4G4GA

Crystal structure of recombinant glucuronoyl esterase from sporotrichum thermophile determined at 1.55 a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
CSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 4-O-methyl-glucuronoyl methylesterase
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
source organism Myceliophthora thermophila
total genus 134
structure length 367
sequence length 367
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4gA00
3WWDA 2VJDA 5C8XA 1ETHA 1W4LA 1CUSA 1QIIA 3L1IA 3O4HA 4KAAA 1AQLA 5HK8A 1QIDA 5ESRA 3FSGA 3UUFA 5YASA 3H2HA 1NU8A 3O95A 1Q0ZA 5EHNA 1ODTC 2EDCA 1BCSA 1QIEA 2WUGA 1LPOA 5K3DA 1XRPA 3ZWQA 3U1TA 1K63A 4C01A 3KD2A 3WL5A 5LIPA 1AZWA 5ALOA 4CCWA 3I2FA 3X3HA 1CUJA 1LNSA 2OCIA 5JAUA 2VJAA 3I6ZA 4X7BA 1JMKC 4DLNA 3HI4A 3H19A 2DHDA 3QPAA 4W1QA 1GGVA 3K9BA 4W1RA 3M82A 1NU6A 1U8EA 3C6BA 4N8EA 5DJ5A 4KYVA 3TEJA 5BWBA 1LPMA 3QM1A 2O7VA 4KE7A 4PNZA 2WUEA 2PSEA 1GT6A 2XMGA 5AH0A 3A2LA 1UKBA 1DWPA 5A6VA 2C5FA 3GELA 2WJ3A 2OLEA 1LPBB 3F8SA 2BFNA 3OC0A 1HBJA 5I8PA 5ALPA 3O4GA 4AB1A 4WFIA 5DYYA 5LYYA 3C8HA 2VT7A 2VSQA 3O4IA 3FLEA 3IUQA 3ZV7A 4JYMA 4Q3LA 3WK5A 4QEKA 3WZLA 2R11A 5DTJA 2H9YA 1HLGA 1K4YA 4GLBA 1QIFA 3DS8A 3N0TA 3H04A 4E15A 4BAGA 4WFKA 5IVIA 3W05A 1X2EA 2CJPA 4G8CA 2B4KA 4BE4A 2HHAA 3WKCA 5AKKA 2ZYRA 4BDSA 2IIVA 4U2BA 4MEAA 4EY6A 3IDAA 3E4DA 2WFZA 5T4FA 1FSSA 1ACLA 4G5XA 2JBWA 1EX9A 4J0KA 2QS9A 5CH8A 2I3ZA 1YS2X 1KEZA 1ZIXA 1HQDA 3R3VA 2XUKA 2O2GA 4MQMA 1TKRA 4IO0A 1Q84A 2D0DA 1XQVA 1F0NA 5KWIA 5JD4A 1QIJA 2FJPA 3IUMA 1K5PA 1LLFA 4LKOA 2ACEA 1M33A 2UZ0A 2WKWA 5DNUA 3SWWA 2QVBA 1XKLA 4BB0A 3BL8A 2E3JA 2XUOA 3FLAA 3WYNA 4P08A 1UT6A 4YPVA 5A7FA 1MU0A 1WOMA 1Q83A 4B9EA 1GPLA 5AKEA 4PF1A 3WKBA 2ROQA 4G9EA 4Y2XA 3C6ZA 3PICA 1UKCA 4UFPA 4WY5A 3VKFA 4AO6A 3ESBA 1VE6A 1UK8A 4LYDA 3IIIA 3V1KA 5LZ4A 3WWCA 3VJLA 2ACKA 2XUGA 4H77A 1PV1A 1H2WA 5AJHA 1AKNA 1XFDA 5D6OA 4G8DA 5C7YA 3UUEA 4N5HX 4M0FA 3AINA 3GBSA 3TRDA 4UHBA 2GZSA 3G9XA 4PO3X 1XZFA 4ZV9A 4FOLA 1QIKA 4ZREA 2ZVDA 3MVEA 3T4UA 5HQ3B 4OB8A 2WSLA 4Y2QA 2JGFA 1GKKA 1WCYA 2Z3WA 4AO7A 1SCQA 2QR5A 1A7UA 3D5EA 3PI6A 2OCLA 2EEPA 2WUFA 1EA5A 3LIPA 5FOQA 2RONA 5K3AA 2H7YA 5A62A 4UBJA 2PSHA 3H2JA 4CI9A 2XUFA 1QIMA 1ORVA 3L1HA 3E0XA 3PUIA 2H7XA 2XE4A 1YASA 4KAFA 2HADA 4LXGA 4X91A 4K6HA 5BV7A 5IVKA 5CT6A 1CPYA 1SCKA 1WPXA 3LS2A 2VJCA 4KJXA 4AN0A 3O4JA 1XRQA 3HABA 1XZAA 4B80A 1R1DA 1GQSA 3VJMA 5LZ8A 4DMKA 1UK9A 1MN6A 2C58A 4D9JA 5KWJA 4FNMA 3QMVA 1YAHA 3C43A 4HRXA 3GZJA 2XUJA 4B6GA 4QDUA 3STWA 5JAHA 1XRLA 5I9IA 2B61A 3G9UA 5DTIA 3EQ8A 3STTA 4YK7A 5FUMA 1XZGA 1XZIA 2PKYX 4RE6A 4X6YA 3QYJA 4M0MA 4QDXA 3KSRA 3G0DA 4H7IA 1O6GA 1XRRA 5HZGA 1BEEA 3R40A 3YASA 2DCMA 2HM7A 1ZIYA 2AXEA 1IUOA 2JEYA 4FKBA 4J0IA 4P9NA 2HA0A 1EINA 1ODSA 5AKLA 1RP1A 3HEAA 2WFMA 3I6MA 2C7BA 2OAEA 4AZ3A 1Q0RA 1W1IA 4J0CA 2PSDA 2PUHA 4QDTA 2BCEA 4HXEB 3DOHA 4H7HA 1ZJ4A 4CIAA 5ALNA 5AIBA 1XQWA 3AIMA 3D59A 1CVLA 1GPNA 2XB6A 1QIGA 3DQZA 1XZDA 3QMMA 1MT3A 4GXNA 1QLWA 2XUQA 2CMFA 1J1IA 2Z3ZA 5CT5A 1QFMA 2WIDA 1YS1X 1XZJA 1ZOIA 3AUKA 2PBLA 2CZQA 4UHCA 1QE3A 2QT9A 3WK7A 5K3CA 2QMQA 1YAJA 1Y37A 1ACJA 3ED1A 1JT2A 1AX9A 3C6XA 3H2KA 2HA2A 4W1SA 5ALKA 2Y6VA 4X6UA 4E11A 4ETWA 3I2JA 1GXSA 4DGQA 3R3WA 4Y2PA 1Y7IA 1YA8A 4DIUA 4U2CA 1RWQA 2HRQA 2DQYA 2G5TA 2V98A 4UHDA 3KWJA 1YSCA 4DMFA 1JI3A 1MX9A 2XLBA 4C6HA 5A2GA 1E89A 4XWGA 4O08A 3WK9A 1CR6A 3C70A 5JARA 2R8BA 3W9BA 4UBOA 5EIEA 3QVMA 4OCZA 3R41A 3BDIA 2XUIA 2K2QB 1UOQA 2ES4A 4Y2SA 3ICVA 5ALFA 5H3HA 3H18A 3HJUA 2WJ4A 2WG2A 3D7RA 4AN1A 2XT0A 5FDFA 5ALMA 4J7AA 1TCAA 4PSDA 4ARAA 3PE6A 1USWA 1BN7A 5CURA 1BN6A 4UFNA 1N5MA 1VKHA 5CXXA 1SCIA 3MGAA 3UMJA 4HVTA 2XMZA 2XUDA 1JJBA 4M0EA 1PFQA 2VAVA 5D7BA 1CUYA 2XQFA 4Y2RA 3Q0TA 2ZSIA 1BROA 2XUHA 3FNBA 5LZ7A 3G0CA 2ZJFA 4OU5A 4DNOA 3R3YA 1HKHA 1CUUA 1JU3A 5LLSA 2OQVA 3DD5A 3G02A 4XX1A 1AUOA 1P0MA 2BJHA 4XJVA 4NVRA 5FKJA 4GDMA 5AK6A 4BZZA 1CQZA 1DINA 2H7CA 5ALSA 5AOBA 2B20A 5ALQA 1IMJA 2ZYIA 3ICWA 5AM3A 1CUCA 1C7IA 4AMYA 3RM3A 2WHPA 5T4HA 1FFAA 5IVDA 4JNCA 2AJBA 1H2YA 2BGNA 5CT4A 3WJ2A 3CCCA 5ALHA 5JD6A 2CB9A 3HSSA 3B3QA 4FBLA 4B83A 1TK3A 5AO9A 5HQ3A 4NZZA 2DHCA 2QXUA 4A23A 4X00A 3STUA 1E8MA 1CUZA 2XUPA 4F60A 5AP9A 2WUDA 5LZ9A 1CUWA 3WJ1A 1UZAA 4BATA 2BUBA 5E4JA 4WCVA 3T52A 4OB6A 1JJFA 3WLAA 4HS9A 1DT3A 1LGYA 4KE8A 3BJRA 1CEXA 3I1IA 2XLCA 3DL4A 1MPXA 5AKJA 2VTVA 5SYNA 4X90A 3HRHA 3VDXA 1GKLA 3BDVA 1LZKA 2V9ZA 2VATA 3A6ZA 3DDUA 3ESAA 4WDRA 2WIKA 3GROA 3I2KA 2GYVA 1HDEA 4GHWA 2Y2UA 3HACA 3BIWA 3G9TA 4DM7A 3IURA 4CG1A 1GZ7A 1L7RA 3BF8A 4JH0A 2ONCA 1WM1A 3C45A 1R88A 4KEAA 4HXFB 4UFOA 5ISMA 4C4YA 1FJ2A 4Q3KA 3E1GA 4G9GA 4B85A 4A5SA 4H0CA 4B81A 4XIIA 5AK5A 3K6KA 2QUAA 4U2FA 5HFNA 3WA6A 4E14A 3WIBA 3AIOA 1N1MA 4CCYB 3I2GA 4ARBA 1MNQA 2NW6A 3VISA 1YCDA 4EA6A 1XZHA 1BEZA 4J0GA 2YYSA 2BKLA 1J07A 2XQIA 5HK9A 2C0QA 3HXKA 5FXMA 4WFJA 1ZGBA 3H2GA 4L9AA 1XKTA 3OURA 4PSUA 2XMQA 2IITA 1FFCA 3FAKA 3QH4A 4KR0A 4GI1A 2WU4A 4FFWA 1EHYA 1CUVA 4I19A 3AFIA 5T4EA 2XDWA 1QZ3A 2QTBA 5E4TA 1QFSA 5AM0A 3BWXA 2I3DA 1XROA 1B6GA 4A16A 2HRRA 3PUHA 4HAIA 3G0BA 1VA5A 1A8QA 5A7GA 4FWBA 1UKAA 1XLWA 1EI9A 2QJRA 2C0PA 5AKGA 4J0JA 5K3FA 3WWOA 3FVTA 4B82A 4X6XA 1AGYA 1R4ZA 2JF0A 2HU8A 2C5GA 1UK7A 4FTWA 2GZRA 4ZI5A 2XQKA 3EBLA 3C6YA 4ZXFA 3A2MA 3U0VA 4C89A 1C4XA 2RHTA 4F0JA 1IUPA 2IX9A 2X76A 4L3WA 2WIGA 5A71A 3S8YA 2QOEA 2RAUA 5AM2A 3ESDA 1IZ7A 5AI6A 4Y2YA 2FX5A 3DKRA 3LLCA 1JMYA 5A7HA 2DSNA 1LBSA 4HTAA 2AJ8A 3WA7A 3OOSA 2XQJA 5FLKA 4Y2JA 3WL7A 4DNFA 3JW8A 1CUFA 1T4MA 2PU7A 5ALVA 3QMWA 5JYCA 2I78A 5JZ9A 1LZLA 4UPDA 2JGEA 3SC2A 4BTLA 4TGLA 2WFLB 3ZPXA 1BU8A 2G5PA 1S8OA 1DQZA 4ROTA 1QTRA 4TPKA 4BDTA 3WK4A 5ALLA 3CN7A 3WWPA 5EIHA 4AZ0A 5CMLA 2FUKA 4Q3OA 5JATA 5FV4A 2GYWA 3FCYA 3HC7A 1KU0A 4OB7A 3V9AA 4BCBA 1DT5A 1DU4A 4K6GA 1CUBA 4FLEA 1CUEA 3WQHA 2HU5A 1CFJA 1HPLA 2EDAA 5AI9A 3A2NA 1I6WA 4U2GA 1JFRA 3AJAA 5JAPA 5AOAA 1QJ4A 1LPNA 1T2NA 2OCKA 1XLUA 1ZD2P 5ALUA 3FWHA 1ZD5A 2OCGA 4OPMA 4U2EA 4Q34A 4IQ4A 1N8SA 1P0QA 5HF5A 1ZI8A 4QZVA 1W52X 1U2EA 4GW3A 4N8SA 1K8QA 3C5VA 2WG1A 2HFJA 4G4JA 2WIJA 1IZ8A 4EY8A 4B0OA 1BRTA 2JGKA 4S0XA 4LXIA 1EXWA 5ALEA 3MUNA 5C81A 4LYEA 1R9NA 4I4CA 2CBGA 1MAHA 3FBWA 4H18A 3VVLA 1ZJ5A 2J4CA 3R3UA 2WTNA 4OUKX 4X97A 1ZD3A 4BRZA 1G5FA 5LZ5A 4ITVA 2GBGA 3ANTA 5FRDA 3V1MA 4J0HA 1R3DA 5ALTA 4B9AA 1A8SA 5FP0A 1GQRA 3IVMA 2XUAA 3D3NA 3STYA 3I2IA 1IVYA 1OILA 4Z49A 4BVLA 4B84A 4UHFA 3NOXA 3DLTA 2OGTA 5AI0A 3FYUB 4FLMA 2ZYSA 4DNPA 3O9VA 1MO2A 2CKMA 3DCNA 5AICA 5DNWA 4MEBA 1K6EA 1TIBA 4RE5A 5BOVA 5AIAA 2JGMA 2ZJ6A 4G4GA 3R3XA 4OYYA 3SK0A 3AIKA 4IH9A 4EB0A 1QTIA 4DYHA 3BE8A 3I1YA 4QA9A 5IKXA 3FCXA 1O6FA 3FSGD 2PM8A 4ZRDA 4H7EA 5E2IA 4CG2A 4UHEA 1VA4A 4EBBA 2WHQA 4BZWA 3O9MA 1WHSA 2Z5GA 5EHQA 5IVHA 4GECA 4C87A 2HIHA 2X8BA 1UOPA 3ILSA 5JALA 3C5WP 1CUDA 2VT6A 3KXPA 3D4LA 3F9CA 4Y2VA 1L7QA 1DQYA 3QPCA 3ZLTA 1VE7A 3K2IA 3A70A 3Q8WA 5FPPA 5LKRA 3STXA 1YR2A 5J3JA 4BRSA 4PV7A 1WB5A 3DYIA 3PFBA 4Q05A 2OQIA 3RARA 1BS9A 4EY5A 5HKBA 1U65A 3TGLA 4HXGA 1FFEA 4Y7DA 2AJLI 3AILA 1CUXA 4QNNA 4KAJA 3WMRA 5AKHA 4MWSA 2G63A 2ORYA 4CCYA 1UFOA 3IUJA 2GBIA 4MQLA 5JD5A 2RI6A 2W6CX 5AI8A 1R50A 4QDZA 4DTCA 3W2TA 3B5EA 5JAOA 4X92A 2J4FA 5JIBA 2Y2VA 2Q0XA 5AHXA 4U2DA 1KU6A 3M81A 3V48A 5LP1A 3AZOA 5ALJA 4PQEA 2RGUA 1RYYA 3EQ9A 3HYSA 3NUZA 1ZD4A 4UBKA 2C4HA 3VVMA 3WL8A 4KRXA 2OG1A 3NGMA 4I3FA 1DWQA 1F8UA 4FLFA 5CXUA 1G4HA 1P0PA 2J3DA 2QRUA 2YASA 1MNAA 4J03A 3FYUC 1EH5A 1F0PA 4X94A 4DSZA 1ORWA 5CW2A 1J2EA 1UOOA 1VJ5A 4DSAA 3EIOA 1XLVA 3QBJA 1CLEA 2VQ6A 5CTAA 4QWMA 2BUCA 4UHHA 1XQYA 3SX4A 5EI5A 3EF3A 4YASA 3D0KA 2HA3A 1YB7A 1JU4A 1AURA 3BXPA 5AM5A 1LPPA 1XZBA 4C88A 5HKAA 5AKIA 5LKAA 3H1BA 3STVA 5AOCA 4NS4A 4TVKA 2BUAA 4MJ3A 3D2CA 3W06A 5HF6A 1EVEA 4BBZA 3HZOA 5HF8A 4C4ZA 4BE9A 1OCEA 4W9RA 1UWCA 4RGYA 2G4LA 1FFDA 2ZJ7A 4IH4A 2Z8XA 4P93A 4OYLA 3CCBA 4FNGA 4X95A 4UBMA 4EZIA 3I6YA 3W9UA 3G0IA 3H0CA 3H17A 5HFAA 2JIDA 2ZSHA 5E4YA 2XQGA 3RKSA 5AKXA 2XMDA 1CUAA 2DR0A 2PL5A 1WB6A 2J3QA 2WJ6A 4EY4A 2Y1KA 1BE0A 1E66A 1QO7A 5K3BA 3BF7A 4EUSA 2XMCA 4DMHA 2QKYA 2PPLA 2WFLA 1WPRA 5DYTA 3DNMA 2AJCA 4KE9A 4OSEA 3B12A 1ISPA 4OD0A 2XI4A 2XMSA 3DOIA 1DX6A 4KRYA 3ZLUA 4PW0A 3IUNA 4H7FA 1UXOA 1QOZA 5C8ZA 4N8DA 1MX5A 3GFFA 1W76A 3TJMA 3HLKA 3IB3A 4C4XA 1LBTA 5ALIA 2O7RA 4OU4A 4BC1A 5JADA 1JJIA 3G7NA 4AQDA 2QXTA 4G8BA 4LIPD 4AXBA 3R0VA 5ALWA 5AM4A 1LPAB 4DNQA 4FBMA 4QLAA 4G4IA 3RLIA 3W04A 1VXRA 5ALZA 4BCCA 4CIBA 3F97A 3DKKA 3H2IA 3R3ZA 4H35A 1MAAA 1A88A 3WZMA 1N5RA 3DYVA 4X85A 5AI5A 4JUIA 1ZI6A 1EB8A 1Z68A 2JGLA 2WLSA 2PUJA 2WU3A 2LIPA 5EGNA 3QPDA 5CH5A 3CN9A 5CRIA 1G66A 2XMRA 5AK4A 2VEOA 3D2BA 4INZA 2JGJA 4JEIA 1W75A 1E3QA 3EQ7A 1CV2A 5EFZA 3PDCA 3WWEA 4BAUA 2HA6A 1TRHA 3KDAA 1QONA 3WKEA 1THGA 4AX4A 1WHTA 1XZLA 4L0CA 4CFSA 3BIXA 5T4BA 4FMPA 1VOTA 1E5TA 2PX6A 4PSCA 4F5ZA 2O2IA 5JZSA 2PU5A 5D3KA 3C8DA 1CUGA 4P92A 2PVSA 5CH3A 3E3AA 2WM2A 3M3DA 5EHXA 4UBLA 2DFPA 3IULA 2HDWA 2W22A 4BP9A 3DJYA 3BJMA 4MWTA 3V1LA 3RK4A 3I2HA 1NX9A 5DLPA 2OGSA 3MUOA 1QO9A 3FYUA 5AI4A 2ZYHA 4QLOA 5KBYA 5F4ZA 3D2AA 5JANA 1XZKA 2WHPB 1P0IA 1CUIA 1U4NA 2CEKA 2VAXA 3JWEA 1L7AA 1H22A 2JGIA 4K5QA 1D07A 3AZQA 4QE3A 2QUBA 2HA4A 2WTMA 1WB4A 2HA7A 2AJDA 2WG0A 2GYUA 4FFVA 2V97A 3F98A 3L1JA 1MX1A 3PFCA 5ALYA 2HL6A 2FJ0A 3KOOA 1ODCA 7YASA 4WY8A 1AC5A 1Y7HA 4L72A 5AM1A 2YH2A 4DMCA 3G9ZA 3O0DA 4AO8A 1DWOA 5LZ2A 3G8YA 1VZ3A 1E8DA 5AKYA 5ALRA 2XMBA 4F21A 3LP5A 1AMNA 1X70A 4N5IX 1B41A 3WL6A 3ZLVA 1LPSA 1XZCA 2GBCA 1W6RA 5ALDA 1R9MA 3I28A 4IHAA 1TCBA 4Q1VA 4BVJA 2RIPA 1J06A 2H1IA 2Z8ZA 5C8VA 1CQWA 2BGRA 2PSJA 1JKMA 3LCRA 2ECFA 1EB9A 1H2ZA 1XZMA 3QZUA 4B7ZA 3WK6A 3F96A 4QWWA 4HZGA 3KWFA 4WJLA 4G1FA 1EVQA 2HFKA 4LXHA 5CT9A 1EDDA 4X71A 3M83A 3WI7A 3WIOA 4LHEA 5DYWA 1XQXA 4HRYA 4J0DA 3DEAA 1IUNA 2V96A 1UK6A 2X5XA 5K3EA 4XVCA 3VJKA 3IBTA 4UBNA 3FLBA 5FPQA 3WKDA 1F6WA 1SC9A 2GBFA 1OXMA 2QM0A 1VXOA 3IA2A 5K5EA 5CT8A 4X93A 1CUHA 2VF2A 2YXPX 4GWLA 2WHRA 4BCDA 1DX4A 4ZWNA 4EHBA 4EY7A 1E8NA 5JZBA 5DWDA 4FDMA 5DNVA 4MYDA 2PSFA 4MXDA 1FFBA 4BC0A 4KACA 3ZI7A 1CRLA 4WDQA 2P8SA 3P2MA 5KREA 3V1NA 5SYMA 1H2XA 5ALGA 1YA4A 2D5LA 2OAGA 3H1AA 3NWOA 4W1PA 4UUQA 5ALXA 1X2BA 2OGZA 2OPHA 2WQZA 3FOBA 3FVRA 3PF9A 2WILA 5K3FB 1TQHA 2I03A 2BAGA 1ZICA 1VZ2A 4BAZA 2HA5A 4IH1A 4RNCA 1HL7A 1TAHA 4BTVA 5D3ZA 3ESCA 3C87A 4JYPA 1PJAA 1EK2A 4Q82A 4B0PA 4Y9SA 4AMZA 3PF8A 3WYDA 3AZPA 1QIHA 4YX9A 1MJ5A 1GPKA 4H7DA 3ANSA 2CUTA 1MTZA 2QZPA 4RPCA 2OXEA 3OPMA 1TCCA 1QGED 1ZGCA 4H7JA 4UBIA 2DQZA 4GEGA 1ZI9A 4QDOA 3JYHA 1EDBA 4V2IA 4BP8A 1CIJA 1G42A 3QITA 5EHZA 2O2HA 2DHEA 3N2ZB 4NMWA 3FYTA 2WIFA 1EDEA 4GBGA 1A8UA 1H23A 3F67A 1THTA 3S2ZA 3VXKA 3GUUA 1XRNA 2JEZA 4BYMA 4Y2TA 4J3JA 5HCUA 4ZGBA 1C7JA 1DTEA 1BCRA 4FHZA 5EIAA 1EK1A 5HF9A 4BVKA 4CG3A 3DL7A 4H7KA 2HU7A 3OG9A 4MYSA 5I7UA 4K6KA 1XRMA 1SFRA 5CBKA 4E46A 5IH7A 3CXUA 4W63A 4K2AA 3OTQA 1YB6A 4Y2UA 2QJWA 3WK8A 5AKZA 5BWCA 6YASA 1XZEA 4KE6A 2RHWA 2Y6UA 4ZV7A 4X3CA 2B9VA 3LIIA 5AK3A 3G0GA 3OM8A 3GA7A 1VLQA 1SOMA 2VJBA 2VA9A 5JASA 3WKAA
chains in the Genus database with same CATH superfamily
2QORA 1X1CA 2X2OA 3RHTA 3TTWA 3WWDA 4KSCA 2P4SA 4ENSA 2Q8PA 5LA6B 3U60B 4YCLA 1UC4B 3WGGA 3MG9A 2QE7A 1PO7A 3CE9A 4KDEA 3EQZA 1W4LA 4KQ9A 4L9WA 4UCWA 4ZAZA 1J0DA 1G8FA 4R40A 1W0JA 3AHFA 4PNHA 4YALA 5JQGB 3K35A 1GGNA 1VYVA 2LNDA 2QVLA 2RSLA 1VCHA 3O4HA 1N92A 4GLFA 4ND6A 1IIBA 4PTZA 5HK8A 3G5UA 1T2FA 1PYOA 2NMVA 5EJ2A 2C29D 3A6FA 3AEXA 2PZ8A 2XGJA 4WN3A 2B4QA 4R1LA 1IATA 2ZI3A 4JBNA 1P8JA 2OQRA 2Z2JA 4EF4A 5CFLA 4O6VA 1EFPA 1OE0A 1GPWB 5LUBA 2R6DA 5CLQA 1FFWA 5EHNA 1ODTC 5L40A 2A5GA 1EQUA 1BCSA 4WKCA 4HMPA 5L7TA 1T3TA 4P32A 3MGKA 2P6UA 3GEIA 1MBZA 2RAVA 1XTBA 1L5WA 3DP7A 5AOVA 3GJRA 3MWJA 4P53A 3UMRA 5K3DA 1CR2A 1XEXA 4C08A 4E2WA 3EGDB 2HSEA 2ZSBA 1PN3A 2VIIA 5EZ6B 4DNXA 4B74A 4IEEA 1MJGA 3P94A 3DB2A 4YDRA 2BN4A 3BMQB 1C2YA 4NPHA 2QX6A 1HMYA 2O2CA 5EXSA 1ZEMA 3BKWA 4XUCA 4MVWA 3KNZA 3QTTA 4BWYA 2XYQA 3GEMA 4JC4A 4BLVA 4BX8A 5F9FA 2QN2A 4LDZA 1ICEA 2QDKA 2CLIB 1V7PC 1E92A 1DELA 1M6NA 3I2FA 4H6XA 5G4KB 2Q5FA 1B3RA 2OFXA 2P40A 4LHWA 1WULS 4E5KA 2OSVA 3NI2A 4PICA 4WERA 2V7VA 2VJAA 5IBCA 3NANA 4KOAA 4RELA 1VL6A 1RQ7A 3TBFA 4BQIA 1JYFA 3AHDA 3PC3A 3QMPA 1PR2A 1CD5A 2O0LA 2IZ6A 3QEKA 4W1QA 3ECCA 4LMPA 3ZYCA 5CLIA 2D59A 2JIZA 4U9UA 1P9WA 1J5PA 4IW3B 5AW3A 2ZDGA 3M82A 1U8EA 1Z39A 4YBZA 2ATXA 4HO1X 4WK0B 5CDFE 1YMVA 4MS3A 1ZM4A 2PD6A 3P9ZA 1UEJA 4YLEA 3V6LA 4YJ2A 4DR5B 4HPXB 5KTNA 3Q3HA 5DJ5A 2QMZA 5I5EA 3ORSA 3BEOA 1PDVA 3G8BA 5BSWA 3DZHA 2WTEA 3TEJA 1JGTA 4EW3A 3OQNA 2RCYA 1LPMA 4IJ5A 1MABB 2NVOA 4OHZA 2QTVA 3D54D 2ID9A 2JZOA 1OQAA 2IYQA 1FNNA 4KE7A 5DYIA 4HSGA 2VDWB 2HK6A 2PSEA 2WUEA 1FS4A 1I6MA 1M1YA 1T0JB 3LF1A 1PNRA 4XX0A 2R4QA 4OGFA 3A2LA 5AH0A 4FGUA 5D00A 2ZVQX 4J0EA 3PX7A 1Q74A 1DJMA 4WQMA 5THQA 1N2EA 5HUQA 1JIVA 2A84A 4W5JA 5DBGA 4ASUD 5A6VA 2IYYA 3MTBA 2C5FA 3GELA 2KSQA 2OLEA 3I8XA 4ZHSA 2F3SA 3HBFA 4R3NA 3DE3X 3TM4A 2Q6VA 4XVQA 3QLUC 4RJ2A 1JR6A 1EE2A 3INYA 3LOPA 5A2QA 5BXQC 1HBJA 1PD1A 4DA4A 5JV5A 3BHIA 3O4GA 4M8LA 2QMEA 1T9GR 3GLSA 2P2YA 3SSNA 4Q47A 3KM0A 2YWRA 4YAFA 5DGXA 5ECYA 4KNVA 3U37A 3JYQA 5JMPA 2WM8A 3PHJA 4XIYA 1WHSB 1AKRA 1TGVA 4P7GA 3P4YA 4FP9A 4JYMA 4Q3LA 2F9LA 4UXIA 2VJKA 1CX9B 2YN4A 4O4JF 2ZI6A 5AVYA 1ZN9A 1ECFA 1F12A 4QEKA 4EYQA 3ABZA 1EWKA 1I5RA 1RLUA 1ZWKA 1ZMRA 1L7DA 3HBJA 1B1CA 2H9YA 3DA8A 4GPD1 3U3MA 3E27A 1HLGA 4YPOA 4V1CA 1K4YA 1JR3E 2W6PA 1ZHOA 3AW9A 5EJAA 1KEUA 1V4VA 2BHRA 3H04A 4D2IA 4E15A 5CAEA 1X39A 2IVFA 3V8PA 1PFYA 4WFKA 3R23A 3C5HA 4PINA 3QFCA 1JTVA 2C2MA 2HQSA 4GKAA 3EF1A 2B4KA 1JYEA 4JX8A 1W0KA 1FPMA 3ZE2B 4F9FA 1K27A 1WCXA 2IPAB 3SX0A 3N2KA 3WKCA 3DV0B 2FAXA 5CJ2A 5BN4A 4DR7B 2WSIA 4JSYA 1SVWA 1YFKA 4ZVQA 1UT5A 3LGXA 4AIRA 1XZQA 5I48A 3TNDA 5KQGA 4NMHA 2IK8A 3HCBA 2QGZA 1K08A 1TYEB 2G28A 5E2AA 4EY6A 1HEIA 2FPOA 3E4DA 3E82A 3EH1A 4OM8A 5TMPA 4CM5A 1CVIA 4QQKA 4HAZA 1JEYB 1WUIS 1ZAKA 3FFWA 1ACLA 3MTIA 3R0QA 1MJNA 3OCXA 4FEEA 3H9EO 4ZO4A 1E3JA 1JHAA 4QYIA 5J4HA 5CA1A 4D9FA 2I33A 5H02A 2WMYA 3LLMA 3KR2A 2WAYA 1FDOA 1YDWA 1TI7A 3E3LA 5CH8A 3RS8A 4URXR 1VL5A 4MUNA 2YJ3A 2ZRDA 4YROA 2GCOA 1A8IA 5EWLA 3R0ZA 3SZGA 4AZSA 3BWMA 3U3RA 4B4WA 1E2NA 4BFLA 1HT3A 1KNXA 4WLNA 5DW3A 1T3LA 4FCCA 4Z0NA 2DX7A 5GONB 1B8PA 4BU0A 6REQB 2PX4A 2HT6A 3DAGA 2ZAGA 5ICCA 3VC1A 4IO0A 2GHQA 3I52A 2WU0A 2DCUA 3LKZA 1FQWA 2QPTA 4LG1A 1CZUA 2RAPA 1H6AA 2HKIA 1LK7A 5A5EA 3L5KA 1ESMA 3T7DA 3J81A 5JSKA 2BGUA 1C8KA 1LLFA 1XVTA 1SQ0A 2EP5A 4ND3A 1TTHA 1VKZA 4LDRA 4V0RA 3LUBA 3FRJA 5KOIA 2ACEA 5MF6A 2UYOA 2VYNA 3IQXA 3MJ4A 1ADFA 3WIVA 2GERA 2V6MA 2UZ0A 3PFNA 4WXEA 1TKCA 1GTSA 4TV9F 2QVBA 1YHNA 4TQAA 2V7WA 3U49A 2XECA 3H4IA 1I0LA 2AZDA 2C5LA 3IDOA 2FX3A 2B2NA 2D3TA 3OBBA 3V8NA 1DFGA 5IN5A 3VR1A 3WYNA 1U90A 5FH9A 4B3GA 3C4JA 1CC1S 2OBNA 2G6TA 3I4FA 4DSTA 4C21A 4INPA 4ZGGA 2BE7A 2A78A 4RLQA 3PUKA 1KZGB 3H9JA 4YPVA 2BE9A 2NZXA 1MU0A 2XRYA 2Y1FA 4J76A 1H4TA 4FN5A 1DJQA 1DHRA 4XR9A 5CCXA 5HRUA 3QKSA 4NYMR 4RTSA 2J0UB 4NCXA 1OXUA 2Q2OA 4JJAA 1NKTA 4OI2A 4UVGA 3IVRA 1G5QA 2QW1A 3R44A 4OXXA 3THWB 4US2R 1CIPA 3U39A 3VKFA 2OR3A 3ESBA 3LQ1A 5WRFA 3F6PA 1QHXA 2CEAA 4Y30A 5G1NA 4CKWB 4EZBA 2JJ1D 1UT8A 2MIIA 5DKFA 5CM2Z 3ZHVA 4A27A 2BDTA 4OGWA 1E4EB 4TKVA 3E4CA 3AF5A 3VU8A 4AUMA 4DEYA 1P4RA 5EC8A 1KI2A 1T8TA 1Z37A 4I7EA 1X7WB 5FBRB 3SC3A 3CUUA 1S8AA 4NAVA 4V0SA 3WC4A 2WD7A 1MORA 4XOUA 5FBHA 3KK0A 5AJHA 1U5CA 1I7DA 1JEEA 4NECA 4Z3OA 2J45A 1FQJA 1HY3A 3BCHA 2FVXA 5AESA 4MWCA 3GUZA 4ND2A 5JHHB 4N5HX 5CXSA 3NM5A 2O5RA 4EYEA 5I9LA 1ECGA 2I4TA 1XCLA 1YNOA 4JJ8A 5KYUB 2GZSA 3DDHA 2OCBA 2DT8A 3AUJB 4OMUA 5TEWA 2ZZMA 1QUEA 2DUMA 3G9XA 4A2CA 4PO3X 4BRWA 1L5QA 1WU8A 1EEHA 1XZFA 1JTFA 4FOLA 1HDYA 1QIKA 4RVCA 5KEIA 1XT6A 2P9TA 3DVAA 2EJVA 4IP0A 4WUTA 5AHWA 1T25A 3ZHUA 3PNPA 4ZCTA 1PT9A 3BVPA 1RBYA 3O31A 4S35A 4F7DA 3AL3A 2WSLA 3GG9A 3IDFA 4Y2QA 2PS0A 1XTQA 3T3MB 3T99A 1Y82A 3E84A 4CL3A 2XW6A 2QTZA 4MINA 3CEPB 1OGIA 2HJGA 2EFJA 1ZXBA 3KJEA 4FS8A 3ANXA 2O5EA 4LHXA 1WCYA 2Z3WA 3IEXA 3N39C 2NYUA 1ID1A 4AVYA 5JS6A 4BNGA 2NT4A 3LVBA 4RM2A 5JALA 1YQDA 2POQX 1HR0B 2GDJA 1A7UA 3D5EA 3Q7TA 1EAMA 1GNPA 3AKEA 4ETMA 2QL7A 3P2IA 3G8AA 4FWTA 4GI5A 2FR8A 3RSCA 2UYCA 1E9AA 1EA5A 1MLDA 4KQHA 2GHIA 4F12A 3GH1A 5JNRA 1LDMA 2E82A 1R12A 2X42A 3EODA 4DMLA 4Z4IA 5EJ9A 4HT3B 2ZI9A 1RRFA 1WMAA 2PSHA 3KR1A 3PR3A 1KJQA 1MAUA 3H2JA 3S99A 2YCBA 1U9IC 5B4TA 5CLFA 4J91A 1KQGA 1XRSB 4N5MA 1IVNA 3TZQA 3K70B 3HB1A 3BG5A 3ECSA 1K7EB 1CE8B 1N25A 4KLCA 2HXSA 4YREA 1RXVA 7ABPA 3PUIA 3P9SA 3T34A 4BS9A 1FLVA 2H7XA 3QPWA 5F1OA 4KIGA 1Z0KA 3W5SA 4K6HA 4IZ6A 4C3OB 4EVIA 5JRJA 3E8MA 5CT6A 1YI1A 2FMIA 5IASA 2X41A 3FCAA 4HDNA 1VDZA 3HCEA 5GWXA 5KYGA 3BWVA 3AR5A 2JCBA 3U3XA 3O4JA 4QVIA 4KDFA 3HABA 1BGVA 4KXQA 5DZSA 3T15A 4EQ6B 5I3ZA 4D26A 2OT3B 4DR4B 3HBMA 4R8LA 4PE5B 5GOZA 1NPTO 3VJMA 2ZBUA 5LZ8A 1DV2A 2YY6A 3WLIA 4E5DA 1Z29A 1TJ4A 4C2BA 1WVIA 1Z22A 2G0NA 5THKA 1TCUA 4XRRA 4QREA 1PWYE 4KIFA 2QZJA 2EWWA 2C58A 2PWYA 3ACCA 3DZ8A 3FRHA 3PLRA 4LYAA 4QBGB 4W8HA 3KSAC 4EPTA 4FNMA 2FRXA 4NBLA 4HFMA 2BTEA 1NXSA 2JI8A 3LBNA 2IOHA 1GA1A 2PZJA 2ORED 3TX2A 3C43A 3NBUA 3UXHA 4ARZB 1QCYA 2XUJA 3GEGA 4MV0A 4B6GA 5BT8A 3QWAA 3CJQA 4D45A 1OFUA 3UPUA 1A98A 1ESNA 3STWA 3KKLA 1FY2A 1MC1A 1UKZA 1NN5A 4DJEC 4ZHQA 4AP9A 1BMQA 5I9IA 1UDWA 5E7QA 3G9UA 4HV4A 1PJZA 4JEUA 3Q2IA 4DXHA 1H05A 4EMSA 3DE0X 2VN8A 1VG8A 2IP2A 1U7DA 4UD6A 2MDTA 4OLBA 1ODIA 4F45A 3DWGA 1AS0A 5FUMA 3HH8A 1JFFB 4B6QA 3GPLA 1M2VB 2JLRA 1GTL1 4CL0A 1IBSA 1TPZA 3QYJA 3QVTA 4L57A 1RRKA 4NBVA 4TL6A 2WR8A 4W4TA 5E2BA 2II6A 2PGNA 1Q0QA 3ZHTA 5JRZA 2XE8A 4R8VA 4DQVA 1U7TA 3KSRA 3K16A 2W6ZA 4P7KA 3U26A 1GVNB 4RQUA 1KGDA 4D6YA 3V6MA 1XCBA 4DBLC 1EFTA 3FNEA 3KJQA 2XKJE 5GY7A 1C3EA 3KEQA 3EFHA 1XRRA 2OZPA 2H1FA 2RG7A 4KR9A 4ZCSA 1E2IA 5IM5A 4XPZA 2V9PA 1U3TA 2C78A 4JEMA 5H68A 3O47A 4QTZA 4ZT6A 1M7BA 1THMA 1Z3CA 3PJEA 4DOMA 5JY1A 4JXXA 3TTSA 2HM7A 1A97A 3LFUA 3UIEA 4MWGA 1KE2A 2JEYA 5JNLA 2GEFA 4B40A 2PV7A 4P9NA 5LM3A 2NG1A 3ZQKA 4OGLA 1CJUC 2HA0A 4JCCA 3QWIA 2G1AA 2C3UA 1KGSA 4LSGA 1G7TA 4G85A 1LRLA 1D6SA 1HDOA 3I6MA 2FZ4A 3ZY6A 3MWEB 4R8RA 5LDDC 4F6CA 3WGJA 3PX3A 2ZCUA 2QYSA 4A2PA 4ZN6A 2Y0BA 1W1IA 5LMZA 2PSDA 2PUHA 3K71B 5GM1A 2C94A 5M04A 3K9WA 4GC5A 2PD3A 1CNEA 3LT4A 4DLLA 2GJKA 2HHCA 5CJPA 1KDYA 3QV1A 3HBNA 3R5JA 5DHPA 2R4TA 4DT1A 2FRDC 2EEZA 3RYCA 3CLRC 3I1JA 2M98A 2SKDA 4H1UA 2B1RA 4IXTA 1EVLA 1BE8A 4TVOA 5IBPA 1Y7TA 3C3CA 3H42B 3B60A 1U3GA 3FW1A 4CIAA 1HOXA 5TS3A 3Q2KA 1GEEA 3ONWA 3PGKA 4MOWA 4O2BB 3TK1A 4QQ8A 1PT7A 5KNDD 3BXGA 3AJRA 3GBVA 3CTMA 3MIZA 2ZITA 2E4ZA 4LN1A 3MSCA 3OESA 5K8TA 3JASA 1Z0AA 1KI1A 2YOHA 4Q9LA 1E4OA 1JZQA 2VJLA 1G20E 3V4RA 1XV5A 1XMXA 2XNCA 4N40A 3AK4A 1XWFA 3OZDA 1NMYA 4B3SB 5ESXA 3BK1A 4V0OA 5K0CA 4F4FA 2X13A 1YJBA 3Q3VA 2Z8YM 3PKIA 4ZAWA 1EFCA 2RDMA 1TQ4A 2DSTA 4I8XA 3R5XA 4MW0A 4GD3Q 5JH7A 3NHWA 5BQ5A 3UBTA 1DDGA 3I04A 1J1IA 2W6IA 5DMXA 4QGAA 3JX9A 1PHPA 2V65A 5DOZA 4JB2A 1PVDA 3FWKA 3QF4B 4Y6PA 4JP3A 3K70C 2I4OA 4UKDA 3BSYA 1GUFA 1MDFA 1ZSVA 2AG6A 1MOZA 2GVZC 2QT1A 3BWDD 3OEYA 3P9YA 3WLQA 4C76A 3SYMA 4CKBA 4EKGA 3TH5A 4YRFA 4FI3F 2EJCA 1W2WB 4RWZA 2HIMA 3TPCA 2D6FA 4MDFA 4QJ4A 5HYVA 1DG1G 1QE3A 2YJGA 3N7AA 4MVJP 1IJFA 1J22A 1NYQA 3CPEA 4LJSA 2NO7A 1FP4B 3LA8A 1V7ZA 5F12A 4IIEA 3WK7A 5HWSA 2CF6A 1E2QA 2R60A 2ENWA 1Y9EA 1RPNA 1Y37A 2X4LA 4DPMA 1ISMA 1QJCA 2UDPA 2WB2A 1XPUA 3JQQA 1CY7A 1HZJA 2FEPA 3LU1A 5BYKA 3E7DA 5DM0A 3GMDA 1LDBA 4WHMA 3G89A 2HA2A 4NQZA 1E3LA 4RHEA 5JPCA 5IT5A 2C4MA 3KEMA 1ZINA 2P1RA 2N0SA 1DV1A 1RKVA 3CO0S 4KTTE 1G21A 4KQWA 2UAGA 4JIGA 1JXQA 1OX5A 2FA9A 4RVFA 5AVJA 3A4MA 3FOCA 4IIBA 1K0UA 2UYGA 1FVFA 2W2LA 4LDNA 3UW1A 5ILQA 2ZOSA 4WLEA 2NZWA 3T06B 3I72A 4G0NA 2LD4A 3KU4A 1FXUA 2YL2A 3LA6A 4Q1EA 4E6EA 3DMHA 2JPDA 4LHYA 4BJ1A 4DDMA 1ML4A 4N12A 4FB5A 3UPTA 3VDNB 1LV7A 1PR4A 1Y1LA 2WYUA 2E4YA 2CFSA 3RVQA 4DIUA 1QX3A 5DI3B 3N3BC 4B85A 4OMDA 2FVYA 4A26A 4L1KA 1OLUB 1T26A 4MYUA 1ANKA 2ZATA 2DQYA 2PGJA 1YDHA 4EKYA 4CF6A 1X15A 3B78A 2CY0A 1Q1ZA 4LNHA 4QJIA 4BX9A 1GU7A 4RKQA 2NAPA 2QUZA 3GLTA 1YSCA 3SZ3A 1Y9DA 4B6RA 2R47A 3BBPA 3KQVA 1AD2A 1YZHA 3S8MA 2WF5A 3V9PA 3VZPA 4LOHA 2IEAA 4CKZA 2I22A 1E89A 5DCUA 1UOEA 4IF6A 4EJ0A 1OFTA 1XMJA 1YV9A 4HYEA 2BRUA 3WS7A 3SF8A 4O08A 1CR6A 1R0BA 5JARA 5T67A 5JCJA 3W9BA 4UBOA 1UQTA 2DFVA 3CB4A 1K7FB 4UNSA 5EIEA 2ZULA 4OCZA 1G6OA 5J23A 5ELXA 3BXZA 4DB4A 2Y68A 2IU4A 2B5VA 3NWJA 3LOUA 1VJRA 1DCMA 2YVLA 4G0OA 4RFSB 1GDDA 1VGQA 1I9GA 3CRW1 4G07A 5JDCA 3C3BA 1PJ2A 1U1DA 2DE0X 2VYFA 4KYTA 4MV3A 2OXIA 2ZM6B 1P77A 4EMTA 4ESOA 2QU7A 3KX2A 1Z5VA 1ZM2A 4QASA 5FHQA 2PT5A 1XXLA 3QJYA 4EPXA 4RKRA 4Y9TA 1K6JA 3H18A 1PEYA 3N8HA 3HJUA 2DBRA 3GI1A 3OQMA 4BLPA 4KX3A 3U3JA 4C4OA 3WRYA 2XT0A 1QQAA 5DSXA 1SG0A 3W2IA 3A05A 1TB4A 3RUHA 5TJHA 3TQSA 1YA6A 4BNDB 4JUCA 1C29B 4XFJA 2FQYA 3M2TA 1RZVA 5I6DA 1TCAA 2VRWA 1T1JA 2X8AA 1FJXA 5JSZA 1BMDA 1O96B 1USWA 1DXOA 3D6VA 4LS3A 2Z9CA 3IAHA 3W4KA 1M1YE 5JBIA 3THXA 2WAAA 1NW9B 4TTTS 3L0PA 3ZJVA 1J8YF 2B4RO 1Y6ZA 2R8EA 4UEOA 2IEBA 3PHCA 4GE3A 1VKNA 4XOIA 4J0QA 5KNCD 4IVNA 3U4QA 4EZEA 2Z1MA 2GM5A 2B8TA 1U3UA 2IXAA 3AJ9A 1NDUA 3COPA 3GUHA 3IPYA 3V32A 1NQXA 3VO1A 2VK8A 3MGAA 3MLAA 5C51B 4LMRA 2CXNA 3RU2A 1JJBA 3COSA 1PFQA 4E5NA 1D03A 1L4FA 1U0SY 3CRMA 3E9EA 1HV8A 4KQKA 5AUNB 2VKQA 1P1BA 4CM9D 3F1LA 3G9QA 1N7JA 1U1IA 5D7BA 1CUYA 4CEIA 1P44A 1ULTA 4Y2RA 1XE3A 1P74A 3G85A 2ZE6A 5ER6A 1ZDMA 1BRMA 3FNBA 1UFRA 4GIBA 3C98A 2ZB8A 5J4LA 3QXXA 1ZHHA 4JYZA 3GV0A 3AI2A 3R3YA 4HUJA 1ZM9A 4P4NA 5G4LA 3AM4A 3AB3A 4I3HA 1TECE 3E5NA 1XK6A 4XX1A 5E8RA 4PG7A 4B43A 3AY3A 3B1KA 3OFKA 2QMUA 4HH1A 4JJFA 2YUTA 4XQGA 3VBCA 3GJ8A 4DXAA 4LOLA 4BQEA 4YJ2F 4HQNA 1P9RA 4NVRA 5FKJA 3VH3A 4RTLA 4GDMA 3FPFA 2NQ2C 4PCVA 2NU6A 1A4UA 3WYAA 4PY2A 3PFWO 1L5LA 3HKBA 2O8FA 5BNIA 1DLJA 1Z2PX 1C9JA 5JS1A 2B20A 4AG5A 3QLVC 1UJ2A 4J7UA 5TDHA 3RS3A 4JC8A 4DAEA 4EOGA 4TT3A 1A2KC 3NATA 4LCJA 2AYYA 3RM3A 3HMQA 4O1MA 4Y9UA 4TZ6A 1JNXX 1JDVA 2Q3JA 3LUKA 2SCUB 3EG5A 4BLUA 1FFAA 1ULSA 1TM7E 1NVUQ 2AW3A 4MYHA 3ZDYB 1DFIA 2FB9A 3AKYA 4JY7A 4RGVA 1ZOSA 4FMDF 4WNAB 4GVPA 4ES6A 4MGEA 1P39A 1H2YA 2IYEA 1GGKA 1K1EA 3GVXA 4YP5A 1L8QA 4FNAA 4EG0A 4LFBB 4FINA 4D0NA 5ALHA 2C3MA 2QRGA 3WYCA 3H8JA 4R7GA 2WW8A 4Z9XA 3A04A 2CB9A 4RGBA 3VUFA 4AKTA 5B6PA 1FLAA 3HSSA 2OAQ1 3B3QA 3FNRA 4FBLA 4M1KA 4FZ5A 1RLIA 2J3KA 4RXTA 1RYEA 1DXYA 3TL3A 5INTA 3MFYA 1K7XB 4U63A 3RSFA 1P2GA 3FVWA 2F1RA 4ID3A 3LY5A 4RSMA 2QR3A 1Z8HA 4I08A 5BV0A 5KYXA 2R25B 5KYNA 4NZZA 3UOWA 3SIWA 2QR2A 2QXUA 5KX5B 5AD1A 3CVXA 1JILA 2VT3A 1B0UA 3PYXA 4PZYA 1KO5A 4FC6A 5FV7A 3STUA 3I3OA 1NJ1A 3K1TA 2E1RA 2M9MA 2XIJA 1E6UA 4J49A 3RRXA 1XCMA 2VJQA 4NE2A 4YIHA 3U19A 4UNNA 2VXCA 2Q1SA 3S2FA 5LZ9A 5FLXA 1Q15A 1CYDA 1LKZA 3OWXA 1R7RA 1CUWA 5JAQA 1UZAA 4BATA 4PO1A 2VPYA 3VPFA 2V59A 1V2HE 3QHPA 5G53C 5I4BA 1AT1A 1WEHA 2HOQA 3KPYA 4OOEA 1X92A 2Z5VA 4DCTA 3RRJA 5BNZA 2TMKA 2E5FA 4AKGA 1TUBA 1XI2A 1C5KA 1E6CA 4ZEMA 2YHAA 1Z6ZA 2XLCA 1VB5A 1VG0B 3C24A 3GCXA 1EUCA 4DREA 1KK3A 1TPYA 3H7IA 3UMVA 1RABA 4GSKA 2OGUA 4RLFA 2QQGA 4ZI2A 1NR7A 3F4LA 5AVOA 3ZJ4A 2C5EA 5H59A 1Y7PA 1WSAA 1EP2B 1XQ9A 1KETA 5IANA 1IK6A 4YJ3F 3PQFA 1EP1B 5EHXA 2XBUA 2TMDA 3FZEA 1ZH4A 1YIOA 5IDXA 3IO5A 4DN6A 3LUDA 1QZTA 3I2KA 2NTYC 3H5TA 2CDAA 3OZBA 2QRPA 4TLLB 3RWOA 2Y2UA 3LHIA 1ENYA 2EERA 1VSUA 1B76A 1MF7A 2GEJA 2N9UA 3BIWA 2AFIA 3I5MA 3O0TA 4NIMA 3ZWMA 1OHHD 2C8JA 2G4VA 3L79A 4ABYA 4CG1A 5GJBA 4Z7OB 4C78A 3G2MA 5TQVA 4D3DA 2VP0A 5DN9A 3BF8A 3GEPA 4JH0A 2FEAA 4KMRA 4KGXA 3IUPA 2WJPA 1DOHA 2ONCA 3LBYA 3C45A 1IWBB 4IDQA 2OHVA 1R8XA 4KEAA 1O8CA 4Z1MA 1ECLA 5T5QA 2PJRA 2FWMX 4R41A 2AN4A 3A6EA 3SVZA 1CJVC 4C0XA 3ZJUA 1O0SA 3ME5A 4YUVA 1T1GA 2AMVA 1FJ2A 2AC4A 2PUAA 3N74A 2FXVA 2Q4OA 5EMKA 1V95A 2VNHA 1ONSA 2ZBEA 4LRUA 1G16A 4A5SA 4D3FA 4QFMA 3AVQA 3MAAC 3OF3A 2J6BA 3ZY4A 4B81A 4XIIA 2BFBA 5GJVC 4PYIA 4MKHA 1CQXA 5CFQA 2YHIA 5A3JA 5AK5A 2QLBA 4UAVA 221PA 1LV8A 2P11A 2XCTB 3OC6A 3QFSA 2P6OA 3B9BA 4RBNA 5ICEA 3KXIA 3KJFA 3E58A 4GOJA 3OX2A 1XP8A 5D8DA 1U0RA 3WIBA 1U2QA 3I2GA 2DPGA 3BK2A 5TSDA 3KUXA 4ARBA 3VTZA 4LGCA 2IW1A 2ZI5A 2ZT6A 3FCCA 2A1UA 4NZOA 2GBLA 1MTOA 4MYRA 5LFAA 3TOCA 3IE2A 3NNSA 1XZHA 5FAXA 2RBGA 1G20B 2J6IA 1YTLA 4UAJA 5BYJA 3TB4A 4NESA 4P33A 3RHFA 3LGSA 5A9SB 2B99A 1KDRA 3ITEA 2E4WA 3LQ4A 3C7CB 3P45A 4G09A 4G67A 3RK1A 1BKSB 2AKYA 2QTNA 2AH5A 2VBFA 2YYSA 4MMZB 1OV6A 1J07A 2XQIA 1QS0A 1TD9A 4U7DA 1J33A 1L3IA 2HZ7A 4HB3A 4O33A 5EOVA 2QBYA 1P7YA 2W00A 1HDGO 1HQCA 3DVRX 2B5WA 4TKMA 2ZM5A 2VHCA 1F6DA 2AQKA 1R37A 5IJXA 4L5BA 1U2PA 2OZLA 4KHPB 3KYJB 2ZWOA 3TSYA 3V80A 3L4KA 2HGZA 2XMQA 1FFCA 4R81A 5C3UA 1C8BA 3A10A 4CM4A 1LTKA 4GI1A 3QKWA 5KJEA 2Z95A 2HJSA 2YY5A 3TZCA 3NYIA 1NMZA 2XTMA 2GPWA 2HMVA 1VYHA 2GHTA 3QNWA 4U0KA 1XDGA 1KRHA 5F33A 3TAXA 2HJHA 2WYOA 1GCAA 5T4EA 3ENNA 5TMEA 1DFHA 1T4CA 1O6BA 4L4ZA 1RVDA 1M1NB 1J23A 1TM5E 4KFUA 3UAYA 3WYFA 2NU9B 4PFKA 4P0TA 4FYKA 1QFSA 3ZDZB 2CV2A 2FZWA 1NP3A 2BEWB 2QUJA 4PLVA 3PKJA 5C5EA 2EBFX 2VP4A 1WP9A 2FEXA 4GNKA 5JJKA 3BCRA 5EERA 3NWEA 4BX3A 3KCNA 1HUQA 1Y9JA 3B8EA 3JWIA 3G1UA 4RL4A 3ROFA 4F5YA 5BUQA 3ZDAA 1P7PA 3H5NA 4KVFA 5ED0A 2Q6OA 5DN6D 4NAUA 3TUJC 3KB6A 2VI5A 1WEKA 3AR9A 4NLLA 3W90A 1BDIA 2QJRA 3NTQA 3BMNA 2PX5A 3EGWA 1NDQA 3C1UA 4H1HA 2FPPB 3LC1O 5KDDA 1JG7A 4XSHA 4ASUA 4DR3B 1C0KA 3Q7QA 1BX3A 4ZU6X 3WB0A 4KUEA 4J6FA 3CRNA 4B82A 1M8JA 2FE4A 3OX1A 4V0LA 1EFPB 4BNKA 2WTUA 3E15A 1SCAA 3KKKA 1N77A 2EF0A 4EG6A 3AOGA 4N03A 1I9CA 1BCSB 1BW9A 2NO0A 2PGIA 3JYLA 2JF0A 4QU0A 2CLLB 3BTVA 1UK7A 2NSHA 3HWX1 4RTQA 4RTMA 1NI3A 1W581 1B15A 1E1QD 1Z0JA 3QX9A 3ODGA 2YN2A 1Y63A 3NHZA 1EBFA 4Q7KA 5FNVA 4EFLA 2QTHA 1ZL0A 4ZXFA 3A2MA 3DBOB 5JPIA 2RGYA 5B55A 2PTHA 1ZAYA 2K2WA 1C4XA 5IPFA 1U2ZA 3OIGA 2QPOA 3EJWA 5BN1A 3S81A 2YXDA 2ZAIA 4GQBA 2X76A 2EARA 4A3SA 3FCOA 1HLDA 5CLJA 1E5LA 2KS6A 4BXOA 3H9CA 3MILA 4FIDA 1YOBA 4I9UA 4FFLA 1O5TA 3AWDA 4A6XA 3BRCA 3JR7A 5EKTA 4Q0MA 3EXIA 1ZOOA 5HKKD 5IF9A 4HNUA 1KJWA 2P77A 1BMFA 4LOJA 5GADl 1IN6A 1XIVA 3FIUA 1VJ1A 4DLAA 2GPJA 1AVTA 3I83A 3ETNA 2FX5A 3DKRA 3JQ6A 5AHOA 4O5OA 3EASA 3HWWA 1WQ3A 3KJHA 2IW3A 4K6OA 4ZCIA 4S0ZA 5CFOA 4MS3B 2W70A 2AJ8A 1WVGA 2FDRA 4YHBA 2HF2A 4QGHA 3DZIA 5FLKA 3UUWA 4QHTA 3QTBA 3UK0A 4DIBA 1HORA 1PCXA 4D4LA 1R66A 2ID8A 1ZLXA 2QG9A 2JIQA 2YKGA 3OQIB 4ZHQF 1TMKA 1C1XA 1CUFA 1J8MF 2GN9A 2QTVB 1L7NA 2ZWAA 3AR2A 3Q6NA 2VSYA 3QMWA 2I78A 2F3UA 1CIVA 2Q4RA 1L5YA 5T3UA 3HXPA 4Y6LA 4ZC1A 4EPYA 1YQXA 3NTRA 3QJ5A 4UPDA 2JFWA 1CHDA 5FBLB 2AKAB 4F2PA 2CXHA 2B92A 3FZNA 1QHNA 5EP2A 1JFVA 3UCEA 4B87A 1DRKA 4BNYA 1Y4ZA 4F86A 3OX4A 2G5PA 3CVOA 2FSHA 4DR1B 1DQZA 3EEBA 1GTRA 2D3WA 2DJ5A 3RIHA 1U6IA 2YFHA 2BGLA 3HB0A 3JQGB 2VWQA 3JALA 1GDTA 3CZMA 3O2NA 4JI3B 1QTRA 1WS6A 3TFOA 1WA5A 4FOTA 3M6UA 1LI4A 2P5SA 5ALLA 3RRYA 3WMXA 2RHRA 4JLKA 2IBSA 4A5OA 4XWKA 1SR8A 3P32A 3T4EA 1I1OA 1G8JA 2BFWA 1Z2EA 3EISA 4XQ9A 3TGPA 4G89A 3RJ5A 1JG2A 2P9YA 5FV4A 2GYWA 3FCYA 4O0LA 5HS4A 3WNDA 2AD5A 2MSCB 2I3AA 2AFRA 3BKXA 4UTVA 3V9AA 4RANA 1CS4C 1E1NA 2GTIA 3MWYW 4D97A 4V1CB 3ESZA 2BGGA 7MHTA 5J1TB 4ZARA 1Q0LA 4M53A 1X7HA 4MEJA 3M8KA 5CAEB 4D0LB 4GG1A 3QX7A 4D80A 4DMMA 2ARKA 1CFJA 1HPLA 3P0FA 5G1OA 3V1TC 4FUTA 1USGA 3A2NA 4BO5A 1E63A 4H9GA 5BR1A 4U2GA 5CDYA 2HUPA 1KH3A 4PQYA 2XB2A 1JLLA 3F49S 3MJCA 1SGWA 1WY5A 2GPAA 3BH0A 3D8BA 4XIFA 3R6WA 1I4OA 1QJ4A 3EIXA 5AOAA 1RT9A 3MQ4A 1KSFX 1PKEA 2OCXA 3OOYA 4RFLA 5HA5A 3T9CA 5LVAA 2OCKA 4LTNA 1ZD2P 1YVRA 4QGBA 5HOQA 2CFIA 3P52A 2O14A 3N0RA 1F2UA 4G3XA 3H6KA 3PA6A 1G19A 4JP1A 4M7RA 2PZEA 1MW8X 2E6UX 4GPZA 3ZDXB 4CDNA 1D2RA 4E13A 2VH1A 1LSOA 1X74A 2JJ1A 2YWFA 4CKEB 5HF5A 4QQFA 3MT9A 3L05A 4DIMA 5K45A 1HX7A 3IYLW 4HEA6 5C4IA 3NIDB 4TWZA 2F2TA 4PLFA 4QYIB 1W52X 4YI3A 2Q9UA 4EB6B 4O5AA 5F23A 1S3GA 1QTQA 4UDXX 2V7QD 4ZI3A 4I36A 1B6RA 3GPBA 5FPHA 4FKZA 4M1TA 3HNPA 3ORYA 4HEQA 4RJLA 5FR1A 3SD7A 4TSRA 1NOKA 3TXAA 1PFVA 4WECA 2D2IA 1HRDA 3A36A 2B82A 2UU9B 2C7VA 4OM7A 4R3UC 5AVWA 1M3SA 3NP7A 4I4LA 2FEKA 3MRTA 1BRTA 4QELA 5EXDA 1M9NA 1XP5A 3AL0C 1HTWA 3NJ4A 3CUKA 1QH0A 3JD3A 4YCCA 3QFTA 3Q1LA 3QPVA 3RVSA 4BLOA 3MUNA 2HRZA 4CVNA 5BVHA 3QEAZ 1Z5UA 2QMOA 4D41A 1TGYA 1GU0A 4D5GA 2JVJA 3UGTA 4MW6A 2QLFA 3U4CA 4F96A 3HKCA 3UC5A 4LYEA 3AR6A 3E1SA 2B37A 2CXUA 2Q62A 3QUSA 4UDYX 2J5KA 1K5HA 4YRDA 1X1AA 4PHHA 1GAJA 3GOQA 3L7NA 1Z15A 4BV2A 1WXXA 1HE4A 1LBIA 3KOUA 4XSGA 3VVLA 2E85A 2GETA 2YV5A 4IGKA 5JFOA 4TZ0A 1D8TA 3RC3A 2H1RA 4EG1A 1QHFA 2YNMA 4HUQB 3TX6A 4JQYA 1IOZA 4OI4A 1NRXA 1XAIA 4YRSA 2J9FA 3HVJA 2GNOA 3MTEA 3EPRA 1UPFA 2G9NA 4Y7CA 2JLAA 5LDHA 1REQA 5CX1A 5K09A 1G5FA 1EK0A 4E51A 5JJ5A 1MH1A 4PGFA 1A04A 2ZI7A 1OU4A 1JHRA 3MQFA 2XEXA 4JNKA 3IFSA 5FRDA 3T1OA 3V1MA 4ZYXA 3PHHA 1D5WA 1SY7A 3OJEA 1OWMA 1WUTA 3ZOZA 4AI6A 2H1LA 3UICA 4YRQA 1GQRA 2IPXA 3D3NA 4IFIA 4HTFA 1XU4A 1YVUA 2B2XA 2BMFA 2ZBVA 3LK7A 4RPGA 1GPBA 4Y18A 3STYA 4PN7A 4S3MA 5CB6A 2TYSB 5IU6A 1CDOA 3IJEB 3PS9A 2JJMA 4B84A 3JS5A 1KH2A 1ZSYA 2Z04A 4RENA 4YCAA 3VSEA 3G8DA 5BO5A 3VDRA 3MWFA 3PLNA 4D44A 5EE3A 1OX4B 4CEHA 3OOWA 4IL5A 2OC4A 2I8AA 3AVOA 2JGDB 2PS3A 4GQAA 4HXYA 4S12A 3IBFA 2HDHA 1LFDB 1EMDA 1W5EA 3L8EA 2WD7B 4RAOA 2DMRA 3O9VA 3UTCA 2ZSDA 2IXBA 2EX1A 4LJ8A 5ADVA 3GT4A 2VF7A 4R9NA 2FF5A 3ER9A 4B80A 5EIXA 5AICA 2RARA 4EUHA 3EW9A 1S2GA 3AM5A 3BMXA 3H3JA 5DNWA 4IVRA 4E5VA 1SD5A 5MN4A 3BFJA 3PXUA 4MEBA 5JI2E 3LH5A 2LCIA 2GK3A 3CEMA 4RV5A 4PXSA 3ZIUA 1ZVVA 2ZJ6A 4G4GA 3RIMA 5AMXA 4RPLA 10MHA 4OYYA 1E62A 1TM3E 2FXIA 5TXGA 6Q21A 3MJSA 1N1GA 3QKIA 1UMDB 3FZQA 4IH9A 2DQSA 5EJ5A 1FFXA 4EB0A 2VPQA 2XNJA 3UGQA 3RCBA 4UUBA 5JO0A 4H6PA 4DSOA 4JR0A 3DD1A 4QA9A 4F97A 1I30A 1KJZA 2DUNA 4MICA 1W7AA 2JFBA 4IDNA 3K4PA 4PAOA 4R84A 4BO9A 2IBTA 4X44A 4KWEA 1DE0A 3LMKA 1M6YA 4G81A 3RYHB 4UTNA 1KQOA 2LTAA 5EZQA 1I14A 2HX1A 2G25A 4OJYA 3DO6A 5BY2A 1CXZA 3PRJA 5DPMA 5L8VA 2BR4A 5A0FA 3SOPA 1LTQA 1Z4IA 3RD5A 1QYVA 4J43A 3TOVA 5DBHX 3V1YA 4M0UA 2N1BA 3CUTA 4BZWA 2R00C 3ZCTA 4MROA 5IM4F 4K9OA 3D02A 3A4IA 3UNXA 2NAFA 3VR4H 1ADBA 5HRAA 4GECA 1C9NA 3A27A 3CTPA 3O8QA 3USES 4C87A 2PLWA 2PS9A 3JVDA 3L1VA 4KKVA 4ZCPA 2WM9B 3D64A 2FOIA 4LJ9A 2N42A 2CJFA 2HCRA 4P6VF 1JS1X 5IMSA 4PX2A 4GU5A 1IN1A 4ON9A 3ILYA 3UV7A 4AJ2A 2TS1A 2A0WA 3AFNA 2X3UA 3DBHB 2Q5HA 2IUSA 3CWZA 4TKUA 1UP4A 4Y2VA 1DQYA 1C2TA 4RMNA 4ZVPA 5JCOA 4YMVA 5K0SA 1NLZA 3HQ4O 3K2IA 3Q5EA 4M86A 2HD4A 5ILGA 1C1DB 1G2PA 2Q6KA 1P1IA 3HYNA 3EVDA 1GN8A 5HZHA 1TNDA 3HNOA 1RZRD 3ED5A 1EX6A 1VGRA 2OFFA 4EHLA 2O19A 4AKSA 4PV7A 3NAMA 1WB5A 1TZ2A 5TV2A 2BEVB 1DO8A 2IHBA 3HV2A 4UMDA 2GO1A 3P20A 3TTVA 2QL9A 1O7JA 2I2WA 4RIEA 5EKUA 1YHYA 4GKKB 1NYTA 5DM60 1BS9A 1BZYA 4EY5A 1FMTA 3WP0A 1U65A 4MRVA 3OZFA 4HXGA 821PA 4MUJA 4PZUA 1K3TA 4HNGA 3TGLA 1E61A 4O4LB 4D74A 3IV7A 1MB4A 3HI6A 5K7SA 1J2JA 1T0PA 1PEDA 3AILA 1OWLA 1GPUA 1NW7A 3L8DA 4QNNA 2IV2X 3W7VA 1R0SA 1EQAA 3T7SA 3I0ZA 4KAJA 3GWGA 4I81A 3WMRA 3RREA 1XAHA 2G63A 2WYVA 4FYXA 3H0EA 4XGIA 1K5DA 1XMVA 3AJDA 3IR5A 2JLSA 2GBIA 4NJEB 4W7IA 4DLVA 1AKYA 1COZA 4EI8A 3K31A 1FTGA 3QV2A 2XBMA 4TYNA 5CP8A 2W8BA 1NF2A 2WOJA 1Q7GA 5AI8A 2I2DA 5P8WA 4DXDA 1AHPA 5NLLA 2DECA 2YV4A 4RPIA 3TE7A 5E3IA 2XITA 5EHGA 1DIGA 5KU1A 1OBVA 1FBTA 4YP1A 5KINB 5KNDA 2Y2VA 1N8TA 2QM3A 4BMDA 2C2YA 1X80A 4R2JA 4XFDA 5E9QA 3V48A 5DV9A 1MA0A 1Y5LA 3CW8X 3N8GA 3OOEA 4IZHA 5ALJA 3ND5A 5F64A 1L5KA 4Z3KA 1QRTA 1R0RE 2CYAA 1RYYA 2VDJA 3LPNA 1I2ZA 2ZR8A 4RIIA 5CVVA 4EEKA 1VHJA 3MTAA 1XCOA 3NUZA 1RHKA 1VYUA 3FDZB 4RKEA 4RL6A 3LY7A 2JARA 4KYIB 5C46F 2Q3BA 5AJVB 1K7SN 2OG1A 2RGNC 4GRAA 2IZ7A 2VDMB 1HURA 1ORTA 2P62A 1D4FA 4I3FA 2FUG6 3ANNA 3NTXA 1X19A 4BQRA 4CFYA 1CZRA 4F1JA 2B83A 1H0RA 2QRUA 3SY8A 1X87A 2COEA 2UZIR 4MYCA 3ICPA 4LE1A 4OBEA 1YVEI 4A0RA 2GD1O 4YRBA 2CNKA 1P5JA 2FW6A 2O07A 1USUA 2NU7A 3VU9B 1BKDR 3UFXB 1ONNA 1EH5A 2CKDA 4M1MA 3ZDQA 2AFIE 3ZX4A 4B34A 4MQ5A 4BIIA 4ZTZB 4DSZA 5LYJB 4B45A 1ORWA 4QJ3A 3HU5A 3A0RB 1FYVA 1KORA 1SB8A 3ZX5A 3JRWA 3MC1A 1T6ZA 4C5AA 4YCJA 3OT4A 2V8BA 3COZA 4K86A 1RWNA 1OXSC 1CLEA 2QVGA 4FE3A 1EZ1A 4L7VA 1ULZA 3TEFA 5KYKA 1N32B 3AQIA 1KVSA 4MV6A 5DRYA 1R5BA 2GPBA 1U2RA 4C7VA 4G0XA 5HGXA 2X2PA 4NR0A 3FMFA 2O8CA 1PLLA 1COWD 4X8MA 4NBWA 5EVCA 3QXSA 5KQRA 3GLQA 3ZXUB 3C6MA 4J0FA 2BELA 3D4PA 2PAFA 3G17A 1C8LA 1TMGE 1Y80A 4P5DA 1LCIA 1IJBA 3ZWNA 5AM5A 4D0GA 1SOVA 3MT8A 3ZXXA 4AL4A 1QG6A 4IEFB 2AYXA 3B13B 2XSZD 5LKAA 1RI5A 2PVCA 3B53X 1US8A 2JKYA 2BKEA 3PQCA 4A8JC 3A37A 4LYHA 3S3TA 4DQXA 2YIJA 2N47A 5KU7A 3AL2A 2W2MA 1XTPA 4XI9A 1F0KA 1X7DA 1SUAA 1Y3IA 2ZUEA 4P38A 3JQ9C 4C7OA 3TRKA 1ISSA 3EGCA 1KK1A 5FOXA 4BJ6A 4HLNA 2BSQA 3U7HB 1A1VA 5HF6A 4AFNA 1JEAA 4XYMA 5A9RA 4KXMA 3EUFA 1EVEA 1SC3A 3JASB 4C07A 4BBZA 3C97A 5D87A 4DLBA 5JZMA 1OIVA 1OTHA 4CZ2A 1KYIA 2WP8J 1AV7A 2HGSA 2WWIA 3CLHA 4C4ZA 3OM1A 1OCEA 4M21A 3SM3A 1JL3A 3DT8A 2JFPA 2G4LA 1K8ZB 2PNFA 3PRYA 4GGMX 1BXRA 5EJFA 5ABPA 5JH7B 1QFXA 1FP2A 2ZJ7A 2GXUA 1Q21A 4IH4A 2WT4A 1IBMB 1NZFA 2BKUA 4E94A 4UBMA 2W98A 4ZCQA 4E5PA 1IG3A 4EZIA 2FSVC 1SRQA 3NV9A 4QUBA 1N2XA 3FUWA 1LX6A 4U8GA 5B3KA 4O4IA 1OYWA 1Y3AA 1A72A 5EWMB 4AYWA 4MARA 5J2UA 2JIDA 3LVQE 1MC5A 1ULBA 3S44A 3JVVA 4AG6A 2C2XA 3PFFA 1WDKA 4ZTUB 1DBWA 5E4YA 2XQGA 3K7EA 3GLIA 2H8GA 1DTWB 2XMDA 4XEHA 2DR0A 2PL5A 3KJZA 3H3FA 1SHKA 4YRTA 2J3QA 3RS5A 3VZQA 1O97D 5ICSA 3PEWA 5TRTA 1T2AA 4CI0B 3BXEA 2P4UA 1H9CA 3UMMA 1NVVQ 1BE0A 4ZK2A 2GJ4A 1QO7A 4IBOA 2XAAA 1RAGA 1SIOA 2OC9A 3GFPA 3AF1A 5LUAA 4CGZA 4ISCA 1ZNWA 1MKYA 3WFZA 1DP4A 3G5AA 3J81k 3O1JC 2AZXA 1G7RA 1G17A 1XJWA 2HU2A 5AXCA 1DJLA 4YC7A 4B4OA 4DMGA 2WWYA 1E0JA 4RHXA 1FUEA 3HM2A 3NU1A 4WBSA 4BVEA 4NZYA 1OA0A 4G1MB 3DNMA 3MMXA 4PNPA 3RDPA 2P7IA 2BBWA 4D4IA 4DJTA 3UWMA 5A3SA 3F46A 3EZ7A 4ZT7A 2BC9A 1MIOA 1AQIA 5HDBB 3P5BA 3RFTA 2ZREA 3B12A 4CGYA 4YMTA 1Q2UA 4QPZA 3UH0A 4LY3A 4A0FA 4F1KA 1E5VA 5BPFA 4PFSA 1GFZA 2O23A 1Y6QA 5KNCA 2XVXA 2ZT7A 3R75A 1SHLA 2FQXA 4D46A 2OFOA 1DBIA 3LRXA 3ENQA 2H5LA 1H4QA 4RQAA 3ZTYA 2XJ9A 4M3NA 2P2DA 2QX8A 1H3EA 1MX5A 4NEGA 4WLVA 4BP3A 2CHEA 4C4XA 1KJNA 1LBTA 2AR9A 3OTHA 1OU0A 1U7PA 2ZQZA 3MT7A 1X3LA 4RVDA 1W4RA 5ALIA 4CM9A 3RB8A 3UV3A 2J59A 2BONA 2J0VA 1JJIA 4GX1A 3U4AA 1N6PA 2O48X 1H42A 2MTBA 2XVYA 3HCNA 1C0EA 1MDBA 3R0VA 1YE3A 2CNWD 4AXBA 4D02A 4W82A 3IT3A 5L7YA 1IPHA 1RHRA 3L0BA 4BZQA 2Z4RA 3KFVA 1X7YB 2RHCA 3SF8B 3KHTA 4EI2A 2Z57A 3ABSB 1JKIA 1PBTA 3TL2A 5ALZA 4BCCA 3F97A 3VR3D 4IUBS 5HBRA 4RIFA 3ZEIA 3ZJ5A 1X0XA 2C07A 2O20A 2NXJA 1N78A 1WV1A 1IOVA 4H35A 2W4MA 1N4AA 3K0CA 1OT3A 4LXTA 1A88A 2P5TB 3E2IA 1DQPA 2OO5A 3AR4A 2UKDA 3LY9A 3R5HA 4XH9B 3RGGA 1TQ6A 1YR8A 4DBZA 5FNZA 3O8CA 4NAHA 3SKXA 4FT4A 4A82A 4JUIA 3OZXA 1EB8A 4QECA 1UDCA 1VJTA 2G80A 2B4TO 2JGLA 2FJUA 2WLSA 1ZSNA 1RJDA 1FS6A 2VDRB 3MJEA 4G65A 4LF9B 4IYRA 2PPVA 2QD3A 4KWTA 5D7NA 3MMSA 3CKKA 3L0ZA 3REGA 4B6EA 3W5JA 1YUBA 4JR2A 3B51X 3UQYS 1JJ7A 3OJXA 1J00A 4HPWA 4IOLA 4G23A 4L4RA 5CH5A 1AUQA 1RRCA 3RS0A 5HUHA 1F3LA 2OSBA 3H1TA 5K05A 3Q40A 1O89A 2VFAA 3G5TA 5AK4A 3TZ6A 3G7UA 2GK7A 4H16A 4US0R 1MAWA 4AJNA 1Z73A 3Q3JB 1XL1A 1ZGHA 1SQSA 3PDCA 3DE6X 3WWEA 2JAHA 2ECKA 4ABTA 1NPYA 1XA0A 3KHKA 4R05A 2WV9A 3VZRA 1PSWA 1JSZA 2GF0A 3THOA 4BGVA 1XDUA 5C7IO 2ISQA 1IY0A 1JRLA 1S9DA 3WDKA 4N39A 1ECJA 3BD9A 3G2KA 4FZVA 2G71A 2LZ0A 4KQXA 4CFSA 1Y1TA 3GHYA 4FMPA 1U0EA 4LE0A 2WZQA 1I4LD 3N53A 3QFFA 3K0SA 2P6NA 3C16C 1Y1PA 3ZU6A 3T3OA 1ZJYA 2RHHA 1ID8A 1DLIA 1Y3CE 4F5ZA 3HN7A 3E8XA 3IJ5A 4O2RA 2PU5A 1OZAA 4IINA 4OLHA 2D06A 1SCUA 1NBWB 2QDXA 4N54A 2ODBA 1IY9A 1EWTA 1Q17A 4LYJA 5KUTA 4HDRB 2V0CA 3E3AA 1RVV1 1Z6PA 3P9QA 3UK7A 4KWCA 5L6MB 3L0DA 1ND5A 4YACA 4EYGA 4UW9A 4Q9HA 2ZVJA 2ZEJA 4X60A 1TK9A 3LW8A 4HWOA 1CRWG 2ADOA 2O8VA 1NYRA 1NNLA 3PK0A 3LWBA 1I3OA 1IQUA 3PNLA 3FNFA 4KXLA 3T9EA 4BMNA 4PAWA 3DJYA 2GASA 4PAQA 4QTUB 5CA0A 4O4HF 4EI7A 2ILTA 2EZ9A 5GJWC 5CEFA 2D74A 5IAEA 2NU6B 2BZ1A 5DLPA 3TTYA 3HKBB 2O8FB 5BRAA 4PM4A 3EEOA 2Q49A 3D7LA 3AJ8A 4FHDA 2VS1A 3CLUC 4LXQA 5AI4A 5H9VA 5DFAA 2HBRA 3HZHA 4LY6A 3ZVLA 2ZYHA 4KMOA 3BTOA 1PGNA 3T5GA 2AFHB 1L4GA 3LHDA 4RCZA 5F4ZA 1QORA 3TKLA 4Y6OA 2ZRLA 2JFVA 2ONYA 2V7PA 4JXKA 5CNKA 3RVKA 3PX2A 1OPRA 2NUPB 1P0IA 3G5MA 3DQPA 3F5DA 3SXPA 4RTJA 4R1TA 4ZJZA 2QX9A 3OMWA 1A3CA 1B0PA 1DBVO 3DCJA 4S04A 1MVNA 1OHHA 2AA3A 3IKMB 4EFNA 1W46A 2GSDA 1CJSA 5CD9A 1TEZA 3W5IA 5EN4A 2QM8A 5K6TA 2QJOA 1ZRSA 3QTLA 2XCUA 3UYLA 4QE3A 2VTBB 3JD0A 1ZVJA 2P9EA 2WINI 4L0DA 3AIIA 4PSAA 1YOVA 2X4DA 2GARA 2AX3A 4X45A 1WB4A 4KXUA 5DDIP 3FZGA 3HVUA 4Q03A 3SHVA 3KETA 3EIWA 2WG0A 5LMUB 1YU6A 4GXTA 4JITA 5AW1A 1T8YA 2H5EA 3T54A 5A4FS 3F98A 2CFCA 3L1JA 1BHQ1 1MX1A 2R7LA 1KYWA 3CMCO 4PQRA 5AVKA 1Z28A 3KYBA 3TSWA 3VKHA 1KK2A 2FJ0A 2RKBA 2IXGA 4CTMA 3KOOA 1R27A 1OIXA 1ODCA 5KVCA 5BRJA 1E6MA 3A6DA 1U3CA 3DO8A 3DLPX 3Q2OA 3VC2A 3NDIA 4IJVA 1RHJA 4PZEA 3TG2A 3H87A 2PXCA 1GRCA 1YQWA 2OZEA 1Y48E 2Z8YA 2OXTA 2WSMA 2YH2A 1ULAA 4FDUA 4AO8A 1Q44A 4D9GA 4YN3A 4JHXA 4FHGA 3O94A 2X0FA 5KQLA 3BD7A 4I50A 5ERXA 3V7NA 3SIRA 2FCAA 3LGAA 1E8DA 2ZBQA 1XAJA 2ZJ1A 4EJFA 3H2BA 1EUCB 4K05A 2Z6VA 5ALRA 1TTQB 1U9CA 2LP4Y 2Y4NA 3SYKA 3KQQA 4RUKA 5DTEA 4QOJA 1F4PA 3ADDA 1AN9A 3EDMA 1UAYA 1F7VA 5BR8B 4YQEA 1QCZA 3MN1A 3R6DA 4FBGA 4J1SA 3ZLVA 2PT9A 5KOJA 1IXRC 1PFGA 4PWZA 1W6RA 2O9JA 3EMKA 1V5FA 3HJTA 4JKYA 5CPBA 5DNYB 5LQDA 1G0OA 3SLGA 5K51A 1EK5A 1KEPA 3EVTA 2H2HA 4CETA 3EZ6A 1X8KA 2OCAA 4LXXA 1V7CA 4IFBA 4LECA 3OZIA 4GMKA 2RIPA 3R7FA 3U62A 3DGEC 1J06A 4TQGA 2FSSA 4W99A 1E60A 3A7EA 1LDEA 1A9YA 3EZGA 1EBBA 3WDSA 3AFGA 2EFYA 3EC2A 3L2OB 4EITA 2QP3A 5IZCC 1TL7C 1ZW1A 4PS1A 1QU3A 2H85A 1JKMA 1GUYA 2I0FA 3BWYA 4M9UA 2YWXA 4MUHA 1PSZA 4ZYYA 2F55A 1N0WA 3C5CA 2ZRAA 1XZNA 3SAJA 3D3WA 4F38A 1EB9A 1H2ZA 2FEOA 3BPSA 3S7ZA 3VHXB 3X1JA 2VDNB 1L4NA 1C81A 1WDTA 3O8BA 2EL9A 3W5AA 3IPLA 3NTOA 3H1PA 1UF9A 2AN1A 4ITUA 4PC1A 4CDRA 3EDRA 3KWFA 1AOXA 2H2AA 2BISA 2Q21A 3LDUA 4EY3A 2BFBB 3DZKA 5KJ1A 2HFKA 1MGPA 2A8YA 2QUKA 4JLSA 5DN6A 2HO5A 3IH5A 1EDDA 1ZFNA 2GCIA 4RF5A 3RJMA 3L4SO 1JG4A 1XQXA 1GL6A 2O6LA 2C2HA 2FCRA 2ODAA 4KO3S 1A4RA 2M6SA 3TKAA 1Z63A 3JATA 1IQ0A 2RGBA 2V96A 1ESCA 2W2NA 4O4JB 3JQAB 4AN4A 3JQPA 5C1DA 1RKUA 3W9YA 2CVHA 1Z2CA 1W2HA 4UBNA 3WZ2A 3ZZNA 3K8OE 3ZK9A 3WKDA 2C1EA 4MRRA 3N1UA 3ECAA 2VDVE 3NASA 1ZUNA 1CEQA 1F6WA 2H00A 4NBNA 4ND1A 3NEPX 4OQEA 1E1QA 3QY0A 4KSBA 2AG0A 3HCAA 1QS0B 1C9YA 1PNOA 1QYIA 2VPZA 3FX2A 1GNQA 3IA2A 2JIBA 3AY7A 2PIAA 1ZK2A 5A5GA 1KI3A 2ECOA 2IE8A 2OZLB 4Q9DA 2JJQA 3D6FA 1RQPA 3JVEA 4GWLA 2IH4A 4CW7A 3G88A 2ZR0A 4C5BA 4PYQA 4EY7A 3KZKA 3CF4A 3ANLA 4P84A 2W7TA 1X1TA 2VPPA 2W58A 1BDHA 2VJYA 4P80A 4JV5B 4JD5A 5JZBA 1KMHA 5BRNA 5HKKA 1S2LA 4MVJD 1FFBA 4D8WA 5K8LA 3GGPA 3LYLA 1RE1A 4AUEA 4LNUA 4F06A 3LXXA 2P8SA 4F93B 1IY1A 3KPUA 4IRXA 4J7XA 3TO5A 1U2GA 1Y33E 2WB4A 4BLRA 3F6EX 5C37A 3SQNA 5ALGA 3EARA 2B8EA 4CCSA 1YA4A 4ER5A 4W5QA 3H1AA 2BGWA 2AHOA 3K0BA 3D8TA 3M49A 1FSPA 3CPJB 4HDKB 3B38A 1JHZA 1V8FA 2IVZA 3DDCA 3VH2A 1VP3A 4UUQA 4BNXA 4OHBA 5ALXA 4RKYA 1SKAA 4BFTA 1X2BA 2HF8A 2OGZA 1H2BA 4M0KA 2W6QA 2W11A 4P4UA 1C3VA 1QBKC 3RS9A 1U31A 3KL2A 4MJLA 4C7MA 5MN6A 1ST3A 4M88A 3FOBA 3ICCA 4ENRA 2RGCA 5ES3A 4A8PA 1X13A 1JLMA 5CYPA 3BMNB 3C8ZA 2KQUA 1KJ9A 2I4RA 3Q0EA 2NVWA 3LO8A 4ND5A 3PF9A 5DTQA 3AHEA 2YW2A 1BMTA 3PVCA 3T12A 2O2YA 2WILA 5TQJA 1NVDA 4GZ3A 2BHLA 2JIPA 1P81A 1RJ9B 3DOCA 3TL6A 3TLYA 3WGNA 4DCNA 2AL7A 2G4CA 4QPCA 4GYKA 3GEBA 2J9ZB 2M2IA 4QNRA 3L0SA 4D7AA 4F2HA 1L5OA 1F9AA 4ZJPA 3CINA 2AHRA 2C5AA 1U99A 3JYPA 2CD9A 1DRWA 1PX2A 1UDAA 3ESXA 5FNVB 2FTKE 5TF4A 4LJLA 1MVLA 4BTVA 3M4ZA 5D3ZA 5KPJA 2NYAA 4Z99A 4DGSA 1AMOA 3WAGA 2QI9C 1PLKA 2Z2IA 3I9V1 2G83A 2QSJA 4O1IA 2FZLA 4PFQA 4LX8A 2MMGA 3EWIA 3W9SA 5BPHA 3KFXA 4DR6B 2QLNA 4GMDA 4N18A 4AW9A 1C41A 3VNUA 2G1UA 2WQ7A 4BXOB 5B3LA 1N5JA 2HT1A 4US1R 2FMXA 3QU4A 4OMFG 1D2NA 3CSDA 1MJ5A 1J7KA 2OECA 3GZNA 3EMDA 2QZ4A 3EXIB 2Q4EA 3WY9A 1E79D 3ANSA 3JRNA 3DMTA 3GFTA 2W48A 3DMNA 1MTZA 3W4IA 1U0TA 2UYYA 4KQ6A 3K5WA 5E1MA 4HFNA 4LGMA 1Y4UA 4RY0A 1OH8A 3BDAA 3FWNA 4YCSA 3UO8B 2GI4A 4MRSA 2HO4A 1G5RA 1V8OA 5BQPA 3W8FA 1GNTA 4BO1A 3TINA 1QAQA 3LL4A 3DT9A 5JO9A 4AJ4A 2SHKA 1EVJA 2FFJA 2J4DA 1P9OA 1PR6A 1JE1A 2H8KA 1E6WA 4QDOA 4KPGA 4UU1A 5C8YA 3UK1A 1YKGA 3K73O 3NJRA 4TUYF 3JYHA 4QHYA 4ZO7A 1NZDA 4HNRA 4V2IA 1K98A 1BWQA 1XEWY 2X14A 3OPYA 4BP8A 4I1IA 1Z06A 2V7QA 4C7XA 3NONA 4D3SA 3QBTA 1LLQA 2C04A 5LQKA 4LRSB 4EG7A 2O0KA 2VP2A 1FXWA 2E21A 2JK1A 2QZZA 5GV8A 4ZAYA 1GKIA 1MC4A 1OZFA 1YDGA 2OV6A 2OORA 1T6BY 1VBKA 3CLRD 4UD2A 2XA2A 2PSSA 3ORHA 4QVGA 1UQUA 4HAWA 2YBDA 5THXA 2ZPAA 3F67A 4JBIA 4ETIA 2VRCD 4YJHA 1THTA 3LDHA 5C5IA 3GY0A 1ZS9A 4MQFA 4TRNA 2LKDA 4PZCA 2AI3A 3CH7A 2UUPA 4Y2TA 3EZFA 5KYYB 2A5LA 3FN4A 1U6KA 2WM3A 3HB5X 4XGQA 2F3TA 4WOBA 5JW6A 2C9ZA 3U7FB 1NQ5A 1Y9ZA 1YQ9A 1UMCB 4CUKA 5HNKA 1JR2A 5HG0A 1I7SB 1K68A 3NOOA 2R1VA 3HBAA 1AO3A 1BCRA 3H9QA 3IKJA 3DE4X 4U9HS 3GPIA 2BFEA 3Q9LA 3ROTA 3VNQA 4ZZ3A 1E59A 4OEHA 1VHLA 1JDUA 1EA7A 1GVHA 2XV1A 3ORFA 2MSLA 2C99A 1J8VA 2BGMA