4RANA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
201
Chain Sequence
b'RSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKVIGGDSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 66
structure length 201
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ranA00
4RANA 1Y0BA 5JV5A 1IBSA 1JLRA 4M0UA 2C4KA 3ACDA 2IGBA 1QK5A 3MBIA 1UPUA 1HGXA 5IPFA 2P1ZA 4TWBA 2XBUA 2VFAA 1P19A 3S5JA 1G9TA 4LYYA 2E55A 3GEPA 4RABA 5K51A 2JKYA 1VSTA 5BQPA 2H08A 2AEEA 2H07A 5HKLA 1G2PA 5KAPA 3KB8A 4WMLA 2HCRA 1O57A 1UFRA 4X45A 4P3KA 4ZFNA 5HIAA 2YZKA 4P84A 1ZN9A 4RADA 5ESWA 2JBHA 5EUCA 1ECCA 1ECBA 1BZYA 5KAMA 1A97A 4M0KA 4RHYA 3HVUA 1P18A 2JKZA 1W30A 3GGJA 3QW4B 1A98A 1MZVA 1I5EA 1BD4A 1LH0A 4OHCA 1P4AA 1G9SA 1ECFA 4LZNA 3G6WA 3DMPA 1ZN7A 4RQBA 4IJQA 5BSKA 1WD5A 2EHJA 1XTTA 1XZNA 4P81A 1HMPA 2GEBA 4QYIB 1U9YA 3M3HA 4KN6A 3OZGA 1L1QA 1VCHA 4JLSA 4RAOA 1QK4A 1A3CA 1NULA 3GGCA 3NAGA 1UPFA 3ACCA 1OPRA 1ZN8A 3LPNA 3MJDA 3O7MA 3OZFA 1TC2A 4FYMA 4X44A 1I0IA 3ACBA 1TC1A 3LRTA 1P17A 1V9SA 4M0PA 1YFZA 3DAHA 4RQAA 4WN3A 4LYGA 1A95A 1I0LA 1STOA 2WNSA 1BD3A 1GPH1 1NONA 3OHPA 2DY0A 4P86A 4P82A 4RHTA 1OREA 1DKRA 4LZAA 1AO0A 1JLSA 1QB8A 4P83A 4RV4A 4LZOA 4JITA 1L1RA 1DKUA 2H06A 1U9ZA 1J7JA 1XTUA 3N2LA 3DEZA 1XZ8A 1A96A 1XTVA 1QCCA 1ECGA 1VDMA 1DQNA 4RAQA 5ESXA 5JSQA 1GRVA 1PZMA 1R3UA 5BQOA 3H83A 1QCDA 2PS1A 4QYIA 4PAWA 4RACA 1ECJA 1DQPA 5IAOA 1O5OA 1OROA 1QB7A 3EFHA 1CJBA 4Z1OA 1QK3A 2JI4A 4MB6A 5E38A 1DBRA 2FXVA 1G2QA 2PRYA 4F8EA 1I14A 1Z7GA 1I13A 4P80A 4QRIA 1D6NA 4RHXA 4RHUA 5BRNA 1FSGA 4S2UA 1A4XA 2PRZA 4PFQA
chains in the Genus database with same CATH superfamily
1QAQA 4DEXA 3GEIA 1Y6QA 2V7QD 1OAOA 2PA0A 4RMIA 1IRIA 3KB2A 1N6LA 4Z51A 1CK4A 1WBJB 1P1CA 1X1RA 4DSUA 2DXIA 1UT5A 2REBA 2G7ZA 2O06A 2Q2QA 3ANYB 5LQCA 1S3IA 3AL3A 3FJOA 4OYRA 4GW3A 3K32A 4AS1A 1R16A 3G49A 4BU1A 5CVDA 4MS4A 2HBRA 3L1VA 3GUCA 1UZUA 4RA9B 5EL0A 3T0GA 3CRVA 3O4HA 4CQNA 3N74A 5HKLA 2JZOA 1YIDA 4W8HA 1RNLA 1U0JA 2QAJA 5IAEA 2BM0A 2NO0A 3DKPA 4O1IA 1C50A 3B9QA 3ETJA 4OHFA 4XDZA 4ZFNA 5KYXB 4MQFB 2F43A 3NPAA 4CCYA 1CNMA 3PJRA 1MC8A 2SICE 3UUEA 1VL0A 1Y6ZA 3B9BA 3C8MA 4MQ4A 3WRYC 3W1VA 1ENPA 4DANA 4M88A 4KE6A 3U56A 1GD1O 3IHWA 4UZSA 5T67A 1MH1A 3HKCB 3HU2A 4PIVA 3VJKA 1FLDA 1UK6A 3G79A 1NN3A 2CYBA 4ZOLB 4TYQA 3DAFA 2B8WA 5EP2A 3RE1A 4OXRA 4WFQA 4QPDA 1G8PA 3A3NA 4K03A 4HNRA 5AOCA 4U7JA 4PQYA 5GINE 5EZYA 3VYTB 3AF0A 4IVRA 3PNYA 5B3AA 4HRAA 5J2UB 1TF2A 1JR4A 2AZMA 2W2TA 3FM9A 5IZCA 2ZW9A 2XE8A 3GL9A 4OB8A 3TO5A 1SKBA 4AZVA 1XI2A 1CHNA 1BS2A 2GJ4A 2G71A 4YASA 5JSZB 3TFOA 1NF9A 1EFUA 1FX0A 1J2RA 1F2DA 4YEDA 4WKGA 1G3IA 2HQRA 3FVVA 2A0XA 1H66A 1T9ZA 3NHZA 4ND4A 3ZIUA 4YPOA 1J8YF 3WGMA 3DYVA 3HVRA 1TUBB 3LVQE 4FLMA 5LZ2A 4XRRA 2H9YA 3B5IA 3FHJA 1FXSA 1JEQB 1T0JB 1TCBA 3A4LA 3ET5A 5A9SA 5K01A 2HADA 3IT3A 5EP1A 1T8TA 4AWBA 1FZTA 3PF8A 1AGNA 3SQOA 3VR4D 1ESEA 5BV1A 1U9IC 5AW7A 1VSQA 5KWEA 1B8PA 1H3NA 3KZMA 2QGNA 3UMMA 3UOGA 1W5BA 3IVAA 4ZCIA 3W7AA 3MLAA 5D8DA 2AMJA 4H1TA 4Z86A 3AOGA 5JSKA 2DKFA 2IDZA 3CNOA 3OT5A 1V43A 4ZI3A 4F46A 2HFJA 4YRCA 4Z3KA 1G3QA 2VDMB 2NADA 4CKEB 1TTQB 3E5HA 1G5QA 3UT5B 5JZBA 1IHDA 2AOTB 2AYYA 1Y3IA 2BZ1A 4MAMA 1UPXA 2CNWA 3KLNA 2W2OA 2ATCA 1R9GA 3C6XA 3A1VA 1WB9A 3AESA 3OZDA 2OTCA 3VSDA 4UCQA 4L72A 2FEMA 2FSSA 1KH2A 1TMKA 5JI3E 1FTYA 3OZBA 2FN4A 5DYWA 2NXEA 3U09A 1UKYA 3FJ1A 3R24A 1NSFA 4TV9B 3S27A 4BNDA 5HRCA 1NZDA 3LRPA 4H1UA 4E1VA 4EKNB 2Q3BA 1V7PC 2EP7A 3KAJA 3ZE8A 3ZGOA 4BX9A 1FE8A 4TQ9A 1RWWA 5DIZA 3V4OA 2PSJA 3AGPA 1LJ8A 3WV5A 3FDXA 2WNIA 4URVR 5BW4A 3DKRA 4NH0A 3GLQA 4EI8A 3PDHA 4FWIB 3ICEA 3RSZA 4HQRA 1V4BA 1ZEMA 1JBKA 2IZ5A 2FFQA 2QTHA 3AJ8A 3TS1A 1UADA 2AMFA 5LUBA 2IGBA 3JRWA 4JY7A 1YFKA 4DMMA 5KYYB 3N2YA 3C97A 1A5TA 1UBKS 4NPHA 3ETNA 2O8FB 3GT7A 1KHTA 3MOIA 3H1EA 4D82A 1U2DC 2EW1A 2GO1A 4GD3Q 3HBNA 2CXOA 4IFEA 5I7HA 1VG1A 3NP7A 3RG8A 4CKCB 5JNVA 4BAGA 1NBME 2H85A 3LVFO 2QHXA 3TQFA 3TZLA 2VEDA 2WUFA 4EGFA 5TT0A 3ZE1B 4TGLA 1KORA 5FBZA 4M0FA 4G81A 1A97A 4G1BA 4BNGA 4R1SA 2WM3A 4CHGA 1USKA 3K15A 4RU1A 4QRDA 5C1BA 5F98A 1PX0A 3ESXA 1KZ7B 3G5MA 1FNNA 4E88A 4M0DA 4L4UA 3G02A 3QLVC 4A6PA 1RMQA 2NSHA 2ZJ8A 3OP4A 1T36A 4M0LA 3RARA 1AHNA 2Z56A 3DGEC 4AP6A 2HEGA 3CGGA 2NUBA 3HKEA 3PHGA 1G8AA 2YYYA 5FI3A 1LLDA 1LDGA 2GEBA 2NOAA 3BFVA 3ROQA 4QL3A 1NUQA 3EGVA 4WKCA 4EYEA 5ICSA 4A36A 3DE2X 2I22A 2RIPA 3CW9A 3JV7A 1M2KA 2QVGA 8ADHA 4ZRDA 2XQJA 3EUWA 3JWEA 4G97A 1FVXA 4YP5A 1C3EA 1G20E 2Q5IA 3E0QA 4RNCA 3RRYA 3CQ9A 3M6LA 2HEIA 5IH3A 2PDAA 4HLUC 2IUFA 1T1GA 2AJTA 3GN2A 2CEAA 1DJOA 3F6RA 2FTKE 4UAJA 5D2CA 1EWYA 2GHTA 2I7VA 4X90A 5AVZA 1LC3A 1Y4SA 1LFAA 4ZANA 5JQGF 3WBFA 2ZQYA 1E3MA 1Q91A 3VAZA 1RU3A 1H2EA 5DSZA 2RH4A 2IHZA 5D85A 1Q50A 4E03A 4MINA 5CCXA 2Y4OA 3D31A 3HGTA 3RBVA 3G17A 4JGIA 1MW9X 5JS7A 1S4MA 3MRSA 2BGLA 1RWKA 3TZEA 1XF1A 1YQWA 1RQRA 4NR0A 1ZVQA 3MJTA 3CUSA 4QT0A 3ENKA 4RYLA 1N75A 121PA 3SLKA 1WCXA 1D1PA 4BZWA 3TBKA 1GZ4A 3OOWA 5EJ5A 1CUHA 1JN0A 1XZDA 1Z2PX 3DEZA 4LWZA 3R0ZA 4EGSA 5KOJB 1AIPA 4PSUA 2GZHA 4HH4A 3CBQA 3WTBA 3HCPA 1ISJA 1DQYA 3B6IA 1UDCA 3IDQA 1OIXA 2IVZA 4XSHA 1P2GA 3WG9A 5KOIA 3R9XB 1IH8A 1WB4A 5FHRA 3CPSA 4ZGGA 5F1KA 2VXBA 5E38A 4Y2JA 3MT7A 2P9JA 2QRUA 1E59A 1N8SA 5DW3A 4JSRA 3WO1A 3WYEA 4DR2B 3OIDA 2H5EA 1PJQA 2VWPA 4GU5A 1OLOA 4L74A 1XSEA 4A6EA 3JTMA 4IOMA 4YRAA 2IDMA 4RF2A 2O2HA 3KHSA 3K1TA 2B0JA 4G3XA 3AQIA 1JFLA 2ZQ5A 2B4AA 3I0ZA 1YI8A 4A1OA 4HAXA 4TT3A 5K0FA 2V0NA 4HO1X 3GT4A 4HDKA 1D2CA 4LXXA 2ZCJA 3SOPA 1P5RA 4KQ9A 3VX4A 2I1QA 1PNVA 2WINI 4K81B 1I01A 1PN3A 3C85A 5ALGA 3VNAA 3AUFA 2ERCA 2R1TA 2BIFA 1DKPA 1H6BA 3P52A 2WJHA 4XKJA 3UJ7A 4AULA 1E60A 1DO2A 2Q07A 3FZEA 1VYHA 2VT7A 4O4IF 1RRMA 3ETGA 5F7OA 5CCBA 4GOXA 2F3UA 4WVLA 1MORA 1UDWA 3H0EA 3KUKA 1TM5E 4FIZA 1QWSA 3KZCA 1WMFA 4IFIA 1KMQA 3HNRA 2P2DA 1Q1BA 3LKZA 1RM4A 1QTQA 2OHIA 1CUDA 4ZU1X 3S28A 5DZSA 3L40A 3LDUA 2QL6A 1H0KA 1NNUA 4ZVNA 3OCZA 5ICMA 2GRAA 3AV3A 4J4HA 3CC8A 5KYKA 4XUGB 5K3DA 4C4YA 3T9BA 4RZHA 5F4ZA 4N0QA 1CRPA 3O0TA 1J24A 5LYJF 2QX9A 2OPHA 1U2SA 3QVVA 4L1KA 3MEQA 1CY2A 2IOFA 2UKDA 3L0DA 5H4GA 1E69A 4YCJA 1PZEA 1SKQA 5ALLA 3OX3A 3TKYA 2Z2KA 4YV2A 1X8XA 3JTEA 4LRXA 3ROXA 2BFWA 3V32A 3ZPXA 5F9FA 1RWQA 5CH3A 2Q1TA 3ZHQA 2IBTA 5FFFA 3NBAA 2NZ2A 4RPKA 1LDMA 4NS1A 2CDNA 4URFA 1Z0AA 2QWXA 4Y30A 2NSLA 4Y6RA 1Q1EA 3MWJA 1Y3BE 3WGHA 2Q0HA 2Y6UA 1DV1A 3OPYB 1NX9A 2NVWA 1YHNA 3SZOA 3EFEA 1XVUA 1Z62A 3LT1A 4LDNA 5IAKA 1G21B 1I7QB 3DAHA 4P35A 1KS9A 5ECYA 1BFDA 2WP8J 1HE5A 1LPSA 1M1YE 1CUAA 4DDTA 5M34A 4C4PA 4MR7A 4FFWA 5KYVA 3KJNA 5EKSA 1PK7A 4GP6A 2Z3VA 2B8EA 3ZHBA 3DE5X 2AA3A 2F7SA 3ZQ4A 1F2VA 1HDRA 3DE6X 2W58A 3MWFA 4JLOA 4PN3A 4UXIA 3ZV3A 1NPYA 1RJGA 5LCXA 1KDRA 4M55A 4WL0A 2HM7A 1ZH4A 4F5YA 4NBVA 1YNOA 1KYXA 4MIEA 1VKOA 2FR1A 2I4NA 2YXPX 5IJ0B 2Q5CA 2RDMA 3FMFA 4D9FA 3O90A 4FUTA 3ELWA 2K5UA 3GRVA 2QN6A 3KKQA 5JY1A 3F5FA 4M53A 2HIMA 4MLPA 2G04A 4TZKA 4ZT2A 5CH5A 2NZWA 4TXNA 4I3FA 3ICOA 1BIFA 1RI3A 2XB9A 2XMZA 1XMPA 2F6RA 1FRVA 2HX1A 5TF0A 4JQZA 4GKBA 5AVQA 1LD3A 3OQHA 3L93A 4ZC1A 2JI9A 3U7JA 1H8EA 1C5KA 4KRGA 3AKCA 1BJRE 4LQ4A 1Z7WA 3I0NA 5HS6A 3C6KA 2DFPA 4QNMA 3VISA 3LHDA 4X95A 5B4UA 1C3JA 3VPBA 4RDCA 2UZ0A 4EJFA 3ZX5A 1XTZA 3V4LA 3V34A 4X9XA 1E9SA 2O7NA 1P4JA 1EVQA 2FRVA 1M7HA 4TL6A 4HQFA 3JD3A 2NNWB 2WA2A 4KLRA 1JQ3A 1W8IA 4FHDA 2RJOA 4PXYA 5J2UA 4LJ8A 3V5NA 2H18A 4ARZB 2VXYA 4WA8A 1UBJS 2ZYVX 3NALA 4JP5A 3QFFA 1AGYA 2PZ8A 4K1LA 2FMUA 3AEZA 2CGEA 4DA4A 1SBQA 1X9IA 1YWGO 2LKDA 1N9KA 3VV3A 3CRZA 3GNSA 3P94A 3EQ7A 1M1NA 4PRKA 4DV4B 3IKJA 1DDGA 3NIDB 5BWNA 2QVLA 5I47A 4ZPJA 3WHPA 4DC0A 1E2UA 1Y9JA 1I1NA 2QI9C 3K4HA 4ROTA 4DNXA 4E4RA 5LMUB 4NULA 2ZB4A 1WHSB 3LGAA 4TL9A 2C96A 3UPDA 3WGTA 1VE3A 1SVMA 3UGJA 2JBHA 2J9XB 4PLVA 5FUQA 5JFTA 5PNTA 1PFGA 2DHCA 3VR3A 1Q5PA 2CHEA 1T1RA 3H99A 4BKPA 4BRUA 1MAHA 2Q49A 3L41A 5T6BA 2ZJ0A 4IW3B 4GMKA 2P8SA 3E3NA 1NBMD 5EJ6A 4FFRA 5C7OO 2EKPA 1M0EA 1DTEA 1CT9A 1Q3KA 2X2PA 1OASA 5ITVA 3R2JA 1JA0A 2QUJA 2O5CA 1KYYA 3QRWA 3IE2A 1XMJA 2PIAA 3EZ2A 3U4IA 4CKEA 1FTGA 4EPWA 2G9QA 5F78A 2VZ9A 1GL6A 3DBIA 2ZBQA 4MV8A 3L2OB 1BN7A 1Y3FE 2XDQA 8ABPA 4EENA 2XUDA 2X42A 2VJLA 3K09C 1II9A 1KBOA 1CEXA 2AN1A 3LPNA 5IG2A 1JR6A 3A4YA 1RFLA 1ZNZA 2PD6A 4MKGA 4RLFA 4DCNA 2ID8A 4OJTA 3MYRA 5H80A 13PKA 2AOVA 1RVDA 3G82C 3IAM6 2EDCA 4MWOA 1FFWA 4R9UC 1KFBB 2VQSA 2JFZA 2OGTA 3HVIA 2EEZA 4CL0A 4ZV4A 3G0OA 2BY4A 2O2EA 1QO9A 2F3QA 2AXQA 4LEIA 4TQUS 1W73A 4G85A 4P82A 4N3GA 4XWOA 2CBGA 5ALQA 3R0IA 4I55B 4ZOEA 5HF5A 2WFAA 3L79A 5ALDA 5IJXA 1U63A 4HWTA 1JIKA 3CT6A 2PRIA 4G5FA 3QX7A 2GARA 3FTDA 4JYMA 2JGNA 4KC0A 5C5IA 4BLVA 4HH1A 1QF9A 3AJDA 2WHEA 4RL6A 4YCSA 3AEKB 2Y2UA 2GQ0A 1OGYA 2YICA 4WCFB 4O0MA 3DDCA 5JTUA 4CI9A 5BR1A 3I5YA 3D1LA 2FXIA 2I4MA 3GLGE 3RFCA 2NU8A 2WE7A 4XLLA 3TLGB 3AVQA 3QUSA 3ZDZB 3C3MA 3HEAA 1DAFA 2VF4X 1NE2A 3BCUA 4TMWA 2RAPA 1V2GA 5K1ZA 2IYYA 2BF4A 4TV8A 2G06A 4ZT5A 4GEGA 3A6LA 3GJ6A 3KFLA 4KN9S 3QX9A 3R8CA 3WRWA 1GGNA 1R5NA 2GVNA 4S2EA 4F86A 4HAUA 2DWCA 3VPDA 2BONA 5L51A 4LGMA 3Q40A 4DY4A 1BEZA 4R2LA 2D7CA 2WSBA 4PFQA 1GCGA 5K0NA 3D7NA 1HLDA 3W5BA 2HK7A 3BZWA 1BDHA 3W2FA 4JLJA 3PHIA 4LRQA 5DRYA 5IT5A 1HL3A 3TEJA 2QLBA 3QBEA 1S96A 5FOVA 4GRAA 4KXVA 3P4XA 1HT1E 3CX3A 2HT1A 3PE6A 4OK5A 2WB4A 5FTMA 5T4FA 3T7KA 1RZRA 2GAFA 5TMPA 3G59A 3LV8A 3PPYA 4YNBA 2HYIC 2XAUA 1NBIA 1L8QA 2D74A 4NJEB 3AVTA 4ALLA 1XLTA 4X1YB 4LF5B 3DBRB 3M8KA 1YF3A 4PZUA 1A88A 2A35A 2WPDA 1RKUA 1K5PA 2R6AA 4LPKA 5H8WA 2GM4A 821PA 4L5JA 5JANA 3R7LA 4EMBA 2PAFA 1MAVA 1N6NA 1CY8A 5ILOA 3HCRA 5EVJA 4ZT4A 3SY8A 2RHDA 3DDZX 2ZIUB 3ZYCA 3EUAA 4AZWA 2W2VA 2GF0A 1NQAO 4P2GA 3A36A 3M6MD 3UMJA 2C31A 3HBJA 2XYQA 3PXEA 5HWSA 3O8CA 2ZCUA 5HFNA 4MYSA 3VNSA 3WK4A 2I6FA 4PNZA 2QN9A 3FWHA 2IBMA 2X0RA 3MBOA 4F5DA 4YK7A 5ALOA 5KYTA 2F8TA 4U9IS 3L77A 4OXXA 3TL6A 2P62A 2ZYTX 2HRRA 5AICA 4MWSA 1L7RA 4GQAA 1Y37A 2RKOA 1U5CA 3D0RA 3CX8A 4WZ6A 5DX1A 2QTVA 5EESA 4C0SA 5AVTA 3OTIA 1F3LA 1BS9A 4KN5A 3CE6A 4L3WA 2JGRA 3KU1A 3OBBA 3EPLA 1BKYA 3CG0A 5IFLA 4MKZA 3FUTA 1ZSNA 2VSYA 3FNBA 1HL7A 3JSXA 4U00A 5T3UA 1IJEA 2GO7A 3FLBA 3TB4A 4ACBA 3ZDCA 4WK0B 4N6OA 3TDMA 3KQYA 3K0AB 1AQUA 1PJ3A 2FZ4A 1I30A 4JIGA 3GYBA 4MVJI 4GLLA 5D3MA 3LPDA 5BW5A 3ZQJA 3T35A 1IY2A 4K6KA 1E1QA 2JHGA 3EDMA 5JRZA 1GIAA 4Z2YA 2IZ6A 1M74A 3C4JA 5E3IA 3H2YA 5KNDD 2EG5A 2ZVJA 3NLLA 4RETA 1MNQA 4CM4A 1HTBA 3UJ3X 1RYFA 3OEYA 3GGPA 5KJ1A 2O8EB 4GGPA 2A5FA 1IVNA 2KB0A 2VQDA 5KDLA 5MN4A 3WZMA 1PGOA 3ORFA 5G41A 5IYZF 1P73A 3GGSA 1T2DA 4B8WA 2OCLA 1U99A 3GA7A 1RYDA 4ZYLA 3JS5A 1N33B 4H6PA 3VNVA 1EEXB 3OQVA 3NHLA 3HB4X 2MMCA 1YR1A 3K1AB 3KQNA 3LGSA 4R2MA 1D9ZA 1B41A 1Z0UA 1I2DA 1KOJA 3RTGA 2VJBA 4WKPA 4YBRA 2BKLA 1GLNA 1EJBA 1UEXC 2NW6A 2QTGA 5E7QA 4Q9IA 1WF3A 4X92A 3FHTA 1VPLA 2ANBA 2DULA 1L5FA 5C7YA 5FADA 1CDDA 2ZSIA 3E9RA 1TVEA 1RXEA 2FXVA 1G0NA 5CA0A 3LL4A 4OBEA 4HKTA 1FRQA 2H1RA 1NW7A 4JYCA 2IPOA 2ZIZA 4AZ0A 1SCUA 4LV5B 1PT5A 3R3VA 4C78A 2XECA 3L8CA 2P9CA 3EC7A 4KDEA 3BVPA 3SFVA 1PWEA 4F97A 3CBGA 2XE7A 3B1XA 1IBSA 4UPEA 3LKBA 3ZUGA 1ZX1A 3DMNA 1PR0A 2MSWA 5A4JA 3ZV4A 5KKCA 4WK2B 1DPFA 4RXUA 4B0PA 2IXBA 1YJXA 3HYCA 4X1OA 1XQYA 4G01B 5MGBA 1ODJA 1GR0A 4UOZA 3IULA 1XU7A 3TPZA 3USZA 3FD8A 3HO6A 3KJEA 4MB0A 1RIIA 3NANA 4Z4EA 1YBVA 1DWQA 2AR0A 1SVNA 4NCIA 1TFRA 2IUUA 3ESBA 1C0IA 4JLPA 1CJKC 1JECA 1P0CA 3MOGA 4V38A 3OKCA 3BIXA 3KIPA 5DHUA 1NOJA 5EMHA 5BOSB 4FZJA 1Z5OA 2FMHA 2RKWA 4HQOA 1SEPA 1ORRA 1XZEA 2YZKA 4QU5A 2YWGA 5FLKA 1SG9A 1KKMA 4DREA 1C9EA 2GNPA 1KY4A 5CLHA 3W8EA 1C29B 1Y80A 1SIUA 1RJFA 1NYLA 2O7RA 2Y8EA 3I6YA 4US1R 4I3HA 4NCAA 4HUQB 2FPKA 4KGDA 3GCZA 4P7BA 1KEUA 2IY9A 3SEZA 3QOYA 4B4KA 1MEOA 1USGA 1R15A 1P7CA 2XUKA 4I66A 1N9ZA 2JHPA 4B84A 1SBCA 3PDIB 4YDHB 4F3CA 2JIBA 3HPQA 4HDNB 5GJWC 5A06A 1Y4DE 2CLMB 1JLHA 1H2ZA 1QSGA 2AC4A 1PJ4A 2P3SA 2X7JA 1GKYA 3TJMA 4CTMA 3MK31 1ZK2A 3WL5A 1IXYA 1ND5A 5FOUA 3ZZ0A 2IYRA 3SMVA 3L8EA 1Q17A 2WEKA 1ONBA 5WRFA 5CYOA 2BHSA 2OFPA 3CCCA 3PEFA 2JGIA 4JELA 4F4DA 1OB2A 4LC1A 1W93A 2P7IA 2COUA 3KXDA 2NV6A 2VCHA 2WHPB 3AERB 1O95C 5AI6A 2PV0A 2LIPA 3E9YA 3HU3A 3PC8A 4OSEA 4US0R 4P32A 3QEMB 3N86A 2OENG 3VV2A 1ORHA 2F00A 3QKSB 4XTRA 5BXYA 1YFZA 5B1DA 3SM3A 1J21A 4XFJA 3W1EA 1YZQA 2W6NA 4GEKA 2RGNC 4DYHA 5CYPA 3KSRA 4BZPA 2HU8A 4NBTA 1Y1KE 2CHQA 1OC2A 5LLSA 3NC0C 4U9HS 2FW6A 3T7TA 1KL7A 2HIAA 2X40A 1FTWA 1ZEJA 4YUAA 2CVOA 3UXYA 4QKQA 1W94A 1ZC3A 3FPEA 3HNPA 2AN5A 1QHNA 3CRW1 5CM8B 4FI3F 3OX4A 4C6TA 1VPEA 4ZI7B 3BGWA 3B12A 3FGNA 3RIXA 3HP7A 3D0QA 1EH5A 1I2CA 3HP1A 4N8EA 3QV2A 2VDJA 2CF5A 5L3SB 3T5GA 4ARZA 1D2NA 3X3HA 1A9XA 4RF5A 1EKXA 5F76A 3VZDA 1Z15A 4ZQCB 4ZCTA 1RXUA 3A4MA 1O0SA 4KR9A 4U3JB 4JL6A 3IQXA 4HDRA 1E3WA 2V7VA 4PWYA 2VZEA 5D01A 1A77A 3DZGA 4BHTA 4F21A 4HWSA 4AB1A 1N57A 1OROA 4FYJA 3I83A 2VZLA 3NYQA 1JWLA 5HQ3B 3V8RA 2XUJA 3CF4G 1KK2A 2P4HX 3OEWA 4KO1S 2YDXA 4R6XA 1V39A 2OBFA 3QZUA 3VTAA 2ZZMA 5AKHA 4BJ1A 2HFKA 1ONOA 4XEUA 2VYNA 4HNGA 4BFTA 2ADOA 3AUSA 3PICA 1GZDA 1DXOA 2X5JO 2BR3A 4GVXA 1K68A 1DCTA 2PGJA 4B3GA 1L5KA 5HE8A 4RVSA 1NJ1A 2WVGA 5U4XA 2ZBVA 4U7PB 1CSEE 4PPGA 2V45A 1LTHR 2VDKB 3QTTA 5BQ3A 4AJNA 1O6ZA 2F9MA 1SK8A 2X6RA 3BE8A 3LPAA 5GZ6A 2VFAA 3DGFC 1GUFA 3HLKA 3LYAA 3WDMA 4B7CA 2NAFA 1X0XA 2GM9A 4QOEA 3D4NA 3OT1B 2WOJA 2VDLB 3ZD9A 5IWAB 4GL2A 5DF1A 2XCRB 4RTNA 1U2QA 3K35A 3D2BA 4WXEA 4ESOA 1Q0TA 1F2UB 2R7MA 4ZGWA 4J0EA 3KB8A 4MW6A 5DGHA 5F1OA 3BL5A 1MO4A 4MUYA 2WF7A 1XL1A 1W5SA 1ZLXA 3BXGA 4WI1A 1PYDA 1PQ4A 2FJ0A 4P84A 3ITDA 5H3CA 2C5SA 3NG1A 5HW0A 3OM8A 4N5NA 4ZK6A 3IIKA 1ADGA 4NQZA 3SI7A 1MVOA 1EUDA 1YL5A 3SQDA 2R2AA 5L8VA 2H1SA 2HL6A 3HVUA 4UVGA 4DNFA 1LI4A 4FC6A 3IUJA 5E4TA 3LU1A 1U4OA 1SXHA 1QLJA 5CVJA 4Z9XA 4LWQA 1XTQA 1CD5A 2OBMA 4HMOA 1X15A 3WJ7A 1TEHA 1BOOA 3GELA 2B7CA 1X1AA 4LZWA 2JFUA 3AXSA 3USES 3VDRA 4TROA 4RD2A 1QG0A 3IUEA 2PUBA 3THXB 1QONA 3AEKA 1NJ6A 3SKYA 1SXIA 3VHRA 4K9DA 2CSUA 3HSKA 3IBCA 4I9NA 5EKXA 2XJ9A 1CERA 2ZIXA 2C2YA 4LK2A 1E2FA 4PBTA 3EGDA 4QAQA 3CVYA 1BDMA 3FUWA 1RWVA 3TLGA 3V7FA 1N5MA 3OZVA 3NIBA 4B4VA 4GP7A 1WTAA 4DOMA 4ZOLF 1QRDA 1HNXB 4B74A 4LHSA 3OZUA 4CT0A 3Q12A 3ZOZA 4HB3A 5ES4B 2Q4EA 3RT9A 1KH1A 1ZD1A 2IYZA 1CCWA 3NHMA 4HTFA 4LBVA 3DC2A 4OYLA 3OMXA 4M89A 1M34E 2BDEA 3SQNA 4ZQGA 1RJDA 4CFSA 2B4RO 3VM6A 3HFSA 3L0OA 1KVUA 2CFSA 2OVBA 3WGVA 1W47A 3PFCA 1NIPA 2RCYA 3DVSX 1RSZA 1Y82A 1VJTA 3CUEF 3FSRA 1ADBA 3A10A 4AQ7A 1LKZA 3R7AA 3O8OB 3ADPA 3BD6A 1DC8A 3OSZA 4NYMQ 3C8DA 2QM0A 1PS8A 3OQNA 3TSZA 2BMEA 3ANXA 4NBUA 3OE5A 2R0QC 1C9KA 2QL5A 1XGKA 3EF0A 4L07A 5A7HA 2DQYA 1FL9A 5I9MA 2HPZA 1ORWA 2J5BA 4LSZA 4I5EA 3GEEA 4I4LA 3O5AA 4WCDA 2GPSA 3MJRA 5GJVC 3BRCA 3PUJA 4RFLA 3R3ZA 3OT4A 5IEJA 2H9IA 1DEOA 3GO4A 1OZGA 4GOJA 3WLPA 4D79A 2Z58A 3U44B 3VR2D 5BVGB 4L8YA 2EW2A 1BXZA 5ALYA 2OSBA 4ZZ3A 2R85A 1V6AA 2H1FA 1UPAA 2QQEA 3M6WA 3ZHTA 4B82A 3GY0A 4PFSA 4CMJA 2WJPA 3NONA 2YOGA 4MVJD 1ZUWA 2I33A 1U5BA 2R8PA 3AL2A 3MMSA 3U7QA 1ZU4A 1DMRA 2MR6A 2PQ2A 3BRQA 4J3JA 3V80A 2BR4A 5EIBC 2JEZA 4MW4A 5CLIA 5KNDH 1IQUA 2E4VA 1IVYA 3WISA 3MBIA 2H00A 4EUNA 4TV9F 5D87A 2XT6A 4FYPA 1B3RA 1QZXA 4P1ZA 3DEIA 4ZZ0A 4A8PA 3RC8A 3I34X 4FONA 2AZ4A 2P27A 3BIFA 1CUWA 3T3DA 3Q10A 2PXCA 2UYQA 5IKOA 1P2TA 1DRVA 2J6HA 1NW8A 4IJMA 3KR2A 2QMEA 4O25A 4BP3A 1X70A 3JYPA 3SKVA 3NAMA 5DT9A 1HE4A 2R44A 1FU7A 1KNXA 2DJIA 3K0AA 3R5KA 1XLWA 2WJIA 3RKUA 4WLUA 3ONNA 1E4OA 3TBFA 1HYGA 2EHDA 2GSDA 4O08A 1P1FA 2AFHB 4TM8A 3D6HA 3TJRA 5SZIA 4RHYA 4BU0A 1WDKA 4UNQA 1NMSA 3C3DA 2CMGA 4CUKA 5IZ4A 1FYEA 3C4QA 1ORIA 1E5QA 2MSCB 2BSXA 2O2XA 2AG6A 3UCXA 4UEOA 4MI9A 3SPXA 2PWPA 4C0XA 3C8ZA 3KXPA 4JYPA 2NSJA 1SVLA 2BKAA 2BLLA 2GM5A 3EVFA 3K1AA 4KAFA 4H9GA 3LAWA 3MPUA 3RH0A 2OCDA 1MJ5A 1VSBA 2X4IA 1N2SA 2XNDD 3MIZA 1SVOA 2LPMA 4G5OA 4XJTA 1QK4A 3IQEA 1EDOA 3O92A 4WERA 4EG8A 1FYWA 1EHIA 3BEDA 5SZHB 2Q8NA 1QOZA 2JB9A 1WUKS 1Y6RA 1G3UA 3NEAA 3ZH9B 4FBGA 4GSYA 3N75A 3M6IA 5T8KA 1BX1A 4FZ5A 1IK6A 3VAYA 3EXHA 3QE9Y 2IPMA 1QGED 3AW8A 4ZD6A 3DLAA 1MEEA 4FOTA 1UM9A 2JHFA 1YS9A 5IC6A 2IHTA 4WLOA 4BYGA 3DO5A 4TMYA 2G0NA 3G0CA 4LHEA 3TOVA 5A71A 5AHKA 1BDJA 1Q14A 4MRAA 2YN4A 2J5KA 4QUKA 3LLUA 9LDTA 2I6QA 2GBCA 2YFKA 2YHIB 3G5AA 1E2KA 1KK3A 1N6KA 1OHHD 3GUUA 3JWIA 3Q3IA 3QPBA 4I1RA 4L5BA 4NBWA 5DHQA 4Z6KA 3FOFC 1MV5A 4W5HA 2V1UA 1CB7A 2W98A 1KR5A 3GRYA 5CH8A 1SD5A 3QYPA 3AFHA 4FNAA 4YUYA 2TMGA 1KNQA 3CUYA 4KPYA 1TD9A 3AKEA 4KLZA 3WHIA 2R8YA 1NATA 1M33A 4WKBA 3ZV5A 4ABYA 1ULUA 3MT9A 1VJ0A 3CH6A 1JR3A 4MPDA 1ITZA 3ZIAA 1C3OA 2HAEA 3VJLA 3L7LA 3QF4B 3I76A 1L4FA 2PSHA 1V35A 4KX5A 5AHRA 3UAOA 4LJ7A 4F60A 4OX9Y 4UTNA 1J39A 1TDJA 3RUCA 5C53B 2RGUA 2IHNA 1JJ7A 1KQPA 4OB7A 5CAEA 1OFIA 4ALIA 5AKIA 4DDMA 1D5WA 2GEFA 4H15A 1R5BA 3ILSA 3RSCA 1UOQA 4JHLA 2AKAB 4ZCMA 2CMFA 2EQAA 3SDSA 3PDIA 2DMRA 3G2LA 4PINA 1AKYA 5B1SA 1V1RA 3R7NA 3SSOA 3PVZA 3DMGA 1EINA 3EAQA 4JFAA 4R2HA 3Q7RA 3SYKA 3ILVA 2VK4A 3UA3A 2PE5A 4O2LA 4LX0A 3S5JA 2XDYA 3OAAA 2WAOA 2PRSA 1QDLB 4MMZB 4UUNA 4KXFB 5U9CA 2WHPA 2XGJA 3AUTA 1RWOA 3JQPA 1ZNQO 1ZIPA 4B7AA 3QKSA 1J90A 5FWYA 3H4TA 4YQFA 2VJDA 2NUTB 3N28A 3ZWWA 2ZIVB 4PSDA 4CMCA 3R3SA 3TINA 1E5VA 1E8NA 1C7QA 5B1EA 3LJKA 2AF3C 2Y1KA 2G09A 4NK4A 2V1XA 5BSRA 2ZIGA 5CEJA 3VA7A 4K9NA 5BWOA 2X3YA 4HVAA 1ZVVA 4B32A 1R7RA 4I19A 3RSSA 1H2WA 4F2DA 1RAIA 2DH5A 1P18A 2FUG6 3C1OA 1GPWB 3EVEA 3ND5A 4PYLA 4RKEA 5FL7D 1CR6A 5GV8A 3WGOA 1YR9A 2CXRA 3FKJA 2PS3A 5EWJB 4DQVA 4LJKA 4GKJB 3TH5A 2BFFA 2PKRA 4MVWA 1N3YA 4I50A 4NX2A 3DFMA 3G8AA 2IXEA 1U9CA 3K4PA 1ISIA 4YRIA 5L3SA 2VDUE 3QXXA 5CHYA 4ZAZA 3SYNA 2H57A 4P0PB 4A10A 2UVPB 1JAZA 3GZJA 2XNSA 4MXDA 2H4FA 3GB9A 3UXHA 2GLXA 4EYSA 2C58A 4X7BA 1YKFA 4XI9A 1V7QA 4JVNA 5K0LA 2DPYA 3MOSA 4MSUA 3S70A 2OWDA 3UAVA 4YYZA 1K6MA 3H1TA 2WKRA 2X2FA 1NMQA 3OO0A 4WQMA 1OXMA 1I4LD 1DEAA 1VFNA 3JR7A 2A59A 3OZAA 3DHWC 4O2RA 4EOGA 4F6LA 3L4BC 1B43A 3NJRA 2GCPA 4EPYA 1SU4A 2C57A 4PS0A 7MHTA 4K9PA 1MN6A 1XZJA 4JP3A 5CTAA 5EFOA 1E7SA 2Q2NA 4FEEA 1Q1AA 2YVUA 4RENA 3GFQA 3R0VA 4I4TB 4LE0A 5K3CA 3CVVA 5DU2A 1XDDA 2JGJA 2YNMD 3UTDA 5H4HA 1Z07A 4OG2A 3RB8A 1SKUA 2F3RA 4WBNB 3IELA 1HDOA 3AEYA 5K09A 3JD2A 2YFHA 2ZBFA 3HN7A 4MDYA 2FSGA 3KOWA 2DBRA 2CYCA 3KYCB 4LYDA 2O0MA 5EUMA 4IJVA 4GZ6A 4GDMA 3L7MA 5T6MA 1PFVA 4ZEMA 3KKMA 2C9ZA 3LWBA 2PZBA 1DOAA 2YV1A 2RHJA 5FI1B 1HV8A 1Q12A 2ZAGA 3OT1A 5JHHB 4HZIA 5J4HA 3ZNNA 1I6WA 3I62A 2CNKA 2CL6X 1IAVA 1F2UA 2WZQA 2EJCA 2ZJ1A 3NMUF 1T9AA 3VKUA 3UCEA 2X8AA 4ND2A 1ZA1A 2Q3JA 3EFHA 3L6CA 1WBBA 5D1HA 4N9WA 1OBOA 5EWLA 2BHTA 1J8VA 4ZJYA 3RTEA 1R66A 3LQFA 1YZTA 2QLTA 4GPBA 2E1PA 4R2KA 5AD1A 1XKXA 4Y2SA 1G7RA 4R7ZA 2IUYA 1IBMB 4UJ5A 4E70A 1VCNA 1Z2OX 4XUCA 4G24A 1WRBA 3TCNA 1F0PA 3ELBA 1YJ5A 4DV0B 2Y0DA 1M75A 5IJAA 2RMKA 1GAWA 2B5WA 4IPTA 3PFGA 4RF4A 2CLCX 4V39A 2Q3DA 1F38A 2XGSA 1UFOA 1KO1A 5BVHA 3IE1A 2HIHA 3W2EA 4BNJA 4COOA 3L1HA 4AVYA 1X86B 1AMOA 4B7UA 1XMIA 5CX1A 1IBLB 4OATA 4CF3A 3L8FA 1X7HA 4I7EA 1QIHA 2J45A 4I0WB 1FFBA 1D1TA 1WSAA 3F8WA 3HRKA 3Q0EA 3UWKA 3KCNA 1O54A 1N9GB 5M7EA 5KTSA 2OXIA 1S5PA 1Z2DA 3U40A 4D56A 1LBHA 2ES4A 4J1TA 4ZT3A 1HDGO 1YASA 2ZXEA 2PKWA 3NV7A 1I51A 4JQYA 3T1QA 1F2TB 3OTQA 5KYNA 3AHCA 1JSRA 1DKLA 4NVRA 4DE5A 2QRMA 2AB0A 5KNCA 3BSSA 1CJTC 2BN4A 1RCTE 4MPJA 3NVKI 2PRKA 2XODA 1FNMA 3UHPA 1TXGA 1Y8QA 3BF7A 4F4CA 4DSOA 4AXBA 5CBPA 2I3BA 2G76A 3HVJA 4Z4GA 1ZUHA 3I30X 1W19A 3PQ2A 3MG9A 4BWYA 3FAZA 1QFXA 2MYNA 3O8OA 3JAWB 1AKWA 2J7PA 2CXNA 3Q11A 2JLQA 4MVJH 4MMYB 1GUAA 4OXYA 1K08A 4G65A 3PPXA 3RVKA 1JIIA 4HDCA 3E3OA 3PA8A 4KIWA 3ACCA 1KMIY 2WJGA 3ZJYA 3WA7A 2W4IA 1PTKA 2P79A 4WZZA 3TQTA 5C46F 2J0VA 2JH3A 2V7UA 4G8DA 5THKA 2AVDA 1GYQA 5CHEA 3V1TC 4PG5A 2ONCA 4IH9A 4PLHA 4BX2A 4KGXA 5DN6D 1H3EA 2OHHA 2Q0XA 2O7VA 1MTZA 2VYFA 3SF8B 3T3OA 4NYMR 1BD3A 3TE6A 4B3CA 1M6VA 2AE1A 2B7BA 4OQYA 1HF3A 3EIFA 4K0KB 1S2GA 4Z53A 1QHIA 4J8PA 1KQOA 1SHZA 4PGGA 4YT2A 6REQA 4IIJF 3KB1A 1JG4A 5H82A 4F2HA 1M2OA 3CVJA 1D7AA 3GRCA 4D7AA 4DPKA 1YULA 4OLHA 5IJZA 3F8TA 1KEKA 1U0LA 1ZGGA 6ADHA 1CY1A 4ND6A 1E96A 3CSUA 1WV1A 3H11B 1HLPA 4RD4A 4FWBA 4M36A 4TMTA 1EP2B 1L9KA 4QG3A 4TYWA 5C4GB 2Z83A 3E8SA 5AVRA 3D2CA 3GJ7A 2A57A 4K9SA 3NYIA 4R2IA 4W5TA 1ST2A 4AK9A 1K63A 2QYTA 1RXYA 2BDUA 3W2HA 3GMTA 4ZALA 3C41J 5TPWB 4R1QA 4BAUA 5KTYA 3R7WA 3N07A 3A6DA 3IMCA 3KFXA 3EXFB 5C1DA 4C1NA 3JYOA 4RHUA 4KVZA 1IONA 4K2HA 5A6SB 1DG3A 1NXVA 1GU1A 4YHHB 2CBZA 4C4XA 3DD5A 2AR7A 3ZVMA 3D3EA 3P9IA 2GEKA 4E2XA 3GGGA 1J0BA 1Q57A 1N2CE 4D4MA 1ZHOA 1ZVJA 2L69A 3ASUA 2ZVPX 3G5TA 4MW0A 3ZWVA 4S1OA 1N2EA 1ST3A 4MKFA 4BDSA 4LWOA 1RTTA 4KFTA 3MTGA 4HXFB 4ZOBA 1IIBA 4AN4A 3L6EA 1LGYA 1N36B 1Y5RA 1UFVA 3WL6A 1I32A 1FSFA 2QTAA 2I4OA 1RJWA 2V5VA 2VLIA 4AJ4A 3EIUA 4IUDS 2CZCA 1FJXA 5C8YB 2IBSA 1NSTA 4RABA 2C42A 3QTBA 4F4IA 3M83A 1FDSA 1YA8A 2VHCA 5D5QA 5JSFA 3EDQA 2P1DA 4DABA 5LM3A 1FQKA 4TTQA 3VC3A 1EPUA 4YAUA 4A8JA 3E84A 2IEBA 1NR1A 3GFRA 4JBXA 4ZC8A 1WVIA 2BEVB 3S2SA 4DJEC 2TS1A 4XX0B 5DH9A 3RHFA 1HETA 1KZYC 1BVUA 5IJ9B 3O2NA 4U7WA 5IJWA 1IHUA 2C88A 5L7TA 3THYB 3G2NA 3HZHA 1P39A 2QAGA 3UWPA 1WUIS 2CLHB 4QO7A 1JG2A 1Z35A 2QRNA 3ISJA 3ZHZA 3EDYA 1FYVA 3U2QA 3QKUA 5JTTA 4A2PA 2VTDA 4JEUA 1W49A 2ZS9A 3USCS 3KEGA 4W1RA 3BHIA 2M6KA 5IT4A 5LQUA 2PL3A 2VF8A 4BMVA 2XZTA 4E7OA 2CV1A 1SHTX 3CCFA 3JQDA 1IE3A 1H2YA 1YL7A 2ZSDA 2MYTA 4G0YA 5BW6B 1Y7HA 1EXMA 1XRLA 2OZEA 3LS2A 4CZ2A 5A4DA 4V0OA 2PT5A 2C9BA 3RI3A 1KY5A 4I1VA 1SZCA 4L57A 1UJ2A 1ZITA 4YPFA 3RABA 3NI2A 1OZ0A 1X7DA 1XHLA 3GJZA 3RVNA 3HLTA 3WKEA 3OHMA 4FJ0A 2C7GA 1PVVA 4RX1A 4DJJA 1LQTA 1U8YA 2UZ4A 1U0RA 3RAEC 2GXAA 1CTQA 2NYRA 3CF0A 4EG1A 3OCJA 3OEED 3N2NA 2PVPA 4IJWA 4TTPA 3S3TA 3TWOA 1ZK4A 3SLGA 3ZU6A 4FFPA 2ZR0A 5AVWA 1H0RA 4DLNA 3A6EA 2WTBA 4X0EA 4UW9A 3N2GB 4AJIA 1YTUA 1T2CA 1XU4A 3KPWA 4XCVA 5FL3A 2ZJ6A 4G4IA 2FZKA 4YQYA 4D9GA 1SC6A 4FBMA 4L3OA 3U17A 1E2GA 4CT5A 3PJFA 1ZG3A 3MWEB 3AHDA 1R8YA 1JJVA 2YXLA 3L5OA 2P65A 4IINA 3UHFA 3OFNA 4DCCA 3SS9X 5BQXA 3U6KA 1LLQA 4NENB 4CQMB 1AGPA 1JZQA 2ZKLA 5DWDA 4D8UA 4G1FA 3VPXA 1GQRA 2KI5A 2JAWA 2HHHB 3UF0A 5B6IA 2Y1DA 4QODA 1IEVA 3RS3A 4PO1A 2AQKA 3Q15C 2VRCA 3QWIA 2F90A 4MIKA 2ATEA 2FQWA 1GGKA 3IVRA 1PR4A 3DL2A 2V9CA 4X61A 4Y1RB 1M72A 4OIMA 3ZZUA 1YZKA 4E22A 5IAOA 1A5AB 5A2GA 1VTKA 4LA4A 5HZGA 3F1LA 3E18A 4ETIA 8GPBA 1N2GA 3GIDA 4CE6A 3OWHA 5K8JB 4P7KA 1QFMA 1V7ZA 3QVWA 2B61A 4NFLA 1EESA 4RTQA 1MO5A 4X66B 4XEHA 1NW4A 4EJ6A 2X0EA 2UUBB 1VZ2A 1C14A 3P2JA 1AKNA 1SC9A 4H0NA 5KJ6A 4JXXA 4I2VA 2LGJA 2OXRA 2EWMA 1IWPB 2H63A 3AEQB 2MSNA 1PWHA 3TX2A 3UZUA 4MWTA 4DF3A 3D8TA 4DLBA 1XKQA 4KR0A 2LWIA 1Q6ZA 4ONEA 4DLRA 1EK2A 3TQIA 2FSHA 1YCDA 2X9QA 1QU2A 5EJ8A 3IEIA 1XAIA 3JQ9A 2UVPA 2XBUA 4KLAA 4BQSA 1E8DA 4ZEOA 4HWRA 1REQB 5LOVA 4EAQA 1NY6A 4QEKA 4ZAWA 2P69A 4H0FA 4OM7A 3V97A 2VJNA 4D99A 3G85A 4QDZA 2RCNA 1UP4A 2OBYA 3T95A 4CEHA 3FCSB 4C7JA 2W2MA 1E6UA 4AAYA 1O57A 4OMDA 5FR2A 3QUBA 1NVEA 5J2TB 4C89A 1NVUQ 1J2TA 4JEHA 1YHYA 5LA6B 2R3SA 2ZJ5A 1H1LB 3CWZA 4CN8A 1MZPA 1RRGA 1I3KA 2C03A 2CT8A 1E0SA 1QGDA 3M4YA 1GZ5A 1X1SA 4BVAA 4WBNA 1T0BA 1YU6A 2OWEA 5ITZA 5J4LA 2RHBA 3LH5A 3EASA 3GR6A 3MGKA 1LSOA 3O91A 4QQ8A 3K0FB 5L6LB 3WIBA 3HZRA 3M70A 3KYCA 4LZNA 1QHHA 3N5KA 4F3RA 3DEYX 1QHEA 1ABFA 1U4NA 1XX6A 4RF3A 5EE0A 5A7FA 1W29A 1A8QA 5K0CA 1NLZA 4Z8XA 4O5AA 1DIOB 1GPAA 3ZOKA 1KFJB 5AK0A 3VVBA 5JAIA 2GKSA 1GNVA 4XH9B 1ZVKA 2EZ9A 1M2VB 1P44A 1ACLA 3DDUA 3EE6A 3FPBA 5E7JA 4DRYA 3BXPA 4GXRA 4EEZA 4EG4A 3HYTA 3L18A 2KSQA 4C3ZA 1WHTA 2MU1A 1GLVA 4EB3A 4RIGA 2Y2VA 1KZ6A 2WFLB 4GVLA 3E3AA 1RBQA 2BWJA 2M98A 3HB0A 4KQ1A 3NBZC 4XSVA 5DX8A 4EFDA 5B30A 4XM2A 1PEYA 5KNBD 3PEWA 2IEAA 1RYHA 5GONA 3DOOA 1V9SA 4WXMA 1IC6A 7GPBA 3VI4B 3K2EA 1Q2UA 4V1CB 4YFVA 4OH1A 1RI1A 4DDKA 4R2XA 3AP1A 4TMKA 4D3SA 2PT6A 2JBAA 5GM2A 3KALA 5E3HA 3OFKA 1PWYE 2F48A 3FRIA 1KVRA 3K9NA 2YNMC 4LJ4A 2J9FB 3IEUA 3RIMA 3U7HB 4LHVA 3FDFA 3IC5A 3PHCA 4FOPA 4YHBA 2CY0A 4IZOA 1NOKA 4OUDB 5AW8A 4AUKA 2EIHA 4L0MA 1JDBB 2ORIA 1R5OA 4PIMA 3FZNA 3C48A 4RKWA 4W1QA 3TRHA 4TTJA 4F5EA 1ZDMA 1NMZA 5FEUA 2JD2A 2QGFA 3A37A 2E6UX 3HZZA 3P2YA 3OM1A 3PI6A 4HNTA 1KI2A 2JLAA 3O4IA 2V97A 3K1ZA 3OZEA 3H83A 3Q88A 4CEJB 1FSPA 5HUHA 4Z1MD 1RKXA 5F51A 3BCSA 4GE0A 5CB6A 1R12A 1QQTA 7REQB 3I28A 1N9GA 2P9HA 4GMGA 4HZGA 3P5BA 5TS2A 4ZKDA 3SU8A 4C29A 5FTLA 3ICVA 4GWKA 3HKBA 1GU0A 2PS9A 1DC3A 1PGJA 1YKGA 3NTOA 2BR5A 4QVGA 3U60B 2YCLA 4R4JA 2WYHA 1MEJA 4ZI7F 1DBIA 4UDOA 1DHTA 4C07A 1AHPA 2X9LA 1GEEA 1VIVA 4DIEA 2GF9A 1E6KA 5AOVA 2PAAA 3O84A 3RJTA 4OSPA 1N92A 2G80A 2HO4A 4ZAVA 1DBQA 3HMQA 4LKRA 4RVGA 4W82A 4EWLA 2JVIA 3IERA 1DQRA 5AUQA 1QO0D 2WD8A 4O59O 5K3FB 5A3SA 4IMPA 4OQZA 1NVVR 1WW3A 4BZXA 4YAGA 1UZAA 1P5FA 2BGJA 2MIIA 3IUYA 3PQ5A 3Q9SA 2YJGA 4YMTA 2PQ6A 1FBTA 2PUJA 2XQFA 4Y6QA 2Q5FA 4GI7A 3BD9A 3BMNA 1G21E 1U7XA 1M6HA 2B98A 3ENVA 5G0VA 2PX3A 1OFUX 2CLKB 4D0SA 4LF8B 1QE0A 2JLYA 1NL3A 2GJSA 2O8DB 2VDQB 1E0KA 1B73A 1P5ZB 2ID4A 5EWMB 3T7DA 4M3NA 4Q18A 4PYNA 4IFTA 4HS4A 1FFXA 3EZNA 4ZK2A 2OKCA 4L6CA 5BURA 5LWHA 3WGIA 5G3ZA 1ZD4A 2HWUA 1GGEA 1L1FA 2FP4A 5CCEA 4N76A 2HRDA 3ONVA 3OIGA 4NF2A 5JZMA 4X6XA 3HO8A 4YAFA 5F1PA 1Z5NA 1NUPA 2Y3IA 2OZLB 1TMGE 1AHHA 4HDSB 2FFHA 2YN2A 4AIRA 2H2HA 4AICA 3NAQA 3ZE7A 4D43A 4ZMBA 1GFIA 5FUYA 3EJWA 4N0DA 3A3YA 5EHXA 2X8JA 3DT9A 1BXGB 1J9ZA 1ICIA 2ZT8A 2Y77A 4YMWA 3TB6A 1ADYA 2PMCA 2NTVA 4D42A 1AOXA 4HVCA 3EGXB 3DFIA 1M2EA 1E94E 1VHLA 2L19A 2QTMA 2G63A 4XDYA 3H2HA 2I7DA 1EQ2A 4LCJA 4FSDA 4UQLA 3MAJA 3HUTA 4BLTA 3RIYA 1UP7A 5KS2A 2CJYA 3ZCXA 2WTNA 3E15A 4M9RA 3RT7A 4KMSA 1OAAA 4BN0A 1VKJA 4O4HB 1ODIA 4FE4A 3THOA 4PTLA 2FKAA 1Z4NA 1PT8A 3MWLA 2XDAA 3DVAB 4MUGA 4LXIA 3ZZTA 4W7HA 5FBHA 1JU4A 1R0ZA 2GTIA 2PKQP 1SUPA 3INYA 4A0GA 2HA0A 2B4YA 1GRQA 2R7AA 3DCJA 2QK4A 1U2RA 3N0XA 3LC1O 2R47A 4G56A 4KYVA 4QYMA 3ERCA 4W8GA 1QHFA 1R0LA 5BOVA 1Y42X 4X63A 1IM5A 4EUFA 1PQYA 3GLUA 1FVFA 4EGCB 5T5QA 4CDRA 3E22A 1SHKA 3FHOA 5JS2A 4V0ME 3N2LA 2Q4BA 1C1XB 4NE9A 2PVCA 1U7DA 4JFRA 4U6SA 1WW8A 1SXQA 2C4WA 5HJ2A 3BRSA 1N3IA 3TQQA 2PL9A 4DADA 4XD7D 4HRXA 5C8YA 4PNEA 4Y2PA 3N7AA 1CE8A 1B74A 4B44A 3BSYA 2XYRA 2FZVA 2JASA 9LDBA 3DMFA 2C9YA 4KE8A 1DC6A 4OP2A 4F9TA 1S4QA 3GWZA 1EZ1A 4DARA 1U3DA 5C3MA 2BEVA 2EDAA 4IVPA 4BWVA 2REQA 4XX0A 1KETA 3B60A 3WOHA 4X3OA 4E2YA 3M6XA 5I9TA 3WMEA 1GNRA 2XRFA 1A8PA 3DKIA 2PV7A 2VSQA 4IYJA 1Y3HA 4I14A 4KH1A 3PQFA 1AUPA 2E21A 4G5QA 4HYQA 5IMSA 2H1OA 1U1FA 3KQPA 3EXG2 5JH7A 3FZQA 2Q5QA 1EQUA 3NH9A 1GCIA 1NW6A 2CK3A 3R6WA 4U6QA 5JV5A 1E2HA 1Y5LA 4AY2A 3NM5A 4DMFA 5AO9A 4JC5A 4FHGA 3ORHA 2IVFA 3RRMA 4R1TA 2H6EA 3R76A 2WQ7A 1X9GA 2BYTA 4BBAA 1RP1A 5JALA 3CJQA 4OGWA 4EJSC 4UHCA 2ID9A 1XMOB 5L45A 4UC0A 2IS4A 3DOCA 2W93A 1ZGCA 5T4EA 1J25A 1U7OA 4QDOA 1H8HD 5LPNA 2E5FA 4HZUA 1UODA 4LHYA 1MAAA 4MYTA 4UAGA 4EHIA 2QZZA 2WMNB 2WYIA 1EFRA 1A2OA 2IZ0A 3A28A 3OEHA 3BXXA 4P3KA 4Z0TA 1I80A 5C5CA 4Q12A 3OLCX 5CB4B 4G8BA 1QHXA 2C92A 4ZVLA 1BZYA 4Z4IA 5JPIA 2VKTA 4N4AA 4PZYA 1NZJA 2JLZA 1FXUA 4LE2A 4BQQA 2ENWA 4RS3A 1JFRA 4G0MA 4N41A 3QU9A 7ABPA 2O0KA 1MZVA 4M1QA 4OHKA 1ONSA 3UFXA 1I3OA 1QGAA 4XGRA 3C87A 4NENA 7YASA 1K7SN 3LCCA 2QD2A 2UV8A 4GGMX 4XOUA 4D3XA 4F7DA 4JJKA 2OD7A 4F92B 1B16A 2KQUA 3HADA 2Q3FA 3C7AA 3H5RA 3KJZA 3NT2A 3PHHA 3S68A 2I9KA 2FSIA 1EU1A 4KR6A 3IAFA 1KQGA 2FLWA 3ZTWA 2RHMA 5AHOA 1CY7A 2XTAA 3FY4A 3M89A 3OF2A 4L15A 4P4NA 5FAXA 4IZHA 5TY0A 1QIFA 4Y1RA 3LQKA 4WXPA 4FMPA 2FSUA 3B1KA 4WWHA 2WVAA 4D8TA 3AT1A 2I55A 2YVLA 2F3TA 4HEA1 3SJZA 1Z2CA 4BS9A 4Y9SA 1PV1A 1U3WA 4KQJA 3T41A 2B35A 3G0IA 1T5TA 3JZAA 4ZYWA 2PS0A 2E37A 1E64A 1JH8A 4YUWA 1AS0A 3C70A 3K6JA 4QJ4A 5E7IA 1YXMA 3RF6A 1X80B 2VF2A 2NZXA 3H13A 2CKDA 5DKFA 1KOGA 4HN4B 3QVGA 3COPA 4BC1A 3EEFA 1L7EA 3AEQA 2X5OA 3HB5X 5YASA 3W8NA 2BFMA 2FPGA 4EYQA 1HFKA 1X9HA 4B4DA 1LVUA 2HRQA 4UDYX 4G41A 5JEDA 3WNZA 4TLLB 3L6RA 3UH1A 2HYDA 2IYXA 1G64A 4D0GA 5FB3A 2FN7A 1KQ3A 2COKA 1C8LA 2GD2A 3IUSA 4G36A 5JW6A 3WGQA 4BBZA 5A04A 1KF0A 1REQA 4WN9B 1JTVA 1WU7A 3COSA 3X1XA 1UZLA 5JYCA 3DTVD 1GLGA 1MA0A 3GJ0A 4IRXA 4NMXB 5AKXA 5ER6A 4N47A 1JHOA 1JALA 4IIEA 5ALPA 4NFYA 2OYCA 5IAJA 3R7FA 2HMAA 4A23A 3G9UA 1R1DA 1X1BA 3ZHXA 3VTKA 3C7DB 4ZXFA 2HCBA 1H1LA 2E4XA 2UYGA 3LGXA 1EVEA 3P2KA 1FQJA 3KAQA 2JJ1A 1NP7A 1UKZA 1TUGA 2D1QA 2VTKA 3EZGA 3FCAA 1P4GA 4S2UA 5KNBH 3BORA 3JALA 2ZDHA 4EKDA 2V6BA 3I1IA 3U4MA 3FTQA 1U3CA 3OU2A 3QWFA 5DM2A 4XJXA 2G1PA 3DLBA 1SURA 4MVYA 3RAGA 1B4DA 2Z9CA 5LIPA 1PD1A 1LV7A 4L5AA 3SHTA 4JBNA 2QN7A 3EHEA 4A15A 1M2VA 4E3ZA 1L5OA 1CV2A 2YW9A 2Z3ZA 2X8BA 1GTZA 2O8VA 4X8MA 5EE5B 3J81A 4QGAA 2RI1A 4NRDA 4BFYA 1QP7A 1R6AA 3I32A 1U7PA 2IC5A 2AN4A 3PG5A 3TMKA 3UAYA 3HRIA 2WFLA 3FR7A 3OTHA 3KZKA 4FI3C 4B2PA 5LC1A 3I4LA 2XB2A 5K2MA 3HEMA 1YRQA 3RU9A 3GAZA 4ZCLA 1VKZA 4E5VA 4EQZA 1QRUA 1H1DA 3F5DA 3M1IA 3FLMA 2QJTA 3P4UA 1IK4A 3EUEA 3MLBA 4K05A 4NZYA 4I1YA 5TQ2A 3SC2B 1J7KA 4FE7A 4Q5IA 1G16A 1NRJB 1TK9A 4IXNA 2PPLA 2OBLA 3N58A 4RSMA 1WD7A 4MQUA 1TD1A 4H3VA 3UXMA 1WDWB 1ECFA 3GMDA 2YCBA 4PEVA 3KKZA 2Y0BA 5HM8A 3Q8MA 2GZDA 3EZXA 3NNSA 2B94A 1AJEA 1F9EA 4PE5B 3Q0IA 3DMDA 2VHWA 5CJJA 2HJ9A 2QAIA 4IIBA 2NUAB 1TLFA 3MUNA 3QJ5A 2ZBUA 5HKOA 3P9PA 2Z09A 2VDNB 2JCBA 3I2YX 5F2OA 5B3JA 5LWQA 1QPZA 4YQEA 2YL2A 4KR3A 4CEJA 5FOSA 1CQJB 2NP6A 3IGFA 2J48A 3NDPA 5G0SA 2N9UA 2XNHA 1UPFA 4QC2A 2C95A 5LQDA 1AUQA 2R11A 2C7QA 2C5EA 1ODKA 4H59A 4WEQA 3AU8A 4R1PA 1WZCA 2CV2A 5KHAA 4PU0A 3I8OA 4JH0A 1NWHA 4IUYA 2XXBA 4G0ZA 4BVGA 3BAFA 2CVHA 1FNCA 2WJVA 1IIRA 1BN6A 2HMUA 3MUFA 3ILXA 4JI7B 5BY2A 2DFNA 2C7RA 1LNSA 4D9NA 2BMVA 5I9SA 3S1AB 1S2MA 1QQ5A 3IL2A 5ITWA 3SYLA 5K3FA 4PBRA 4BNKA 1O94A 3ONEA 5LP6F 2HWKA 3BSWA 1E62A 5HTKA 3GZNA 3H8JA 4OFXA 1R50A 4MYCA 5JR3A 3AQ4A 3V2IA 3NVMB 5IW8A 1OE0A 1PL6A 2II6A 5F5XA 4CW7A 4V0KA 5EJ2A 2K7ZA 4MKIA 1II0A 2IA5A 5AOBA 3MCAA 2WM2A 3TPFA 1EE2A 2FEOA 1XJWA 2ZBRA 4I4TF 4JAVC 5IABA 3IPXA 3CZQA 3ZY3A 2O8DA 3KFVA 2OQVA 4Z9BA 4XFKA 5EWMA 4YXWD 1W36D 2R4UA 2PMWB 2IIVA 2DSTA 1RCUA 2NT4A 5KVSA 3C6YA 3T3GA 4BC0A 3WS7A 4B5KA 4FXOA 4D57A 2HN9A 1FDWA 4HN2A 1A8UA 3PQ3A 5IANA 1Y8RB 5IXYA 4RWEA 2I65A 1SU7A 2QEQA 3GRZA 4QNRA 3W05A 5I8WA 2IIPA 2OZLA 3D0KA 3SQMA 3AB8A 1EK6A 5FULA 1D2HA 1ZJ5A 2HTFA 3O8QA 2PZEA 5EIOA 3WRYA 2X2EA 3DBVO 1GGVA 3ZWPA 2C00A 1AS3A 3LIIA 4AY4A 1G41A 3D81A 5LLTA 4C3VA 1IN7A 3EW7A 4FHFA 3ZTYA 3RTAA 4EL5A 3M6UA 3EGXA 2I71A 1J1IA 3RD5A 2XUPA 5FUXA 3O8NA 3K7EA 3ZZ1A 1H6AA 4NMWA 1W4BA 3I9FA 4YT8A 16PKA 1GT6A 1Z12A 2VHZA 5IBPA 1M5UA 2XTNA 3HA3A 2PHZA 3V48A 2ODTX 4OQFA 5DTMA 1GO2A 2R79A 5REQA 5A5VA 2KS6A 1W6RA 3L0YA 2O3RA 4ALMA 1UJ5A 1AKTA 1I3CA 4LISA 2A5DA 4YJGA 1E5XA 3TZCA 4CMEC 3DBHA 3VDQA 3PJEA 5BSTA 3B13B 1IPHA 2RGYA 2CL0X 3QP9A 5T57A 2CFIA 2E3JA 4G37A 2JANA 1QTIA 2QQGA 1EB9A 2R5FA 4NDNE 4QDTA 5DOVA 1SXJD 1SBIA 1E2DA 5CIQA 4XWAA 3PIDA 2O2ZA 1CR2A 4QTZA 3QMVA 1PR9A 3FVTA 5AJHA 1EFDN 2ZM6B 4CTKA 4RPJA 3RYHB 2YYZA 1XDUA 4MV4A 2Q0SA 3O82A 2ZJ7A 4DR1B 3ETHA 1GUYA 2ZE7A 1RFGE 2DH6A 1WBDA 2CCGA 1U9IA 3S29A 2FOIA 5DI3B 3SE7A 1XTTA 3GLFB 3CUVA 1C1XA 3C16C 4YRMA 3MS7A 4OQNA 2R8ZA 4MQBA 4IOKA 4KE9A 1NYRA 4YJHB 3WGLA 3P7MA 4W9MC 2B8JA 3MWDA 4BPBA 3E9QA 3E5NA 1JV2B 1SCIA 2A5JA 2G25A 2HHAA 4DXAA 3K9CA 4BBJA 1N5LA 5LQMA 2R87A 5MGNA 3UKOA 3IIEA 1R0BA 3JZFA 1D2MA 1A8IA 1V7CA 1I3NA 1C3LA 2C4NA 3Q9NA 4DLAA 3WXBA 4D46A 3DCNA 2FDRA 4MWBA 4DDHA 2WV7A 2ZPUA 3OY2A 3EIXA 3FN4A 1JPJA 3L9XA 1PT6A 1ZP6A 3E70C 1YC2A 2JS7A 3LWZA 3RBAA 5KINB 3STTA 3PNPA 4J2OA 5CT8A 4BVHA 4LJ6A 4TLMB 1HRDA 4ESEA 2O1EA 2G5CA 3QVLA 4IP0A 2HK9A 5G02A 3X43A 3G7NA 5I9IA 3IIJA 4NKRA 1GZSA 3E3MA 4ZAGA 1VE9A 4WUVA 1ZUIA 3GFVA 1YO6A 3Q9LA 3SR0A 2Q7XA 4XASA 4ZTZB 2HA5A 1X3LA 1U0OC 2IYFA 4GKKB 2WVJA 4NBLA 4JOCA 5HKAA 4OU4A 4H08A 5HVNA 1CUXA 4PQRA 3MTEA 5AFSA 5JCOA 3DQQA 1NVWQ 2PGIA 1U2DA 1SCAA 2BH9A 2W6ID 3ROFA 1XYYA 2C5AA 1VRWA 3WSTA 4FNGA 1G17A 2FPSA 3SXUA 1KZHA 3V4FA 2Q1SA 1M6WA 3X1WA 2L17A 1VYTA 4BJ6A 3KEQA 3PNSA 2V7TA 1KJQA 3CKMA 1CEQA 2D2FA 1H9CA 3FSJX 4DR5B 1Q1GA 5J63A 2WD7A 3CMCO 4IG9A 2R68A 2XMBA 4L6AA 5LZ4A 3H4IA 1EX1A 4DT1A 1SC3A 5DK6A 5EXTA 1NRIA 2WLTA 2XLBA 3B6JA 4UBLA 3EXEA 4JI2B 4I81A 3CHYA 4MTLA 3QLVA 4QLBA 3ROKA 3QQ5A 3IDAA 3ABQB 3P0FA 5SY9A 3W2IA 1E9DA 3C6MA 3AB7A 1M6NA 1MT0A 1RABA 4ZI5A 1IBCA 5FNVB 5DDIP 2IYEA 4JP8A 2JFOA 5CJ2A 3QFSA 5KYUB 1EDEA 1L5WA 3ID6C 1T2UA 5HJEA 1RC1A 4IRUB 4IZIA 3JQ6A 4JB3A 1MDBA 2XTMA 2ZPTX 3NFYA 2YWJA 3M4XA 4QDUA 5IN4A 3ZBQA 1KDVA 4HLUA 1BMFA 3AX6A 4YJFA 1NMEA 1QQBA 2B4TO 1ICEA 3ND9A 3FNGA 1X80A 4QPNA 4LSGA 2JJ2A 1EFHA 2JGKA 3ZDRA 2NQ8A 3WB0A 3AEUB 2YUTA 3PQ8A 1I5EA 3NZEA 4H18A 4Q9KA 1SHUX 4R8RA 4H60A 3NCTA 3SE0A 5GPBA 4DUZB 4IJQA 2IYTA 3A9RA 2JAXA 1GNQA 1K89A 3ICPA 3K05A 2OSVA 2BLNA 4FDTA 4HDMA 1VJ5A 4LHZA 4RELA 3VNBA 4EHJA 2ZTMA 3IFSA 3UK0A 2GK3A 4U5XA 5B5SA 4GBMA 3CZ5A 5I7UA 2Q5JA 2VPTA 5C31A 2NU7A 4BV8A 2C61A 3PWSA 1YRHA 2L42A 4DQKA 1JHXA 1D03A 1FFEA 3W6UA 5KU1A 1BU8A 4IHJA 1GCAA 1B00A 1TA4A 4JOBA 3KZXA 5I5GA 3A9UA 3ZCPA 1G6HA 5DASA 4F3YA 5KTPA 1P4SA 2DZDA 5HCIA 1QE3A 4Q4LA 2JLUA 2HDHA 4L85A 2GS9A 4DBLE 2G82A 1UOOA 2HRCA 3N6RA 3U4DA 1SEVA 3KZOA 1GZUA 1Y9DA 3RFXA 2AJBA 4D0NA 4UATA 4UBJA 3J7TA 1A9RA 1U8XX 4ND5A 4W5NA 1FS4A 3HCDA 3RVDA 3TXAA 2ECPA 3AYZB 2BGTA 3IDOA 3WWOA 3QVJA 1H9BA 4MW1A 4TSFA 5C80A 2GDZA 5KWIA 2QMQA 4UHJA 3FF4A 2I4IA 5AM5A 1Y3CE 2OM6A 2I7TA 2J07A 4RIHA 1FVOA 1L1RA 1OILA 1G8JA 2HU5A 3UAGA 3T3MB 2F67A 4F9FA 4F3NA 1B15A 4DWWA 1BJTA 3CV3A 1CR0A 3H3FA 4NPAA 2LW7A 5B58T 1Q0PA 3OC6A 4ZYZA 4G0XA 4BKOA 2ORED 2C29D 2DFDA 4ARCA 4OK6A 2RK3A 2AFHE 1BXRB 3UV6A 4Z54A 3KWJA 3REFA 4YUXA 1C0EA 4R98A 1P45A 1J1ZA 4BLPA 4OIFA 1LPOA 1OKKD 1XQVA 2G0TA 2PT7A 1DBRA 4H7IA 4TMFA 3VPHA 1MHPA 3W5AA 1O6CA 2FPIA 1LNZA 3R3YA 3VO2A 4AMUA 1IZ9A 2ZJ2A 1KI3A 1Z28A 4R8KA 3KKOA 1YAJA 3TTYA 4FS3A 4PXAA 2OCKA 4UM7A 4BB6A 1E2PA 2BZGA 2I87A 2OAQ1 4BMZA 5B7PA 1G0OA 1ZNXA 5J23A 1JWAB 2PJZA 2VPQA 4UBOA 1JS1X 4MHTA 1FXWA 4C30A 5CT5A 3AWIA 2O5VA 1HZZC 1X38A 1ZMBA 2YY5A 3FLEA 3AUUA 2IYVA 5SY6A 4D4JA 4AO8A 4YDQA 2X15A 4HWOA 2PZKA 3WLOA 1SCDA 4R8LA 2PXXA 1YMUA 1I8TA 1OV6A 4XX1A 2O8CB 3BRWA 1H05A 1WF6A 3JZIA 5AKYA 1QH8B 4WJLA 3IT0A 3SJAA 4TYYA 1A9ZA 4FCTA 1B0ZA 1J0XO 1U0SY 1VG0B 4TM7A 4NDZA 2W8ZA 3OQBA 2YJ6A 3LBIA 2A1TS 1AA9A 1M2WA 3S99A 4LBWA 1T5HX 5IKMA 5TV2A 3F5SA 1KZ4A 3L8GA 1CUIA 1Q0UA 3IESA 2DY1A 2JFXA 4NNOA 1B1AA 1GA4A 1WZNA 4IHAA 3NQ41 4E4TA 4ZQEA 1O0BA 1NDUA 1J5PA 1XRRA 2Z57A 4NH4A 3TR5A 5L3VA 3HYSA 5KKAA 2PSSA 5GZ1A 5K5EA 1EUCB 1G6KA 1PZGA 2JDIA 3BGVA 3FTPA 3M49A 3MQ2A 4I2NA 1M2NA 1CRQA 3K1JA 1XZBA 3AM3A 4P4LA 2QL7A 1EB8A 2ZJBA 3PQ7A 2VOEA 3W6ZA 4WKNA 1GPNA 5KCZA 2OMEA 4F06A 4J76A 1XZQA 5LA6F 3SDZA 1VBKA 4R5MA 3EEYA 1OH5A 5DTEA 4F85A 5C0OE 1TLLA 3S44A 3VNUA 1V45E 3MJDA 1WKBA 4LI3X 2H1IA 1WMAA 5H70A 1IFXA 5KOHA 3I04A 1NTOA 3W6OA 3AUJB 3RW9A 1Z4IA 2CWWA 4MRRA 2ZE8A 4BB0A 1Y8RA 4DV7B 4M6WB 3LQ1A 4I4CA 5A4KA 3NBMA 1ZK3A 2Y67A 3CN9A 1VGRA 2YWFA 1PL8A 1KJZA 1L3IA 1MOSA 1H6DA 1QGZA 1Z5ZA 2VT2A 4C1BA 4C0WA 3CURA 1CB0A 1YL6A 4G25A 2WWRA 3DEFA 3FTNA 4PZZA 3VTZA 3ZWCA 4E5PA 3QYJA 1UP6A 4RD0A 1GP2A 4ARUA 2OOKA 4EX6A 4UUQA 1T6YA 2GSWA 3GJ4A 3MCVA 4REQA 3HY3A 4RSGA 5SYNA 4MW2A 4CM8B 1KC3A 5HK8A 3D2AA 4DV1B 3U4GA 4EHDA 1B0AA 1H2BA 1DBWA 2V7QA 3LK7A 4R7GA 4F0JA 3AM5A 3VKFA 1P4HA 1UFQA 3G2KA 5ESXA 1Q3HA 2B83A 2PRJA 4LV8B 1VQ1A 2O07A 1KO4A 3IOYA 3TN7A 3ZE2B 2AS0A 2PFKA 4BFUA 5EA2A 2BI7A 3NVAA 1R4NA 3HXPA 3QU5A 4B5LA 1LTKA 3ANMA 5K9ZA 2JFVA 5H3HA 4G1VA 1L4LA 1MOQA 2DVMA 2QG4A 2QNRA 3GLTA 3JQGB 4H7HA 3OKFA 4QHSA 4BP9A 5IDQA 4ON9A 4FZVA 3AILA 3QKRA 1C9MA 1XRNA 1YZHA 4Y3UA 1J97A 2QR3A 4QFDA 3IEVA 1FEZA 3BBLA 4B1FA 2A9RA 4NP6A 2W6ZA 5K05A 4F2GA 4IGIA 1BC5A 2I6TA 3HHPA 4B7ZA 2ZTHA 4NSNA 3CUTA 4X8OA 5DVZA 2YRFA 4F7WA 3VR5D 4EY6A 3ADOA 3D3QA 3KELA 4QM7A 5KX5B 1D8AA 3PGLA 1N2ZA 5MN5A 4ZVPA 1O08A 4HEA6 1JLRA 4XM0A 3FYUB 1E0AA 1XJCA 2VATA 3N0WA 1VRVA 3Q41A 3ZIDA 1WSWA 2R6GA 4FR2A 4RQUA 3QXHA 2E6KA 3IR6A 4YWHA 5FA6A 4KPFC 4XUDA 1T0PA 3JY6A 4YACA 4DG8A 1NJSA 1OWOA 3GEPA 5IVDA 4GOND 2QRVA 1JB9A 1XAGA 2ZITA 3IBSA 4JIMA 1OTXA 1J0DA 4MITA 5IVIA 1ZIXA 2B6NA 4O1MA 5EHGA 2XMRA 3LA6A 4LN1A 1ZINA 1X74A 1OR8A 4KXUA 3FWZA 1PEKE 1UWVA 2J1LA 3ENZA 3K09A 4J4BA 4J0FA 1P2BA 1D04A 4EI9A 5I4IA 4FSXA 4FMBB 3ZYZA 4F4JA 4ZTBA 2VXCA 1P61B 1SXJC 2W9XA 4F56A 3DKVA 4RA6B 1XNRB 4UU7A 1Z2EA 3ET4A 3FW1A 1K7YA 1NVXQ 1YE3A 2H8GA 2W5UA 1NVAA 1QV7A 1W30A 2PLFA 2YHAA 2Z9BA 2ZXFA 3QELB 2PZFA 4MV0A 4PO3X 3DT6A 2AK2A 1YGYA 3B7PA 4FGKA 4Q3AA 1E3QA 2X41A 1IOVA 1C41A 2I9PA 4B8YA 3FOCA 3EVAA 1UMBA 3KTAA 4BWGA 4CDMA 5LIRA 3H2BA 1Z45A 4KWEA 4R1OA 2BI4A 3MERA 4MYUA 1EWTA 1X7YA 1ZXXA 2J5XA 2OUKA 3EA4A 4WCFC 1VCHA 4E11A 4JUAA 4Q6WA 1KR2A 4CCWA 2C5BA 2OCIA 4FEYA 3LZ6A 4NI5A 4S0XA 3TLXA 5JXGA 4X44A 2D1RA 2Q6VA 3D3WB 4OHXA 3WGUA 3NH6A 3F67A 1QIIA 4NJOA 4DHEA 3W5HA 5HM6A 2ST1A 2E7ZA 2FCRA 2I1LA 2FW7A 4JR2A 4HNUA 4MK4A 5EINA 5F1YA 4QDKA 4EI2A 3IB6A 9GPBA 3JQRA 2IXGA 4GZ3A 3AJEA 3FPJA 2F1HA 3LC0A 1S2OA 1LXCA 4G5YA 4TUYA 3T3HA 5BV2P 4HX9A 3W4IA 2R751 4B6EA 3CNHA 5HRUA 3VU1A 3BWMA 4JLDA 1MUUA 1FMTA 4GWGA 5DLQC 3ELDA 4FW8A 2V3WA 2PBLA 2EKLA 1HY3A 2NVOA 4ED9A 4URYR 4UQPA 4KTVE 3LECA 4GO1A 3L7JA 2WIDA 2EBFX 2JCVA 1R6BX 1Z25A 5E9JA 3T7EA 1Q6YA 4ZO8A 5HGJA 4RPCA 3T3EA 3WSWA 4LZOA 5F7ZA 1I2BA 2QZPA 3CKKA 3LCVB 4O4HF 4OYHA 4QTTB 1V2HE 3AFNA 4HB4A 1NV9A 4Z7NB 1P29A 3U4QA 5FNVA 3VPSA 3FNQA 5EUCA 1OWMA 4TTIA 1KO7A 1EAMA 3CXUA 3EEBA 3I4CA 1BHSA 4N40A 3AR3A 2C9CA 3ZKAA 4V0LA 1Z5VA 1ZCJA 2VO1A 3CLHA 4QUBA 4EW3A 3TSOA 4E5NA 1J8DA 1GFZA 3PNKA 4JDPA 4N82A 2VHEA 2XXJA 3G89A 4G26A 4N7MA 4D41A 4EYGA 1X1QA 2OQIA 2HLNA 1A5ZA 1CZHA 1QVAA 2QZ4A 2CC2A 1ND6A 2V6GA 3LBAA 4L4ZA 3RFFA 3HCFA 4DKXA 5K20A 1TU4A 2EV9A 4ESVA 3IH5A 3TVYA 3VR0A 3VGPA 1B26A 1UDXA 4JGBA 4JJ8A 3RYIB 3FTEA 2ASVA 4E6PA 1P3Y1 3B52X 2VJKA 4DV2B 4D45A 1Z38A 2RGRA 1HX7A 3FZGA 2FY8A 1XNQB 5IKXA 4CG2A 3DBLA 1OTHA 3GXOA 5I7WA 3VDXA 1YD7A 2NSYA 2YIDA 2QV0A 1ZI8A 2OXEA 1A8HA 1OZHA 1HDYA 4FX2A 1D0VA 2EGGA 2QR2A 3C2QA 3EIOA 5FV7A 1U1DA 1UANA 2CFCA 1IZZA 4DSZA 2LXNA 4KWIA 3JD1A 3V8VA 2QG6A 4QG7A 3TTXA 3X1JA 2IEGA 3EBOA 3FNFA 1OD6A 2Z3WA 1AE1A 3ZCVA 1IG3A 1JEAA 3ME5A 1E9AA 1LK7A 5L3RA 2VR1A 3I6ZA 4BO6A 5JNSA 3UN1A 4DZTA 3OFVA 3QVUA 3DMTC 2WR8A 1LVHA 1W6UA 2R00C 2ZRAA 2A1UB 2O2CA 3K0HA 3RGWS 2CXQA 4BUCA 5JY6A 5ADVA 3MNFA 1JIVA 4L08A 1KAHA 3I9OA 1WPRA 1HM5A 3AF5A 3CVOA 4PSVA 1EXNA 3PNBA 3OUZA 3OO1A 4FFVA 2E4UA 1SQSA 2Q8PA 3A1FA 2F17A 1GG2A 2BSAA 3GLIB 5HOEA 4DAOA 3S2FA 3UPTA 1N5IA 3QI7A 1H0HA 1TQ8A 3R5SA 3VH1A 2HF8A 2XF2A 3GT3A 5BRAA 1A8SA 4GC9A 3WIDA 3KUXA 1XEFA 1KJJA 1X7XB 3TPCA 1KFEB 2J3EA 4JI0B 2B78A 1DEKA 2EKDA 3MGCA 2EIXA 2BKUA 5CB4F 1M2JA 2BSQA 2W37A 3W2TA 2GN0A 1IDOA 3RFUA 1BXRA 2ZJ4A 4CDNA 1ZZEA 2O52A 3KQHA 4R1LA 3O7MA 3ACBA 1GSIA 1RRPA 2F9LA 3K2QA 3P32A 5JCZA 1PW7A 1T24A 5LQAA 3QI2A 2DE0X 3SICE 1OX6A 1G2IA 3HR7A 2D5IA 3PQ4A 3B2EA 2XAAA 5LSAA 2VLBA 1N32B 2HB6A 1MU0A 2QLMA 3WYAA 4MGIR 2ZTVA 1VSUA 2IY7A 3H84A 5JPCA 1FIUA 2Q0QA 3NS7A 2QVZX 3AR2A 3L7AA 5KQPA 4WA7A 3FUCA 3VZSA 3A1EA 2O2SA 4PG8A 4NEQA 3GUVA 3NWOA 3IIMA 4EJ2A 2YVKA 3S81A 4NE7A 1XZ8A 3K9GA 3PGMA 1N1GA 3EYWA 2WHQA 4NCBA 4RVDA 2CFOA 2OFWA 4WLNA 4NXNB 5AKLA 3LY5A 5KDOA 4IWNA 4KIJA 2WJYA 1BMQA 3L84A 1ECJA 5K0BA 4QYTA 5LXTB 2XYPA 1E0DA 2NYUA 3DWFA 3KU4A 1QB7A 1N3LA 1GPUA 1VHJA 1IUPA 4OAOA 3C7CB 3MXTA 3K92A 4PC7A 1E4EB 4F6RB 3BM5A 2V0GA 4JR0A 1VMDA 2EYQA 5T8KC 5I7RA 5FBQB 1SG6A 3T7CA 1UBFA 2W0SA 3CEPB 5BORA 1W4ZA 1TT7A 2IUEA 3G0BA 4MJ7A 4P5DA 5H7XA 4OOFA 4L16A 2C3YA 2X3UA 3WIOA 3ZU5A 4B3XA 2Y1CA 4HY3A 3BGSA 3SHQA 4QATA 1NXOA 5ALFA 4OQPA 3BEOA 1BMTA 5EP3A 4B35A 5HXAA 3ZGYA 3GRUA 2EL9A 2GERA 2C4KA 3SF0A 4PAMA 4J0DA 3HWWA 4I1SA 2X0KA 5CD1A 1Z63A 3VR1A 1Z6XA 1VG8A 4HGRA 3GVHA 4DN6A 4EB8A 4DWOA 3DUFB 4C7BA 4URUR 3M7IA 3EQ8A 3IALA 1VI6A 3NWJA 2HMSA 3TVDA 1QFZA 3H42B 2QX7A 4G09A 3TLEA 5EIXA 3TOZA 1GV1A 2CHGA 2J08A 1CXZA 3B2NA 5ALRA 4K6OA 3F3SA 1Z4OA 3WLTA 1QZ3A 2VRBA 2WUGA 3MB5A 2WZDA 3FAKA 2O7SA 1JI3A 4LDZA 5A62A 2E5WA 2YC4C 1NMYA 1O95A 3NHUA 4UREA 1BYIA 1IEWA 1M1ZA 3KR1A 5ETJA 2JCYA 5FFNA 4JZYA 2ZVQX 1KK0A 3AW9A 3I04M 4MB2A 5KAMA 4E32A 1OLUA 4ZRMA 4C0KA 1IJKA 5JPDA 5CK5A 3B70A 1F6BA 3I01M 4NFSA 2RGNA 4RCYA 1YACA 1XZAA 2CNWD 1P4AA 1QV6A 2NZYA 3C4VA 1BW9A 3FYTA 4KGZA 5DOZA 2GHIA 4D8WA 1N5OX 2XXAB 2A30A 1JU9A 1XQXA 2BEUB 2BHLA 1HI9A 1N25A 3BJRA 1II8B 2ZAOA 4ML3A 5B1HA 3RASA 1G18A 4QYIB 2RSLA 3N0VA 4GSKA 4LMBA 3VR5H 3LP6A 1TNDA 5AW2A 4ND7A 1SH7A 2DQZA 2EFYA 4GXNA 4HAVA 2ZSAA 4WX2B 2GEJA 3HKDA 2QP4A 2PMDA 3NAGA 3NOVA 4F9GA 4BNTA 1I6KA 2OFFA 1TT5A 3KXIA 5G1NA 3QLTA 2YRWA 3VMMA 2ZRHA 5CLQA 4GHWA 2FB9A 2A6PA 3PRYA 3WGZA 4HC4A 4EKEA 3VBEA 4KW7A 5IHXA 2PH1A 1TAUA 3I61A 2OB2A 2NTEA 4RNDB 1O4WA 2HC9A 1LRKA 5BSGA 4RK4A 1UPBA 2JAUA 5ED4A 3GJYA 4NBSA 5FPTA 1UBNA 1W4LA 2VSFA 3DXZA 1DIBA 4IDCA 4Y2QA 1ARZA 4A03A 4FHZA 3HYNA 4PHTA