4RANA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
201
Chain Sequence
RSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKVIGGDSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 66
structure length 201
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ranA00
1J7JA 4P84A 1P19A 1A95A 3QW4B 3LRTA 4X45A 3EFHA 3H83A 1Y0BA 1TC1A 4P83A 4JLSA 1DQNA 1I14A 1DBRA 1FSGA 1ECBA 4LYGA 4S2UA 1MZVA 1NULA 1U9YA 1JLRA 1XTTA 4PAWA 5IPFA 4WMLA 3GGCA 2AEEA 5EUCA 1G2PA 1QK4A 2PRZA 1G2QA 4M0UA 4OHCA 1BD4A 5JV5A 4KN6A 1R3UA 2P1ZA 3KB8A 2E55A 4WN3A 3G6WA 3M3HA 1CJBA 3O7MA 3ACBA 4P81A 1O57A 3ACCA 4RACA 1A4XA 1YFZA 4TWBA 4RAQA 5JSQA 1QK3A 4ZFNA 3N2LA 4RV4A 5IAOA 4P80A 4RHXA 4RHUA 5KAMA 4LZNA 3GGJA 1ZN7A 4P3KA 1UFRA 1VCHA 2GEBA 4LZAA 1LH0A 4RHTA 2C4KA 5BQOA 4F8EA 3MJDA 4MB6A 5HKLA 1ECFA 1PZMA 3NAGA 4RABA 4RADA 2IGBA 1UPUA 1A96A 1HMPA 1QCCA 2PRYA 1XZ8A 3OZFA 4FYMA 1G9SA 1DKRA 4RAOA 2JI4A 1AO0A 1TC2A 5ESWA 1XTUA 1JLSA 1P18A 2XBUA 2FXVA 2WNSA 1I5EA 2EHJA 5E38A 5K51A 1DQPA 1G9TA 1XZNA 3HVUA 4PFQA 1ZN8A 1P17A 1ECJA 5BRNA 4RHYA 1L1RA 1Z7GA 2JKYA 2VFAA 1QCDA 1I13A 4QRIA 4RQAA 1ECCA 2H07A 1OREA 4IJQA 1D6NA 3OHPA 1I0LA 3GEPA 2H08A 1IBSA 4Z1OA 4QYIA 3ACDA 1BD3A 1HGXA 3MBIA 4LZOA 5ESXA 1GPH1 1OROA 5KAPA 5BQPA 2PS1A 1QB8A 4M0PA 1ECGA 4P86A 4P82A 1XTVA 4RQBA 3DAHA 1U9ZA 1I0IA 1QB7A 4M0KA 1DKUA 1UPFA 1W30A 2YZKA 4RANA 5BSKA 1OPRA 1VSTA 1ZN9A 3DMPA 1A98A 1A97A 1P4AA 1A3CA 3LPNA 1QK5A 1V9SA 4JITA 2JKZA 1VDMA 2DY0A 1L1QA 1GRVA 3OZGA 4QYIB 5HIAA 2JBHA 4X44A 1WD5A 1NONA 1O5OA 1BZYA 1STOA 3DEZA 4LYYA 2H06A 3S5JA 2HCRA
chains in the Genus database with same CATH superfamily
3PQFA 3EYWA 1EUDB 1U98A 4WLUA 5C5CA 4G9EA 4MS1A 2VDWA 3QY9A 1HL7A 2ZW9A 2W6OA 2HSGA 4ZPXA 2A1UB 3USZA 1P7ZA 3CX3A 2DY1A 4HNAA 2ORIA 3SICE 3VU1A 4A0QA 2O3UA 4MKZA 1FNBA 4TGLA 3OQBA 4TUYA 1VDZA 1RM0A 1UFKA 2BMVA 1QE0A 1BH2A 4ZQIA 5AJXA 1CQIB 1JFVA 3Q3GE 1JR3A 3FZEA 4GYWA 4XQCA 4X24A 1J07A 1XDGA 2Z4TA 2W2NA 3Q1KA 3GWZA 3TQOA 2N3ZA 3DR3A 2WT8A 1T2NA 5THXA 3MWYW 2AR0A 4PZLA 3A6GA 2HLNA 4PAOA 3QEOA 5B2ZA 3WIDA 1LGYA 3P2OA 1VI2A 1P1JA 2X0DA 2IBTA 4GE0A 2PMKA 3K0EA 3MILA 2A3RA 3G89A 3AONB 3O4GA 4KVGA 4M6WA 1E8MA 4NCNA 5IJWA 2GKGA 4JUDX 1TCBA 4KHZA 1Z06A 5CJJA 3VX4A 1YS9A 4JAVC 1KI7A 2BGRA 3CLUD 1NRXA 3MXOA 1A88A 1V26A 1YHYA 4UMDA 4MKIA 1MOQA 3VPXA 3TTXA 4O2AB 3HUFA 2JD2A 1FP1D 3HY6A 1PEKE 3CNBA 2QN7A 1A7AA 3OF5A 2PRYA 2ZB4A 4H6XA 4PHCA 1UEXC 2Y4OA 2XNDD 2Y71A 2ODEA 3EBPA 4LXYA 4ZO8A 1JDVA 2UVPA 3R3WA 5GZ1A 1KIFA 1OWPA 2V54A 1L1FA 5FOQA 3HCNA 2IS6A 5JJLA 2H65A 4H0FA 3SZOA 4A82A 1VRCA 3H9JA 4IDOA 4OFZA 2Q3MA 1TT7A 3T6KA 1ZNQO 2BUAA 3LP5A 1V0JA 4UM7A 3CUTA 2AI1A 3MYYA 1EHYA 5M5BA 4O2BB 1U0RA 1TVEA 3F8TA 3AUXA 3RYFB 4EHAA 5CXQA 2C5EA 1E2NA 2EKLA 3NKLA 2HSZA 4Z1MD 3EQ7A 5MN5A 2PFKA 1EVKA 1LBTA 4ZTUB 3TPCA 3ACDA 1BD3A 1HFKA 2WHEA 3H5VA 2P2SA 4UE2A 1QZZA 1P5JA 3GJ4A 4DQUA 4ZYLA 3KFLA 3ZUPA 2JC3A 3GLHE 4DLWA 4ZN6A 3FPGA 1X70A 3AJ8A 1QVWA 3P9ZA 3D1JA 3NCHA 5FUVA 5FPYA 3RD5A 1BGXT 3IURA 1HMYA 1ZH8A 1R12A 3CRMA 3R0IA 5EZYA 1J2TA 2R7NA 3IJRA 5AKKA 2GZ2A 4XQEA 1SC3A 1UDRA 5ENZA 4ZVUA 1NI4B 3M1YA 4A0SA 3C74A 1T6XA 5IF9A 2H1SA 4YFVA 1U8EA 4TLEA 5K6AA 1QXSA 3F8SA 1OAAA 5BW6B 5DN6D 4LE2A 4WRRA 2J0UB 4R1QA 1HF3A 3D6FA 4U2CA 1K6IA 1MOSA 3SYRA 1M1YB 3D7RA 2V7GA 1YB2A 3QXGA 1EFRA 2HBQA 1WB6A 3HA5A 4RY8A 4X8MA 3KM0A 1ABEA 2O0MA 2Y0EA 4HDOB 4RPHA 5E7JA 4YUAA 3MGGA 3R7SA 1JQAA 3QA3E 3QPBA 4IOMA 4UVEA 1XQ1A 3RK1A 1VECA 4ZT5A 3WE7A 3DEJA 4KO8A 4V0QA 1G8SA 1V96A 3C6ZA 1YDWA 3NHRA 3IB3A 1AUQA 4J0KA 4LPSA 4JFRA 1H66A 2YWXA 4EKGA 3H17A 4JLSA 1ZA1A 3IT0A 1W73A 1HDZA 3LHIA 4IVRA 1GPYA 1WG8A 1OWLA 3RARA 1U9YA 1ZCAA 3R7FA 1IJFA 5IAKA 3GLFB 1AN9A 2FETA 4RF4A 3QVJA 3AEUA 5A4JA 1LJUA 1FFBA 2QRMA 2GYVA 1B8UA 3EVDA 2O07A 3K92A 1K98A 1PSDA 2C61A 3KSZO 1ULSA 3OO0A 4FFBA 4G1BA 3V5NA 3VR5H 4B6RA 2P9JA 4CRWB 5IMSA 2A14A 3C3MA 2XGJA 3M5DA 4MUJA 1SUDA 4OAPA 2W2XA 1KKUA 1RYNA 3O7MA 3ZXYA 1EIWA 1CX9B 2ZCVA 3M70A 3E81A 4KIGA 5LWHA 1F6WA 3GH3A 2D5IA 3Q3IA 3B7WA 5FBQB 2GBCA 4NOMA 4TL7A 5DEIA 3D2LA 2CBGA 3CVJA 3SBEA 3WICA 3RBVA 1Z22A 1LPOA 4BB9A 2YJZA 4L57A 5FOSA 3RGGA 4BGDA 4XYLA 3QVVA 4O4IF 2R44A 4RHFA 2R25B 3FETA 5AHKA 4AKIA 5AIBA 5IHXA 2R4QA 2IYAA 3U3ZA 3FPHA 2D1TA 2O3JA 3K5PA 4Y6RA 4J0HA 1DUSA 2X8LA 3DTVD 1AKEA 1LKZA 1ZD3A 2BH2A 3M9XA 1QQAA 2O23A 2DUWA 4MXDA 4U7TB 1TVMA 1C1XB 1WHSA 1K92A 2IHUA 2XCIA 4IICA 1WY5A 3ZKWA 4FUQA 1WTAA 1Q21A 4GSYA 1XN4A 3BMNB 4IHJF 5A4FS 2XBUA 4FNOA 4D80A 4C6SA 4HNAB 1G1MA 1E3JA 1FE8A 2ZIAA 5IJZA 3ZXUB 2CCGA 1RI5A 3O2JA 4MROA 1Y6FA 4MRVA 2HK7A 121PA 4RLQA 1UBLS 2Z08A 2XMBA 1AQNA 1ZVVA 2IF0A 1GYQA 2OFPA 5BWBA 2Z2XA 1JZQA 1IM8A 1RVDA 4G36A 3HDJA 2E48A 1RHQA 3KZCA 4XUDA 2JBAA 1I94B 4BAZA 4LY0A 4RQAA 4EI8A 2ZIXB 4KYTA 2MR6A 5JZVA 4CV0A 4B35A 5KDOA 3K6SB 1Q7CA 1II8B 1KJNA 2NYAA 4QO7A 4QICA 1NN1A 1PDVA 5JRDS 1TGVA 4MJ7A 3T7CA 1GPH1 1RCFA 3DNFA 3TVTA 3C98A 4X85A 4RQUA 5ILQA 1XZJA 3GIWA 2FUNB 4Y2JA 1T3GA 1Z3CA 5GV7A 1NL3A 4A2WA 2W6CX 1RQ7A 1AUXA 3DWGA 4RLFA 5E0KB 3QF4B 2JGRA 3ZW7A 1UC4B 3ONVA 3UMBA 5L8VA 3E22B 4OA8A 3SC4A 4D8VA 5L3QB 4GW3A 1DINA 2FMHA 3GY0A 1LTKA 1E98A 4L95C 4OQXA 4Z0TA 1AK9A 1RC0A 2VK2A 3P0HA 2OHVA 3SC2B 4E2ZA 1LVGA 2JBHA 5JYDA 1SD2A 1Q83A 5EZSA 5ABPA 3H0EA 3HKCA 1G60A 5A1TA 6CHYA 1BXGB 2CSUA 4EW1A 4WEOA 3N39C 4WKNA 4JIMA 2ACWA 4P2BA 1RWXA 3D4OA 4J4HA 3N8IA 2PX4A 5TIIA 1A95A 1E6KA 3G5MA 4FNGA 3DKIA 1K7YA 1KJ8A 1QOZA 2DTXA 3JATA 3ETDA 1IMJA 3OCVA 1YCHA 5HG0A 2WZDA 3TW8B 2AKEA 5TARA 4WHMA 2CK3A 1DS6A 4XGIA 4UTRA 1E6MA 2ECKA 4OKSA 5FAKA 1G8AA 1P8JA 3LCVB 4FCTA 4ESEA 1RE0A 1S8NA 5FOTA 3M6FA 4QLBA 5D85A 4EJSC 1X7XA 3EMDA 4OHCA 2FPGA 3OQOA 1FDWA 1PFUA 4DMCA 3EIHA 3A06A 2ZQZA 3CR8A 3O75A 2HTEA 3M6AA 4CUJA 3O6VA 3KSUA 3O9MA 1X1QA 3L4KA 4DV6B 4DV1B 3AR7A 1RU3A 1ISRA 1Z5UA 2R7KA 3KTOA 4ODIA 5LQNA 3BQMB 3BH7A 3QXXA 1LQ2A 1HTBA 2RH9B 4R1OA 3KEQA 1IZ7A 2DHDA 3KQTA 1YASA 3CF4A 1L5HA 4DPMA 3LW8A 4DLYA 4A91A 5MFZA 5EE0A 1OA1A 2BEUA 4AJHA 3CSSA 3SP1A 5JCXA 1IN6A 2OVBA 5CCXA 4JHXA 2IUTA 4L0CA 5ALKA 1XTRA 5BQOA 1FYWA 1QHNA 4JJ4A 3GNLA 3OPYB 3PJRA 1Z4OA 1X1DA 4G6ZA 1YD7A 3VVBA 4HDSB 2BP7A 2P6UA 2DFPA 2WJZB 2XKBA 3EIQA 4GI7A 1TKAA 2B37A 3CX8A 3NHAA 4X1IA 1R0SA 4ZTZB 5CB0A 1KFJB 2CZGA 1HURA 2YZMA 3UMRA 5KNBD 3FDZA 1RZRD 2IYOA 1S8FA 1AGPA 2A86A 4ENSA 1DX6A 4TWIA 3VHRA 2HMSA 4LJRA 2ZRHA 1K63A 4HRXA 3FDFA 1F6DA 3IQGX 3F6CA 3GEGA 3KJEA 4G5GA 1XDDA 2F1RA 2O52A 3MUOA 1Y33E 4PHTA 1GL6A 3GJXC 2DT5A 1UDCA 4J2OA 3D6MA 4KWEA 1GTL1 4RD6A 5HF5A 1WBBA 5MF6A 2WIKA 2X2EA 4Q7LA 4UU7A 5HGJA 4K88A 3OCWA 3W3AH 3Q87B 4L8LA 4B3RB 1TT5A 2WSSD 1FP4A 3K0CC 2W6QA 5REQB 1DAHA 1VPTA 3V2IA 1EU1A 3OE5A 4DIKA 3OJ0A 1WOYA 1OVMA 2AL7A 1FFCA 3LBYA 3W9BA 2ZXUA 1E2QA 5FP0A 1SUIA 4AZSA 2QVBA 3MFQA 3M6LA 3T5MA 4QYIA 3AUSA 1B41A 4QX6A 2MSLA 4XKJA 1DJPA 3RODA 3NHZA 5I9SA 4WERA 3OQHA 1WZEA 3VV3A 4G1CA 3KOOA 1VLVA 1HNNA 3HG7A 3TLCA 3O93A 4XUGB 4YT4A 2HMYB 2GCOA 4FX5A 3H5WA 4P33A 1ZK4A 3STYA 3UUWA 3ZWPA 2CY0A 4ICIA 2QROA 1YNSA 3SIWA 1ZMBA 5F2EA 2WQ7A 5KJCA 2FFBA 3OTHA 4K9LA 5CW1A 4EA8A 1FU8A 1GNTA 3E7XA 4KZPA 4POAA 2FTKE 1MQAA 2AZMA 4IP0A 4J0IA 4PG7A 2PMBA 3WLOA 1C4WA 1DV1A 2QQ5A 4IV8A 2YOHA 2Q7OE 4LWQA 4BNZA 4X7MA 2W2OA 3NZEA 1BS1A 3EXIA 1SOWA 2O1SA 4M9ZA 3RU2A 4C0AC 5F9FA 1YQEA 5BWCA 2J59A 3EAFA 4ESVA 4PPYA 1ZUNA 5CX1B 1UF9A 3PC2A 4U9IS 2C96A 4MUYA 3WNBA 1PR0A 5FI0B 3B1JA 1ETUA 1XWWA 3IQEA 4KOEC 2B83A 3X2EA 2R4TA 4WVLA 2BR5A 4BNWA 5DK4A 1H0RA 3KJQA 3ZDXB 4C1NA 5KTSA 2OB1A 1SG6A 4HEA6 1B1AA 2RCYA 4L85A 2ZJBA 3RYHA 4HEA1 2A0KA 2P4QA 4YRRA 5B7PA 5KQRA 4MYUA 2EC5A 4B84A 4E03A 4JLVA 4TLDA 3WGUA 2ZJ1A 2AEEA 3T94A 2EQAA 4C4OA 2VJLA 3HP7A 3K1AB 1G2QA 3PV0A 3R6DA 1G4AE 1NT2A 2AZ4A 3HB1A 2O06A 1YK1A 2ORVA 2C5BA 1ZJYA 2D5CA 2HU8A 2P0YA 5GM2A 2O2CA 2W98A 3IT1A 4ZK6A 4C22A 3RKSA 1LZLA 1GG9A 1LLDA 3I34X 3LCCA 2AI2A 3C6QA 1AJEA 1Q3TA 4OHZA 1ISMA 5FA5A 1P2VA 2EF0A 2WHYA 3Q0IA 4RD2A 5DX0A 3WG9A 3GN1A 1YB5A 2I2AA 2Z9CA 3F6BX 2KB0A 4XYMA 5LOVA 4WKGA 2B4QA 3O82A 2ISCA 1KFEB 1PWYE 1QIIA 4ZJYA 1I2CA 1SK8A 4M7WA 1ZZGA 3FYUA 2XUIA 4NVRA 2AQIA 1Y4ZA 3IUEA 4KQEA 1XZMA 3T99A 1NNLA 4D43A 1ZD2P 2HH9A 2XVZA 3D2AA 2IX3A 3L92A 2HYDA 3QMVA 2RK3A 5KNCH 2NO9A 1MX5A 2Q4BA 5FRDA 2NQ8A 4GP9A 4HVTA 3QPUA 4QSHA 3RUEA 4FKZA 3FPKA 1E3SA 2VAXA 5U9CA 2RMKA 1U2EA 1U90A 2J5QA 4F1JA 1ADCA 3ELBA 2J3HA 3QUTA 4KIWA 4B44A 5J4HA 1KDPA 5JD5A 1NBEA 2NZXA 4JJGA 4NZMA 4YXWD 4DC9A 2BFEB 1DIBA 3OLXA 3V2UA 4EUFA 1ETHA 4Z54A 3TOZA 1N6NA 1DBIA 2J45A 2JVIA 4PGMA 4ND6A 2WJIA 3Q41A 1YQGA 3KKKA 4IDGA 1DFIA 3L79A 3RR2A 2FRXA 1CIPA 5EHNA 1KAEA 2SHKA 4ML3A 3EAQA 2HC9A 1FTSA 3OP4A 4CQNA 2J3DA 3O8OB 1KPIA 3IPXA 4QPJC 2WSIA 1IY2A 1R0RE 3H3FA 4M0EA 4MCAA 5DYNA 3SF0A 4B7CA 2GEKA 2B8NA 4DIEA 1P4JA 3WFJA 1EE2A 2Y8EA 3AR5A 4PO1A 3REGA 4EL5A 4URVR 3NXKA 4BVLA 2WTMA 1OGYA 2HHJA 4I5DA 2VTKA 4KGVA 3KAKA 1TXGA 3DEIA 4L2IA 3RC9A 5HCNA 2VDUE 4DNOA 4F97A 1QB7A 1WP9A 3PX7A 3JW8A 4YP1A 5IMBA 2AWNA 4O5OA 3VGJA 2BMJA 3I04M 1GZUA 2G9NA 3STHA 1EM8A 4GOXA 5DO9A 3T0IA 1GUDA 5JXWA 1VE9A 1BS2A 2EJUA 3WA7A 3PFBA 1YCFA 4X94A 5B4VA 3JRNA 5ED0A 1QH1B 4DDKA 3DM5A 1CCWA 3AQIA 3P9QA 2G0AA 1C8LA 4BTVA 2WIAA 3SU8A 5K3BA 4EELA 5KYYB 5CRIA 2H18A 2ZSJA 1LC3A 5K5EA 2ATEA 3EZ9A 2A4KA 3IV9A 4GKKB 2WWVD 5IT5A 3F96A 3RS7A 1R0BA 1IQPA 2FMUA 3H2IA 5K3FA 3G59A 3HKBB 3E8SA 3FMIA 2XITA 4WGFA 2V1XA 1E0SA 1ODKA 1Y0BA 3E5HA 1KDTA 1TC1A 3GUUA 3LCRA 1TJ5A 3AFNA 3LIPA 1VBFA 4K9MA 2HQOA 2QVCA 2B3DA 1H8HD 3BN3A 1U5AA 3E61A 5TVKA 2IQIA 2N47A 1E2PA 4R9NA 1J99A 5K9ZA 1KY3A 4GLLA 2O0HA 3AF0A 1H9AA 3WRWA 1VXOA 4V3CA 4EFKA 4QLAA 1FVFA 2NU6A 1NNEA 1F3LA 1G8KA 3OA2A 3SX4A 3EZFA 4B6EA 3VR5D 4E07A 1DEKA 3GAFA 4TTJA 4ZAYA 2ONZA 3LA8A 2VZ9A 5F77A 5ICGA 1ZH6A 4JOSA 4KP7A 2P35A 1R9MA 3H84A 2FVXA 4BQFA 4KXLA 5CM8B 2RHGB 4RFVA 2ACEA 2ZRFA 1JI0A 3SBXA 3ZXXA 3ZV3A 3E18A 5TS3A 4D26A 2QRNA 4GX1A 4KQ6A 2DCMA 4WXMA 4B2PA 3AUJB 4PHFA 3GEIA 1K0FA 3DMRA 2OT3B 1XCOA 2IX9A 4P80A 5KI6A 1SQFA 3PHBE 4HDSA 3K8QA 2I2CA 4YJGB 5AVJA 2NX2A 4DLPA 3PWKA 1EA5A 5FV4A 1YR8A 2B92A 3NHPA 1V25A 1YU6A 2GN0A 2D7CA 3M9WA 3OC6A 3ITEA 1GTVA 1NIJA 1HQYE 3NANA 5CX1A 3R3SA 2HFJA 5PGMA 3ZGYA 3EXFA 4B7AA 3QUQA 4G67A 4MVJD 3UENA 1E7QA 4YCNA 4TKVA 1X9GA 3UJBA 3ADBA 1UUFA 1I51A 3O8CA 1RWOA 1YZLA 4LDRA 4RPLA 2GCEA 3SIPA 3WDMA 5ALSA 4Y98A 2GWHA 3BGSA 4NYIQ 4DNXA 3HMKA 3TZBA 2Z2JA 2IYXA 4U3JA 4BX9A 2FPKA 5SYAA 2JLYA 4IHAA 5GZ6A 1DQPA 5J2TB 2CCJA 3MC1A 1KK1A 1WWKA 1GRCA 3R5SA 1JKJA 3P0JA 5CDSA 2YX1A 1KEEA 1Z7GA 1QGYA 1PV1A 1JDBB 2PEYA 5E7IA 5EVCA 3SZMA 3WWEA 3UPUA 4EUHA 4G8BA 3RK0A 1P3Y1 4AXBA 2WQ6A 5DN9A 3AVWA 5DEOA 3JYHA 4DYHA 1D6NA 2P9FA 1TEHA 2YIMA 1A7KA 4C7BA 1DAOA 2QR2A 4AX8A 2I33A 3A9CA 2ZRGA 1OROA 3EX7C 2YZ2A 1Q6YA 4OFBA 3GFQA 3GP3A 3L7KA 4HSEA 1TOAA 2IY8A 1T36B 4WY5A 3B78A 4MEAA 2ODQA 3DFMA 4DR4B 1CJTC 3ISJA 5BSRA 4OFXA 3C8MA 1LBQA 3P2MA 3VC7A 4NJEA 1AU9A 1L7OA 4OQYA 3DOFA 2NTEA 4QUBA 2L19A 5GPBA 5U1PA 3K73O 1QVAA 3ANTA 4R40A 5HBGA 4L7QA 1U8XX 5B1HA 4C0XA 1VM6A 1ACJA 4R68A 3PZBA 2JKZA 2W4IA 4CFSA 3Q40A 3B9QA 2KBFA 4F5DA 4Q7KA 4MVJI 4QUHA 1FFAA 2IOFA 4DABA 3FVVA 3NHYA 2HKIA 4R1LA 1R0ZA 3WV5A 2IU3A 6AT1A 4KUHA 1SCUA 4D4MA 4DMRA 2A9PA 2FLVA 5J5AA 4AP6A 2FN4A 4TSRA 2B1JA 3E5RA 3TXYA 4EHJA 4RTLA 4LYDA 2WYWA 3KKMA 3VKVA 2HTFA 3MLAA 2F90A 1T0PA 3BEDA 2ZYTX 3VXKA 4L3WA 3ZW8A 2PLFA 1ZL2A 3BDVA 1IAQA 1ZUIA 4R0NA 3HR7A 1IOVA 2J0EA 1IHDA 3IBSA 2BI4A 1UPCA 4NV0A 3E15A 2XZLA 1CUWA 3VYTB 1SXHA 3OJOA 2B1QA 2CJXA 1H2WA 4OJQA 1E1YA 1L7AA 1XR3A 2GXQA 3PFKA 3QRWA 4L4SA 4ZYZA 2I3DA 2J9FA 4FOOA 1YJQA 1H6AA 4KRXA 3BL5A 5LUAA 4XFKA 5FPSA 3T3NA 1XCJA 4X3CA 4LJ6A 5D86A 3AB3A 3ORHA 3SX2A 1XVLA 4RJTA 5A6SA 3OKFA 3ZV5A 1QHIA 1SGWA 1ZCJA 3H5IA 2MWMA 4OL0A 3L9WA 2CLCX 1U8CB 3F7TA 3O73A 4CI9A 2AOVA 5LZ5A 3UAWA 5JBNA 3L5OA 2VHJA 4MINA 3WRXC 4C78A 3FUXA 2QN2A 2QQGA 1VP3A 3HUUA 3PTZA 4URFA 3VNVA 3KYCA 3JQBC 4TT3A 1GTRA 4EYEA 3C1UA 1EHIA 3D5TA 4BZPA 3H8SA 2V58A 3WB2A 4FS8A 3UWDA 3G2JA 1WAMA 2GHIA 5ARDA 3TJMA 3QE9Y 2ODNA 2QNBA 4DANA 1I3NA 3EGEA 2ENUA 4M60A 3EPJA 1F2UB 5BRJA 3ADDA 3P19A 2PU5A 1TECE 3E22A 1AO0A 1ENYA 1MX3A 4IZ6A 4C21A 3U60B 4UBLA 4WUVA 3U80A 5KTKA 4MW4A 5JXHA 5C0OE 2V4UA 3U3OA 2ZBVA 1I0ZA 3IODA 1GXSB 3BCSA 3TNDA 2AB0A 1TK9A 3GAZA 1XU9A 5EQDA 1PGQA 3QLVA 4S0XA 3AUFA 2AR9A 5IDXA 1SVIA 3B7PA 2ET6A 3LW7A 1IUOA 1RQLA 4FFNA 2XNHA 3E3AA 2ZYUX 3GL9A 3WYBA 3ZN2A 4HAWA 3VJMA 1GQQA 3ICQB 1EAYA 3OZRA 3QX7A 2OK7A 1UWLA 1KK3A 1LV8A 1XNHA 4R0VA 1Z0JA 3DO8A 4KQ2A 2JFFA 2FUG1 1M6HA 2ZQYA 3CWZA 3LDGA 2R0QC 3WNCA 1AKQA 1M76A 1OA0A 1ZINA 4JENA 5JD3A 1TF5A 2A57A 1V71A 1IN8A 1DB3A 1REQB 3ABQB 4G25A 5FO1A 1OXTA 1KJ9A 2OUKA 3RC7A 3RAGA 4EBBA 2V6MA 1ILWA 2ZULA 3HCRA 4Q47A 1DBVO 4QPCA 5DHRA 3N8HA 3M4JA 3KSBC 5DHSA 3B82A 2CF6A 4NJMB 4YO7A 2H59A 2Z83A 5CIWA 5FORA 3L46A 4WZAB 1PBTA 1QCZA 4CKWA 4KUGA 4TRNA 3V4SA 1L5YA 3LC1O 4DIMA 3BVPA 2PKWA 4CLDA 1MO3A 1HR0B 4EG4A 3ETCA 1ZIPA 5IUJC 3OLCX 1QTRA 3PXAA 4GLOA 1ZPDA 4H7PA 4YJ3B 3ZBTA 5EP2A 3NUGA 3K2EA 1TAGA 2V7XA 2ZJOA 4KQCA 5EZYB 5K0LA 3WLKX 1A72A 1KBOA 3V00A 2E37A 1VYHA 4Y1EA 3KR1A 3S5JA 5K3CA 1U99A 2V59A 3SCZA 2F3TA 1C3JA 1BMQA 3Q6MA 3QU2A 5G4KB 2PUDA 1U63A 2VA8A 3JD1A 4UHDA 3QVLA 1NE2A 2O8NA 1BXRB 2IUFA 2P11A 4LRYA 4QYSA 4LSMA 3K1YA 5K2OA 1XELA 3AESB 2I7TA 2VXCA 3PUJA 4ME6A 1R8JA 4Z8XA 4LQLA 5DYIA 4YRLA 3UFXB 3L7CA 3FCXA 3JYLA 1XPJA 2DX7A 4QNRA 1RYBA 3I12A 4HAUA 4R1NA 1HSOA 4R8LA 4R2MA 3E0XA 1D7AA 2Q4DA 1Q0TA 3E7WA 4XFJA 2J5BA 2QK4A 2GTPA 1XKXA 1BKSB 1CZRA 4OATA 3RDPA 3TR6A 1T29A 1NXQA 2Z6VA 3F74A 4K1XA 4Q9AA 3C14C 3F78A 1O5TA 3EPRA 4D8TA 2BMFA 3DHEA 3GA7A 4N82A 2VG8A 5JW6A 2O1EA 2B5OA 4KNVA 3R7WA 4TRRA 5AVKA 2SCUB 3CRQA 2Q6VA 1EMDA 1SK9A 2YJ6A 3QXSA 4HH3C 3U9LA 4D25A 1NP3A 1DHRA 1O54A 1TK2A 2VLBA 4RETA 3DTYA 5GMOA 4BNHA 4MUMA 5B58C 3BSFA 4FILA 4KAAA 1UT5A 4NHOA 3KAPA 2G1KA 3HSSA 3HXTA 4KK4A 5DRYA 4HQRA 2AEJA 1W7AA 2DUJA 4ASUA 4RKRA 3AUUA 3GGJA 5EXXA 3UJ7A 4HN2A 1P60A 4C4XA 4CNBA 4ETMA 2DR0A 4KKVA 3ZPXA 2G9UA 3QIVA 2QYSA 3H1FA 1F8YA 1FS5A 1LPMA 3TLKA 4NESA 1LB1B 2DH5A 4E0BA 5EQFA 1SVSA 3WKCA 2VH1A 1Z73A 3N0WA 5KX5F 4XAQA 1M2HA 4QXOA 3HBMA 3Q7SA 5CFLA 3CG0A 1PJ4A 4MSUA 4F4JA 2H8KA 4MV1A 3W9SA 1C8KA 3K09A 3LZCA 4ZKDA 3ZJUA 3M6IA 1VBKA 2GZDA 4M88A 4UTVA 4BNMA 2E3JA 5DYWA 1XU7A 2P2ZA 1WXEA 2G5CA 4K28A 1JMYA 5CYPA 4ZEVA 3ADOA 4K87A 2YJTD 4BWVA 3VNUA 4KRGA 2ZRJA 3NV9A 3DFUA 2I4NA 3GFGA 4HI0E 3D5EA 3WLLA 3A7EA 3HJRA 3N58A 4MV3A 1CU1A 1P1RA 2HYIC 1SEPA 3LVQE 5IC6A 1SC4A 5IAGA 3VDXA 1IZ8A 1TMKA 3I1IA 4ZOAA 5AR1A 1LF0A 4PXSA 3EQ9A 2IRWA 1U65A 4WDRA 5EP3A 4EP1A 4EMSA 3GRVA 5I7OA 1KQGA 4UUBA 4XB6B 3NTQA 2RHMA 1EUDA 4OHMA 4G84A 3HXOA 1QRTA 2K2WA 3O5AA 1GZ4A 5K8CA 1RZRA 1AZLA 3LGXA 5AWFC 5AVYA 4I5GA 1NUQA 4MVWA 5D3QA 1NVTA 4WE3A 1NMQA 1SBIA 3ORRA 5KHOC 1B16A 2PX5A 2ORED 3W2TA 3GFSA 3FDJA 5B58T 5B12A 2YASA 1I7QB 2PKYX 3FGPA 3GMTA 1C2TA 2I6SA 3MRXA 4RCZA 1Z2AA 3RS0A 1CB7A 2OFFA 4GOKA 2Q6OA 2PEZA 3SYMA 1JLHA 2CC2A 4EX7A 1LFAA 2OECA 4BBZA 4FD3A 3TNYA 1N2OA 4K40A 3ZZ1A 3OZGA 2CVHA 5FLKA 1J21A 2QRVA 4LVCA 5BSFA 3TBKA 4HNTA 2OV1A 3NYIA 1COZA 3E48A 1KDVA 1XK6A 3L2OB 2ZCUA 1KE2A 1NFRA 3O3MB 2J0QA 3WTCA 1C4OA 1AN0A 3N3AC 1WKVA 2NP6A 2PH1A 2NT3A 3OJXA 4YUVA 2B4RO 3VX3A 1QOQB 4OP1A 5CM2Z 1EZ1A 1F8GA 4RCYA 1WW2A 3TOVA 1E2BA 5EIBC 4M22A 4F3CA 3U09A 2ZWIA 4LNUB 4D9FA 6PFKA 2A7XA 3TWOA 2P0AA 5I4KA 3HE3A 3BK2A 4FW8A 4KW7A 1ZD4A 1THZA 3KHKA 4N3GA 5IASA 2G1PA 2H7VA 1J7KA 4J03A 4CKBA 2CGEA 3PK0A 2X1VA 3WMXA 5C7YA 1P31A 1JR6A 2NTYC 1OZAA 3M34A 5CEJA 4EGFA 2BZSA 4DNPA 4JYAB 4B4OA 4N8SA 3BRWD 2O8BA 3FOAA 4RXMA 5H0IA 4ACAA 2XLBA 2BZ1A 3HCCA 3ENVA 2V9CA 5IBPA 1JP7A 3TKYA 3JQFA 3W2EA 1YS7A 4D5EA 4K9NA 1T24A 1MO4A 4UBOA 4TUYB 5CYGA 2HW8A 1OW3B 2HV9A 3HEAA 5ALNA 5TX7A 1PQPA 2PGLA 1MVNA 2RHCA 3QNWA 3VZDA 2F8SA 1JZSA 1GPNA 1RXSA 2GARA 3KXPA 3PC8A 2FGKA 3RYHB 1AZTA 1JSXA 1LVUA 2IKSA 2VDWB 2BM8A 1OYWA 3HXPA 4IV0A 1JAHA 1H5QA 3CT6A 3I9NA 2B8TA 4GDMA 3R8XA 1Q57A 2NTVA 1NUPA 3LSYA 1JEJA 4XJVA 3TLAA 2Q5HA 2ANCA 4HDMB 4I4IA 4BLWA 4BQPA 4E5YA 4G81A 4L50A 3TIXB 1N2CB 3JWHA 4IUDS 2FUKA 1O97D 4ZMBA 5EWJA 1P61B 2R96A 1E4YA 4F11A 2VYND 5CDYA 3GRAA 2YS7A 4JWTA 4U9UA 2I2DA 5JY6A 4MS3A 1Z2CA 1Z6YA 5IM5A 3NDPA 4JKIA 4X8LA 4C7KA 3KQUA 1UWCA 2NIPA 4QU8A 5H4HA 2Y1LA 5DNUA 2F8MA 3GXOA 1R4NB 4FFPA 2BUBA 3EVGA 2JLVA 3SXUB 4NMWA 1RYDA 2FWAA 3CLSC 4GT1A 3HM2A 1DWQA 3EVEA 4DCJA 4ZALA 1SXJA 3AJEA 2WP0A 1PK8A 2YY6A 5EZ5A 1CUUA 1A8IA 4DFDA 2F59A 2IYSA 4PO3X 2R3SA 5AW9A 4B8ZA 5LP1A 2J4CA 2P2LA 4YRCA 4AC9A 4CL0A 2BM9A 1GZVA 1UXKA 1L5VA 1UBTS 2I2XB 3F3MA 3HR4A 1SZJG 3ZY4A 1CPYA 2HA7A 1NV9A 1HDXA 4JT4A 4PC7A 4HDQB 4UNSA 1ESDA 1OIXA 4DSZA 4M0FA 2IYWA 1JDSA 4RMHA 5CCBA 2R11A 1XN1A 3S5UA 1EP2B 1A2OA 4UAUA 2O7VA 4ZHQF 1SUEA 5KHLB 3OT5A 1A9QA 4I9NA 1EVIA 1WRBA 4L07A 3QWFA 4MUXA 1D0VA 3P1JA 4JSTA 1YO6A 2QZPA 1YRWA 4TMWA 3HH8A 4Y2VA 3X2SA 3H2KA 1VLQA 4DPKA 4YV2A 1HE2A 3G79A 5J58A 3UFXA 4XIYA 1UAGA 1NBAA 2BUCA 3EW7A 4Q39A 4WXEA 5AKEA 3OMWA 5C8YA 2HD4A 2K6GA 4UARA 3F9IA 1NVDA 3OM1A 5FEUA 3EWNA 1PV2A 3DBLA 3KFXA 4F3KA 1D4AA 4MGIR 1GUAA 3RF6A 3HCBA 5AQ1A 2TMGA 3ZHUA 4MNTA 1PGPA 3BXHA 3OPYA 3HJCA 3TLBA 3W7AA 4CL2A 4G4IA 4LWZA 3EIUA 1T5HX 3T7SA 3LVRE 3P9YA 4FHFA 3S70A 3LGSA 5JZBA 1LFDB 3BXGA 4O2BF 2W42A 2IS2A 3KK0A 3I4LA 5BV1A 2J31A 1OAKA 1XKTA 2GLTA 2GUGA 4MMYB 4ZQEA 4C43A 1SO8A 2WF7A 5K8JB 3GJ5A 1XQ6A 1EFHA 4DG5A 2EL9A 2VCHA 2BI8A 4G09A 2VKQA 2REXB 3Q9SA 4EFMA 4MLCA 1V1RA 2RGCA 1MOPA 1GARA 1QYWA 2QI9C 2RGBA 3HA2A 3BMCB 5IS2A 1AGXA 1UXGA 2QRUA 2W2LA 4OIFA 4Q4AA 2XY4A 4FC6A 3EPKA 4AY6A 4UEKA 4QATA 4YJ2F 5ALEA 1J8FA 3V34A 1NXSA 2A5DA 3V80A 4TT3D 2WLSA 3D6UA 5ULLA 2OC9A 1TB4A 1USWA 4RFSA 2YY7A 1P2SA 5E3JA 1X2EA 2F3PA 4A2CA 1TYDE 4AS3A 3ICCA 3COJA 2OCXA 2JGMA 3KFVA 1LNSA 1RJFA 3KR0A 1KJJA 3I9LA 3KSRA 3PGKA 4OFWA 3Q3VA 1MN6A 1V4NA 3N28A 4BVKA 5IT9A 1HQCA 1TUBA 2AI3A 4PGGA 3ZUGA 5BV8A 2VXYA 3WLPA 3FSRA 3VGPA 1EFPA 1HUQA 2BGMA 1JA1A 1T4DA 4N3BA 3LKDA 5BPHA 2J9RA 3GO4A 1H4TA 4WXRA 1EXDA 3HNPA 2IYVA 1JKIA 5KPDA 5EHGA 3I04A 4X93A 3TVDA 1BJRE 5EIXA 3RTCA 1NVBA 3KZNA 1F2UA 5HKAA 3WC4A 1RQRA 2DEUA 5K51A 1QQTA 2J48A 2C9YA 3C3JA 4F91B 4GL4A 1C7JA 4MCHA 2R1VB 3D8SA 1L7BA 2PO7A 5BNZA 3TVYA 4RNDB 2K7ZA 2HIGA 4M8KA 2XXAA 2X6RA 4NK4A 4R3NA 3F73A 4ZKEA 2CMFA 3X0DA 3AXSA 1II8A 3UGJA 1OOEA 1RFGE 4JX9A 4UNIA 2RIPA 3ZCQA 2W0SA 5CB4F 1YRBA 5FH9A 4IV5A 1VMIA 5C51B 4K6CA 1XZFA 2Q3BA 3D3KA 4D0RA 1QP8A 7MDHA 4JJKA 1KY4A 3C16C 2R85A 1Q95A 2FH5B 2H16A 4WZAA 2R6ZA 3LY8A 1XJ0A 2XMCA 3MJ4A 4Q4JB 2W7TA 3BRSA 2C2YA 4EMUA 4IJ5A 4I1VA 3TGLA 2I6GA 1J1UA 5AFSA 1J23A 3I09A 3OJFA 2OA0A 3S2FA 1GKIA 1E9DA 1C1XA 1K1EA 1R3DA 1WHSB 2Q3CA 3EGWA 2UDPA 3JQ7B 3OIFA 1BSVA 2RC5A 4WNIA 2MYNA 3WL5A 1FS4A 4FMBB 3WVNA 3ZE2B 1XROA 4KJXA 1KU0A 4KLZA 3OLYA 3ZIDA 3OCYA 1KMHB 3MGBA 5BQXA 1LV7A 5BSHA 4D8XA 8MHTA 2UZ4A 5EG5A 2W4MA 4IR7A 4TV8A 5BOVA 2YIVX 2ZI4A 4A2PA 2ZVDA 3RIXA 4YWJA 3R20A 3WNDA 5KC9A 1ZICA 3QWAA 1CB0A 1Y5LA 4MZXA 4N39A 4DDMA 4B3XA 1QFYA 3L6DA 3MJVA 4MA0A 1YU9A 3GGCA 3PGMA 2I4IA 2R8PA 1VJTA 2GA9A 3CVXA 2ZYWX 4DLTA 4M9CA 1CT9A 3DMTA 2YVUA 4GQBA 5DWDA 3BRCA 3DMNA 2B34A 3G0OA 4A5OA 5HP4A 3GNSA 2DBQA 2GKSA 4I4TF 3ACBA 3GLFE 3GC6A 4EYOA 3RYIA 1JEYA 1AV6A 3L05A 2XWSA 2XOKD 4UOQA 2CDBA 2HLHA 3BCRA 2GZRA 5JDCA 1ITZA 3S81A 3UJNA 1ORIA 1KC1A 3Q88A 3WGIA 4O2LA 3HZHA 3IMKA 3I0MA 2XGOA 4LVNA 2CV2A 3RTBA 1RWNA 4GRIA 3SQWA 1N2XA 1B0UA 1WKCA 2WK1A 4YT5A 3QXJA 2X6TA 1ZRHA 1RVV1 2Z4SA 1YL5A 3OA0A 3TDNA 2WWYA 4BMOB 1RJ9A 4Q16A 4ZWNA 2ZR8A 1ZMRA 4KXQA 4WKCA 1C30B 4I46A 5A9SA 3HXQA 4RABA 3KIPA 1KSFX 3P5SA 4IJKA 4MWTA 5CR9A 3SIXA 3GRUA 2WJJA 3OU2A 4I1SA 5ALGA 2DPMA 4DOMA 3LYAA 2HCBA 3P2EA 4RSMA 5FIUA 3RTAA 2OEPA 4L16A 4FSHA 4EHBA 3CZMA 2A3NA 3WLRA 2XRFA 2QWXA 1JPNA 5FBRB 1V3UA 2IV7A 3L6BA 1L9KA 1T9AA 2E21A 4XVQA 3WBFA 4HFRA 3WYDA 2DFDA 4BXOB 4YROA 4EH1A 1YZHA 3KVRA 3QHPA 3QXCA 4EG5A 2X0RA 5JHHB 1TYAE 5K6TA 1BJKA 4J8PA 3ECSA 4MIOA 1VIMA 2EKZA 4V24A 1U8AA 2XUJA 1W19A 1E7YA 1Q3HA 3PWTA 4L8VA 3MIZA 3I9OA 4IFBA 4KE6A 3SDBA 2RGYA 2GAAA 1WCIA 5GJVC 3Q7PA 3A31A 4H08A 4EBFA 1HLGA 4Q9IA 1C7RA 5AUQA 5GWXA 2NM0A 1FRNA 4P35A 4DWWA 4ZHQA 3JQ9C 1KEZA 1OFIA 1XA3A 4JB8A 4J1NA 1E0JA 3QU5A 3LWZA 3MJFA 2AYXA 5AI6A 3F5SA 4ARUA 2XDAA 3BSYA 5BP7A 5KSOA 1BU8A 1DRVA 3IUPA 3RABA 5AW1A 4KXMA 3OIGA 3L8FA 3UIEA 3VPAA 3NP9A 3JV7A 5DN6A 5JQGB 3P9NA 4B34A 4HGOA 4D9NA 3LT1A 1LDYA 3I32A 1RKQA 2EWMA 1RYEA 1QHEA 1S3SA 5K03A 3M4YA 4TXJA 3O47A 3L0BA 2WWFA 2YR0A 2FMTA 3EGDB 5DOVA 1JN0A 2PH7A 1DT3A 2D1RA 3II6X 1DBWA 2J4DA 4YRFA 5EIHA 2ZRAA 4GMFA 2QVZX 5KCZA 3PGVA 3PGA1 4ND1A 4LY3A 1EDZA 1TVKB 4TN5A 4UM9B 5SYNA 1TPZA 3CLVA 4FSDA 1JW9B 4CM9D 5BR8B 1FLNA 1KYZA 3REQB 5AUNB 5IVPA 1OY1A 5JQGA 3OKAA 1KPGA 1H1TA 4F7DA 4K26A 4X90A 5J1TB 3ZE7A 1FTWA 3B5EA 4C6TA 1FQOA 3P9CA 4URYR 1W8DA 3KVNA 1RAGA 4HWOA 4LV6A 2GPTA 6GPBA 2IBSA 1E6LA 2XMDA 3AV0B 1KEUA 2XE8A 4BLVA 1ADFA 1CRWG 1M1NA 1KU6A 4I9HA 1MZVA 2CD9A 2AOTA 3HYRA 3QY0A 4RZ2A 5DW0A 1LI4A 5MGBA 1E1RD 2QA5A 3BL8A 1V7PC 1H05A 3UFBA 1K9SA 3AEKB 4QUJA 1K06A 4HLQB 1M33A 3W4KA 4H16A 3X1WA 3EQ6A 2E2WA 3LVFO 3MM4A 3OBBA 4QXQA 4G1MB 4KYUA 4FGUA 4P3NA 2QX7A 1PG0A 2XYGA 4KQ1A 4OQLA 2I80A 5KQLA 1QM5A 5LQJA 4PGHA 1YS2X 4Y2PA 1YB6A 4UCWA 3BWCA 3K0FA 1R9NA 3QK7A 2HWWA 5AHXA 3IAFA 5E4YA 5G3YA 2WJAA 4KQXA 3JRXA 4FHEA 1D2RA 4AQYB 2WKQA 4YJFA 3D8NA 4E88A 3IBYA 1J09A 2R8EA 3EGIA 3MWDA 3NT4A 3WGHA 3WDSA 3QW2A 3GXBA 5IKEA 2PV0A 4R1SA 5LMUB 1SBHA 4INZA 4RL6A 4L22A 4KTVE 1EGQA 5ES4B 3WL7A 1SRQA 1W48A 3LUDA 1ULUA 1WB5A 2C2KA 3FMGA 1D4ZA 1VG1A 4LZPA 4TX1A 3W7VA 1G8YA 2ZBFA 5TPWB 2C5GA 1RAIA 2FRDA 2X2FA 4P9NA 1ISIA 2QM8A 2J32A 3M2TA 4J0CA 4FZVA 5LC1A 5BQ5A 1XEWY 3AUTA 3B3GA 2YUIA 3VR6H 4E5PA 3I9KA 3BJEA 1E8DA 1VI5A 2BF4A 4ZFNA 4FKBA 1A2KC 4D4HA 1U0SY 5DK6A 3H5TA 3GJ0A 2ZIUB 4E22A 1Y1SA 5BNWA 5KEIA 5G0UA 5KREA 4EB3A 4TTTS 4R8SA 4A6XA 4HNUA 4LUCA 4RHYA 3W04A 3GT4A 1MQSA 3RUHA 5LP6A 3QSYA 2ZXFA 1Y8RA 4JBHA 5FNVB 5JO0A 2HGSA 2CWWA 3SMVA 4AZWA 4Z51A 4DQKA 1OBOA 2PR2A 3CLRC 4F2HA 3FN4A 1NVMB 5FTLA 4J1TC 5LZ4A 1Z2DA 3JD0A 4BCDA 2P9TA 4JSRA 2X1MA 3HV2A 3HZZA 1PJTA 4PC6A 2KX7A 4JS0A 3RGWS 4TLLB 3RV3A 5BUZA 3W5BA 3K9FC 1P5HA 3BMQB 5A3SA 4YRSA 5ITWA 1AOXA 3AHHA 1ZL0A 3IHTA 4NNOA 1N2HA 1QKKA 2G4CA 2H52A 1JQDA 4YRIA 4C2TA 2PCJA 3MB8A 3T52A 1G3MA 4RZSA 2QZSA 2VXOA 4UUOA 4CM6A 1CY7A 4LDNA 1UKZA 4PRZA 4A4DA 3EPHA 1E2EA 2XRMA 4GD3Q 1OFUX 2JFGA 4IUBS 4MDFA 5CM9C 1ODCA 1KZYC 2ZJZA 5EGNA 4NK5A 4R5MA 3BUSA 2OYRA 4XLTA 1K27A 2AMJA 5DP1A 4N5HX 2X7JA 4FT2A 4QEZA 1ZOSA 5BNFA 4R16A 2WTEA 3LF1A 5JSUA 3ANYB 1STOA 1UC9A 4AY3A 4N8DA 1GFWA 5JCJA 2W8BB 4LCEA 1W88B 3HADA 1W47A 1KYQA 3I2GA 3ZDZB 4C4ZA 5T3UA 4DG9A 3U4IA 2JIRA 1XMXA 3KT8A 3W6PA 1MTZA 4HVAA 1P0MA 3HDHA 5JTUA 1GGJA 1QFSA 5DRTA 2BY4A 3QVUA 1E5VA 4QU5A 1SWWA 2D1YA 3DDZX 2L42A 3JYOA 4IDFA 2FPLA 3EC7A 3MTJA 3A4VA 4XCVA 4LBYA 3RJ5A 4ZXFA 3IERA 1H3NA 4Q3NA 1N2SA 3NETA 3REFA 3BHNA 2Z56A 2E55A 1OJ7A 1VP9A 4RE6A 1EBUA 4NZ9A 3EIEA 1TJ4A 4QUGA 4QTUB 4O33A 4DLRA 4EA9A 2D6FA 4RH0A 4QOSA 3V1YA 1PYOA 3FCAA 4O8ZA 4O63O 2CEAA 2GT1A 1ABBA 1CV2A 4WKOA 1KVRA 1PE0A 2ZE7A 1RMTA 1GZDA 2QP9X 3HVKA 1ZXLA 1IJEA 1CUJA 3L7AA 4XJTA 4D45A 3WBKA 4YCSA 5JSQA 5J4LA 2HNKA 1DWPA 4IMPA 5DW3A 3TZEA 1WS6A 1X14A 4NE2A 4G37A 3TLGB 4I1OA 4XVRA 1W4LA 1WSWA 2SCUA 2VUUA 2Y4NA 4JWKA 3ZVMA 3PPWA 1X2BA 1EXNA 1DARA 5EINA 3QEBZ 2GPWA 3NB0A 3UXMA 1NHGA 3H11A 4Q9JA 2H4WA 1JJIA 2DULA 4NDZA 3FWKA 1HDGO 2NXNA 4UC0A 5HTKA 3SF8A 1T10A 1V8ZA 4BGUA 4C89A 3GW8A 1E3DA 3W1EA 2V3CC 4IUCS 4JT2A 3HK2A 3H9CA 5LCXA 2ZIWB 2IYUA 1O6ZA 4HH0A 4M8NE 2DR2A 2QTGA 4ZDKA 2XNCA 4YIHA 1XUOA 1ZOLA 4WKBA 1XP5A 4K6FA 3EF0A 5YASA 3TRKA 2P3OA 2ZAIA 3PENA 1I13A 2PCLA 2D4AA 1M0TA 3CZ9A 3EDCA 3FUWA 3JYPA 4F3NA 1I2ZA 3IA2A 4NAUA 1HX7A 2H1IA 1JWAB 4JH0A 2FKNA 1I4EB 2XE4A 4MGEA 2EWWA 3F5FA 3G0BA 2JJ2A 1KXZA 5A9RA 4AKHA 4YK7A 3LYUA 2QE7D 4UM8B 3B1FA 1QYXA 1K7FB 3FW1A 4F5ZA 1I7SB 2MT9A 4RZ3A 3A58B 2JS7A 3QWBA 4W6QA 3EPPA 4UHBA 5CDFA 1IE3A 4L5CA 3JAWA 4S1NA 4TXMA 5ALOA 1YR2A 2GCOB 2JAXA 1NSFA 5DM60 3DW1X 3PHHA 1XRQA 4BMSA 1I3LA 4WK0B 4CCSA 3UAOA 2XB6A 1HDOA 1JJ7A 1LK0A 2I54A 2VYVA 3IUJA 1U2DA 3OTQA 3T35A 3PGJA 3K0AA 4EGSA 1QQ7A 3E0QA 4HRVA 1GRVA 5ALXA 1JB1A 3ESYA 2Z8XA 5LZ2A 4FR5A 4FOLA 1V9CA 5IN5A 1DDIA 1WD5A 3FBWA 1PAUA 3NONA 1SWVA 3COPA 1E2IA 1FRFS 2Q5EA 2V9ZA 4FOSA 4MUHA 3W2FA 4LBZA 4QGSA 1WMAA 4R5HA 1IATA 1MPTA 1K4MA 1OAOC 1Z39A 3QQ5A 4U7DA 3D59A 4PSVA 3WGVA 1SVUA 3P0IA 4PBSA 4KR7A 4R2JA 1JQJC 3HKCB 3R40A 3J80A 1GZSA 4CE6A 3SWWA 3NKVA 3MTIA 3MWFA 4RCVA 4RA9B 4J9VA 2LKDA 1X7ZB 4L75A 5D00A 3PD7A 1S8AA 5KKNB 5T8KC 1G5RA 2Y77A 3IKJA 4BO6A 3UWSA 1RLIA 3G9TA 2AJ8A 5KQGA 1DP4A 1CNEA 4JLDA 3BYZA 3JQCA 4PG8A 1T6NA 4QOHA 5KTYA 3RWOA 1JT2A 3TR5A 1Z0KA 4PC1A 1POWA 1IY9A 1EFVB 1RWBA 2J09A 2YV3A 3P27A 3PQ4A 3R3JA 3HB9A 3KOZA 3S8MA 1E2GA 3EGOA 4LJ7A 3CZAA 3D0OA 3GZNB 2QLBA 3OX1A 2QOEA 2WSLA 5B1IA 4LDJA 4DJ5X 2J3KA 4X20B 2W83A 1CULC 4I3GA 5ER9A 4A15A 1HBJA 3W7BA 4XZ3A 2PA3A 3QEKA 4HNQA 1FTNA 2V5UA 3PXEA 4MARA 4U7HA 1LEHA 3GI1A 4RACA 2NP7A 1DAIA 1CUXA 1N3YA 4KMOA 4B3MB 2FUCA 2QEQA 3LX6A 5FHRA 2NAPA 4IRMA 5SZJA 4B5KA 2EKBA 1PBNA 2WFMA 2IXGA 2JJ1A 5BYKA 5KZMB 4AO6A 3VHQA 2G76A 4XX0A 1EXMA 1BROA 1F5SA 1RE1A 1VE3A 1RZ3A 3I0ZA 4OXIA 4E70A 4HNRA 2NZ2A 1A8HA 4LJLA 3MRVA 4LTNA 2GPNA 3NAGA 3WAJA 3AW9A 3ETEA 5DASA 1EJBA 1M10A 2G4LA 5TT1A 4TMFA 4RZXA 4MGHA 3JALA 3CG4A 1AQIA 1MAWA 1E9EA 1PEDA 1QCCA 2CLIB 1OR8A 2VJNA 2YW9A 3UTCA 5EUQB 2XGGA 2JASA 2B25A 4P4GA 1NF2A 5JPIA 4BX8A 3BIJA 1EWVA 1DEHA 4TLCA 3SYKA 1JG6A 4B5LA 4AZ0B 2ODPA 2HR1A 1D2HA 1OFVA 4UDNA 1UPTA 5AIAA 4D0GA 1HT2E 2W5UA 2PGDA 3OFSA 4CTMA 1G2IA 4AKEA 4UXJA 2FZ4A 1EFAA 4TTRA 2X9QA 4XWYA 1DWUA 5CYFA 2M6RA 4AJ9A 1CJCA 2WIJA 1RYFA 2VK4A 4WEQA 5FD8A 3HS3A 4LGVA 2CLLB 3VFDA 1UBMS 1BXGA 1ECCA 3KZVA 4UU0A 2NO7A 2QS9A 3E7DA 1RYZA 3ISTA 4NE9A 4RK0A 4XGQA 3WQRA 4RDXA 3M4XA 4W5RA 1YR7A 1GPJA 4UQPA 3HBFA 5LUBA 3USES 4WBNB 1KO7A 1MTOA 4WLOA 1NYTA 4L51A 5LP6B 4MVJF 1TTHA 3R5XA 1BVHA 4NEGA 1G3IA 4C04A 1OI3A 1WR8A 3A4MA 1U6JA 2Q4RA 1B3RA 1J2UA 1VJ0A 2WFZA 3I01A 2RGAA 3NTUA 4OYRA 5LM3A 4CEJA 5KTOA 1GYRA 2XE7A 3HJNA 3K5WA 4RIFA 3H2HA 3RVOA 4YB8A 4W9RA 1M7GA 2H4ZA 4C0SA 4ZYWA 3PD0A 5IKMA 3RTGA 3WJAA 4PPFA 1T36A 3CNOA 2YHIB 2NNLD 3FB1A 1D1SA 1MC8A 2QJRA 1Z4LA 3RADC 4Q21A 4WPGA 3V8QA 2RB5A 5HE8A 2OHFA 2QMUA 3OD5A 2E1RA 4QDOA 3VJKA 2DTDA 2ETVA 2PUJA 1SURA 3VVMA 2WE7A 2WFLB 3QEJA 4NR0A 5IH7A 2IF2A 3K6JA 4N47A 4NS4A 1NR1A 1M1UA 3MG9A 4YMIA 3TS1A 3OTWA 2Q7DA 4DKJA 1YB1A 1HTWA 2TECE 1MO2A 1R5BA 4XQGA 2W2MA 4QJIA 4AVYA 2QRPA 3ZZ0A 2G04A 5EZ6B 1MZPA 1D5CA 5IU6A 3T0GA 2NUPA 1S0UA 1IFXA 3AGPA 3PX2A 3WJ1A 4EKYA 1G42A 2CFRA 6ADHA 2BBSA 3RTEA 4Z3DA 4M83A 3C5CA 2H3HA 1Q5PA 3UV6A 1Q22A 2PTGA 1R5JA 1S2IA 3A25A 3H9QA 5HHTA 3TAXA 3NI2A 4B40A 3NTLA 4EFLA 4KIFA 1OLOA 1N33B 5KJ1A 2EX4A 4GI5A 3AUAA 3OFJA 2XF2A 1SU4A 3STVA 3OQVA 3VR6A 1PQ4A 3RSOA 5KWEA 2NMVA 3JQGA 2YJ5A 1L5QA 1PRYA 1UCFA 2V9PA 3GMDA 3JTMA 1VRVA 1MIOB 1KGSA 3QLVC 1ULZA 4KI7A 5I8PA 1CEYA 3DJYA 1SXPA 1IUNA 4J2HA 5DPMA 1MT3A 2OXTA 5IXYA 3UWPA 1V8FA 3L4BC 4HRAA 4Q6BA 1NLUA 2WVHA 3MMXA 2XZOA 1HM5A 2C3YA 1D1PA 1U1GA 4BB6A 2X9GA 1QH8A 4EGCB 1I1OA 1E0AA 2O2ZA 1TIPA 2QU7A 3VO2A 1GAEO 4LF5B 1W581 5FBHA 3A10A 1YJXA 2QG4A 3H75A 4RY2A 1AKYA 1M6YA 4D99A 2ZJAA 1H4QA 4FK8A 1DRWA 4M7RA 1CQPA 1MAUA 4PFSA 4EKIA 4K03A 3U7FB 4F2WA 3OLVA 3JWGA 1J8YF 4YRZA 2C1XA 3DONA 5F2NA 5EPEA 4I7EA 2PIAA 4MYSA 3TEJA 4GS5A 1Z7WA 4DY4A 2YDXA 2QI9F 1GQYA 3L8EA 1E1QD 2JANA 2AMFA 1RWVA 4BV2A 2P5UA 2I2FA 3QH4A 2HWXA 3ZWVA 4MIEA 1YTLA 3L7BA 3TF5A 2WD7A 1GA6A 5F5NA 4DN6A 2F6RA 1WB9A 1EFTA 4Y2XA 4OI4A 1M34A 4W82A 2FSFA 2O5RA 2EF1A 3P52A 1GGNA 2SKDA 4NWIA 1NYQA 1TIKA 4OHVA 2R8OA 1UJBA 1YL7A 3LBIA 4HB3A 4LTDA 1CFJA 1NY5A 3VDMA 1OIVA 3I2HA 3KKOA 3BXXA 3RWMB 4FONA 4TMYA 4FLEA 3BH6A 5F7ZA 2VTEA 5EJ8A 1QR6A 2HSWA 2B1IA 3PUIA 2AXQA 2FMFA 4ARZB 1QTQA 1GPKA 3NU1A 1X3LA 3JQGB 3KELA 4TXNA 3K20A 3ICEA 1T4CB 2FZCA 1SKAA 1W30A 5C52B 4IS2A 2FKAA 4TRMA 1X8XA 3BTOA 3ESRA 1IH8A 3JQAA 1P4AA 1JFTA 3TIFA 3AJRA 1GHTA 3ABOB 4XX1A 5A71A 3T9FA 1SEVA 3QLJA 1PVVA 2REBA 3KEGA 3GFBA 4AU1A 4EPRA 4QDTA 3QBDA 4RMJA 5AVOA 3BA1A 2WIGA 1SB9A 5I9LA 2BZGA 2JEYA 2H7CA 4UNRA 1PR6A 2JRCA 4XFDA 1DCKA 1GA4A 3PHLA 4QOJA 1DJNA 4TTSA 3NYWA 4W8HA 1RKXA 4LZLA 3W1VA 5CCEA 1DCFA 2JI6A 4DV3B 4DB2A 1E79A 5DM4A 4C5AA 4MLDA 3B85A 5FBZA 4LYYA 4W5JA 1REQA 2H4YA 3JWEA 1SMKA 1QF6A 2EFGA 1Z0IA 4HGZA 2Y1GA 3V33A 4RGYA 4PN7A 3VNRA 1DIRA 4BASA 2G71A 1T35A 3ETGA 2OMKA 2AK2A 3PNBA 4QFMA 2C4UA 5TC4A 4Q1DA 3TXAA 1KSJA 3O31A 4DWJA 1D3AA 2VWPA 5H7XA 2GETA 4ZAXA 5EYPA 4DCUA 2DKFA 2ZREA 2RE8A 3H13A 2J8ZA 3W6OA 2VQ6A 2QTWB 1NW7A 3FD8A 1CUAA 3IV6A 2EZ4A 5G02A 1GTJ1 4D9BA 1HZJA 3P26A 4CYMA 3BC1A 5HM6A 1BCSB 2I1VB 1B2RA 1D7OA 3Q5GA 4O4HF 2GEUA 3O8QB 4WSOA 2B3TA 4B81A 2P8JA 3AMVA 1G59A 1P4RA 2XYPA 3NIWA 3FYUB 1XZLA 2CHGA 1TPYA 1Z68A 4E2YA 4ND2A 3E9MA 4U2BA 3QPAA 1KE1A 4J0GA 5LB2A 3WYEA 4BNFA 2P9BA 1RAHA 4E4RA 2LCFA 4H7EA 5DISB 5E9QA 1XL1A 3PHJA 3LJKA 5AI8A 3UYKA 3VUEA 3DDNA 4BFUA 1NU6A 2AN9A 1K68A 4PS1A 2R6JA 4YALA 3VPSA 3HWSA 2QRJA 1UJ6A 4YV7A 1EA7A 1N6HA 1VSUA 2AQ8A 3D3QA 4ZP1A 5AKXA 2P62A 3IPCA 1Z4MA 1U2TA 5B1EA 4NU6A 3GJSA 4LECA 1BQEA 3D8RA 3H4IA 3S40A 1PW5A 1WUYA 1WUTA 3MD9A 4CUZA 3VR5A 3F5QA 1SOVA 3AR4A 2OBFA 5HTOA 1CDDA 4H1WA 2FN7A 1IY8A 1Q0QA 2V96A 4EDFA 3TCNA 5AM0A 3H4MA 4MRMA 1WVIA 3RIHA 3U31A 3KQMA 3L49A 3NVKI 4RPCA 4CTNA 2YJGA 1QP7A 2QL5A 4N5LA 4TLAA 2XUKA 3BMCA 3UWOA 3ND5A 1ADJA 1UOQA 4ZICA 5I3ZA 1CXZA 3AFGA 3L9XA 1GAXA 4G01B 3T7EA 3QPCA 4MR7B 2GK7A 4EB6A 2FZWA 3PE3A 1VLMA 2D0OB 3JWJA 5FUXA 3RT1A 4EITA 4EQZA 5A4DA 5AVXA 3HFGA 1TCAA 4DJJA 5ERYA 2IHJA 3C3XA 1RPZA 3P9KA 1PWZA 2XZDA 5CHYA 1BE6A 4R51A 4HMOA 3UXYA 3JPYA 4LHWA 4PLVA 4QOEA 3KBOA 2QYTA 3SC3A 1MMFB 2WJHA 3KT3A 4H59A 2VYVD 5LN1A 3UJDA 4RANA 1OASA 3TSOA 2C7BA 1THTA 3VKWA 3OM8A 3MUNA 1VSBA 3HUEA 2YWJA 4NICA 5LSAA 3V7NA 1D2MA 1HYHA 3UKOA 2MSKA 4JI7B 3D9QX 3K2BA 2V6IA 3LFUA 4JOBA 3UAYA 4JI0B 3N8GA 2B69A 4FYWA 4LGMA 4NF2A 1HETA 3ZIAA 1NY6A 1OI2A 1IN7A 4AKGA 1IN5A 3RFUA 2JGNA 2H0AA 5KYUA 1KJWA 3ANXA 2NADA 1WF6A 3GUCA 3ZQJA 1QUFA 1MAVA 2YJNA 2FEAA 1XWFA 4UVDA 3VU0A 4F72A 4FLFA 1NN0A 1BJTA 3I45A 4BJ6A 5K6RA 2BTEA 3ER8A 3PXXA 1ZK0A 5E3IA 2V6JA 1SZCA 4XXHA 1MABB 1QANA 1Y8QA 3KHSA 1X8JA 2PS0A 3LQFA 2PSDA 3CLKA 3Q7QA 2IU0A 2O2YA 1C9NA 2BMDA 5JJKA 2V7BA 2A78A 3ELDA 1C0KA 4JLWA 4ZO7A 4EGJA 4I4NA 2N1BA 2XQIA 3OX4A 3MTEA 3EEYA 1KI6B 4BBJA 1TU3A 1L9XA 2B20A 2AG1A 3OEYA 4OQZA 3WADA 1C1HA 4NFLA 4OBWA 1WF3A 4MRNA 3RBAA 5K8UA 4BO9A 4MQFA 4PLYA 5TGTA 1QK4A 3RVJA 4XCXA 3SXUA 2FWBA 3DD1A 4RESA 2QMYA 3CA8A 3RS9A 1PJRA 4RS4A 2PVCA 3QYFA 5FI3A 1P0FA 2FI1A 4LI0A 4DQ0A 4EWLA 4UUAA 1U11A 4PONA 3M3HA 3AJDA 4X3OA 2XMSA 1QORA 1QS0B 1T43A 1T9DA 2NT4A 1CVLA 3B53X 1H5NA 3DZBA 3EK2A 2QP3A 1XLUA 2IDZA 3UAGA 3BX1A 4F6CA 3H5OA 5KYTA 4YS6A 1QG6A 1NXTA 1JEQA 4KMMA 3N6RA 3W5AA 2H5IA 3IVXA 1K2WA 4HDNA 3B52X 5FYQA 1GWNA 5BR7A 5DKFA 2Q2OA 3GDFA 4QFDA 3AVUA 2HWUA 4LZAA 4QE3A 5EJMA 2C9MA 2QE6A 5KYXA 5A7HA 1PLLA 4MMZB 3Q8MA 1EVQA 3DCNA 1Y3AA 3LOUA 2OHGA 2AUNA 1ZU4A 2RARA 4KFRA 4MUEA 1YT5A 3NHJA 4D9GA 4DHWA 8ATCA 3H7IA 4W7HA 1TQ6A 2Z43A 3AY6A 1VL6A 2H7XA 4U2GA 4UUMA 4RTRA 5TT0A 4L6IA 4MTLA 5HFJA 3SM3A 3ZIUA 4G4GA 2HQBA 4NBUA 3I2YX 3JQDA 4RVNA 5JS1A 3R76A 2Q5LA 4N4AA 5IUKC 4CIDA 3PIDA 2OZLA 2WM3A 3CH4B 3FNHA 4X61A 3RV4A 3CGWA 1QMPA 3WISA 4UNPA 3FRHA 5L3ZA 4CMCA 1ZSYA 2NVUA 2VCEA 4RTKA 3ADCA 1GR1A 3PRYA 3EQ8A 5ISMA 4CEIA 1XG5A 2E6UX 2F9LA 4FQ5A 3JQRA 4RVDA 4IPTA 4US0R 5BSTA 4JI8B 5H16A 4JN6B 1DLJA 4BNIA 4G4SO 1H2EA 1DEAA 3H16A 4AZVA 3MCUA 1UM8A 2WJ6A 4BMCA 4LZOA 5J2UA 1PZHA 4OVKA 3BGDA 4ZVPA 1LU9A 4HQLA 4I55B 3HYLA 3SJUA 3HLYA 4BMZA 4QDJA 1LD3A 2MSCB 3BQNB 3T3DA 1W1IA 1BWRA 3H6GA 3P2KA 4M1MA 4UHKA 4DARA 2JLUA 2C8LA 5CB6A 3RRFA 3ZNNA 4QARA 2VJMB 1X3SA 2RB4A 2B61A 5EJ2A 1BN7A 1S4MA 3A2MA 3MJHA 3K30A 1M2WA 2C04A 4D4IA 5LMZA 1L4NA 4ER3A 4X6YA 5EYPB 3NLLA 2D7DA 1RHRA 3W3AA 1NC3A 4IKPA 2NACA 3OM9A 5HS6A 4JNCA 4OQ4A 2I3ZA 4E13A 4RYDA 5LQRA 4JUCA 5T41A 3K4HA 5AUPB 2PXXA 2QZ4A 4HDKB 2YDYA 4ZOBA 1KSGA 1IXYA 1UDXA 1YI8A 3G88A 1I5OA 3GGOA 5T57A 4G2NA 4FDMA 5AJVB 4B3BA 3RFVA 3HI6A 3V4VB 4R6WA 1E3QA 1NBMA 3SLKA 1VKOA 2W9XA 4MRMB 3W0LB 3VR6D 3UF0A 4CETA 2AVNA 4XTCS 2OCGA 1J8VA 3ZEIA 1UKYA 1M75A 2F62A 1FMJA 2CK3D 1SUBA 4K1LA 5KDDA 2VUIB 1OWNA 4G0MA 3QZUA 4ND8A 4P4SB 1QGED 3WNZA 5HWSA 4OQQA 1CJBA 2OG2A 4KO2S 5LBIA 4YT8A 2OBLA 4K9DA 1YRQA 1JFRA 2GD1O 3D7LA 1QG4A 4G5XA 1NU8A 4YP6A 5FF9A 4AYTA 2LR0A 2PTHA 3D64A 3L0DA 4HZGA 3JZAA 4LAFA 1KFKB 1YTUA 3BDAA 1QIDA 5L95A 2VL7A 3HWX1 4MS4B 3VISA 3DZDA 4PSUA 1XCBA 3BH0A 4P0QB 4C0BA 5D3MA 5F23A 1DQZA 1V37A 1VKJA 2EV9A 2CNDA 2PVPA 2VRBA 3NBKA 3PQCA 4QPDA 4DR7B 2AMLA 3WLNA 3QI7A 5KX5A 2VNSA 4ZVQA 3P20A 4GBJA 4E6EA 5KYNA 1TVKA 1DEOA 4WOJA 3FLBA 4F6RB 1M2VB 2W6JA 3AB8A 1USKA 4FGZA 2OORA 4TMXA 4V0NA 3BM5A 4UVIA 4A8JB 5D2CA 4BNTA 2RAPA 2Y1OA 2KYRA 1SRRA 5K2MA 1WCWA 1PQUA 5LYJF 3DHWC 5EP4A 4MW6A 3FVWA 3OPMA 1SQGA 1T13A 1T0HB 1VSVA 1XPOA 5CDUA 4OMDA 3ZCPA 1GRQA 2FN8A 3PGXA 4ZVTA 1XTQA 3HDYA 2XYHA 5FJIA 3C7CB 1U3FA 2DT8A 1NYRA 2RI6A 3BQ9A 3H8JA 1UKEA 2ILTA 4PE5B 2JIPA 4E31A 4KR3A 2AOXA 1XLTA 5TVGA 4Y2TA 5JADA 1B14A 5B1DA 2Z2IA 4NOJA 4WCFA 4JYMA 5DMXA 1ID1A 1MIOA 4MITA 4G1EB 4UHFA 4ALNA 2Z5FA 4P86A 1MB3A 1IIRA 1H22A 5L7WA 3HYTA 1RAEA 3F7NA 3PC6A 3WSTA 3SG0A 5I5GA 3QA9A 1V8BA 3T54A 4RTNA 2EXXA 2VOJA 1R0CA 3B1XA 3C3PA 4UHJA 2PZKA 2BGWA 1VSTA 2FEXA 2I4RA 1ZW1A 4U1RA 4WZBA 3J81k 1F4LA 3FVQA 3MMSA 4ARAA 3BXEA 1NR5A 2WMYA 1Q91A 1TF2A 3IP3A 3KG2A 1ZVMA 2IYQA 1KWKA 1MJGA 1O9BA 2VJAA 4KITB 2YRWA 3HC7A 1ZRNA 4B17A 1DC8A 3DC7A 1RP7A 2GERA 3STXA 2IS1A 4QBHA 2BFCB 1GTZA 2AQHA 4UTZA 4ETIA 1QYVA 2PXHA 2PJDA 2E4WA 4HSGA 1E66A 1OV4A 1NNSA 2IPMA 3KS9A 1M8GA 4YC7A 3TQRA 3U1TA 4FFWA 2ZATA 4F8JA 2FQ1A 4MV5A 3S2EA 1UR5A 3LPMA 1R4MA 1BO6A 4JBWA 4EYSA 1YAJA 2WD7B 3H2BA 2ALJA 2X3FA 2Y68A 1WW8A 3CF6R 5HGXA 1MQ8B 3BIOA 2J30A 5FTWA 3EA4A 5BNIA 4QA9A 4FGJA 1Q0ZA 3OIYA 1NATA 1QIEA 3KTAB 4FLMA 2P77A 1QZTA 1FFWA 1OI7A 4NKRA 3WGJA 3R9XA 1U3GA 2FUG6 5E0OA 4LXTA 3CX7A 1U04A 2VAWA 2DFTA 1CS0B 1NW5A 1BD4A 4Y2HA 3IPAA 5F5XA 2JLBA 3VO1A 4QOIA 5HR5A 1Q14A 4FJ1A 5CVDA 1D2AA 4D4JA 1BQ4A 4Y9RA 1L3BA 2CHFA 2GF2A 2Q9UA 3BAZA 5TGZA 3B3AA 3T5BA 3TNFA 2NO1A 2NZ8A 2J7PA 2QDXA 2CJWB 3HYSA 3D1VA 5J63A 1PLKA 2VPPA 1XVVA 3DB2A 3R44A 2ZVPX 4CR6A 4TVSA 2XLCA 2P3SA 1IOZA 1K3FA 1UQUA 1I1QB 2IPAB 2F8LA 3EAGA 1E6EA 3JSAA 1BEEA 2IOFK 3N2LA 1WMFA 3OHSX 3QBJA 4UAGA 3K9NA 4BNXA 4OXQA 3GP8A 2YHBA 1XHFA 3RVSA 5AQEA 2WVAA 4Q18A 4OLJA 3IILA 4V2UA 4OI1A 3UICA 2JLQA 3MJDA 4YQEA 1F0YA 2GXSA 3FFAA 2XHZA 1ADBA 4F4FA 3C41J 3OZDA 3R6TA 3UW1A 1BMDA 1RWKA 4ACBA 5T64A 2YOFA 4LOJA 1W36C 3FPEA 2XRYA 1VHJA 3HJHA 1E6WA 1G8GA 4B6SA 4JEHA 1NQWA 1NW3A 1X8LA 2R6CA 4KO1S 1WZIA 4HGPA 1WX1A 3TRHA 5IJ0A 4Z3OA 3HTXA 1T5LA 2H31A 4FYYA 1FZTA 1LTQA 2Z0MA 2X9NA 4XVHA 5ALQA 5BN1A 1UOPA 3DLCA 1PGOA 2Q1XA 3DTNA 5ICMA 5E38A 2EDAA 2J4FA 4LY6A 4DM3A 3GELA 6YASA 3CEJA 5ECDA 2YW2A 4FNAA 3LUBA 4MHSA 4PYQA 1L1RA 5JNVA 3ZGZA 2ZVJA 5EE1A 1MEJA 3V7FA 4BCBA 1N1DA 2FX5A 2H0QA 2IK8A 3GJTA 3M6XA 2CV0A 2WPDD 2ZSFA 3CUYA 1ML4A 1IL0A 3PDJA 4UCFA 2DPLA 2GM3A 1GN8A 1P7VA 2A8YA 2JIBA 2R47A 3E3OA 4B3TB 1JXQA 3NP7A 1IYZA 2WINI 5SYMA 4I4TA 4AF8A 4MICA 4K0KB 1JHDA 4KV7A 1OTYA 2OZVA 2H2GA 2P1DA 3PI7A 2WUFA 4LFBB 2WJWA 4F4HA 3AERB 1S4QA 1Q1BA 3ELUA 3PDWA 5AVVA 1A9XA 1AVTA 3GZNA 2WTNA 3FPCA 1U1EA 2JFOA 3VHLB 2VDVE 4LFAB 1VA4A 2HHHB 3D8BA 2W2QA 3CF4G 1R7RA 2OYCA 4EG3A 4ES6A 4ZGBA 5C1OA 3ND7A 5HK9A 5JYBA 2GSWA 4H0CA 1Z0AA 4UNNA 1U8FO 2OL4A 3PQEA 3RF7A 2JEOA 4ZJZA 4DR1B 1B3BA 1JTVA 4Q9DA 4DW8A 1B0ZA 5TMEA 1GU1A 4QTZA 1TJ3A 1PTKA 4WWHA 3R23A 2C9ZA 4NBTA 1J6UA 3HU2A 4QAQA 4E2WA 3NFRA 1E9VA 1T9GR 3VU9B 4BKOA 4OI0A 3WI7A 1U7UA 3ENWA 4W9NA 1JDBC 3I52A 2QGZA 5DHFA 5JUWA 1VYVA 1EQAA 2XCSB 1HYGA 1YZYA 3C97A 3FWPA 1MGPA 4Q1CA 4MPRA 3ZDYB 4X66B 5IN4A 3DGEC 4HO1X 4BP3A 2KWIA 3NTOA 2XBLA 4Q34A 1JIVA 4LEIA 2V55B 5T6MA 3W8FA 3WZLA 1U2GC 4MIYA 2JPDA 4ED9A 3U5ZB 5CA0A 1ST3A 3RVNA 1L5NA 2J33A 4F46A 4KQKA 2VBIA 3OU7A 5JAHA 1NZJA 3ZDAA 4LJ4A 3FR8A 3H0KA 3VPCA 2P1ZA 3LE8A 4CKXA 3WL4A 1GU7A 3T4PA 4M38A 3BA6A 3C3EA 2HJGA 4L27A 2NN3C 2OBYA 1VG0B 1JEAA 3BMNA 3KXDA 4UVGA 1B2LA 5CT4A 4O3MA 1T2UA 2RGWA 2GVDC 2C4VA 3IDQA 1A4XA 4UHCA 4BKMA 5KUTA 4MGZR 3BKWA 3HPQA 2HEGA 1JF8A 3R9KA 1P9RA 3IUBA 3NHLA 3VAYA 2GYUA 3A1WA 2ZYAA 3OSUA 4JEUA 5FNZA 4AG6A 1ZJJA 2R1ZA 3HEMA 3CR3C 5KSZA 2AS0A 2VNIA 3NXSA 4KC0A 2VQFB 3E3NA 4D8YA 1M66A 1UK9A 2GX6A 1CDEA 3EFBA 4FIDA 1MC5A 3AEYA 5CT6A 3TQTA 3WYFA 4XJXA 4LF4B 3AF4A 2X1HA 3E5MA 3IESA 3TGWA 1QQBA 3I23A 4L08A 2RGUA 1K8QA 2II6A 1DIGA 3I42A 1D1QA 2G1AA 1VL8A 2Q0SA 2CB0A 2XWJI 2ZSEA 3I3OA 4MQ4A 2VZ8A 4OAQA 3ICWA 5KNBH 2LDXA 2I9KA 4H0NA 1TZKA 1ZOOA 2FLKA 2RG7A 1HT0A 2QX6A 4X84A 3IIKA 1GM5A 5C5EA 3RHFA 4M7OA 1QTIA 1Z56C 3MQ4A 2X42A 1OMOA 3BSSA 3JQPA 4M37A 5CTJA 1JFLA 1DG1G 1RMYA 4DJFC 4N41A 1P5RA 3OCJA 4D3SA 4BNYA 4Z6KA 5CBPA 3BTVA 3TTVA 2ZBPA 2D2FA 2VFAA 1U0LA 2PSHA 1VA5A 4C03A 2PR7A 4RSHA 4E1AA 1U0BB 5GINE 4XPIB 3T4UA 2X4IA 1JHQA 4O1IA 3T1VA 3W8EA 1DOZA 3AIKA 2IOQA 3L93A 3TL6A 4C4RA 2V3VA 1NPTO 3K2QA 1XCGB 2R5FA 1BS9A 4MGKR 5KYUB 4B31A 3MMNA 4LRTB 1DJQA 3RS5A 3DBVO 2DTEA 5EUMA 1NMXA 2OLJA 5F2KA 1KYTA 1OF1A 4RPIA 2YJ4A 4ZCLA 1YVRA 3BJMA 4PNEA 3IS3A 2VSOA 2UKDA 3M1AA 2OBMA 3PNYA 1I4DD 1GTMA 4XRRA 4IZIA 3WDKA 1MFPA 5DBIA 5LJLA 3UUFA 3WRYC 4MUKA 5ILGA 5J2TA 3BXFA 2QMHA 2OGSA 3EZ6A 5F3DA 1Y5MA 4DEVA 1D5WA 2PBFA 1JH9A 2VKTA 2ZYGA 1SCJA 2IITA 4NENA 3R0JA 4YA6A 2KQUA 2JIOA 3INNA 4ZOLF 4ZV9A 3T9CA 3LMKA 3N76A 1JR3D 1U0EA 3CV3A 4N0DA 4OK3A 2HSDA 3EZXA 5ADHA 1RI2A 4EHIA 2QJFA 5CK4A 1YA8A 2JJQA 2XD9A 3TX6A 4I1RA 3L7NA 5IC4A 1T0BA 3AKEA 4PZ9A 5KOHB 4HC4A 1US8B 1GVHA 4C3OB 2I4TA 3ZV7A 1E2FA 3A2LA 4R71A 4P22A 1T1EA 4FCVA 4J76A 4TM7A 3AHIA 3ENKA 4QO8A 1M6NA 2YXEA 4JXZA 2ADMA 3WJ2A 4B47A 3SJCA 3HJTA 2AKAB 2P68A 3DLAA 4FWTA 5T4BA 3UOWA 1EINA 2BRUA 2HHCA 2APJA 3DHYA 3MN1A 1M2JA 4G5HA 3PT9A 1YHZA 3U7GA 4MP6A 5E7MA 4LBVA 3UBTA 2JFQA 3FOZA 4UHHA 1VLHA 3NG1A 3UB3A 1NQOA 1Y1PA 3K72B 4PGAA 2CUKA 3R6LA 1N34B 4RVCA 4HLUC 1HC7A 4XH9B 5ALIA 4M1YA 2NSDA 4CG1A 5LQCA 1KTVA 2HNAA 3CSUA 2J3LA 3KWJA 4YIKA 4PXYA 5AVRA 2GEDA 1JQ3A 4ID9A 3TEFA 4OY3A 1WDWB 4K2HA 4F60A 4V1CB 1B8VA 3GD5A 1W59A 1O1YA 2C07A 3PHCA 4A8JC 5BV2P 3M81A 2PL5A 4J4TA 3DOOA 4FN5A 1Z0ZA 3VBEA 3R4VA 2BHSA 4K7JA 3B51X 4CCAA 1H2BA 3D2BA 3PLAE 2OPHA 3X1JA 4D4KA 3IXQA 3ZJVA 4DDTA 4L5AA 4JLOA 1VMAA 2GCPA 1U9JA 2FW0A 3PR1A 5EJ6A 1JWBB 4P7JA 2EFDB 2XT6A 3JVIA 3RU9A 2I22A 4N6GA 5L40A 4X8OA 1CZKA 4JJFA 1SA0B 3J7TA 2WQZA 4MIKA 2H9YA 2VNJA 1EE1A 2YQ4A 5EXTA 3TLMA 2B36A 4AJ1A 4BNLA 4XWKA 1PN3A 3IBFA 4IINA 1X7YB 3WLMA 3T3PB 3CH7A 2XMZA 3WZ2A 4XWTA 5EWJB 4CWAA 3ZH2A 1CP3A 4KO4S 1PNTA 2LTAA 3O74A 3I6ZA 4G5YA 3HB5X 1PSWA 3OQMA 1A04A 1U7ZA 3CKYA 3DGFC 4QXRA 4XSVA 2NVOA 2MR5A 4FBGA 3M3DA 4GR5A 3UT0A 5ESDA 5FUQA 1FL9A 4I6GA 1C50A 4FB4A 4RMNA 3UBMA 3QOXA 4L8YA 3ZY5A 4BZWA 4EZIA 1PKEA 4LVOA 5KYWA 2D8AA 3N86A 3FRIA 1X94A 3EZLA 4PF1A 2FOXA 3ZHQA 1XHEA 1DWOA 4XASA 3SYLA 4AXXA 4I2VA 4IWYA 4NC9A 2MJLA 1P1CA 2FPUA 5CA1B 1XTVA 3L7IA 4FEEA 4Q9KA 5KPJA 1J25A 3A9VA 3GAMA 3Q8XB 1TO2E 1COWA 2QE7A 2CE7A 1PWEA 2CDNA 2O2SA 3F4BA 2M6SA 4CLOA 2ZTMA 3ZCVA 2QKYA 3PPIA 1PT8A 1F4VA 3PHGA 4KNYA 1CDZA 2PNJA 1GJRA 2HI0A 5E6UA 4ZV4A 3M0EA 3C15C 3PNLA 5BYBA 2GZ3A 1Z17A 5C3UA 1OYVA 4DSNA 2ZRCA 2ZRDA 2R9VA 3B2NA 2H06A 3QKRA 3P0RA 1J9EA 4URWR 2ECFA 1RRPA 2CMHA 3T41A 4UBKA 1E5TA 3Q7IA 1OPXA 1JFSA 3O1HB 4IJVA 1U0GA 5F78A 3KJGA 1AURA 4E5DA 1E5XA 3K3PA 3FGZA 3ABSB 4DTCA 2Z8ZA 5K4AA 2NTNA 3M8KA 1P9NA 2WAMA 2HZ7A 2EP8A 3KQYA 4NYIR 2ZRNA 1DCTA 1GKUB 2IYZA 4A0HA 2GJ4A 3EG9B 3MBKA 2H4JA 3H5NA 2Q3FA 2I0FA 5SICE 3BFPA 1NN5A 4BWYA 4TSFA 1TJNA 3FMPB 3OZ7A 3H65A 5AVSA 2ZB7A 1PFVA 3CPJB 3L4SO 3WYCA 3SEFA 4R4JA 1ENOA 1FNCA 2V7UA 1MR3F 2VH5R 3IIEA 2O14A 1Q7RA 5FO0A 3NAQA 3TQSA 3DKRA 4MCIA 2BBWA 4I5EA 3M6UA 4LZJA 2E0IA 4I5FA 5MDHA 1XRSB 3DOJA 1O08A 1WVMA 3LKZA 3AESA 4X7PA 1G66A 2I4MA 3IDFA 1BA2A 3BTSA 3IYLW 1PL8A 3NHBA 4AY4A 3KU1A 5AK0A 1N32B 3Q8LA 3OCXA 5EN4A 3RO7A 1LQUA 3W1WA 2H8GA 3S44A 3O03A 3UJHA 5DWVA 4EVSA 3P71T 1CQJA 1ZGJA 1FYXA 2IIQA 1Z6ZA 2B2NA 3G1UA 4PXAA 3L0ZA 3TLYA 2AE2A 2XX3A 3RWBA 1MX1A 2XUFA 2Z2ZA 5GONB 5FR2A 5I8ZA 3OJLA 1LJLA 2IVFA 4BYMA 5C5IA 3VUFA 3RSHA 5ITSA 5KSPA 3PSAA 1M1NB 1CF9A 4BYGA 1YCGA 2ZM5A 5BN4A 1H1LB 4M76B 2VUHB 1FFHA 3FBTA 3ILHA 4AJKA 1G8PA 2IH2A 4AZTA 4WUTA 5CIYA 4OBBA 3RLFA 1Y8CA 4MQFB 1MKYA 2WICA 2NW6A 4KEAA 4EAQA 4CM4A 1LW6E 1SOAA 2BHTA 1E9RA 2L17A 1M2GA 4JV5B 4US1R 4TQ9A 4DAOA 1CJMA 4ER0A 1U9IC 4PG5A 1A9ZA 4MQEB 3X44A