3UUGA

Crystal structure of the periplasmic sugar binding protein chve
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
329
structure length
329
Chain Sequence
DKGSVGIAMPTKSSARWIDDGNNIVKQLQEAGYKTDLQYADDDIPNQLSQIENMVTKGVKVLVIASIDGTTLSDVLKQAGEQGIKVIAYDRLIRNSGDVSYYATFDNFQVGVLQATSITDKLGLKDGKGPFNIELFGGSPDDNNAFFFYDGAMSVLKPYIDSGKLVVKSGQMGMDKVGTLRWDPATAQARMDNLLSAYYTDAKVDAVLSPYDGLSIGIISSLKGVGYGTKDQPLPVVSGQDAEVPSVKSIIAGEQYSTIFKDTRELAKVTVNMVNAVMEGKEPEVNDTKTYENGVKVVPSYLLKPVAVTKENYKQVLVDGGYYKEDQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Multiple sugar-binding periplasmic receptor ChvE
publication title Agrobacterium tumefaciens recognizes its host environment using ChvE to bind diverse plant sugars as virulence signals.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 137
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uugA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uugA02
1BA2A 4O5AA 2L2QA 4MLCA 3I45A 5JS2A 1W25A 3OO1A 4O1IA 3RVOA 1BDHA 4Z4GA 2PUEA 3OLZA 5EWJB 1JF8A 1SXIA 3QK7A 1NXOA 3RVLA 3HM9A 4KREA 3RVPA 1CEYA 3OLYA 1KRWA 3GT7A 5FWYB 3H1GA 4RKRA 1GCAA 3MMNA 5IC5A 1EAYA 2NZVG 5BRJA 3TB6A 3A3KA 3QLUC 1D1PA 4KVFA 3BILA 5TE9A 4E7OA 5TQ2A 1DP4A 1W9HA 4OLAA 2NT4A 2A9OA 3QEMB 3FFTA 3BBLA 1H9CA 2LP4Y 2E4YA 3M9XA 4MPTA 1E6LA 1JWLA 2CHFA 1LJLA 5BR1A 2RJOA 3O2SB 1NXSA 3KHTA 1ZDMA 3KKEA 2DRIA 5KC9A 4N47A 3MF4A 3RQIA 2PL9A 3GRCA 3LMKA 3JTEA 3W9SA 3QELA 3I09A 3DLHA 4PYRA 5BQ3A 1D4ZA 4Z99A 4GPAA 4ZMRA 4MS3B 2QV0A 4RK1A 3T6KA 4EVSA 3FFWA 1JLKA 3EDCA 4YO7A 2PL1A 3JPYA 3M6MD 1P8AA 3OMWA 3BRSA 5CNKA 3RVRA 1YTUA 4ML3A 4Q7EA 3HZHA 3QX8A 3LTEA 2NT3A 1NXVA 2RGYA 4MR8A 3RVSA 4XXHA 4MLDA 5KQMA 2L17A 3S99A 1PNRA 4N76A 3OLXA 1BVHA 1K68A 3O75A 5DGCA 1VRVA 1NTRA 4Z4CA 4MQEA 4FE4A 4IRXA 4ETIA 2CD7A 2B1JA 1M2EA 7ABPA 2LPMA 4M88A 2JBAA 3GBPA 5KC8A 3QLVC 4HNQA 4MR9A 5CNIA 4F11A 4NCBA 3LUGA 4Q6WA 2HQBA 3H1EA 5B3JC 2GBPA 4RY9A 3UKJA 1Z16A 3O1HB 3E61A 1JYEA 2FEPA 2FMHA 1GUDA 5FBHA 3LKVA 1DG9A 1DRKA 3CZ5A 2KYRA 5TQ2B 4N0PA 1E6KA 4MAAA 4OLBA 1QNLA 4KQCA 3CS3A 2PUGA 1LJUA 1JL3A 3HVRA 2VUIB 3H5TA 3DBIA 3EAFA 1QPZA 3KS9A 2B4AA 3HO1A 5GOTA 2IPLA 5I4CA 5IULC 4JB2A 5IUNC 4EGSA 1R8JA 1L5YA 2LIVA 5FBKA 1MB3A 4G86A 1MVOA 3HK2A 2QVGA 4KK4A 1P2FA 4QPJC 1J56A 1KGSA 5PNTA 1LBHA 1ZGGA 3KLNA 2N9UA 3QELB 4JA2A 4YRZA 2HQOA 5TPZA 2GKGA 1IIBA 1Z17A 2QSJA 4RK7A 5TQJA 1GUBA 4YLEA 2A9PA 1GCGA 3LUAA 5CNMA 3LUCA 3IP7A 3Q7SA 3M9WA 1DCKA 3C3WA 3K4HA 4LZLA 3N75A 2FLWA 4RV5A 4Z0NA 4IGAA 2HSGA 1APBA 4RY8A 1NXTA 3SM9A 2WB4A 4G0XA 4MR8B 1JDPA 1JBEA 2JB9A 2FN8A 1EWTA 1DC7A 1F51E 2YHBA 3GA5A 2FMIA 4Q6BA 3MQ4A 1E2BA 2MYNA 5KI6A 4EYGA 2FVYA 3EGCA 3E3MA 3H1FA 3I42A 4W5QA 2JBAB 4QYMA 1K66A 1PNTA 2IDMA 1SXHA 3LOPA 4MR9B 2FXIA 3KTOA 1FSPA 3ROFA 3OLVA 4MRMA 1D2AA 2WRZA 3IDOA 2QVCA 3NNDA 2FQWA 3GV0A 1MB0A 4EY3A 1JX6A 3H6GA 4F12A 3IPAA 1Z18A 2FTKE 4Z9AA 3CG4A 3OO0A 3T95A 4W5TA 4NQRA 3HCWA 2WMYA 2BGGA 4DN6A 2PE5A 2PUFA 2QXYA 1NY5A 4FE7A 4IMJB 1OXBB 3FGZA 4RK4A 2ID9A 3A0UA 4H60A 3OLWA 4N0QA 5IBQA 4LDZA 4S04A 3NHZA 3F6CA 3EQ2A 1SXGA 2E4ZA 2HQRA 2PKXA 1NXWA 3GWGA 5GQSA 3Q7RA 1DBPA 1GLGA 4Z4IA 2IPMA 1ZESA 2LUOA 1DCFA 5IEBA 5DCLA 4IILA 1Z13A 1DBWA 3TMYA 3OQNA 3JVIA 4LE1A 3T8YA 3CTPA 4ZJPA 3QLTA 4IF4A 4QICA 1URPA 2R47A 1A2OA 3EODA 4EVRA 3HV2A 2AYZA 4JASB 1PEAA 3H5IA 4L4UA 4LE0A 3GBVA 1M5UA 4N03A 4NICA 4PZ0A 2WJAA 4HNSA 5JNVA 3T38A 3OMXA 5KQPA 1DRJA 2MSWA 4LRQA 3C6QA 1L5ZA 3JY6A 4WXEA 1JYFA 3L49A 2F8TA 1YMVA 3HSYA 3BRQA 1RZRA 2FMFA 3JVDA 4RY0A 3TX6A 2F8SA 1RZRD 4PE5B 5TPWA 2QW1A 3G85A 4MRMB 4RXUA 1DZ3A 1JFVA 4KPYA 1U8TA 3C3MA 4RDCA 2ID7A 1AB5A 1QQBA 2VUHB 3HEBA 3H5OA 4GNRA 1YVUA 1NXXA 3NBMA 3SY8A 2MYUA 2WWVD 3B2NA 1VKRA 4XAQA 5CNJA 4WZZA 1Z25A 2MSLA 3D8UA 3N0XA 2RDMA 4WT7A 2P9HA 4G97A 4MQFA 3IPCA 5CHYA 3GYBA 1TLFA 1JFSA 1YMUA 1P6UA 1B00A 4EYQA 2FQYA 4RU1A 3P9YA 4HYEA 5TQ0A 3CLKA 3GL9A 1RPJA 4YP9A 1BDIA 4YGXB 3RVMA 2W42A 1T34A 1FFWA 2CHEA 4RWEA 1U2QA 3N0RA 1KMIY 4ZPJA 2MYTA 2QU7A 2FMKA 3O1IC 5JNUA 2Q5CA 2MYPA 5ABPA 1Z15A 3CZCA 3D02A 3NHMA 4PICA 3CKMA 4YR7A 1JDNA 1Z2DA 5T7BA 2V0NA 2PLNA 2QR3A 5TPZD 3KCNA 1U04A 2XDYA 1VLZA 3OQOA 3F7NA 1MAVA 2PAFA 4RZSA 3KYIB 5FWXA 1NATA 5JNWA 4B09A 2E4XA 1A04A 3JPWA 2PUAA 4TLLB 1ZH2A 1RXIA 2FLKA 4Z9BA 2H3HA 2IYNA 1DJMA 1SD5A 1FQWA 4S05A 1XHFA 3FMVA 3K9CA 2PUDA 3VNBA 2NUBA 1DCMA 3I5AA 4TLMB 3LUHA 4XASA 1ABEA 2JVJA 2FKAA 1I3CA 2I6FA 4JAVC 5TPWB 3DLBA 4UHJA 5IX8A 4MQEB 4JB0A 1YIOA 1JH9A 3UUGA 2GWRA 5JNRA 1U2PA 4MS1A 4KK3A 5HSGA 2H0AA 1QP0A 1UDRA 3KJXA 5EWLA 4ETNA 3ILHA 1ISSA 5HQJA 4OBBA 1RNLA 3ILYA 4MQFB 5KWSA 4MS3A 3UK0A 4F06A 3EJWA 6CHYA 2R4QA 5IUKC 3MYYA 1F4VA 1CHNA 3TO5A 3RVKA 2R25B 4W5OA 3O74A 1YK0A 5KQGA 2M98A 1U0SY 3RVQA 5JNTA 2YHAA 3NNNA 1JFTA 5TQ0B 3O1JC 3RH0A 3CNBA 3HUUA 4H3KB 1USGA 1Z12A 4W5RA 1PEYA 3CRNA 4PEVA 3Q7TA 4RKQA 4EUKA 4MR7A 3BREA 2MSKA 2RJNA 3HS3A 3NNSA 1D5WA 2J48A 3OM1A 4RK0A 6ABPA 3LUJA 1C0EA 4MS4A 9ABPA 2PMCA 1C4WA 4G0ZA 3IP6A 4XFKA 4YS6A 1BAPA 3Q41A 5FWXB 1CYEA 1M5TA 2QZJA 2O20A 5D2CA 4G0MA 4IMIB 3QLUA 1EHCA 4G0PA 4LX8A 4E7PA 3DGFC 5C5EA 4FB4A 3F6PA 1WETA 2FN9A 2IPAB 3EULA 5IUJC 2JVKA 1M2FA 4RXTA 4YV7A 2VK2A 4YWHA 3IP5A 2OENG 4N41A 1ZITA 4EYKA 5EWMA 1ZH4A 3H5WA 3QX9A 1ZGZA 1ZVVA 3IP9A 2X7XA 1ZN2A 4TMYA 2E4VA 4D6XA 2A9QA 3ROTA 4RSMA 4MS1B 4KZKA 1RXEA 3O2JA 3RVJA 4DQDA 1DBQA 3N0WA 4G0QA 1QO0A 5EWLB 1PUXA 3C97A 8ABPA 4WUTA 4MGEA 3F73A 1QO0D 4G0OA 3QEKA 2FW0A 3EQZA 4KNYA 4ZYLA 2OQRA 4QYWA 3SQNA 1E6MA 2P4UA 3N8IA 1FFSA 4OATA 4W5NA 3JS5A 1SRRA 3HDGA 4NV3A 4UHKA 4D6YA 3KYJB 2FEWB 1QMPA 4Z4FA 4O1HA 2L18A 1ZY2A 4WXMA 5JNSA 1S8NA 5JS1A 5DKFA 4P98A 3MM4A 4P1ZA 3MA0A 5DTEA 2PUBA 3DGEC 5KQLA 2FQXA 2GI4A 4RK6A 1EFAA 4CBVA 2JRLA 1YS7A 3HUTA 4XARA 4MR7B 3O21A 4OG2A 1TMYA 1D1QA 3HDVA 3H5VA 1TM2A 1YK1A 2NZUG 1HEYA 4KFCA 3LUFA 4RK5A 1MIHA 3QLVA 4MS4B 1Z2EA 2CWDA 2HPHA 3O2QB 3KG2A 4RXMA 5HKOA 1NXPA 4F8JA 3CHYA 2IKSA 5B3JA 1USIA 2R48A 1JHZA 2GX6A 2WJWA 3FFXA 3OM0A 5E3JA 4MYRA 5IEJA 4LE2A 4JP1A 5C5CA 1FFGA 3A0RB 5EWJA 4KQ9A 2ZWMA 5F64A 1A0OA 1LK0A 2HJ9A 5FWYA 3OQMA 3KSMA 1ISRA 3LUDA 4XLTA 1EWVA 3H6HA 3Q15C 1ABFA 2JCGA 4RS3A 5EWMB 1ZHHA 3QEMA 5T3YA 2IPNA 3DZDA 4LDAA 2JVIA 4OTZA 3VNAA 4EVQA 2PUCA 4EYOA 4NCAA 3R0JA 3LFTA 4G0YA 3H75A 2JK1A 1PHRA 2ZAYA 2IOYA 4KRFA 1EWKA 2A9RA 3SG0A 2AYXA 1Z26A 2FSPA 2TMYA 3G1WA 4JOQA 4KMRA 1QKKA 2LBPA 2L19A 3LKBA 2PJUA 1XWWA 1P6QA 5DLEA 4D74A 1ZAYA 3SNKA 4Z4HA 4F3TA 5HM6A 2M1ZA 3MIZA 3CG0A 4H3HB 5ED4A 4HNRA 4L85A 3A10A 1QQAA 3HXMA 3LUKA 1KRXA 1TVMA 1TJYA 1LBIA 3KLOA 3SAJA 4ETMA 4Y9TA 3FDFA 3Q9SA 1AB6A 1BDJA 3RVNA 2E4WA 3URMA 1USKA 4YCSA 3N6VA 3N53A 4WWHA 2WY2D 3TD9A 3HJFA 3H5LA 1VPWA 1QP7A 5BRAA 4Z4EA 4DADA 1YS6A 1XHEA 4TN5A 3CU5A 4KV7A 4ZMSA 1Y1LA 3C3KA 2VYCA 2E4UA 2FEKA 1OXKB 1DC8A 3CFYA 1QP4A 3L6UA
chains in the Genus database with same CATH superfamily
1CQZA 2C7VA 3T7TA 4Y9RA 5EVJA 4F71A 4BZQA 3JTMA 5BW6B 3MOSA 1W25A 3MJCA 1SM4A 1KDVA 5EZYB 4G6ZA 4UDNA 1PNOA 1OU0A 1QNFA 2A4KA 4UTZA 1JR4A 1QRDA 2BSAA 1SXIA 3EVTA 2H2IA 2ODNA 2NVWA 2ZJ7A 3BB4A 4ZT3A 4ZT6A 2P0AA 4DF3A 4AY2A 1U9JA 1TEVA 4F7WA 3CUTA 3EG9A 5E6UA 1ZNQO 1E2MA 3Q3HA 4FZ3A 1M34E 2XB4A 1RQRA 2ZRFA 4IIYA 4K46A 2D0PB 1BX3A 2N47A 2ZR9A 4MNTA 4OCZA 1D0SA 4PR0A 3P2IA 3VHXA 1EHYA 1TTHA 1LA2A 5ALTA 3ZVKA 4LRSB 1VI2A 2ZVDA 1IBRA 1KZ1A 2NT4A 5LMZA 3Q7EA 2OORA 1OT5A 3K9LA 1CVLA 1NFQA 1FP4B 4EMUA 2BFFA 4ESHA 2ZTSA 1F48A 1JHQA 1QOZA 4LHYA 1N5MA 3GMSA 4E51A 1F9EA 2QTVB 1P1JA 1ZZGA 2XWPA 3N3AC 2G1JA 3UOWA 1PQUA 3WNQA 4GWGA 2RB4A 1LF5A 3GUCA 2P8SA 3ONFA 4TTJA 4Z3DA 4BMVA 4EHLA 3PSAA 4ENSA 1MCZA 3LMKA 3D6AA 1HFWA 3JTEA 1A69A 1CBUA 1R9GA 1QIHA 1ODCA 4IGKA 3CB2A 1UFOA 2FSSA 1UAYA 2XOKA 2YZNA 3AUAA 3B9PA 3DT6A 3KPJA 1TCCA 2IEZA 2FZLA 3R77A 4OGWA 2FZEA 3S8YA 1C1DB 3M6MD 1NR5A 2VCHA 3OMWA 1BN6A 3UB2A 1I5EA 4EQ6B 1MTOA 4ML3A 2ILTA 2YQ4A 4B4KA 4UUMA 3SOPA 2XXAA 1E5TA 4CTOA 4PSVA 1OYOA 1Y8CA 1VIAA 2X6TA 4L76A 1DEXA 3BMQA 3MD0A 2CLIB 4CWAA 1IUPA 3I3SR 1KORA 2GAJA 3U1BA 3VTZA 4KUGA 1VRVA 1NTRA 3ZWBA 2GRJA 2O8DB 4NCXA 4I81A 1NV8A 3NQ41 1M2EA 4JWTA 4LV5B 1T0JB 1RI1A 2QRZA 3LLMA 3NVDA 2OPHA 2HDNB 4Z9YA 2HL6A 4BRSA 4C5AA 3I2KA 4MR9A 2AKAB 2O3QA 3LUGA 3WLHA 1FPMA 1HMYA 3PGKA 2EX1A 1ESNA 1PFKA 1FLDA 4CVNA 1ZK2A 4LNHA 5KWIA 5ICEA 5L3VA 3CUKA 2C5EA 1YDEA 1ZA2A 3JWHA 1G9TA 3OT4A 3TAUA 5I9LA 1DG9A 4WJKB 4X9XA 1EPUA 4QBIA 1H6AA 2XB2A 2JGKA 2TMKA 3PNMA 6GPBA 1ONOA 1UF9A 3CS3A 4MTCA 3WLJA 3FYUB 2Z8YM 3T4XA 4ILKA 2NZWA 3DZCA 2DFNA 3SHOA 4FPXA 4JB2A 2P4QA 4KIGA 3BMNA 5JAHA 3ICCA 5DHUA 1GFIA 4G0UA 2YUIA 1HDCA 3JZIA 4OOFA 3EVAA 3JARB 2H08A 1ESMA 3WWEA 5CEFA 4FFVA 5LKAA 3VH4A 5IPFA 4E5KA 2PQ0A 4PR3A 1PLKA 3Q1KA 4QOGA 4B0OA 4QBGB 4N6GA 4B79A 4YDQA 1IIBA 5E7MA 3K15A 1E9RA 3TEJA 1NPDA 1FYEA 4JLUA 3DEZA 3R8FA 3PVCA 2VQFB 4DR6B 1HQKA 1OI4A 1CY1A 2Z56A 3T9AA 4BMZA 3TKAA 1RM0A 1HTWA 1Z4IA 3ZDQA 4OSOA 3P96A 1UZNA 1APBA 3A4TA 3GR6A 1XZBA 3M4YA 3TUJC 3HGMA 1EBUA 1BCRA 1A4UA 2G4CA 2ISQA 3QKSB 4HRXA 1MB4A 2MSEB 3NT5A 4L9RA 4NS1A 2WHYA 3EA0A 4OHPA 1CFZA 1I3LA 3WYFA 1NUSA 4Q6BA 5FAKA 3PLNA 4CEIB 4Y2RA 1Z3CA 4MITA 1RYFA 4IDFA 4LXYA 4S24A 5IF9A 5JEEA 4JQCA 4TWZA 4ARCA 4OJKA 4CCYB 1X9HA 1L7QA 3ECCA 5CA0A 4LSMA 2QQ0A 2JNWA 2X76A 4WEOA 2R7KA 1GVNB 4ZCTA 2Y1XA 2XMBA 3MWEB 4N48A 1YU6A 3QA9A 4CFSA 1CSEE 1LY1A 2I6QA 3L7YA 5HCUA 2FQWA 1Q0LA 1UKCA 1I3KA 2V7UA 5MFZA 2CFIA 5DP1A 2NUPB 3TVTA 4R98A 3ZWOA 4W7IA 5C34B 4U7PB 3WLLA 2OBMA 3FPJA 1W36B 4XW2A 1U90A 4HL6A 4BLSA 4W5TA 3W6OA 5H4GA 4GF5A 1XGKA 4TMZA 5JLAA 2IXBA 4FE7A 4QG7A 1XK6A 3SK0A 3K0FA 1GGMA 3RC7A 2HX1A 1EVIA 1S7CA 2WD7A 3TZKA 4KEAA 2IYSA 4E07A 1XLWA 4K9NA 2OORC 2QAJA 3EXEA 1GCOA 1GG2A 2OHIA 3FUVA 5CB8A 1JVBA 3BHMA 4J1SA 4LJ8A 3KQVA 1WDMA 3TW0A 4NYMR 2ZBPA 3VX4A 1E58A 1L4KA 3GUYA 3JAKB 2XMDA 4Q3BA 1NM5A 4U2CA 1X94A 3A1WA 2BGJA 2O23A 3KX2A 3REQA 1B3BA 4MVYA 4R68A 3L6DA 3TEFA 1G2PA 2CJFA 3GDHA 1BXZA 3PCRB 3ZZUA 3IAFA 1EM8B 2V5AA 2Y6VA 3FMPB 3FRHA 3KR1A 3VR3D 3G9UA 1U7XA 4M1QA 1CR0A 2G0TA 4MVCA 3UY4A 3L92A 4B40A 4FXPA 1YNOA 3HE3A 1L0BA 3V33A 4AUNA 1NYRA 3VJRA 1SK9A 5EIXA 1U0RA 4IF4A 5DNEA 2QJRA 3U40A 2OXRA 1UJ4A 3NT2A 4X95A 5EXEA 2VFAA 3QKTA 4NICA 2QRMA 3ZXXA 2CDNA 2HU5A 3JQAD 5HUJA 4YJ3A 3DHWC 3FUTA 5BVGA 4OA8A 2BHTA 3QA3E 3VXKA 5FLXA 2X0DA 2F59A 3OFKA 3ZQ6A 2QRHA 1XMXA 5LUBA 1FX1A 2YHIB 3JD3A 4KIUA 1RWBA 1PSDA 2C4HA 2W5UA 2ZSFA 4AKSA 2QEQA 3NHUA 1QGUA 4OMFG 4BVGA 4PINA 4QVIA 3ZGOA 5BYKA 2FEMA 5CXXA 4LBWA 1E5QA 2XXJA 4PANA 2XQVA 4KO3S 3QG5A 2PCJA 1K7SN 4QDOA 4F93B 4DUYB 3HWX1 4V1CB 1GV0A 1MIOB 1HLGA 4L27A 5A6VA 3RYCB 1TL7C 4KYTA 5CB4A 2B3TA 3OU7A 1N5RA 5KNDH 4JSRA 3EF1A 5EP2A 1MABB 4I5DA 4HH4A 5DBEX 2E6KA 3ON5A 4HN9A 4HYYA 4LTDA 3TLZA 4C7OA 1SBYA 3QJYA 1OX6A 4E5PA 1VE6A 4KQKA 1EP3B 2FUCA 4PG4A 2X0NA 3GYBA 4EHIA 2HPVA 1YFZA 4M1YA 3NXSA 5HM8A 2QG6A 3ZBUA 3FCEA 1WR8A 3ZYZA 2ZJ6A 4M6WB 2J9FA 4MCIA 1T2DA 3PDWA 4KN5A 5F78A 1U1EA 5CVUA 2HH9A 1P6UA 1YCFA 2R2AA 3OEWA 5HGJA 1TO1E 2EHDA 5BYAA 1PSWA 1FC0A 4G67A 5LQUA 2B78A 1HEIA 1OW3B 2O2SA 3W2HA 5AI4A 1D9ZA 3JW8A 4UEWA 4B82A 3JD2A 2QQEA 2X4GA 1E4EB 2HSDA 2ZFUA 4OAQA 4M4SA 3K6SA 2MYTA 3ENNA 2PR2A 1XDDA 3TL6A 5ICMA 5JE8A 1HK7A 3LO5A 1MVNA 3QXHA 4ER5A 4ONEA 4CODB 3CPSA 3RSGA 2YC4C 1I1NA 3MN1A 4KWIA 5FOVA 2QWXA 1JEDA 4GMGA 2B4KA 4BMYA 2OE2A 4TV9F 2VHCA 3U4IA 2PLNA 1NJ8A 3X1WA 3SS8A 3SVTA 1K92A 2CKMA 5KSWB 4D4JA 1N8NA 3TM5A 3CUSA 2P75A 1UBFA 4DLYA 1U7WA 3QVTA 5DSXA 2ZDGA 1Y8AA 1XHFA 2WVHA 4PX5A 4NYMQ 5EFZA 1XRLA 1ZGJA 3B48A 1B41A 1V8PA 2PZBA 2C2OA 3CRW1 3IUNA 2JIMA 4LHEA 4UJ3A 2DPYA 2FFHA 4FHEA 4XASA 4OHCA 1AV7A 1OFIA 2FPIB 2WKPA 3KFVA 3TE6A 2JGLA 2XHZA 4ALIA 1OWNA 1PGOA 5IAKA 3R7WA 2VUTA 4RL6A 1RSZA 3GQBA 4RHXA 1BQ4A 5B4VA 4JL6A 3V8PA 3ILHA 2FR8A 3GB9A 4JBHA 1CUZA 5B6IA 5L53A 1KTIA 1B23P 4E3ZA 5BW5A 2DLDA 3GDGA 5JYDA 3GN1A 1FX0B 2BDTA 2AD5A 3EG5A 4AP5A 2Q1TA 5IUKC 5C1PA 4JYPA 3GZNB 2VDOB 3DAGA 5EA2A 5B3AA 3SC2A 3X2FA 4D1YA 5IVHA 3V80A 2C0PA 4RANA 2OCBA 3K1ZA 1SUSA 4LSZA 3MJ4A 1Y4AE 1E9FA 1V1RA 4GOND 4JLPA 1LBSA 4QL3A 5J2TB 1CUWA 3EZGA 5FBWB 2WAYA 3L0OA 4H3KB 5LYJA 2Q8NA 3EDYA 4CHGA 4RMNA 2OQIA 3FKSA 2BSQA 5I47A 1WNFA 1QP8A 1B14A 1T1EA 4F3RA 2SHKA 5EY5B 1FIUA 1EXWA 2HB6A 4MR7A 2IOFA 3RAFC 1G98A 5F52A 4CUZA 3RSCA 1YZQA 3P45A 4KQIA 4UCFA 1NM5C 3QPVA 2H2AA 1U2TA 5DIZA 2PMCA 2IHYA 1XYVA 4BO0A 2CXHA 2EQAA 6YASA 1PQPA 1NBME 4UW9A 4WGFA 2APJA 3Q41A 2JEZA 2D3TA 3HYNA 4TMTA 1B6SA 3TIIA 4UVEA 1X2EA 2EJTA 4RZXA 3QLUA 3K8ZA 4GRDA 2Z0MA 2FWMX 5KINB 1U5BA 1N8SA 1RXUA 1W30A 2PIAA 1EJ2A 2TS1A 1HE4A 4K6HA 4WCDA 5ENZA 3WJ2A 5AKKA 4NJOA 1OWPA 4FMPA 5FFFA 3Q9LA 3O4HA 1KY3A 1O95A 5J59A 3VSDA 5IUJC 2WU4A 3DV2A 5AOCA 3P9RA 2WLTA 5DI3A 1F0YA 4QFDA 2NG1A 4YWHA 4P4GA 3T99A 3V4PB 3KXDA 2Q9AA 3M1LA 1T9DA 1VKZA 3MBIA 4MUNA 2DU8A 3CLSD 4MVWA 3SN6A 3SJAA 2J07A 4N3AA 3E5NA 2EKBA 3NGXA 3CT6A 4FYWA 1KVSA 2RHGB 5SYAA 2ZCUA 1T2CA 2AFIE 4XX1A 2M6SA 1O94A 4MV6A 2HA7A 3FD8A 1N5KA 1QUFA 2DPGA 4BNKA 1WQ3A 3A1FA 5EQFA 1BFDA 3WL6A 3WTBA 1H93A 2W2NA 3K70D 3U3KA 2IT1A 4I50B 4LF7B 4QA9A 1T4GA 1J0BA 1THMA 5JAMA 4W5NA 1KRWA 1XCGB 4RJTA 4IHKA 1P19A 1QMPA 3SFTA 4DLPA 2L18A 1VMAA 2P3QA 3PUZA 2EBHX 4LW8A 3TLMA 3TR6A 2VQEB 4HWPA 4P98A 4EMSA 3MM4A 3MA0A 3ZVRA 4JUCA 4L6CA 4R5MA 5KMGA 2BRUA 2ZIFA 2XGGA 3T3DA 4YASA 4DQLA 2WMOB 1S2IA 4UZSA 2RCYA 3DH0A 5T67A 4L0MA 3KXKA 1DS6A 1PKXA 2GILA 3MMZA 4UUNA 3QU9A 4XJSA 2Z4RA 4FDVA 4CMEA 1R7RA 4TKMA 2R84A 3LUBA 5EE9A 4R9SA 5DBHX 2VPQA 1PJSA 1ULTA 1CULC 2C99A 2RKWA 3IDQA 3RJMA 1T5LA 3T5CA 5BOSB 1IRXA 1GAQA 4RK5A 5FTKA 1OZAA 3U81A 1W59A 2E21A 2F64A 3DEAA 3O2QB 3PUXA 4JB8A 4EZBA 3TGLA 4C04A 1OGYA 2ZVJA 3PWZA 3W6ZA 3BRWD 5EPUA 3THOA 5C5DA 1GQQA 4H7FA 1H2ZA 4S1OA 3A0RB 4HGPA 4WTOA 5IFKA 2YVLA 1OC2A 2JW5A 3OCYA 4I6EA 4JLSA 4QOSA 4XB6B 3LNTA 1XNJA 2IJGX 3PTLA 3PZRA 4TXLA 3I9LA 3ZS8A 2Z58A 5DYWA 3T15A 3TNLA 5KQSA 1KH3A 4LFBB 4O0MA 1ZWLA 1FTGA 3MQ2A 2XMGA 3OJCA 2G1KA 4AG6A 2ECQA 4N4AA 1MT0A 1C1XB 2PUHA 3Q8LA 2QL5A 2BE9A 1G8MA 2D6FA 3PNBA 3RC3A 4D3YA 4DJTA 4P86A 1IBSA 3VKWA 1TZCA 3BIWA 5JXGA 2AKYA 3NTOA 1Z26A 2JFVA 3FOFC 1CS0A 1YJBA 3LCJA 5JJIA 2IEIA 2XWJI 1OZGA 3EUFA 3GLVA 1TX4B 5IM4F 1XA0A 2FR8C 4HNRA 3WGQA 3NHAA 7ADHA 3TEMA 2H1IA 1XVIA 3A10A 3GG9A 5CPBA 4U6SA 3ZWPA 1TJYA 1UZUA 1ZMOA 2R7AA 4BV8A 4R2KA 5HKKD 5K6RA 3I61A 2YRWA 1NMYA 3DVAB 3FDFA 5I9BA 1YRYE 2BTQA 3QOFA 3QFCA 3LY9A 1VMEA 1YNSA 3H9QA 5IU6A 2GTHA 4HDAA 2VRCD 2V4UA 2C8KA 4JNCA 2IUTA 1PG2A 2O3UA 5IN5A 1L3CA 1WHSB 5F7JA 5BV7A 1TEHA 3IBCA 4L75A 3LQQA 1M1ZA 5HK9A 4Z4EA 1LSUA 3CLTD 3FSJX 3ML1A 4NG4A 3TTUA 2CGEA 1PTKA 2XWSA 4GO1A 4RD1A 1HORA 2KBEA 2WOJA 4B76A 3HFSA 1G8HA 1BN7A 3L6UA 1IHDA 1RMQA 2V8OA 1W1UA 2PRYA 2XX3A 5F21A 4ZU1X 3VR5A 4D0GA 3ZDBA 3OOSA 4C4SA 3CVWA 4JI1B 1NVTA 4N40A 2HDWA 3KOOA 4TGLA 1UOPA 2FF7A 3UXMA 4OB6A 4XVHA 1KJIA 3KYDA 2A94A 3HCOA 2X8JB 3LQ2A 3S4YA 3EPPA 3H1GA 1CJSA 3BWCA 3WHLA 3UJBA 2JH9A 2P9CA 2Q9BA 3H8WA 3PL5A 4YYEA 2CZQA 4GPZA 4B3FX 3QLUC 3QF4B 2C9MA 1JFLA 4UBOA 4K3UA 4RGVA 2GVDC 4J0EA 4TWRA 4P82A 3MWLA 4UQOA 2FHSA 5BSUA 3ROGA 1K7XB 1M1YB 2ZATA 3EVFA 1O95C 1S4MA 2JLXA 3EQ7A 1NDHA 3SF0A 2XUPA 1RXWA 3TYXA 3JVVA 1PDWA 3CRVA 1M2HA 2BFWA 3F3MA 5A7HA 3RK4A 4AIRA 4X7MA 1FFDA 2Z5FA 4WNIA 1QHHA 2LKDA 4Q4DA 3I8SA 3VNVA 3KR2A 3EZ7A 5FI0B 1KL7A 5JVDA 4IOJA 3EF0A 1IQ0A 1O94C 2GHIA 3I09A 4MWTA 4Z7JA 3ZD7A 3L4EA 1C1HA 1Y9ZA 1VE1A 4PYKA 3RT9A 2ADFA 3PKIA 2NNLD 4ND1A 4C0SA 1YB1A 1Z0UA 2JFWA 4DM3A 5KX5A 1LI4A 4GPEA 1UJBA 3FYDA 1J23A 1DJNA 2CVFA 3K9NA 3RVBA 3T54A 2V7VA 2VYNA 4NENA 2GD6A 1ZUD1 2C78A 2O0MA 3NBKA 5IKOA 1CY0A 3ZHQA 1UM8A 2C4TA 2XD4A 1E9SA 1SVOA 4FDAA 4M55A 5DHSA 4CM5A 4F38A 4DSZA 4PAQA 4WKNA 1G19A 4OSEA 3IKJA 5E8JA 5FORA 4GKVA 4DDKA 1AKWA 2BBWA 2F1OA 2Y0PA 4ZVTA 3ESCA 1IJFA 2BRUC 3OD1A 4MLDA 4D9BA 1RZVA 3S99A 3HR8A 4IX1A 4PYNA 1LUAA 2BHSA 2BZGA 2C4WA 2WSSA 2AR7A 3B3JA 4CMEC 3GUZA 5E4FA 1M6NA 2OCGA 4FMCB 4JHXA 2VI5A 3AI7A 3JWJA 5EMHA 1G64A 3PA8A 4KUHA 4X1YB 4IO1A 3S2GA 4O4IB 1GDDA 1U6JA 3I1YA 3L8MA 1AG9A 1QCDA 4MOWA 4RQAA 4V1CI 4PNHA 2YICA 1ZH8A 2O2JA 1CJCA 2ZWVA 1XLUA 1LS1A 2WA2A 2XRMA 1DELA 1Z2NX 3E9NA 3HN7A 4L4YA 3KQMA 4EF6A 1X7YB 4C6TB 1AMOA 3LIPA 3LP6A 4L28A 3AU9A 4WFQA 4RVGA 4AKTA 1DAGA 3PQ7A 2H31A 2YMMA 2GAAA 3EUAA 3H8JA 3SR0A 3TKYA 1FSFA 3V4ZA 5AW3A 2NO5A 2QPAA 3OCCA 4LIPD 2ECPA 3CR7A 2AF3C 3DXFA 3L0CA 5IUNC 4AZVA 2VJAA 4DV1B 5KB3A 4BXOA 4IVRA 1H2YA 3BOSA 2JGRA 1MVOA 5JD3A 2GF9A 3AZPA 1ZD5A 5AH0A 5EZ6B 1ISMA 1YFKA 2HRRA 1LCIA 3HP1A 3EOBI 4LBYA 3DE5X 2N1BA 1Y9DA 3RSQA 3IBYA 2F2TA 4RHCA 3BD7A 3KBOA 5BV0A 4RK7A 4JWKA 1U1CA 1Z4JA 5TGZA 2JFHA 4R51A 1KAGA 2A9PA 2AD1A 3UO8B 3R3JA 4IIJA 5AJUA 5EQTA 3HY4A 3M9WA 1T15A 2CJWB 2WKQA 3GRVA 3MRSA 4R01A 2GZ3A 4D8WA 4E12A 1JFFA 5JPDA 4F5YA 5BWBA 2CUTA 2X42A 3Q9NA 1WSWA 1LQTA 1JAIA 3DE6X 1PI3A 1EXVA 4AYWA 1KC1A 3KB6A 1Y42X 3K05A 4MP3A 4PZDA 4B47A 1NPYA 5U4XA 3T9CA 3I5YA 3UTCA 3UHOA 2A14A 3IR6A 3RLFA 2Q3LA 1AM4D 1FLNA 3C3EA 3ES9A 3ICQB 3WAJA 6LDHA 3SNHA 3ND7A 3DCIA 3G2KA 5J5AA 1QFJA 1HDEA 1F38A 1MJGA 3ONVA 2B8EA 4OF4A 2JGEA 2PO5A 3ESYA 1DMSA 3H1FA 1RJ9A 3KWFA 3PFWO 5C8YA 4NU0A 1P62B 1WY5A 4F72A 3REFA 3L8DA 5KVQA 3BH0A 4A0GA 1LJ8A 1ST2A 1KZ9A 2NOAA 3GLSA 4HGOA 3I6ZA 1T1JA 1GPAA 1RBMA 1G21B 2CB0A 4NPAA 2AG1A 5CFNA 1RU3A 1T4MA 2RHLA 4U00A 3F96A 2JJ1A 4W8GA 1Y6FA 1HOTA 3FNHA 4HDOB 3F71A 4P2BA 1CT9A 2ECOA 4BLTA 2E1PA 3HCWA 2GLTA 3AVQA 3JALA 5C1BA 4I4NA 3ACDA 3GFBA 1VLHA 1BKSB 1IAQA 2EKLA 1FDOA 2PZGA 3Q6MA 3JATB 2P2LA 3RVMA 1JR6A 2Z9CA 1ACLA 5A6SB 2CLMB 4WK6A 4XFJA 2I33A 2CLHB 4H7DA 4M1SA 4UU8A 3DBLA 4FDLA 1WUHS 2ACWA 1JG2A 2GZDA 5AP9A 2MJLA 3W3AD 4FSHA 4DT1B 1GAEO 2RARA 5DP2A 2BPOA 2H16A 4U6NA 5GQSA 1R9JA 5HWSA 1DADA 2QTAA 1QH1A 5KSYA 4HDMB 1SXJD 3TW6A 3EZ9A 5TY0A 4D9HA 2OD2A 3VDXA 2QA5A 3NX4A 1JPVA 2OKGA 4FR5A 1LB1B 1T2NA 3OG9A 1SPBS 5THKA 2HQ1A 3K9WA 3AEQB 2V7XA 3CNNA 3NIDB 4JC4A 4DDUA 3G2NA 4ENVA 1DAMA 4XJVA 1XP5A 2FK8A 2GPYA 4BMPB 3G0DA 5F9FA 3OEHA 2D0OB 3AHGA 2DCUA 3UWSA 2BMAA 1M1NA 4A0FA 4BQSA 1QVWA 1XWIA 2X0RA 1N6IA 5DOVA 5A0VA 3BWMA 2DKFA 4AZTA 1QB8A 2LV8A 4LDPA 4OQYA 1A9XB 5DEIA 1Y63A 2J6CA 1W7AA 3D3JA 3SZGA 2O59A 2UUPA 4PE5B 1VYUA 2YFHA 3G85A 2E5FA 3NUZA 2ZBUA 4MA4A 4MRMB 3UZUA 4F04A 4K6KA 4EBFA 2QIPA 3BWYA 3I58A 4IMPA 3S70A 4RLQA 1FMLA 1U9YA 3BF7A 4LXUA 4MVJE 3A9SA 2HK8A 3HEBA 2W8BB 4GNRA 1FYWA 3BL8A 3DOUA 3UJDA 3B2NA 1KZ7B 3RUCA 2R1VB 3M4JA 2R7NA 2RHCA 1IQPA 5CAEB 4QDJA 5F51A 1Z9BA 4RD3A 3DDOA 3DOEA 2ET6A 5E7IA 1TB4A 1GTZA 1XXHE 3AFMA 1DVRA 3G2QA 4FLEA 3W2GA 2J7PA 3PEYA 1LQUA 4OQZA 4U7WA 4WFKA 4P0TA 3K0AB 3MRVA 3B5JA 4RF5A 5A5VA 3KQHA 3CLKA 1E2PA 2O4CA 2PVPA 1SQGA 2GEJA 4G36A 1KDRA 4FNGA 2ZWAA 3E5RA 5EE5B 3NBXX 3O8DA 1E7YA 1EFVB 1T5TA 4FN4A 3NVMB 4ARIA 3GLFE 4RVSA 3DEKA 4OV6B 4ZAYA 2DR0A 2MYPA 2F4VB 1DV2A 5BN5A 3ZJVA 1OBCA 1U7HA 1N6OA 3A11A 1MC5A 1TAHA 3BA1A 3PE6A 4CT0A 4NHEA 4W5WA 2XDYA 4BNFA 1CY6A 3EW7A 2C7BA 4ALJA 3LF1A 1RJWA 2Y27A 2W2LD 3H4VA 3UMFA 3UCEA 1FMFA 4TLLB 3IO5A 4R2LA 4IM7A 2BFEB 4G4JA 4LRYA 3RIMA 5JC8A 1RCTE 4RCVA 5L51A 1FVXA 3FPBA 5HS6A 4D81A 3AM4A 1PGJA 1W47A 3HJHA 1QX3A 4UNIA 3MCAA 2P6RA 4LYFA 1KOJA 3ZIAD 3MYRA 1HI9A 5JS7A 3B3QA 1OFTA 3OTIA 3E9RA 3ILXA 4GMHA 3CQ9A 4P81A 5SY9A 3UPUA 3D9QX 4LRTB 5EQDA 2V8BA 1WZ2A 2Q0SA 2C9YA 1U2PA 3MWJA 2QJTA 1ECJA 1GG5A 3ODGA 2IZ7A 1X1RA 5DX1A 4C4PA 1MD9A 2ORYA 3KSUA 4S3MA 1KWKA 1AHHA 1ISSA 3I8OA 1T3LA 1IJEA 2X2OA 1IXSB 1TECE 2DE0X 4MQFB 2X5JO 4F06A 2LD4A 2P2DA 3P8ZA 3KLPX 3MYYA 4TYNA 2QORA 3TO5A 4L22A 3ND5A 3Q6IA 1C9EA 1ISJA 1IZ7A 4L2IA 4PHFA 5EE1A 3WBJA 4FB5A 4HNVA 5AVJA 1JFTA 2J45A 4MHOA 3PXXA 3RUIA 2Z04A 1IONA 1VPTA 2ZLBA 2WF9A 3ELWA 3T5DA 1G291 1Q22A 2DQKA 1P1FA 3L7OA 4F86A 1ODLA 3CKLA 4EJSA 3Q7TA 3MUFA 4UCQA 1WIWA 4D4GA 3UBMA 1UT8A 3TZ6A 3VC3A 3VZQA 4TS3A 4E31A 3L4KA 2XCTB 5NLLA 3T0GA 2NAFA 3TXYA 2PZMA 3VR0A 4AAYA 3ER9A 4YA6A 2J33A 3UT6A 3BCRA 4KXFB 1PBNA 1YZVA 2H9AA 3R1IA 4M7PA 1ODJA 1WETA 2VHUA 1AGPA 1X38A 2C2KA 2CHGA 3AP1A 4K86A 5LA6B 3W8FA 4AVYA 4ZCMA 5F23A 4BZXA 3I0NA 3W5BA 2R00C 3F6PA 3N2GB 1KYVA 1EWQA 1NUTA 5GV7A 2C3YA 3GT0A 1HRKA 2O6HA 5K0CA 2QI9F 2V7PA 3DVLA 1IUOA 3PR2B 5ITZA 1CD5A 3U4QB 4GHWA 2H3EA 1FSGA 1YS2X 4TXMA 1YVEI 4X1IA 2MIIA 4NAVA 4GXNA 4Y30A 4CM4A 4QU0A 3AO0B 2Z2JA 4M0UA 2BVNA 2CDCA 1UMCA 3I1FA 2IU3A 3FBWA 1KNQA 1TZ2A 3AONB 1CUVA 1I6MA 1HGXA 3U16A 3MCUA 3Q3IA 4L9AA 3TVDA 4Y18A 4R16A 1PR6A 3AHJA 1Z6AA 3THRA 3DL2A 1QGED 1GN9A 3Q11A 1GZSA 5CVJA 4DJAA 2J0UB 2A58A 1DPFA 1SUIA 4O2AF 1ZOPA 4BVLA 5CA1B 1ZOOA 3GGGA 4I1VA 5IAAA 1KRHA 3DJFA 2BW0A 3EYAA 3PEEA 5U4QA 1C7FA 1KMHB 2FZWA 5EXPA 4AK9A 1XB2A 5DBGA 4EGAA 1ML3A 1EA7A 3GRUA 3RS0A 5DTEA 5AQEA 4BO4A 3ERCA 3EIXA 4IVNA 1I7LA 4ZEXA 3K2BA 3LYHA 1UM9A 3SS9X 4AKIA 4IXWA 1OXUA 1QYIA 4KMOA 3DMGA 1E9EA 2IUFA 3A6EA 4LJLA 4Z0PA 5G1NA 5HA5A 1DQZA 1A9YA 1U65A 2NSLA 1JI3A 3C8DA 5KSPA 2N3ZA 2Z6AA 2J6IA 1FP1D 4IOKA 3H86A 3B6KA 3LUFA 3QEOA 5CK5A 4BX0A 1JJFA 3ASYA 4XCQA 3ICVA 4BRZA 5CXUA 1KFEB 1OZHA 3AUFA 1GWNA 3LAWA 5DVZA 3FFXA 1VLLA 3ONWA 4V3BA 3SZ3A 5C8ZA 4PIMA 2UVPA 1MV8A 3PC3A 3RSHA 4R2XA 4EJFA 3FWPA 3RUEA 3UCFA 4PZLA 5K6TA 2YOHA 5CR9A 2P68A 4HDNB 1LPOA 1BG6A 1UT5A 2B0CA 4FDUA 3EPKA 1QZZA 2QLFA 3BHIA 1ZRHA 1OMOA 1MH9A 3S2ZA 1WXGA 2VYQA 3OPXA 2NU8B 3BA6A 2J0SA 1EWVA 1GLNA 3DE1X 1ABFA 1IMOA 3H6HA 1XFDA 1BX0A 1DEKA 2GEBA 1UH5A 2IOQA 3AOEA 5FNVA 5IFLA 4EHHA 5K4GA 4JKOA 4EVQA 3DMHA 2JATA 5IDVA 4N9QA 1D1TA 2C2ZA 3B6IA 3QJ5A 3ZGLA 1BHSA 1PHRA 5LJIA 3G8BA 3PNVA 3INTA 2D3WA 2QUHA 2TMYA 5A9SB 1YL5A 1FFHA 4OM7A 2OYRA 1SQ5A 1QKKA 2VL7A 3TD6A 1KBQA 1MEOA 2I29A 4WLFA 5EYPB 3WB9A 4C4OA 3TOSA 4G9GA 3SNKA 4O2LA 4HYQA 2IXFA 2R66A 5CM8B 4NJMB 3E70C 2RGNA 3CTMA 1G66A 3QU2A 4NMLA 3FTNA 4E4RA 5K45A 2P9YA 1KMQA 3UENA 3LXMA 3K9FC 5DWQA 3QVUA 1QQAA 4Z5XA 2W58A 3C98A 1E3TA 4ECAA 1BHJA 1E1RA 3G2JA 3C7KA 3HNOA 5TEWA 1C8BA 2OC9A 2HJVA 4RMHA 2E4WA 5A3QA 4C08A 4MQ6A 4P58A 3N6VA 4TZTA 5CYPA 3DUFB 3W04A 5JO0A 1KPGA 2VDQB 4IQ8A 3DMFA 1QU3A 3OWOA 3OOEA 4G4IA 3HN6A 3TNFA 3WGTA 1JXQA 1Z4NA 1V47A 4EJSC 1RCFA 3I04A 4BDSA 4U39A 1SU4A 4FYIA 4BLWA 3CCFA 4B3HA 1U0TA 2AZ4A 1KIAA 2GARA 1QXSA 3I45A 4YRCA 5JS2A 5BN3A 4B3RB 3C24A 1E3DA 1WPGA 3DBHB 3ITEA 3KUCA 3GLIE 3DNMA 4PYMA 3IT3A 5D3MB 2DLCX 2VAXA 1EDEA 1M7BA 4RVDA 4KLNA 5CM2Z 1WXHA 3A2MA 1N2IA 3L93A 1J5PA 3V42A 1PW7A 3U3XA 1GCAA 4JUBA 1CUXA 3AI3A 4P0PB 3VNRA 2PZFA 1T1GA 2JI6A 2BUAA 5AOBA 4JEUA 3TSCA 4WLUA 1WA5A 5KVSA 4RNDB 2GCOB 4IOLA 2R1UA 1H2WA 5DGDA 3TPCA 2JIBA 3K2IA 5EJ7A 5FEMA 3H2YA 5F1KA 5L6MB 1AGNA 4L51A 4DBVO 3LYUA 3MIIA 1J39A 3WL5A 1NU8A 4HFRA 5KVAA 2VRWA 3ZJUA 2VH5R 4OREX 5A04A 1R8QA 3R7FA 1I01A 2D5LA 2DRIA 2FCAA 3L79A 2RAFA 3BWEA 2H2DA 2PMKA 1C3OA 1N2CB 4NBKA 1P7VA 5CYGA 1BW9A 1F0NA 4CIXA 3CLRC 3JWPA 4MRNA 5BQFA 1GD1O 3FKQA 2ZZNA 4Q1BA 3RKSA 2IYZA 5FI1B 4GVXA 3WZMA 2NACA 3LFHA 1D6SA 4RWZA 4LDRA 3ZZMA 3THXB 1QOPB 4GGPA 2WB2A 5AKHA 3DCYA 5HCNA 2VSQA 4CU2A 2WI8A 1XTTA 1ZGCA 2WUDA 3X1ZA 3J7AC 3X1DA 4WXPA 3GX1A 3Q3GE 1BXRA 1DEHA 2I1LA 5AJVB 1BFUA 2QLLA 3BTVA 4H4CA 4PSCA 1B6GA 1DEOA 4NAHA 5B3KA 1XIVA 5DGCA 2VUSA 2QP9X 4DRZA 3C45A 4QVGA 3H4IA 1GPKA 1KKLA 1NUUA 4JUDX 2RHOA 4P34A 5T4EA 3FPAA 4QSHA 2BM9A 2VNIA 4JENA 3SI7A 3JQGB 3PX2A 1I2CA 1E0AA 1P31A 4QXMA 1H05A 4KOAA 4PRKA 3WOVA 4C05A 4Q6WA 5JI2E 4UAJA 1XZCA 1Y3BE 2GBPA 2NPIA 4TS9A 3DL0A 4CF6A 3VR4A 1IZ9A 5DNAA 1HBJA 5KOYA 2GYWA 3H17A 2HTEA 1MB9A 2OZEA 2HHCA 3OOYA 4RIIA 4GP9A 1NOJA 2Q6KA 4ZVNA 3ZCVA 1CUFA 1DWPA 1GNLA 1QYWA 2M9MA 2YTZA 4BRUA 4C7MA 3AF3A 4AZ0A 1AUPA 1RKXA 5H16A 4EELA 5C18A 1EUQA 4ESVA 2VF4X 3AOEC 3MJVA 4OHXA 2FG7C 1ZI8A 4NZOA 1VE7A 1OOEA 1NAHA 4ZAGA 4M1KA 5HQTA 3KPWA 1W6UA 5GAJA 1Y7PA 2C77A 2XF2A 5CG2A 2DZDA 3H9UA 3RHTA 4B8WA 4EI8A 5HBGA 3IV7A 1ST3A 2DTEA 5E0KB 4ZVLA 2PQ2A 1QMGA 2W4IA 4KWTA 2GPAA 2YNMA 2PBRA 1U0EA 2Q3HA 1NVVR 3E5HA 4B6EA 5EIHA 4DZZA 3F6BX 1H2XA 3N74A 3DOOA 5K3FA 5LLDA 4INAA 1DCKA 4V0NA 2RGNC 3IAM6 4Z2AA 4QEZA 3KQOA 2JIPA 4B85A 4QECA 3E7FA 1C3XA 3AHCA 2YH2A 1ZRMA 3IUJA 1AQUA 1A8HA 1NSYA 5JZSA 1WZCA 2FX5A 2Q3DA 1NF2A 3DAFA 3DTNA 3QBDA 5IZ4A 2FMXA 4MUKA 1N2HA 1KYXA 1WABA 1YHYA 3MINB 3KT0A 2FMIA 4PLTA 5H59A 1P0PA 5I45A 2WNIA 4LS3A 1C7JA 2QVBA 3B1VA 5E95A 4AD8A 5CCXA 1ZLYA 3PXAA 2PN1A 3GP3A 2H8KA 4PWYA 2JBAB 4DA9A 4FGJA 3A8TA 1GPJA 2CNWD 3RTBA 4C4AA 3MOIA 5LR6A 2KWIA 3VC1A 1EGVB 2HNAA 2YJGA 1EFLA 2JFFA 3IUBA 4A2CA 4P8RA 3P7MA 2J3JA 1IQRA 3JQPA 4KXMA 3NNDA 1FUYB 1KHHA 3BBPA 5G0SA 4QUDA 3EY9A 1N3YA 5KREA 4L16A 4CM6A 2ONYA 2OOKA 5KDDA 5AW2A 4UASA 2IYRA 4MUMA 3CG4A 2PUFA 3RIXA 3DP9A 2PRSA 3MS2A 4R1PA 1TA9A 1TMOA 2OV2A 2O9JA 1MO6A 1RWVA 1MKYA 2H1WA 2B3DA 1F06A 2W6JA 3KEQA 1P29A 3LX8A 4UQPA 1Z6TA 2ATXA 2VDNB 1CZUA 2EJVA 3WIBA 3QX7A 5AKEA 5G0TA 4IKOA 4YRSA 2E4AA 2V7BA 4H60A 1V96A 5BMVF 3V9PA 2ERCA 3B82A 3PNKA 4QUBA 2CV0A 4C89A 4S04A 3WL4A 4D02A 4UEKA 1P9RA 3V7FA 1KI9A 2X15A 3DULA 4B75A 1W73A 3B53X 1WW8A 3INGA 1QKIA 1EJ0A 1JKXA 1BDBA 1RHQA 2PSSA 1F4LA 2K2QB 4IQ4A 3RNOA 3OZIA 4V2UA 4RTPA 3QE9Y 2P30A 4DMUB 2Y77A 2M6LA 6NULA 4NK4A 4MPDA 5HKBA 3DEYX 3PRYA 5CT6A 1QFYA 5T5QA 1H4QA 4IILA 4TS4A 3P2OA 4EPVA 3COPA 2DWUA 1K7EB 5REQB 1MTZA 1XZDA 2Z83A 4D9KA 4EVRA 1XK7A 3U2QA 4DBLE 1PEAA 3QNUA 4YRKA 4H7HA 5AIAA 1M10A 4UD2A 4LUCA 1TCBA 4OJNA 4I1IA 4W7HA 2CNNA 3RRYA 3NRJA 1DRJA 5CLQA 4CGYA 1L7VC 1SKUA 2CL5A 1FXUA 3F49S 1TKCA 5ESXA 4AZWA 3VDNB 4BQIA 4YRAA 2PU5A 4ZXFA 3UV7A 2QLJA 3CNOA 4CT4B 3WYGA 3TQTA 4DJ5X 1Q44A 3R75A 1HL7A 2BI8A 3MVEA 5BQPA 5EJ9A 2RHTA 4X6LA 4UARA 3F0TA 4KE6A 3HUDA 5LBTA 5HIMA 3G5LA 1NVVQ 4H2DA 1TT5A 4I9HA 3DKKA 2DY1A 3LGSA 4M0KA 4QTTB 4RXUA 5DM4A 1I36A 3ZD9A 4P38A 2CLKB 4FYVA 1Y34E 1SKYB 1CUGA 2CK3D 1T29A 1VBNA 3FSGA 3I6MA 4MKGA 2PLAA 1FFXA 1Q1NA 4Y2VA 4N5DA 2BEVA 5HRUA 2IEGA 1EXDA 3QFSA 1X1QA 5BWOA 4RFSA 4R3UC 2WJZB 4C21A 3EZ2A 3PS9A 3I23A 4NBLA 2XW6A 4YQZA 1BE8A 2VQSA 2XE8A 1CQPA 4BB0A 1IEXA 4GX1A 2OSBA 1OAOA 1OAKA 1X77A 1KS9A 3PKZA 4GX5A 4ZQHA 1Z28A 5FHQA 1LFAA 3M7IA 3AVWA 4EYQA 6AT1A 1X80A 4NS4A 4DV7B 3WA7A 6REQA 3TVYA 4U7DA 3QFRA 3BMCA 3P52A 3JYHA 4HZUB 4QQFA 2HQSA 4H1UA 3N6XA 4LNUB 4JDPA 1VYVA 4ZAXA 4QHTA 1KVUA 4U8HA 1IZ0A 1KMCA 5EZQA 5F3RA 1JQAA 3CCBA 2RK4A 2WVGA 3CJRA 1SC9A 3E15A 5ENDA 1T6BY 4M86A 3QM1A 4KAJA 5D7NA 4ZMBA 4V0OA 4XH9B 2HBYA 1GYQA 4B34A 3A9RA 2NAPA 2YNMC 3QSYA 3EZYA 1YJ5A 2ORWA 1F5SA 1AUVA 2X41A 3F7NA 3AL3A 1MO4A 1PS9A 4LJKA 4NZMA 5AWFC 2CXUA 2PUAA 1A98A 1ZH2A 1UPTA 4J7CA 3WMFA 4E5MA 1GOTA 1DJMA 1XRPA 3IUEA 4XCXA 2XQJA 3K9CA 4BNVA 3NHPA 4B3CA 3VNBA 4HAZA 4RS4A 2EOAA 3GOQA 3I5AA 3UWKA 4OKSA 4ARUA 1XBTA 1I3OA 1QS0A 3N1UA 3ZY6A 5JISA 4MYHA 5MF6A 3FNFA 4LRUA 4DM7A 1Y4ZA 5DHQA 2ISCA 3JQ8B 2IV7A 2GAIA 5AKZA 5IX8A 2GJ8A 3TR0A 2FDCA 1YIOA 2PL3A 4CQNA 3RROA 4YAWA 3ADBA 3DP7A 3R5FA 4FEEA 1SAYA 2JANA 1JHPA 3PHHA 1D2CA 2IY7A 4DYDA 4ETNA 2BHLA 3AY3A 1TVKA 2NO0A 4XR4A 3G0HA 3HI4A 1R4MB 5C1IA 2D7DA 4DMFA 1TM5E 3UK0A 721PA 4PHGA 3DJYA 1S8AA 2DSNA 2P9JA 5DW0A 2WHRA 2QTTA 5JR3A 4P4NA 3ZHUA 2OR3A 2ARKA 3TXXA 3LCRA 3RJZA 1ZK3A 1JLLA 2LKCA 5K4HA 3JYOA 1RHKA 2OCKA 3T1QA 4HNGA 2AN9A 2KB0A 3BK1A 1USGA 5JTTA 2FR0A 5AW7A 1PS8A 2BHNA 4G5SA 1PR3A 4MW2A 4JP3A 4BQEA 1N77A 4FMDB 3NIBA 2R8ZA 2PQ6A 2Q41A 1ZGAA 2MSCB 4ZEWA 1MOZA 5C3UA 3PT9A 4ZCRA 5CDSA 5EJIA 3QVGB 4MV0A 1JIXA 2QY9A 2QE7D 5J63A 5BN4A 1ZMRA 2R6GA 2IEAA 2CYAA 1R6DA 3IDAA 3IPYA 1H1LA 5L7YA 3WDMA 4BQQA 3ONDA 5B7NA 2PWPA 4I5IA 2PYZA 3ANMA 1BROA 1SVMA 2RGWA 1L4HA 1ML4A 1KAEA 5HW0A 1JZSA 5LD2C 3O91A 4ZAZA 4PLVA 1JFFB 1QFXA 4TXJA 1AK2A 4U0KA 3S2YA 4BN0A 1YZKA 1JHXA 3HI6A 4LX8A 4H1VA 3K9HA 1XL0A 2V5VA 1I2BA 5A4FS 4LZPA 1GRQA 1PCXA 2EJCA 4HAXA 4B4UA 4LK2A 3GNQA 5FTLA 4RXTA 4D3XA 4GYYA 3FR8A 4UUBA 4NCJA 1X7HA 5MHTA 2OENG 4EUFA 2AWOA 1H3NA 3L0DA 1BD4A 1QX4A 1KZGB 1KOFA 2ODAA 4M21A 5HP4A 5AM0A 2X7XA 3RRXA 4HDRB 3V2GA 2V6BA 2A9QA 1XCJA 2JIZA 1R74A 1ESCA 1Y6ZA 1DE0A 3GFRA 3MCWA 3O2JA 4LVOA 3RVJA 4EATA 3OZDA 3GMDA 3TLGB 1WU7A 1SWWA 2G80A 3IMCA 3HZOA 3M82A 1DC4A 3QFFA 3CBGA 1KO1A 1XD2B 2CWWA 4I8IA 3U7QA 1KDYA 3C6MA 4QXRA 5JBQA 1G8PA 4G09A 1D9XA 1UP6A 2OGWA 2VJLA 3DQQA 5KNCD 2P4UA 2ZDQA 1EFUA 2GD0A 2JCVA 1O1YA 3BXZA 1YF3A 3BUSA 1EVEA 3OLCX 2A9KA 3ZJTA 1RQLA 1A7AA 4BAGA 2UUOA 1FFEA 4EW6A 2WUVA 5ELLA 2QLMA 4GP7A 4TLEA 5EJFA 5FX2A 4DR2B 3CCCA 2G77B 4BQRA 1REQA 2FG5A 4ESEA 3PQ4A 4XX0A 1OAOC 5JWOA 1A4XA 4MQUA 2GI4A 3LDAA 1EP9A 1GRRA 4P7FA 1EVZA 3C5VA 2A7XA 3GAFA 3GFSA 3TZEA 3PQ6A 1JIQA 4EL0A 3JYLA 3IXQA 3ZY3A 1JAZA 1QHIA 1NVUQ 2R48A 1KO8A 3O3OB 5IEJA 1RTKA 2YOFA 3OVMA 4HZIA 4Z49A 1XNHA 2F62A 1OYWA 1GKLA 5JT1A 3QMPA 3LHIA 2NUTB 3EXG1 1VIMA 2ZB7A 2Z95A 4NV0A 5FWYA 2O8VA 4RVUA 2QNBA 4KQWA 5HGXA 3N6RA 4RKEA 4N3CA 4Z0HO 1OREA 2BP7A 4XLTA 5BYJA 3D4NA 2I3DA 5E1DA 13PKA 1ZWKA 3LK6A 3MOGA 1G5RA 3DBOB 4WXHA 2N42A 2PUCA 3QU7A 3HDHA 3X2EA 5L8VA 4NY1A 1DKQA 3HKEB 3PIIA 4EHJA 3QEJA 3J81k 1NW7A 2XSZA 1V7PC 3BJIC 1AJEA 2PX6A 4JOQA 4DEYA 4IS2A 1LPAB 2PBZA 4O4JB 5H82A 2OFFA 1T8TA 3CEMA 4QPPA 1LH0A 3F67A 1KIMA 1JIIA 1V11A 2UUAB 1MP0A 1OX4A 2V6JA 4DCSA 5ED4A 3K5PA 4YJ2F 4URZR 4MYSA 1GGFA 3PJGA 3AI1A 1SXJE 1UXGA 2YBEA 3VZSA 3PFFA 1SY7A 1Z6GA 3CN9A 4FMBB 4BNGA 4TTSA 3H42B 3ZTWA 4I5FA 4JJ4A 3ZLJA 2B36A 4BX2A 1CR2A 1EZ1A 2IDKA 2GXQA 3E8XA 4CQJA 2HI0A 2QVZX 1QP7A 3C6XA 1W46A 4D9MA 1N7HA 2D8AA 2PXCA 4EFMA 1YCDA 4XIGS 3SX4A 2FEKA 1PW5A 1U8FO 3VPFA 2R6ZA 3KEOA 4MWOA 4O5AA 2I6GA 1XE3A 4I36A 4R8SA 4NCNA 1YZYA 2BFAA 2C95A 1CE8B 1HQCA 4UOEA 1LVHA 2CMFA 5KHLB 5H4HA 4GOJA 4KODA 4TSFA 1YB2A 2B7BA 3RVLA 3RVPA 3OBIA 4LF4B 2V7GA 2BISA 2J59A 4Z53A 3B7WA 1G7TA 1ZIDA 2QUJA 3MMNA 3LE8A 3H1PA 2A1TS 4D41A 3FCXA 3E48A 3KUUA 2WT9A 1WUIS 2WIJA 3VNUA 1D1PA 1HE8B 2HMWA 2NXCA 3E3OA 3L7BA 4E7OA 3U56A 4ZVOA 3A1TA 3ENKA 3FUXA 3QEMB 3SZUA 1G63A 2GBLA 2I2DA 3FLMA 4C1BA 1CQJA 1RAGA 2E4YA 1AQIA 1PJZA 2ZUCA 3OP4A 4AJEA 4ZCIA 5JTUA 3WVNA 5BR1A 3KHUA 3VVLA 2UZ1B 3O2SB 1M2OA 4QOJA 4UJ5A 4RZIA 1L5HA 2VKQA 3Q2OA 1U8XX 4DCCA 4MP6A 3TUIC 1XTPA 4C6SA 2XTAA 1HYQA 2WTNA 2B30A 3II6X 4QHSA 4EA8A 3VH1A 2XCLA 2VJCA 3W9SA 2F9LA 3AIIA 4JC0A 1JR2A 3NEJA 3ZWCA 1RAAA 1KQPA 2Y6UA 3A6HA 3BFKA 3C7AA 3GELA 3LCVB 3OQ6A 4X85A 4ZGWA 2AUMA 3M6XA 4IJMA 2J6BA 2CLDX 4LKRA 2ZUUA 1PJLA 3ANSA 1YE5A 4Y1FA 3N59A 2FZKA 3IA2A 3IPLA 3W79A 5JADA 5JSQA 4GI3A 3FAZA 4DPMA 3EDCA 3NOQA 4YO7A 1PS0A 5AJXA 3QLJA 3DC7A 3ETGA 1COWA 1GRNA 4NAUA 3C4VA 2A0UA 3C7TA 5CNKA 1QIGA 1XZQA 3DHNA 1KU0A 2B9VA 4MW1A 4EB0A 3LTEA 4CV3A 3PXGA 3GP8A 4HVAA 3WRXA 4KX3A 2WABA 3IQGX 1Z06A 2L17A 4AF8A 3LPAA 2DG2A 3QTLA 2J9RA 4TMFA 2FRXA 1TOAA 1XZEA 4ID9A 2H11A 2IV3A 1ZL0A 4Q7MB 1R0SA 3EXFB 4KP7A 4RPLA 4DBZA 2QENA 4HGNA 4PGMA 4Q82A 1A4RA 3LNCA 2OYSA 3GCGA 1VG8A 1VIDA 2O2DA 2REQB 3I34X 1X70A 4WY2A 2ODPA 2G5CA 2PH5A 2YV3A 1Z16A 2G8LA 3UT5A 1NNI1 2V4ZA 1GZ4A 1NQWA 2AFHB 2XPCA 2YHUA 3ZQUA 3WQSB 5C1OA 5IJ9B 3GVPA 2IDJA 4G1UC 3CZ5A 1SHTX 3WDKA 1UBMS 2PRJA 3L8YA 5BR8B 2CT8A 1MJGM 4I1UA 3I62A 1RLJA 3ZHRA 3H2HA 4OU4A 5FTWA 1R64A 1U0OC 3LWDA 3FYCA 1LJUA 4EUNA 4ZOCA 2VP3A 2OFXA 3WO0A 5ENVA 1L4YA 1CLEA 1JDZA 3KFLA 1CJTC 2GPTA 1VG1A 1NZJA 3KSZO 4W99A 3ZPXA 2D1YA 5HVNA 3ZXYA 3U4AA 2LIVA 1GA1A 4J6FA 1GL9B 2ZT8A 1YJXA 4KK4A 1B0UA 2J31A 3UAYA 5JRJA 4RDIA 5FIUA 4BU0A 3OI7A 1GNPA 1QE3A 5TPZA 1M8JA 2IYXA 1N57A 2CL7X 3TK1A 1PYGA 4YRZA 3P2KA 3S2EA 2DB3A 4LZNA 1UQTA 1DUSA 5TB5A 3C43A 4GR5A 5KJ6A 1TU0A 4TMVA 1DDIA 3HLYA 4AX8A 2CSXA 2YFQA 3ZDRA 3DBRA 3E1KA 3FVRA 1IVYA 1JGTA 3K4HA 1FUUA 1XEFA 1WMDA 2CE7A 2AJBA 3K30A 4BX3A 3PQFA 1M73E 3EXHA 1XZHA 1NU6A 3OF5A 5K8CA 4KN6A 2QSYA 2QRKA 4IDBA 4B7ZA 5JCPA 2X22A 1L7RA 2WB4A 4ZWNA 1A5TA 1G5IA 5CITA 5JAOA 5CEJA 1K0UA 2BMEA 5ALJA 1EWTA 5ECGC 1DQRA 5KCMA 3PGXA 2LZ0A 2WYVA 3B5IA 1GADO 3QLEA 3W1WA 4HFJA 4HQFA 3MLBA 5KI6A 4B46A 1Y1PA 1QV6A 4KYUA 2G5GX 5ELMA 3DDNA 4Y6GB 1GGJA 3GLTA 1C4KA 1I4TD 1KR2A 3GGSA 2IYWA 2VP0A 2E48A 4I55A 4I66A 1B0PA 3LCCA 4IDQA 3R3ZA 1LNZA 2J8ZA 2AF4C 3ODPA 3ZKWA 1P18A 3HR7A 3OLVA 4A8TA 2GASA 3K0SA 3Q9UA 4YAFA 4E03A 1DIAA 1N6RA 1QZ3A 2B25A 5EJAA 3GLGB 1MB0A 1LF0A 2AV6A 1D03A 4Y2SA 3FIUA 3KDAA 4L95C 4F12A 5BXQC 3D4PA 1RP1A 3IKMB 4JOCA 2DWOA 2IEYA 4O4LA 1J0XO 1NWCA 4AL4A 2QN9A 2OCYC 3PI6A 1YDGA 3KXLA 3RD5A 5B64A 4D6PA 4JVNA 1H6BA 2ZR8A 1RYYA 2HM7A 5G02A 3IERA 3QOXA 4LTNA 1U6IA 1WMFA 2XJ4A 3CURA 1J22A 4HUJA 3F97A 1U9IA 3N5CA 3VC7A 5LZ7A 4BJ3A 4EMBA 2CDBA 1IPEA 2ID9A 4Q3NA 3EMKA 5LP6A 4LXGA 5KYUB 2GBLC 3FUWA 1PFVA 3GA7A 1E3JA 2XECA 4LYYA 3D5QA 1QVAA 1JMYA 4QFBA 1KDTA 3R7NA 3WMEA 4PPQA 4O3FA 5EIBC 4UTPA 1YZGA 2HXGA 3UHJA 2BMVA 4RTMA 2G4VA 1JYSA 2B99A 3AB8A 3LSTA 1YONA 1SU8A 2CCJA 3DQZA 3DFFA 3AJ8A 2IDZA 3TDKA 3TBFA 4BO1A 3RK1A 1QVRA 5KWEA 1HDRA 2BBOA 2AOWA 1SC1A 2QSZA 1ZKDA 3MMSA 3D31A 3DC2A 5C1DA 3WADA 3IEUA 3BXFA 3HNPA 5G1PA 1B8UA 2CUKA 4IG9A 4NE7A 4M9SA 3W3AH 3AM1A 4QICA 2OP0A 2ZGVA 3PR3A 1OASA 3CXRA 4NFLA 4M1MA 5D3QA 1BEUB 4N8DA 5KVCA 3AIKA 3ZXIA 2WJAA 2HN9A 3DEJA 1CRQA 3EMVA 4RC9A 1UBRS 4RABA 2ZUTA 4LC9A 1EI9A 1WJGA 4C2BA 3E7WA 3FOZA 1PZMA 1TEZA 3IE0A 1PQYA 4OGLA 2H4FA 4RA6B 4AIIA 3BK2A 5JXWA 1LLUA 4B8YA 3WRXC 1U3TA 1GPBA 4GW3A 5E3IA 3N2IA 1LPPA 4BX8A 2IA5A 4TKUA 1EUDB 3VO1A 4D0NA 4K9SA 1U4SA 2ZYDA 1JQ5A 1QONA 3NH9A 1E7WA 1UBKS 1TDJA 1TADA 2GVNA 2G25A 1DIRA 1GITA 1C4XA 2VJMB 3AZOA 5CIWA 4BNXA 1XN4A 3SDBA 1I1OA 1YI0A 1YVUA 3UWOA 5H8WA 1VSQA 1HE1C 3WQQA 1F1BA 5U9CA 1T5OA 1V9SA 5CNJA 3B1YA 5IYZB 2MSLA 5L7TA 3DOIA 3N0XA 1T4CB 3HSSA 4IEFB 2QD5A 1G18A 3IPCA 1UXJA 3N2NA 4UNQA 1A8IA 1LLDA 2PSDA 4OSPA 2QAIA 5CFOA 1NONA 1EBBA 1JIVA 1D7OA 1JFSA 2W6OA 5EIOA 2P65A 2VDWA 3O0TA 4MKFA 4EPYA 1XAGA 2XWQA 4HYEA 4Y6PA 1X7XB 3EEBA 1I13A 1OKKA 3O9MA 1BDIA 4I5GA 4DSTA 1VE5A 1VFPA 2X4LA 1V1JA 3FMIA 3SYLA 1ENZA 1U2QA 4RWEA 3F90A 3IOBA 3UV6A 4HGRA 3WKAA 4ENRA 3T5AA 3BD6A 3D2AA 4EPWA 1V8OA 4XM0A 3P9ZA 3A2KA 4HN2A 4BNJA 3OLQA 2B1RA 1BW9B 4WKBA 1QF6A 1NVXQ 1Z2DA 4K6MA 4JV5B 1QQ6A 4X3CA 1F6DA 3STTA 3D0OA 1FRZA 3G8AA 4GVLA 1POXA 1A5BB 1DWOA 1L7XA 3KYIB 2Y9MB 4P0QB 1DFIA 1K9SA 3RE1A 3M5WA 3ROMA 3PYXA 4H7KA 1R6BX 3C4JA 4HTAA 1DXHA 4EG5A 3EXHC 3NC1C 1P80A 3HXTA 2IY9A 4MVJA 5D6OA 1UBSB 4MWGA 3ESXA 4S05A 5KDLA 3NKLA 3SC4A 4RADA 1C8VB 1T0HB 1Z63A 3RQSA 1I51A 3E3NA 1OBVA 2PT9A 4CJXA 2LDXA 3E27A 3NTQA 4Y2XA 1P1HA 3M4ZA 1M34B 1PFGA 2B4YA 2NGRA 1FDWA 1T0UA 4POOA 4YCNA 2NVUB 2P78A 1CUHA 3K1AB 2IS6A 3GRAA 1LV7A 3CW2A 5DU2A 2RBEA 5F1PA 3HB0A 3NJ8A 3NTRA 4EARA 3DD1A 4TWAA 2R11A 5IJ0B 2XD9A 2SBTA 4QO8A 1QJ4A 3GLHE 3ZJ4A 5BSKA 2G76A 3CV3A 1T8SA 4BNWA 4IP0A 3LZCA 4N8EA 3EIQA 4KFRA 1E0KA 4QGFA 1S3GA 2SKEA 5ADWA 4Q4JB 3EJWA 3GLFA 1DAIA 1JEYB 1CJVC 1NTOA 3AR3A 4YY3B 5I48A 1CHNA 5L40A 5AVWA 2G71A 3NRBA 3SEZA 3RYTC 2PSHA 4JYCA 2UVDA 4BNIA 1SQFA 3EQ6A 3PSHA 5HILA 2CY0A 3D4OA 1LSJA 5CLHA 4RLHA 3RABA 4NOKA 4YAJA 4PPNA 1JQJC 4QOFA 2X58A 2NM0A 3ZWKA 1UQUA 1U9IC 3KXPA 3K5WA 1PEYA 2HWUA 4PEVA 5IH3A 4DG9A 5KPJA 3EBLA 2ZYVX 4QUJA 4RKQA 1AU9A 1PT6A 1RWQA 2WU8A 1BKYA 2FZ5A 3FKSD 1WHTB 1XSEA 2QT1A 1EIZA 4MZXA 3ZW7A 4YMLA 1PZEA 4GR9A 2ZBFA 4D79A 1Z82A 3OJ0A 2HYDA 3D3KA 6ABPA 1G5FA 2FG6C 2I6XA 3IP1A 2B69A 3D64A 2ZBDA 2YV1A 4MS4A 3KLMX 1YT5A 1UKAA 1UPXA 4JODA 3E58A 2QOEA 4MRVA 1UMKA 3ETDA 3LJKA 3DCNA 2M1XA 4OK5A 2JAPA 4U02A 3VAAA 3UTDA 4CM3A 1YS1X 1RP7A 5AUOB 4U4AA 3OZXA 3CN7A 1QF9A 1GP2A 3ANTA 4FFPA 1K8RA 2FKNA 4US1R 3AU8A 4JUIA 5HFNA 3AC0A 3LCMA 4Z6KA 3EGIA 5EAIA 5KPDA 5KTRA 4EPTA 1L7DA 1J0AA 1QAOA 3CZAA 1O95D 2O3TA 3HDYA 4NEGA 2PS9A 4CLOA 4DSUA 2VLIA 4LK3A 4DY4A 4E30A 5JSFA 3IP9A 3MELA 4FCVA 4M3NA 4BGVA 5BSHA 3FFAA 2E4VA 2XE6A 3EEOA 2IRWA 5KDOA 4INZA 3TG8A 3V48A 3IUMA 4BEJA 5E38A 4DFDA 5E8RA 1UEIA 4PLPA 5CIYA 4G0QA 4J3JA 3OZGA 1M2JA 3PC7A 4TV8F 3PIDA 4OKNA 1O94D 3LF2A 4G0OA 3F73A 4ZP1A 1XMJA 1N2EA 2Q62A 1MX1A 2XGJA 2HSEA 3JZFA 2KJQA 4AY4A 4ZT4A 1QU2A 1QBKC 1FFSA 3AR8A 3HDGA 3T7KA 3C41J 4FYPA 2WIGA 3A9VA 3DV9A 4EVIA 4URUR 2OCXA 3Q8KA 1S8NA 1Z5VA 1Z68A 1O6BA 1V48A 1N0UA 2IHBA 2VSNA 4JVMA 1KSGA 3CE6A 1Z5NA 5LN1A 1TGYA 2ONKA 2FPWA 4HUQA 1JEQA 4RKYA 4WFJA 3DTVA 4MIEA 5C7LO 2VP4A 2FZCA 4Y0VA 5DGTA 3R7LA 1MOQA 2Q4DA 2JRLA 1N0WA 4QVKA 1LGYA 4QODA 2XB8A 1A5SB 1D1QA 3PYLA 4W8OA 3WR5A 1SD1A 5T41A 3GVHA 2PPLA 1BX1A 1VMKA 2AN1A 1AS2A 3L8CA 4PNZA 3AWDA 4ZHSA 2IHTA 2B4QA 1WU8A 5FOQA 2HMVA 4B74A 3A6ZA 3SHVA 5K3SA 1MJHA 3RANA 3O8QA 1T4DA 3AQ4A 2WJWA 2GX6A 4GYJA 4I50F 1A4IA 4D8UA 4MYRA 1G1MA 5BWNA 1P1CA 4MKHA 5IABA 1LWNA 4CQLA 2OD7A 1Y7HA 3AEUA 1S0UA 1AMUA 3QE0A 3UMVA 4N3BA 1YACA 4RM3A 5CBKA 5EE3A 1YTLA 3AEYA 3R6DA 1KAOA 5KTSA 1JVSA 3PPXA 4QYIB 3DAOA 2UUBB 2YZMA 3I04M 4QPNA 2ZB2A 3C48A 3TW8B 3KOWA 1GKKA 1HSZA 1OZ0A 4BE7B 1X7WB 2Q29A 1ZCFA 4CETA 5MN4A 4NCAA 2R85A 4C01A 3GY0A 5CCBA 1TU4A 5JZMA 5FD8A 5K4AA 4DA8A 4PF1A 5M04A 4LCBA 1O03A 2Z5GA 3PCTA 9GPBA 3EPLA 2QTMA 3FVQA 3DE2X 1HDYA 2J4CA 1UAGA 3O6VA 3PUKA 5L3SA 4AJIA 2L19A 2XYRA 5AK6A 4L9SA 5F76A 3CONA 3JZMA 4Z4HA 3TW4A 2VSOA 2IGBA 4LJ6A 4LF6B 1Z0ZA 2J41A 5EOVA 2XYHA 3MWYW 1X0VA 1CY7A 3GPCA 2X8LA 3PUWA 4L85A 3FXAA 1CRPA 1ZK1A 1O6CA 3ZI4A 3I1JA 5C4GB 2P9BA 2YX1A 4RSGA 1NJ5A 2IHUA 3CWCA 3LK7A 4ND8A 2VP5A 4LBVA 3VU1A 3SQOA 1UDXA 4H08A 3B1XA 3H5LA 5G3YA 1XD9A 4U6QA 2ZWPA 5FPPA 4CMGA 2H7VA 1U11A 3WGYA 2ZBEA 3RPEA 2R60A 1Z07A 3RFFA 2WT4A 4ZDIA 5KJCA 1PUJA 1QE0A 1OXKB 3OECA 1I7SB 2L2QA 2RGBA 3D1LA 4YRBA 1E59A 4IHQA 1BGVA 1Z2PX 4FOOA 3BERA 5EEHA 4A4DA 3W4IA 3M70A 3QVKA 2C84A 5F9MA 5HIIA 3VR5D 1VRCA 4C6HA 1P0IA 3Q8MA 4II2A 4WLNA 5DM70 3HC7A 2JASA 4EF4A 3VZPA 4IOMA 3OLYA 1KQGA 1WPXA 2EGHA 2RGAA 4KQHA 4NONA 3HYLA 2AT1A 3D0RA 5GY7A 3SQLA 1KWGA 1K2VN 3CW8X 4J2TA 2GS9A 2ZRKA 3LQKA 5BRJA 3D54D 1X8JA 2JC3A 2O2GA 3DR3A 4HAOA 4MGZR 4RF3A 2I5PO 5TE9A 4FN5A 2XI4A 5D51S 1JHYA 2G8NA 3FFTA 4REQA 4D82A 1YO6A 5I51A 1MN6A 3ABIA 1PK7A 5IKPA 1Y89A 3H6KA 3QPBA 3D3WA 2GK6A 4HMPA 5P21A 1N9KA 3ZBPA 4CCSA 4XKJA 3ESZA 3K0HA 2EAUA 5BNFA 4EOGA 1NXSA 1U1GA 2GJ4A 3NTLA 3P2JA 4G9BA 4B2LA 3BG5A 2E85A 2WK1A 1ZVMA 1LDEA 1X2BA 2C83A 1XELA 4G8BA 1XZLA 2EP5A 2FOXA 5F3DA 3WRWA 3NWBA 1KVRA 3GRCA 1F14A 3BE6A 2YUTA 4QRDA 4AO6A 5HUQA 1MLDA 2AI2A 1Y8RB 5JXJA 4G41A 5ISMA 1Y3CE 4U7TB 5BQ3A 5JQGA 2W98A 4DNPA 1DG1G 1GN8A 1OXXK 3ECSA 5JYEA 4H1TA 1MVLA 3U3DA 3EFOB 4P4LA 4LISA 1PO7A 4JHLA 3R5TA 2H4JA 3QQPA 2NSDA 4NBRA 4F5DA 1MOSA 5HKLA 1L4NA 3M4NA 1HNXB 1KH2A 3GRKA 3PBKA 5SYNA 4ZHQF 1IVSA 4NEQA 2W2OA 2VJPA 1SZPA 1LTKA 4UATA 4A0SA 3DWIA 1NUQA 3Q98A 4P4SA 2NT3A 2AE1A 1RYZA 2XEDA 2OZKA 1Y6GA 2EQBA 3X1MA 1ISGA 2GZSA 2XTMA 3A9WA 2DUUA 3BWBA 3O75A 3OZVA 4RDHA 4KB5A 5HFAA 2JBHA 3T9BA 3CZ4A 2O6LA 1SN7A 1Z6PA 2FPPA 2RH4A 5CJPA 3EOAI 4PQRA 1YWGO 2X86A 4X91A 3VGJA 3UMCA 3VO2A 7ABPA 2VHEA 3GBPA 3ZWNA 1YFLA 1D3AA 4IV8A 4O29A 1M76A 5LNK6 1RR6A 2LW7A 2RH9B 3EF3A 3VR6A 3IO3A 4Q1DA 1HKUA 4PC1A 4YLGA 2DPXA 2LCIA 3COSA 4FK8A 2FDRA 1HUQA 2WZQA 5GJVC 3ULKA 1ZMTA 2QD3A 3FIJA 2C82A 1ATIA 1U3FA 3CLVA 5EJ4A 1XCOA 1FCJA 4RHEA 1TMGE 3PK0A 1IN4A 1BYIA 1Q3KA 2HSWA 3HJNA 4UPDA 4BKRA 1WCXA 3BRCA 1LC3A 3EGDA 3LC7O 3IXMA 1QPZA 3DBIA 3EAFA 3HO1A 3DE4X 3IVXA 3CEJA 4YONB 1N3BA 4ER3A 1M66A 5IULC 1AQYA 3KBBA 4P3KA 4BTEA 2IYOA 1BS2A 3CUUA 1EP2B 3IJRA 3KD2A 3HLKA 1HNNA 1T9KA 4FMCF 1DCTA 3AEXA 4PRZA 4XIIA 3U7RA 3ZK9A 3RF6A 3UUWA 5K09A 1KS2A 3LVQE 4O4IF 3FTEA 1ELOA 3RKUA 2PFSA 2HQOA 3JV7A 3IB6A 4CLRA 3OZEA 2QYHA 3OQPA 4OQ4A 3RKRA 1J7KA 4DDHA 5TT0A 1IXKA 5EYPA 3R2JA 4MV1A 2NSJA 3A4MA 9MHTA 5GTDA 1WSBA 5AVKA 4BWVA 2HD4A 5CFMA 1G4AE 2EKZA 3UWMA 1SCKA 2EFCB 3SOZA 3E22B 5ERXA 1Q1EA 2WYIA 2YVAA 1CIVA 5AHOA 4DR1B 1B4DA 2NSHA 1PHPA 1W0CA 1X7DA 2NU7A 2WW8A 3AP2A 4UM9D 3GDWA 4DMGA 1P4HA 1M0TA 3LBFA 2ZXFA 2J9XB 4OH7A 2MYNA 4WCVA 5ALVA 4J0QA 1M1UA 2AZMA 3A1SA 3QUAA 2VQ6A 1T8WA 4J75A 4CF7A 4X66B 5LIRA 5AHWA 2V9ZA 1KNXA 1SXHA 2P11A 4MGHA 1UOQA 1GEEA 4EENA 5LU9A 5MN6A 2JLZA 4CTJA 2SICE 2ZVPX 4B9EA 3NPAA 3CVXA 4MIYA 3D8BA 3D7RA 2H5LA 1JG6A 3WNVA 1ID8A 3UK6A 1CVIA 4IQ0A 2HFJA 1ZX1A 5T4FA 4JYMA 1DG3A 3RUAA 3ZCSA 1NPTO 1QIEA 2AFIB 2DUJA 4JBNA 1Z08A 4JI5B 5A0FA 3ROKA 1W5AA 1WOYA 2O52A 3IGFA 3QG1A 4BTVA 4C5BA 2JJ1D 3KEGA 1TUBA 1ULSA 4ALKA 4AZ3B 3EFBA 2PE5A 1NY5A 4GXRA 4FS3A 2W2KB 3UYLA 3I5UA 4JOSA 1R6XA 1JXMA 1XDUA 2H4HA 2XDQA 2NU6A 1NRWA 1NA5A 4FZVA 3M89A 1US8B 4I14A 1A7JA 4LWQA 5ER6A 1K2WA 2FFAA 4FJ1A 2P1DA 5EXXA 4H1WA 2E4ZA 3MB8A 1DRWA 1JHOA 4EO7A 1PZFA 2NVBA 4G0VA 3GWGA 1IB6A 2VF2A 4UUQA 1ONBA 3D8SA 3SDSA 2GOYA 2HWXA 2EU8A 1VPEA 3QVJA 3K6KA 1QRUA 3O93A 3ROZA 3VMMA 2COEA 2CXXA 3GH3A 4G4GA 3JVIA 3L04A 1EGMB 5AJTA 3WHKA 4UM5A 2YY6A 4HO1X 4CM9A 1YUMA 2R8XA 3BMXA 1U28A 2QVXX 2WJPA 1A2OA 2A3NA 3MFQA 1W6RA 2DWPA 2Q2OA 2AYZA 2O1EA 4FBLA 1BRTA 4C88A 2XUFA 3B36A 5TC4A 2IU0A 3L0IB 4LRWA 1O9HA 2QYSA 4XGIA 4Y1RB 3OMXA 4PX2A 2YJ3A 2EYUA 2JKVA 2XNKA 5EIFA 1P60A 1IE3A 3OTHA 3DKPA 1GA6A 1ICEA 2K4MA 3OEHD 3PP8A 4JITA 4PX3A 5JXIA 4OI4A 2R7LA 4I3GA 4C87A 1TJ5A 1U1DA 4TKVB 4FGSA 3MXTA 4QPZA 3GEMA 2JI8A 1RS0A 2Y1DA 3LBNA 3NEAA 3PNYA 3TRFA 4H1HA 4DMMA 3EWIA 4BEVA 4R9UC 5B57C 1DDOA 1LDGA 2E82A 1YB4A 4JC8A 4K9MA 1FP6A 4BNMA 4RDCA 2FPKA 4WGGA 4YMGA 1Y8ZA 3H5OA 3NBMA 2WWVD 1I6WA 2Q99A 2QQFA 3EYWA 3VZCA 2P0EA 1QSGA 5JOQA 4M0MA 3NGLA 1NG9A 3QWHA 4EA9A 5EMLA 3LT5A 1WL8A 1B93A 3ZI7A 3VKVA 5ILOA 2VDPB 4I4TB 1D6JA 1O8BA 3UEOA 5GJWC 2H06A 1W4BA 4JGBA 3A6GA 5JDIA 2KPOA 3RHZA 1AKEA 2ACVA 1OLUB 2J7PD 4I08A 4K0KB 1T9CA 3NCTA 3FZEA 4L1KA 3EDMA 4BU1A 1XTZA 3QWFA 2ZYSA 1A97A 1VP9A 1W8IA 2YJ4A 2ZKLA 4TL9A 5AKLA 1J20A 2EHJA 2J9YB 3COVA 3GXBA 1T3ZA 3QYFA 1U94A 2QW0X 1AQLA 4AO8A 3AF5A 2Q5CA 1E6EA 2J3EA 4HF7A 1IY1A 1QHYA 5F98A 8MHTA 1UWLA 2D54A 2O05A 4NG5A 3MTDA 3VJMA 3QIVA 4Z4QA 2HF8A 4GRAA 4H6VA 3GEEA 4Q1VA 2HRCA 4ZI5