4RANA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
201
Chain Sequence
RSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKVIGGDSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 66
structure length 201
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ranA00
4RHXA 1DKUA 1P4AA 1U9YA 4RAOA 1I0IA 1BZYA 5HIAA 4FYMA 4JITA 4RANA 1QB7A 4RABA 1XZ8A 1NONA 3H83A 5BRNA 1UPFA 1BD3A 2C4KA 1PZMA 1ZN8A 5BSKA 5ESWA 1P18A 1Z7GA 1O5OA 1ECJA 3ACCA 2JKZA 2JKYA 3DEZA 1VSTA 1DBRA 1UPUA 1G2QA 3DMPA 3O7MA 4RV4A 3GGCA 1ECBA 4P82A 5ESXA 3G6WA 1I14A 4RQBA 1I0LA 1MZVA 2JI4A 3NAGA 1A3CA 5IPFA 5KAPA 1OREA 1YFZA 1ZN9A 2H08A 1XTVA 1A4XA 4ZFNA 2DY0A 1V9SA 4QRIA 1J7JA 1QK3A 1GPH1 2XBUA 1CJBA 4RHYA 1XTTA 2YZKA 1ECFA 3GEPA 4WN3A 5JSQA 1WD5A 3DAHA 1P19A 1A95A 1I13A 1A98A 5EUCA 1G2PA 1JLSA 2P1ZA 2E55A 1LH0A 2PS1A 4LYGA 3HVUA 4LZOA 3ACBA 4P80A 2EHJA 5HKLA 4LZAA 1VDMA 4PAWA 2WNSA 4S2UA 1AO0A 3GGJA 1I5EA 1L1RA 5BQPA 2JBHA 1U9ZA 4PFQA 3KB8A 2HCRA 1QK5A 2PRZA 3EFHA 3OZFA 4P3KA 1VCHA 1UFRA 4RACA 4KN6A 1DQPA 3N2LA 1A96A 1ZN7A 3LRTA 4MB6A 4RQAA 5KAMA 3MJDA 1L1QA 1HGXA 1NULA 1QCCA 4P81A 3MBIA 1OPRA 4JLSA 1O57A 4LZNA 1HMPA 1DQNA 4M0PA 1BD4A 4P86A 4RHUA 4OHCA 1QCDA 1JLRA 1G9SA 4M0UA 1Y0BA 1D6NA 1W30A 4TWBA 3OHPA 3S5JA 1XTUA 2H06A 2AEEA 4RAQA 3ACDA 1A97A 1P17A 1FSGA 1OROA 4P84A 4IJQA 1GRVA 4P83A 1ECCA 1IBSA 4X44A 4F8EA 5IAOA 2PRYA 4LYYA 1G9TA 4QYIB 4WMLA 1QK4A 5E38A 3M3HA 2H07A 3OZGA 4RHTA 3LPNA 4M0KA 2GEBA 5K51A 4Z1OA 4X45A 1R3UA 1TC2A 1TC1A 2FXVA 1DKRA 1ECGA 1XZNA 5BQOA 5JV5A 2IGBA 3QW4B 4QYIA 1STOA 4RADA 2VFAA 1QB8A
chains in the Genus database with same CATH superfamily
2FW0A 1JVBA 3PTLA 5HFJA 3AWIA 4U02A 2F3SA 3CVOA 3GNQA 5BUQA 3TSCA 2C77A 1XVAA 2QTMA 3KEGA 1T9HA 5BRNA 3UBMA 2A3NA 4P4TA 2WU0A 2V6JA 3MT0A 1G18A 2CJWB 2R86A 3FI0A 3Q0EA 4FQ8A 4V3CA 4ZCQA 4AS2A 4N76A 2E21A 1G42A 2RB4A 1BO6A 2XGMA 4NLLA 2IITA 3DOHA 3U0VA 3UHPA 4BAGA 2PX3A 3IPAA 2VVTA 2WA1A 3NYQA 3PEFA 4I2NA 4XGQA 3WY9A 5H80A 3W3AD 3EASA 3TNDA 4FKZA 3QYFA 4MI9A 2W8BB 1X1DA 3FPJA 1ZOSA 3EIFA 3QYPA 2RAVA 3KXPA 5J43A 1LK0A 1RXCA 1JLKA 4Z7OB 1QF7A 2H5LA 2BFEB 4HR7A 3SFVA 5DGXA 8ADHA 1QO7A 3BK7A 1DO0A 3FNHA 2X4DA 4AQDA 1QV6A 3LL7A 1P2VA 2Q4DA 4X1KA 1TJ4A 1KJ9A 4GM0A 1L5OA 4GI7A 2OC9A 4XUGB 1Q0RA 4ZCTA 2SECE 1M8PA 2ADMA 1GN9A 3CZ9A 3DD5A 1W4LA 5CPFA 2IUSA 2X8JB 5AI5A 4YROA 4BTLA 2CD7A 1W0KA 2Q2VA 4WKGA 4WT7A 3VH2A 3HVJA 1I24A 2GARA 5B58C 3L1IA 3FPFA 1IRXA 1U2RA 4L5YA 5AJWA 3R7BA 4B8YA 3PPWA 3KL4A 1EP9A 2NIPA 4Q3BA 3TLYA 4JV5B 7GPBA 3SI7A 2YR0A 3WNDA 3K5WA 4OFXA 4MPTA 4DG9A 1BH2A 2EFEB 4MKIA 1Q0HA 5ALKA 3OLWA 3DBHB 1RS0A 3FNGA 4KPGA 1YT5A 1KQGA 3FHTA 4G9EA 3B2NA 1ZEJA 5CJ2A 4CCAA 4FI3C 2CE2X 2VKQA 3KM0A 1F5SA 3ESZA 1RQNA 3IDAA 4IZ6A 1AQ6A 4OB8A 5I9NA 5K6AC 1CW2B 1IATA 1Q1QA 2OCKA 3IIKA 1Y3CE 3O2QB 3TNYA 2H2FA 1ODJA 2J9GA 2R62A 1J23A 1B8PA 2EKLA 3M83A 1R74A 4KFSA 2Q4OA 3U0BA 3RQIA 1WE2A 3ZE6A 4BNZA 1D2CA 4CTNA 2ZROA 1JEAA 3IMFA 1OXUA 1U2GC 2AZDA 3KXLA 1CUZA 1AMNA 1KYTA 3IUBA 1ESDA 3TDMA 4LCEA 1D6NA 1U8FO 2ZRDA 3F6YA 4AJHA 5ED4A 1UOQA 4P1ZA 5CB8A 5FOUA 2NNWB 3NBZC 1G2IA 3NBQA 3VPSA 3M6XA 4CKCB 4PLCA 1Y8QA 2V7VA 2X13A 3UB4A 3ONEA 2PMEA 4D81A 1ZIOA 5A6VA 2VL7A 1SU6A 4YRPA 1PVDA 1A7JA 2A4MA 2FXIA 3VXKA 4AKEA 1ZGZA 5FBRB 5JV5A 3IUPA 2J9XB 1LW6E 3K9HA 4WY8A 1YL6A 5IXSA 3Q5GA 2QL5A 2VFAA 4NYIR 4EHIA 4TV8B 3MN1A 1WY7A 2H4XA 3SC2B 2J9FA 5JXWA 4KQFA 4R5MA 3G2QA 5JHHB 1M1NA 4NYJQ 5B53A 3AH8A 4ZOEA 3U6BA 1GJRA 4JC5A 4WFIA 2GK3A 1Z0AA 3TG8A 2P9CA 2IU6A 2X0DA 4JB0A 1EEXB 2HK6A 3HA7A 1SZCA 4D3DA 2EJUA 2YMPA 4JOBA 1Z0JA 1A8QA 4CWAA 3GBVA 2DWCA 2H51A 4Q4JB 5DLYA 4NPHA 2IOFA 2I66A 3FXAA 3KV1A 4B6JA 4B7AA 1EVZA 4NEQA 4O6VA 2AKYA 2D2VA 1XTJA 4REQB 2QX7A 2IA5A 1M7GA 2CFSA 1RFGE 2BRUC 2R4UA 4M6WB 2Y0BA 3GCZA 2Q5OA 2IXFA 3L8CA 3MGAA 4UHEA 3E22B 3H2SA 4I0WB 1NBWB 3KQSA 5ESRA 3W06A 4UUBA 4Y8VA 4YJDA 2FRVA 3TD2A 4JVSB 2RBEA 2JFYA 1T2EA 4R0NA 4ESEA 1ZMOA 1L7BA 5FR1A 4A16A 1JQ5A 1NQAO 3GLVA 4XIJA 3OICA 1N5MA 3N70A 1Y4ZA 2LPMA 3B5EA 1E2KA 1EK0A 2CSUA 2AFHE 4BEBA 1XEXA 3BK1A 4WN3A 3II6X 2PL5A 3DAHA 1E61A 3EBLA 4M0FA 2CLSA 4MJLA 1OAAA 2I4RA 3R7DA 2DG2A 4OJTA 3UMYA 1WW2A 1U4SA 3OQNA 3P2IA 2C2XA 4R84A 4UTOA 1QFYA 4DA4A 4G85A 4N7BA 1QP8A 2FOLA 4OKNA 2YWFA 1NLZA 4ABTA 2VG8A 4BXOB 1OFIA 3IV9A 4QAJA 2CLIB 5GJCA 5KJCA 3RJ9A 5C5IA 1TMOA 3FNQA 2XNDD 5KQRA 4UM5A 1NW6A 2FWRA 5ADHA 3L0SA 3LA8A 4QDZA 4X8HA 4YPFA 2QMHA 3HDYA 1LFAA 3ENVA 5EJMA 3AF0A 5ALDA 1G3UA 3G9UA 2FW8A 3DS8A 2ZR0A 1O5IA 3D6MA 1F6DA 5BQFA 1NVWQ 1DPGA 1LRLA 1Z25A 1EJBA 3PXBA 2HA2A 1W2WB 4N5LA 4I3HA 4DDVA 3UWKA 3AW9A 4JXJA 4EVQA 3BREA 2O8EB 3KQWA 4EGAA 4IZOA 3PIIA 1SHUX 1E7SA 3W9UA 2BCJQ 4JVNA 2AX3A 2OCYC 3ABRB 2CE7A 4JLNA 3DG9A 5DM1A 5HJ2A 5SY4A 4TQUS 3RV3A 3ADCA 1CEEA 4OXKA 1OV6A 3R23A 1YS2X 1H2YA 2WF6A 1JJFA 2REQB 3IELA 3FVQA 3RVPA 2GYYA 2ISSD 5B4UA 1MGOA 3D81A 3IMEA 3WRXA 5HA5A 5EG5A 4UDOA 3RUIA 2FPMA 4JI7B 4KXQA 3V4RA 3QY0A 3KKLA 621PA 3OIVA 4WZBE 1T9GR 1N2BA 3L93A 5C1BA 1KNQA 3B82A 4E5VA 3RVSA 3U9SA 1LTQA 3ONWA 4GD3Q 4MV7A 1TM3E 4JEHA 4D3SA 3EGXB 4R8VA 2IZOA 4JLAA 3QU7A 2FDXA 1PR4A 1ZRSA 5FBLB 5TR9A 3T7EA 3ON5A 2CFIA 3EVFA 4EENA 1VP9A 1TEXA 3DNMA 4DJDC 1WTAA 3G2OA 4NABA 2VSOA 5C2JB 1CS0B 1D0IA 5IBPA 4RIHA 3L1HA 5DCYA 1WZCA 1QZUA 4R1MA 4CIWA 1J0DA 2CYAA 3NKFA 3F71A 3I9OA 2JJMA 3TTUA 4QGGA 4TVOA 3F8WA 3A9RA 3EGDA 2V6BA 1SEVA 4HQ6A 2UZ1A 3QBTA 5CM8B 5F2NA 2OYCA 1TPZA 3DFIA 3OF3A 3IP7A 5K5EA 3RS3A 3SR3A 3EPKA 1J5PA 1MIOA 1N1GA 1VMIA 1V37A 3I9FA 4XVQA 1N33B 3ZOZA 4K6FA 3ZI0A 5C7IO 1ZOIA 1NU6A 2O2JA 3RAEC 3KZVA 2J7PD 1GL3A 1CR6A 3NQ41 2KW5A 3L7NA 4IVNA 4LJ5A 1OI4A 2R2AA 4RESA 4CT0A 1NP3A 4QJ3A 1QGOA 3ITNA 1E7WA 1Q7BA 4XI9A 4B5KA 4EW1A 4R2XA 2HR1A 3WGOA 3J80A 3EHDA 4TL9A 5IT4A 2CMHA 4JVMA 5CEFA 4AYWA 5IWCA 4R6XA 3O1JC 5TT0A 3NJRA 1UINA 2FMFA 1EUQA 4IJKA 3U4AA 3FTNA 3QU2A 1VZ2A 3LMKA 5BN5B 3NTVA 1RMTA 1UJ5A 5FIUA 1U0JA 2KX7A 2NVWA 1BXZA 1PYOA 4JP2A 2VPXA 5KDLA 1QGZA 2Z57A 4P0QB 1MB4A 1J8MF 3DPSA 1IOVA 2HKIA 1XLTA 3H2BA 1BFKA 2HD4A 1XJWA 4L4RA 4XGKA 2JGKA 4WQMA 2IYXA 1ZGAA 1B1CA 1DQSA 2JF0A 2MSKA 2Z3WA 4MEBA 3SM9A 4OTZA 2QY9A 3ZHQA 4N54A 3VAAA 1Z18A 5KNBH 3WP0A 4MI3A 1E0SA 3L92A 2EWVA 2X4LA 2ZJ6A 3EZ9A 1G7SA 4GNRA 2ODTX 4PSVA 3TOXA 5BSTA 4BB6A 1L5HA 2WQ7A 1JEOA 3T3MB 4MGHA 3GUYA 4D9FA 4LYAA 1T36A 5EIFA 5IDVA 2V9CA 4UMEA 3RUCA 2QIPA 4E32A 4BE9A 3KP1A 4MUNA 4UU7A 5G0VA 3IEMA 3CO0S 1IIBA 1CY6A 3IR6A 3GG2A 2YASA 4KITB 3VSEA 1XZLA 5ILOA 4BKUA 3GC6A 5LPNA 1JSCA 2X6RA 3JQGB 5IEBA 4Q1EA 4NYJR 1HY3A 3BERA 5HBRA 2WPNA 5IAEA 3A6LA 2OORC 4O2LA 3E27A 4MRAA 2QX9A 4KJZA 4G65A 4UDNA 3IT1A 4FS8A 2PU5A 1OB5A 1V71A 4M8IA 2C20A 4RZ2A 1JKMA 5I9BA 3RRMA 2ZWIA 1AKTA 3QTLA 2GEDA 4L8WB 2HQOA 4Y1FA 2YMLA 3R9XB 2EX4A 2VYFA 2VNAA 4WRRA 2R11A 3H0EA 4EI2A 3V3TA 4FI3F 2WVGA 1ZBQA 3D7SA 1Y9AA 2QRZA 4IXNA 4YUXA 1H66A 1KRHA 2AFHA 2XQKA 3DZBA 2CJWA 3JWIA 1EMDA 2XHEA 3F5DA 4DIDA 5A3JA 2HPAA 4WFKA 3JWJA 1D04A 2ENUA 1V1JA 3KQKA 4FFBA 5H02A 5I8WA 3KEOA 5ARBA 2Z30A 4RNDB 4BNDB 4U6QA 4DIEA 4E88A 4CE6A 4EGJA 1TF7A 3OU2A 5CHYA 2ZBVA 4B17A 1ZNWA 3TI9A 5I9LA 2J59A 4YYZA 2YWGA 3K0AB 2IUEA 2QTFA 3GRZA 5J9FA 1GPLA 1DCKA 3AI2A 4RTNA 4O8ZA 3TTTA 3SDZA 1ZK3A 3Q9LA 1VBNA 3FWHA 1E58A 5TQ2B 2PXXA 3CINA 3KQYA 3QKUA 2BFEA 4QU5A 2QP3A 4N0PA 5T7BA 2VOJA 4FHGA 3RU2A 2E7ZA 1XA3A 2HEGA 1OXKB 3NTXA 4FGJA 3EPJA 5CD1A 1DKNA 1M8KA 1GCOA 1CJMA 5B2FA 1RIIA 2IFTA 2QKYA 3KXIA 3WYCA 2DQYA 4H0NA 1DV1A 5HOEA 3F4BA 3KHSA 2NUAB 1RJDA 3T5BA 2GBFA 4BUZA 1V3VA 4MWOA 3SS9X 2X8JA 1ST2A 2H08A 3TTVA 3PWTA 4F7DA 3G7SA 2IBSA 5KKAA 2ZREA 1CY8A 2RC5A 2W93A 4IXWA 4QD3A 1EVKA 4WERA 4DWOA 2YWJA 3MTJA 1XYVA 5IBCA 4BZXA 1U4OA 1GZ3A 3QV2A 5JAMA 4J0GA 5B7NA 2FDCA 1L8XA 3GU3A 4O29A 4WOBA 4AROA 3FPLA 1WUYA 2N75A 2Z8ZA 4ISCA 4HN2A 3LUGA 4IFEA 3RRFA 4A2QA 3VKHA 1DFHA 5EIBC 4K0KB 1A4UA 4DA7A 1S6YA 4L8GA 4LJAA 4O1IA 3O1HB 1LCIA 5B30A 3ZUGA 1FRVA 3JQFA 3RODA 1WEKA 2BL4A 4FE4A 3AI3A 4JX9A 3ANYB 3HR8A 1H1LB 1UXGA 2N1MA 2WV7A 4MKZA 1BMDA 2XYHA 2HU5A 4DNFA 4EOGA 5A5DA 3SC3A 4RTSA 3NHSA 5CCXA 3IOMA 4DMHA 3QE9Y 5TQVA 2HYDA 3D3JA 5KX5B 1NGSA 4ZA2A 2GLTA 1EUYA 2O2HA 4NG5A 3EIOA 2HRZA 1O3YA 4J03A 3DJFA 1KFKB 1RJEA 4ND8A 4P5PA 4JHLA 3ZWXA 2RONA 1L5NA 1GPKA 4B76A 4LS3A 5KTRA 3R4VA 1TQ2A 4OM8A 4CKCA 2OXRA 4RY9A 4AJOA 1LDYA 5IVKA 3I12A 1T5OA 3S55A 1DQNA 1GRRA 1AGYA 2OCIA 3NNDA 2VYNA 3IAS6 2NX2A 2BMJA 1RCUA 1P7VA 4IAOA 1PU2A 2NO7A 2VDQB 1EX6A 2B9EA 5EWMA 1LWNA 5JS2A 1ZO8A 4TM8A 4A4DA 1XD9A 4MUKA 5HMLA 2OGTA 4BGEA 3IEVA 2QUZA 3LP6A 2WPDD 3HB1A 2CNWA 4TV8A 1JB9A 1ORRA 3SC2A 3CIFA 4AJJA 5KTYA 2Z9CA 3ZHZA 2X5KO 1JMYA 5A4DA 1EWKA 3JS5A 3OFJA 2Q3HA 3OZGA 4IXDA 2P75A 4CM3A 1BJRE 3E7DA 4M0KA 2ZCUA 3SIRA 1C0LA 2YV2A 3HO1A 4IQ8A 4RU1A 4DLXA 2YVQA 5HSGA 1TAQA 1N5IA 1L7XA 2WUDA 2HV8A 1NBME 3QI2A 4UNNA 1AURA 4A6XA 1ACJA 2OD7A 7REQB 1J2UA 4L7VA 4M0MA 4E46A 3LT2A 4GS5A 5B1IA 4Z0PA 1GG2A 1OF1A 1XTRA 4JITA 3R9IA 1MHTA 4ZK2A 1SBQA 5IJAA 4M6WA 1WMEA 2QL6A 2C4KA 2VAWA 4U39A 1ZN8A 3UUWA 1XQ6A 1OI7A 4YP7A 3BSSA 1HQKA 4RDHA 5JANA 1NURA 2Y68A 4BIIA 4Y1GA 3ZV5A 1QAQA 2K7FA 5AK0A 2Z3VA 1KKLA 2PRKA 3UC9A 2JIDA 1N2CB 2Y6UA 1W35A 1ISSA 1MDBA 2VTKA 3UPDA 4X84A 4ZV9A 1PZFA 1YVUA 3A3YA 2JIMA 1Z36A 1Z0DA 2HLHA 3BQMB 5AMXA 3EIQA 4V24A 4WK4B 4BRWA 4A91A 3EUAA 3VFDA 4MYUA 3H5VA 2CKDA 2Q0SA 5FI3A 5HZKA 2BKEA 3NEPX 3UMVA 1M2GA 3LH5A 1FE8A 2XUKA 4MP6A 1HEYA 5DTEA 4CQNA 1EEHA 4PGAA 5FF9A 4ZK6A 1HNZB 1YA8A 4LRWA 4DSUA 1FVHA 5B2EA 3GUCA 4OVKA 3T06B 1E4EA 4Q7EA 4TM7A 3KPVA 1T0UA 2P1RA 1E3EA 3KWJA 1Z4OA 2PMDA 3SDBA 3P5SA 4PLPA 1G2PA 3OCWA 1AKEA 3RCBA 4B4OA 4C5CA 4CDRA 2A14A 4XRRA 4FHZA 5DYNA 3S1AB 3QVXA 4G4GA 4PR0A 2R5NA 3CVJA 4LPSA 4QBTA 2PEYA 4UFPA 1FRFS 4OGGA 5D5PA 2O1EA 1XBTA 2J08A 3EW9A 4ZYZA 5CB0A 3IH5A 1Q92A 4Y2YA 4G0WA 4YC7A 5BNZA 4HK4A 1GDTA 4TV9F 1FFBA 3EW7A 2VBGA 1KSJA 1RHRA 3OZWA 3AKZA 2VF4X 3W9SA 2V8OA 2O8EA 4HVTA 1CZUA 4B09A 3KX2A 4CKWB 3WLRA 2XWQA 1K08A 4EHFA 2A0UA 1AUQA 1PZNA 1CUJA 1IZYA 1JR3E 1KVUA 1W75A 4D3FA 6NULA 4U2GA 1ZR4A 1NT4A 2C3MA 2XRMA 3F96A 3CLUD 4PPQA 1LEHA 5JISA 1MZPA 1DARA 2Q21A 2ZYRA 2FFJA 2X2OA 3TI7A 3Q10A 4DQDA 4OU4A 2OLJA 1UM8A 2XT0A 4LCJA 1Y98A 3QX9A 4MVCA 5J4LA 1F7UA 3EGEA 5DW3A 3EOZA 2QXYA 2I34A 2IS4A 1WSDA 3LRXA 2Z95A 3JX9A 3LY8A 3OMWA 4I5IA 3VPGA 1UBHS 1YV9A 1NT2A 3FKSA 4CKZA 3HCRA 3HBFA 2C9MA 2DFVA 3I30X 4JB2A 1M6NA 3I45A 3S6JA 1JEYA 1RADA 4X00A 1CS0A 1W5EA 1JHRA 3DMGA 5CW1A 3UC5A 4D9CA 5ADWA 5KBYA 4Z51A 4MQBA 1KKUA 5IKPA 4FYHA 1ONBA 5AQ1A 4CF6A 3SQNA 1H6AA 1W6UA 2WVHA 1PZEA 3FDZA 3MT9A 1THGA 1U3VA 2O1SA 2PUEA 5IJXA 1DX6A 3L04A 1HLFA 1SHJA 2ON6A 4TN1A 3NBFA 1V41E 1EFHA 1RLIA 3ROPA 4Q4HA 3MWEB 1SKMA 4EG8A 1CQIA 4CLDA 1GRCA 1QB8A 3PEWA 2WWWA 2WC1A 4JUCA 4MWZA 5DTQA 2ZFUA 1F51E 5B5SA 1H8EA 1BRTA 4DCUA 3GRFA 5C8YF 3PDHA 1GO2A 3GEMA 3SGLA 3WLEA 1PZMA 1TRKA 2A9JA 1NW8A 2HJGA 4BNMA 4NR0A 2AN3A 3CA8A 5KCMA 1MU0A 3PWKA 5D1HA 2A92A 3K1AA 4HAYA 4JBXA 2AG1A 4R05A 3TCXB 4BX9A 4CW7A 3H8WA 2TRSB 3ZCSA 4QJBA 3VH3A 4GF5A 2RI6A 4IO1A 4YAGA 5BN5A 4BFXA 1K2VN 3K0SA 1GL7A 4R31A 5K8JB 4PVDA 1UIMA 3MCAA 1TZJA 3VUFA 1N5RA 3QSGA 3LY9A 1NOKA 2WHQA 3K0FA 3ZQKA 4ZCRA 1NMEA 3REQB 1C9NA 3UFXB 1GUDA 1M74A 1VECA 3PHIA 4NFYA 3COZA 2OB2A 4LVOA 4LBWA 2VATA 2P4SA 2P27A 4DRZA 2PKQO 4IGFA 3SC6A 3UW1A 2BJVA 3G9XA 3BX1A 4E6EA 3EH2A 3LC1O 1RRKA 1XTTA 2AXPA 3I61A 3LDFA 3SJAA 5FOVA 4ES6A 3STVA 5BWOA 3C8MA 1IULA 3V8VA 5BT8A 3S8YA 1IN8A 1KC3A 1RAEA 1PFVA 1QG0A 1YD7A 3K4QA 2GFQA 4BNTA 1GTSA 3VTFA 1CZKA 1JLLA 4LHVA 4OUKX 1LC0A 4P35A 4YJFB 5ITWA 3M8KA 2AX4A 3FTQA 4MUFA 3IJEB 2IYEA 3VMMA 2CXNA 1NR5A 2I2AA 2YDYA 3QLTA 4J2OA 5DHRA 3W9YA 1Z0ZA 4M3NA 1Y4DE 2JATA 3EVBA 2G06A 1JR4A 4WJZA 1QBKC 3WO1A 1U7PA 3JQGA 1N5LA 2YRFA 1WL8A 3ABSB 3P45A 2Z5FA 4IV5A 4LF8B 1AG9A 3PFBA 4AJKA 2PBRA 3JYPA 3K0CA 5IABA 4C7MA 5AOCA 5F35A 3OIGA 2QT0A 2QRKA 4MIEA 1QU2A 4HUQB 5H3CA 1J8FA 4J3FA 2F4VB 4GBGA 5KQLA 1WA5A 4URYR 1EGVB 5IN4A 4M76B 221PA 4ZT5A 1PYGA 1S9DA 1Q0SA 2HREA 3H86A 3R9XA 2HU8A 1GLNA 2XWPA 3QFCA 2WTEA 3DOJA 3JD1A 4DLAA 4PYQA 4QG7A 2CHVA 1T0IA 5JRJA 1K5DA 4HB4A 2HA3A 1VBFA 2X1VA 4JX8A 4M0UA 1YQDA 5H59A 5AIBA 4PG6A 3BBLA 4DCTA 4X90A 2EIXA 1YDGA 3V4OA 3NH6A 1T10A 1BXKA 2I2FA 4O1HA 5E7JA 1E99A 4BNDA 3GPIA 2GZSA 3IEIA 2IYZA 3LVRE 1LLUA 4K0RA 4QFMA 4ZQBA 2WYVA 1ILWA 1TU4A 3T3IA 4IIYA 2P9QA 2H29A 4WXYB 1N8KA 1HYGA 2OB1A 4RTPA 2ZYDA 5CLIA 4HNVA 4IMIB 1B0PA 3W7BA 5F33A 4OF4A 5JXGA 4QEDA 3PDWA 4II3A 4PFSA 1Y1TA 2FPPB 1L8OA 5LP6C 3UAGA 1YB1A 2C8KA 3TL3A 3QIVA 1JZTA 3ND5A 4NZYA 4RM3A 2FHPA 3EG9B 3DD1A 2QI9C 3KWLA 4BNJA 3QBDA 1F3OA 2LZ0A 1O97D 3DLCA 4BV3A 1U3GA 3DHEA 3Q8XB 1IN6A 4RHEA 4TUYF 3RS5A 3NHZA 1VQ1A 1OTHA 4B80A 4YMLA 3UBTA 1PJSA 3NATA 2ZXUA 4RYLA 4HH0A 1KY5A 2XXBA 1QIJA 2HNBA 5JTUA 3T7JA 2VN8A 3D4BA 1T0BA 1Y4UA 1CIPA 4HQRA 2OT3B 2Y4NA 1QFSA 3CN9A 1UP7A 2AUTA 3EWAA 3OIWA 4YREA 3C70A 4J7XA 5JADA 5JAOA 1B15A 3T15A 1OMOA 1LSJA 3L7LA 1V4NA 1E1LA 3DL0A 3WGKA 4G4SO 2EGUA 3N7AA 3S0JA 1P4GA 5AW6A 5C18A 3S44A 2X9QA 5JSYA 1GGFA 4MVJG 3VPAA 1OTXA 2D06A 3MUNA 1UKEA 3OC6A 4JI5B 2XKKA 3QHAA 3VR2D 3AT1A 1P0QA 1SQSA 1V11B 2ARKA 1XQ1A 1EINA 2WZBA 1P2SA 3MK31 4ITVA 4KOEC 3LWZA 3S28A 3O8QB 3LXRA 4RFVA 1KS9A 4JYAB 1VL1A 1AH2A 1S1MA 1XCMA 1XOIA 4HQKA 1L4EA 2F3UA 1OC2A 3TX2A 2AZ4A 4DR6B 3S2UA 3X2EA 2R6GA 1GA4A 1C4KA 1VPWA 1E9AA 2F1JA 3IUYA 1ECPA 3QLVC 1ADJA 1JR2A 1VI6A 4KLNA 3O3OB 4CUJA 2RGDA 2P91A 1N5DA 1QX3A 5B6PA 4B2YA 2VAVA 4AT1A 1OHHD 1ZXBA 1FTSA 4JYPA 5DDIP 1JV2B 2GPAA 3AJAA 1JDUA 4V3BA 5H70A 5IK2A 4AP6A 2GBCA 4LGVA 1SZJG 3BXGA 2YXLA 4GP7A 3VPCA 5ICSA 1MEJA 2DFPA 2Q2WA 3O4FA 4OK5A 5TE9A 4A2CA 3V4VB 2W2OA 1E79D 1SM4A 4BGDA 2VYCA 4W5JA 4HFMA 2JHFA 4G97A 4RD2A 3G5UA 1Z2CA 2XOXA 1QZTA 2VWGA 3WK5A 4EUSA 2GJAA 1E1RA 3U37A 4OHOA 2GZ2A 1SELA 4EAAA 3QVGB 1Y8ZA 1AXGA 1UBCA 2PFKA 2Q46A 3L7YA 3EQ9A 2OHVA 4PC7A 3WGVA 3F1KA 5EUBA 1R0SA 1TK9A 4XDHA 1YS9A 3MUOA 4H7HA 5ARDA 4BGIA 4XVUA 3IGFA 5LLTA 3RS2A 3TD9A 1Z8NA 2PLAA 3LQQA 3OHSX 1UPTA 3L8FA 1P17A 4OQLA 1YU9A 4ZJPA 1JDJA 2ZSBA 1GNTA 4IIVA 4D1YA 3ANSA 4ESHA 1HDOA 3QX8A 5HIJA 1CRQA 3WISA 4YH1A 2TYSB 2V7XA 1NVGA 5EA2A 1QDEA 3HZZA 1HNNA 3EY9A 4Q9NA 3SE7A 2LTAA 2UZ0A 1KWGA 5E7IA 3LPAA 3WL6A 1PS0A 3LQ1A 3DAOA 2X9LA 2XMQA 3IB6A 2K7ZA 3RFCA 5KC9A 1JZSA 1YB5A 3FCYA 2QOEA 3MRXA 3M33A 5F4BA 5IN5A 4OYYA 5EP3A 4MDYA 4Y2GA 4HH1A 1JYSA 2Q07A 4NMLA 2Q3MA 3GOQA 5FNVA 3OZBA 1NI3A 3KLNA 1UK8A 4TROA 3X2SA 5C5CA 2FMHA 1GZ5A 3PGLA 2OYRA 4QT0A 3TX6A 2OO5A 3OCUA 1FP2A 1U2DC 2P68A 2GK4A 2YYSA 3MD0A 4II2A 4MDHA 4XIIA 2UKDA 4YT5A 1N2IA 1Q6YA 1GAWA 1TA4A 4LQDA 2NPIA 2HN9A 4OHUA 3N6XA 3OQOA 1YO6A 4EEXA 2CV0A 1XT6A 4D9BA 3A3OA 3VJMA 4XJSA 4DA8A 1SHTX 1ETHA 1AU9A 1USWA 3NAGA 2Z6UA 2UDPA 5BNWA 2VPQA 3KZCA 4RTOA 2HQ1A 1HEUA 4QIHA 3FZQA 1XTVA 2V9PA 2WTBA 2ZWPA 3C43A 5K7SA 2VTBA 1UOPA 2I22A 2QQ5A 1J1IA 3UMSA 4HPJB 4R9NA 3TBHA 5J2UA 5I7WA 4JUDX 5T57A 5L45A 5FFMA 1M1UA 1VB5A 1WXWA 2FMXA 1E5DA 1Z2PX 1JIVA 5TSDA 3ZPXA 1UKCA 2XKAA 4QARA 3LRPA 3CJQA 4IY1A 5EWJB 3DC7A 3TQCA 3BHIA 3FB4A 4KE6A 1X2BA 3SICE 1A95A 1Z83A 2QXTA 1TB4A 1SVUA 2GAOA 4O3FA 4BN0A 3AVQA 3PQEA 2X14A 1FTYA 3BTSA 1K5PA 2HHHB 5FORA 1WUKS 5AJYA 1W52X 1J2TA 2Q6TA 3JD2A 2JHAA 2OZLB 3ELUA 3H5LA 3UY4A 1HZZA 2P41A 1XZHA 2YIMA 2P4EA 4J4TA 2WT9A 3NCTA 4RK6A 1A4IA 3V7FA 3FI9A 4WXMA 4Z9XA 1XPOA 1BA3A 2E4AA 3L6OO 5IJ9B 3P0JA 3ZVMA 1Z12A 3T35A 3ISJA 1Z0FA 4AJLA 4ZTUB 2AV6A 2QMEA 5KWJA 3G7NA 4YUVA 2VP3A 4PGGA 4ZC1A 2HMTA 2PANA 3DUFA 2Q27A 1WDMA 3ROZA 4H1WA 1U7WA 2VPTA 3TRIA 2EJCA 4XOUA 4IDNA 1RWXA 4TS9A 3UB2A 5KMGA 1QUFA 4FEYA 5DBFA 4C76A 4BN4A 1ZZEA 2X7JA 8GPBA 1RQRA 2VUUA 1GKLA 3I83A 2HTFA 2YJ5A 2C7VA 2PT5A 4JBHA 2PZBA 3DPUA 4I4TF 4EHLA 4MUIA 3RIGA 4DQUA 3M5PA 3LSTA 2Q29A 4UEOA 3RAPR 4Q1VA 1Z5ZA 4UFNA 5A62A 1TVKB 5AHXA 2F3PA 2IHNA 1QQ5A 3X1KA 5U4QA 2YOHA 3BGOS 3PNVA 4J91A 4BNNA 1LTKA 3C87A 3QUSA 3RTDA 3TLAA 1Y6JA 3Q5DA 1Y6FA 3H11B 2J6HA 1OYVA 1Z6ZA 5GOZA 5T8KA 1OILA 3U3JA 3N0TA 3FGZA 1T29A 2ODAA 3FSGA 3OTHA 4IJWA 4K26A 4LBYA 4M7OA 3RSZA 4DMMA 1EWVA 1JS1X 1G1MA 2F1IA 3NDPA 1B6TA 4YB8A 3KR0A 4BV9A 4OV6B 1KJNA 4AUKA 3W6ZA 4POOA 3D7KA 4I1VA 4QU0A 1PW7A 2RJOA 1NW9B 2I99A 2VPPA 3GX1A 4R16A 5DTRA 3MS4A 3DXXA 1ORWA 4GX0A 1I3CA 5KYKA 3KSAC 2Z1DA 1IHYA 4A8TA 5JZ9A 2OESA 1ZRHA 1W0CA 4MWGA 4EELA 4ZAYA 4JLMA 2XNKA 3Q0IA 2AFRA 2WF9A 4PGFA 1M8GA 1Q0QA 5ECGC 3RPEA 3KAPA 4EQ6B 1SBNE 3CF4G 2ZDHA 4TVBA 5BPHA 2WDZA 3AV0B 3N5KA 1Z56C 1CXZA 1LVGA 3LX8A 3REQA 4BTEA 1OASA 4I9HA 1ECJA 2HSWA 1R4AA 4JJ7A 1B23P 3GGCA 1K6EA 1KE1A 1G0OA 2IIQA 3MTQA 3SSNA 2IXEA 4CZ2A 4DSTA 4J2TA 3C7KA 5LUAA 4AECA 2X1LA 3USZA 1GV1A 3CY6A 3A6JA 3C14C 4EBFA 3CLUC 4HDQB 1B00A 2DUMA 3O92A 4KGDA 4ZRNA 2W4QA 5LP6F 4YJFA 2J30A 1FFHA 5F3DA 3EEQA 3NDIA 4W6ZA 5JE8A 1KZ6A 3AYZB 4ALJA 5C37A 1KK3A 4DCJA 2A9PA 4PQFA 1GGVA 2QI9F 1I1HA 3H7AA 1F0KA 1T2FA 4YMVA 4DIKA 5AYVA 3N74A 3PSHA 5CIYA 4AW9A 2IBTA 2OD2A 3WHPA 4N1AA 3Q88A 4U9IS 1RE1A 4OMFG 4UAGA 2JCSA 2NUPB 3QMVA 1P77A 1YCDA 2IVZA 1EJ6A 3G9TA 4TXMA 5MHTA 1TKCA 1A98A 1RFLA 2QLTA 1JVNA 3GIWA 3QPVA 2UYCA 4OHRA 1ZWKA 2HJ9A 5L3RA 5HK9A 1OT5A 2QUJA 1A7UA 1ZMBA 5DZSA 2Q5QA 5BXQC 4P54A 3ZCUA 2ONYA 5A5EA 2BEVA 4G01B 5FFFA 4F5ZA 2ZYGA 1YR8A 5FBQB 1P1BA 4G1MB 3D0OA 2QW0X 3TAUA 3V8NA 4DKJA 2D8AA 3GAMA 4WUTA 4WVLA 4MA5A 3M6UA 3HJRA 3ZWQA 2ACKA 1JT2A 4TV9B 5LQMA 1KAMA 4TQGA 3PFGA 3A1CA 2KS6A 2VRCD 2O2GA 3IT0A 3ZHTA 4ER3A 3TW4A 1KO4A 4R3UC 3PGVA 5I9MA 3QRWA 4RQAA 4C3ZA 3GH3A 1ZI8A 1CUXA 4F6RB 2WU1A 3K09A 4FVTA 4LSZA 1OKKD 1T34A 4X6UA 1M67A 4OQQA 1QHFA 1XWIA 3HKCB 4I4CA 1IXRC 5CNMA 2Y27A 3JR7A 4I8IA 1V6AA 5K03A 1Y8RB 5KB3A 3EH1A 1HE3A 5JD3A 3BJZA 3DMTC 4MIKA 4YAOA 3FRHA 4BMNA 2FPPA 3TVYA 1Q7EA 3TFOA 4MZDA 4U63A 4CDNA 5DTMA 3OX2A 5FLKA 5JLJA 2Y1FA 1FVXA 5DBIA 2LRHA 3TPZA 5D6NA 5J5CA 3GY0A 4RA6A 2HSGA 3BE5A 1X7WB 1YJ5A 1BX0A 3GJ0A 4MH0R 5G1NA 3TTXA 3WJAA 1UAYA 4BX3A 4F21A 3ZCRA 5BORA 2CLOB 2MIIA 3F98A 3DTVA 3THXB 3SF0A 4C9BA 3V5NA 4RPHA 1IQ0A 3M6MD 2FLKA 5I5GA 5LXTF 3RBVA 1ULZA 4YAEA 3HA3A 4DIFA 4C88A 1HBJA 3AJDA 5H4HA 5BWNA 2G09A 4LHZA 3ND9A 1FBTA 4WK0B 4RS3A 4UE2A 1QNFA 1T6YA 1UJBA 3JWGA 5KVVA 4RD4A 3I73A 5T4FA 2J9ZB 3ESAA 2FSIA 1A04A 2TECE 2PMKA 3DV9A 4FPXA 4G0VA 3QU4A 4OXQA 4J0CA 1FNSA 5CDGA 1U2PA 2PMWB 2VWHA 2YMMA 2QNRA 3GYGA 4LWPA 4B7XA 5HKAA 2W2QA 4KVZA 4EUFA 5C8YB 4DTIA 2P5SA 3OLYA 4KQ1A 3GFTA 3REOA 3FWYA 1E9RA 1RWNA 1VE3A 3VSAA 2Z1NA 2ZB8A 4AMBA 1ODFA 5ESDA 1NQVA 4ALNA 1RZVA 1V11A 4L8FA 1L4HA 4MYDA 4FYJA 1AKWA 4I9GA 1Z16A 4ZWNA 3O8QA 2DPGA 1VPEA 4J9UE 1OY1A 1U9JA 3NYIA 3NTUA 4YMSA 2QW8A 1SQ5A 5ALYA 4HXFB 2X19A 3VV2A 5JS6A 1S2NA 2Q6OA 4PCLA 4DXAA 4GOKA 4HNSA 3BF8A 2PH7A 2NO4A 2ZJ0A 2UVDA 3A14A 1YBVA 1DTWB 2HSJA 5F7JA 5G3ZA 3KTAB 4JZKA 1YSCA 1WPQA 4K9SA 4U00A 3GP8A 1PUIA 4QUGA 2XW6A 4XUCA 3T8YA 3VNAA 3DVAB 1TGVA 2VTEA 5JASA 4KLRA 1OFHA 3BMQB 2W6QA 2NV6A 3LKVA 4KMMA 4BE7B 1E96A 1GRQA 2XTNA 1F4LA 3CT6A 3HB9A 3L7BA 2DZDA 4ICIA 4MR7A 4A26A 4D43A 1UMCB 1TCBA 4ZPJA 1TYDE 1V26A 3A9WA 5ICGA 1K6JA 2O6LA 1TK2A 3BYZA 1NQXA 2GILA 2OQVA 1L5WA 2PGIA 3GGJA 4AIIA 2V3VA 1B2RA 1BW9B 1O96B 1PSWA 4GI1A 2CT8A 3VTKA 3WX0A 1D2MA 3JYNA 3I5XA 1KAGA 1KOJA 3CGWA 5REQA 4LDJA 1R0YA 5BW5A 2H85A 3EQ7A 3ASZA 3C39A 2QVZX 2IDJA 4Q3EA 5IKXA 3V7NA 1KIFA 3DVSX 3RC9A 1SPBS 1OR8A 1CY7A 4GMKA 2J3EA 3SJZA 1O97C 3SVLA 1U1CA 1MQSA 1PVVA 4F11A 1RPZA 4CUZA 2EP5A 3BTOA 1M1ZA 1SD5A 1I10A 2JRCA 3IKJA 4Z7QB 1VXOA 4OHVA 3G59A 5G1OA 4DMRA 2QN8A 3RTBA 4C4PA 4TKVA 3AUJB 1XEFA 3F4LA 4RQTA 4TMTA 3UWSA 1AHPA 3LDAA 3PNSA 4PPNA 4RYDA 3ZD9A 1N9ZA 3R6LA 3FKJA 3QFRA 1DC3A 2D0DA 2TMGA 3DEKA 3GJQA 4RJJA 2EQAA 2OILA 1XC7A 5K6AA 4HC4A 1YQXA 1ZPDA 2CCGA 3I52A 4MV1A 2PUVA 5KPJA 4TZ0A 3FDIA 1G17A 2XNHA 4MMZB 4QSMA 5FUXA 2I7DA 1YMUA 3N8GA 4NPAA 1H9CA 2VK1A 3IERA 2B2XA 2OO3A 1T25A 3IAUA 3NIWA 2ANBA 2BZSA 3NHJA 1A9TA 1JIQA 3UHJA 5DWQA 4G5GA 2OGSA 4L07A 3DHYA 5EIEA 2RE8A 3SNHA 2WP0A 1RQGA 4BMYA 1U2GA 5K51A 3CE9A 3ANTA 4OOEA 4KREA 4IUBS 1M6VB 2AFIB 2R3SA 1W9MA 4YV7A 1MHPA 16PKA 2Q49A 4LV8B 1QM5A 2FSFA 6ABPA 3IPCA 1Q0UA 4TMKA 4Z4HA 4HGZA 3ZCVA 1DRJA 3KQTA 2GASA 4OX9Y 4DA0A 3UAOA 4P4LA 3KSZO 5LMUB 2YV1A 4KQKA 1N2SA 3F5QA 1XNGA 2W43A 3H5IA 1J8QA 2GT1A 2H2IA 4ZICA 5A1JA 3ITEA 4Q1BA 3O9ZA 3H5TA 1I9CA 2CJXA 2YV3A 3MD9A 3M6LA 2B4YA 2VO1A 3O2JA 2AA3A 4G37A 4K2AA 5DEIA 3I04A 1G60A 3G82C 3B3JA 4MS3A 3GNSA 3OO0A 3WL8A 1G5PA 3R40A 4X71A 3GD5A 3V1LA 3VC1A 2JJ2D 5IM4F 5JZMA 4NXNB 4DPMA 3GHYA 4M1TA 1ST3A 1KFEB 2R00C 4PG5A 5AKXA 1Y9DA 2QRPA 1DBPA 3AR5A 4RS4A 5EEGA 5FPQA 5HFNA 5TXGA 4EARA 4ZJYA 5EWJA 3BRWD 3QHQA 4JS0A 4AVYA 4BEVA 2JFZA 3CVXA 3UMBA 1E1KA 5KJEA 3ONFA 4XWYA 4OGWA 2W00A 4BL5A 3S99A 2YDXA 3TGWA 4A6PA 2OHIA 4B34A 1KJIA 1VA5A 2OZLA 2MJLA 3PNLA 4M8LA 2P0EA 2VDMB 5B2ZA 3AQ4A 3EVNA 3FNEA 4Q6BA 6PFKA 1QO0D 2D13A 2UXCB 2BI7A 2IUTA 4QPPA 2FJ0A 3AJEA 1RYHA 4AXBA 2GN1A 1PGOA 2G72A 2ZWOA 4DARA 2NPFA 3EGOA 4P93A 1V4VA 2IP4A 3CNLA 1CUEA 3TL6A 3CSUA 1XJCA 4JXXA 3F49S 3M81A 5DULA 1X2EA 3CX6A 1SC3A 3I2IA 3OAAA 1NF9A 3QFFA 4IFIA 3RU9A 1N6IA 1YULA 1F0YA 2B4KA 2JS7A 3E70C 1OCEA 4XGIA 3VR3D 3SYNA 3OECA 1ZOLA 4B8WA 1T6NA 4MWSA 5HYVA 2PIAA 1X1EA 4KR0A 4GDMA 1DWPA 4XEUA 1VXRA 1YHNA 4QUIA 3AG6A 1RNLA 1QK5A 1N2XA 3KB1A 3KPJA 4QXOA 4TSFA 3SEAA 3B9PA 3OPYI 4XB6B 1SIBE 3DE7X 4DY6A 1YOBA 1FJXA 2FR8A 1K8QA 1QG6A 1MD9A 3HNRA 7AT1A 2RB5A 2ST1A 1TVKA 3HB5X 5J5VA 1SCQA 1AF7A 3HGQA 3WDSA 3AKDA 2M6LA 2GZ1A 1HSOA 3JVVA 1ZUWA 1N6LA 1R16A 5KEIA 4KVFA 1Z7BA 3DCIA 4IIHA 2NWQA 3JWPA 3ST7A 1KVTA 3DNPA 3NH9A 4CQMA 3EZLA 3GRYA 3ZU6A 3NORA 3GGGA 2KE5A 2G3YA 3O93A 4CN8A 2SHKA 3ILSA 4KRXA 1X15A 3FBWA 1U1EA 1YI0A 3F6RA 3MILA 2YBEA 4TTPA 1C8LA 1U31A 4P36A 2GAIA 1TD1A 1KO8A 1OLUB 2WNHA 3MGKA 5DMXA 3S1LA 4QDUA 1T1IA 4JFRA 5L3ZA 4DUPA 4ZZ0A 4Y6QA 4BV8A 1UT8A 4BLVA 1TT5B 4FKMA 1Q1ZA 3QU5A 1ICIA 4KAFA 4RSRA 5EJ5A 3I8XA 3MT7A 4ML3A 4PXYA 2XGOA 2YXBA 1H6CA 2VQFB 3P71T 4Q3KA 3S5UA 5AK5A 3PI7A 1KI6B 5LQAA 1QC5B 3TQQA 2RHBA 4Y98A 3ZK7A 2RHCA 5KTSA 4MQLA 1Z62A 4D3ZA 1GQRA 3O1IC 2ZCJA 1WV0A 1J5XA 2BSQA 1KXZA 2YV4A 4K5QA 1MA0A 4XUEA 2XUAA 3IJ5A 2ZUBA 2OP0A 3O4VA 3JRWA 3P1JA 3FWNA 2I1LA 1D9ZA 1C1HA 1PJAA 3M9LA 3LC0A 3MTIA 4M98A 4N39A 4PLTA 4RVHA 3PDUA 4GSLA 1UZNA 5I9SA 3SYKA 2I1QA 4CMBA 4DZTA 4QGHA 4H16A 2XYRA 1M2VB 1U7DA 3FUCA 2XGSA 1C1XB 5DP1A 1TGYA 2XV1A 4EJ2A 1R50A 4HQOA 3DZJA 4OPMA 3DYVA 3B9BA 4J4HA 3C74A 2R8XA 4L4UA 1A8UA 5IT9A 4FFRA 2QWXA 3M6IA 4P82A 2B69A 3P9SA 4U2FA 3MYYA 4RH0A 5LQSA 3INGA 4UVIA 4HNTA 2ZBQA 1LI5A 5AOVA 5E9AA 1KAEA 3M5CA 4ZI3A 1DC5A 2Z5VA 1FP6A 3K1JA 3ETGA 2Q5LA 2Z08A 1J0XO 4R1OA 1U0HC 3L4EA 1GGHA 2VJCA 4AKGA 2OE2A 4HB2A 2Z83A 4O08A 1P5FA 4X1OA 2ESRA 2OV8A 3IT3A 5JUWA 2FPRA 1PR6A 2IT1A 4KO8A 4OY3A 3WLFA 3QVLA 3ZH9B 4YJHA 1DJMA 3GZNA 4FFNA 4IG4A 4MXDA 3G13A 3T99A 4FCCA 4U0KA 1YKSA 2I03A 1QYDA 5LBIA 1XZEA 4HO1X 3A4LA 3ES9A 2HDOA 3L1JA 4DL9A 4ZVMA 3AY0A 4L2IB 3N75A 5DOZA 2G5PA 1FYVA 1YQ9A 2APJA 5CLGA 2WHPB 1VJCA 2O4CA 4BWGA 3R24A 2BKVA 2ZM6B 5AI0A 3MRVA 1AX9A 1T1GA 4N47A 3UT5A 2E1RA 3WMXA 1W46A 3R6TA 2WKSA 3K70D 3I09A 1QHEA 1GCAA 5T5QA 3RRBA 3F2IA 1INLA 3CNOA 3L7KA 1H4QA 1SKYE 4F6RA 4ENRA 1LZLA 1RLUA 1RZ3A 2WIJA 3PUIA 3DVRX 4AM8A 4NFHA 1RKVA 1AM4D 1K8ZB 3HKCA 4N3CA 4TYQA 2UV8A 1C2YA 1P1IA 4P3KA 1Y8RA 1ZD9A 4F2DA 4ZYXA 3I04M 1TQDA 3SXUB 5M2QA 2B8JA 1C3LA 4JVLA 3P8ZA 3L1VA 3FJOA 5LN1A 1V9LA 1MX5A 4XA8A 1WY5A 2G8NA 3IAAA 2AMJA 3NVMB 4TRMA 5ALQA 1A2QA 3GLHB 3CJRA 3W78A 4DE5A 2OV6A 5IMSA 2E18A 2G9ZA 4PONA 2GOYA 4RVFA 2W6JD 1LJ8A 1X7WA 3IYLW 4JC0A 3KQNA 1TJNA 2G6TA 1ZKMA 5KDOA 2V8BA 1XN1A 1SXJD 1V8OA 1RYZA 5JXJA 2R9VA 1EKXA 2CMDA 4TTQA 1AQIA 2RCYA 1RC0A 1T3HA 3DE5X 1XEAA 4FIZA 4I4TB 4MQ6A 2GVDC 3MW8A 3UO8B 3JYOA 2H7YA 4M8SA 4AU1A 5ALFA 4QNRA 3HVRA 4A0QA 1JEDA 1DJNA 4KQHA 1D8AA 3R44A 1GYRA 3ROEA 2COKA 5AXDA 3ZNNA 1ULHA 2BMWA 2HQSA 3F78A 4ILEA 4ZGBA 3KD2A 1PJLA 1TQ6A 3VZDA 3PQ8A 4G0YA 1EFRA 3DBLB 4HX2A 4RZ3A 4E09A 1L5YA 1Z45A 3SFTA 3ZIUA 4R1UA 3TQSA 5C8YA 4EW2A 1YRWA 3ORSA 1K8XB 3Q8WA 3QXXA 4YHBA 1KNXA 4B85A 1STOA 5AVOA 4KGVA 4UW9A 2JFUA 3SU8A 1E7RA 2VJQA 5J58A 4I36A 4L9RA 1AXEA 3H2HA 3HSYA 4HGPA 3QBVA 3OD5A 4QGBA 4GFDA 4XZ3A 5A6SB 1R3DA 1UANA 1USVA 2YN2A 4CV0A 3I3OA 5E4YA 3HUFA 4MYTA 5BOVA 1YRAA 3OCVA 1WZIA 1L6RA 3KQHA 3D7RA 5FEUA 4DLWA 5JH7A 1NJ8A 1JZQA 3H8SA 1ENOA 2BEJA 2XY4A 5IASA 3VAZA 2XMSA 3BZUA 3M4ZA 4LGYA 4Z0TA 2VJBA 4KAAA 4CG2A 3LT5A 3F3MA 1UEJA 3Q6MA 4V0KA 3V80A 2Q4RA 4KXVA 2FEWB 1U0TA 3CSDA 2FSHA 3W4IA 2OK7A 2ZCVA 5INTA 3Q1LA 4ITUA 3HVHA 3EVAA 4LXUA 2XKJE 5CDSA 4G5OA 2P6NA 3ROGA 3JTMA 2C94A 2HT6A 2J32A 1NNI1 5FBHA 2NU7B 1UMCA 2DBZA 4FNOA 5BSUA 3KTOA 2CJYA 4I4LA 3S70A 5LP6B 1EBFA 2GHIA 1JH8A 2XCRB 2CXOA 3QX3A 1SPXA 4L75A 4U2DA 1KH1A 4QYXA 2X2PA 3T7AA 2ONKA 3OZDA 1BW9A 1O96A 1UWLA 4LDQA 1BXRB 3A0RB 5C4IA 1YKGA 3OZRA 3ND7A 4G2NA 4CLRB 3PT5A 2P11A 1DBVO 4F96A 2ZWVA 1AQYA 1RMYA 4R01A 1S2OA 1R6DA 2IRWA 8AT1A 4JKYA 5K0EA 3D6TB 4LMPA 4ETWA 2O8DA 2ZUDA 4HDKB 1P2FA 4O4LF 4ZVSA 4UNQA 1ZJZA 4P80A 1CUGA 1QCZA 3K5PA 4D9JA 2PSDA 3T38A 5SYNA 1BAPA 2FI1A 1IHDA 1X8LA 4K1XA 2FQWA 3MWGA 1BHSA 4YCLA 3KB8A 1UODA 5JY1A 1KRXA 4EG3A 1T4BA 1XRRA 2DWQA 3X0DA 5FPPA 4KAXA 2EARA 1NHGA 3O84A 4XX0B 4I8XA 4AMUA 1Y1KE 4MUAA 3RGWS 3R0XA 3ADDA 5G53C 2GPTA 2FY8A 4MGIR 4ZRMA 4ZAWA 1KBZA 2ZDQA 2QR2A 1N7IA 3B1ZA 1NXQA 3HGTA 3W2IA 1S8AA 3V7UA 2YHAA 3QVOA 4LSWA 1L7DA 3TSYA 3I0MA 3VNVA 4P3PA 2ZSFA 4LRSB 4B6OA 2L82A 1R88A 2B4TO 4KKVA 4LZJA 1QYRA 4NYMQ 4O0LA 4P86A 3NX4A 1AN0A 1VSUA 4AL4A 1P5JA 1V96A 5ITSA 4U0JA 4EVIA 1X8KA 3PGA1 5F7XA 1K86A 1XNJA 2PHZA 4NCHA 2H31A 3DH0A 4YP6A 4PZPA 4QHYA 3URMA 3DB1A 4CM1A 3ZDQA 3U61B 1IZ8A 1M6VA 2AFIA 3OT5A 4TPKA 2BFMA 4B6FA 1ODKA 2CWWA 3MQ2A 1R5JA 4MLPA 3GLKA 2BHLA 1WLSA 3DE3X 2O3SA 4EB0A 2PKXA 3PWSA 3TF5A 3D43A 5IT0A 4OHYA 1NKVA 4JHXA 4PLGA 4RJ2A 5T3UA 1BWPA 3I9KA 3LYHA 1GWNA 2ODQA 3HP1A 1CEXA 4YLGA 5F1KA 4C07A 1NFFA 1PR3A 2OZKA 4F46A 3EDQA 3ISVA 1KEZA 4WSOA 4N6OA 3X1JA 1X9IA 3W3AA 4PYKA 1XVUA 4TUYA 3O8CA 2QL9A 1GKUB 1K92A 3HADA 3L5OA 4S12A 4AZ0A 1A69A 2C4TA 4DDTA 1MC8A 1OIXA 3CEAA 1CUIA 3G8DA 1GPJA 3PHLA 5LXTB 1ADFA 1PK9A 2DUUA 5EJIA 5TJ9A 2P7IA 4NF2A 2CLEB 1KFCB 3OY7A 4GZMA 1AN9A 2F43A 2I33A 1JECA 1CT9A 1JQ3A 4RABA 2Q7OE 4BYGA 1TX4B 2AHOA 2XVAA 1O6CA 1ITZA 1ZD2P 4C4XA 3V1YA 3IXQA 4Q02A 4WJLA 4ZI7F 4V1CB 3OCYA 3VJKA 5CR9A 3HCBA 3LP8A 4JBYA 3I2YX 4PV7A 2A1UB 5TIIA 1QQTA 5FQNA 1YZFA 2GNAA 5KYVA 1PJZA 1DBRA 1HURA 4GKBA 5FRDA 1HSZA 2IEAA 4KWEA 2D62A 1I80A 2AS0A 3UATA 2C97A 3OURA 3BUSA 3NHUA 4GOMD 3QP9A 4TLEA 4EUNA 4HDAA 3AOGA 1JALA 2QVLA 4LJSA 5THKA 1YFZA 3DZFA 2YWRA 4IF4A 3TR6A 2D0IA 3S4YA 3ZH2A 3C6XA 4DV3B 3RSSA 4E7OA 2AFVA 3QEAZ 2CXXA 2Q6IA 1YWGO 1OYWA 2EG5A 3IODA 4WW0A 4PHGA 2XA9A 4KYUA 5U9CA 1J1ZA 2JRLA 1ZYUA 4HEJA 4HZUB 1XALA 1QE3A 2NAPA 3TZQA 3CXRA 4R9SA 3NPMA 2X9GA 4NFSA 5CT6A 3WXBA 1CQPA 1U7UA 4WVFA 4BU0A 2IGTA 5FJJA 1NN0A 4TKUB 1WBBA 2QRNA 3HY3A 3L0DA 3A27A 2O7RA 2CV2A 4IIJF 4PFKA 1R5NA 1VLHA 3OKPA 2E4XA 1Q3HA 4C4TA 2FPKA 2QN2A 2GJ4A 2OEPA 2Y2VA 4R7GA 4YRRA 5D85A 1VKZA 5FB3A 1FSFA 4WBSA 5GOTA 1NG9A 1Y3DE 3A58B 3KLOA 1VMAA 2XUHA 1REQB 2Q50A 2JGNA 1ANKA 2PGJA 3D3NA 3QHPA 4NCKA 5ALLA 1YB6A 9GPBA 5F9FA 3B20A 3BIXA 3K0KA 1Q0PA 1Z4PX 4UULA 1OLOA 3T9DA 1XZBA 4EJ6A 3LUHA 5FL3A 1JWLA 4AZ3B 5LL6P 1J2JA 3OPNA 4P4SB 5BVHA 1FDSA 2ZZMA 1G41A 3JY6A 4KR9A 5JCJA 1OLUA 2WUVA 2I7VA 1UJMA 3HNPA 3ZWCA 4NV1A 2KSQA 3OJCA 4PIVA 2CBGA 2V0NA 3O6VA 4FHDA 3IDSA 4NTZA 1A2KC 3UA4A 4DAEA 1F6WA 3QUQA 4F97A 1FFYA 3WV5A 3FIUA 5FTJA 2OCBA 5EKUA 4MVYA 1M9NA 3LDGA 5KQMA 2BM8A 2WD8A 2PLRA 3B7GA 3MAAC 1QC5A 2ZJ7A 1T0JB 2J0QA 1ABBA 3PHJA 2VTVA 1R0XA 3DC2A 3TPCA 1FW6A 4EKDA 1Y5NA 4B9EA 3U48A 2O7VA 5AUPB 1FU8A 1LTHR 3LL4A 3ACDA 2PO7A 1T26A 3PFHA 2CHQA 4JYMA 3SOPA 4E4YA 4CL0A 2NZUG 5LM3A 2NZYA 1WMDA 3GVPA 4B79A 1N3YA 4IJVA 4QYIB 1GGEA 4ILKA 1M34E 2EBWA 4JP5A 3T4EA 3Q8LA 1FU7A 2X0KA 4IV8A 4N18A 1M2VA 1C1XA 5HCUA 3NHAA 1ZONA 3JU3A 3Q9SA 1WBDA 4H35A 3ZIAA 1KFBB 3WGYA 2VTDA 3HBMA 1G3RA 1ZCBA 1YMQA 1RVV1 1GLGA 2PMCA 2Z4RA 1PDWA 4NQRA 3ZLVA 4AG6A 3VGPA 1EZ4A 4D0SA 1UJ6A 2O8BB 4HADA 3BQ9A 4UTRA 1XTIA 3DBIA 5D7NA 2QNBA 2XDQB 3NTLA 2V4ZA 4NL4H 2JBWA 4RZQA 1Y7HA 3MLAA 1SVWA 1NVKA 2QAGA 4JEMA 1I1NA 4OUDA 1NXTA 3QA3E 4A82A 5BVGA 1R9GA 1RTKA 4DUZB 4HP8A 3P2YA 4XWTA 2ZULA 1OGYA 2YX1A 3CUEF 3DF9A 2FPSA 1IHPA 3UJ3X 5KOJB 2WMDA 4KZPA 5BSMA 1QE0A 3TXYA 3HCWA 2LD4A 3REGA 4EVRA 1ONPA 4EI7A 3EVEA 4QBIA 4DT1B 5CFLA 4MVJE 3W5IA 1L3IA 4PRLA 5AW9A 3U44B 4TLCA 1JVSA 2IY7A 4MQEB 3ORRA 4L2IA 1O08A 4FGZA 4OATA 4V0ME 3LLVA 4B2PA 3U09A 4CPDA 4W5RA 4A0SA 4QM6A 2B34A 4Q24A 2WHPA 4MA4A 1RQPA 4D5GA 1T5LA 1QP0A 2V6MA 2AOTB 3AEQB 1D7AA 3FVWA 3MJRA 3VBCA 1U0OC 2G80A 3VAYA 2YXDA 4DA9A 3O4RA 4LC1A 1BROA 2XNDA 1P0MA 2QHXA 4XTCS 4E5KA 5LC1A 3W6UA 1ECLA 5DVZA 5EPEA 3WB1A 4X7MA 4NYMR 3ZU4A 3O4GA 4C6SA 4LKRA 4NBSA 4JLDA 2BFBB 2F59A 1EFVB 1SCDA 2RHRA 3LQKA 2M6KA 5EJAA 5B4VA 1KRWA 2N9UA 4K9KA 2GLUA 1RWWA 2G67A 1E9VA 3CW2A 3SXUA 4X85A 3AHIA 1SZPA 2WY2D 2XZOA 1G8GA 1SKUA 5CLQA 4AQ7A 1DC6A 2RHMA 4FGLA 1AUPA 5BMOA 5JAZA 2Z8YA 4ERNA 1WPRA 3MCZA 2JFOA 5CFRA 4Y6PA 2V6FA 3C24A 3HHPA 3WBBA 3ZCQA 5JU6A 2QYHA 4K9NA 1YBHA 1PJ8A 2QR3A 2R25B 2HMYB 2GKSA 2I29A 3NT2A 1O0BA 1MDFA 1LSUA 4GGOA 4TYWA 4RPKA 2IZ1A 3D3WB 1L4MA 1ZD5A 2VBFA 3FUVA 3GJ5A 2FFQA 4I4TA 4DQXA 1A96A 1NTOA 1K6XA 1ZIDA 2XR1A 3GXOA 3NDRA 4WNAB 2Q2NA 2BKAA 1DBQA 3EXIB 3QH4A 1M2OB 1E2JA 2ISQA 3AEXA 5ARCA 4E30A 3U4QA 4NCAA 1FJ2A 3CVVA 2GCGA 4INJA 3R3VA 3WGMA 5HQ3B 5F7OA 3O8RA 1OLSB 4PFJA 1GVHA 4JC4A 3NWPA 2FAXA 1T0HB 2JFPA 1XDWA 5H83A 1JR6A 1O7JA 3I8SA 3DBLA 4XUDA 4YGXB 2N46A 3GRPA 4RJKA 4UJ5A 3ZCPA 4B3FX 4EMUA 5A4FS 2YUTA 1CR4A 2V96A 4YMGA 1DXQA 2B7LA 4GOOD 4KQ6A 1JTFA 2FA9A 2WP8J 2AEEA 1PR5A 3VPFA 1R12A 1BJTA 1R8QA 3UNXA 1U6IA 1BFUA 1GRVA 1WMAA 2EDCA 4HDRB 5KSYA 2Q5CA 3LC7O 4BOYA 5IHXA 4NMHA 3PXAA 5A6SA 2DKOA 3LLUA 5FL7A 3UKDA 1XLWA 4HN9A 1WU8A 3L6DA 1S3FA 3FCAA 4EYKA 4W1PA 3EQ6A 1FNDA 2ZSHA 1ZUNA 2GGSA 2REBA 4CQLB 2PD4A 2VT2A 1JHZA 1E9FA 3C2QA 2XXJA 4F5YA 4D57A 3K9BA 5EQFA 5PNTA 3DFZA 5A5GA 4PF1A 3EQ2A 4B3BA 4L08A 4GW3A 4EAQA 1WETA 2IZ6A 3C5HA 4D4MA 5BWCA 1TCCA 2MR6A 3K70C 1ZJ6A 5LQRA 2NU7A 3O9VA 5BUZA 3E84A 5PGMA 5BRAA 3TW8A 4BLUA 4RWZA 3GEIA 5LP6A 3JYQA 3CZAA 3W6NA 4ZCLA 3H99A 1K4YA 1A72A 2Z1MA 3ZEAA 2DKFA 4FWBA 3CPHA 3KVOA 2NN3C 2GN4A 3OM8A 4QYWA 3X43A 5JAIA 4UEJA 1DEKA 4RKYA 2LDXA 1XRSB 3X44A 4CLRA 1VLMA 4EFLA 5I4IA 3B6KA 3T4UA 1R0BA 2DECA 5IVPA 5IS2A 4FNAA 3SIPA 2NVUB 4W5QA 3DDSA 4BXOA 3HO8A 2I4TA 4YFYA 5JNTA 5EIHA 1SCJA 2P9YA 4NG4A 2P7HA 1Z82A 5H8WA 2XB4A 1GSHA 1HG1A 4BVEA 3G9ZA 3HFJA 3LZ6A 1SXJC 4KQIA 4EHKA 3H5WA 1FU4A 3PR1A 1U5BB 1BHQ1 3GEPA 3H1GA 1ZK1A 4ZQFA 1GSOA 3HC7A 4F8JA 4DZZA 1HR0B 3GR6A 4XYLA 3PEYA 2QXUA 2QLMA 3RVRA 1CF4A 5IC4A 4XX0A 1L4YA 1ZGCA 3ZQ6A 2G63A 3DM5A 1E0AA 3JSAA 3R41A 3ANXA 1U3UA 1RSZA 3L1KA 1B43A 1UT5A 5B1HA 4RWEA 3RB8A 3HWSA 3E3OA 2JIRA 2PGLA 4WBNA 3BSYA 1ZM2A 3I5UA 4LY9A 1ISFA 3K05A 3N53A 2RHTA 4D98A 3WWDA 4HDNB 3WVNA 2D3WA 1UCFA 4XGRA 4U9UA 5MGBA 1U3WA 5CAEB 5F5NA 1IFXA 3HJHA 2ZIZA 4YRMA 4LOKA 3CRW1 3B3GA 3DA8A 2YFQA 3HMKA 1M6EX 2O0KA 2QTLA 3QLVA 3LCRA 4XEHA 4YJ2F 3VDMA 5AVZA 4DILA 3TW6A 4O8CA 1ZN7A 3HI6A 4D6XA 4J16A 1A9PA 4OXRA 3RD5A 3PE6A 4N7JA 2O0MA 5DYIA 5CVCA 1LV7A 4CQMB 5IULC 1HNWB 1E2UA 2PS0A 1EQUA 1PQUA 4QQKA 4URHA 2AE2A 2DFNA 2WAAA 1QSGA 1CUSA 3ROTA 3D8TA 1TMGE 2QY6A 3SKYA 3K30A 4IUCS 2OC4A 3OBIA 4ARBA 3COJA 4ME6A 1FFDA 2E5LB 1WKCA 4MVJA 4KR7A 4LXIA 2ACEA 2OXFA 4V2UA 1XMVA 2HA5A 2DUWA 5CW2A 4BWFB 1Z26A 2WB4A 3D6AA 1E9SA 2FP4B 2PX6A 4IICA 3ENNA 3QWBA 1NZFA 1F12A 4PYRA 3CV3A 3F9IA 2CVZA 2GQ0A 2J9YB 1U98A 3AMVA 5ELMA 3ZW7A 5LXTA 3DCJA 3PLRA 1J1UA 1JDPA 1J8YF 4GLJA 2HB6A 3STWA 1YR3A 1I3LA 3TB6A 4OA8A 3BHNA 1W9HA 3AR8A 4GHWA 2VZLA 4D4JA 2HQRA 2FE4A 3NAMA 1NUTA 1ZD1A 2X7XA 5ALHA 2DPXA 4HMOA 3W4JA 4F38A 2FZVA 3WIBA 2A1UA 1Y5IA 2ODEA 3N0WA 4RQUA 4KHPB 1TQHA 1VKRA 4Y6GB 3RBXA 2SICE 1J2EA 5H3LA 1O4WA 3PGMA 2O20A 3RIYA 1QWOA 2PLNA 2Z8YM 5CLFA 4LSMA 4X20A 2B2NA 1K3TA 1R9JA 3RVMA 3PQ2A 3GMDA 2DH5A 1DIAA 4GRIA 1DFIA 4BN5A 3NLLA 4G67A 4FJ0A 4P31A 2YCLA 5K0TA 1CQJB 4DUYB 3W8RA 5BQXA 2XNCA 3CZPA 2VJAA 1Z13A 3D4NA 3PCXA 3QEMA 4FSHA 4B71A 4B73A 5EJ9A 1NF3A 4F0JA 1CIJA 4A6EA 1T5HX 4D6PA 3H8JA 4UPVA 2C9YA 2NSHA 2BAGA 3FCUB 4ND6A 2XOKD 4Y6SA 5TPWB 3CNEA 4ZAXA 2BTOA 2Q4EA 4ND2A 5HTKA 5IF3A 1V3TA 2F2TA 1PUJA 1XG5A 3GQVA 4J0JA 4WCVA 4K28A 3B2EA 4TTRA 1P4JA 4J76A 2ES4A 3E9DA 4XYMA 4TKUA 2XGJA 1KKMA 1ZD8A 3LX5A 1YVPA 2VHWA 2A8YA 3WGHA 1N1EA 5JC1A 4DWVA 2EERA 2Y6VA 3GEGA 2CXHA 4HOYA 1BDIA 5DISB 2ZJ4A 4R2LA 4OJYA 1FW8A 1L4NA 1H1TA 3PXUA 3HA2A 1REQA 3L8EA 4BO4A 5IYZA 4TZKA 3F90A 1TCVA 3ZBPA 2FUG6 4EY8A 1FK8A 3KSUA 2W0MA 3HV2A 4LRUA 4ZOLF 5AW8A 2ZYWX 2J3MA 13PKA 1XHFA 2AUMA 4AZSA 3I6ZA 4XLZA 3HUDA 3UQYS 5E7QA 1E3TA 3OU6A 2N0SA 4LZAA 1Y7LA 1P2BA 2ZJFA 1SCBA 3CYFA 1TZMA 3GT3A 1RCTE 4O4LB 721PA 4B3TB 4DR1B 4M0CA 1QMGA 4ARIA 2Y2UA 2QM7A 4PBTA 3P27A 5KYYB 3OM1A 1JX6A 5F2OA 1G8JA 3VDRA 4BNYA 5KVCA 1F4PA 1GR1A 2O0JA 2QN6A 2ZITA 3PHCA 4LV6A 2ZPUA 5LYJA 3LM8A 2WPDA 4R98A 1SURA 3PC8C 4PTYA 5ES4B 3G49A 3MELA 1M5TA 3LTEA 4NOLA 4W9NC 1X7YB 1OH7A 4QXMA 1JMKC 3BIFA 3PU6A 2FW9A 1YRYE 4EA9A 1NVTA 2P4QA 2OCLA 3BAZA 3P9KA 2C7OA 4PSAA 2ZI4A 3VISA 1A5SB 5EESA 3QNMA 3F6PA 1BD4A 1FFSA 1XEWY 4N5IX 1PV4A 2J3KA 3NBUA 3BWBA 1PE0A 1J6UA 2EZUA 3CB4A 3TJMA 3WA7A 1QLJA 3DT8A 1R66A 3C3WA 1JPJA 1Y9JA 3BKWA 2NO6A 3C5VA 3U1TA 3RRXA 4RENA 4E13A 5FJIA 4MTLA 3MMXA 3AK4A 2DBQA 3HNOA 3OE1A 3GFVA 4HXEB 1W6RA 2CYCA 2OHOA 4KN8A 5JWHA 4YT8A 1ZIPA 3HSKA 4Y2PA 4I4NA 4FP9A 5F12A 3SEQA 4OMDA 4H6XA 2HTEA 1H1DA 1PFWA 2XDQA 3M4YA 2PBFA 3QF4B 4MW5A 4V2IA 2XADA 3JZDA 1KSGA 4ATNA 1B0ZA 2JCGA 2Q9AA 4HAWA 2VCHA 1YR6A 5ALSA 4OI0A 3JVUA 1BRMA 1RXUA 1TVMA 1Y3BE 2X86A 3AHFA 1UMBB 4RNCA 4K9RA 5JAHA 2HBQA 3JAKB 5AUNB 5KS2A 3NIDB 1ZW1A 5EC8A 1O6GA 2A33A 2Y93A 5KOJA 3D3QA 1QKJA 4OLAA 2ZYVX 4HFRA 1HO3A 1E6CA 3CUVA 3DV2A 4MRMB 1VDZA 3D6UA 1RRGA 2QMOA 4OJNA 5BT9A 3ZC3A 1VI5A 2YOFA 4DT1A 4L9AA 1T43A 4MDEA 2PSSA 4GSKA 4MQEA 4IQ4A 3NG1A 4ND4A 4LJ8A 1Z5WA 3QPWA 1NPYA 1G8KA 3UM9A 3ZWKA 1PF7E 1SZDA 1CRWG 1T3SA 3AFMA 4YRJA 2ZR8A 4ZI7B 3HI4A 2AKAB 3K4HA 4OQNA 2AOTA 3HJAA 2WWYA 3FJYA 2HCFA 2XTZA 3HWX1 3PJFA 1P6XA 4CIXA 4EMBA 2ZE8A 3LTNC 4L8LA 1S0UA 1S7CA 3IJRA 1KZ9A 4LRTB 4AG5A 4BNKA 2FSSA 3D2LA 3HN7A 5EJ7A 5KTKA 5EIXA 4MW1A 3HYNA 5MDHA 2R6FA 2BFBA 3N7TA 1EFVA 2WWHA 4MVJM 1FP1D 3KTDA 5EZYF 1M83A 1V1MB 5TF0A 2VK8A 4G5QA 1I33A 1JIIA 4LXXA 3KLPX 3GLTA 5SY9A 3QFSA 5EY5B 3KDSE 4A3SA 4Q7QA 4LJKA 4R2MA 1GL9B 2W2MA 5MGNA 3SQMA 1Z7EA 2YJNA 2DBRA 1WVGA 3ER9A 4D9KA 1U2QA 1HZJA 2AMLA 3KQQA 2V74B 4YS6A 3DKIA 3IVMA 1M2KA 1KBOA 1OLXB 1W85B 4N3AA 1Y1QA 1JWBB 2J7KA 1CF2O 3D3WA 3OEWA 4LYGA 3U7RA 1SMKA 3GW8A 3ZIDA 3T34A 1D8TA 3OQPA 4A2PA 3GL9A 4LZOA 1EK2A 1IB6A 3ZWMA 2OFWA 4IIJB 1UJCA 5A9TA 2Q45A 4XIYA 4NOJA 2B1IA 3ICVA 3HXTA 4PIPA 1W76A 3T7IA 4B6GA 5CA1F 5HQ3A 1DOHA 1U5AA 3CF4A 3TOCA 5K2OA 3D4IA 3P97A 1FVFA 1TL7C 2PD3A 2BD0A 3LVQE 5L7WA 1RYNA 4DLZA 1P60A 1NUSA 2EZ4A 1GGKA 3D8SA 2CV1A 3S8MA 2CLDX 3ZLTA 2XGGA 3L0OA 1MGPA 2IW1A 3CHYA 3WIUA 2WJ6A 3GRRA 1GFSA 5CB4F 3DTTA 4KXUA 4TZ6A 1LZKA 1ONOA 4J29A 2QUBA 2ATEA 2N3ZA 3MF4A 4HDRA 1XFAA 3N8NA 3BXEA 3MWDB 3FBGA 4Z4FA 3OP4A 4RIIA 4DIMA 1Z35A 2P2ZA 2ZU6A 3PKZA 4UOZA 1RKXA 3ZS8A 1SOVA 4ZQHA 1P39A 3IV7A 4WN9B 2Q4TA 5KCZA 1K8YB 2IY8A 1E32A 1G98A 1OFGA 2CNWD 2ZRLA 3DZIA 3HSSA 3IQFA 3SEFA 4A0RA 2XRYA 4EI9A 1YQUA 3OJ0A 1KJZA 5DNVA 1JQLB 1NJ2A 4OLFA 5CLJA 3C85A 3TE6A 3TQTA 4CQLA 2ZATA 1HFJA 2JCBA 4ALIA 1YIOA 3DR5A 1A4RA 1UPBA 2WFAA 3M6WA 3N8HA 3QGMA 4L4ZA 4LA4A 4MWEA 5IVHA 3IUNA 2GXSA 5SZHB 1QQBA 4U2BA 1QTQA 1JQBA 2H11A 1JHDA 1QHIA 3IBSA 1JJIA 2IE0A 4RDCA 1SC6A 1TC1A 1ECGA 2R8PA 5D51S 3TLKA 1NW5A 1E98A 2M32A 3DMTA 4YBRA 3WLAA 1ESMA 5HILA 5YASA 1G66A 1ODSA 2FFHA 3DZGA 4FCWA 1OBFO 2B4QA 5K05A 3EEIA 4DYVA 1COZA 3JV7A 4YP0A 1U9YA 2E87A 2NYVA 3OE4A 4LDNA 3A37A 4G6ZA 3C15C 1W5SA 2C4VA 5F23A 1OXXK 3GJ4A 5DBEX 7MHTA 3V4LA 2Q3LA 3M1AA 4X41A 1RC8A 5JD4A 3PNKA 4I50A 5HPYB 1UKYA 3NHKA 3E9RA 2P2CA 1F2TB 4JSTA 3N7UA 5K4AA 5K3AA 1NXWA 4M1ZA 3TOZA 3TOSA 3M6VA 3STTA 4PM4A 2YXPX 1HF3A 1N8TA 4BFTA 2AC7A 5E0OA 5JCOA 1RQLA 3C16C 3F7TA 4G5XA 1U5BA 3P7MA 3TTYA 3AQIA 5BMVF 3VVLA 1I7SB 4CKXA 4GPIB 1L8AA 3M2TA 5KNCA 4N65A 1HRKA 4Q66C 3A10A 4WXPA 1ZHHA 1L4FA 4P3NA 2YHIB 2EBFX 3HDQA 1XJQA 1A76A 4L02A 3ZDYB 2HSDA 2PT6A 5I8ZA 3TJRA 4ZGGA 1NVAA 1Z4IA 4FINA 1SIOA 3EA5A 1IJKA 3V4ZA 3W04A 1CY2A 5L40A 5JMTA 5TGDA 3A3KA 4Z9YA 3R5HA 4XPZA 3KYBA 2BISA 2B92A 2VDVE 3P32A 3WYFA 1BHJA 5FHQA 2ZJYA 5CAEA 3PA6A 4MGYR 1FQKA 3UXEA 1JU9A 1PTJA 1CUYA 2E55A 4I9NA 1GP2A 2M6RA 4HRXA 4KODA 2F1KA 4ZV7A 4CDGA 1WLYA 4TLLB 4GG1A 2OCXA 1DAHA 5CBKA 4J1SA 3SSMA 4DBLC 3D0KA 4GNKA 2H59A 3QPDA 4EA8A 3SYLA 2B36A 5E3HA 4RTKA 3W2GA 2XX3A 4GT1A 3BICA 2POQX 4BPBA 1YH3A 5ALUA 1TVCA 1U8UA 2J3QA 2VHUA 3A9CA 4BP8A 1RHUA 4OO3A 1KK1A 4WUVA 1PT5A 4NEHB 2FP4A 3D8RA 3N07A 3DZCA 2WOJA 3IAHA 2Q4BA 3VYUB 2PZEA 5B6IA 1WSBA 3CWQA 2VDWA 2G4LA 1M8JA 3B1FA 5TGTA 3CS3A 1HE4A 1LGYA 1DCMA 2PNFA 3FKSD 2DP4E 1TLLA 2NT3A 2OXCA 2ZSEA 1MQ8B 3OEYA 2MSLA 2YW2A 3TM4A 5A9SB 5E1DA 2OL4A 4WNIA 4ZO6A 4X3PA 5EFZA 1SKBA 3CZ4A 1XTUA 3UMMA 2JFHA 3GA5A 4BAUA 1N9GB 1ZU4A 3T7CA 3W5HA 3IKVA 5JARA 4DADA 2H52A 1EFDN 3H7IA 4W9RA 4Z1MD 3JR3A 4MCJA 1I3KA 3DZDA 4BO6A 4BHTA 3CH6A 3UA3A 2GTHA 4OXIA 2AR0A 4ZREA 3UJNA 5E38A 1JEQB 2JANA 4WAUA 1NY6A 4S1TA 2ECKA 4Y9RA 1ISHA 2GEBA 4B81A 2X1HA 2PGXA 3AZPA 4Q01A 1A5AB 2HZ7A 1TM1E 1WABA 1CQJA 1ZVKA 2MSCB 3IP3A 2GKGA 1LLDA 5DN6D 2Y0PA 2MR5A 3MJVA 4KR2A 5D1NA 3ZY3A 4PLZA 5JBIA 2BYTA 1V7ZA 1Y37A 3EF0A 2QD3A 4L27A 1XTQA 1E5VA 3DKPA 5HEKA 5TPWA 1UJ2A 1ZG3A 2A5FA 3P96A 4OB6A 3UENA 4C03A 2WMYA 2Z9BA 4I19A 4MQFB 1L5GB 1IN7A 2PT9A 1R00A 2O7QA 3RARA 1SA0B 2ZRGA 2F3QA 3GJ7A 5FOTA 1MG5A 1UK9A 2SCUB 4FC6A 2GBLC 4PTZA 3L4BA 1R0ZA 1KI4A 1U7OA 2G9VA 4K3UA 3H9GA 1DQYA 4LJ4A 3VR2A 1NF8A 4OSEA 4M8NE 3MPUA 5LLDA 5CM9C 1OBVA 3OTOB 1CEQA 3B6JA 2I2CA 3G1TA 2AYYA 3AHHA 1C7IA 2KPOA 1VE1A 3VNQA 1SCUA 3RFXA 3K0EA 1XRPA 1DBSA 4OIFA 4PAOA 1BEZA 1IOLA 2FSPA 3FMPB 2VOEA 4ZOCA 3HEAA 1W1IA 1ZGJA 2GN2A 2JAQA 4H4DA 5CLLA 1JTVA 1P74A 5KOIA 2GM9A 3HG7A 1J33A 4Y7DA 2R7LA 3LW8A 4YHHB 1JEJA 1YZ3A 3CKKA 5K45A 1WXIA 4HTFA 4MPDA 2I65A 5AVWA 1V95A 1RM3A 2YVUA 1YZNA 2PVSA 4MJ3A 2J5RA 2R00A 2IX3A 3GRUA 4L4YA 1D1SA 3HWWA 4CMIA 3VR4A 3QKTA 3I8OA 1G6OA 4GMHA 1FNBA 3FRJA 5D5HA 4YONB 1WDTA 3WRXC 1E79A 3WA6A 4BCDA 3R8FA 5L9AA 3DR3A 1NQOA 1QPBA 1W59A 4NJOA 3I6IA 5CGQB 2X3UA 4KJXA 1TYCA 1OIVA 2WKQA 3PNOA 5KOYA 3RVDA 1JFSA 2WJAA 3LUKA 1ZDMA 5GJWC 1SB8A 2BBTA 1NBMD 3AIMA 1X7YA 3L8ZA 3PPXA 4YNBA 1QRDA 3LDHA 3L06A 2AC4A 1DEAA 4QU8A 4S1WA 2BMVA 1EHYA 1SUWA 2ZKLA 3KOUA 3NBKA 2WNSA 1P8JA 2VXOA 2IHUA 3G0DA 3WIVA 2XCQA 3I32A 4GYYA 5KKNB 1U65A 3K8ZA 1OE0A 2JD0A 1C50A 2I9PA 3VOTA 3D2BA 5IFLA 1CNMA 4QPCA 4NBUA 1DX4A 2H65A 4M9UA 3QITA 4RF4A 5EKDA 2OBMA 3VHXB 3SJ7A 2ZS8A 1CFZA 5LU8A 5LOVF 3OZ7A 1VP3A 2XJ9A 1T5TA 3C8DA 1LS1A 3ETLA 1WHTB 3ML1A 3QZUA 2C58A 1UH5A 4HD8A 4YJ2B 1TVEA 1OU0A 2DU8A 3C8HA 3COYA 3NTRA 5DGDA 2PFGA 2X5OA 3BEDA 5LDGA 2PX8A 4HLCA 2Z0MA 2PCLA 2XLBA 3TLMA 3ZLBA 4RJTA 4EP1A 1BE1A 1MORA 2ZUFA 1DAIA 2PA3A 3FFTA 3QF4A 4F7WA 3HCOA 1TM4E 3AVYA 1NXVA 1DBIA 4PX2A 2BDUA 2P67A 2M2IA 1O2DA 2FUKA 1B0UA 1MT3A 1R6AA 1Y6QA 1ZIXA 1V7CA 2B0CA 1MC5A 2ZTLA 1PK8A 3G0IA 3OPVA 1CDZA 2H8GA 1UMBA 2BJHA 2P1DA 5IEJA 3F97A 3LQRA 4ZIRB 1WCXA 4L1KA 2YN0A 4QFCA 3K8QA 4H7FA 2V9ZA 2H0AA 1RRVA 4MINA 4D82A 1RBQA 4YALA 1K7FB 3MIIA 2R7MA 2IBMA 1BS1A 4YY3B 1NVDA 3NOXA 5KSWB 5EHGA 2X9VA 4JJ4A 4QOFA 3EXHA 4V0OA 1X6VA 3R6WA 1XMSA 2OR3A 1QWSA 3QM1A 2C95A 4ZT3A 4ZYYA 2X58A 3WYEA 4PO1A 1D7OA 3T5GA 3I4LA 2P9BA 2LW7A 1RBZA 2IGBA 3LT1A 1YJ8A 4UAUA 3NHFA 5NULA 3UJHA 4AJPA 3FGOA 1EXWA 4XWGA 3SBDA 5LQJA 1ZR2A 1Q11A 3EC2A 4ZP1A 4EPYA 2E82A 3ZJ4A 1MX9A 1KI1A 3CLRC 3DF7A 2A3RA 2F62A 3C4VA 3I01A 3W0LB 1P5HA 4L15A 1G20A 1XZ8A 1PFUA 2VXCA 4FB4A 5CB6A 4A36A 1DGQA 2H9YA 2MT9A 4O4HA 2CDNA 3TDKA 1A0OA 4DY4A 4AMGA 2GK7A 2LCIA 1JR3D 1V1MA 3KOOA 2X76A 4OHKA 4HAUA 3B5IA 3SF8B 3ETNA 2IYPA 1HTBA 1WD7A 3UMGA 1K66A 1XWWA 2DWOA 4HEA1 3RI3A 4CLXA 1E3QA 2O5EA 2Q41A 1OC4A 3B1VA 2PZAA 3HCPA 3A6KA 3C6KA 3PZRA 4FOLA 5UKDA 4D2IA 4Q9AA 3QMWA 4IIXA 4PU0A 1L7QA 1BE8A 1E60A 1DX9A 3EIWA 4KOAA 4AY5A 1IH8A 2HIGA 4QAQA 5JSHA 5A2GA 3G17A 4OSOA 4X65B 5IJ0B 2C5EA 1GITA 2I6FA 1OWOA 3MBOA 4LHWA 1QIMA 4A8PA 2VYQA 3D9QX 1ADGA 1W85A 3RFFA 3KUCA 1CJTC 4JENA 3JATA 3L8DA 4KQ9A 5AM1A 4DPKA 1FQOA 5DE3A 4IIJA 4RMNA 1BWQA 5GADl 1G38A 5B37A 3OZXA 3FFAA 3L8YA 3QWIA 2CK3A 1R0WA 2QGFA 4LVCA 3BDIA 4NHEA 3U4CA 2PKYX 3H0CA 2YYYA 1KYWA 4IL5A 4TT3D 2O50A 2YVKA 2ZJ3A 2ZAMA 1XMIA 2P1ZA 1R8XA 1JN0A 1E1CB 2C2HA 2HZBA 4M87A 1ZU5A 3DVLA 2PS1A 5D3ZA 4HNUA 1IY9A 3UXYA