRWA 3PGA1 4TS4A 1W4BA 3E23A 4MB2A 4NJOA 5TT1A 4BJ3A 2ZWOA 5CG1A 4V0ME 1Y8ZA 4M76B 4B2LA 4F72A 4HEA1 4BQIA 1EWVA 1QTIA 4Y98A 2F2TA 4H1HA 3SGLA 2QEQA 1QH1B 4NTZA 2QG6A 4X97A 4YAJA 3NUGA 5TS3A 4QECA 4CDMA 5TPWB 3LC1O 1B1CA 1Z6TA 1FTSA 4PE5B 1D2AA 1SH7A 3H0KA 3RIGA 3BD9A 2RHBA 5FEUA 3GELA 4KQCA 5JXIA 2CT8A 3QEKA 2OCLA 4FBGA 4D0NA 4ZJPA 1WD7A 2ZVPX 3RFFA 3H86A 3LC0A 2JF0A 3FPBA 3WDKA 4F5EA 3DL0A 2WM8A 1L5OA 4RNCA 4RV4A 3B5JA 5H0IA 4F6RB 2NO0A 4ZZ2A 4D4HA 2CB9A 4FT4A 4DJAA 2OK7A 3O9ZA 1RFLA 2PJDA 1CF9A 2VKTA 4II2A 2GBFA 3EOZA 2V9PA 2YFQA 4J9VA 4BDSA 2XF2A 4M60A 3HKDA 3MF4A 1RWPA 2O4UX 3PRJA 1H8HA 1YNOA 4L8WB 3TRFA 2WNSA 1EUDA 3IUNA 2JFBA 2P41A 3H9JA 3BWMA 4LDNA 4LVNA 1GJRA 3QOFA 1CP3A 2MSEB 2WMDA 2WUEA 1FNSA 3FM9A 4FQ8A 4XAQA 3EGEA 3RVDA 2HLDD 1TAGA 1J2JA 3FBTA 4PNZA 4XIJA 5AW8A 4XQEA 4BCBA 3IUEA 3STXA 4DSAA 3GEGA 3R7FA 3TOSA 5EUCA 1EVLA 4REQA 3WYBA 2XAUA 3ZQ6A 3DFFA 4WXRA 1NQTA 5HDQA 4CLOB 3OOHA 1BSVA 1R0BA 2ZIZA 4FYHA 4QOEA 3MWDB 1DQRA 2Z56A 3KSAC 1DCMA 3K05A 4CCYA 1AKVA 2G04A 3N2ZB 5HEKA 3VJLA 3TVTA 2HBYA 2QN1A 3MWEA 3ZNPA 3WLKX 3W5BA 4AYWA 5JO9A 1NYQA 3RYFA 1ZYUA 3N76A 5CG2A 3GLFA 2SNIE 3TE6A 1Y3AA 2EFHB 5IK2A 1NIPA 2EZ4A 1ONOA 1ZEMA 1YA4A 2R6HA 1OFIA 4MKFA 4G2NA 4MR7B 2GH1A 1YQEA 2OGZA 4ILKA 3HNRA 2FZEA 4H16A 3A3PA 2XTMA 3MB8A 3TQTA 4HVLA 5KQGA 2XGOA 3KV3O 4L4SA 1NXTA 2P9FA 3WYGA 2XRZA 1I7DA 2HU2A 3SIPA 3C1AA 1XDUA 1FMTA 4HEHA 3TSAA 2OP0A 1DBSA 1E3WB 1ZI6A 2A14A 4RMHA 1KR5A 3DCJA 4GMKA 4P9NA 1W36B 4DB2A 3HVRA 3G0DA 2C2ZA 2NQ8A 3QF7A 4ZHQA 5LU9A 2Y27A 1KI7A 3E9DA 3F49S 3PKZA 4MO9A 1KZHA 4LF8B 1D1PA 3O2NA 2P2ZA 1D4AA 3AUTA 4L6AA 2WICA 2PV7A 1UMBB 1TW3A 4D3XA 1G291 4L5YA 3GLRA 2G5TA 1KC3A 1DBWA 5I7AA 3TF5A 4FJ0A 4EJ0A 3MCZA 2Q4BA 2H51A 3A4MA 4X6YA 2J45A 4MWDA 4O4HA 5BWMA 5JNUA 3SHOA 2VJQA 2WE7A 1Y1KE 1JU4A 3UJ9A 5HWSA 4JB3A 4RCZA 3THYB 2HK8A 1CXZA 2G1JA 2LKCA 1H23A 1AGNA 2EL7A 1UT5A 5BOSB 4I9FA 2JIOA 1OY1A 1YQXA 3O74A 4CMIB 1ZO8A 1A71A 4J03A 3CLSD 3OJ0A 5C31A 1P0IA 2Y0PA 4IDNA 4RBNA 2R1TA 2B34A 2XMCA 3ADKA 4LOJA 4ZVUA 3L6CA 2CXRA 1TE2A 1WCIB 3K94A 1NKVA 5CA1B 4BMXA 1I0ZA 3WWCA 3MTDA 3GQBA 2YNMC 2ZRMA 4BIMA 3DWIA 2JI4A 2AQKA 5AO9A 3RFTA 3VAAA 8MHTA 1TZKA 3KR2A 3BZUA 3KTDA 3QITA 3ANSA 4X94A 4DA0A 5L8VA 1XQ6A 3PGLA 3T7EA 2ZYGA 3WO1A 1RYZA 2W2XA 3KHKA 4BO6A 1IWBB 1UBKS 3KYCA 1KU0A 3LP6A 1KE2A 1JTVA 2ZJ2A 4G67A 5IK2D 3H9UA 3HADA 3OQOA 3S27A 5K3AA 1XMVA 1VI6A 2YQZA 4FBLA 3O0TA 3WYCA 3GK3A 4RJTA 4ZJYA 3QX9A 4WCFC 2FP4B 3IL2A 4DKJA 4E5KA 1Z4NA 3FOCA 1ORTA 3M9XA 5HZHA 3JVVA 3WP1B 2Y1DA 4CIAA 1NDHA 4ASUD 1HYHA 2QB5A 1VE5A 4D4GA 4FZ5A 2EIXA 5C1OA 1E1RA 2CLKB 1KWKA 4MH0R 4YRTA 4B43A 2XIQA 5BSVA 3ZXIA 4RGVA 4RHXA 3JQGB 5K8IA 2DX7A 1FUYB 1AS0A 1H6BA 1PR4A 2QUJA 1PD1A 2GF0A 2FWRA 2EFEB 4MIYA 4D57A 5B1EA 4DJTA 3W8EA 2QUIA 4Q3CA 1KAQA 4WZAE 4RLHA 1X1RA 1FU7A 4H7DA 2BUAA 3W8DA 2QDKA 1D6NA 1O5TA 1ZXBA 4NESA 3ZU4A 2DHRA 4R6WA 3LT2A 5IVDA 4J1QA 2XMDA 4EFLA 4YAGA 1E5XA 2P9QA 3I6QA 2AX3A 3KHUA 3WFIA 1UKCA 1VSQA 4K6HA 1R8XA 2FOLA 1SY7A 1CY6A 1M0SA 3G8CA 3M6WA 4QT0A 1PGNA 2C2WA 4MRSA 2R66A 4MYHA 3IR5A 1C4KA 3DKKA 3H87A 3PGMA 5H83A 3OPYI 3CR3C 3I5YA 1W1IA 3ZX5A 3NWOA 3DE7X 4YJHB 4DR2B 2C0CA 2VZ0A 2QXUA 1UDRA 4JROA 4JP2A 3EBLA 3OAAD 1IZ7A 2DMRA 4K8RB 3C8DA 5B5SA 4LGYA 3QK7A 3MAAC 4LBWA 2G6BA 3LHSA 1LFDB 3IDFA 1DC5A 3H2GA 3CKKA 5IC4A 2RD2A 2DF8A 3GIDA 3WVNA 4HZUA 2WAMA 1WNTA 4XWOA 5KKCA 5E1MA 4I08A 3HXTA 4AMBA 4I9UA 4LTMA 3IAFA 1NT4A 2A1TS 2CYCA 4G0PA 4Z9YA 4BO4A 1R00A 1P8AA 2J3LA 1B74A 4UBKA 5H68A 1JE1A 2JBAB 3JQ8A 3KT0A 3RS0A 5BR1A 3G9XA 1NZDA 2H8KA 1D0VA 1Q44A 4H6XA 4QXAA 2XXBA 4DRXB 1IEQA 3NBFA 4CNBA 1UKAA 3D4LA 5I9IA 2PCLA 3OD5A 4CLDA 3UYLA 1NVAA 4Q6BA 5JXWA 2IHJA 1UKYA 3WQHA 1AV6A 1X7XA 3UUFA 3DC7A 2EP5A 4JOQA 1QMPA 4ACBA 2CYAA 2GJKA 2F3PA 4ZI3A 2VWPA 3P19A 1Z6AA 1NVUQ 1DBVO 3HZRA 2I7DA 1MC1A 3K9BA 4K5QA 2Q62A 3C3AA 3VSDA 4CCSA 3A7DA 4GC9A 5DCYA 4BZWA 1JG1A 3NHJA 1QV6A 3I2JA 4D9NA 5K0JA 3OD1A 2OFPA 3GDWA 3PBKA 1XZDA 2ZKIA 2YRFA 1ULZA 3I01M 3L0IB 4G8JA 4UNSA 5P8WA 3OPYA 1MLDA 5CTAA 1GPWB 2I6SA 1ZIPA 4FVTA 4G0OA 4ONEA 3BXFA 3SK0A 3VZPA 1M74A 4W1PA 3W4IA 4PQFA 1IBMB 1G5HA 3AFIA 3ANNA 3NBQA 3OEWA 1G5FA 4KQHA 2JCXA 4NABA 1PG5A 1VJ1A 4DQLA 5JCXA 1W52X 1EX9A 2J31A 2B6HA 5FADA 1M34A 2MMGA 1HF3A 3JSAA 4IJ6A 4TRMA 3AF6A 3I8SA 1ZESA 2E21A 1F5SA 1OI4A 4JSTA 1QWSA 1DLIA 1SHKA 1VBFA 1XALA 5E7MA 4ADSG 3IQZA 3RVRA 3HVJA 1BXGA 3EQ7A 2JBAA 1RQXA 1YA8A 2LXNA 4F3TA 4A6XA 3CY6A 1I80A 1JDSA 2C42A 2IF0A 3NHPA 3KQQA 3FVTA 4JGIA 3K35A 4IIFA 2ENUA 4XQ0A 1J33A 3B38A 3U1VA 4CN9A 5CVTA 3GFQA 5WRFA 1QDUA 3QJGA 3IRVA 1ML3A 2NO1A 3CYFA 2BFOA 1NMXA 4X61A 2YCBA 1DFHA 1W19A 2DQKA 3ORSA 3SQXA 2WAYA 1A9ZA 1U02A 2FPOA 5I7FA 3K8YA 3DOIA 2QZSA 1Q2UA 4P3NA 4Q48A 4XARA 4DJJA 2GDZA 4TKVB 5JASA 2PUCA 4EF4A 2A88A 1J0BA 1GADO 2R11A 3GA5A 3PPYA 5A1JA 3ISTA 5ADHA 5HJ2A 2H9AA 1V5WA 2ODEA 3KLPX 4GQIA 3PC8C 3V1YA 3I2GA 3NT2A 2VOJA 4ZEWA 2UZIR 2C5SA 4AZ3A 4O6VA 1EA5A 4PO1A 4EUKA 3IXLA 4PN3A 4LZLA 4Q03A 4XVUA 2AMLA 3HACA 3II6X 3TCKA 4YJ2F 1JYEA 1LA2A 1M6VA 1V4NA 2OCBA 2PBLA 4CG1A 2IEAA 3NOXA 4H3VA 1C3VA 5HIMA 2O8BB 2VXOA 2R8PA 3FSGD 1PJTA 3CB2A 4P3PA 3CZRA 5KVVA 2X7HA 3C1TA 3D6FA 2BFCB 4I50B 2I87A 5H3HA 3R5SA 2H2DA 3AZQA 2QZ9A 2Y9PB 5EZYB 1QTNA 2AH5A 2HRZA 4GPTA 1C9MA 1KJYA 2VF7A 5ALMA 2IYLD 2G5PA 5AUNB 3U7FB 3Q9SA 4JXJA 1LY1A 2QTVB 3A14A 1ZOSA 2IYXA 3AONB 4G01B 4RABA 2AN1A 3I64A 3IHTA 2IVZA 4GPEA 4GX5A 2I80A 1XIVA 2R86A 2WFAA 3SSAA 3M4JA 4EECA 4LQ4A 3OEYA 1C8VB 3MMPA 3PKJA 1FOEB 4HUJA 1C2TA 4QFMA 1CJKC 4FFVA 4UJ5A 1EK0A 1R6DA 1UXJA 5F73A 2E9SA 4XM1A 1OAOA 2P77A 5CJ2A 3SYTA 2PS0A 4FLMA 4ROSA 1RLMA 4ZREA 2VPIA 1L1QA 3WBKA 1IDN1 5EYPB 3VAYA 2YOHA 1JMKC 2VH2A 4GZ3A 3GGPA 1YL6A 1WEKA 3KT3A 5BRNA 4O2LA 3DBHA 4DC1A 4DLSA 4YMIA 3KQVA 3WQBA 3PQ5A 1O58A 5B7NA 3CM0A 1LLUA 1UBEA 3WMFA 2V7XA 3IBGA 3PR2B 4O1HA 1GT91 3CUKA 1MAUA 1QC5B 2WRZA 2YMMA 3JAWA 5ES4B 1C8BA 1V8DA 2IYEA 3TNDA 4YUXA 5J4LA 5AKZA 1UWVA 3TZLA 1SU4A 3IOCA 4Q9KA 1EFRD 1CE8A 3IIJA 4MV9A 2GETA 2H4JA 2W5UA 3GJ4A 2D4HA 2YYYA 3CVJA 3ILSA 4FJ1A 2NTJA 1O4VA 1UFQA 2NYUA 3PSHA 5FL7A 4HPJB 1IM5A 1W48A 2CLMB 4P4LA 3DZCA 1E1QA 1XRLA 5AIAA 4MKXA 1PLLA 2A9OA 1JH8A 3NONA 3KB2A 3AFNA 3HKDB 5AJZA 2C4VA 3KRTA 3PLRA 4TQUS 4W5JA 1Y1RA 1QR2A 1ESMA 2WA2A 2J8ZA 1DE0A 3JD2A 4WXYB 4CCWA 3MGAA 4B7XA 3JASA 4GDMA 1YR9A 5DK4A 4OHPA 2Z3ZA 1YDEA 1FC0A 2WMOB 3IQDB 2CLEB 5HA5A 5BRAA 2EHJA 3BC1A 1PYDA 4J6FA 3CH5A 4B0OA 1IAVA 3H2JA 4BZZA 4BO3A 1W94A 2YXLA 4Z4IA 2ACVA 2V54A 2GCOA 2BJHA 2OD9A 2WKQA 1Z2DA 2JJQA 4C7VA 1RCUA 3IVAA 4W5WA 2WQ7A 2OV2A 5P21A 4FB4A 4J2HA 1MTZA 4MW0A 1FQJA 2AQ8A 4GIBA 4AKHA 4GP7A 3EH2A 3L1IA 4JC0A 4ETNA 1Z18A 4FDUA 2JZCA 3HB4X 3B9PA 3ENZA 4RETA 1V8BA 3G2JA 3J81k 4DR5B 5A04A 3EFOA 5HFNA 4BMYA 2JS7A 2MSWA 3RYCB 1RPZA 1O5OA 5FFFA 4MW1A 3SKXA 1EG7A 4BB5A 2IK8A 4Y2YA 3QUCA 3VNSA 3OICA 2BEVB 1JALA 1ZDMA 3EHDA 5CM8B 5ES3A 2VZ9A 1GKLA 2F6RA 1F3LA 3ZCPA 2QTBA 3JRNA 3ZD7A 2HIAA 1L5LA 4XI9A 3P2JA 1DX9A 1UPBA 4GPZA 2HFKA 2H16A 1DFGA 2OV8A 2XUIA 4IGEA 5KX5B 3UV6A 3H11A 4GUAA 4G3XA 3EMBA 4MYUA 3G23A 4L0CA 3T4XA 2GZ3A 1YMVA 4CTKA 3HHPA 4J0HA 3QVVA 3NRJA 2X4IA 4DSUA 1E0JA 5JD4A 3KQUA 2X58A 3HQ4O 4Q82A 3U48A 3QEJA 3EPJA 2QD1A 1V7ZA 4NV3A 4A92A 4CNQA 4MS3A 1TFRA 2CCJA 3BF8A 4AWBA 4MS3B 1D5WA 4TS1A 4WUTA 1HDRA 3C3XA 2FG6C 2JHPA 4KV7A 1Q0PA 3E8XA 3RRBA 3DZ8A 2ORWA 2A57A 5AKGA 1II0A 1O9BA 1WB6A 1AV7A 1GL3A 2WLSA 4KDRA 3MT8A 1IVNA 3OKCA 4MMZB 4Q9HA 3WAJA 1Z33A 4GHWA 3O2QB 1JJ7A 2OG1A 2OHFA 5ALQA 1B8OA 1LSUA 5EMNA 5FI5A 1ORHA 1ZINA 4J7UA 4RMIA 3NJ8A 1POXA 5KTSA 2UXCB 1LNQA 2DUJA 3FPEA 3UHAA 1GU1A 1GKUB 3EAQA 2WG0A 3AOGA 3IEPA 2J9ZB 2ZAIA 4KJXA 1DIAA 1P19A 2I3DA 4MVJH 4ZVNA 3L0YA 2ATCA 3CLUD 4JUCA 1DG1G 4BYGA 3LQ1A 1JVBA 3RIMA 5FWNA 2PKCA 4KGZA 1E6CA 5EHQA 4EG7A 3QW2A 1UK6A 2NO6A 4L8YA 4JSYA 3UMRA 3A8TA 1Q1EA 2DUMA 1JEOA 1J21A 5GV8A 4I5DA 3T0IA 3HUTA 2VHTA 4RENA 5JG7A 2WWVD 4YYZA 2D74A 1Y3BE 4HFJA 4AJKA 4AT1A 1MRZA 3L8YA 4CZ2A 2NX2A 4E3ZA 4YRSA 4UOEA 3SFVA 2VK1A 1MC8A 2JAPA 1XVLA 2ZBDA 3B7GA 3OQPA 4G25A 2AJ8A 3AL3A 4PAMA 4ZOLA 3ZXYA 1JDBC 2CD7A 4M98A 4DV1B 3EXHC 3UG6A 3HU1A 1E4EB 3GG9A 5CVVA 5D51S 5B1SA 3HCOA 3PQ2A 4L74A 4CQNA 3RJZA 1TO2E 3PTZA 2F7SA 1JKFA 3FDZA 3NG1A 2GN1A 5E6RB 1ONSA 4RYDA 4EZEA 1UBGA 3KQKA 2AFRA 2BFAA 1K7CA 1R10A 1FNBA 2PX4A 4RGBA 1CR6A 2IW3A 1YRYE 2BW0A 3VUEA 2XDWA 2VQEB 3H65A 1G16A 4ZXPA 2IDJA 4G5SA 5GZ1A 5G4KB 3GHYA 1VRCA 3G79A 3NTLA 4L4XA 3SQOA 4ZVOA 2B8JA 1Y6ZA 5TEWA 3MG9A 2VP3A 2P2GA 1CE8B 3A1UA 3AEKA 1E4OA 3D4OA 3TQHA 3AT1A 5IF3A 2GZSA 3PTLA 2HK9A 4Z4GA 2BC9A 3W9YA 1OHHA 4FK8A 3AP1A 3MS2A 1JLLA 3DP7A 4DIKA 1PZNA 1VL8A 1MH9A 1IWOA 2A9FA 2NWQA 4RXMA 2Y1EA 4HEA6 1E3JA 1Q3KA 2F62A 5EOVA 1E6MA 2XCRB 4IINA 2I8LA 3OZBA 2X1VA 1YUNA 1JKJA 2DERA 3AV0B 4Y6QA 2EKDA 5H80A 2WWWA 2GD2A 2QXTA 3GFPA 2EFGA 4ENVA 3JATB 3LY9A 1ODKA 3LKZA 5FPQA 3RAGA 1J9ZA 4LSWA 3V2IA 4I81A 2JH9A 4N03A 1M8PA 4G9BA 3A3NA 2VPWA 1W1WA 4YV2A 2HJSA 5FNVB 1ORRA 3UYKA 1IEWA 2YWHA 3GEBA 3CT4A 4UFOA 3W5IA 4C0XA 2VDWA 1K4KA 5SYAA 1DDOA 3KQWA 1ZOPA 4X6LA 3AL2A 3O5AA 2ZE7A 5EJ4A 1PZMA 3LPAA 5K99A 4KE7A 4EARA 2PT6A 5CAEB 3AHEA 1PGOA 4Z7OB 1NN3A 1O97C 3S8EA 4GKJB 1KRXA 1W5EA 3B6EA 1OT5A 3ZK8A 3V7UA 2DM6A 2PMKA 4OQFA 2QY9A 5J4VA 2FPPB 4BPRA 5DEOA 1KEEB 1ESZA 1T36B 1ZA1A 2XB8A 4YUVA 1SVUA 2MOKA 3LG2A 4G1UC 3R3WA 3U3KA 1FEZA 1D8AA 1LZLA 3M9WA 3SI7A 3PX2A 2FQXA 3ZHUA 5ALXA 2AXNA 1D9ZA 1OLXB 3EEYA 3Q2IA 3GRFA 4NYMR 4A91A 1PWXA 1F20A 3EXEA 3PRKE 3R3JA 3GNLA 5H70A 3OU2A 3WC4A 3I9KA 1P9WA 2HYDA 4O4JF 1CDZA 2CL0X 4BNKA 5C8VA 3NYIA 1Q17A 5TXGA 3CX4A 1Z7YA 2IYRA 2IUSA 4TTVA 1UP6A 4K1LA 2VYQA 5I5EA 1HM5A 4FGWA 1ZCFA 3Q3VA 1DHTA 1KL7A 3D6UA 3ONVA 1RQ7A 5D3MA 3T5CA 2QRGA 3NBXX 4Q3LA 3A32A 1MW8X 5A6SA 1WHSA 2HF2A 3RFCA 5LQJA 1E64A 3KXDA 4HQOA 1N75A 1MRNA 3IQHX 5C51B 2CC2A 3PGJA 4U6SA 4R01A 4B7AA 2V7WA 2ZRIA 3B6JA 3FLAA 3IBCA 3JQ7A 3K6KA 3LWDA 1ECGA 5JLAA 1KE1A 3ZTTA 4F4DA 2ZXUA 2JRLA 4K6GA 3CZAA 2ECQA 1DRJA 1V4BA 1HEYA 3HUUA 2NIPA 1NZFA 4R2HA 3SE0A 3S8YA 2VLIA 4PX2A 1BVYF 3SM9A 3FWYA 1AO0A 2JFPA 2WZBA 1FSFA 2IY9A 3O8QA 4JBIA 4EHIA 1NV9A 3AUUA 5BN5A 1U5AA 1YE5A 1GY8A 4YMGA 2YDYA 2FWNA 2YW9A 3FH0A 4B3FX 2JAOA 1X74A 1Z38A 4BO7A 1U4SA 5GJBA 1ECJA 2P5UA 3EH1A 2Q0QA 4KAFA 1SKUA 1K6MA 3FNEA 1N7JA 1R6VA 2DFKB 2XUJA 5LPNA 2VEOA 2FDXA 1T1JA 2PFGA 4L15A 5GWXA 3A37A 2JD1A 1AS3A 1JUDA 2AX4A 1E9SA 1C0IA 3QEAZ 4QJ3A 1QS0A 2M1XA 2WTNA 4MV0A 4EVQA 1SK8A 2ZBGA 4F7WA 4GKAA 1EDEA 1QORA 5EPOA 3L6OO 2HCBA 4M2LA 1FLVA 3T5BA 4BMPB 3TLJA 3A1NA 4URWR 1FFXB 5LDDC 1TM7E 1SQSA 1T3SA 3FWHA 3TNJA 4D9GA 1G2PA 1JAIA 1ZNQO 4QFBA 2BKXA 2WSLA 4Q19A 2P0EA 1FJ2A 3IC5A 3AYZB 4GX2A 1VCIA 3GUCA 3WNBA 4C0SA 2ZIXB 3LBHA 4IEFB 3ZBTA 4DA9A 3OZGA 3OOJA 3H8JA 1N34B 4MZDA 1K6XA 1JHOA 1JDVA 2IP1A 2D2EA 4C76A 3OKPA 1ODIA 1T6ZA 2DBVO 1NN5A 4ICIA 1JEDA 1JIJA 3ZNOA 3S1LA 3PJEA 3HYRA 5B58T 2AD5A 3IJPA 4H4CA 4Q16A 4R1TA 3S2UA 2BZSA 2ZYVX 3M8KA 4IHJA 1Y3IA 4K2HA 1DIOB 2XR1A 1KH1A 4QKQA 4UQLA 2BGLA 2A86A 5E7QA 4YJKA 3W6NA