4RANA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
201
Chain Sequence
RSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKVIGGDSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 201
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ranA00
1I0IA 1G9SA 5HKLA 4FYMA 1DKUA 1L1RA 1ECBA 1STOA 1U9ZA 2FXVA 1Z7GA 2JKZA 2C4KA 2IGBA 1ECCA 1TC1A 4RADA 4WMLA 1A96A 4LZNA 2WNSA 1BD4A 1QK3A 4MB6A 4P83A 2H08A 4QYIB 1JLSA 1W30A 1IBSA 1LH0A 5KAMA 1P4AA 1QB8A 2EHJA 5K51A 4LZOA 4P84A 2XBUA 1V9SA 1MZVA 3EFHA 3G6WA 1ECGA 1A97A 2H06A 1Y0BA 1J7JA 3GGJA 1QCCA 4RANA 2H07A 1PZMA 4PAWA 2P1ZA 1DKRA 1HMPA 3DAHA 1I5EA 2JBHA 5BSKA 1JLRA 4WN3A 1A95A 1OPRA 4RABA 5KAPA 1QK5A 2AEEA 1UFRA 2PRYA 3NAGA 4P86A 1WD5A 1XZNA 2PRZA 4IJQA 1L1QA 4P80A 5ESXA 4KN6A 4X45A 5BRNA 4Z1OA 1GRVA 1ZN9A 3M3HA 5EUCA 1DBRA 1O5OA 1OREA 1QCDA 4RHUA 1VCHA 1P19A 1A3CA 3S5JA 4P82A 3ACDA 1P17A 1DQPA 2VFAA 4TWBA 4JITA 4LYGA 4LYYA 1GPH1 5BQPA 1DQNA 4RQAA 3H83A 1G9TA 4LZAA 1XTVA 2PS1A 1A98A 4RHTA 4OHCA 1R3UA 1ZN8A 4QYIA 1D6NA 3GGCA 3ACCA 5IPFA 1FSGA 1BD3A 1UPFA 3ACBA 3OZFA 4RQBA 1XTTA 1I13A 4RAQA 1U9YA 2JKYA 4QRIA 5IAOA 5E38A 3KB8A 4P81A 3MJDA 1NULA 1I14A 4RHXA 3QW4B 4RHYA 1QK4A 3O7MA 3DMPA 1VDMA 1YFZA 1TC2A 1O57A 3GEPA 1G2QA 3OZGA 4PFQA 5ESWA 5JSQA 4S2UA 1OROA 1I0LA 3DEZA 1G2PA 1NONA 3N2LA 5BQOA 5HIAA 1P18A 2HCRA 1ECFA 4ZFNA 4RAOA 1ZN7A 1BZYA 2YZKA 1CJBA 1A4XA 2E55A 3LPNA 4P3KA 4M0PA 1AO0A 1XZ8A 4M0UA 4F8EA 3HVUA 3OHPA 5JV5A 2JI4A 1VSTA 1ECJA 4RACA 1UPUA 3LRTA 2GEBA 3MBIA 1HGXA 1XTUA 2DY0A 4X44A 1QB7A 4RV4A 4JLSA 4M0KA
chains in the Genus database with same CATH superfamily
5TMEA 2X2PA 1T3GA 1ZFNA 1XZDA 3GVHA 3GPIA 4L7VA 5KYGA 3QP9A 3LQQA 4NYJQ 1XEFA 2G07A 3ELWA 2WVAA 3OT1B 2BEJA 4FGZA 5AO9A 3RRFA 1GV1A 1UF9A 2I34A 3QX9A 1VP9A 1QAOA 4YQYA 4BC1A 1TL7C 4Z53A 2QX6A 1C50A 1CRWG 3M6VA 3OCXA 1UL1X 1PD1A 1Y8RA 4U39A 1EUDB 2NU9A 5BYBA 4TUYA 2VP6A 3WX0A 4I50F 2V7PA 2E4AA 1Q22A 3ZV5A 3R1IA 1CP3A 4XJXA 3VNSA 2PNFA 4K88A 3ODPA 1SBHA 1UDWA 4A1FA 1QUEA 3GO4A 5LKAA 5DNAA 1DJPA 1KC3A 1PDVA 1ND5A 1XC7A 4LY0A 2GXQA 4ND1A 5C1BA 4MKZA 3U44A 3M3DA 2HEGA 2IU3A 5K3FA 1QZTA 3DCJA 3NJRA 2IY9A 3CWZA 1DUSA 2NNWB 1BW9A 3CEMA 2VCEA 4PZZA 1HFWA 2CXNA 2HIHA 3KJQA 1F8UA 3CLTC 1RI5A 3K0SA 4AP9A 1KVSA 1XNQB 3IE1A 4MUKA 2WJJA 4MVWA 3KPVA 4NAVA 4W1PA 1C9NA 2ZIXA 4TUYB 2HCBA 2NU9B 3TIXB 3VOTA 1MRNA 4TROA 1ZXXA 3C8ZA 1EP2B 1JECA 1XDBA 2N42A 3V32A 1NBHA 5DYGA 4ML3A 3FNQA 2OFOA 1G63A 2MYUA 4S05A 2PWPA 3FPAA 3CZ9A 1H42A 5KYTA 1IZ0A 2ACKA 2IYOA 4HQKA 4PXSA 3C5EA 5A71A 4O1MA 2H2GA 2RGRA 2FMFA 4G0MA 3U44B 2WIAA 4X6UA 3QLUC 4TUYF 3EGCA 5CJJA 5K3FB 3UTDA 1HE1C 2WM8A 1K7YA 4BNHA 4UM9B 3MTQA 1BW9B 3W9BA 1XJ5A 5THKA 4KFCA 1H5UA 3MAGA 4PLGA 4TWIA 3OX3A 3REOA 5C51B 3JQGA 3K9QO 1VCIA 4EEXA 4G0NA 1KZ4A 2P0AA 3QLJA 4RQBA 1XRMA 1J8FA 3DSRA 4RPJA 1JKXA 1TEVA 4RAQA 3H2YA 5HRAA 2DB3A 1W29A 1ISFA 5T64A 1E2BA 2I66A 1KVRA 2ZIXB 3C6BA 3G7NA 3MF4A 2D59A 1JILA 1OJLA 2HL6A 3C1UA 3RARA 1ENPA 1PT7A 2ROQA 3DMRA 5AWFC 1AIPA 1E66A 1FMJA 1IG0A 2EJVA 3FNHA 1HDEA 1Z75A 2F9FA 3BXOA 3JRXA 4NDAA 2OXEA 4C7VA 4D41A 1FLVA 3BCHA 3BRQA 1QQ7A 3OJCA 1JWBB 5C37A 2XE4A 3HADA 3HDJA 1EX6A 3EGIA 3W7BA 2AG6A 3K0AA 2PN1A 3TLYA 4LHXA 4US0R 5JDIC 5IKXA 4OHZA 4ZC1A 2J3JA 3JQGB 1PAUA 3LTNC 4C7OA 4J1QA 1OXBB 5G0WA 4B40A 4CQNA 2BRUA 3RH0A 1JG2A 1NURA 1WUHS 3C4QA 3F9RA 4EFMA 1FS4A 4WJLA 1RJGA 3EDCA 1TAUA 1R0CA 1U9IA 4B5KA 2FPPA 4MINA 4JXXA 5BN5A 4UHJA 3F3SA 4FILA 2VKQA 5FLXA 2IXFA 4ZKEA 5K4HA 2EKPA 3TQQA 3GDGA 5BP7A 1DU4A 4B6SA 4JBIA 4J4BA 1G1AA 2VBFA 1OWMA 1CS0A 3G13A 5LDHA 2Y1XA 3RD5A 3LRXA 4DCOA 2FUEA 2X2OA 4YRJA 3F96A 2RBKA 5ALWA 4TTIA 3MWDA 3HN6A 5IASA 4V1CI 1KRXA 2CDBA 1YWGO 4L15A 2IX3A 1O08A 1S3FA 1TM3E 1YU9A 5I4CA 2ZYIA 4N5NA 4C7OB 3ABOB 4LZOA 1RP1A 2HNKA 1M6EX 4ZAWA 1C1DB 4HS9A 4PM4A 4A8HA 2ATEA 3JD3A 2WKQA 1PWEA 2ZSUA 3DAFA 1NT2A 1T1RA 3HCCA 2JFVA 3IIIA 3LXRA 4TV9A 5DNWA 2QVXX 2FPPB 2QN3A 5IJXA 4EHJA 4LYJA 3EFOA 4TTPA 4JZKA 5BN5B 1LWNA 1T3HA 1LPMA 1XZCA 1T8WA 4MS3A 1LF0A 2ES4A 4MVJI 2LKCA 1ZWLA 4NAUA 4M8SA 5AJHA 4YI5A 4C7XA 3OC0A 5EP1A 4A8PA 1QIIA 2G5GX 4YGYA 1A4RA 4ZXFA 3V4ZA 2R7LA 2NNLD 1T2VA 1LDNA 2IHBA 4KWEA 4OO3A 3RIMA 3OHMA 1M2HA 3HEBA 3Q85A 2J5BA 4L5YA 2HQBA 4WEQA 2VK4A 3BXZA 3P9RA 1K8XB 3MWDB 4HB0A 4IWNA 2O3QA 1NJ6A 4N7RA 1ODLA 2G83A 4QRHA 5JE8A 1AMNA 3TLAA 1NVVQ 1NP6A 3L4EA 3D8TA 4PAQA 4DKJA 3ZK7A 2RH5A 3O8NA 1R8XA 1E99A 3SNHA 4MUFA 3HFJA 2ASVA 1G20A 5ITSA 4TV9B 4GSLA 5LMCA 1CEEA 5IZCC 4U7WA 1ONBA 5ER9A 1Y42X 4LOHA 4F12A 5IEJA 2V4UA 3WJAA 4MS3B 2WWXA 3H5AA 2GPWA 5AKXA 1OH7A 4P0PB 1WEKA 3DHEA 2BGNA 2GK7A 3A4MA 1DZ3A 2FFBA 3UWOA 1QTIA 1XCOA 3NANA 2XUGA 4MUGA 4TV9F 4RTNA 1C8BA 4YJ2A 4EPTA 4HDCA 4QXQA 1I13A 2X3FA 2RGUA 5HJ7A 2HW8A 4UVHA 3I1FA 2IV7A 3B9QA 2PTGA 2J67A 4QNRA 3EXFA 1L7RA 2EJBA 3ASZA 3B89A 4KO2S 1V3UA 4QVGA 1FQJA 4XRGA 5CBPA 4NBNA 4NTZA 4P3NA 4JBWA 1AVTA 3ZU2A 5A4JA 1E4EA 2DZDA 3C2QA 3GFBA 3D7RA 1SHJA 4NQZA 1ZESA 2QXYA 3QMMA 4W7IA 3ICCA 3OCJA 3K9HA 1QOQB 3PC3A 3CKLA 1F60A 4OVKA 2R8PA 3CO0S 3WFZA 1SUPA 3HNPA 2PMDA 4IM7A 4MKIA 2RH9B 3PHCA 3UJHA 1L4BA 2X5KO 2CMDA 2RCYA 1W6RA 3E3LA 2I6SA 1KZHA 3DZIA 3PFGA 4REOA 1HQYE 4XM0A 4YJ2B 3DFMA 3O9VA 5DHSA 4ZQHA 4PC3A 4R40A 1RE0A 1P4JA 4UQOA 4AJ2A 2GN8A 3PEWA 4C78A 3EXFB 4CM9D 3SQXA 5CITA 1CR1A 3SE7A 5FD8A 1P1RA 1QAMA 5ANRB 5HF9A 3A05A 5CBPB 2W83A 3OJ0A 3O90A 3OVMA 4LJRA 3ONVA 4PGGA 1E4EB 1WDMA 2X4GA 5SV2A 3ROGA 3TZQA 1EVLA 1F2DA 1MBZA 1JZQA 1PG5A 3OCWA 4MAMA 4YJ2F 2YYAA 3FYUA 1T4CA 2NZVG 1GLNA 5DHRA 5TJ9A 1GGKA 3O8CA 1KYQA 2HV9A 4AX8A 3OQIA 4BUCA 1JAXA 2AQKA 3GWZA 4QTZA 1BD4A 2QM0A 3F4KA 3GDWA 3PNBA 2D1FA 1DEKA 2GRJA 4S3MA 5T41A 4HB2A 4A6DA 3PX7A 3K30A 4QUIA 3AU8A 2PDAA 4EGFA 4WKNA 5JAIA 1Z29A 4CLDA 2HFJA 1ZSVA 3HGMA 1UPXA 1GQSA 3VV3A 2O8DA 2BCJQ 2AC7A 4CLEA 1E9VA 3PYXA 3SVTA 4IF6A 1SQFA 1SXJC 3MHTA 2WSLA 2Z2KA 5ADWA 3L93A 4DCGA 1UXKA 4DLNA 4JQCA 1N78A 4DW8A 3DJFA 2QI9F 1NQAO 1E0KA 1XMSA 4II7A 5HJ5A 2GF0A 3K70C 1JXOA 1N5RA 4W4TA 3BXEA 3FYUB 1T4CB 1WX1A 2VSFA 5AI4A 5AHOA 2D06A 3CBGA 2G7MC 3NJ8A 3FSEA 4HATA 1IQRA 2QZJA 4KMOA 2WY2D 3D8SA 2P9BA 5TT1A 4JLMA 5SZKB 5L8VA 4MRSA 2ZXFA 5ICFA 4JI3B 4OLJA 1P1FA 2WUWE 4AXXA 2WNHA 721PA 1P19A 2ANCA 3QXHA 2O8DB 2AZTA 4ZA2A 2ZJZA 5IK2A 2VYNA 4EA6A 2W2NA 3C43A 1CS4C 3V42A 4H1WA 2QGNA 2KW5A 5GJWC 5CW2A 3L8GA 2I2DA 3A9CA 4FYIA 3UXEA 3A1FA 3JQ8B 2F1KA 4G0YA 3RV4A 3TAXA 2J5QA 4LXYA 4R2WA 1XZQA 2W48A 1NJ8A 3GIDA 4ZEXA 3OLZA 4R8LA 4GPIB 4UNRA 1TJNA 4IVQA 4OEHA 3UA3A 2FSVA 4EUSA 3CKKA 2JHPA 1CUDA 3EXHB 1KDTA 2DLDA 2GYWA 2Y0BA 1HNXB 3KJIA 1QRDA 5LIPA 3A58B 2PPLA 5FR1A 1CZRA 3C3YA 5CDUA 1PTJC 1AUQA 1MFPA 1JB1A 3JD2A 1BHSA 4NEQA 2C2WA 1AX9A 3RC1A 4GDFA 2OG2A 2TMKA 1A8PA 1BGVA 3E22A 2IXEA 4N3AA 4CG3A 3C98A 3DBOB 5BWCA 3KSDO 5ADUS 3OZCA 5FNZA 1KKUA 2B8TA 4NOKA 3AGPA 4U5QA 2HXGA 4C6SA 2QTGA 1MZPA 4RFLA 1WQ4A 3EC2A 5AI6A 4ZCLA 2C4NA 5A5VA 5AW0A 1EJ6A 4LEIA 4FIDA 1JN0A 1NQUA 1WXDA 1YE3A 2A30A 4YTEA 1N77A 3RFUA 3BPSA 2Z1DA 3R9XA 1RMQA 3P4YA 1AKUA 1MX9A 1U6JA 2G9VA 4RD6A 1RQRA 4IF4A 5DSZA 5E4FA 4QO8A 2QT9A 1SULA 3CKMA 3ROFA 1BS9A 2EQBA 3O8QA 4MCHA 5KDDA 1UFQA 4MIOA 4U3JA 2V5AA 1KDOA 2XT6A 5CVEA 5IAEA 2JI7A 8ABPA 2K4MA 1Z08A 1BDMA 2DRIA 3ZUPA 1I2DA 3HEMA 3AB3A 3WLEA 5H3LA 2B21A 4YDSA 3E22B 1S8AA 4FD3A 3RRYA 1KXZA 4MVXA 2JJQA 4EG4A 2EL7A 1KO7A 3Q3HA 3SZGA 3ZCVA 1BFDA 3UHAA 4BX9A 3ESZA 4L08A 3O21A 2YXPX 5B36A 1JXMA 4NJMA 4HB3A 2QJOA 4UARA 1U0LA 2VSQA 4CLHA 1PHPA 2Y0CA 1RQXA 3LPAA 4LS3A 4RE6A 1I2BA 4DNXA 3AHGA 3R9XB 3WFJA 4X90A 5EHZA 6NULA 1OXKB 5LLTA 5K3DA 3QKIA 1CUIA 4GG1A 5EQTA 2G9RA 3N9IA 4Y2UA 1N2JA 3U9SA 4TL6A 4BX2A 2DULA 3BC1A 3LLSA 3O8QB 3A4NA 1I2MA 2ZUCA 3EG9A 3TQRA 1O95C 1DC6A 2NADA 4U3JB 4DLPA 3PPVA 4PYKA 1GZVA 2QNBA 1EP1B 4Y6PA 5K05A 4Z5XA 3D6FA 1DC3A 4O5OA 5CNMA 2OESA 5KYKA 2IS4A 4LVUA 4EBFA 1UQTA 3G2MA 1TFUA 4XVHA 2YV4A 1HT0A 4RKQA 3R6TA 2WICA 4IKPA 1MO6A 4UM8B 1JWLA 3LBNA 2JHCA 3NHYA 4NJMB 2PMBA 4DAEA 5LP6B 3KAPA 4QPJC 5KZMB 2F9LA 1KRWA 1SWVA 3RJTA 1UPAA 2OMKA 1M1YE 1ZOLA 4HDMA 3UANA 4MK4A 3DDCA 3TI7A 2JIRA 3N58A 4Y9DA 1QCDA 2HLPA 2CDCA 2HDHA 1DBSA 4BXOA 4YGXB 4HG2A 3BCRA 4X84A 4ONEA 3TRIA 2V6IA 1EQAA 4DUGA 5LP6F 5J2UF 2FY8A 4PQEA 4MW0A 1SK8A 1B7GO 1NFFA 1WMSA 2B1IA 1XQ9A 1UWVA 3WYEA 4JEIA 1XTVA 5CDFA 4F85A 1WZIA 2E0IA 4BEBA 1Z6XA 3HP1A 2OBXA 2Q49A 2YIMA 3LRPA 4ZO7A 4U8HA 4LC1A 3FR8A 3RHTA 3UOGA 1J8DA 2PSFA 5LMNB 4KFTA 1V5EA 2F00A 1DZIA 5LN1A 4B7AA 1UBJS 3ANNA 3PC7A 4KYTA 5ED4A 4JJIA 3VR6A 2X86A 5JPDA 5DEOA 4O2AB 4BP3A 3HO6A 4FFWA 1KXJA 4MIYA 4RHXA 3HJHA 4UHDA 2CXUA 3FOZA 3D2AA 4HK4A 4LISA 3QKUA 2H1HA 5IABA 2PA3A 1YK0A 3H1BA 4QEZA 6YASA 5I51A 4BXOB 1G4UR 2WOJA 5AI9A 4LSWA 1GGHA 2J6IA 1EP9A 3FJYA 2ODWA 3K70D 5LZ4A 4FSXA 1WKVA 3F5MA 1ULAA 3MUNA 4ESVA 4U00A 1CRLA 4KHZA 4MQUA 2XW6A 5U1PA 4O2AF 1KJIA 1P73A 4NNOA 3I5XA 3TMYA 1OWPA 3RANA 1TI7A 2QRMA 2XLCA 4EMTA 2P11A 4TYPA 4IUDS 1IZ7A 5HDBB 3LGSA 5FPSA 4IILA 4R8SA 3DE6X 2CF5A 1JQKA 4QFDA 4RZ2A 3HKBB 4UU0A 4AZSA 2BL4A 5GY7A 4LF9B 2B9EA 5B5SA 1KSGA 1UPUA 4FZVA 4OQZA 3VYUB 2GM3A 2OGSA 2IOYA 3QFFA 4XVUA 4NPHA 3AJ9A 4NNJA 2VDVE 3W6ZA 3B70A 3G8CA 3KYCA 1A7UA 3OF2A 1EK5A 1F12A 4MI1A 2HRBA 3VO2A 3TTYA 4AZWA 2PKWA 5EUBA 4J90A 1T6BY 1JDTA 3WDLA 4DHEA 4LTDA 4PLPA 5CFPA 2R5FA 1NN5A 1VSUA 2JH3A 3H1AA 2J6BA 4IIFA 4HNSA 4NE2A 4TPKA 1T91A 3Q7RA 3WBJA 4CTNA 4E09A 1GZ7A 4FFSA 4URZR 2J7KA 1NUTA 2VPTA 1GVHA 2AV6A 3FAZA 5IAGA 3DOHA 4LDJA 4YACA 5ILOA 3IVGA 3PNLA 3H5TA 1E79A 2K6GA 4B8YA 5KTPA 1N3IA 2OEPA 1YAHA 2ATCA 3DE1X 1JLHA 2ATIA 1SCNE 1N6HA 4ARSA 2NPOA 3AFNA 2IZ5A 4HUQA 1TTTA 4XI9A 1M0EA 2Y4OA 2WYUA 3STXA 3L7MA 1U3GA 1MABA 4D0RA 1DKRA 2EHDA 3KYCB 3BMNA 2PZEA 4XD2A 1TD1A 4S1VA 5WRFA 4HEJA 3SR0A 4B45A 2FSSA 2XIJA 5T3YA 1V9CA 4ECEA 5JI2E 2YC4C 5EJ4A 1VE6A 2B69A 1WCWA 3KLOA 1X42A 1ZUWA 4LWOA 2ET6A 3GZ4A 2R8YA 5ETJA 3FI9A 4EG6A 1SC1A 1OYWA 1R10A 3U0BA 1J06A 5CFRA 9LDTA 1RC8A 2YDYA 1BO6A 4H6VA 1GKLA 5LQCA 2WB4A 3CX3A 2DBRA 1OC4A 3INGA 4M1ZA 5K6TA 1JQEA 5A62A 3E4DA 5T3UA 3Q3JB 4JLUA 4Z7OB 1BXKA 3VR5H 2JGFA 4CNBA 5HYVA 5L53A 3WISA 3W9SA 2AYZA 1MABB 4AM8A 3SR3A 2FPUA 5F7JA 1F4LA 3K35A 4IDFA 2FZLA 3BMNB 3H18A 3LVFO 4UASA 2NAFA 3ZX5A 2ZYGA 1R3UA 3WL8A 2DUJA 3LSYA 4RFSA 4YK7A 2EKZA 3DCNA 1W581 3G2LA 1JJ7A 4IXDA 1EFTA 4XOUA 3EF1A 3TEJA 2VXBA 3C97A 4QYWA 5LD2C 3H2SA 3NP7A 1G5PA 3D7KA 3ZE9A 2ZT5A 4G6ZA 5HRCA 4TMVA 2G5PA 3CH6A 4KMSA 4U2FA 4B46A 1JDNA 3UJAA 3ZDZB 4QHTA 1L4GA 5G1PA 1KY3A 3U3OA 5BSHA 1G2IA 3SDSA 2NTJA 1N0VC 3H4MA 1RKVA 1VIMA 4MQMA 1RMYA 1KK2A 2Q2QA 1P75A 3B9RA 4PFQA 1DE0A 4R9VA 2VYND 3BGDA 4Z51A 4YRLA 4A0SA 4P0QB 3LPDA 1ZM7A 4LC0A 3EZ2A 2P69A 4P38A 1ISHA 5AOVA 2FEOA 3ANXA 2CL7X 4KNVA 4E30A 3MGCA 4ZYZA 3ZZNA 1UWLA 1HRKA 3ED5A 1DFHA 1PYGA 2E4ZA 4F3NA 2YZKA 4FHDA 4AYTA 3V8PA 4RFSB 3RAPR 4LJ5A 4GRIA 4WNCA 3C6ZA 3U19A 3P2KA 1E7QA 1TVCA 1E89A 1WU8A 3ICWA 1GA6A 4MI6A 4RF4A 3B12A 3OLQA 3R9WA 1CF2O 3RU9A 3QG5A 3AVXA 3GGSA 5F9MA 3QE4A 3HJCA 3NC0C 1Y3DE 4CIYA 1GT6A 3B3FA 3K0KA 2VJPA 4HYYA 4D6XA 1PZNA 2C2GA 2CLLB 2I8LA 2RB5A 2N3ZA 2RGCA 3A3OA 4DLUA 3KYIB 5HKLA 3ZY2A 4BAZA 2ZSFA 2C1ZA 2Z09A 2WI8A 4BMZA 1ST2A 3L06A 5DHUA 1W76A 2VF5X 4DYVA 4IOKA 3ND8A 3HUDA 4OH7A 4IZIA 5B4VA 3TVDA 3HCEA 4QUJA 1Y6ZA 1YE5A 4N4AA 2Q0XA 4J0DA 5EP3A 1RWXA 1Z74A 1K5PA 3K7EA 4K9KA 1M2GA 2A92A 1WF3A 3I0NA 3ZCRA 4C4ZA 2C00A 1Y1SA 4D45A 4WA8A 1EVKA 3WWOA 3KB6A 1HRDA 2Q07A 2C5GA 3ONWA 1N2GA 2HZBA 2Y2VA 4M88A 4I5GA 1WA5A 2PX5A 3ESAA 3R5TA 4Y2HA 1PR1A 2WT4A 4I9GA 2CVFA 4CCSA 1W73A 2IYWA 4YP7A 1SG6A 2XUPA 4P53A 3PA6A 3WZLA 4D80A 1D8TA 2Z3VA 2CNWA 4JIMA 4TTSA 1EAMA 4WN3A 4E5MA 4EENA 3S2GA 4ZRDA 1NF9A 4EZEA 3DXFA 5EAIA 3IDSA 4RKRA 3NAGA 4BMOB 3E82A 5K8LA 3QU4A 3ZI4A 2V3CC 5IHXA 5JBQA 2IYYA 2R65A 3MTDA 1AU9A 1EUCA 2WAXA 4L07A 5FB3A 1R9MA 3R6GA 4D46A 2X4LA 4R9SA 4E2XA 2JJ1A 4CL2A 3TZKA 3CLUC 4JEHA 3QEBZ 3OPYA 5I9MA 3SJ7A 2CWWA 2ZE7A 2QT1A 4GPZA 1OXMA 2WVGA 4MP6A 3P2OA 1GPWB 1U2GC 2LRHA 3D7NA 3LQRA 1D2EA 2IEYA 1EFAA 5HMLA 3PVZA 2XKKA 1YBAA 4UW9A 2Q1WA 2GEVA 2ZKLA 3B20A 3D4BA 4K2HA 3KXDA 2B5VA 3T5BA 5GVSA 3DLIA 4U6SA 1TYBE 5CHYA 2ZJ0A 2IYAA 4L0QA 4JC5A 2RI1A 1JIVA 2NXWA 1PJ2A 3REFA 3TEFA 2YMMA 1JKFA 2KJQA 3GUHA 5FV4A 3EPHA 4WBNA 2H9AA 3W9YA 2OK7A 1JFSA 3K1AA 2JCBA 4NYIQ 1EUCB 1TZCA 1SA0A 4I4TA 4JWTA 4FDLA 4Q4HB 3TM5A 2GD2A 5ENDA 3GLFE 4PNEA 3MCZA 2BGUA 2HDOA 5CMLA 1M1UA 3OPYB 3FCYA 4ER0A 2G9QA 3PQDA 1OROA 1NW6A 2BKLA 2IU0A 3FNFA 3HXPA 1GGVA 4LY9A 3UB3A 2B4TO 1BVUA 4DUGD 5H9WA 3QSGA 1MVNA 4DLYA 1KVQA 1ESMA 3GPDG 3SLKA 4BVEA 2IY7A 3KJGA 7MHTA 4XM2A 1FFYA 4WY8A 2ZRFA 3MINB 4JDPA 2I29A 1FP6A 1FU7A 3AVTA 5HF6A 5CRIA 3W04A 5HMMA 4BASA 2LCIA 4L3OA 4KXVA 4BFYA 4QJ4A 4EI9A 3PEYA 3SIPA 3ZEIA 3TDMA 4MARA 4TT3A 2WTBA 5JDCC 5DDIP 3SBXA 1I3LA 4P08A 3VR6D 3K1AB 3W79A 1SA0B 4I4TB 5JISA 3C14C 2BSXA 4I8IA 1MC8A 5EERA 1C7RA 2EV9A 1JR2A 3Q72A 5KC8A 3V8MA 3WL5A 3RCBA 4DQUA 4GPBA 2ZI5A 1W36B 5L40A 1GVNB 2LP4Y 1S2IA 2EATA 3L1IA 4YEDA 1XVVA 4COKA 1N2XA 2I4NA 4DV2B 1XVUA 1ZI6A 5HBGA 2OY0A 5CFZA 3LDUA 1QDEA 3KAQA 2HTFA 3H1PA 4NMXB 2GWRA 1M33A 4DJ5X 3DBRA 1RAAA 4X91A 1N33B 2E7ZA 2RHTA 3FBWA 1QFYA 3CA8A 4YBZA 5IBQA 4NBLA 2MYTA 1ZP6A 1QVAA 5CTAA 1ESDA 1GZ3A 3NATA 5JPIA 1PN3A 5F3RA 3ZK8A 3EHEA 4K26A 1NHGA 2VZLA 2XGSA 3KAKA 2WA2A 2BGGA 4RTQA 2GQ0A 1L4MA 1L7MA 1X7YA 1X1EA 4JR1A 4EF6A 4BQSA 2HXYA 1Y7TA 2BFWA 3RJ9A 3SBEA 1N1GA 4B6GA 4F96A 2H18A 5JEDA 1RJ9A 3TLMA 2CLEB 2R751 2RARA 3N7TA 1YZNA 4UE2A 5KDOA 4TMTA 1JLRA 3NUQA 5EIHA 4CLRB 1U5AA 2HPAA 3CRW1 2JASA 4JB3A 4RZXA 4UBNA 1BDBA 4XDHA 4Y9UA 1G21E 1HFJA 3RIHA 2UZ0A 4YMGA 1RAIA 2LE0A 3ZDDA 2H3HA 3FPKA 4M0FA 1Y7LA 2JK1A 1GGEA 2QAIA 3LQ4A 4LX8A 4ZQGA 3IXQA 4QBKA 4YAJA 3ROXA 3ZCSA 4LFAB 4ZTZB 1VG9B 3PSHA 3WQSB 1E79D 2IZ7A 3DBRB 3HP4A 3LUKA 4BZPA 4LWPA 3L0YA 3FUVA 2Z3ZA 3TFOA 5FBHA 3BF7A 3PGMA 1EZ4A 3PV0A 1R4AA 2PBZA 1YR2A 2W98A 3BL8A 3LK7A 1VLVA 4G67A 2AE2A 1B2RA 2CBGA 3EVTA 1ADJA 5DM60 2R60A 3VZRA 2YFYA 1D4AA 1HNWB 3RC8A 1X7YB 3FMFA 3FROA 1GSIA 2IODA 4LNUA 1GTRA 1OXUA 1RJ9B 4UBIA 5U4XA 4MV8A 1GUFA 5F3DA 5F5XA 5CTJA 2J3LA 4N47A 1E9BA 4J1SA 3GVCA 3QVMA 4MKFA 4O0MA 1GRRA 4D8XA 2V1UA 3KHKA 2AQ8A 2ZB2A 3HB4X 2ZBFA 1WHSA 3AY3A 3PHJA 1EVQA 2XUHA 2QNRA 4WK6A 1I5RA 4G1VA 3ER9A 1NN1A 2GARA 2GBIA 2BOVA 4GR9A 2XGGA 1Z4JA 5BMVA 1I9CA 3C3CA 4HJXA 3H9BA 4FR0A 5EUQB 4B4VA 4BLVA 5B1HA 5JNLA 2A1TS 4PLWA 3C48A 4WUTA 3NHKA 1XT6A 1CDEA 3OCYA 3PNYA 4CKWB 2QE7A 3GH1A 4DJTA 1KYXA 4O0LA 4DC1A 5HQTA 3DR3A 4EY7A 1SB9A 1ELOA 1XRJA 5AXCA 2R1TA 1AGPA 1AV7A 1U0JA 4TRNA 2CLSA 5HK9A 1I1HA 2XQGA 1BWPA 4LNUB 3AINA 3NRCA 4NR0A 1X1TA 1EVYA 1FJHA 2O2XA 4BV3A 1SHKA 2ZP1A 3MGBA 5DSTA 4AMGA 2HOQA 4WXRA 3HYRA 1U8CB 1WSBA 3G9TA 4MROA 4CT4B 5F7OA 1JIXA 1VJTA 3AR2A 4L8FA 4TYYA 3FA2A 4MLPA 2GEBA 2XA9A 5FULA 1QGED 5L7TA 2PV7A 1VLQA 1U8XX 1QP8A 2NO5A 4IHQA 3EVFA 5HCIA 4WAUA 4IR7A 4OSPA 5BMVB 2GBPA 4X61A 4AUKA 2PIAA 3QM1A 3AI2A 2Z6VA 3VYSB 3GLHE 3VYWA 5C7YA 5KVCA 1KSFX 3IKVA 2I2BA 3RQSA 3TE7A 4BRWA 5GTDA 3RYIA 3QFCA 4TWRA 1VHLA 2GAOA 5I7UA 2R1TB 2PUVA 1TO1E 2BMJA 2H59A 3FSRA 1SVKA 1E7RA 3JU3A 4AKIA 2QAGC 2HAEA 3OZVA 1K8ZB 4A6EA 1PZXA 4P33A 1QNFA 1Y9JA 5AJZA 4F8YA 3R09A 4L85A 2FPMA 4WI1A 1BHO1 2WA1A 3FWHA 4FGLA 4PLTA 3ZIAA 1VOTA 1FS6A 2YW9A 4FQ7A 4V2IA 1H2WA 3SLGA 3HABA 3UGJA 5GOTA 3DE5X 5LUAA 4MUJA 1LUAA 5K1ZA 5IKOA 1OXTA 4DLSA 4DR6B 4FZRA 4MYTA 3F5SA 3FGOA 4F3CA 5CUQA 4J0CA 2OR3A 4PC7A 2C94A 4L9AA 1QFZA 2ZANA 2A9QA 4IGEA 3P5BA 3LXMA 1J9GA 2C0QA 2GK6A 1A9SA 3IVMA 3OP4A 1CJTC 3SF0A 4EITA 1UR5A 1IBCA 5A05A 3OJLA 1OBFO 1ZRMA 3RYIB 2YS7A 3LUPA 5A3QA 5IJWA 4CMIA 5BSFA 1MG0A 2GXSA 1G21B 4DMUB 1A9ZA 4F72A 2XTAA 2NO6A 4GOMD 1S2OA 1CX9B 4PG8A 2GGSA 3PQ5A 4KKXB 1F3LA 4AZVA 1FIUA 5CCDA 2G17A 1W47A 4JI2B 4IGAA 2RIRA 4NU5A 1I4TD 5ADHA 3WMEA 3VTAA 2OVFA 4MGYR 2ZYRA 3T4PA 1K8RA 3HPQA 1T1IA 3I1IA 1PR4A 2DR0A 4EDHA 3M4XA 3NOOA 3OM0A 3QUBA 5FBRB 1MJ5A 3NVDA 2CE2X 4U7DA 1Z5OA 3DKVA 4NAHA 4DEXA 1FP4A 2XH8A 3H97A 3E9YA 3MWKA 3NG1A 2BM9A 4LYFA 2VC2B 1KZ9A 3RVDA 2EBUA 1GQFA 4YONB 2XODA 4QYIA 4E3WA 1Z16A 5HR5A 5BNZA 4FZJA 2OUKA 4AJ4A 5KTTA 1T1EA 4IH1A 4CMIB 2DSTA 4XARA 1C3LA 5AKEA 3ORQA 1ORRA 3FAKA 1XZEA 1J7KA 1WXFA 3DB2A 4R2IA 5C46F 2AFHA 4FQ5A 5E38A 3L4KA 3H87A 3S8MA 3AEXA 4DREA 2PM8A 2JJ1D 2QD2A 2OQ2A 2Y1KA 1YH3A 1OBVA 3IILA 3LLMA 4F5YA 1QLHA 4ID3A 4QTXA 3KQYA 3SZRA 3ER8A 4G89A 4IJKA 4J0HA 5C7OO 1CR0A 1Z2CA 2DWQA 3TN7A 3ESCA 2CZQA 4QGFA 4BLRA 3RUFA 2RGGA 4C0KA 1WTCA 4OQDA 3BQMB 4WSOA 3DPSA 3WIVA 4JVOA 2PCLA 1P8JA 3H5VA 4IS2A 4I1VA 4UBLA 4G86A 4DA7A 1TVEA 1V3TA 1XROA 4MV0A 3P0FA 1MPTA 1TX4B 5C4GB 4WNYA 1XI2A 5MGNA 3VOAA 4R1QA 5B37A 3CNEA 1MAUA 1JAYA 2FLKA 2HA7A 1C9DB 1HT1E 1PL0A 2JC3A 2ZG6A 2F59A 2XWSA 4WZZA 4B8ZA 3WYDA 2YMPA 4ENSA 1YRYE 4M55A 2WG2A 3GQBA 2PX6A 2GB4A 1KDPA 1KRHA 2OAGA 1ZI9A 3PR1A 3RUHA 2EG9A 1FSPA 5JH7A 1QTRA 2DXIA 1E1LA 3FDZA 3LNTA 3NVKI 1CEQA 1PW5A 3AW8A 4ZYYA 5CVJA 2ONZA 1SVMA 1MT3A 2OHHA 2FPGA 2OO7A 3MW8A 1PGQA 4RPLA 4TMKA 4DCMA 1IN5A 1LSJA 2XSZA 2YHIA 3OZEA 1KR2A 4WDQA 1R0SA 4R7GA 5AK5A 4DMKA 3LVBA 4E5VA 3THWA 1PQPA 2E4WA 1JSRA 1M74A 2H4YA 1LLCA 1OX4A 1FQOA 1EFKA 1PS8A 2P2GA 3TLCA 3CSUA 4PWYA 1OA0A 3DFFA 4I9NA 1PJTA 4HZGA 4XVQA 3ZHYA 4D0NA 1Z2AA 3HEAA 1P8AA 4L5JA 1OVGA 2OBNA 4RVNA 1PV4A 2PWBA 4YUVA 4MVJD 2FP4B 2DOKA 2OUIA 1ZKDA 3GQBB 4A0GA 1QX4A 4Q3CA 4BVKA 3RU3A 3DFZA 4B3DA 4CV0A 2WE7A 4O4LA 1I7NA 1SO8A 1C81A 3WA7A 1NM5A 4O4HA 5HDQA 5JXHA 4KPEC 2J9XB 4PLHA 1ZGGA 3P9IA 1CZHA 3LP5A 5DNUA 5JH7B 1QDUA 3FDZB 2HMUA 3E15A 1E4OA 4KRYA 3PC6A 2AZ4A 1ZUNA 2FPGB 4KTVE 4X6YA 3MTJA 2W70A 2YHIB 5BSEA 1PUJA 3THWB 3F3MA 1OXXK 4LI0A 4RL6A 5TVGA 3FMPB 1HZZC 4PQFA 1LQUA 1GUDA 1OX4B 1RMTA 1WP9A 3B2NA 3RV3A 2AR7A 5JH7F 4Q3AA 4TS3A 1GDDA 2BKAA 2HGZA 2VIIA 3HZZA 2AUMA 5GJBA 2G72A 1AK1A 1ZN9A 1NVBA 1FFBA 2W6OA 3OURA 3KT8A 3W3AA 4GEKA 2QRVB 3S1AA 4ZRNA 2R96A 3JQEA 4BKOA 4BZWA 3OLCX 3LBFA 4QD3A 5C32A 4JI5B 1R15A 4AG5A 3EVBA 4QKQA 3ONFA 2FQWA 3FNEA 3EAQA 3W5VA 4O4HB 2ODBA 3QPUA 4R1OA 1QRUA 3MJFA 3W8RA 5AI8A 1R9GA 3QLVA 9ABPA 3K92A 4PPGA 2YQ4A 3DKPA 4LMAA 4DG5A 2XCLA 2NGRA 3VVCA 3G1TA 2VJBA 1ORVA 3REGA 1ZUNB 1W4RA 1X7GA 1TMKA 1Y8AA 4NJOA 1MO5A 4GWLA 1S8NA 2RHGB 4H35A 1A04A 1SQGA 4BLSA 1EXMA 4ETIA 1XTTA 5LDGA 1JXAA 1YDGA 3WYCA 3B3QA 3MWJA 4XB6B 1BJRE 2IOFK 4N18A 2GZ3A 3UJ7A 5JROA 2XKJE 4GS5A 3WNZA 1A8HA 3I6BA 1J5EB 2HLNA 3QVTA 1JEDA 4BP9A 3S1AB 1JG3A 3ZWCA 4XTCS 2QMEA 4KAXA 4BLOA 1OKKA 2RGNC 3KQPA 1I30A 4K9DA 4WHMA 5T6MA 2EDAA 1ZX1A 1XIVA 1Q17A 2AWNA 4POAA 2B0CA 2OAP1 5JZSA 2OQRA 2QPAA 2B34A 2BFBA 2V97A 3FVQA 2VDQB 4G26A 2JGEA 3GCXA 3DEIA 1WULS 2MIIA 3K0CC 4V3CA 2REXB 1ESCA 5D85A 1JBEA 4H9GA 3EY9A 1KYYA 2AEJA 2D2IA 1E2EA 3ETEA 4JQZA 3BJIC 2H2DA 2W2XA 2WP8J 4F9EA 1S4QA 2UUOA 5H81A 4DRXB 3VNVA 3BWVA 1YB6A 2DP4E 3CNHA 1GPYA 1GUYA 4LHVA 4KLNA 5CX1A 5KTMA 1E18A 1YZLA 2Q3DA 3CZQA 1HE2A 4MGZR 1RKBA 1TYDE 2BZ1A 4C6TA 5CK4A 1DRVA 2QE7D 1Z35A 3Q9UA 5HGJA 1FYEA 3AHIA 3ZW9A 3ZHTA 4S1TA 2HJSA 4B84A 2P2ZA 4QO7A 4B6EA 2IBTA 2BFBB 1A96A 3FDJA 4BHTA 3N53A 2J45A 3AY6A 3GGGA 3GRFA 1GAXA 1QPBA 1LDEA 1EB9A 3F71A 3IBGA 2SNIE 3L7BA 4HHEA 1XQYA 1NJ2A 2AX4A 1QH8A 2DTXA 2Q4DA 3OEWA 3OU2A 1UP4A 3KV3O 3QVKA 4CR8A 5B55A 2C7RA 3U48A 1OAOA 1YTUA 2YV1A 4PZ0A 2ADMA 1WB6A 1WDWB 1Z0DA 2HKIA 3VI3B 3CLSC 4O5AA 3GLUA 1H0RA 1GDHA 3F6YA 3V8VA 1P7YA 3PB3A 1L5ZA 1OGYA 2QN2A 3G89A 2PGOA 1MKYA 5ARDA 1ZMOA 2P9GA 4C6TB 2IOHA 3QJYA 4A0FA 5C8XA 4R1PA 5ELMA 1NVMB 1PK8A 3IPRA 4IAOA 4F60A 2O0KA 2VJOA 3U39A 4Y6GB 3EIFA 3PLRA 2ZXUA 3KB1A 5MFZA 3M2PA 1H0SA 3BKXA 3O7WA 5C1IA 3TB4A 3QQPA 2YXEA 4NIMA 1XLTC 3RO7A 3FNGA 1GEEA 4YB8A 1ZEJA 1X86B 3GN2A 1EX1A 1KHTA 3H5RA 4ROTA 3CUUA 1NQWA 2FSGA 3UW3A 9ATCA 1DAEA 1GRVA 2XD9A 3WKAA 4YT8A 4JQYA 1QH8B 1Q11A 2C54A 3JTEA 3LYUA 3P96A 1NVDA 2GZAA 4P54A 3OZDA 4TS4A 3WFIA 4CQMB 3MIZA 5JAOA 4ND5A 1T2FA 3ZWXA 2IPMA 4CIVA 3K9CA 1KK1A 2J8ZA 3E9QA 4DQDA 1N32B 2PD3A 2B4RO 2B82A 2ZBDA 3HR8A 2FPIA 3UXYA 1ZQ1A 2Q5CA 3EASA 3MTGA 4ALMA 1EKXA 2C96A 4YAGA 3MCWA 1L5WA 3O4GA 5L3QA 4FYHA 2COUA 1E7MA 4MVJM 5D1NA 1K2VN 4GM1A 1DEXA 1MCZA 3TTTA 1Y1KE 1BN7A 2D7CA 4MGKR 2ZUBA 4Q7EA 1VZ2A 2VT2A 3L02A 2M6RA 3MJEA 3OLYA 1ZCFA 2JAWA 3OZIA 5IH3A 5C8YF 3IJ5A 1XCBA 1ML4A 3CKYA 3LKDA 1ILEA 2P2DA 4RS3A 1Z63A 2DF8A 1LVUA 4S35A 1L0BA 3PPXA 3H8WA 2UDPA 5JY1A 1AHPA 1DFIA 1FSZA 2BC9A 4CKEA 3CNNA 2C61A 4UUMA 5AW7A 1THZA 2GPJA 2FZKA 3CN9A 3PIIA 4KV9A 1IBLB 3NB0A 3O75A 4GI3A 4EDFA 2XMBA 4UZSA 2IF0A 2ZIUB 2FPIB 3GAZA 3EGWA 1KJNA 1WR8A 2I87A 5CEEA 1F0NA 1NKTA 2PFKA 2V65A 4JS0A 4MW9A 2IP1A 3VDMA 5A0TA 3JWHA 3QRWA 2H7VA 3PKZA 3K8QA 5L3QB 1W8DA 1LB1B 2XB4A 5KYNA 2YJNA 4M0UA 4N3NA 3D1VA 1HUQA 5J5AA 1VKZA 3EMVA 3HWWA 1ZISA 1RCTE 3DJYA 4IJ5A 1ZOPA 2W2VA 3D5QA 4DMFA 2R6GA 3UCFA 4B3HA 1A7AA 3TRJA 3T9FA 4Z9AA 2F62A 4JX9A 3CLKA 4O29A 2X5JO 4GKJB 3DHWC 5BW4A 1UQRA 4N1AA 4AN0A 1UAYA 5KKNB 1CUCA 5BUCA 1DAOA 3FFXA 1K5GA 4FVTA 4MLDA 2H7YA 1XDZA 4OQNA 2QVZX 3BIJA 3MK31 2VHJA 4Q19A 2Z83A 4WFJA 4NU8X 4P8RA 4DXAA 1BROA 2EZ9A 5JSFA 3CQ9A 2FETA 4RV9A 4UFOA 3EF3A 1JE0A 4KO3S 4PZAA 5EQJB 5K51A 4YDQA 1XKTA 2ECQA 4MA5A 3SQMA 6PFKA 1PYOA 4Y0VA 3UUFA 2V5UA 2CCJA 2WG0A 1WMFA 1YZVA 1XQ6A 4KPFC 1RXUA 1DTEA 1ETHA 1ODCA 2C88A 3JD1A 4LRTB 4LGCA 4GGMX 4D74A 2HLHA 3T3DA 1J56A 1YB7A 5FBQB 2A94A 3PCRB 4LHYA 1AB6A 4PIVA 3AJEA 1PWZA 3QX8A 2AI1A 2MSWA 2VBGA 4FX5A 5ITVA 4DN6A 1ZINA 2HK9A 2ZW9A 3RBAA 3G0IA 4MZXA 2XSZD 1HTBA 3CT6A 1GNVA 1NI4A 1Q1BA 2IZ0A 4FN4A 4OY3A 2WFLA 4P9NA 3EODA 1JKJB 2BTQA 3ZS9A 1XTJA 3HYSA 3EVCA 2PE5A 3FDIA 1CKEA 1U1EA 1T8UA 3V1YA 4WLEA 5JS7A 1LS1A 1IVSA 2IYEA 3TXYA 5IM4F 4MPJA 3K4QA 3RFXA 3KNZA 3RHSA 4CDMA 1TOAA 3CB4A 1HTWA 1WV0A 2FVXA 1CFZA 5U9CA 2QK4A 2W11A 2OO5C 3OZRA 5F1PA 4EO7A 3DLPX 4LOKA 2D6FA 1COWA 5DU2A 3MGKA 5K3SA 3DLAA 3BBLA 1XMJA 3BH7A 2JFPA 3HA5A 4Q5IA 4EPRA 3D3KA 5CT4A 1CY8A 3EC7A 5KYUB 3RSHA 4ZI7A 2OQIA 1SUEA 2COKA 1FYWA 1Q44A 1UK8A 4D4IA 2EF0A 2XQVA 3KHSA 1NI4B 3F4LA 4HN2A 1F3OA 2V7VA 4OXYA 3ROZA 4DM4A 3R0VA 2BTQB 4XRRA 1XTQA 2JB9A 3E48A 1CY4A 3EDOA 3PU6A 2G8NA 2YHAA 3WMXA 5MN6A 3HN7A 3BDAA 4W5NA 2YQZA 1OZHA 4Y1EA 1ZSNA 3FRJA 2AF4C 1BX1A 3QKTA 1F9AA 4RVHA 3ZWVA 3VR4A 3CMCO 7ADHA 2VLIA 3AKYA 3W3AD 2HLDD 2Z1NA 4JROA 2NTYC 4KIFA 1SKAA 3WAJA 4QGGA 1ZM3A 1U2DC 1G42A 2D5IA 1PG0A 4IDEA 1RBYA 1AQYA 3GVPA 1Y82A 1V4NA 3PVSA 1ENOA 4P93A 1YVPA 5DISB 1YRHA 3DEZA 4GSYA 4JBLA 3UPUA 1HEYA 3M6UA 1NDHA 2QW8A 2RGXA 2ZI4A 3HACA 1DRWA 1W7AA 4C0HA 2L17A 1KYIA 4ZI7B 4UTNA 1YAJA 3O73A 4O3FA 5KVAA 3BICA 3T3HA 4BO0A 2ZUEA 2A67A 2FEWB 4U0KA 2QR5A 3VU3A 1TM1E 2P9EA 2D0OB 3H1GA 1TW3A 3R20A 2IXDA 3QYPA 4DMMA 5FUQA 4ZQIA 5FBLB 3CTMA 5DT2A 3UQYS 2YCLA 1JRLA 3X1WA 1N2CE 1CQXA 1RFLA 3TXAA 2RGDA 4BCCA 2GH1A 5H4HA 2ZRCA 2EZ4A 3VR6H 1C2YA 2FAXA 4HZIA 1O9BA 2I1LA 3FHLA 4MJXA 3U13A 3ADDA 1FFXA 2Y0PA 1YZ3A 3PEEA 2V7BA 1AS2A 3HL0A 1OKKD 1X14A 1ADGA 1QZUA 1ZCZA 2BE9A 2OOSA 4IXNA 3T35A 4E5UA 2FCAA 2NX2A 5C35A 1I1QB 3ROKA 4PAMA 3MT0A 3KUCA 5A7HA 2X6RA 5JSKA 5GP1A 1D2NA 2E4XA 2QM3A 2Z4SA 4WKPA 3RJZA 1DPGA 1C9JA 1GQ2A 5KJFA 3U7FB 2QYHA 1F14A 1CQPA 3F6EX 2C3PA 3ZDBA 1FFGA 3KXIA 4XLZA 3F5QA 3OZSA 2BONA 4WBSA 1EA7A 1EX9A 4IFIA 1AKWA 5DLQC 1M83A 4BNJA 2PSSA 4DEYA 1CF4A 1CV2A 2XBMA 2J0QA 1RRMA 3KOYA 4YMWA 2Z6AA 4ZMRA 2C97A 2WF9A 1KOFA 1SHZA 3H16A 2JRCA 1FFXB 4MHSA 4M9ZA 4G01B 4Y0AA 3ZBTA 4XB2A 4EB0A 1P4GA 3CYFA 3FIJA 1VLHA 1BKDR 2L2QA 2GN6A 2YVUA 1YQTA 2IQIA 5CGZA 4JP2A 2Q9UA 5K4AA 1LFDB 3ENVA 1XCLA 2JFQA 4ZOLB 1T9DA 4D02A 2CSXA 1Z5VA 5L7YA 2QL5A 3HFRA 4MGHA 1XRPA 1DC8A 5FQNA 4JWKA 2P2SA 2GNOA 4NSNA 3W34A 2O5EA 3STVA 3EZGA 4AG3A 5L3VA 4EBBA 4X1YA 1Y1PA 1QRRA 4GGOA 4JUAA 1TVKA 2YJTD 1SD2A 3NI2A 1LPBB 1Q5PA 3AYXB 4OH1A 1Q1EA 4Q12A 3WGYA 3OX1A 3ETGA 4DPLA 1TA9A 4ZOLF 4LQCA 2QUKA 2DM6A 3BDIA 2EBHX 1YSCA 1TZ2A 1QIDA 1BFUA 3I5UA 3ND9A 2FDXA 2XRFA 2I2AA 3D3QA 4CMCA 2DHDA 4PYOA 3NTXA 5BRAA 1DB3A 3OHSX 2VVTA 4MVCA 1QIKA 5F5LA 3HFSA 1QH9A 5MHTA 2FU5C 2CK3A 3I28A 4MEJA 2C2YA 3IOBA 5GPBA 5JXJA 1QR2A 4M9QA 1TAQA 3H99A 1DAPA 1BEEA 2YZMA 3FRIA 1GP2A 5AQ1A 2FG5A 3E5RA 2RK3A 1GFZA 2A5GA 2X9GA 3QKSB 4ZQEA 4NYIR 3J81k 3FFWA 3TSAA 3QA9A 3G79A 1WV1A 3PC4A 4EF4A 4C2UA 4B85A 4L02A 1Z4PX 3GFVA 1TVKB 1XDUA 4PE5B 4CL3A 2ZB4A 3ROMA 2YZGA 2ZUWA 2Z9CA 4GQAA 3WB1A 3BTUA 3QENA 4EABA 3QG1A 4GWGA 2O4UX 4HWOA 3QA3E 4RVSA 1J8QA 4PY2A 4F9GA 1H4QA 2ISQA 3FVVA 1KBOA 2PL3A 1KVTA 4N5DA 3BD9A 3MTEA 4QEDA 3SIRA 4QLOA 2OENG 2YVAA 5EIWA 3ZBQA 2GBLC 4RDCA 1C0KA 1QIGA 2ZWAA 2Q62A 4QHSA 3GZJA 5ECDA 1USIA 3HV2A 3I9V1 3IV7A 3NW9A 5AM4A 3NHMA 3R5HA 1X74A 3DD1A 2V9PA 3IJRA 1VQ1A 4Z86A 4WFIA 5KU7A 5FWNA 3AL2A 1BU5A 1BWSA 3P9SA 1TO2E 2EFJA 2Q2NA 1J2UA 1GQOA 1MH1A 2GF2A 1TIBA 3K0BA 3KJXA 2P27A 1Q83A 4JT4A 2RHMA 4AJEA 5ISMA 2F6RA 2AXNA 4LXGA 1DAGA 3DQQA 5FDFA 4BS9A 1ZU5A 1KARA 2P68A 1F2TA 4B76A 1HEUA 1L8QA 1SVSA 1Q1AA 1KEKA 3ERCA 3ICEA 4FDMA 4TWZA 2FHSA 2P2CA 4C2AA 1CIPA 1IPEA 2CFIA 2D0DA 2J3KA 4M8KA 2CD7A 3LTEA 1UT6A 3SR4A 3CO5A 1VL6A 4ZANA 2UYGA 4WKCA 2DBVO 1CB7A 2J9GA 2NYUA 2OHXA 3UJNA 5TC4A 1T0UA 2VPQA 2VP3A 1N3BA 1YU6A 2H51A 5JSYA 3R7WA 3FYHA 5EJ7A 2Z9BA 1M54A 2Z2XA 4R81A 3DH0A 4HBGA 1YQUA 1SXJB 3R23A 1FTWA 3AF0A 5D3MA 3JQCA 4DC9A 4TX1A 1BKSB 1ZJZA 3CZRA 4RH1A 3THOA 3VAAA 3U4GA 2NO9A 4DMRA 4JQOA 5A2QA 5HQJA 3RGWS 5KOIA 2WKWA 2QIPA 2ZZNA 2RAUA 1TYEB 1PJZA 3QV1A 2EZ8A 2CMFA 3T0IA 4ZV7A 3P94A 4WGFA 1A5TA 1F2TB 3FKJA 3ZKWA 2L82A 1RXVA 4DJDC 4NCIA 2EP8A 3OCVA 4JB8A 1VFPA 3VX3A 5A06A 2HHLA 4FYKA 1IPHA 4JN6B 2GUWA 4LXTA 1JDVA 1QG6A 1UODA 3BTOA 2BGLA 1TZKA 4ESOA 1QU2A 3R7WB 1GV0A 1RHMA 2OC9A 1L2TA 1ZA2A 4AROA 1MTOA 1JJVA 3CISA 1EFHA 1V7PC 3D64A 3MIIA 4FGSA 1P6QA 2V6MA 3KIPA 1CZUA 5D3MB 5HKAA 4ID9A 1FTQA 3EX7C 3K1YA 3CCFA 3RYTC 4EY5A 4TV8A 1MOZA 2B7BA 3N5KA 2CVPA 3IRVA 5D8DA 1Z0AA 5EQDA 3AL0C 3M9XA 1N0UA 4P6VF 4HMPA 1ESZA 3RIGA 3QWAA 4LYDA 3ZKWB 4DCTA 1R8SA 3GXBA 4M9SA 4ZK2A 1OH8A 1ZVQA 4UCFA 1WQ3A 4BBZA 1ZJYA 1T8YA 2Y05A 3NEJA 2JK0A 1DP4A 2WT9A 4PGHA 1R9NA 2QS9A 2ONJA 2J6CA 1DFGA 2VK1A 5A5FA 3BL5A 3BMCA 3TOZA 4ISBA 1SD1A 4YP9A 1SGWA 4K7JA 1XN1A 3OTQA 2JCSA 3GJ5A 2YN4A 4IIXA 5LOVA 1ABBA 2O4CA 4PBRA 2ZUVA 3ZD8A 4V0SA 1C7JA 1Q12A 3I04A 1DKMA 2QUHA 1COWD 3TECE 1P18A 3HKCB 4MEAA 3CLRC 3FVWA 3MELA 1T6ZA 4ZEWA 4F1WA 1IBMB 4X54A 5L4LA 1LW7A 2G09A 3B36A 4TV8B 2XGMA 4YLGA 3W1VA 4YRBA 4M60A 3WYFA 3BWBA 3GA0A 4J0IA 1OWOA 5TQJA 3SEZA 3GA7A 2PKQO 4AZ0A 2O7SA 1U0EA 2BHSA 4MWGA 4OX9B 4LCJA 2O0JA 2YWCA 4AKEA 4R4JA 1YVEI 3P4XA 4TXJA 2WEKA 2ZUFA 1D9ZA 4JOCA 2A0KA 1QZ3A 1RHKA 5EIBC 3UJCA 2Z57A 4GP6A 5KQSA 4EHIA 2CBZA 3BMCB 2VP5A 1RBZA 4R3WA 4HWPA 4AN1A 2EJUA 1L4LA 4CCAA 1J0EA 4RCYA 4BOYA 4HUTA 4IS3A 3OQMA 5LQAA 1MOSA 1RLMA 3AVOA 2IHUA 1YMUA 4QULA 4X62B 1L9KA 2WMYA 3T94A 4UPEA 4AAYA 2F1RA 3BTVA 3M34A 4UTZA 1GY8A 1EB8A 2PKYX 4NZPA 2PMFA 3MMPA 3IEKA 3PIRA 1G8SA 1HPLA 1XZJA 3URKA 4AZ0B 4BO9A 1BH2A 3TQCA 3ISTA 2AKAB 2I3AA 3HUFA 4KYUA 1LF5A 1XAJA 4KR7A 2PZAA 4BIMA 4Q7KA 4LK3A 4Q66C 1P2DA 5DOZA 2NTNA 1GNTA 2Q9AA 3C87A 2R6CA 3JQ7A 4LY3A 4QBHA 3I9KA 4YROA 5DGHA 2RD2A 1VCNA 1Q1ZA 3BB4A 3IMCA 3OX2A 3JQBC 3VR1A 3ZV6A 2PUCA 2O0LA 4BO8A 4FBGA 4R9UC 5CLQA 3U3KA 4MYSA 3NEPX 1N8KA 1EE2A 4L9WA 2V7WA 3CZ5A 3N2EA 4RLSA 3JZFA 4LJ8A 4N01A 2FWPA 4GT1A 2HV8A 3B60A 4ND7A 2ORYA 3N3BC 4II3A 3I01A 3SQDA 4EKEA 5HHTA 3ZWOA 1JS1X 4DXDA 5EJ9A 2ZRBA 4HQ0A 2RSLA 1UPTA 4M86A 2JAHA 1V47A 2GK3A 1SCKA 2C8KA 3BA6A 5F77A 1N6KA 3W4KA 3QXJA 4LBZA 4CM1A 5AW5A 4E3ZA 3FF4A 1WY7A 2ERYA 2NXJA 3L6BA 1Q0SA 3OIYA 4R16A 4CE6A 3JQ7B 3AI1A 2YJGA 4QG3A 4EGJA 1KMCA 1N9GB 1S0UA 1JIUA 1MJGA 2OYSA 1VPLA 1OHHA 2PSEA 3K53A 3N2GB 2H1RA 5AHWA 3SEAA 4OQYA 1QU3A 1EEHA 2OLEA 2XUKA 1ZN8A 1ADBA 1M7BA 3PHGA 2ZRJA 1Z6AA 5LZ5A 3U9LA 3L7KA 1QRTA 1XNRB 1AJEA 1W0CA 2WWTA 4XWGA 2VAPA 3DZ8A 3IUSA 2ZWMA 3ZBPA 2ORVA 1Y3FE 5DHQA 1AGRA 4E1VA 1ZH4A 2I3DA 4U7GA 3RC2A 2CYCA 2FH5B 2YMLA 3QVJA 4G0VA 3V2UA 5IKMA 3P7MA 3UWKA 2JI9A 4N8EA 2BPOA 3EGVA 2L19A 3T5MA 5JO9A 1C9EA 2WLTA 2XXAA 1RRVA 1T2DA 1EA5A 1DLJA 2ZIWB 4RF3A 4AFNA 4EQ6A 3ZJ5A 2VR1A 4HGPA 4GRDA 3OIGA 4Y6LA 4UTRA 1YC2A 3EQ9A 3G2JA 4H7EA 4IDPA 4D9CA 3R3XA 1U90A 1T3LA 1YRWA 4D4JA 1T5DX 4EY8A 1NJSA 3NXKA 1Q74A 1PR2A 2NXNA 3PPWA 5LJLA 4L8YA 2CJWA 3B6JA 5DKFA 1E6MA 2CFRA 5B1SA 4QT0A 2OBYA 5JC1A 3KXKA 2XZPA 2GERA 1YR8A 1E1RD 3ZVMA 4MB2A 5AOCA 4PS0A 2R6R1 1U63A 1A5ZA 3G88A 1XTUA 3MBKA 4JUBA 4L2IB 1SXQA 2DERA 1GD1O 2OLJA 3O91A 4FYXA 3JQFC 1GFWA 4IDBA 4S0ZA 4K9OA 4WEOA 5FWYA 3VYRB 2VG8A 4EO4A 3DBVO 1YZKA 4J9VA 1C7IA 2RBGA 4P32A 4S0XA 3R7SA 3PTZA 4DB2A 3NGLA 1K8YB 4KMMA 3UMRA 2R0QC 1NRWA 1XEXB 4MULA 5TMPA 2HMWA 2EW8A 2W4QA 4BTEA 2CHQA 1NNEA 5TNXA 4L72A 1RVDA 5J4LA 1QRSA 3TLBA 3TYXA 5LWHA 2VF8A 4CU2A 1A7KA 1A9RA 3FXAA 4H0FA 2CJWB 3KSRA 3D1JA 4LMRA 4P31A 5FNVA 1NBAA 4JYZA 3GEHA 4CKBB 3GVXA 5LPNA 3KC2A 1P44A 1KEPA 1G5TA 3I8OA 1CF9A 3L4SO 4HF7A 4BV9A 4D6YA 1I33A 1M34E 1UC9A 3DP9A 3L6OO 1FMTA 1SJ9A 1UQUA 3PE4A 1PVOA 2F17A 4N39A 4DVGA 3LF1A 4GUAA 5FWYB 2R1UA 3ZC3A 4LPSA 1JGTA 1UJ2A 3CN7A 1BXRA 3OEEA 1N6IA 4IQFA 3EWIA 2ECOA 1V8PA 3BGSA 3E81A 3LY8A 4AKTA 1JHVA 1V16A 2WMDA 4QU0A 4TKUA 3HJNA 1MIHA 5EVCA 5GZ3A 2CLFB 2I80A 4C4YA 3CSSA 1ZO8A 1NOKA 2MINA 4M1OA 5FOVA 2A5JA 5CGQB 4YPFA 5M3BA 4JHLA 1AOXA 3O3OB 2FKAA 2PRZA 3DF9A 1Q6ZA 1JHMA 1H2BA 2IE0A 4HB4A 4KREA 2BFAA 3KOXA 3GYBA 1U7HA 4NP6A 2QTFA 2YWEA 3DHNA 2CHFA 3DR5A 3IALA 4I08A 4HNQA 5T4FA 5HM6A 3RYCA 3WGKA 3QPWA 2QQ5A 5IF9A 3RADC 4Y30A 2FWJA 1DQPA 2YJ3A 3CWQA 1RTTA 1JVBA 3TKLA 2QMOA 3F73A 1IHOA 3S7ZA 2X1VA 1YVRA 1E2LA 2JLUA 3DEYX 2FRXA 1KEVA 3SXUB 2SCUB 1CZLA 5EE3A 4EL5A 2V3VA 3ETCA 1ESNA 4B79A 1RIIA 4MUNA 1V16B 3T3OA 3EJ6A 4OHRA 4TKUB 4E1AA 4B5LA 4NBTA 5BQXA 4XQ0A 2CUTA 4HPWA 4UEWA 1V4VA 1BD3A 1XK7A 5C81A 2P62A 1WEHA 1U31A 4Q9NA 1I1NA 3DFIA 2OBLA 3RC9A 2Y8EA 1SUFA 3RSCA 2PRIA 3RVNA 2H5JA 2VDUE 1MVLA 3JYPA 3ZHOA 4DDTA 4BB9A 1TTPB 1NR1A 3NJ4A 5L3RA 5KSZA 1ZIDA 4LQDA 2PH5A 1O77A 4KUHA 1RLJA 4XEHA 4ZAGA 3ZHCA 2HWUA 5EOVA 2OXRA 4OM7A 4TRJA 3RYCB 3MTBA 1PJLA 1K6MA 3C3EA 5MFPA 3UT5A 3N0WA 1Y4SA 4BY9E 3QPCA 3PGLA 2I54A 3K2QA 1JG4A 3H2BA 4HH1A 2I4RA 1LBQA 3UJ8A 1TQ6A 4D96A 2BMVA 1DTWA 2H7CA 2G9UA 4ZYTA 2FFHA 1U4NA 4KX3A 2VJNA 4ZVSA 2HNBA 2Q3CA 2XMDA 4MV9A 5AW1A 3RRMA 2QBYA 4LSMA 4U0JA 2HFKA 1A0OA 2HHHB 1M5UA 4KQJA 4KXUA 1F4VA 4ALLA 3GFQA 4BPRA 2AMVA 2DTDA 2X19A 4IIUA 2PJRA 3S2SA 3MBIA 1NC1A 2W22A 1FUYB 3ZVNA 2G82A 2QD1A 1E0SA 3QX7A 4O02B 4CRWB 2GAIA 5JBIA 1ZCJA 3HUUA 2QWXA 2H4HA 1TJPB 3P2JA 2JVJA 2XYVA 1NFRA 3R5SA 4HDRA 3MD9A 4TVSA 1L1RA 2ODEA 3FWPA 1DDIA 2AD5A 3LHIA 3NWOA 4G5QA 4AQ7A 1MW8X 3BCUA 2XHZA 3PF9A 3UT5B 2O2CA 1KMMA 3QPDA 4EVSA 4WA7A 1MF7A 4F7DA 2VUIB 4MQ6A 1KJQA 4KACA 3RAJA 1ZK2A 2OL4A 4FKMA 2V98A 3KOMA 4K03A 4BQPA 5AUNB 1DTWB 4MO2A 4IYJA 3ILYA 3B9PA 4J4HA 5IJ0A 1U0OC 1LK7A 1TW2A 2FTKE 3EA4A 3HMQA 4LECA 2NU7A 2HMYB 3PGKA 4I36A 4YQEA 1CZOA 3IP9A 3MRTA 4KUGA 2WKPA 1Y80A 4E5KA 2FWBA 2YYZA 1Y5MA 1X1DA 3ZE6A 1RM0A 1M34B 1RYYA 2OSVA 4L4UA 4LY6A 4QDKA 5IEBA 2PXCA 4IUCS 1K5HA 3NTQA 4J8PA 3NDRA 4NCXA 1LTQA 4XD7A 3UF0A 4WRRA 2X2EA 3DUWA 4Z4FA 2JHFA 2W4MA 1MOPA 4L4XA 3WSVA 5JNVA 2VNIA 1YQQA 2I1WA 2ZVJA 5KHLB 4AX4A 4TSFD 4Z49A 4ENVA 4ZT2A 1H2EA 1M2KA 1PEYA 4OQ4A 1XRLA 1Z18A 3I05A 4Z0TA 5ITZA 2UYCA 4PSAA 3KSUA 1W5BA 5KAPA 1MRSA 4N5MA 1YUMA 1BMFA 3ZXXA 1Q95A 2I2XB 4BEVA 3K09C 5DIZA 2PIDA 4R6XA 2NU7B 4FEGA 5IDWA 3ICVA 3R7NA 2XTMA 3ESBA 2FA9A 3JCZA 2C2HA 1HURA 2PUHA 1SZDA 4GBMA 4AWAA 4TVKA 1R6BX 1NXSA 2Q5JA 4O63O 1OZAA 2PKXA 4MWBA 4C14A 4K3VA 1Z2EA 4EUHA 1NBME 4LRWA 5AQEA 3DTVA 3RWBA 5FUMA 5JD6A 3CLVA 2ENUA 4GMXA 1E92A 1D7AA 1KGDA 1Y1TA 3OPQA 3T34A 3GZTB 3R3HA 5DI3A 5IUJC 3PDIB 1DV2A 1HF3A 1AA9A 2JLBA 2WUVA 2GF9A 3HCFA 4PFKA 2PTHA 1C1YA 4HNHA 2YOHA 4BNNA 1L5RA 5K0EA 3UJPA 5I9IA 2YV5A 3VPDA 2JAXA 3S7TA 2C5FA 1L5NA 4OREX 3N7AA 2C31A 3KB8A 4Z2AA 3DOOA 3ENNA 1CUAA 4WUVA 4S24A 2AFIA 4MVJE 1K88A 4DC0A 1AXGA 1IQUA 1E6LA 1JR3A 1RYBA 1VIYA 2IIBA 4DNQA 2XMRA 3RLFA 3W3AH 3QNUA 1P72A 3JQ9C 4U2BA 1CEXA 3B6KA 4GPEA 5H59A 4UAGA 4ZQCB 1NMSA 3BWDD 3DTVB 2IS2A 2XB6A 2VQSA 1YJCA 4M7RA 4E12A 3JAMA 2HC9A 1OHHD 4G2TA 4XDYA 3ZTTA 3UMFA 1QWSA 4L9SA 5DI3B 3Q3VA 5LYYA 5KQMA 1CWUA 2QLFA 2J0UB 1ULUA 2LPMA 4ZQFA 4C4SA 3A7DA 4CV1A 3SD7A 3U1VA 1EGVB 1O5IA 4HNAA 4WFQA 4DV1B 1EQUA 3C16C 1TF7A 4UUOA 5DLYA 1X6VA 2VDKB 3NNDA 1SELA 2AFIB 2XWQA 4KWIA 3BMXA 4BAGA 3LBIA 4EJMA 5IG2A 3I8XA 2VJMA 1VPWA 1IXRC 1U8TA 3LCCA 2FDRA 4HADA 4YMHA 1V71A 3KR9A 2XCOA 5EN4A 2ZJYA 4HXFB 2QJFA 4RO0A 4Q39A 4ZU3A 5HBRA 2VJDA 5KTYA 3FCOA 2B2XA 2B8WA 1Y8QA 2GHRA 2HA5A 4LAFA 3WHLA 3L07A 1KERA 3L5KA 2AF3C 3V4SA 4CF7A 1TJ3A 4BE7B 4FR2A 4B3MB 4D5EA 3HHEA 3SXPA 4UJ3A 4JBGA 3WGUA 4HLDA 1OX6A 1FVXA 2O2HA 2OCAA 1AGXA 1UIRA 1QP4A 1EFLA 4HNAB 1KY5A 1L7BA 2R8RA 1RQLA 4NX2A 3WDMA 3EXG2 3IUYA 1ZL2A 2J3IA 1YI0A 4UJ5A 2OFFA 3CTPA 1RRPA 2XI4A 3CZMA 4L6IA 3VQTA 3S68A 4MDFA 1HH4A 5ALLA 4FW8A 3FYTA 2QR3A 4CPDA 2C3UA 1BS1A 1ABEA 3CRQA 3L8EA 4FYVA 3ISVA 3PUXA 1ZQ9A 3G7UA 1TCAA 4D57A 2YS6A 1KP3A 3NFRA 1C5KA 1X77A 4MPPA 2P41A 2JIZD 3HE3A 5LU8A 3BSWA 5TQ0A 3IDZA 3RBVA 5BN3A 2DKNA 5HIMA 1Y8QB 3PBKA 1KR5A 5TE9A 3KU4A 4NC9A 2C57A 2AZDA 2NN3C 3GUZA 4YWHA 2IUUA 4I3HA 3TLEA 3ZX4A 2VRCD 4KC0A 4R9NA 5K8JB 3G5AA 3HXKA 4CEIA 1JDUA 1B3RA 2R11A 3ECSA 1FC0A 1VYTA 2HWXA 4MRNA 1XMXA 5TDHA 4TMFA 3RTCA 821PA 5EJ6A 5I48A 1QIJA 1N25A 1NW9B 5C7LO 3MCAA 1U94A 4MNTA 4H3HB 1SN7A 4I1IA 4J3JA 5C5IA 1P7PA 1U28C 5E2AA 5DK4A 4KAJA 3IQIX 3LNCA 4IEIA 3L8FA 3ZH2A 5EG5A 1TDJA 1AUOA 4YMLA 3TBFA 3M4NA 3OEED 4YDHB 3G2OA 1ZD2P 5DN9A 3VPCA 4C0SA 3AILA 4FQ8A 4EAQA 4RHTA 3IFSA 1XVAA 1CY2A 3AUSA 1P4SA 5K01A 1GZ4A 2VNKA 3QKWA 1S3IA 4K6HA 2XUZA 3PQ3A 1W1WA 2N9UA 1PNVA 3Q88A 5TQ0B 1Q0HA 5BN3B 2J46A 1TT7A 2CMHA 3M81A 3EWSA 4O4IA 3SSAA 4O2RA 1D4OA 3KK0A 3IKLA 3VV2A 3IAHA 5P8WA 4DSAA 3GJTA 1JU3A 4CEIB 1YUBA 3O7MA 1DWPA 1T9HA 3EOAI 1DUIA 1BWRA 4LPKA 4ZDIA 3A1DA 4ND3A 4EIWA 1T0HB 3HKDA 4FMBB 2ZTHA 2Y1FA 1R3DA 2Z3WA 5ENZA 5G4LA 3CINA 4YHHB 3RTBA 4NENA 3R5KA 2JCYA 4DCNA 2YOGA 1WWKA 4DV4B 4WVFA 5K8UA 3U4QA 1OT3A 2H1SA 4Q00A 3QFRA 5ALRA 1NYQA 2C9CA 4UCXA 5FA6A 1DJOA 1NV9A 4D9GA 3U1BA 4K6CA 3TNYA 4IVPA 3WZMA 3VSBA 4RJTA 2E4UA 2GHTA 1F7VA 4BC0A 4KFRA 3QJGA 2C5BA 4Y1FA 5HQ3A 4LYAA 1HG0A 2PX4A 3E3MA 1U8FO 1PFKA 2WZQA 1PFQA 2G71A 4ZIRA 5FBVB 4KXMA 2Q2OA 4O4IB 3IA7A 1DINA 4BB6A 4B34A 4QG7A 1QVZA 4KQWA 3T95A 3WMGA 5I7OA 3JWIA 4Z9YA 2VS1A 3JAWA 4YAOA 2W6PA 5F78A 2CL6X 1FNSA 2C84A 3BM5A 1QFMA 4Z3OA 4ESEA 2ZT8A 3OOEA 2PRJA 4R5MA 4BO5A 1U1DA 3ROEA 1IY2A 4NENB 4ZZ2A 1K3FA 2ZCUA 3K31A 1F20A 1B74A 1NF2A 2JZCA 4KDRA 3U4QB 3GRKA 4MQFA 2RE8A 1ORWA 4ZVNA 1RWQA 2CE7A 2VUHB 3Q12A 3FF1A 3QOXA 2XB8A 4HGNA 5CVCA 5EJIA 5FL7A 2LDXA 3T3GA 4D8VA 4PTLA 4ERXA 1QYVA 4KWTA 3MLAA 3CR8A 2AOUA 3O03A 2Q7DA 5KJ6A 1VI6A 4FUQA 1S2LA 5J47A 2ZJ6A 3UWSA 2PVCA 1A8UA 3COYA 5HQ3B 5AW9A 3IVCA 2XBUA 4YAWA 1OY1A 3VKWA 1QRAA 1GUBA 3L05A 3L2OB 2B30A 1ZNQO 4IICA 1H2HA 4AIIA 3UMJA 5JD4A 5JVDA 1KI4A 2QKYA 3RI3A 3QE9Y 1XZAA 2WJ6A 5GAJA 3HI6A 5IVDA 4QBGB 4DGSA 4NZMA 4WKOA 3JAWB 4KPUA 2UZIR 1MQSA 1CJUC 3C24A 3FTNA 2V9ZA 3X2EA 4B2LA 2PZFA 2ZE6A 2Q6KA 5AW4A 4MITA 3T5TA 4C0BA 3AW9A 3O2QB 4KXQA 4MQFB 3AOGA 2QL7A 5KNBA 1P39A 3MYRA 1HT3A 1K92A 2KSQA 4Z3KA 1U7OA 4HN9A 1OB2A 1M5RA 2XOEA 3OQVA 4Y9SA 4YH1A 2AOUB 4Z1OA 4C2TA 4JJEA 1QORA 4RW0A 1Q1QA 4BVHA 4QJIA 3NIFB 5K5EA 2UV8A 2C4HA 2R8EA 1MX3A 3AVQA 2XQIA 3T5PA 3RAFC 1ZVKA 5JVDB 2D7DA 3X1JA 4OI1A 1DJNA 2HA4A 4XD7D 3VM6A 2XYQA 1GCIA 3RSFA 2BHTA 2I71A 1DG3A 1IATA 1YZGA 4KPUB 3EYWA 2HJHA 1UMDA 1YS6A 1BRMA 5DN6A 1IULA 2O7NA 1YOVA 3HYLA 5H02A 1W75A 3SXJA 2Y4NA 3P9PA 1PL8A 2GA9A 2YY7A 4QPZA 1SUDA 4OXKA 2W93A 3KEGA 3TLZA 4EPYA 1GADO 1T0PA 2D4AA 1MD9A 2V1XA 2WJVA 3FCEA 1EEXB 4RZIA 1CLUA 3TJMA 4BNUA 5LKRA 2GZHA 1URPA 2IVZA 1TK2A 3MFYA 3E7WA 4IDOA 2VH1A 1U1CA 1U6IA 4LBVA 5DV9A 4BUJA 1UXGA 2H2HA 3ZOKA 3GGOA 2F3QA 1EI9A 2IZ1A 4WNAA 3FKQA 3BKWA 3QIAA 4NV0A 3DTVD 5T4BA 3A3YA 4MUMA 4XR4A 4HAVA 5J63A 4DR7B 3R77A 4EKGA 1UMDB 2A0XA 2B36A 2BEKA 2QROA 3NTVA 1YOVB 2UUAB 1NP7A 3ZIUA 2QJRA 1TU4A 4EYOA 2WJGA 1WB9A 1MLDA 3VR2A 2E1PA 3HP7A 3L9XA 1QWOA 2OHOA 3M6MD 5A03A 2VUUA 1B8NA 4ZXPA 3KZ1E 4Y6SA 5JHHB 1OQAA 1UP6A 3LGXA 1MQ9A 2NYRA 3TE6A 3A1TA 3BT7A 1KQOA 4OMFG 4WH0A 2KS6A 2H52A 1YIDA 4OGFA 1B15A 4QVIA 1PT9A 2ECPA 4RMHA 4N8SA 5FEMA 4UCWA 4BFSA 4NMHA 1C7FA 1GYRA 3WKEA 4AWXA 4DB4A 1JR3D 3PD7A 4BWYA 1NZFA 2QUIA 4HWSA 3VR4H 4EHLA 5ICSA 5IWCA 4WNAB 2QEQA 3JTMA 3WRVA 5JANA 1ORTA 3RASA 1NJGA 1RLTA 3Q9LA 3EFBA 2FMTA 4P3OA 3A0UA 1NW7A 1MW9X 3N8KA 1VB3A 3NV7A 3RSZA 4AZ3A 2HR1A 2DUNA 1L4UA 3M9LA 3SJZA 2P2YA 2XUFA 4YN3A 1GZ6A 3D4IA 1R0KA 2BI4A 1JEJA 2CYBA 4JQSA 3IMKA 1HFKA 1AKNA 5D7BA 4KQ9A 1S7CA 1R6XA 2GNAA 5A6VA 2LR0A 3C5VA 4GBJA 3RS5A 2AGVA 3NTUA 1IN4A 1E3WB 2VOJA 3FCCA 2YN2A 1KMIY 1T5HX 3Q0IA 1P3DA 5BVHA 1HWYA 4ZOAA 5FWAA 3A1UA 1NN0A 1O0SA 1U3DA 1XVIA 1LI7A 2RBEA 3BHNA 3HLTA 3K4HA 4IFEA 3WAGA 1UBFA 4ENQA 1U9CA 1RDFA 3QUAA 3PDUA 3Q7TA 2XADA 1OI3A 1HTTA 3HRHA 3O8LA 4RJJA 4UOQA 5JYCA 3DVQX 2VJYA 2E48A 5T5QA 4DLAA 4QQKA 4ZREA 4IG4A 4AZ3B 1ODSA 1UFRA 2PRYA 3DVSX 4F56A 1NRJB 4LDZA 1YZUA 4ARVA 4PLFA 1V2GA 5B58C 3ZWBA 4E51A 5E4TA 2ZAGA 5CT5A 5TV2A 2G3YA 1O5OA 1C8LA 3G2NA 3CW2A 3WDSA 4GX0A 2GLTA 1XDWA 3F49S 2B5OA 3SC6A 2A9OA 1H8EA 3VPBA 3GPLA 1G8FA 5EHGA 2V7EA 5BVHB 3CRZA 2IHKA 1PF7E 4F2WA 2GEFA 1VE5A 2VPYA 2JD1A 1T9ZA 3PICA 1EG7A 3HSYA 2GZDA 1M2FA 2H1FA 2OV1A 3IJEB 4TKMA 3U26A 3KEOA 5FQOA 3CUSA 1N36B 4J91A 3IB6A 3LHFA 1T3SA 3FFAA 4C2BA 3A11A 3GX1A 4R1TA 1U9YA 4W5HA 1E8MA 4NPCA 5ED0A 4L7QA 2ZWPA 3ZWDA 3D6JA 4PR3A 3CPHA 4IEEA 3RKUA 1NXVA 3P52A 4KN8A 1SCDA 3W2EA 2WQ7A 2PAAA 2VEOA 4B82A 4H6PA 2UUCB 2O2YA 4MA4A 4QU9A 4IDQA 2Q3BA 3DWFA 4OFWA 1WXGA 4YRMA 5CG1A 5IVKA 2YWHA 2YHBA 4WN9A 4HV4A 3TPFA 2CDRA 3IQHX 1KGSA 1R66A 2J32A 4WGGA 3TG8A 1BZYA 4HQOA 4O33A 5HILA 2QTLA 2NV0A 1PUIA 4MYDA 3ABSB 4MIEA 1IQ0A 4RHCA 4Y2JA 1U1GA 4DAOA 3T1YB 2ZBQA 4O8CA 4UEKA 5COBA 2HRDA 4CM8A 2ZJ2A 1X15A 3EDMA 5LYJF 3OIFA 5FUXA 4ENUA 1DXHA 2Y77A 4PHFA 4MKRA 1T8PA 2Q45A 2P91A 4R1LA 1WHTA 1Z5ZA 3CEHA 4A82A 1Z0JA 4KQ1A 3MOGA 3I09A 3K20A 5DNEA 1W25A 1WPQA 3GJSA 4HSGA 1TTQB 1UMBA 3TCKA 4D9FA 3IX7A 1PX2A 5JRJA 3Q7PA 1EK6A 2VCHA 2ZZMA 4B3IA 5DP1A 4QC2A 2VUTA 1H1TA 4FJ0A 4UM5A 3UNXA 4RZHA 2ETVA 2VPZA 3VNUA 1NUQA 1RRKA 2XITA 3WLFA 3O5AA 4AD8A 5KNCA 2GM4A 4N48A 1BQ3A 1T1GA 1Z0KA 4IEFB 4YMVA 4TLLB 1T9GR 4RKEA 1PS0A 4LXUA 1G9XA 2B5WA 3ORRA 3G6WA 2J3EA 3VZQA 1ZWKA 2R3SA 1B42A 4L50A 1ZHHA 1CYDA 1JSXA 4B47A 4CM8B 1YS1X 4FFVA 1VDZA 3DMTC 1M72A 5FBKA 4G8JA 2GPTA 3S2EA 1WHTB 2OFXA 4IDNA 3UB2A 2XAUA 3EIWA 3AU9A 2W2QA 4Q4CA 4K1LA 4LX0A 4RTOA 4DE5A 1C7QA 1RWNA 4ZD6A 8ADHA 1UMBB 3OE7A 3PHHA 2FFRA 5KVSA 2FMXA 2FQYA 2MHCA 4B7UA 4CEJB 4M46A 3FOFC 1NQTA 1TA4A 2CZGA 4D4KA 4CEHA 1SOAA 3AEZA 4FFBA 5JCXA 5AI5A 1XZNA 5JI3E 4ZPXA 2X0RA 5KVQA 3OECA 2ESRA 1OV6A 4I9FA 4R1NA 4MV6A 4IINA 3DZHA 2X1LA 3RE1A 1EXWA 3PGJA 3B7GA 1ZNZA 1LBEA 3NAQA 4X9XA 5FV7A 1ECLA 5F76A 3EQ7A 5ALSA 3USCS 2AMYA 3H86A 3P5SA 2YRFA 2XEDA 5AVJA 5L51A 1H4SA 1DQSA 2J07A 4JYAB 4Y1GA 3EMDA 3GRZA 1XF1A 4ABYA 1Y4ZA 2GVNA 2PAFA 4S1NA 1G9TA 4BEJA 1I51A 2O7QA 2XVXA 3CNOA 4EZBA 2XPCA 3QYAA 2NMVA 4OQLA 1JJBA 1RCUA 2NP6A 4L74A 1JDSA 4QAJA 3KQHA 2P35A 3AC0A 2N1BA 2RKWA 3DAYA 2IV3A 5IYZB 3WGHA 1U7XA 2CF6A 3GFFA 1MB3A 2P2NA 4CF3A 3C0KA 1T4BA 1VE1A 4FFBB 1P62B 1KOJA 3HU3A 4FJ2A 5CH8A 5KNBD 3EUFA 3S2ZA 4WXPA 2B1QA 1DT5A 3C39A 1PR5A 1SVUA 1OTHA 2AA3A 2GWHA 4RHEA 2WJAA 2DJ5A 3DDHA 3ZLUA 1FYDA 3KLBA 4FHEA 1WG8A 4CNQA 3FOCA 1LNQA 1XQ1A 5IYZF 3RHZA 1S9HA 3M6AA 2JH8A 2PZMA 3ROPA 4BZZA 2QN9A 2CXRA 3PR2B 5LA6A 3KQVA 1VBKA 3JD4A 2PWYA 1RIFA 3MAJA 3TBHA 4JJGA 3BZBA 1JFFA 2VPWA 3FLBA 4RJIA 4FHZA 3OIVA 4G81A 5FI5A 4NE7A 2AG0A 4OQFA 5DN6D 2ZRQA 1LPOA 1RZ3A 3K73O 4KQHA 4JBHA 1X7ZA 3HBNA 2B4QA 4LGYA 5HKKA 3P8ZA 1ZVJA 3K0FA 1JQAA 4M0EA 3OJXA 3DZBA 1PQWA 5A4IS 1HGXA 1KYTA 3E2MA 3ZW7A 5ICMA 4LDNA 1SKMA 5GWXA 2R84A 1FB5A 4JSYA 4F5ZA 1T2EA 1V26A 1LDBA 3WQRA 3LZCA 1Z6TA 2R5NA 4F92B 4GOND 3FFTA 4WNIA 1R9JA 1XU4A 1NUAA 1D3AA 2JKZA 2C3YA 1OASA 4RM3A 3E9DA 1SOWA 3ENQA 3TL6A 3ZLJA 1JFFB 4J43A 4LF8B 1OZGA 3C4JA 2HBZA 1TZBA 3RREA 1FTNA 1VG0B 4LJKA 3RWOA 3QVGA 5BVGA 1X7ZB 1UBHS 1YT5A 4ITVA 3WR5A 2G77B 1PT8A 4KOAA 1NNI1 3IVAA 3FTQA 1KYWA 4BE4A 2WV9A 2GSWA 1Y9EA 1Z83A 1YQEA 5J23A 5L7WA 2VRNA 2MR6A 3VO1A 2K87A 4E7PA 4Q16A 1BVHA 2BGTA 3PXAA 1N6OA 3AB8A 1Q2UA 4IGFA 3B3JA 1RXYA 3MB5A 4BAUA 4AY3A 2CVOA 2GTPA 2QD3A 3QNWA 3PFWO 2AT1A 2FEMA 4O3MA 1YJAA 4GMGA 5TMBA 3DC7A 4JUDX 4ZRMA 1RQPA 2XMZA 4URYR 5AK0A 4EQ6B 2X0KA 1IEWA 3L1UA 3T3NA 3QBJA 4AJHA 4DZRA 4IJVA 2VBIA 2YBDA 3DLCA 4X45A 2W8BA 3QVGB 4HVAA 5BVGB 4K3UA 1Y5NA 1DBRA 5LQMA 2OMEA 3MUFA 4LKOA 4QPCA 2FEPA 3DTTA 5EJ2A 1DAIA 2IP2A 4FYWA 3R3UA 4GX2A 3C5WP 2WSBA 3NOXA 3DMGA 2I6UA 5AKJA 5KI6A 1F0PA 3PXCX 4UU8A 1GDTA 5TF4A <