4G4GA

Crystal structure of recombinant glucuronoyl esterase from sporotrichum thermophile determined at 1.55 a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
CSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
source organism Myceliophthora thermophila
molecule tags Hydrolase
molecule keywords 4-O-methyl-glucuronoyl methylesterase
total genus 134
structure length 367
sequence length 367
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4gA00
3IA2A 2YXPX 1LZLA 4Y2TA 2O7VA 4MQMA 5AJHA 2AXEA 2FJPA 3H0CA 3VJLA 4DMFA 5AI4A 3L1JA 3HLKA 3YASA 2VJBA 3QM1A 1EDBA 5E4TA 2H9YA 2JBWA 3FCYA 3R3XA 2OCGA 3EQ8A 5E2IA 4FKBA 1ZGCA 2QT9A 4UHEA 5AKLA 4G8DA 1K63A 5LZ5A 1R88A 4BDTA 1ZICA 3JWEA 2WIDA 4A5SA 3H2GA 3G8YA 5AKHA 3WK8A 2J3DA 3WZLA 5ALOA 4CCWA 4L0CA 3G02A 1GQRA 1FFBA 5F4ZA 4QWWA 3F67A 2XT0A 4X6XA 2XUJA 4OYYA 3ZLTA 4B9EA 1DX4A 3I28A 2EDAA 4ARAA 4BVJA 1THGA 1FSSA 5C8VA 1AQLA 2HRQA 4PSUA 2VQ6A 1CUJA 5AK6A 3G7NA 3WK7A 4BCBA 2QUAA 2IX9A 4BCDA 3VJMA 2QTBA 2ZJFA 3NGMA 4CI9A 1CUHA 4DSAA 3HJUA 3IBTA 4PQEA 3C5WP 4B9AA 1GZ7A 1XZHA 5ALJA 2ECFA 5ALNA 5AI9A 3RM3A 2HA3A 3K6KA 2Q0XA 4UHHA 2QOEA 1XZLA 4QDTA 5JAPA 4H7DA 4GI1A 5LZ2A 3B3QA 1YB7A 2YASA 3KXPA 2QJWA 1CFJA 3C70A 4Y9SA 3UUEA 2QJRA 3A70A 5FUMA 5K3FB 1ETHA 1CUFA 2CEKA 1YCDA 1EVQA 4Y2XA 1LPBB 3O95A 4BP9A 3C5VA 1H22A 1R50A 3D2AA 1VJ5A 3PICA 3HXKA 1LPPA 1AX9A 4B82A 5EHNA 1WM1A 3TRDA 4JUIA 4NMWA 3M83A 4J0KA 1VXRA 5KREA 1IUOA 1RP1A 3V1MA 3FCXA 3S8YA 5T4HA 4UFNA 5FRDA 2OCLA 3VDXA 5AI6A 3WKAA 2XMSA 3SWWA 1F0PA 2JGJA 3OURA 4ARBA 5DJ5A 4B85A 1OCEA 3HRHA 2QZPA 4L9AA 4BAUA 1O6GA 1WB5A 5FDFA 2XQFA 3FOBA 3WKBA 2QXUA 3UUFA 1O6FA 1A88A 2C0QA 3OC0A 3I2KA 3PUIA 2WJ4A 4M0FA 2XUKA 2DHCA 2PBLA 3STWA 2I78A 2XB6A 5AI5A 3F8SA 5IH7A 2RIPA 2I03A 2ZJ7A 3W9UA 5E4YA 3RARA 4UBJA 3WZMA 1DINA 2HM7A 2R8BA 3I2GA 1JMKC 3DNMA 4XWGA 1ACLA 3DS8A 4A23A 5JAUA 4PO3X 2PSEA 4K6GA 1G42A 2CMFA 4Y2PA 2NW6A 3IUJA 3E0XA 3H2JA 1P0QA 3CN9A 1ZJ5A 4CCYA 3FLEA 3ZWQA 4IQ4A 1DWQA 1ZIXA 1R4ZA 5CH8A 5AH0A 1CUZA 2QXTA 1MX5A 1AUOA 4Z49A 2PSFA 3DCNA 1QIFA 2C5GA 2DHDA 4ZV7A 2XMGA 1QO9A 5FXMA 1AMNA 3VVLA 4X71A 4EY4A 4AN1A 1F8UA 5AI0A 1Z68A 3IB3A 5K3FA 1MN6A 1P0PA 2WU4A 4U2GA 1J06A 3C8HA 1EINA 1MPXA 1K4YA 4LKOA 1DT5A 3KWJA 3DOHA 2PU7A 4BDSA 5AIBA 5JADA 5ALQA 4HAIA 3STYA 3KSRA 2GYVA 3WKCA 2E3JA 1Q0RA 3H04A 1MTZA 1YA8A 4F21A 4QLAA 2FX5A 3SK0A 3WQHA 1TIBA 3HACA 3AZPA 5AK3A 3WMRA 4ZGBA 5AI8A 3D4LA 3EIOA 5K3EA 5AK5A 5AK4A 4E15A 1CQZA 1ORVA 4M0MA 4W63A 2PVSA 2AJ8A 1UXOA 3L1HA 1E89A 4B84A 1VXOA 4KE6A 5HKAA 2BKLA 2HU8A 1GKKA 2DQZA 3C6BA 1DTEA 4Y7DA 1WPRA 1XZDA 4E14A 4CIAA 3JYHA 5DTIA 5ESRA 4U2DA 3C87A 3DLTA 1U8EA 4Q05A 3WL8A 4B83A 4QWMA 1XRNA 4H7IA 4F60A 3HABA 1VOTA 3QMVA 3FLAA 3F96A 5JZ9A 2XUGA 4WY5A 5C7YA 3M3DA 2JGKA 4HTAA 1TCAA 5HFNA 1H2YA 2K2QB 3BIWA 3WL7A 3G0IA 5ALLA 1XZGA 1DT3A 2XUHA 3G0DA 1GGVA 4BRZA 1KEZA 2H7CA 1Y7HA 3Q0TA 4J3JA 4EZIA 5BV7A 4G1FA 4HXEB 3A2LA 1CUVA 4BC0A 5EIHA 1QO7A 2XQIA 2GYWA 4P93A 4W1QA 5ALWA 4LIPD 4MWTA 3WK5A 5JASA 4GBGA 1LBSA 3G0CA 2Y6UA 4KAJA 3M82A 1OXMA 5JD4A 1Y37A 1Q0ZA 1CUCA 3CCBA 4RE5A 1QIIA 4UBIA 1CUGA 4I3FA 2XUFA 3ANTA 2PX6A 2XMZA 5AICA 3R41A 4L72A 1BEEA 5AKKA 4WFKA 4DNOA 4UBOA 1ZI8A 3CCCA 3R3UA 4FMPA 1UOQA 2CKMA 3G9ZA 3STUA 4JNCA 1A8UA 1MO2A 2VSQA 2OLEA 5A7FA 4W1SA 3BF8A 2VT7A 3WK6A 1JU4A 4C87A 4XVCA 2WUFA 2V98A 2BJHA 3I6ZA 5I7UA 3KD2A 2AJLI 1WOMA 2BGRA 3FWHA 4KYVA 5T4BA 1GPLA 3WWDA 3NWOA 5AKEA 5E4JA 5ALMA 4AN0A 2WLSA 5DYTA 4FLMA 1EH5A 1U65A 1QFSA 4BE9A 5JZBA 1CLEA 2HU5A 2X76A 4QDXA 4EHBA 4V2IA 4L3WA 3WJ2A 4UBNA 1G5FA 3H2HA 3W05A 4Y2QA 1K8QA 2QKYA 2W22A 2OCKA 1DQYA 4WDQA 5A7GA 4BTLA 2PU5A 3HYSA 1NX9A 4H7JA 2HA2A 1CUXA 3O9VA 3QYJA 1FJ2A 2EEPA 5J3JA 2XMBA 4UHFA 1WB4A 3K9BA 5K3BA 1DU4A 2Z8XA 1J2EA 1TCCA 5DNVA 1UKAA 3R3YA 2HA4A 1GPKA 4IH1A 3KOOA 3H2IA 3MUNA 5EIEA 3T4UA 5CBKA 4H77A 3MUOA 3RK4A 2I3DA 1H2WA 2WIKA 2WUEA 5EHZA 2B20A 1DQZA 4AX4A 4U2FA 3WWOA 5JATA 4BAZA 1OILA 3H19A 1IVYA 3T52A 2WILA 1W1IA 2O2IA 1BRTA 4WFIA 4E11A 3P2MA 4J0HA 2PM8A 2H7XA 3W9BA 4FNGA 4KACA 4QDZA 5KWIA 1Q83A 1QIGA 1PJAA 2OGSA 3MVEA 3H17A 1BU8A 5CXXA 2RHWA 2RAUA 3UMJA 2HIHA 2Z5GA 1QE3A 5BOVA 1JU3A 2Y1KA 1SCIA 5H3HA 4AO6A 3E3AA 2P8SA 4NVRA 5DYWA 4N8SA 4BAGA 4J0CA 1YR2A 3BDIA 4UBMA 3O4IA 3VISA 5JALA 4C88A 3FYUC 2WM2A 2YYSA 3H1AA 4U2BA 3KWFA 4QZVA 3PF9A 1W4LA 3ICVA 2Y6VA 4X7BA 2BUCA 4XX1A 1E8MA 2ZJ6A 1JJBA 4X85A 2WQZA 4H0CA 5FKJA 2ZVDA 1R9MA 3BF7A 5HZGA 2WHPA 5ALFA 1VE7A 4JEIA 2WIGA 3FAKA 1H2ZA 3I6MA 4KRXA 1XRMA 5EFZA 5JAOA 1VKHA 4H7FA 1XRQA 4KR0A 3IIIA 2HADA 5DNWA 4EA6A 7YASA 2Z3ZA 4N8EA 4OD0A 4XJVA 2ZSIA 4FNMA 1LBTA 5FLKA 4MYSA 3FLBA 3WWPA 2XMDA 3BWXA 3CN7A 4BBZA 4ZXFA 1MX9A 1CPYA 1YS2X 2OGTA 4B81A 2OAEA 2GBIA 3V1KA 4EBBA 1LPOA 3DDUA 3OPMA 4RNCA 3LP5A 1MU0A 3ESAA 2HFKA 3WKDA 5HQ3B 5HF8A 4PV7A 1WB6A 5LZ4A 1MJ5A 1ACJA 1QZ3A 5HF9A 4YASA 1B6GA 1RYYA 3DKKA 3I2IA 1ZOIA 1LPNA 1JI3A 4DNFA 2C58A 4GDMA 1IUNA 3DEAA 3FVTA 3G9XA 3D3NA 1L7QA 3GFFA 3PF8A 3WL6A 3FBWA 2WJ6A 4IO0A 5AP9A 2WJ3A 3IUQA 1NU8A 1FFEA 1CRLA 1ZIYA 2D0DA 1EDEA 4Q1VA 5ALUA 3ICWA 1SC9A 4ZWNA 1MAAA 5ALHA 5CTAA 2ZYSA 5C8XA 2O7RA 2BUAA 1XLVA 1VE6A 3LLCA 2VEOA 4X93A 2B9VA 2VJAA 5AM5A 4INZA 5HFAA 2CB9A 2XQGA 3W2TA 2JF0A 3WWEA 4WY8A 4LHEA 5DNUA 3U1TA 1ZD2P 1QGED 1ODSA 1RWQA 2GBGA 2GBFA 4X6YA 1GPNA 3GUUA 2JGEA 1CR6A 2O2GA 2ZYHA 4EUSA 4HXGA 3AJAA 1VA4A 1N1MA 4IH4A 2GBCA 1CEXA 1HQDA 2ACEA 1UKBA 4FTWA 4RGYA 2QVBA 3OTQA 4HS9A 2V97A 3M81A 4OB6A 1FFAA 1YA4A 2XQJA 3VJKA 3PDCA 4Y2VA 1XROA 2AJBA 3EQ7A 5HCUA 4C89A 1UK9A 1T2NA 1WCYA 4LXIA 4KAAA 3ZPXA 4G4GA 3LCRA 1L7AA 4DMHA 1XRPA 4OPMA 5IKXA 3AFIA 3F98A 3LIPA 3C6XA 4OB8A 1LNSA 4OYLA 5FOQA 1EHYA 1ORWA 2IIVA 4DMCA 1ZI6A 3BIXA 2H7YA 3DQZA 4CG3A 2PSHA 1AZWA 4BYMA 4B80A 5FV4A 5SYNA 3OM8A 1CUYA 5JANA 2ES4A 2HA0A 3NOXA 4AO7A 4Y2RA 4CIBA 3WLAA 5CT5A 3AINA 4H35A 3PE6A 5ALGA 2XDWA 1EB8A 2WHQA 2HFJA 3PFBA 2X5XA 4OU4A 2VTVA 1E5TA 3AZQA 4Q3OA 5AO9A 1YB6A 5EHQA 3EF3A 3QITA 2GZSA 2G5TA 4DNPA 2BUBA 3D2BA 5CT4A 2RGUA 5JYCA 4MYDA 1BE0A 2EDCA 4DMKA 4TPKA 3E4DA 3ED1A 2XUQA 3GROA 2O2HA 4KAFA 2C4HA 5K5EA 2JGMA 1A8QA 5JD5A 1BCRA 1GT6A 4Y2SA 4NZZA 4HRYA 2BFNA 1N8SA 3SX4A 3B12A 3HSSA 3U0VA 1UOOA 1VLQA 4A16A 1UK6A 2WKWA 1TKRA 1ODTC 2G4LA 1BROA 5ALVA 2DR0A 4U2EA 1W75A 4UHBA 5LZ7A 1MNAA 1BS9A 1CIJA 1X70A 1XZKA 4AZ3A 1EA5A 4ZRDA 5HKBA 2WIJA 1LPMA 4ITVA 3QH4A 4FBMA 1BN7A 2XUOA 2PPLA 2PL5A 4BCCA 3R3ZA 1HPLA 1EVEA 4MQLA 4UHCA 4CG2A 3WKEA 1LPAB 2ONCA 3D7RA 1E3QA 1F6WA 1DWOA 1E8NA 4PSCA 3WWCA 4K6HA 4X91A 4B0OA 5DTJA 5AM1A 4EY6A 4GLBA 2HDWA 2CBGA 5HK9A 4G5XA 4B7ZA 4J0DA 2JEYA 4M0EA 4EY8A 4H7EA 4BE4A 1U2EA 2VAXA 3C45A 4UFPA 2LIPA 5CXUA 1SCKA 3DD5A 3O4GA 3V9AA 5T4FA 4S0XA 2JGFA 2DQYA 3HZOA 2QMQA 4MWSA 2DHEA 3I2FA 3WYDA 3GA7A 4X92A 2WG0A 1AKNA 1J1IA 1XQWA 5C81A 3AZOA 1ZGBA 3ZI7A 2WG1A 1BEZA 5LKRA 2WSLA 5JD6A 4K6KA 5IVDA 4X00A 5CURA 4P92A 5IVHA 4KE8A 2J4FA 1LGYA 1GQSA 4N5HX 2WUDA 1Y7IA 5DLPA 4J7AA 5AKIA 2OCIA 3TGLA 3E1GA 4G4JA 1YS1X 2I3ZA 4GECA 2C5FA 2QUBA 5A2GA 1FFCA 4P08A 3STTA 1LPSA 4HZGA 4J0IA 4H7HA 4X95A 3DYVA 1YSCA 4D9JA 3R3VA 1BN6A 3G9TA 1UT6A 4QLOA 1K6EA 4WJLA 4AO8A 3OOSA 4BRSA 3Q8WA 3WYNA 2PSDA 5ALEA 2AJCA 1X2BA 2VT6A 4LYDA 1CUUA 1UOPA 2PUHA 4N8DA 1UKCA 2JIDA 4Q3LA 3SC2A 2WHRA 4IH9A 1QOZA 4BVKA 4EB0A 4NS4A 2VATA 4H18A 2AJDA 2XUIA 1JJIA 3N2ZB 4G4IA 3BJRA 4H7KA 4K5QA 4BZZA 3I2JA 3MGAA 1AURA 4FOLA 4Q82A 1XLWA 1XRLA 1EK2A 2XI4A 3L1IA 2HRRA 3D2CA 4QDUA 3G9UA 1G66A 3R3WA 1VZ2A 1MAHA 5DWDA 4YPVA 1XZFA 5JIBA 5AKXA 4QEKA 4KJXA 3FNBA 5YASA 4BC1A 2ZYIA 1QIJA 4G8CA 3QVMA 3CXUA 4JYPA 5EGNA 3IURA 3G0GA 5KBYA 5BWBA 4C4YA 3S2ZA 1XZJA 4F0JA 2VJCA 3I2HA 3IVMA 3JW8A 3ESCA 5SYMA 4X6UA 1U4NA 4B0PA 4FDMA 5K3CA 3GZJA 5D3ZA 4AMZA 4IHAA 2C7BA 1IMJA 1N5MA 4BVLA 3F9CA 4DM7A 4I19A 3BDVA 4FWBA 5K3DA 4FLEA 2XUAA 2WFMA 3QPCA 5FPPA 3DOIA 3VVMA 4CFSA 4LYEA 2HA7A 2J4CA 2GZRA 2ZSHA 3N0TA 3V1NA 1UK8A 5HF6A 1XKTA 1TRHA 2WTNA 4RPCA 2FJ0A 2JGLA 1QIHA 1M33A 2WG2A 2Y2UA 3H1BA 2WHPB 3GBSA 3LS2A 2FUKA 1XKLA 2XLCA 2D5LA 1AC5A 1ZJ4A 1XQXA 3ZLUA 4WDRA 2R11A 4U2CA 1UK7A 4JH0A 5C8ZA 2HA5A 4BATA 4ETWA 2ZYRA 2BCEA 3F97A 3KDAA 2ROQA 1IZ7A 3WK9A 2J3QA 1X2EA 1QIDA 4P9NA 3W06A 2DFPA 1EX9A 1XZIA 4Q3KA 4FHZA 5JAHA 2OG1A 3FVRA 1DX6A 5JARA 3K2IA 2QS9A 4PW0A 3O0DA 2DSNA 1E66A 1JT2A 3RKSA 2H1IA 1KU6A 3BXPA 2RI6A 4FFWA 1D07A 1WPXA 3R40A 1USWA 1J07A 2VA9A 1A8SA 4G9GA 1ZD4A 4WFJA 5CT8A 5JZSA 4AB1A 5FPQA 3DL7A 4UFOA 5D7BA 1YAHA 3AILA 1CVLA 3QPAA 1MX1A 5LYYA 3D0KA 3WIBA 1K5PA 4N5IX 1EB9A 2IITA 6YASA 1SCQA 5AOAA 5IVKA 3QMWA 4DSZA 1UFOA 3GELA 2WFLB 3C6YA 4EY7A 3ILSA 1CQWA 1FFDA 1XZMA 1KU0A 2G63A 4KE9A 5ALTA 5K3AA 5BWCA 1E8DA 2XUDA 2WU3A 4HXFB 1W52X 2ACKA 5ISMA 1UZAA 1HL7A 2C0PA 3VXKA 1F0NA 4TVKA 3A6ZA 5A7HA 1CUEA 2VJDA 5ALSA 5KWJA 2OXEA 4X3CA 5AM3A 4MXDA 4ZREA 2VF2A 2OPHA 2PSJA 4K2AA 1CUWA 4FLFA 1R1DA 5HQ3A 5DYYA 4PSDA 1AGYA 5AOBA 1C7IA 2WFZA 4TGLA 3WIOA 3B5EA 1GKLA 2OQVA 5CT6A 4DYHA 3A2MA 1XFDA 2XMRA 4YK7A 4ZV9A 1EXWA 1EK1A 2V96A 1HDEA 1HLGA 1WHSA 2G5PA 4QDOA 5AKZA 2XMQA 3FSGD 3IUMA 4UUQA 5ALKA 2CZQA 1XLUA 5EI5A 4X90A 4CCYB 2W6CX 3D59A 3AIKA 3DYIA 2ORYA 1XQYA 2CUTA 5EHXA 3WI7A 1ODCA 3EQ9A 1H2XA 5LZ8A 3NUZA 4DLNA 1JKMA 3TJMA 4OSEA 4LXGA 3ESBA 4PF1A 3HC7A 3STVA 1DWPA 4OU5A 3DL4A 4BTVA 3OG9A 4FBLA 1R9NA 5HK8A 1HBJA 3FYUB 3I1YA 4PNZA 1T4MA 1TAHA 2XUPA 2Y2VA 4W9RA 2Z3WA 1QTRA 2QR5A 3IDAA 3I6YA 1QIMA 3C43A 2RONA 4AXBA 3A2NA 5FP0A 1CV2A 2B4KA 1QIEA 4LXHA 1CUAA 4RE6A 3BL8A 1QTIA 3QZUA 4X97A 3X3HA 5ALDA 4OCZA 3QMMA 3AIMA 4UBLA 3AUKA 4QNNA 4Q34A 3STXA 4HRXA 3PI6A 4UPDA 4BZWA 2HL6A 5ALZA 3BJMA 4KE7A 4C4ZA 5ALPA 4OUKX 3BE8A 5A71A 5D6OA 4Y2YA 4Y2UA 4KRYA 1ZI9A 4GW3A 1VZ3A 3IUNA 2B61A 2OGZA 1P0IA 4B6GA 4GHWA 5AKJA 2UZ0A 1MNQA 5LZ9A 3O4JA 1XZBA 4BB0A 4YX9A 1PV1A 1IZ8A 1R3DA 1C4XA 3WA7A 1QLWA 1YASA 4JYMA 1YAJA 1H23A 1UWCA 5LLSA 3D5EA 2V9ZA 4CG1A 4QA9A 3G0BA 1BCSA 1ISPA 1JMYA 3ZLVA 1P0MA 2OAGA 1LZKA 4UBKA 5HF5A 3ESDA 3C8DA 4QE3A 4ROTA 3H2KA 1MT3A 3DKRA 5A6VA 4MEAA 5I9IA 3O4HA 1HKHA 5LIPA 4W1RA 3O9MA 1CUBA 3V48A 5CRIA 3DJYA 4UHDA 5ALRA 3VKFA 1I6WA 2PKYX 2RHTA 4EY5A 4AMYA 4X94A 5AM4A 2HA6A 1WHTA 4DNQA 1TQHA 1W76A 4DIUA 1GXSA 3PUHA 4J03A 3R0VA 4C01A 4GXNA 3TEJA 4KEAA 5A62A 1QJ4A 5CW2A 3AIOA 1S8OA 4J0GA 2HU7A 1XQVA 2BGNA 3QBJA 4DGQA 5I8PA 1XZAA 2WUGA 5AM2A 2XQKA 5IVIA 4DTCA 1XRRA 1C7JA 1B41A 3RLIA 5AHXA 5D3KA 5AKYA 5AM0A 1CUDA 3ANSA 1G4HA 2X8BA 4G9EA 1JJFA 2YH2A 1LLFA 3FSGA 1ZD3A 2WIFA 3PFCA 5ALIA 4E46A 2QM0A 2CJPA 2OQIA 1QFMA 4XIIA 1A7UA 4ZI5A 1IUPA 1THTA 3IULA 1W6RA 2Z8ZA 2BAGA 1CUIA 1TK3A 4WCVA 4AQDA 2WFLA 4GWLA 2DCMA 1XZCA 3I1IA 2HHAA 3HI4A 2VAVA 4MJ3A 4F5ZA 1SFRA 4HVTA 5ALYA 5EIAA 4MEBA 4I4CA 1CUSA 2GYUA 4O08A 1L7RA 1SOMA 5CH3A 1NU6A 2JGIA 1N5RA 1ZD5A 4J0JA 3QPDA 5ALXA 4BP8A 2JEZA 3ZV7A 2XE4A 3HEAA 5CT9A 3W04A 3WA6A 4G8BA 1EI9A 1JFRA 3WK4A 1PFQA 1TCBA 3H18A 2PUJA 3LIIA 4AZ0A 5CH5A 3FYUA 1QONA 4W1PA 5LKAA 4GEGA 1VA5A 5LP1A 2QRUA 3FYTA 5AKGA 3WL5A 5AOCA 1QIKA 1XZEA 2WTMA 5AIAA 5T4EA 3WJ1A 1Q84A 2XLBA 5CMLA 3V1LA 4C6HA 2XMCA 1EDDA 3EBLA 4OB7A 4FFVA 3C6ZA 4C4XA 4Y2JA
chains in the Genus database with same CATH superfamily
4J6EA 1UXKA 3IA2A 1X86B 3Q15C 4ZK2A 3KM0A 1Q95A 3KTOA 4JQOA 3OHMA 4N48A 3DV2A 2FGJA 2YXPX 4J9UE 1MRSA 2XDAA 5EE3A 5DI3A 1E3DA 4DQKA 1FUIA 1NR5A 1RQNA 2EIHA 2VCEA 2Y4NA 2ZBUA 3EY9A 2DM6A 1W6UA 3GLHA 1G5RA 1LX7A 1OQAA 1ZINA 3NEJA 4FONA 3TIIA 4BU1A 1P6QA 4I5IA 4REQA 3CB4A 3F5SA 4MQMA 4F46A 2XJ4A 1VL8A 2G08A 3JX9A 4TQ9A 3VJLA 5TF4A 2FEXA 2Z4SA 4RPHA 2J08A 1NDQA 1SUFA 2YMMA 1G1AA 3B85A 4FGJA 4UU7A 3RJTA 2A57A 2GERA 3PRJA 4IY1A 1IY8A 4L4SA 3YASA 2VJBA 1YFJA 2K5UA 2KJQA 5A05A 2I3BA 3FPFA 3NHBA 5FPSA 3UWDA 3N2KB 3SFVA 4DCGA 2HGSA 4F45A 1L3BA 3ORSA 4X8HA 5L8VA 4QHTA 2H9YA 1YS4A 2FEKA 3EC7A 3FGOA 4K6OA 4MS1B 4BKOA 3NHKA 4BOYA 2DPXA 3ABQB 2OCGA 3HVKA 1F2VA 3PPXA 1NYQA 3EQ8A 5F33A 1PVOA 2B2CA 5E2IA 2B94A 3GFTA 4M1OA 2PMDA 1ZGCA 5C5DA 2DLCX 4X84A 4FT2A 1E7MA 3KUKA 5KYVA 1JHPA 3F6EX 4LQLA 4QEDA 3T5MA 5FBWB 4I1UA 2WWIA 3J81k 1OAOA 3AONB 5JXWA 2X0NA 2EWMA 3H5AA 3G88A 4TS9A 4QGGA 4X0EA 3H2GA 3AL3A 3EPLA 5TS3A 2X3FA 3OPYI 3G8YA 2VSFA 2GF2A 3R0ZA 3NP7A 5AKHA 4CCWA 2C5EA 2C57A 2ZB4A 3AERB 3DZHA 3TB4A 1KQ3A 3G02A 1LDEA 4WZAA 1K4MA 5F4ZA 4LJRA 4QWWA 3L4BC 3C85A 3MB5A 2XT0A 2AJTA 4WADA 1U81A 1R4NA 2GH1A 3W5VA 2AOVA 3MOGA 4AG3A 5C8YF 1XCJA 1D4FA 3Q6NA 2FMTA 2EDAA 1FVHA 2UVQA 2VP4A 1K98A 1FCJA 1ADFA 1XP5A 1PL7A 3FBGA 1T9ZA 3I23A 3G59A 5FA8A 2A0UA 4OX9B 5LQNA 1JHDA 3EVCA 3ZDYB 3PTAA 4ZCRA 3A9CA 4LPKA 5C8VA 1AQLA 5CGQB 3NCHA 4D1YA 4ALIA 4KKVA 2CBXA 2H2IA 3B7PA 3E53A 3ZHZA 1CUJA 3HJGA 4HEA6 1O94A 4LF9B 3KAJA 5KNDA 4DKJA 1XJCA 2J7PD 2NZJA 4EM6A 1BJTA 2UZ1B 2Q3BA 2EGGA 1Y3CE 2ZP1A 1GG5A 4KPGA 5KYXA 1P8JA 1N2EA 1L2TA 2QN1A 3VO9A 5K0FA 2W2XA 3RBVA 1H69A 4ZVSA 3O26A 4QVKA 1GFIA 4NJMA 3B89A 1DX9A 2NNLD 4C0HA 1DJPA 1IFXA 3EAFA 1IBCA 2JANA 3HJUA 4QUGA 3C5WP 1GZ7A 4HDKA 4LISA 1NVDA 3T9CA 1OYOA 1P6XA 3BXEA 1E5XA 2K87A 5AI9A 1XVIA 1JHRA 3PC6A 2WYOA 3DXYA 4GH5A 4TMWA 2HA3A 5JSQA 5KTYA 1A1VA 2BTQB 4AAYA 5J43A 5KJ1A 3HQ4O 1Z0FA 4DJ5X 4CLRB 1U1DA 2AC2A 1RRFA 2OZPA 3T0FA 4H1VA 4ENQA 5AVTA 1TZMA 4UHHA 3A6KA 4YRAA 4V02A 5CB6A 3IEUA 3D3WB 1ZR4A 1SOUA 1IG3A 5JS2A 4H7DA 1RQ2A 1XMJA 1YB7A 1TJPB 3B3QA 2D1RA 2BM8A 4RHCA 3SKVA 4MV7A 4K03A 3UB4A 3WB2A 2ZJ3A 3ZCSA 2QTVB 3OOJA 1LSOA 2DBZA 4MVJM 4EECA 3CNEA 2CKDA 5JDCC 5A4MS 3VR3D 4A15A 1K0UA 1GRNA 3C3XA 3I72A 4FFBB 4R9SA 3A0UA 4FD3A 2PGJA 1X74A 2V6IA 3G9QA 2W2LD 2P2YA 2EJUA 3I9LA 4OFWA 3HSYA 1VYUA 4LRQA 2QYOA 3IRVA 4FDAA 5DULA 2J9GA 1MUUA 4MMYB 3U9LA 5F3WB 4M89A 3F3YA 4P38A 3EFOA 1N3BA 4ZQHA 2CVPA 4NWIA 2IXAA 2ZEJA 4Y2XA 1HF3A 1P2TA 2VPYA 3NXKA 3O95A 4IIHA 5AOVA 3TK1A 3W6NA 1C3OA 2HW8A 4IIYA 5E7IA 3RYFA 1SVMA 4LCEA 3T1TA 3D2AA 3DZJA 5LD2C 2DMRA 4NOLA 3HXKA 1LPPA 4TKUA 1RLIA 2Q3LA 3EY4A 4B82A 3OI7A 4XD7D 5EHNA 3VR0A 5BORA 5BVHA 4V0NA 3BH7A 4N6GA 4MUJA 3WADA 1AQYA 2J6BA 3UPUA 2P5YA 1E59A 1A8IA 4LXTA 1ARZA 2PGDA 1THMA 2VP5A 2XOXA 4MV1A 5KDDA 1VQ1A 2HBQA 1T0UA 4Q03A 3M83A 1RI5A 4NMWA 2ZKLA 5TQVA 5A04A 3NBYC 2XCOA 1VXRA 5TMDA 4B6SA 4C7KA 2ZJOA 4BGIA 4F4JA 2LP4Y 5K4HA 1IUOA 2UYHA 5JSKA 1R0LA 3FCXA 3NJ8A 3S8YA 2C2WA 1VG8A 5C31A 3C16C 5T4HA 5H8WA 4C4SA 2YVQA 3DZDA 4UD2A 3AEQA 4PGHA 3RPEA 5AI6A 4UM9B 1UBTS 1UPTA 2CVFA 4I50B 5GZ1A 2CHVA 2R9VA 1E6EA 1KO1A 5SY9A 2A1TR 3RKUA 3HRHA 1XD9A 4ANFA 5TX7A 2NTYC 2HC9A 2ZJ2A 3DDNA 2NQTA 3C6QA 4PEVA 1E3JA 4L8GA 4XD7A 5CX4A 3KR0A 1DRWA 2QZJA 4PBSA 1O6GA 1VBNA 3OQVA 1Z5NA 4QT0A 5HZHA 5BV0A 3ND5A 5IP5A 3CF4A 4G0PA 4WLFA 1UQRA 2ZIWB 3PXEA 1SQGA 3FM9A 4Q39A 4L3VA 4IRMA 3TIFA 4ZQGA 1QS0A 2QZ4A 2V5UA 4HDSB 1EDZA 5F5XA 1TO1E 4DUGD 1O6FA 4OHRA 2C0QA 2JAUA 4YRQA 4EG4A 5LDGA 4A03A 4TLEA 2WIAA 2PXCA 4RHXA 1VYHA 3GMDA 1AA9A 1M6EX 1G2QA 1OV4A 2EBHX 2PBLA 3STWA 4CN9A 3X1MA 1BTOA 4LRXA 5EP2A 2IY7A 3T41A 1Z2EA 4RVUA 2ZGVA 1MQSA 3CE9A 5CPFA 5AI5A 4EW1A 4GFDA 3H2BA 1J7JA 2WAYA 4WXPA 2KX7A 1HTWA 1WKVA 3HDJA 2I03A 4C0QC 2ZJ7A 3IAAA 2IV3A 4MUFA 3FSJX 3GQBA 4ZEMA 2ARKA 5J4KA 5E4YA 5GONA 3KQWA 1OJLA 5FQOA 3RARA 5KJ6A 4LC9A 1E4EA 2YRXA 2HT1A 5JO9A 1L8OA 1TIPA 1TLFA 1QYWA 2XOKA 2ZYUX 1GN9A 2MTBA 2PQMA 2NN3C 2VKTA 3GG2A 4ZHQA 3DVQX 3KEMA 3PEYA 2R8BA 3CRRA 4M6WA 1KRXA 1IATA 4RPJA 2PKWA 1JMKC 4LF5B 3COPA 2JI9A 3DNMA 1PYDA 2QE7A 3H2SA 3NTVA 3DEYX 1SMKA 4MGEA 4XIGS 4P83A 4XWGA 3SZLA 3FF4A 3IKJA 2JRCA 5EUQB 4E6EA 3B7GA 2I33A 3FMIA 3JZIA 4LDPA 4ZVPA 5JJLA 1PHPA 1XN4A 1G42A 1WNFA 4WBSA 4ZOLA 5BMVB 1MO5A 1JA0A 2X9LA 4G2TA 3IUJA 4Y2PA 4YIKA 5A5FA 1R0BA 5BN4A 5KC9A 2X8WA 1P0QA 2UYOA 2XTAA 2QD2A 1YT5A 1DG1G 3D8TA 3ZWQA 2HMTA 5DDIP 4B3FX 1GQYA 3EVDA 2PA3A 3PR2B 5AJZA 5ILOA 3KEOA 3EPKA 3NBZC 2EJCA 1VHTA 1ZIXA 4Q48A 4L9WA 5CH8A 1I2CA 5AH0A 3PHIA 5EIOA 4WRRA 5AVVA 1PI3A 2FPSA 1NW3A 3W0LB 1AUOA 1PT6A 2VP3A 3ESRA 4PGGA 3WDMA 5AVXA 2CLKB 1P1KA 1L8LA 2C5GA 2DHDA 4ZV7A 1QVVA 3T1HB 2E1PA 4OMUA 7ABPA 2MR5A 3FJ1A 1V39A 2VWHA 3DOEA 4X71A 1DRVA 2C94A 4MWZA 4PNHA 4RVFA 4AN1A 1HX7A 1Z68A 1R16A 3HMKA 4UM7A 2KLHA 3LU1A 4YJFB 1MN6A 5CDFE 2WU4A 3I8OA 3KU4A 3FKSA 4M6WB 3GGSA 3THRA 4HMOA 1EE2A 3C8MA 4U7PB 3GAZA 1ZMOA 4KQHA 1K4YA 5EKTA 3P9YA 1DT5A 3KWJA 1BMFA 2O2DA 1Z0JA 5DXJA 2FB9A 4KV9A 4PGMA 4IDQA 1ONPA 2HWYA 4RVSA 1Y7PA 2HMAA 3RB8A 3UC5A 1BHJA 1V9CA 2H4WA 4TWZA 3TUZC 5JUWA 4AFNA 5DHSA 1X7YA 2A9KA 5CDTA 5T64A 2CV2A 2P65A 3IUYA 1SEVA 3UM9A 3TAXA 3HV0A 4CEJA 1A2KC 1G7SA 3K32A 4OAOA 3WKCA 5BMVA 3ETDA 2ODQA 4F21A 1XJQA 2ATIA 2XWQA 1FYFA 1K3UB 4E5KA 1LW6E 1Q44A 1E69A 3ECCA 1GUBA 3GK3A 4FS8A 1DAFA 1JVSA 2GEDA 1TIBA 2QEQA 3D3EA 3M5PA 2J87A 3GEDA 5AK3A 2VH5R 1R27A 1IG0A 1XU4A 2DBYA 2P77A 4JJGA 5JXGA 3PGA1 4RTOA 1ZZGA 4JWKA 4B33A 1BH2A 1ZHOA 2CLHB 4D81A 1FP4A 1VI2A 4CV0A 1QG2A 1BMFD 1Z8NA 2QPLA 5DI9A 4LG1A 4E15A 2OV4A 3SSNA 2R5WA 2RGXA 2YX1A 2ZYGA 2NG1A 2Z83A 4QFMA 3OEWA 3UWPA 4YJ2B 1IUKA 1YQ9A 3UW1A 4W63A 3HVIA 4M9UA 4OLFA 4EBFA 3DE5X 4PZPA 2JK1A 2AJ8A 1OI3A 3KQTA 4KZPA 1E89A 1ONOA 3QBEA 1IN1A 1MKYA 1L4MA 3R9IA 3JD2A 3EGDA 2Y76A 5HKAA 2BL4A 1TEHA 2J0UA 4DR3B 1DZIA 1M5TA 4L1KA 3FDZB 3INNA 1UBSB 1QGUA 4REOA 2I2BA 4GOXA 1C14A 1Y1PA 4JYZA 4M1WA 2YV3A 2DF8A 3GLUA 2PQ6A 1T4GA 4Y7DA 4LYJA 1XZDA 1E77A 3TR6A 3JYHA 4CIAA 1SURA 1CS4C 3ZH9B 4CDRA 4JP2A 1FY2A 2XB9A 2CJWB 1VG1A 4NCIA 3GUHA 5FHRA 4AD8A 3AFNA 5BUSA 3WL8A 4LXQA 5HGXA 4Z7OB 4KNYA 3V1YA 4LAFA 2EU8A 3V9PA 2JLZA 1HDZA 4W8GA 3SQLA 4DLBA 4F60A 5JS1A 3HABA 3MJCA 5AXBA 3D8SA 3ROFA 1S2DA 1X0VA 2AEEA 2GM5A 3QMVA 2HJSA 4LHSA 5AW9A 3WOHA 2MSCB 4J16A 4CWAA 1NONA 5JCJA 4BV3A 3LSTA 1Z2OX 1BMDA 2CLMB 1P8AA 2XUGA 4MLCA 4UXJA 4ZP1A 3D7LA 1N3LA 3NIBA 3TD6A 4AJ4A 2NVBA 4A0GA 4YRBA 3QTBA 3E2MA 4KBYA 4MR9A 3HP4A 1MMFB 1NVWQ 2H1SA 2IIPA 3IVXA 2YXBA 4PCAA 5AESA 1H2YA 3QQ5A 1EUDB 2WWRA 3FDXA 4BUCA 4IOMA 5JYBA 4EJ0A 4RA9B 3TLZA 3G0IA 2ERCA 3AUYA 5ALLA 5KNCH 1WDLA 2F3TA 2O23A 3KSBC 5FADA 4EQZA 4IXWA 2Z2ZA 3PQ5A 1GGVA 2B82A 3HUTA 2PNJA 1UMBB 3QE0A 1PZNA 1GAWA 2X7HA 3IEIA 2JFGA 3VR2D 2ZT7A 1EK0A 3OTOB 3VYSB 4IYJA 3Q0TA 3LT1A 3P0IA 1JHYA 1WXFA 2ZS7A 4J3JA 3EVFA 4EZIA 4OGWA 5BV7A 3SZRA 2BGGA 3FVQA 4MCHA 5HKKA 5GP1A 5I3CA 2BD0A 4KC0A 2IW1A 4R3WA 1CUVA 2RD2A 3EZ6A 1B76A 1QO7A 2WNIA 2YY7A 3HO1A 2BELA 2EIXA 2PS9A 4HNAA 1KYVA 3KQOA 5G4KA 3SM9A 4EFNA 4KR2A 1V3VA 5J47A 1Q3HA 3OLVA 1AKTA 2JFWA 4FR2A 4FE4A 4K40A 1KMIY 4P93A 3ZN2A 4TV9B 4MWTA 4KLZA 3C7TA 2GPNA 4RL6A 2ZS8A 4MVJD 2NPFA 1L7VC 1ZUHA 3M82A 4XYEA 4DNXA 1OXMA 3OE1A 5ECDA 3O8BA 4HBZA 2Q8NA 1WMFA 5HRAA 5JD4A 5JAZA 1BX1A 2ISCA 4UVDA 1S2IA 1Z4OA 3CKKA 2BFDB 3HM2A 4GX5A 2VXBA 4RCVA 1CUCA 2O48X 5FI3A 2P0YA 3FUTA 3IKTA 1Z4NA 1K89A 4IEIA 1FNSA 1FDWA 4I3FA 1XXHE 4V0KA 4A8JB 1CYDA 5C3MA 3KPYA 3HDVA 3PTZA 5FEUA 2YZ7A 1AKWA 3R6WA 3ANTA 4ZT4A 3RRZA 1GCGA 2Q62A 2WD8A 3G0OA 5FNVA 2PX6A 1MC8A 1NI3A 2E4AA 2XMZA 4OBXA 5AICA 1YB4A 2J0SA 1E94E 2KWIA 1HFEL 4MROA 5HBRA 4RD6A 1VKNA 4IM7A 5BUCA 2CLLB 1JAHA 2MMGA 2F3QA 3WS7A 3CCCA 1DJOA 1EK6A 4CM9A 2QRQA 1M8GA 1SUDA 3R3UA 3HL4A 1V5IA 4FMPA 2JLUA 1OLUB 4HAOA 2CKMA 2E2WA 4I66A 1EWVA 3N8IA 3OZXA 4JNCA 4KX3A 4FFLA 3TKLA 3TGWA 2I2DA 4OQYA 5LXTF 1U6KA 2EKQA 1CP3A 2HCBA 3DLIA 4B6QA 3RC7A 4FJ1A 5HRCA 3O73A 1YACA 3KHTA 4I81A 2PUTA 4EHNA 1IRIA 1P45A 1QDEA 4YUWA 3AR4A 2G5GX 1E2DA 1H1TA 4DCUA 9ATCA 4RMGA 4IHQA 1K5DA 2VT7A 1HI9A 2IPXA 1NRXA 1BKSB 2BN4A 4KXNA 2H3EA 4WOPA 2XITA 5L6MB 2V98A 3VBEA 5FFMA 3T7AA 4LSZA 2F3SA 1PFWA 1OSNA 2XEDA 3H16A 3IV9A 3QFTA 4MQFB 1EJ2A 1H0KA 1U7HA 1T2AA 1XCOA 3HUDA 3IQZA 3KD2A 3MS4A 2H51A 2MIIA 2XD4A 3JQPA 1WOMA 4JD5A 1DIOB 2LXNA 3ZWPA 2PL3A 1PFVA 4AJOA 3Q9UA 2BE9A 3TECE 4YRSA 1H05A 3P5SA 4G1BA 1P5RA 3G3EA 3JYNA 1GPLA 5KX5A 3KO8A 1BQ3A 4M7PA 1Y5MA 2GFHA 5E4JA 3HU5A 5HFJA 4BLVA 2RJNA 3QW4B 5BT9A 3VA7A 2FN7A 4ZO8A 4EJSC 4J7UA 2CNLA 1RM4A 2WLSA 3DTNA 3PS9A 4FLMA 4KK3A 4JB0A 1LQTA 3OCWA 4TMXA 4XPIB 3RT1A 1KO8A 3COYA 3IMEA 3NH6A 3E9NA 3LT4A 4HXYA 2JFYA 1RWVA 1M6WA 4YDHB 3DYBA 3OMWA 4EG3A 1DVRA 4BBJA 5BSHA 2ZYDA 1U1GA 4KMRA 4OJQA 4RENA 4ENUA 4LJ9A 1IIBA 5FWDA 3GJTA 4OQMA 1YZVA 4IDFA 3H2HA 3L7OA 3I45A 4G1CA 2D1SA 2Z9BA 2C4UA 4GX1A 3W05A 1BXGB 3ZJTA 1QG6A 4GZ6A 4Y2QA 1Q22A 3WRYC 1ZA1A 1HH4A 3AIIA 2ZB7A 2O5EA 4KBFA 5IX8A 3TE6A 2Q5FA 5DBFA 4ER7A 5F7OA 4UC0A 2O52A 4YRFA 3EXIA 3CKMA 5EFOA 4Z4HA 5K6RA 1WB9A 3HYSA 2RG7A 3C5HA 3TSCA 6ABPA 1XZ8A 2MDTA 1RFLA 3CG4A 4NBWA 4F86A 2PUAA 1F8GA 5TRTA 5EOVA 1KTVA 2EZUA 2VVTA 4PX2A 4CNQA 1I30A 4MP8A 3LVFO 1W2WB 2ZPAA 1L5SA 3S4YA 4UHFA 2X58A 1WB4A 1QQ6A 1U9CA 5CDSA 2GAFA 1PR0A 3K5PA 1KIFA 1GWNA 2QVLA 2W2VA 1DU4A 3AEKB 3M7IA 4CW7A 2FPIA 4X3OA 1J2EA 1ZCBA 1T2FA 4Y6SA 2B1QA 2JCGA 4AKSA 4ADSG 2GF9A 4MW9A 3REQA 3TLMA 5HUQA 1UKAA 3P9IA 1T91A 2ZWOA 4I9GA 1QANA 4PQRA 4V0ME 1GD1O 2HA4A 3QYAA 4S1VA 1B93A 3EZFA 2PUDA 4W7IA 1GPKA 4IH1A 3KOOA 3H2IA 3KQSA 1GZ5A 1VHQA 2VK2A 4OGLA 2NZWA 3VM6A 4EVIA 5CCEA 3HPQA 3H65A 4H77A 4YP0A 3UCFA 4FB4A 1Y8RA 3S99A 1UDRA 3ENQA 3R6TA 1U8FO 2A0FA 4EABA 5E6UB 3C1TA 2OBMA 2DY1A 3BIOA 2OXTA 3RUEA 3S2YA 2P4QA 1XIVA 1Z34A 4FR0A 3T94A 1R10A 5JATA 1PTJC 3R9XB 3U3OA 2I71A 3QF4B 2X9NA 1B0PA 1OILA 1IVYA 3B6EA 3FNQA 3GLRA 4DDMA 1U2GA 4J8PA 5CLLA 3HP1A 2PJZA 1CEYA 1FQKA 3DZ8A 5DCYA 2ZI7A 1D2MA 5E7MA 3TW4A 4Q4HA 1UEJA 3PDUA 1U3DA 4E11A 4E88A 1C9DB 1CJVC 2IP1A 1JIJA 1RYZA 2VYND 5C34B 4UHKA 2PSSA 4M36A 4XLLA 2AUTA 2R25B 3NUQA 3WIDA 4Y1GA 2H7XA 5KEIA 3QFRA 4D7AA 3AU8A 3I5YA 2R3SA 4EG8A 3RIMA 3AJ9A 2P7HA 4YAKA 1YOBA 4I1PA 1Q83A 3CLRD 4P3XA 3BUSA 2FDCA 3D6NB 2QRNA 3CRQA 1PT8A 3A6HA 5CXXA 2RHWA 4UTNA 4JQCA 1RAHA 3LTNC 3RF7A 1BA3A 2ZBEA 4RGBA 1DAEA 2A94A 3ZJYA 2FN3A 2UUCB 4O4LF 4CM6A 3UG7A 2HIHA 4ZC8A 1Y1QA 1SCIA 1BS2A 2O5VA 4ER5A 4M2LA 5H3HA 2W6PA 1EU1A 5KPDA 3T1NA 1EG7A 3AR9A 4KYUA 5CBPA 3PHCA 1RJ9B 5EMMA 1SN7A 4JLOA 3B9PA 2LPMA 3PXDA 4IGIA 4PU0A 2PH1A 1DC7A 2PMCA 1M7HA 2BEVB 4UTVA 3DBRA 3S0JA 1RSZA 1YIOA 1YKFA 4CV3A 4CUKA 2YYSA 4U2BA 1CQIA 3Q3IA 4ML3A 1BCSB 4TLBA 3VR6H 1N4AA 3UMVA 1H6BA 1RAEA 4QZVA 3PF9A 5E38A 3MC1A 1ML4A 1T1SA 1UT8A 1KY2A 4KV7A 3ICVA 5E3HA 1BHQ1 2P2ZA 4Z54A 1AD2A 2C4VA 2A9QA 5P21A 3ADCA 4H0CA 3DSRA 4YS6A 3IDOA 3HB9A 4PZ0A 2ZVDA 1I5RA 1R9MA 2PLFA 2ZB2A 1HNNA 3L7MA 4KGXA 3EFBA 4R2JA 2OV8A 5EJ6A 5IDXA 3AI1A 3SF8A 5GJCA 1NBMA 4MIOA 4QJBA 1KP3A 3FAKA 1FDRA 1H2ZA 5DNAA 5FQNA 3WLNA 3HU3A 1NVVR 4K8OA 4OKSA 4Y7CA 4QLBA 6GPBA 2IW3A 4Z6KA 4GKVA 3RUDA 2HPAA 1UP6A 4A3SA 3SJBA 1IQRA 3LVRE 2OP0A 1V1MA 4H7FA 2C92A 3NIFB 3V8NA 5LXTB 3RR2A 3VZPA 4EUKA 3OM1A 2EL7A 3H1EA 3OFND 1Z47A 5CDGA 1QP4A 2DWQA 2JJ1A 3A10A 1Y8AA 3Q10A 4KU4A 1RXIA 4MGKR 2WQ7A 2YCLA 3MYYA 3MWYW 4N9WA 4EA6A 1WQ4A 1VDZA 1ZH4A 2NO4A 3ZDZB 4Z7JA 4KN9S 3MMXA 4OMDA 1YB5A 2ATXA 2IUUA 2HKIA 2CLSA 1NXXA 3TKYA 3RG2A 1LBTA 2QVYX 4TLAA 3WGLA 4AUMA 3BWXA 4LRWA 2Z1DA 2Y1EA 1M0WA 3QVTA 3CN7A 2CD9A 3TN7A 4D9CA 3LVQE 2FWMX 3UQYS 1CPYA 4JUBA 2B5OA 3MILA 4YLGA 3QJ5A 3ZIAD 4V0RA 1UKZA 4MKIA 2WAMA 4EGQA 4JI8B 4E22A 1GZVA 2AFIE 3A6LA 2H1LA 3JQ9C 2RMKA 3OFNA 4AWXA 5C52B 1XHLA 3BC1A 1H8HA 2C9BA 3OPMA 1J9EA 1JLLB 2NZVG 2NSHA 1RZ3A 3HFJA 2WVHA 1XN1A 3KKZA 4PTYA 3HG7A 1ZW1A 3BMCA 3DA8A 2G80A 2V55B 3B8EA 3FCOA 1EJ6A 1RLUA 4E7OA 1QWOA 1USUA 3LHSA 1FTQA 2BR4A 1OTHA 2P0EA 4HG2A 3SF0A 3WKDA 1H4VB 1P9RA 1X7WB 2H3HA 2ZE6A 2NO6A 2ZJ1A 4OGKA 3L7NA 1TT5B 1ACJA 1U3GA 1JLSA 4U39A 1MAWA 2B2XA 2ZZNA 1JALA 3DKKA 1Z62A 4C20A 3ZQJA 5KWJA 3P19A 2IV7A 1ZU5A 5DM70 3ITEA 2KS6A 2O5CA 1ZOIA 3KQVA 1YDGA 1NXPA 3F6CA 1Z22A 3NBXX 2PRIA 4E2YA 5B2FA 5JDIA 5J2UA 4DNFA 3HMQA 4GDMA 4WEOA 2Q29A 4BNXA 3VZCA 3B1FA 1Y3BE 5J2TB 1M6VA 3KOMA 1PWXA 2GJ8A 3FVTA 1CX9B 2XZTA 3AVVA 2L42A 3G9XA 4RD3A 2ZYAA 3RTGA 4PIMA 3RKRA 4YR7A 1ADJA 3KYCB 4BIIA 4BP1A 2FZWA 4BX8A 2M1ZA 4KXMA 2GJ4A 3ABOB 5DLQC 5E2BA 2WF5A 3LDGA 5LMNB 2ZTLA 1QKJA 3UAVA 4BMNA 2PZBA 1OXTA 2D0DA 4LV6A 2FQQA 1GAEO 2A59A 4Q1VA 2P90A 5ALUA 1IZYA 2B5VA 3A3KA 4TYNA 4RF3A 5KTPA 1AV6A 3N6XA 4ZWNA 4UKDA 5F5LA 1M66A 3GQVA 5ALHA 2OTCA 3G79A 4ZICA 2QA5A 2C8VA 5C4GB 2CDAA 4RMNA 2UXDB 4HNSA 3NNSA 5JO0A 2XODA 3DOFA 4U8GA 1CF4A 4ESEA 2WF6A 3NFYA 2CWDA 3VRHA 2Q9BA 4JCOA 3CX7A 4FEGA 1KORA 521PA 5TS2A 2AE1A 5B30A 1J2TA 1KOLA 4X93A 1C3OB 2B9VA 3H9QA 2VJAA 3KZVA 1V95A 2AOWA 2HT6A 5HFAA 3TW8B 1NYLA 3CX3A 3VC1A 1JQEA 1MVLA 1OHHD 3WLLA 3EFHA 4LW8A 5BW8A 4WZ6A 3HKBB 1OE0A 3DL0A 7MDHA 4QUHA 5C8YB 1SCDA 1BVRA 2FFRA 2O2SA 2RGCA 3MB8A 4RK6A 4Y18A 4BXOB 1ZD2P 1TUBA 2IEBA 4XH9B 2LKCA 2CXNA 5TQ0A 2IUTA 4KG7A 1QGED 5ED0A 1ODSA 1RXVA 4IIGA 4CF3A 4LQ4A 5A0VA 3ZV3A 4JDUA 3O90A 2RI0A 2V5VA 2G6BA 1GPNA 3QWFA 2JGEA 1D5CA 1DQSA 4NECA 3NW9A 2TSYB 3KKOA 3SYNA 3VKVA 1EXMA 3GHYA 1V7PC 1G6OA 3ZE6A 4JJ6A 2H4ZA 3P71T 4BWYA 1VA4A 1N1MA 4N5DA 2R1ZA 2XXAA 3O93A 4FIDA 4GNKA 1QZZA 4OKNA 1N0IA 4F3RA 3BX1A 1VKZA 1H2HA 2AI1A 2G8NA 2GBCA 3COVA 4CU2A 1UKBA 4RGYA 5CB8A 2FG6C 3GLSA 3ED5A 3ZY3A 2EJWA 3KOWA 1WLSA 1FFAA 1YA4A 1DAKA 2CF6A 1TQ2A 3EQ7A 5BUQA 5D2CA 1GPAA 1ECBA 3A1FA 4KI7A 1UK9A 1T8UA 4DCNA 3SC4A 1RQXA 1XA4A 1T2NA 3OFKA 5DBGA 5ER6A 2BGJA 5IXJA 4PGFA 5FO0A 1F7UA 1JLLA 2PCLA 3LCRA 1D09A 4IKPA 3L0OA 2HNAA 4GD3Q 3ERCA 4LXYA 2V4ZA 3JY6A 2BFFA 1A50B 1M2VA 1BXRA 3LCUA 5K8JB 2ESRA 2VRCD 3EVTA 4XYMA 2OO5C 1OKKA 1SB9A 2D3WA 2YUIA 5KX5F 2V59A 3U80A 5A4DA 2C9OA 4MGYR 3IXMA 1LNSA 3IP5A 1MB9A 3URKA 3ZU5A 3C48A 1Q6ZA 4AROA 1JWAB 5BXQC 1EHYA 5KYWA 4FI3C 4DCJA 1CY6A 1O96B 2QGFA 3GQBB 2JFZA 4LHYA 5AXAA 4MW1A 3T0GA 4CG3A 2IU3A 3S28A 5TLSA 5ICSA 2BRUA 3QXCA 5SYNA 3OM8A 2IYNA 2HJHA 1IWBB 2VDVE 3WAGA 5DNYB 1U3VA 4N03A 3NOXA 1EUCA 3C7KA 4FC6A 3GLQA 5F7XA 2AFHA 2ET6A 4CIBA 4R71A 2QL7A 1B8UA 1JZSA 2YNMA 2ISQA 1GRQA 1BYIA 3M6UA 1GR0A 5K0LA 1YE3A 4YQZA 2IYEA 3ND6A 1HKUA 3CY6A 3IP8A 2VRCA 4RDIA 1QUEA 1VYVA 1LS6A 1ZH8A 2YZGA 4PFQA 1C4WA 4DE5A 2WHQA 3PSAA 2C20A 5I4IA 2HFJA 1SBIA 2HDNB 4WW0A 4Z4QA 3H75A 1T4BA 1KOJA 3SEAA 3PFBA 2JAQA 4PLWA 3CO0S 2ZUBA 2CNBA 4OU4A 2QPAA 3OVMA 4P7GA 1P2UA 4ZKDA 1ZN8A 1E79A 5ED4A 3ZCVA 1GRVA 3T7SA 5CA1A 3K4PA 2JBAA 3BHJA 4F6CA 3DDOA 3T5BA 4ES6A 3AV0B 1QU2A 3MWGA 1HUQA 1CERA 1R0CA 1U1EA 2FPXA 2W00A 4YRDA 1AUPA 1UJ5A 4PSAA 3TRJA 4IMRA 4DW8A 1NNI1 2WP8J 3QVOA 4KQ9A 4HTFB 1QHGA 3ZKWB 3H83A 3HFGA 3SYRA 3ZIUA 2FZ5A 2YJ5A 4MQEA 3HUEA 1GTZA 5I9LA 3QITA 2GHTA 3CVJA 3G49A 3VVBA 3HR8A 3K0CA 3NBUA 1J70A 4QECA 3QU2A 1BGVA 3NASA 3I52A 3QI2A 2BFFB 3ZXSA 5K4AA 1KTIA 3QFSA 1Z33A 5JSFA 2ZRKA 1LC3A 3BQMB 3TQQA 4NI5A 2EDCA 5C4MA 3DWGA 2OZLB 1TA0A 1HQYE 3SDSA 1T1EA 5F52A 1RQRA 1YVPA 1JAYA 3ZV4A 3ORRA 3RS0A 5HPYB 2V58A 3HYLA 5IARA 3LHFA 4D43A 4GMKA 4JA0A 2XUQA 4PYKA 4KGDA 2FF7A 1KC3A 2J4DA 3JQFA 1WDKA 4MS3A 3OF2A 4DZZA 3Q12A 1FVXA 4RY8A 5BYBA 4DRXB 5K4GA 2GKSA 1BJRE 1IQUA 3BH6A 1JH9A 3DZCA 2W90A 5CXQA 3HKDB 1A8QA 2J67A 4GR5A 1I7PA 5L7TA 4I36A 3FTQA 4Y2SA 6NULA 3PPVA 1F3LA 2AW5A 1EG2A 2PD6A 4HQKA 4NZZA 2QRHA 3UPDA 2CNKA 5EIXA 2XZLA 5CPBA 3ZZ1A 1P6UA 1FA9A 1GAQA 1PJBA 1VSBA 3MNFA 1N8SA 4WGGA 4GZMA 3JD0A 5JU6A 1GDTA 4PBRA 1P2DA 3U0VA 4C08A 3EULA 1DXHA 1TNDA 1VLQA 4FN4A 4OHXA 3E15A 1UK6A 2X9QA 1TKRA 4JCCA 2RI1A 4DLVA 1W0JD 1J49A 4JT8A 3U44A 1L8XA 3Q9NA 2YXLA 1BROA 2DCUA 3HB1A 2XCSB 1SCAA 4GBJA 2B7BA 3IMFA 4QSMA 3SG0A 2C97A 1W75A 1RRPA 3K8YA 1MNAA 2ZCUA 3QHPA 3GRAA 2KYRA 1XQ9A 4JLVA 3IEVA 2POCA 2C8JA 1EQ2A 1X70A 1YGYA 1Q11A 1ZK3A 4QYXA 5D5PA 3RS8A 1VI5A 3JPWA 2P3OA 2A35A 1JG6A 2QORA 2QRJA 3BS4A 5A6SB 3KT8A 1ISJA 2R97A 3WFZA 1IDN1 3PPYA 4LE1A 5E2AA 1DB3A 5L51A 2ZIFA 2FSFA 3BJZA 2FPOA 5CCDA 4E5UA 4YP9A 5JVDA 1O6BA 1Q7EA 4MA5A 1NBIA 1WVGA 3OQOA 4B71A 2BSXA 5AQEA 5CDFA 2W7TA 2JJMA 3BZBA 3OZCA 2AK3A 2QROA 4V1CB 1D4OA 4MQLA 1GZUA 2ZTUA 4NESA 1JVNA 3I9NA 1RAIA 3PJGA 3HCOA 3MN1A 3DNPA 1QQAA 2ONJA 1RW4A 1PU2A 1M2EA 2PUVA 1PT9A 4M8SA 2ZJ4A 1J2RA 1EVLA 2BH9A 2A6PA 3HXMA 2WJYA 3EBOA 3VH2A 4I4TA 2KMLA 3FTPA 1KFCB 4RPGA 4DSOA 1W88B 1BHO1 2RCYA 4E1VA 3WWCA 4DC9A 1NBME 1BU5A 2JFPA 3FNIA 1JTFA 5CVCA 4B0OA 1V3UA 5JPIA 2CLCX 1XJ0A 4WESB 1QR6A 4HK4A 2IXEA 3H7AA 4CQLA 4HH0A 1BQEA 1K8RA 5EXXA 4YUVA 1HZZA 1KK2A 2CBGA 3HDYA 3T3PB 1WABA 9LDBA 4HB0A 4US1R 4H4DA 4G5XA 2OO3A 5HK9A 1KYQA 1L7PA 2RKBA 3L05A 4G5HA 4B7ZA 2PYDA 5A4FS 1HA3A 1ZFNA 5JTUA 3VNUA 4DLZA 4EY8A 4H7EA 2EV9A 2X1VA 4QKQA 4LGMA 1IOWA 2J5BA 1IHDA 1UFVA 3HSKA 3PFIA 1U2QA 1POXA 4EKYA 3CSSA 5JDCA 4HCJA 4P5DA 4XGKA 2WJVA 3WLKX 4RDXA 4H9GA 3DD5A 3QENA 4Q0MA 3FDJA 2JHFA 5LNK1 3PEFA 2K4MA 4L8VA 2Q0SA 4NBLA 1NMQA 4PINA 4J76A 3FCCA 3V9AA 4AM8A 2ZRQA 3L6RA 5H9WA 3F9RA 1M6HA 2H00A 1D2EA 2JCVA 3ZLJA 3IQEA 3DZKA 1DAOA 1DE0A 4B87A 4BV9A 5CR9A 1DJQA 1G63A 1NM5C 3W8NA 3UOAB 4NTZA 3I2FA 1NR7A 1TTQB 2ADFA 2OCYC 4EYEA 1LV7A 3TFWA 4HH1A 4WESA 3UANA 4NDNE 1Q3KA 5L4NA 1HDOA 2R47A 3OEYA 1DC4A 1RBYA 2MHCA 3M0EA 1X80A 3CR8A 1ZM4A 3MJSA 2EHDA 3VPCA 2EOAA 2ZXEA 2JAXA 2DKNA 1BGWA 1PTJA 1AXRA 1RRGA 1BEZA 1Z13A 3IXQA 3WGYA 2WSLA 2FZKA 3DMHA 4IX1A 4KQWA 4EO7A 4F9TA 4N3GA 2AC4A 2H7VA 1ZD1A 3QOFA 4OA8A 2IU0A 4X00A 5CURA 4AVYA 3K1TA 5IVHA 3FNGA 1O94C 1P1JA 1VMAA 4N49A 5MFZA 1H66A 3UZUA 4MRVA 4IV5A 3E9RA 4PO8A 4OLBA 2ZR9A 4FGKA 1P1CA 5ELLA 4RM3A 2OP1A 3FZGA 1II9A 4XX0A 4Z4GA 5ENDA 2V6JA 4ERNA 5AKIA 3V8RA 3ADBA 2GZMA 2NM0A 4IKOA 2JKYA 1Q7GA 1VIYA 1GEEA 1O57A 1YS1X 2RDMA 3CLVA 4KSCA 3FPGA 4DCCA 2HO5A 2BFEB 3H4TA 2GK7A 5A2GA 3V7FA 2DX7A 1AKYA 4PWZA 2I6FA 4AF8A 3D0OA 3OZWA 2PFSA 2X1MA 4JA2A 2GCPA 1R3UA 2GHRA 2V7UA 2WMNB 4WA8A 2JIMA 3FPBA 1E2IA 3G0HA 4W9NC 4YJGA 1PR2A 3A04A 2BWJA 4HNTA 4TV8F 1LPSA 2QHXA 4G0MA 2MYUA 3R77A 5IAKA 4ZMSA 4JR0A 3A37A 1YO6A 3U1BA 3R3VA 4CLRA 1BN6A 3SX2A 1ECPA 1UT6A 1K6EA 4WNAB 2XNCA 4F9FA 3OOSA 3C6KA 4BRSA 1NX6A 1VJRA 3NJRA 2WTAA 4RC9A 1HLPA 5IYZF 1OU0A 2KQUA 4DY6A 1YR9A 2QQEA 4YC7A 1SGWA 3LPAA 1X2BA 1GGFA 2I2XB 2QVXX 2VLBA 2VT6A 2ZRBA 3AR8A 2R65A 3O4RA 4GYKA 5DLYA 1R74A 4JKIA 3IPCA 4JJAA 3L0PA 3QVLA 2J0UB 1ICIA 1U28A 2VDKB 3P2JA 4U2KA 2PUHA 1SOVA 4L6IA 4N8DA 3K1ZA 3D64A 2XTMA 2YW9A 3AESB 3H1GA 4YCSA 3GMTA 1X7XA 1I1NA 3OAAD 3DMTA 4L5CA 1G7RA 1G21E 3MRXA 1TCUA 3SC2A 1TGVA 1K86A 2OBLA 2ZSJA 1XL1A 4AL4A 1WW3A 2XGGA 7AT1A 4PSVA 1SZPA 3SHQA 2BTEA 4OM8A 1KAQA 1Z38A 2A88A 4TL9A 5AK0A 2SECE 3QIVA 2F9LA 3FR7A 2GO7A 1G9XA 3NRJA 4UVHA 1NW5A 3P9ZA 4E5PA 1XTIA 1Z37A 4MVJI 4P81A 3V8VA 4P4GA 1U5BA 2P41A 3DGEC 4TS3A 4ZEXA 5AW1A 2XYHA 3U49A 3EH1A 1O5OA 3A27A 1KO7A 2QX7A 4X20A 1A1SA 4KBGA 3NB0A 4BZZA 4P4UA 3I2JA 3OUUA 1AURA 1XD2A 1GGJA 3AETA 4GGMX 4M7WA 5KTNA 1EUDA 3VR5A 2Y1DA 4ZI7F 5JTTA 3W5BA 1A9TA 3ICCA 1D7OA 2PGNA 4WY2A 1FZTA 1J0EA 2XECA 1MH9A 2R751 3ZDRA 2FOIA 4H4CA 1N5KA 5IJ9A 4GWKA 4YR9A 1U4OA 5CHEA 3L1IA 1TI7A 2HRRA 2DLNA 1CJKC 2IPOA 2IHVA 2XVAA 2VDQB 3H9CA 1EQAA 4HF7A 4YUAA 1KEEA 1TC2A 4IHJA 1WUKS 4ZVMA 3LBAA 5IDWA 1IC6A 1WCIB 3ZX5A 2P1ZA 2V65A 3GI1A 4JBLA 2FX2A 4RLSA 4FMDB 2FCAA 3K0BA 3E5MA 5AW4A 5IC5A 5I7RA 1M34E 5JIBA 4QOEA 5FI5A 4UE3S 3BG5A 5I7AA 3HXOA 2P27A 3PBKA 2BMDA 4IFEA 4KQCA 2DPMA 4YP6A 4EHFA 1T3SA 2V6GA 3KLPX 4EL0A 4WJKB 5GV8A 3P2YA 4CTMA 2A1IA 1B8VA 3AKCA 1XDGA 5G4KB 3RJ5A 5IM4F 3CH4B 4G8CA 4Q9JA 3ZCXA 5J4HA 4RAOA 3DP7A 2VOJA 4YO8A 4TL7A 9MHTA 5TE9A 2X2EA 3OZEA 4AZVA 3HBJA 4DJEC 2QU7A 3F3MA 2JJ2D 2OM6A 2NU8B 4ZYVA 3IURA 3JARA 4B7XA 1U02A 3DR3A 3G0GA 3HPRA 2W6NA 1FBNA 5KBYA 5KNBH 4LJ7A 3DFMA 2DFKB 3HCEA 1JTVA 4XWAA 1EM6A 3K16A 1KXZA 4ID3A 4F0JA 2RGAA 2J46A 1JEQA 3NBMA 2VJCA 1QH8B 4NOJA 3I92A 4X5OA 3RUIA 2PZAA 4BLUA 1CJTC 1OX5A 2EP8A 1ODJA 3JW8A 5TGDA 1S8NA 1E2LA 3GVPA 4ZFNA 4L02A 5BPHA 4X6UA 3UMFA 1PG2A 1W5AA 2O50A 5GQSA 2ZAMA 4LOJA 4ZANA 2OV1A 1P3DA 1BOFA 1KOGA 1JG1A 4JASB 3FYDA 2MSDB 1R6AA 3Q9SA 3BQNB 1OZGA 1SVWA 5EXSA 2FW8A 2JAWA 4E70A 4UTZA 5DBHX 1KMQA 1NYTA 2WINI 4TZKA 4XGRA 2XKJE 4YCAA 3GZJA 2BGIA 1P9LA 4L3OA 5D3ZA 2PD4A 1SXJA 4R16A 3PDJA 2ODWA 4R2WA 3NHYA 4OHPA 3ZQ4A 4DQ0A 4XWWA 2PE5A 1W581 4JZYA 2C7BA 1MR3F 2FUCA 5EP3A 1QH9A 3MBKA 2H4FA 1H2FA 4DIBA 2BKVA 4CGZA 2VJPA 4I19A 1TQDA 4FWBA 4WKNA 1BXKA 1KYWA 3GU3A 5DM1A 5K3DA 3ZVRA 4FLEA 2DB3A 2QL6A 2WFMA 5D1HA 4ZQBA 1JQ5A 5ESDA 4FYVA 4R0NA 5A3SA 4BNDA 4KR7A 3KPVA 2OENG 4OHWA 3ZZ0A 1K5HA 1FTGA 3K92A 1P60A 1KS9A 1I1OA 2V7VA 4CBVA 3KQUA 1XTRA 5J9FA 4O63O 3V1NA 2QJFA 5HF6A 4GGPA 5E6UA 1T5BA 3USES 3EVGA 1CS0B 1JDPA 1TW2A 1XVVA 4HUQA 4LHXA 1TRHA 4DIFA 4E51A 1AH2A 3ADOA 3O8QB 1MCZA 1GGNA 3RIEA 4YJFA 1TK2A 3CRVA 1KEUA 3CTMA 3DB1A 2FDRA 2WG2A 2O8CA 4KVGA 2AFHB 3FLMA 1PR1A 2OFWA 2CHEA 2GFIA 1UZLA 3TLXA 3WGTA 1Y9EA 5HEKA 1YHYA 2ORIA 4EJFA 3CEMA 1NVUQ 2G9UA 1XQXA 2GEKA 3VBCA 5LA6A 4BLTA 3N2LA 4YAGA 5LC1A 1UPBA 3GYBA 3OIYA 2OM2A 5HE8A 4ZZ1A 4KLCA 5C8ZA 2F6RA 4NFHA 3AB3A 3WGQA 4BATA 2ZYRA 2FRXA 3UWSA 5HP4A 2ANCA 4DC1A 1EMDA 4QT4A 5JQGF 4OHUA 5LDHA 2REXB 8LDHA 3F97A 3PLNA 2WZBA 4URHA 5H81A 3NJ4A 4RFLA 3TD2A 4IQFA 1SBYA 3HDGA 2FETA 2R87A 5FWYA 4UVGA 1YBHA 2K2WA 2ZBVA 3UKJA 4EI2A 2UZIR 5GADl 1Z0DA 3IOMA 1TQ6A 1K8ZB 2CBZA 4YRMA 3S2FA 4J4HA 4KXWA 3MINA 5JAHA 5AW7A 1JG7A 1XSEA 4XTCS 2BVNA 3AR2A 5JARA 2IVFA 2NV2B 3K2IA 4LC1A 2QS9A 1A82A 2OILA 2IOQA 1HDCA 4KX5A 1U8YA 4CM8A 4F97A 5BOSA 5LUAA 3R7FA 3F8WA 1EZ1A 4F12A 1Q20A 1HM5A 1W5SA 2DSNA 3I32A 1KSGA 3ZR4B 5B12A 4IQ8A 3BXPA 1U7WA 4C6SA 4ARUA 4PIPA 3WLTA 1Q7BA 1P61B 1D07A 1G7TA 1PDOA 2DTEA 1HO3A 2ZRNA 4FFWA 4J1NA 4TLLB 3R40A 2FAXA 1J07A 1P7CA 2E82A 3QEBZ 4EUNA 3QG5A 5I9BA 3SLRA 1W1UA 1A8SA 1DO2A 2VA9A 1QX3A 2B36A 5AJXA 4OK5A 3L5KA 1N6KA 10MHA 1XWFA 1C2TA 1N7JA 2OV3A 4YP1A 1C1DA 3G8BA 5JNUA 4GRIA 1JYFA 1T3GA 1H1LA 1G8FA 1XLTC 4C7XA 1X19A 2IZ1A 5E1BA 2R6ZA 2WDPA 3PQ8A 5F64A 2Y92A 2VP0A 3DEIA 4IGFA 3QPAA 2X22A 3PK0A 4RBNA 5LYYA 3D0KA 5TPZA 1JG3A 3V4ZA 1NFQA 1OWNA 1W36C 3PGMA 4ZCQA 2VPPA 3KR9A 5BPFA 4RYLA 4EX7A 3HLYA 4R1UA 2IY8A 4NCHA 3NH9A 3C3BA 1HORA 1EFRD 5AOAA 5B4UA 4RHUA 3IC5A 3KYDB 5DP1A 3T5DA 1RHUA 2WWFA 3WQRA 5DX0A 4ALJA 3E9EA 1ZHHA 3GYGA 3WP1B 1RNLA 4EJSA 2EKDA 2RHCA 4G9BA 1P17A 4P1ZA 3RG8A 2C96A 4DSZA 2GXAA 2IS2A 5JYEA 4X1YB 1SPBS 1MX3A 4UCQA 5LD2B 5LQSA 1NJGA 3UQZA 3DFUA 1L8AA 2HMVA 3I73A 3LZ6A 4RJIA 4E5YA 3PWTA 3V3KA 4EY7A 4M9RA 3WLPA 2FZ4A 1RADA 1H1DA 4NQZA 4QBIA 4EH1A 3ZWVA 1E98A 1KU0A 1O9GA 2G63A 3H11B 4KWCA 1CQXA 4PSKA 2I9PA 4O2BF 4RD1A 5EZQA 3TOCA 1RM0A 1Y3IA 2AH5A 5K0NA 1A2OA 4YT2A 3I0ZA 5K3AA 3GT4A 4DF3A 1GNTA 1BZYA 3GCDA 4PR3A 3LLSA 4UZFA 4LBVA 2FVXA 2IEIA 2DQ4A 1UWKA 1E8DA 5A4IS 1O4WA 4P22A 1PZXA 3UB3A 3HH8A 1XZNA 3IE0A 3A4YA 1UZAA 3L07A 3JYLA 3PVSA 3VXKA 4BV2A 3KKLA 4ALKA 5IXSA 1F0NA 4TVKA 3A6ZA 2E87A 4CXMA 4W9MC 4R0VA 3G2IA 2XVXA 3OE7A 1F12A 3MRVA 5BR8B 3T5TA 2VJDA 4H16A 4NV1A 5ALSA 4DR6B 1JJ7A 4GUDA 4YYZA 4M98A 3NOVA 4J2OA 1B8OA 4Q66C 2WTEA 3C2QA 3FE2A 2EP5A 2GN1A 3F7MA 4X3CA 1QU3A 5AM3A 3WLMA 2OPHA 5I01A 1FBTA 3NLLA 1I10A 1PR3A 5BNFA 1Y9ZA 1RXSA 1XAJA 1YONA 2WAXA 3A4MA 3LQKA 1ECGA 1KDOA 2PSJA 4MARA 4A27A 5IK2D 1IM8A 4K2AA 1HDIA 1PJSA 1BFUA 2ST1A 2ADMA 2ZT6A 1GFWA 3Q87B 4FLFA 2RC6A 2QG6A 4KXQA 3QU4A 1TW3A 4NARA 3BERA 2X7JA 4FK8A 5ANRB 4M22A 5AOBA 2WJZB 3UCEA 5LVAA 2WFZA 2A92A 3CR3C 1N3YA 2A9OA 1SVUA 1MGPA 4HAXA 3AF3A 1Z88A 1GKLA 3IMKA 4C21A 2Q9AA 4PR0A 4O4JF 2CVOA 3RSSA 4DYHA 1XFDA 2PXAA 3GXBA 4ZU6X 2F59A 3UW3A 2GD6A 3LWZA 5HKKD 2XMRA 2R6CA 2FR0A 2CHUA 1EK1A 1GRCA 1NI4B 1HDEA 1ISHA 3CM0A 3DE6X 3OPYA 4K87A 1SXJB 2IQ5A 4WCFC 5JOQA 4EQ6A 3K6SA 4BHTA 1XEXB 2W48A 4R41A 2JA2A 3HXTA 2R8RA 3GLKA 1U63A 1RHRA 3O8CA 5AMXA 3DZIA 1SHJA 1N6RA 4QDOA 1ADBA 3U1VA 4CKXA 1RFGE 1U5BB 4B79A 4O5AA 3VH4A 3HKEA 3B5JA 1CHDA 1IEXA 1KNQA 2RKWA 2VHEA 5FBRB 2WWHA 4JV5B 1GRRA 3H3XA 4TTTS 1XLUA 4JI5B 3UJ9A 2NO1A 3PR1A 4O4JA 4CCYB 3RVLA 4P98A 3A0RB 1QCYA 2B1IA 2W6CX 3RH0A 5ILGA 3D59A 4ZRMA 3L8DA 5F78A 2FU5C 1N8KA 5LOVF 4EG7A 1P4JA 3DYIA 2QW8A 3RVQA 3N7UA 1XQYA 2YHIA 2WAAA 5FT9A 1DS6A 3U7IA 2ZXUA 2IDJA 5E6SB 5K01A 2L82A 4FKMA 3X2SA 3PLRA 1HLFA 2QMZA 2VP2A 4IEEA 3EDOA 2JH3A 3ZNOA 4DG8A 4F72A 2D74A 4G0WA 3GP5A 3WI7A 4TV8B 1ODCA 1LSJA 2OC9A 1F06A 2B8WA 2B1GA 2CF5A 2C82A 1MVNA 1J22A 3N39C 2DOKA 1KJIA 4IDDA 4MP3A 2BSQA 1KMHA 3NUZA 4H27A 3O82A 1JKMA 1N8NA 1VMEA 1YUBA 3VSCA 1BCRB 3IBFA 3BE4A 3BM5A 3NIWA 1T3LA 1BE6A 4JQSA 4ONEA 3ESBA 3IOYA 4JB8A 5GZ6A 3TIGA 1L5LA 3OLQA 1E0SA 2ZUSA 2OMEA 3RYHA 1NOJA 3R5KA 2YC4C 2JHPA 3DL4A 2PPVA 3ND7A 5E3IA 2P4SA 2DXIA 1TQ8A 1G64A 1ZX1A 2Z57A 2AYZA 4J07A 3UMGA 3CNOA 3TZHA 3H99A 4RMHA 2WTUA 2AW3A 3TSOA 2IT1A 3NV9A 1R9NA 3FI9A 4DLSA 2H4XA 1HBJA 3TDMA 3FYUB 1L4EA 3LYUA 3IOBA 5BMVF 1XTZA 2ZREA 2CLEB 4NZMA 4AP6A 4NYJQ 3C8UA 3QKTA 3TZKA 4MR9B 3ECSA 3EGXB 4WK0B 2O8EB 4YXFA 1MJHA 2BYTA 4RK5A 1XF1A 1T15A 4UEWA 2AL7A 1KGSA 1MHTA 2IHNA 3PX7A 2G72A 2O4UX 2XDYA 1JL3A 3LV8A 1QM5A 1G8GA 2H57A 1VJDA 3OZAA 1PJ2A 3IDAA 4HTFA 5E4FA 3TLAA 2GM9A 1TXGA 1WV0A 3F71A 2JGDB 1YFLA 4AY6A 4ABYA 4HZIA 4KRFA 1IVNA 5AFSA 1E2NA 1DAPA 5E1DA 1Y82A 1Z0ZA 2W93A 4LJKA 4CL2A 1CV2A 1ZL2A 4F4UA 3AOEA 2FR1A 1I4DD 4CMEA 1U7OA 3R5TA 1UC5B 2X5OA 5AW6A 1GFSA 2XDQA 1R4NB 1T0IA 1U2SA 2F2TA 2YNMC 5FTNA 4BO0A 5TB5A 2VOEA 4JXXA 4MVJH 1GQQA 5EQJB 2A9RA 2DFDA 5TPWA 4BMPB 2CFOA 4YV7A 5C8DA 4FCTA 2Q2QA 5J5AA 1N7IA 1YI1A 3Q5GA 5INTA 2XA9A 5K0EA 3OJLA 1FIUA 1FP6A 1Y6ZA 3AUKA 1YJXA 1CRWG 4RJLA 3STXA 3WXMA 3IJEB 3I1JA 1FMFA 1C8KA 3PI6A 1S9HA 2ZTVA 2Z08A 4C4ZA 3BJMA 2Q6OA 2E5FA 1G3QA 4OUKX 5JPCA 1J42A 2DYKA 5TV2A 2C4MA 4L08A 1H85A 2ZUUA 3TCXB 2JD0A 3UH1A 3D4NA 3HB4X 1SEPA 4TTIA 5HX7A 4HQOA 4P0QB 2P2GA 2GKGA 4M0PA 3MGCA 1J2UA 1LK5A 1VE5A 4F3KA 1MA3A 1YKSA 4HWOA 4F7DA 3UH0A 1QG0A 4TWRA 3B1XA 1Z39A 4RNDB 2J3HA 2OGZA 3N8NA 4KRGA 1NBWB 2R1VB 4GZLA 5JSYA 4BNHA 1NPTO 8ADHA 3ID6C 5CD9A 4MI1A 4B45A 1TM1E 3DLBA 4JFAA 5KOHB 2GAAA 3PNBA 2CJYA 3OZSA 3W5SA 1Y0BA 5D5QA 4D8VA 1XZBA 3SU8A 2FEWB 1NQXA 3CZPA 2YZKA 4YX9A 1ENOA 3JR7A 1E2QA 2VQDA 4UREA 2OKGA 2QP3A 4YAEA 3ZWXA 1LF5A 3WA7A 3QKSA 1QLWA 3NT5A 5FNVF 2E6UX 1D2AA 2RGDA 4ENSA 4ARSA 3EJ6A 4JYMA 4N3AA 3FETA 4XFDA 2G09A 4XJTA 1XCLA 1BS1A 3PPIA 4YJHA 2PGLA 3ROEA 1H23A 2XXAB 4KYTA 1EHIA 1CXZA 4NMMA 2IOYA 5LLSA 3KJZA 2GN8A 3DVAA 3I6IA 3K9LA 3OX1A 3R7WA 5BRAA 1JKJA 3GPCA 4KKXB 3VTAA 3MD0A 4QA9A 1PCXA 1PN3A 1QCDA 3G0BA 3W9YA 3AHEA 2I4NA 1FFSA 1QO0A 3Q8LA 1NULA 1QNFA 3CZ9A 3JYQA 2OAGA 2HIGA 2VYVD 4PCLA 1XHEA 1MAUA 3N8DA 2AG5A 5E9WA 3ESDA 4D25A 3H2KA 1FF9A 5DHQA 2OLKA 1TJNA 2JD2A 3A4VA 4CHGA 4IWXA 1NXVA 1V7ZA 3RFFA 5DX8A 3FSEA 2P6MA 4NKRA 4OBEA 3IEMA 3ZCUA 1WDMA 2IYFA 3O4HA 1O03A 1HKHA 2P3QA 3OLCX 1JJVA 2Y68A 2ZR7A 3DE1X 3HJRA 4W1RA 2PIAA 4TN5A 3O9MA 1I33A 3P9PA 3V48A 5K8VA 1AKVA 2R68A 3CFYA 4J4TA 5CRIA 4EDHA 2AR0A 3ENKA 4NSNA 5ALRA 2HJVA 1I6WA 2QUZA 2PKYX 4QPDA 3C3AA 4TN1A 4PLVA 1WZCA 2G7ZA 4AP5A 1QO0D 3OESA 3NAQA 1G20A 1RU3A 2QJOA 3FHLA 3QWBA 3F5FA 3K2QA 3ROGA 1S96A 3GWZA 5LIRA 4NL4H 4TROA 5KYKA 1QB8A 1WHTA 1E3IA 2MSKA 3O5AA 2PVPA 2Q6LA 1EGQA 3KU1A 5A1TA 3UMRA 3SR0A 4DIUA 3COZA 1Y4AE 5BRNA 1GXSA 1I3LA 1YL5A 1YHZA 3S1AA 2IYXA 2XEXA 3PUHA 2D8AA 3L9WA 1RC8A 2HR1A 2GPJA 3N2GB 3OFVA 3R0VA 1T8PA 1TZCA 3CZ5A 3M2PA 1GSOA 4HLDA 4DPKA 2JIZD 1RXWA 3QBVA 3AF0A 5T8KC 3L1VA 4AS3A 5EP1A 1SXPA 4GRDA 4I1SA 4AI6A 5A62A 2QVCA 1PR9A 2OHXA 4JC4A 3B3JA 3ZI4A 1S8OA 1Q2UA 4IR7A 5BSUA 5IULC 1VJGA 3V7UA 4DV2B 1GSHA 2DTDA 2GZ1A 2EFHB 2J48A 4BB5A 4DGQA 4P3OA 1E7SA 1DJNA 3KB8A 3RFXA 4EX6A 3KOUA 1U11A 3KV3O 2DERA 1CY8A 1EFVB 5HBGA 4XYLA 5THQA 5AM2A 4IZ6A 5EXDA 5TMEA 3TXXA 1U0SY 4OOFA 1WBBA 3G13A 3D54D 4FGWA 4DTCA 2D4AA 3VKWA 5L9AA 1XRRA 4AKTA 3C39A 1TLTA 1T6BY 1ZW6A 3NNDA 4B2LA 1N6NA 4EHDA 4BECA 3HZHA 2QJTA 1M74A 3N87A 2Q7DA 3EZYA 5LJIA 5LMUB 5D3KA 3WLSA 4DYDA 2PD3A 3DCIA 3H87A 3H2ZA 2RHGB 4XR9A 5JMTA 3A3PA 4MO2A 4GMGA 3HEBA 2XXJA 4AP9A 3IPRA 4LF4B 2IIQA 3RE1A 2X8BA 4FFNA 4L75A 5FL7A 3WC4A 3AWDA 5HCIA 2NVOA 4M21A 3EXHA 1Z0AA 1UMDB 2W8BB 1RM5A 3TZBA 4LDNA 3GFGA 3MWKA 1YR3A 2OCDA 3HCRA 1I80A 3PFCA 4NJEA 4NYMR 4CTKA 1RWXA 2XKAA 3E27A 3N8GA 4RVOA 1MB3A 3VU9B 1L5KA 2J9FB 4D5GA 1LDGA 1CW2B 3GF4A 4GSYA 4ZI5A 4AKEA 1KPGA 5IDVA 2O8BB 3KTAB 3AT1A 4U3JA 1RYFA 1V3QE 2O3TA 2YINC 4RIIA 1U3UA 2E0IA 3UC9A 3ZIAA 2Q5QA 2BAGA 3MJEA 2NTVA 4WCVA 1A71A 2WAOA 1J56A 3CINA 4H6WA 4NU5A 3ZE1B 1KERA 1Q92A 1Y4UA 3EOBI 3PGVA 4ITRC 2JI4A 1HZZC 2NPOA 3WQQA 4AQDA 5FORA 2WT8A 1JI0A 2VKQA 2AB0A 3I1IA 4LNHA 1MH1A 1YDEA 1UIRA 4MUYA 1PGJA 2WJWA 5FL7D 3MSXA 2QRVA 2Y71A 1W5BA 3ZHUA 4DR1B 2Z5VA 4E09A 4FQ7A 4OIMA 3LCJA 3RVSA 4DT1A 2ZTHA 4KO3S 4KODA 2FDXA 4OMCA 4MTCA 5KAPA 1C0LA 3MQFA 1MAVA 2PBFA 4A7PA 3EZ7A 3TJZA 1RXCA 5I45A 1KJZA 2C2OA 1UC8A 5D8DA 2BGWA 1E4OA 3S68A 3EDRA 1UZUA 5IZ4A 3TRFA 1VI6A 3A1VA 3ELDA 3TVDA 4CIXA 4KFSA 4D9KA 1ECCA 1U8UA 3RYCB 4B48A 1D1SA 3V32A 3NP9A 4BQSA 2VI5A 5BN1A 3QKWA 2HWWA 4UUBA 4I4CA 3LVBA 3A2KA 4ERXA 1B00A 4KVFA 1OVGA 4QQKA 5JI3E 4GL2A 2GYUA 2EFEB 5G40A 2PFKA 4U6NA 2X4IA 2X0IA 4L74A 4ND7A 4LQCA 4V2UA 5J2UF 5CH3A 3NXSA 3DUWA 3I61A 1ZITA 3PC3A 4J0JA 1ZD5A 4KPFC 5C37A 1QF7A 1K2VN 2UAGA 3WHPA 4N41A 4EFLA 5JCXA 4Q9LA 1ZNZA 4GC9A 4YQEA 2FMUA 1FX0A 4DHEA 4UDYX 2R8PA 2B4AA 2O1WA 5JAIA 1BOOA 1VB5A 3FVVA 3QVJA 2RGWA 4CLXA 4A0SA 4D0SA 3CVUA 3ZJUA 3L8EA 4RKWA 2XE4A 2PBZA 4MV0A 4A2PA 1UBHS 3HEAA 2YUTA 3FOCA 5CT9A 1RZUA 2A3RA 3W04A 5KSYA 1K7XB 2BGUA 3E8MA 3PDIA 5DO9A 2H31A 2YICA 3GGGA 1PV4A 5H7XA 4HDRB 4O4HA 1FX1A 1PRYA 1QXSA 5KYXB 2UZAA 3WK4A 1GQFA 4DMGA 2ZIXB 4D98A 1PFQA 1TCBA 4IV0A 4R84A 1DOAA 2E9SA 4H4EA 4M7OA 4MW7A 3RC1A 2ERYA 3SLKA 3ZUGA 3LKVA 3RYCA 1SVNA