4G4GA

Crystal structure of recombinant glucuronoyl esterase from sporotrichum thermophile determined at 1.55 a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
CSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
source organism Myceliophthora thermophila
molecule tags Hydrolase
molecule keywords 4-O-methyl-glucuronoyl methylesterase
total genus 134
structure length 367
sequence length 367
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4gA00
1EA5A 3FVTA 4HXGA 4BRSA 3GROA 5AICA 1SCQA 5CTAA 3QMWA 2VAXA 2XDWA 4LIPD 5HKBA 4H7JA 1WHSA 5IVHA 4GI1A 3FLAA 3LLCA 5ALLA 4J0IA 4F0JA 1VE6A 3FLEA 3GA7A 1JKMA 4YPVA 4TVKA 1H2ZA 5EHXA 4KACA 4ZWNA 2WTMA 1DT3A 2XMDA 3BF8A 5A62A 3IUMA 5ALSA 1IZ8A 5AI6A 5AH0A 1FJ2A 4O08A 5K3CA 2RIPA 3TGLA 3DDUA 4G4IA 2XUAA 2W22A 1IMJA 3GBSA 1TAHA 4OB6A 2D5LA 3ZV7A 1JJIA 3QH4A 1E8DA 2WU4A 1YS1X 1ORVA 4UFNA 5HF8A 2PUJA 4NMWA 2H9YA 1C4XA 3FYUC 3V1LA 2IIVA 5ALTA 2XQGA 3QZUA 1B41A 5A7FA 1W6RA 5HZGA 5EIHA 3QPCA 2VQ6A 4Q34A 2QJRA 2C7BA 4I3FA 2AJDA 4B7ZA 4BC0A 1RP1A 4MYDA 3VVMA 1QFMA 4YASA 4H7HA 5A6VA 4HS9A 5AKXA 4LKOA 3WI7A 4E15A 3WL7A 2Y2UA 3KXPA 1VA5A 5ALYA 1QIIA 5FXMA 3W2TA 2WILA 2I3ZA 4JYPA 5ALJA 5JADA 2GZSA 2WUEA 3GELA 3BF7A 4ZRDA 3STXA 1ZD5A 4GXNA 4OU4A 4BVLA 1N5RA 1GPKA 2ACKA 4DNQA 3C8HA 4M0MA 5K3FB 1X2BA 4X92A 1UWCA 2HU8A 4UHEA 4CIBA 5CXUA 4N8DA 4B85A 2UZ0A 4UHBA 1BCRA 5JATA 2HA7A 1BE0A 4OB8A 2JF0A 2XLCA 3F9CA 1XRRA 1KU0A 3R3VA 3WJ1A 3OM8A 3QVMA 5HF6A 3RK4A 5ALWA 3BE8A 3FLBA 3WK7A 1VXRA 5CRIA 3WWCA 2OGSA 2PUHA 4Q1VA 2WUGA 2VJBA 2Y1KA 3M83A 4BAUA 3IURA 2XQJA 4KAAA 3V48A 4Q82A 3B3QA 2JGFA 5LIPA 2PVSA 3I6YA 3O9MA 2OGZA 4OYLA 4X00A 4GEGA 3WK8A 3R0VA 1CUUA 2Y6UA 2G5PA 2WHRA 4XVCA 4B81A 2DHCA 4GECA 4QLOA 5HCUA 4H77A 2FJPA 2Q0XA 5DWDA 2OAEA 4AZ3A 5FPQA 2ZYSA 1TIBA 1E8MA 1WOMA 2HA5A 4F21A 5ALOA 2QUBA 4KYVA 3D7RA 2PBLA 3EQ8A 3DKRA 1SFRA 1FFDA 1LZKA 3D4LA 3VDXA 4A23A 3G9ZA 3DL7A 3MGAA 1R88A 2Z8XA 2WHPA 1L7AA 2QT9A 1LPOA 3ICWA 4A16A 2OCKA 1CR6A 1Q0ZA 3NOXA 3RKSA 1EINA 5DLPA 5IKXA 3QPAA 1BEZA 2GBIA 4MXDA 5AJHA 3WKDA 3GZJA 4N8EA 4B6GA 1LPNA 4PNZA 3WL6A 4AO6A 2JGLA 3G02A 4LXIA 2WM2A 1XFDA 3HSSA 1UKCA 4H18A 1U2EA 3H2KA 4L3WA 3I2HA 3PUIA 5ALUA 1HKHA 3HC7A 1BRTA 3STYA 3CCBA 1E5TA 5JD6A 1A8UA 1MTZA 1YR2A 5ALEA 5D3KA 4CCYB 2XMSA 1JT2A 4YX9A 2VJCA 3NGMA 1DQZA 4J0CA 4MQMA 1YB6A 2PL5A 1H2XA 1UOOA 3HEAA 5HK8A 3QPDA 1XQWA 1XZIA 1E8NA 5AOBA 1USWA 2VJAA 1DWPA 4K6KA 2H7XA 4Y9SA 3L1HA 3WZMA 2QJWA 5HK9A 5BWBA 3JYHA 3WK4A 1ACJA 5A2GA 3PUHA 5CXXA 4H7FA 3HABA 4FNMA 2HADA 3VKFA 4UHFA 3DOIA 2C4HA 3EBLA 4ARAA 4K2AA 1H2YA 3DNMA 4MQLA 3W06A 2E3JA 5FDFA 2OXEA 1LLFA 1FFAA 5LZ9A 1HL7A 2HIHA 5AK3A 3C5WP 5ALHA 4OCZA 2D0DA 4E46A 3UUFA 1XZDA 4HZGA 5ALRA 4C4YA 1G42A 2K2QB 4Y2UA 3WL5A 4NS4A 2GBGA 3PDCA 5AM0A 1EVQA 1CUFA 4U2DA 5IH7A 3F8SA 1UKAA 4GLBA 4GBGA 3WMRA 1CUYA 5CT4A 2WIKA 4C4ZA 2O2HA 2JGJA 3HLKA 1AUOA 2VJDA 4Y2SA 3L1IA 5AOCA 3S2ZA 1E3QA 4Y2VA 1WCYA 5HFNA 5AM2A 1XZGA 2RI6A 1W76A 5CMLA 4HRYA 1J07A 3IIIA 1Q83A 2EDAA 2PSHA 1K5PA 3O95A 2OCGA 3H2JA 5AKIA 4IHAA 4OB7A 1TCAA 2GYWA 3DLTA 3WA7A 5LZ7A 2OGTA 3AZQA 1R50A 3WZLA 1ISPA 1ACLA 2QTBA 4QZVA 2ZYHA 5E4YA 5T4EA 2P8SA 3WQHA 1ZI9A 2OQIA 1MNQA 4I19A 1QIJA 5DJ5A 4G8DA 5EHNA 1BN7A 2VEOA 5A71A 3RARA 1OILA 4RE6A 4U2FA 3OOSA 5CT9A 1E66A 2QUAA 1WPXA 5SYMA 2JGEA 1VZ3A 1X2EA 3IA2A 1QIKA 3I2GA 1EDDA 2C58A 1S8OA 4U2CA 2BKLA 5JARA 1U8EA 5IVKA 1LGYA 1QE3A 3ICVA 3DYVA 1T2NA 2XQIA 5I9IA 2J4CA 1SOMA 3T52A 4X71A 4XX1A 5AHXA 3H1AA 4U2EA 4GDMA 4X3CA 5FLKA 1DWOA 2XUKA 1ZGBA 2ZJ6A 5IVIA 1XZHA 1CUSA 3LP5A 3ZPXA 2DFPA 4KRYA 4Q3KA 4HVTA 7YASA 2I03A 2EEPA 4KRXA 1EXWA 5AIBA 1JFRA 5JZSA 5FPPA 5FP0A 3H2IA 2XMZA 4C01A 4TPKA 5BV7A 4X93A 2VT7A 4FFWA 5EHZA 3A2LA 3I28A 4I4CA 1ETHA 5LKRA 4A5SA 4CCYA 5CT5A 3IUNA 3IUQA 3STUA 1ZJ5A 1XLUA 3KD2A 5KWIA 4DSAA 5CT6A 3LS2A 1MAHA 5AIAA 1ORWA 4CFSA 3FCXA 2XUPA 1PJAA 1CUIA 4AX4A 1K4YA 2ZJFA 2X8BA 1IZ7A 4DMHA 1IVYA 1GKKA 5D6OA 5AO9A 3CCCA 4X6YA 2XT0A 4TGLA 3WIBA 3OURA 3L1JA 2XUDA 1XROA 3EQ9A 3F97A 2XMGA 1EI9A 5HQ3A 3ED1A 3G7NA 1XRPA 3EIOA 1Y7IA 4KAJA 1BEEA 4KE8A 3DQZA 1CPYA 3H18A 3H19A 2WUFA 5EIEA 4AO7A 4UBNA 2WIFA 4B84A 1JJFA 1XZLA 1ZI8A 4HRXA 5CH5A 1XZEA 4OSEA 4FBLA 4LYEA 1CUEA 4BAZA 4BYMA 1J06A 1LPSA 1GPLA 1MU0A 1RWQA 4HTAA 3JWEA 1HLGA 3PE6A 2OAGA 5JAUA 4HXFB 1CUGA 1H2WA 3ZLUA 5ESRA 2XE4A 3PFBA 3W04A 4K6GA 3WWEA 4KR0A 4B82A 3C6YA 3ESAA 2R8BA 2V97A 1CUDA 2DHEA 5FRDA 4V2IA 3QM1A 4G1FA 4X6XA 2VAVA 4FTWA 1AX9A 4DNOA 1JU3A 4JEIA 4DMFA 4IQ4A 3WWPA 4QNNA 1UOPA 5ALIA 4QA9A 4G8BA 4M0FA 1CIJA 2PKYX 4Y2RA 5EFZA 1XZJA 2V9ZA 1ZIYA 4Y2TA 1VKHA 3PF8A 3F98A 4DM7A 1RYYA 3ESDA 1HPLA 4BC1A 3LIIA 3QMMA 1VE7A 2WJ6A 1QONA 3BIWA 1QO7A 4Y2QA 1IUNA 4QWWA 3QYJA 4F5ZA 5EGNA 4EY5A 1U4NA 5JD5A 3R40A 4B9EA 2ZSIA 1W1IA 1YS2X 4PW0A 3WA6A 5ALKA 4UBLA 1A8QA 1EK1A 2WIDA 3RLIA 2XQFA 4BVJA 5K3AA 1CVLA 3ZI7A 3H04A 5T4BA 4PO3X 3WWDA 3O4JA 4BAGA 4CI9A 2WLSA 5K5EA 4RGYA 5HKAA 3G0GA 1VA4A 2ORYA 5HF9A 2I78A 5K3EA 3R3XA 2RGUA 3BJMA 1TCBA 2FX5A 3K6KA 4Y2PA 4IH4A 4AN0A 4KAFA 4IO0A 1LBTA 3BJRA 1KU6A 4ZREA 2Y6VA 3IULA 5JZ9A 1A7UA 4BZWA 4BCCA 3G9XA 4S0XA 4P93A 4U2GA 4X85A 2WG2A 1IUPA 1DINA 1XZAA 3IB3A 1R4ZA 4CCWA 1UK6A 2J4FA 2XUFA 1CEXA 3LCRA 3R3UA 1XRMA 3DCNA 1DTEA 2QZPA 4MEAA 3HZOA 4BCBA 1XKTA 1HQDA 3CN9A 4Q3LA 3X3HA 3G9TA 4J0KA 2WFLB 2WKWA 1AZWA 1IUOA 5ALNA 2WFMA 4RNCA 1CUCA 1CFJA 3DYIA 1LBSA 2XB6A 3DD5A 1CUHA 3AIKA 2XMRA 2CJPA 1X70A 1W75A 3JW8A 5K3DA 1W4LA 3DJYA 2WSLA 1QIMA 5AOAA 2WG0A 1AURA 2CUTA 4EHBA 2H7CA 4AMYA 2ROQA 5LZ4A 4PSCA 5LZ2A 2ZVDA 3WK9A 5ALDA 1ZI6A 2DQYA 4UHDA 2HA4A 3KDAA 3UUEA 5D3ZA 1EH5A 3PF9A 2J3DA 1MNAA 5AI5A 5D7BA 4PSDA 4C4XA 5LP1A 1XZKA 1UKBA 1P0QA 3G9UA 2PSFA 2XUQA 1ZOIA 1CUXA 1VJ5A 2BGRA 2XUIA 1BU8A 1CLEA 1TRHA 5E2IA 4W9RA 3I2KA 4FLEA 3G0CA 2ECFA 3FOBA 4CIAA 5DYWA 2H7YA 1WHTA 3TRDA 4FMPA 3DL4A 3STVA 1XZFA 2C0QA 1AGYA 3DKKA 3I1IA 2NW6A 5T4HA 1AQLA 2CB9A 3HYSA 4JNCA 1PV1A 4RPCA 2PSJA 2HA6A 4J0GA 1G4HA 4HAIA 2HU7A 2JGMA 3R41A 3FSGA 2Y2VA 5DYTA 1C7IA 3MUNA 5SYNA 3M81A 1WB5A 2DHDA 3G8YA 4DNFA 5C8VA 3K9BA 2Z8ZA 1MJ5A 3AIMA 1WPRA 4FHZA 2Z3WA 5BOVA 2IITA 4MWTA 1BCSA 2EDCA 1UXOA 1CUAA 4Y2XA 5ALVA 1R1DA 4FNGA 3S8YA 2CZQA 2VATA 1T4MA 1TK3A 2XMQA 3V1MA 5CW2A 2VSQA 3ZLVA 2BUCA 4JUIA 1G5FA 3C45A 5CBKA 3O4HA 4UFPA 2JGKA 2B20A 2ZSHA 5C8XA 3WWOA 1XZBA 4BE9A 1LPPA 4P08A 1UK9A 1YB7A 1YASA 3O0DA 2XI4A 2HFJA 1XRLA 3KWFA 4ZGBA 4J0DA 2G63A 4AN1A 1F0PA 1ZD2P 1UT6A 6YASA 2WUDA 2DQZA 1DX6A 3ESBA 3VJKA 1DWQA 3EF3A 3D59A 4LXGA 4XIIA 3LIPA 4XWGA 2HDWA 1CQWA 3WK5A 2OQVA 3QMVA 1R9NA 2PSEA 1ZD4A 1K63A 3STTA 5FUMA 5AP9A 2AXEA 2IX9A 2CBGA 3HXKA 4Y2YA 3W9UA 4BTVA 1ZGCA 4ZV9A 2OCLA 2HU5A 4WJLA 1H23A 2QOEA 2O2GA 1QO9A 1EDEA 3P2MA 1YAHA 3D2CA 2BCEA 4FDMA 3VISA 4WDRA 1CQZA 5JASA 4BBZA 2ONCA 4X91A 2WG1A 4N8SA 4H7DA 4L0CA 1SC9A 2AJLI 5EHQA 5AI8A 4CG1A 2WU3A 4J0HA 4DTCA 2WIGA 3BDVA 5JAPA 2DSNA 1P0PA 1TCCA 3A70A 3D2BA 5C81A 2XMBA 1QZ3A 4BZZA 4ZV7A 4P92A 4MEBA 1LPAB 3MUOA 3E3AA 2YH2A 4JH0A 5DTIA 1JU4A 2O2IA 4C87A 3AUKA 4F60A 4MJ3A 3H2HA 2JIDA 1DU4A 4AQDA 5ALMA 4AXBA 4WFKA 4G5XA 5AM1A 3I2IA 4G9EA 1OCEA 4BDTA 2ZYIA 3M82A 3BL8A 2ZYRA 2QM0A 2QXUA 2ES4A 2X76A 1QFSA 4DLNA 5H3HA 2OLEA 4CG2A 4EBBA 4QDUA 4Y2JA 1UK7A 4B0OA 4BTLA 1VLQA 3NUZA 3OPMA 4QDXA 4UBKA 2XUGA 1E89A 3WL8A 1SCKA 4EZIA 5ALFA 1O6FA 4FWBA 3PICA 5YASA 3OTQA 1N8SA 3I2JA 1XQYA 1ODCA 5T4FA 1JMKC 4PSUA 1C7JA 2BUBA 5LYYA 5FOQA 2HM7A 4GHWA 2WFLA 2Z5GA 1Y7HA 2B61A 2VT6A 2WFZA 3AIOA 4K5QA 1FFCA 3ANTA 4OUKX 4C89A 4YK7A 5AKHA 4U2BA 1QGED 1GKLA 1DQYA 3Q8WA 2GZRA 4ZI5A 2RHTA 1J1IA 3ESCA 3I6MA 3VJMA 1YCDA 5AKGA 3K2IA 1Z68A 3T4UA 4UBIA 1GGVA 4BE4A 5AKJA 4EUSA 4NZZA 1BN6A 4FLFA 1YSCA 5J3JA 1MT3A 3N0TA 3AINA 1O6GA 1NU6A 5HF5A 4INZA 5AI4A 5DNVA 3U0VA 4PF1A 4X97A 1UFOA 4IH9A 1GZ7A 4Z49A 1DX4A 1FSSA 3FNBA 5HFAA 1QIFA 3PI6A 1VZ2A 5ALGA 4M0EA 1THTA 1Q84A 2CMFA 3E0XA 1CUJA 1PFQA 4X6UA 2JEYA 3FVRA 3FYTA 1ZICA 2XQKA 4H7KA 4OD0A 2AJCA 4QWMA 2QVBA 4L72A 5K3BA 5DTJA 2HA3A 2RHWA 2DR0A 4L9AA 4DYHA 4BP9A 1TQHA 4XJVA 3WK6A 3BIXA 2YXPX 2WQZA 1XZCA 3C6ZA 1WM1A 4B80A 2XUOA 2PU5A 1QOZA 4BCDA 4C6HA 3TEJA 2WHPB 1CUWA 1ODTC 5JYCA 3A2NA 1JI3A 5HQ3B 3H2GA 3N2ZB 2H1IA 2QXTA 3F96A 3KSRA 1XKLA 3QITA 4LHEA 4G4GA 4AB1A 2WTNA 4HXEB 4ROTA 2PU7A 1MPXA 4WY8A 5A7GA 3C43A 1UK8A 4B0PA 2V98A 4N5HX 3D5EA 4EA6A 1HBJA 3VJLA 2YASA 4E11A 3M3DA 5JALA 5DYYA 2FJ0A 2O7RA 4H0CA 3R3ZA 3C70A 2HRQA 1SCIA 2V96A 1AKNA 3V9AA 4UHHA 2WHQA 1NU8A 3SX4A 2QS9A 3B12A 4FKBA 2QR5A 4KE9A 1GT6A 2C0PA 2O7VA 3E1GA 5ALXA 4AZ0A 1M33A 1FFBA 2HHAA 5EIAA 5ALZA 5EI5A 4J3JA 3I2FA 2XLBA 3PFCA 4G4JA 5KBYA 1YA8A 5AKZA 2C5GA 3KWJA 1JMYA 3UMJA 2BGNA 4WY5A 3WKBA 4Q05A 3OC0A 1QTIA 4AO8A 5CURA 3W05A 3WYDA 1FFEA 3AJAA 1EB8A 5FV4A 1ZJ4A 1J2EA 5E4JA 3H1BA 4LXHA 5AKEA 1CV2A 2PPLA 3FBWA 1W52X 5AK6A 2VF2A 5JD4A 1QJ4A 3H17A 4KE7A 5K3FA 5AI0A 1F0NA 1GPNA 4EY4A 3QBJA 2QMQA 4DIUA 5ALPA 1F8UA 4PQEA 4NVRA 5E4TA 4DGQA 3DEAA 4BDSA 5CH8A 4EB0A 1LNSA 1MX1A 2XUHA 2C5FA 3TJMA 4UBMA 1VXOA 3AZPA 2VA9A 4DNPA 4UBOA 2RONA 3R3YA 2G4LA 4DMCA 4MWSA 2DCMA 5LZ5A 3CN7A 2HA0A 1EB9A 5ISMA 2XMCA 1CUZA 5BWCA 4FLMA 2LIPA 1QIGA 4QE3A 4DMKA 4OPMA 4DSZA 2JEZA 1ZIXA 1R3DA 1WB6A 1DT5A 1K8QA 1XRNA 3WKAA 1CUVA 1GXSA 3FWHA 3A2MA 1MX9A 3YASA 2OPHA 3ZWQA 2CEKA 4RE5A 4CG3A 5JAHA 3NWOA 1BS9A 4QDOA 4MYSA 2J3QA 3U1TA 2OCIA 5JANA 1N1MA 5LKAA 4OU5A 1EVEA 1XQXA 3EQ7A 2ZJ7A 1BROA 5FKJA 3VVLA 4ITVA 3WLAA 2AJ8A 3I1YA 3FYUB 3BWXA 5LLSA 1XLVA 1OXMA 4C88A 1CRLA 2OG1A 3OG9A 4QDZA 1MAAA 1U65A 3O4IA 3C6XA 4B83A 1JJBA 1MX5A 4QDTA 3E4DA 1THGA 4BP8A 1QLWA 2FUKA 3AZOA 1ZD3A 1B6GA 1G66A 3CXUA 2ACEA 1Y37A 4OYYA 4X7BA 4Y7DA 3R3WA 1MO2A 4LYDA 1H22A 5ALQA 4BATA 2JBWA 3HACA 1HDEA 1A8SA 4UUQA 1GQRA 2BAGA 4WFIA 4WFJA 3VXKA 2HA2A 1UOQA 4GW3A 3WKCA 3HI4A 3D3NA 4K6HA 1UZAA 1KEZA 3ILSA 4KJXA 3C6BA 4J03A 3G0BA 3DS8A 4FOLA 3IVMA 5C7YA 1QIDA 2GBFA 3D2AA 3HJUA 3O9VA 2GYUA 2YYSA 4UHCA 1I6WA 5JZBA 2HRRA 3C5VA 4E14A 1EHYA 4H35A 5CT8A 3RM3A 2GYVA 4QLAA 5AKKA 4WDQA 1XRQA 1L7QA 2PM8A 2VTVA 4UBJA 4UFOA 1A88A 1VOTA 2I3DA 2RAUA 3IUJA 1D07A 2WIJA 5I8PA 3WJ2A 1EDBA 3I6ZA 5AM5A 4BRZA 2B9VA 3C87A 2QRUA 4ETWA 5JAOA 2QKYA 4KEAA 1LPMA 4UPDA 1AMNA 4WCVA 1NX9A 1P0MA 2PX6A 4EY6A 3FAKA 4J7AA 3HRHA 4KE6A 4H7IA 1N5MA 2BFNA 1YAJA 2CKMA 1QIEA 5KREA 3WIOA 4X90A 3C8DA 4FBMA 3BDIA 5I7UA 2WJ3A 4N5IX 4ARBA 2PSDA 3MVEA 3G0DA 3FCYA 3Q0TA 1XLWA 3KOOA 3FYUA 1QIHA 2XUJA 4W1RA 3V1KA 1P0IA 5JIBA 4G9GA 5C8ZA 1Q0RA 4J0JA 4W1QA 3DOHA 5AK4A 2W6CX 3H0CA 3O4GA 4X95A 5CH3A 4D9JA 5KWJA 4W1PA 4BB0A 5A7HA 5IVDA 5AK5A 5AM3A 3AFIA 2X5XA 4JYMA 1CUBA 2G5TA 4W1SA 2HFKA 1L7RA 3B5EA 3AILA 5AKLA 4GWLA 3WYNA 3W9BA 3BXPA 4BVKA 1EX9A 5DNWA 4FFVA 3G0IA 1GQSA 1LZLA 3V1NA 1K6EA 3FSGD 1YA4A 2B4KA 2R11A 2Z3ZA 2WJ4A 3ANSA 2BJHA 3WKEA 1AC5A 4ZXFA 5AM4A 2JGIA 3IBTA 5LZ8A 1MN6A 3GUUA 3D0KA 3A6ZA 4QEKA 1R9MA 4H7EA 3GFFA 3SC2A 4EY8A 4AMZA 5AKYA 5F4ZA 3SWWA 4B9AA 4Q3OA 2BUAA 1WB4A 1TKRA 3ZLTA 1ODSA 1QTRA 2AJBA 2HL6A 4IH1A 1XZMA 4P9NA 1LPBB 3F67A 3IDAA 4PV7A 4W63A 5DNUA 4G8CA 3SK0A 3STWA 4EY7A 1F6WA 1XQVA 2GBCA 4X94A 5AI9A 1EK2A
chains in the Genus database with same CATH superfamily
1EA5A 3REGA 2YZ7A 2FZCA 3DGEC 1ZMBA 3FYDA 3JSXA 4QUGA 4HXGA 1N7HA 1N75A 3GROA 5ESWA 2X41A 1RJ9B 2H29A 2A1TR 4KNYA 4YO8A 5EWJB 1IYZA 2BBTA 1ISMA 2R7KA 3DBIA 3LHKA 4ZJYA 4XWWA 1KZ4A 3JWPA 2EX1A 3R3JA 4KXUA 3B9QA 1K8XB 1HMYA 3I04M 3OTHA 4KGDA 1ONBA 3ELWA 2P7HA 5ICMA 3N0WA 4LNUA 4MKXA 5AVOA 4W5OA 1H6DA 2XR1A 2OMKA 1NZFA 3PGVA 5HUQA 5FJJA 4KXVA 1J25A 4MO9A 1KY2A 1XCPA 2EL7A 4GI1A 2MCFA 4LBYA 4LRQA 4FFRA 2GTPA 5EXDA 4F0JA 1BMDA 4TUYB 2DWPA 4HNUA 1Y1PA 2QL6A 3A4IA 4F92B 2G0TA 1PJ2A 4YQFA 4MUYA 3GA7A 4XVRA 5GM1A 2C4MA 1NUTA 1H2ZA 4B5KA 3PR2B 4PQFA 4II2A 4MR7A 2QY9A 4UZFA 3G5MA 4MKGA 2C1ZA 5IZ4A 3S1SA 4YDQA 3THXA 4CEJA 4XOIA 1NZJA 1DT3A 1DEXA 4PZCA 2Q99A 5JJCA 2XXAA 3CBQA 3GT0A 4EG6A 2M1XA 4V02A 2PV0A 5KVSA 2NGRA 2C8JA 5D2CA 3Q7TA 1V1JA 3GAFA 4KPGA 2AXQA 2R68A 3SYRA 1JWAB 3Q15C 1U2PA 2H2HA 4Q9IA 3K6JA 5AH0A 1G291 3GEHA 3PB3A 4CQMD 4ETMA 3ZYZA 3TGLA 2QQ5A 2QX4A 2VBFA 4WOJA 3OJLA 3L6EA 3P8ZA 1OA1A 1V7CA 1JT9A 3EDMA 4FOOA 4LJSA 1XNHA 5CVVA 2FOLA 3RTGA 1P45A 1OT3A 3P20A 1PSZA 4WKOA 5DBFA 4DPLA 1LRKA 1R2QA 2CXOA 2EVWX 2RKWA 2IUTA 3Q0IA 3UGKA 1THMA 1VE9A 1NVGA 5DLEA 3RG2A 4BLRA 2JA2A 1JJIA 2MSWA 2ZT7A 3BD7A 4WJZA 3TR5A 2ZWPA 5I9LA 1E8DA 1DQRA 1YQUA 1T6NA 1YS1X 4YMWA 3S2UA 2D1RA 4OMUA 3SKVA 5HF8A 1YGPA 5GZ6A 4BNDA 5E2AA 5CFPA 4J75A 1OXSC 2EW2A 2I1VB 3INNA 1ZCJA 3IP5A 2ZVPX 3VC3A 3NS7A 4CM1A 4MR8A 4NMWA 3RC8A 1JBQA 1HNNA 3OZIA 3SY8A 3JARA 2DFNA 3OA0A 2IIVA 4HB2A 5I9TA 1AA6A 5J23A 2DTXA 4GM1A 1Z6AA 2BH9A 3OQJA 2GWHA 3X43A 5I4KA 3B8HA 4ITRC 1PFYA 4X24A 5A7FA 5BWLA 5EIHA 5C8DA 4LZPA 4Q34A 1YQGA 1VPTA 2C7BA 4K0RA 1ZVQA 2GJKA 3U3XA 2X1HA 2H2GA 4QBTA 4EHFA 3KETA 2F3SA 3GRYA 3TEFA 2HNBA 3QK7A 5A9SA 1ZHOA 1GYPA 3GJRA 3UXHA 7REQB 2PX3A 2C5AA 2AJDA 3N6VA 3DBHA 1D4FA 3L8ZA 4LC9A 3WQRA 3WYFA 4NK5A 1GDHA 2WHEA 3H0KA 4BVAA 1A8IA 4EFDA 1EE2A 4NEHB 3EH2A 3B3GA 4WZBB 4IJUA 1DJMA 4GPD1 1EFVA 4Y6RA 5CX1A 1L4EA 4HS9A 4EGAA 1EFRD 5AKXA 2GZ3A 1GSOA 3D3JA 4O4JA 4RL4A 2B30A 1KP3A 5KINB 2RHOA 1IY9A 5AW3A 1RQNA 1SPXA 1ZK2A 3WL7A 1RZRA 1UJ4A 1DHRA 4YAGA 1QRAA 2GD6A 3R4VA 4PVCA 2PGDA 4YROA 2P65A 2PGJA 3UAWA 4AN0A 4C0KA 4F3CA 5BSGA 2RHRA 2PWZA 1X86B 3K0FB 3IAHA 1KP2A 4EI9A 1ORRA 1QIIA 5JLAA 2WWXA 1VKZA 4MDYA 1L5KA 3OSZA 1PE0A 3TOZA 2I3ZA 1KK0A 1ZC3A 4D8YA 5JADA 3CU5A 3EEYA 1Q92A 3EFHA 5FYQA 5LC1A 1P61B 4JBNA 4WBNB 1HQCA 2WJVA 5EJ9A 1A2QA 1AS3A 1BKYA 1KHTA 5AW8A 4TVBA 3QJGA 3EGEA 4ZVOA 2AWOA 3PKIA 3VPXA 4BVLA 1C4KA 4TXJA 3F5SA 1ZG3A 3QLUA 3PEEA 2XKJE 2HIMA 1DVRA 1EFPB 3UBTA 4ZYTA 3E61A 3ZZ0A 3P26A 5TARA 4Q9LA 2GJ9A 2BHTA 4CKYA 4BVBA 1ST2A 4A0FA 5JSHA 1SQ0A 3TKYA 3WZ2A 5F2OA 1DL5A 1G8JA 4UHEA 1RXUA 4CEHB 3H9EO 1PN3A 5CUQA 5AK0A 1BS1A 4RIGA 2ID8A 5K2MA 1BWRA 3OU6A 1UDCA 4O5AA 4I08A 5CVJA 3OCZA 1CY6A 2XGJA 2VTDA 4JBGA 1AGXA 1G7TA 1FTWA 1NVDA 3REQA 2DQ4A 3DTYA 3G7UA 2R751 4FIDA 2V7BA 3H5VA 1NJ8A 2UZ0A 3C4VA 3LY9A 4GC5A 5EWJA 3X2EA 3F7OA 5JATA 2Q8NA 1RABA 2XT6A 3HSYA 2O8EA 3BAFA 1Y4ZA 2JF0A 1JPNA 3PHBE 3F9CA 1KU0A 1E92A 1USVA 3JQAB 4B3XA 4UUNA 5TE9A 4ENRA 1JIVA 1RVV1 5AW1A 3PHGA 4FD3A 3R3VA 5IHXA 1Y8RB 5CFQA 5DM0A 3OM8A 2YVAA 3QVMA 3ZDFA 4L5YA 4Z4QA 2BKEA 4NZ9A 4BRWA 4IKEA 2AMFA 4BO6A 3EZXA 4IHQA 4KQWA 2CUZA 2RGYA 1GRNA 4GVLA 1D2EA 3FLBA 3AEUB 1ADGA 3IVGA 3FG9A 1W8DA 3CPJB 3ENVA 1X7GA 1PRYA 2IK8A 3BEDA 3IAM1 4GR4A 3TKLA 4OUDB 4PZLA 4UQLA 1XHEA 1I13A 1YL7A 5L53A 5ILOA 2FW0A 1NNUA 5ERGB 1DLIA 2WWWA 1HG1A 5KNDH 1DAEA 4CLXA 4KAAA 3V48A 3VI4B 1XNJA 4FB4A 1D8TA 5JJBA 3UWMA 1OIXA 2JGFA 4ZAWA 3GXBA 1J0DA 4R5MA 4S1NA 4CE6A 5JZVA 1YRQA 5LIPA 5GIOE 3VOBA 4NQZA 2H4FA 4F5WA 3OAAA 1T24A 4X00A 1SJ9A 2FSHA 1D0IA 4GEGA 4JYBA 4XR4A 5BV8A 3IH5A 3F6RA 4L0MA 1CF2O 2GXSA 4X1KA 1JQJC 2P2LA 2PFKA 3FF1A 3NGXA 4GECA 3HADA 3OC6A 2X9GA 2IEDA 3HNPA 5HBRA 2FJPA 1Z5PA 1Z7BA 2EZ4A 3MILA 4MWDA 4HEQA 4G8JA 2ZJ1A 4K9DA 5FPQA 1E8MA 4RGBA 1KQPA 4F21A 3O21A 1N6KA 1YCFA 2RMKA 5ALOA 4UNQA 1JDBB 3EMKA 3W79A 1P6UA 1CZOA 2FPGA 1GPAA 2VJKA 3GI1A 1D03A 1IU9A 4F8EA 2Z5VA 3CRVA 4L1KA 4QRDA 2O54A 4OH1A 4L5IA 3RSQA 1Q50A 2AB0A 2QZ9A 3P94A 4H2DA 5CAEB 1PX0A 5H80A 4DBZA 2V9CA 1FFDA 2VNIA 3GT7A 3JVVA 1GTVA 1WPQA 2HZ7A 2QYHA 2XH8A 1FS4A 2W8ZA 5FT9A 2H3HA 1AKWA 2NU7B 2W00A 1XDSA 1L7AA 2YOGA 1GV1A 4WNCA 3AHGA 3LA6A 2GESA 4FBGA 4EGCB 3NHMA 3VNSA 1VIVA 4B3FX 5AVUA 3JZDA 1SXJC 1KI8A 2N47A 4LGMA 1KMQA 1H4TA 1U8YA 4X1KB 4A16A 2IIBA 3KPUA 3WGQA 2X0RA 3NOXA 5B3AA 5KTSA 3NBKA 3VZCA 2OVFA 3P0EA 1EINA 4N5MA 1MH1A 2WMNB 1SKYB 2N75A 3NHZA 3M70A 4K87A 1BEZA 1VYUA 4FDLA 1D1PA 3HA3A 3TLEA 1QH8B 4EG7A 1KWGA 1TFUA 2OTCA 2R47A 3GMDA 4LJ6A 4RCYA 2XGOA 1XP5A 4N8EA 5BR8B 1J7JA 3TUIC 4FHGA 3MEQA 4E07A 4Z9YA 1YVUA 4HEA6 1FQOA 2IP4A 1ILEA 4AO6A 4PIVA 2QAGA 1O77A 1YVRA 1SIOA 1CW2B 4WWHA 1V5FA 4P0QB 1MDBA 1OWLA 4GM4A 2V45A 4BBJA 3DZ8A 3HE3A 3DUFB 1JSCA 3EHDA 3FNIA 3OAAD 2JK1A 1PSDA 3N39C 4L3WA 3PUIA 2O8CB 4JFRA 1QO0A 4D9MA 4UPVA 1JQDA 2V0NA 3UIEA 2F8TA 4DCTA 2TSYB 3PEWA 1IG3A 1RMYA 3T7TA 1BRTA 4I50F 1E6WA 3ZWPA 3KYJB 4HQ0A 3NVKI 4MW9A 4S12A 1QRRA 2F64A 3FTPA 5A05A 5CXSA 5E1OA 3WYBA 1WBBA 3KD3A 3THYA 2X40A 4I55A 2O23A 4RCZA 2UU9B 1C2TA 2DYKA 3OKFA 3ROXA 4CLRA 2HGZA 4ZJUA 1R8XA 1YR2A 3VX4A 1BQ3A 3MS7A 5ALEA 5D3KA 1WXHA 1M1YE 1SVKA 1NOKA 5IP5A 3VR4H 1Z5UA 4DIDA 5IN4A 2E9SA 1I80A 1O7JA 4J0CA 5C8YF 3B7PA 3L7BA 1YB6A 3PL5A 1NPTO 3FJYA 3N8DA 1SC4A 2CXHA 1SHLA 2P4EA 4EW1A 4PZ9A 3EWNA 3HEAA 2VYVA 4LBVA 4M0CA 4BUJA 2M9MA 5HK8A 1LBHA 1Y1RA 4MW0A 1XQWA 2IEIA 3UJ9A 1E8NA 2X1MA 4MWBA 4O2AA 2IXTA 5FUYA 1OFUA 1WA5A 1DWPA 5LP6F 2BEVB 5CNJA 1WNTA 2H7XA 3L1HA 3RB8A 1GAXA 3DNFA 2ZOSA 1BFKA 1FXUA 2C2MA 4ZQIA 2C59A 3S99A 4MIEA 3ZY5A 5C34B 2HGSA 2ISCA 5LWHA 2ESRA 3WZMA 1Z4PX 3AR6A 1E9SA 3RVMA 5HK9A 1RM5A 4N76A 1HNXB 1FDRA 5FEMA 1FC0A 2ODQA 2J0SA 2RG1A 3CEAA 3TW8B 3RSGA 4QASA 3AVUA 2Q6IA 2V7EA 1XTSA 3OEYA 3AESA 2D5AA 5A2GA 1X14A 2IKQA 4DYVA 3H5OA 2Q5FA 2P4HX 3PT5A 2O2SA 1YL5A 4C2UA 2J3LA 4KAXA 2IYLD 4K9SA 5LXTA 2FGKA 4YFYA 4B2LA 1ND5A 2VUTA 4JDUA 1RJDA 3Q12A 4L27A 4M9CA 1VIYA 4HVAA 2HXYA 3LT4A 4ARAA 4I1UA 2A5GA 5DPMA 2W4QA 2OD9A 4OQFA 4L6AA 5FORA 4AS1A 1QYRA 2FZLA 2LWIA 2XRYA 4KJZA 1A4RA 1HH4A 4MIOA 3K0AA 1ODKA 4XVUA 2E3JA 4GYKA 1A8HA 1JHRA 2QPLA 3KOZA 3G5UA 4AYTA 1N0IA 3DMFA 2P69A 3EZFA 1HL7A 1E6LA 3G7SA 4OFXA 1LDGA 4Q12A 1KRHA 5AK3A 5CD9A 3C5WP 5J2TB 4XYLA 4HDNA 2D0DA 1QVVA 1N3YA 5ICGA 4TWIA 2QTMA 4HZGA 1U2DC 5CIWA 3LSTA 1A7KA 2YW2A 2QSZA 5ALRA 4E3WA 3CH7A 1GGJA 5GINE 4Y2UA 2YFQA 2YHAA 4NS4A 3GCWA 2IPXA 3GHHA 3PDHA 3FA2A 1TZCA 4BASA 5AVYA 3ICQB 5EE3A 1UBRS 3E9NA 4U2DA 3GRVA 4PO1A 3V34A 5IH7A 4OV6B 1Q16A 5DOZA 3A9SA 2HKIA 4YV0A 1YR6A 4ANFA 2B9EA 4JP2A 3T3NA 3MA0A 4UHKA 1WZ2A 4BNJA 2MSEB 4GBGA 4ZOCA 5FAKA 5L4NA 3WMRA 2O2JA 2ID7A 1KO7A 2XKAA 4LBZA 4EA7A 1ENYA 3RBAA 3QEOA 5JMPA 2WP0A 5K6AC 4QOJA 5CT4A 3B60A 1TAQA 2O8NA 4JVNA 4RSMA 4YAJA 1Q0UA 2G67A 2Z2JA 2O2HA 1HSZA 1UDBA 2FFQA 2CFSA 2FOXA 2NAFA 4NYJR 4KOEC 2MMGA 3JCZA 3QFSA 3R0QA 5E6SA 3U7QA 4XIGS 4Y9RA 4HDMA 2FEXA 3LLSA 3T7RA 2VJDA 2UVPB 3GIWA 1P62B 2OV4A 2ATEA 3L1IA 4KQXA 2CV1A 3FXAA 4P3YA 3T5DA 3WLQA 5LLDA 1T4DA 3K9GA 1E3QA 1EPUA 1LV8A 1Q12A 5HFNA 5HRCA 2RI6A 1PZGA 1P31A 3LPAA 2CLKB 3IIIA 1T26A 1QYCA 2YHUA 2J4DA 3A4MA 3LYAA 5K7SA 2EDAA 5KNCH 4QPJC 4DV2B 5KS2A 2M6SA 2OCGA 1I36A 4YRSA 1LSSA 4KLRA 4PNPA 3H2JA 1ZSYA 4PSAA 4W9NA 3QTTA 4X8LA 3UANA 1UPAA 4IX1A 3LCJA 1JDTA 4KH0A 4O2RA 2ZPAA 2Q1SA 3AG5A 1UWLA 3ZZNA 4ZDJA 3NJ8A 4GSYA 2VYFA 3B6IA 1UFVA 5L45A 3H8WA 2OORA 3DLTA 1BE1A 2XGSA 3GRFA 1XDGA 4RD2A 3T1NA 3OZSA 1Z38A 2HWYA 3ZKWA 3ABQB 4BQNA 3K8QA 1ISPA 1DC4A 4C1BA 1VP9A 3EZ9A 4LTNA 2Q4EA 1G1AA 2WIAA 2XCSB 4II3A 4WZAA 3GIDA 1W47A 4BLQA 5E4YA 2NYAA 1WABA 2X6RA 1VE5A 3D2LA 1D2GA 1B8UA 3BJZA 1CRWG 3M6VA 3ELYA 2FLKA 1RMTA 3AKCA 3L7JA 1T9AA 2HJGA 3P2YA 5CLIA 5HGXA 1Y1KE 4RLSA 4Q1EA 1KF0A 3LPLA 3W3AA 3PHJA 1Z74A 1K3FA 4HFJA 4L4ZA 1FRQA 4XQEA 4Y6QA 1L0BA 1YHYA 3QVTA 2H48A 4YRTA 5A71A 1CR4A 2EP8A 2WSYB 3IUEA 4IYJA 4R8RA 4RE6A 5KYYA 4CN9A 4GR9A 2RDMA 3K94A 1ZL0A 4M8NE 2HN9A 2UYQA 1E66A 3SKYA 3EG9B 1ZUD1 3M6MD 3OX3A 3AL0C 3N76A 3CRMA 1WPXA 5B4UA 5ARBA 4DUGD 1ULHA 2LDXA 3LRTA 4L73A 5K0FA 4C0SA 3C24A 3ADBA 1ZH4A 4FYVA 4YCNA 3LVFO 2P2DA 3T9FA 2F3PA 3EWIA 5COAA 2DWOA 2FZEA 4CIWA 2J3IA 3UJ3X 5JARA 1U8EA 1Z4KA 2CNNA 1UP7A 4J76A 1XIVA 3HUDA 1LGYA 4X7RA 3LCUA 1HV8A 1XTTA 1YO6A 1A0OA 2B4TO 2R65A 3DYVA 5SICE 3AVWA 2GEFA 1KARA 2V4MA 2V6FA 2FSFA 3BFXA 2TMDA 3T1TA 4U7FA 3KB1A 1SOMA 2C96A 3DE2X 1CG6A 2FE4A 3JVDA 3U3RA 1X42A 5C32A 1II8B 2AMVA 1NHGA 3G5LA 3MXTA 3H1AA 4XCVA 1QS0A 3ANLA 1U7HA 3HWRA 2C9BA 3DEKA 1UEXC 3PFNA 5BSUA 4A2CA 3GVPA 3A1CA 1SOVA 4U2EA 4IIJA 4UCWA 3S28A 3VV3A 2GSDA 4AG3A 4CT4B 2BFWA 3ZJ5A 3SS9X 2PLWA 1RLUA 3VKWA 3ETGA 5IVIA 4E4YA 1ZWKA 3EQZA 4RK0A 2QROA 5SZKB 1NW8A 6ABPA 3LP5A 4JMLA 4EW2A 1G17A 1MJGA 1T9ZA 2DFPA 3QFFA 1CC1S 4KX3A 3IFSA 3Q11A 4NCHA 4D8XA 1U63A 4HVTA 1XN1A 2I03A 7YASA 2EEPA 4XIYA 5A6SA 2B69A 2W2QA 3FZEA 1EXWA 1X7YA 1SKQA 4WBXC 1VPVA 3C3PA 4O3MA 4R2WA 5E7IA 2Q5IA 3C0KA 3P45A 3ZWKA 1AG9A 5JZSA 4XA8A 2RGXA 2W2OA 3VKUA 4AJKA 1DMSA 4WLEA 1D3AA 1LRJA 3EFBA 3NEPX 3O1JC 3QKIA 4ME6A 3TOCA 2DG2A 3GLTA 2Z6UA 4FT2A 4TLMB 3U1BA 2HSZA 1QF6A 1J8QA 1CF9A 1WV0A 2IYNA 2R8RA 3GOQA 3A2LA 4I4CA 3C5HA 4M1OA 4RDXA 4CGZA 2XNDD 3ZDCA 3R44A 3WAKA 4YLEA 5TQ0A 2JIPA 2COKA 5CT5A 3TZLA 1EHIA 3H99A 1O89A 1EUCA 4P80A 1E3JA 5CEFA 4WOKA 2XXAB 1WQ3A 1XLUA 2YFKA 4QVGA 3HL0A 4B3CA 3JQGB 4RIHA 4LRYA 2BSQA 3IIMA 4DSAA 2HJ9A 2ZI9A 4CMEC 1P1FA 3K9NA 2FPPB 3ASUA 3VC1A 2AFIA 4MPTA 3MSXA 2ZSFA 1QUEA 3CZCA 3ZXUB 5KYUB 2XUPA 2ZK7A 3EUFA 2AR9A 2WZQA 4YA6A 1I3LA 2V6JA 4Z9XA 4YY3B 1DBQA 1PGJA 4F8JA 1M2WA 4Y9TA 3JR3A 1XA0A 1ECJA 1XHFA 2OWEA 2TMGA 2ZRQA 3QKSB 4WZ6A 3WAJA 4DUYB 1IVYA 1GKKA 3CUWA 5D6OA 1H8ED 5JSQA 2PUEA 1WXEA 1USGA 2YV1A 4X6YA 1XO1A 5GONA 3U09A 1E6EA 2XT0A 4U7GA 4CVNA 3K6SB 4ZAGA 3WIBA 1F9AA 3OURA 1UDXA 3EQ9A 2YFYA 1W0JD 4BUZA 2Q3JA 1EI9A 4F93B 5HQ3A 3ED1A 3T6KA 2IEAA 3G7NA 4P98A 1BX0A 5LQUA 2CEAA 4IDGA 1U6JA 3EIOA 3H87A 4L5AA 4O4JB 2B8JA 2QTNA 1E2QA 3OPXA 1H1TA 4YT8A 4Z53A 4ZRMA 2IUEA 3AR4A 3L7DA 1BSVA 1AHNA 1TD1A 1IB0A 4KE8A 1XTUA 3FM9A 5AW6A 5DTQA 1ORDA 3X1MA 2E5FA 4WKNA 3DQZA 5FPTA 4LCBA 5AUPB 5KQMA 1H2AS 3RHSA 3TUZC 1ZNQO 1W87A 1JQBA 3UHJA 3LBYA 1QZUA 1DFIA 1SO8A 5DX0A 3TRJA 3HI6A 2VA8A 1B2LA 2AR7A 1ZH2A 2RK3A 3H19A 1KMHB 1AUQA 2XA2A 3AM5A 2LW7A 4QJIA 1EWRA 4MUMA 5IT4A 2FP4A 2WIFA 3HA7A 1JJFA 3PNKA 4Q4AA 5JSKA 1FEZA 2DKFA 1B00A 5BUQA 5DNAA 3C3WA 1YZUA 3HRKA 2PXAA 1JH8A 2DUJA 2QYTA 2V7GA 2Q1YA 3KCNA 3PIDA 4MGIR 4HRXA 5CH5A 5BN1A 2VPQA 5K4HA 1Q7BA 2G09A 2EFYA 4OSEA 1CUEA 2ZB8A 3MXOA 2IV7A 1JEJA 1BVYF 3ZE6A 2J5XA 4O3FA 4BYMA 5BRAA 2GKOA 3SP1A 1BVHA 2ZTSA 5JS8A 1RHKA 2F62A 1M8JA 4E6PA 2OEPA 3GEGA 5EEGA 1PR5A 2P1DA 4HTAA 4R9RA 4D0RA 5E95A 1ZAYA 3JWEA 2NV0A 1TT5A 1NQAO 2PWYA 3PE6A 4MMZB 3OICA 4F9FA 2FP3A 4NCAA 2VDPB 1W5TA 4HXFB 3ABSB 3G88A 4DDHA 3LTNC 1RSZA 1V7PC 2L2QA 5EMHA 4Z2YA 3RBZA 1GZDA 1EUDA 3MLAA 4HPXB 5T8KA 3H2YA 3UCEA 3U7QB 1PTKA 4QHTA 1YFLA 1U0JA 4FP9A 5JS2A 4E5SA 4UEWA 3IVXA 3BORA 3SX0A 1ZMOA 2GZMA 3GZTB 1KI9A 3N8NA 1OROA 5ITSA 4J6FA 3WWEA 3FOCA 4PR0A 3CNBA 2ZZMA 3AUFA 4EZEA 3C6YA 2HK7A 3H1FA 2C04A 5FL7A 3S2FA 1F1JA 2RCNA 4CMEA 4OBWA 4JR0A 5CIYA 2WJPA 2V97A 4HH0A 2D06A 4BP1A 1U11A 1TZBA 3A26A 1TT5B 5FRDA 1AQJA 3Q3VA 3GY0A 4G1FA 2D62A 2R96A 4QHSA 1SG9A 2W8BB 2XTNA 4DT1A 4Q3BA 1CNEA 4F6CA 1AX9A 4J1NA 3LECA 1SEVA 1XMSA 2C84A 4J94A 3CUTA 3DNPA 4JKOA 1RYHA 3LY5A 4ICIA 4Y30A 1BVRA 4DMFA 3UOWA 1RC1A 3SC4A 4N0QA 2CUNA 5IVPA 4QXMA 3LKZA 7ABPA 1V96A 2FSVC 3HFRA 3TIGA 1EFTA 1NVAA 4P4TA 2VDNB 4FJ0A 1BQEA 1ZUNA 1VIDA 4QA9A 1HWYA 1DC6A 2O8FB 3RYHA 2HLPA 4MKFA 2B6HA 4LSMA 1UBKS 3FB4A 3AF0A 1GTZA 2PKCA 2PX5A 2WKQA 2RI1A 4M7PA 3GGOA 2CYAA 3I8SA 4UNRA 3NO4A 4IGKA 1NR7A 2O6HA 3D7SA 4TL8A 1T1JA 3T4XA 3AB8A 3VYRB 4L51A 3TD9A 4GGMX 2C2HA 2YVLA 5B4TA 4QECA 5EESA 5GOZA 1K98A 3PIRA 4P7BA 4DM7A 1RYYA 5D85A 3Q2OA 4DY4A 4AC9A 2QRHA 4BMCA 1HPLA 2KWIA 3OECA 2OB1A 3LIIA 4MP3A 1I7LA 3L6OO 3AY0A 1VE7A 3QEAZ 2B8WA 3HN6A 1T9BA 1P74A 1QO7A 4Y2QA 5I7WA 2JJ2D 3W1VA 1YMQA 3RYIA 4AKHA 1IUNA 3G5TA 3OCVA 2GAOA 1M7HA 1GGHA 4QWWA 2BSAA 3WR5A 2IPLA 1GPJA 2Q27A 1QR2A 3HJTA 4QODA 4F5ZA 5LQDA 4G0WA 3L01A 4NH0A 4DUPA 1ZGJA 1OXUA 4NH4A 1B23P 2EOAA 3AR9A 4ZARA 2FG7C 5FEUA 4WVLA 4A3SA 2OXIA 5DGIA 2Y9PB 3MRSA 1EVKA 1W1IA 3P97A 4UUOA 2YUTA 4ZCSA 4GT1A 4URYR 2A67A 4GRIA 3K53A 4IQGA 1Y1SA 3WLIA 1EAYA 4KFTA 2G6TA 2IZ1A 4PLTA 5EIWA 5G1OA 1YK1A 3WA6A 1NE2A 5JOQA 1EXNA 1N6NA 3W4IA 3PQDA 1SKUA 1RWKA 1KQGA 4G5OA 3V8QA 3MINB 3FKJA 3NVMB 4MW1A 1OLXB 2WIDA 1KC1A 4UAGA 4D2IA 5FOSA 1NI3A 4BVJA 1C9YA 3OIWA 4I0WB 3E0QA 5K3AA 4JP1A 4EYSA 2VHJA 2Q0HA 1RQPA 3DL0A 3MD9A 3JTMA 1G5IA 2I6FA 6GPBA 2DPMA 3ZI7A 1UJ5A 2MSKA 1LVHA 3N53A 3Q1KA 4ZOAA 3H04A 4LFAB 1L4NA 1NONA 2X4DA 3A28A 3NBQA 5H7XA 5BNIA 2R7AA 2EG9A 4U7DA 4D02A 2VJLA 4N3GA 2WLSA 4GOND 3RUAA 2R0QC 3ZHVA 1BW9A 4XLTA 2VJMB 5JMWA 2RAPA 3EGCA 2WB4A 3PE3A 4YECA 5MHTA 1RFGE 4CMGA 3HY4A 1QHXA 3CEHA 2XYVA 3AEZA 3G0GA 3QSGA 4F2GA 1GOTA 1WLYA 2Z4RA 2ORYA 4LMAA 3QKTA 1OX4B 4YMTA 2VPPA 3KM0A 4LYHA 1SU8A 1XNGA 4YONB 3R5XA 2YL2A 2RGUA 2Y0DA 4UM8B 1FYFA 4WLNA 3DXFA 2ZYWX 3RRMA 4CDNA 4KAFA 4A5OA 1QG2A 1KMHA 2VI5A 5CVTA 2HJWA 1G6KA 2Q07A 1SUDA 4IO0A 5FNVB 5LCXA 3GJXC 3KPYA 4HAYA 4Y6GB 5H9VA 5KYYB 3E7DA 2FVXA 1SBHA 2I29A 3ZXIA 4ZREA 1EJ2A 2Y6VA 2BIFA 5CFLA 2P9FA 1A7UA 4BCCA 2JPDA 1E32A 421PA 5B2FA 3RC7A 3ZH9B 1J0CA 4ARZB 4P93A 4CWAA 4X85A 5KJEA 1E2EA 2WG2A 5CIQA 1S3GA 4OQ4A 3LC2O 1C5KA 4TZTA 1PZXA 3B48A 3SGLA 3ESRA 1W36C 2PLFA 4IJMA 4KKXB 2VHVA 2V3CC 4E5MA 4N6NA 5F21A 2J6IA 2RHJA 2ETVA 2GK3A 4TQAA 4YCBA 3HJFA 4BO7A 1YUMA 3QLJA 2YXEA 3W8RA 5DI9A 4NE7A 2ZJOA 1CEXA 3ML1A 3R3UA 1U0FA 4KR2A 3BXXA 4NESA 4WZAE 3STHA 5KNBH 4WUVA 1RQRA 3H0EA 4HDRA 4IDCA 1D1QA 1DTEA 4RY9A 4HB4A 1XMXA 4HR7A 4PX3A 4LA4A 1VKNA 4Q4HA 4NULA 1HQDA 4Q3LA 4NYJQ 4XJSA 3X3HA 2OM2A 5CX4A 4MKZA 3UKJA 1L5QA 2GNOA 2WFLB 2WKWA 4OAPA 3I01M 3GP8A 4TRNA 1AXGA 3KB8A 1NIJA 2E85A 3SZUA 3V32A 1ACMA 4MQFA 3W2HA 2CT8A 2DT5A 4CCAA 3WFJA 3EVNA 4LDZA 1JJVA 3QHQA 3RLFA 3RVKA 3V8PA 3QBDA 4Y1FA 1L5LA 3UO8B 1ARZA 1QG0A 2XB6A 4S1OA 2GCPA 3RS2A 4M1MA 5DB4A 1CUHA 1XEWX 4YPFA 1R0RE 1RQ2A 5HBGA 4OYRA 2AN1A 4MV5A 2JI4A 4P5PA 3OFJA 2GOYA 3DJYA 2RC6A 4GI5A 4YUVA 3ECAA 4G0VA 4R0VA 1QM5A 1KMNA 4MICA 1INLA 5IYZF 5IUKC 4CEIA 2ZYUX 1QWSA 1WB9A 1HT1E 4DIMA 2P27A 4EA8A 2JBAA 4IP0A 3KDSE 1REQA 2L0XA 5K01A 1KYTA 3NYIA 1JN0A 1OFGA 3HWWA 1URPA 1ZI6A 2DQYA 4JD5A 4Y6SA 1ADCA 2WW8A 2F3QA 1XEWY 2AKAB 2HNAA 4KPFC 4BIIA 2QNIA 1TJNA 3RUCA 3FGPA 3T1HB 3AF3A 1EH5A 2CVZA 1GGFA 1HK7A 2HWXA 5L7WA 3KAJA 1T10A 1XEFA 2GCNA 1E79A 5AVJA 3L84A 2GZ1A 4HTFB 4PN7A 2ZUCA 3M3PA 3ABOB 3OU2A 3T7SA 1IEVA 2PGXA 3UMMA 3QNMA 2ZSJA 2QRNA 3QOYA 5LP1A 1JKXA 2YQ5A 4PG4A 3QA9A 2NVBA 1V7QA 2PSFA 2XUQA 3FBGA 1YBAA 4W5WA 3VHXB 5F7XA 1CUXA 3NDBB 3K92A 1UQTA 2ATVA 2BGRA 1WMFA 1E3LA 4QFMA 2ZM6B 4XEUA 3C3XA 3V8NA 1TRHA 2PZGA 5E2IA 3U9SA 5C1OA 4TS4A 5B7NA 3CLKA 1ABEA 3QLUC 5EERA 4D9HA 1R18A 4DIFA 3D6AA 4LXQA 3GGDA 5HTKA 3G0CA 3PNVA 2V1UA 2X0DA 1Y7PA 2JLRA 1KYYA 2Z8YA 4OY3A 4ZEXA 5SZHB 5K8JB 3QUAA 2XYQA 4I3HA 3HYCA 2BFCA 3KE8A 1IE3A 3QU9A 2EW1A 3QUSA 5DN9A 3TRDA 5BPHA 4LDNA 1SZJG 3GAMA 3FTQA 3LTEA 1Y34E 4OHPA 1Z8FA 2HLDD 3S6JA 1MHPA 1N2CA 1QPBA 3I8XA 4NATA 2NW6A 4Q1DA 5HFJA 3UT6A 1DIGA 2A1UB 3AHEA 2HIAA 3LP6A 1FU8A 2JFFA 4BLUA 4PPNA 5JWOA 1RKBA 1WJGA 3UJAA 4HTFA 2O3SA 3U19A 4J3NA 2HUPA 3EGDB 5EPEA 4DQKA 1E61A 1UBTS 1XWWA 3PUXA 5BPFA 4GLJA 4CIXA 2Q21A 4RYLA 1G4HA 2EKZA 1S8AA 2KPOA 4PWZA 1VIAA 4RIFA 2PSSA 1GPDG 1SHZA 2R2GA 4YRMA 1Z07A 3Q7IA 4Y1RA 3O8CA 3K7EA 2HCJB 4L0DA 4ZGWA 4KN9S 4DVGA 1EA7A 2AFVA 2E4YA 3GVCA 3IESA 3O3OB 1T8YA 5E8JA 2LP4Y 2A1IA 2QUJA 1RIIA 4JI2B 1JQ3A 4F9TA 3HMKA 1DV2A 1IVNA 2GN8A 3W5AA 3JYQA 4DB4A 1ZN8A 2WZBA 3D54D 4YBZA 1VG0B 3ME5A 4XFDA 2H85A 3PEFA 2PT9A 2VEDA 2YMLA 3E3OA 1JAIA 2VH2A 3G2MA 3GOHA 3LGXA 4M9XA 4TKVB 4QVKA 3SF8B 3UFXA 1I2CA 2EJVA 1ZD1A 2XGGA 1G6OA 2DR3A 3QPUA 4URUR 4TRMA 4C0WA 4CUKA 5BYBA 3M6XA 1X13A 5KIAA 5I7SA 1O5OA 5FWDA 1OWOA 4M1KA 2HBYA 1JS1X 4Q03A 2R62A 3KHKA 3KQSA 4RCVA 1V8DA 4TV8F 5AQ1A 2WU1A 3L0PA 4LC0A 1HM5A 4PGFA 1FQJA 4G5QA 3VOTA 2QVGA 5KTTA 4A8PA 1NG1A 1WEHA 4FHZA 5JPCA 3KR0A 2Q7OE 1MKYA 2IITA 2YNMD 3FRJA 1UXOA 3E35A 2EWVA 3AF2A 4D9BA 4DEVA 3O8RA 3JQ7A 1E63A 1XJ0A 3NBAA 1T0JB 5ALVA 1KEVA 2JH3A 4NDAA 3THSA 2HTFA 1VJDA 3WVNA 4N18A 5AW9A 3GLIE 5H3LA 1TJPB 3FMPB 3TBKA 2VH5R 1X94A 3PQ5A 3FPKA 3KQOA 1W5EA 2NT4A 4CJXA 3ROFA 2Q62A 3TLGA 2NT3A 1DJPA 2VSQA 4RTKA 1TMYA 1FNBA 3KJIA 4H1VA 3C3KA 4I5GA 4Q3CA 5HPYB 1H4QA 3QBTA 3K0SA 3G2QA 4REQA 3CA8A 1CYDA 4HGZA 2SHKA 1JIXA 5CB0A 3Q1LA 2YYYA 3V8EA 5DGDA 4MS1A 4UFPA 5CBKA 1T3GA 2D1QA 2IX3A 2A8YA 2B20A 2DPHA 1T3TA 2RHGB 5JQGB 1R0LA 1TVKA 3MN1A 3TFOA 1G9TA 4NRDA 2FPXA 3IQZA 1A9SA 2WYIA 1XMIA 5JV5A 3F7MA 2H2AA 3WXBA 2DE0X 3ZK8A 3ADCA 3WGOA 3PWSA 2AMJA 2FMKA 1YASA 2YYAA 3H05A 3JS5A 3ZBQA 2P35A 2PAAA 4PS0A 2XI4A 4D3ZA 4QQFA 4JXXA 3ONEA 3AR5A 4KXXA 4U6NA 5KJFA 4MROA 1E9DA 3Q2IA 2E4UA 3MM4A 3IR7A 4FCWA 3Q5GA 4J0DA 4ISBA 4QEZA 4RZIA 4UEKA 4MGHA 4AN1A 1OZ0A 1R6BX 4R71A 1F0PA 2CVFA 3R9WA 4GL2A 4FWTA 3AKEA 2VPZA 3LOUA 3ZCUA 1TB4A 2EGUA 2GCEA 2J6BA 3LPNA 4N40A 4YGXB 4D26A 1W5SA 5CG1A 1GGEA 4X5OA 3INGA 2OYSA 2J85A 1DX6A 2JCBA 2AEMA 1YZ3A 3VJKA 2JLBA 5JCXA 1DWQA 1TF5A 2FSIA 5M7EA 3D59A 3LIPA 1PX2A 4MI9A 2ZEJA 3I01A 1TF2A 5DWQA 1FJXA 3QF4B 1A5TA 4AAYA 1KPHA 3A4YA 3ZOKA 4BP3A 1Y81A 3G89A 5U1PA 1S96A 2QA5A 1NUUA 1T9KA 4FXOA 4G41A 4L5BA 4Q9AA 1SBYA 2Y66A 4QYIA 2R5FA 1FPQA 2AXEA 3GT3A 2YRWA 3CUKA 2FEMA 2MYTA 4DDKA 3MGCA 4M36A 2CBGA 2AXNA 4Z4GA 2PANA 1WWKA 4L6CA 3W9UA 2ALJA 2A94A 4S35A 2IYUA 3TZBA 4N3BA 1NAIA 3TCXB 1U0SY 1RBMA 2XIQA 4ZODA 2RKBA 2VHYA 4ZV9A 3P5SA 4OVKA 2AT1A 4KN6A 4R54A 2JJQA 2PN1A 4FEYA 5DKFA 4BV8A 3SG0A 4RVHA 5F3RA 4AKSA 1AKYA 5FL7D 4DJFC 1H23A 3S7ZA 1YKFA 2Z9DA 4WHMA 2QOEA 2P2ZA 5EQTA 4ZZIA 1KXZA 1PDVA 3PJFA 4OOFA 1KPGA 4DV1B 4R9UC 1BWSA 2DOKA 1BWPA 2IHYA 4MV3A 2D7CA 1GRCA 2I6QA 3MJRA 3VISA 5BSKA 3ZHQA 5DLDA 5B30A 3V7YA 1BGWA 2HDOA 1TO2E 3QXHA 4TKMA 2DMRA 2IXGA 5KTMA 1EVZA 1WV1A 4N82A 5GV8A 4Y1EA 4ZHQF 4G09A 1NVXQ 5A9SB 4E09A 1NRXA 2V65A 4K3VA 2O2CA 4EYEA 2EERA 4GR5A 3EYWA 4N5LA 4OHFA 1Z4QA 2IYEA 2YMPA 5HP4A 3BEOA 2HQOA 2XW6A 3VO9A 2VPTA 1M2HA 1VJRA 2ZU6A 1J2JA 3HA2A 1JHYA 3M6IA 4L76A 3FKSA 5AI8A 5AW7A 3NBUA 3AEUA 4LAFA 1E1QD 3RU7A 1XTPA 1CJVC 1NLMA 5BVHB 2XHZA 2X8JA 3EJWA 5E7JA 3DBLA 5SZIA 5FOUA 3WBJA 4UVIA 1RZRD 1H1DA 3GG9A 1QOPB 3KTAB 1Y8QA 3DMDA 4E2WA 4G84A 4AMGA 3F9RA 4AD8A 5LSAA 3G3EA 1PUJA 3P4UA 1U8CB 5FOTA 3EJ6A 4WGFA 4HEA1 2NPFA 4CM6A 4L57A 3JXEA 2JG3A 2B8TA 1A2BA 1LPAB 2CGEA 3OLWA 1MX3A 4BPRA 4F7WA 4HT3B 4B6QA 4EKNB 2P7IA 4PFQA 3W4KA 3E3AA 3EXFA 3H11B 2QTCA 4ERNA 4HK4A 3SFVA 1I2DA 1C9DB 3H13A 2HJSA 3FSJX 3RVRA 4JH0A 1T9CA 5JE8A 3T35A 1VGRA 3U44B 3L0ZA 4DE5A 2XB9A 2GK7A 2PH1A 1GL3A 2FY8A 3COYA 1DB3A 3HJNA 3RSOA 4TN1A 5E1BA 4JQSA 5CNIA 3H2HA 1ZR4A 5F3DA 2WK1A 3PQ8A 4R2LA 5ALMA 3I6IA 2J7KA 2VDMB 1MABB 1JIKA 3C4JA 1IDOA 3N75A 3T9AA 3E84A 3VR4A 3ZHRA 4BDTA 4DZRA 2FQ1A 1CTQA 1ZU4A 2ZYRA 3LSYA 5BN5A 5J4YA 1KEWA 1SY7A 2QXUA 2I6TA 2W6PA 1C14A 2VBCA 3LD9A 1U2DA 3Q3CA 3WB1A 4ZAZA 3CY6A 2WKRA 3OCWA 1W88B 1OWNA 3AOGA 1C50A 5H3HA 2R44A 3AR8A 2FQXA 3A1DA 2D3WA 1YJBA 5F1KA 1ZGHA 4BWFB 5IRCD 2YKGA 3U4IA 4ZKEA 4H1WA 2ZP1A 4LQDA 3OPQA 1PEDA 1YJXA 3NUZA 2W2LD 1L5GB 4QDXA 4IDQA 3A7DA 1L5WA 4JQCA 4B17A 3HXLA 1QPGA 3H4MA 4N0MA 4R05A 1JP7A 5E3HA 3IPLA 2C92A 3JQ8A 4QFBA 1F2DA 3KG2A 1E89A 3OKAA 3OI7A 1SCKA 2W6JA 3I9MA 4A6DA 2I7DA 4BNHA 4HLDA 4UU1A 5HMLA 1OLSA 4G4SP 4IIJF 2ZUEA 4LHWA 1BAPA 2VDLB 2ZATA 2OFWA 4RZ3A 1IN1A 3I2JA 1IWPB 3A04A 4DHWA 4JI4B 2XODA 2FCAA 4YUXA 2EWMA 2ZIEA 2RGAA 3GMIA 4BV9A 1EUDB 4DLUA 4IW3B 1YD7A 1GEGA 2P6RA 1C9EA 3KP1A 5FOVA 3QX7A 5T4FA 2ADMA 4RKRA 2I91A 4PSUA 1X7ZB 2J5RA 1Y4AE 3RSHA 3VUEA 2JS7A 1NW5A 2AYZA 2VHZA 1M2OA 3R5KA 3X1KA 5KU1A 2JANA 4XGIA 1UXGA 4TRRA 5ECDA 5AWFC 1BIFA 1BVUA 4WBNA 3UK7A 1TD9A 2Y71A 2Z5GA 2I8LA 2B1QA 2O5VA 2WM8A 2XQVA 3JQQA 1R4AA 5FB3A 2WA1A 1R64A 2IDKA 2ILVA 3JPYA 1K7CA 5FBHA 3QX3A 2QRVA 1DJNA 2CUKA 1PNTA 3EPPA 1WCIA 3AIOA 2PLAA 3S1AB 4GDFA 1JE1A 3A3NA 4O8ZA 4YCAA 3UQZA 1V47A 2BKAA 4LC1A 4K5QA 4MQEB 5GGYA 2C3UA 3CURA 1V8ZA 4GOXA 1K88A 5DN6A 2XNSA 4WOCA 2RBGA 3U1VA 4C6SA 3EZGA 4YLYA 1T8SA 3FOEC 1E2BA 4TT3A 1XXHA 5EQDA 3DKPA 5AKHA 3VPAA 4JJ6A 4X1OA 3HG7A 3UENA 3WGVA 1WHSB 3LVBA 4CKZA 2Z1DA 5ES4B 1OI3A 3UUWA 4Q93A 1B16A 1XEAA 1Q2XA 3Q8WA 1KZHA 4YXWD 1TYZA 4YRCA 3BREA 5ITVA 1WMSA 3RFTA 1S2DA 5DGTA 4DIKA 3TLGB 4AZVA 2P6NA 1QFXA 1GVHA 2B1IA 5CG2A 2XDAA 4UUPA 4HB3A 1YCDA 2HT6A 3FFBA 3MMZA 4HAUA 1Z68A 1V0JA 1PNRA 1TEVA 3T4UA 3EVTA 4BE4A 5AKJA 2OZKA 1DRJA 2YS6A 2ZAMA 3EBPA 5G02A 3UWSA 5L3QA 1FMFA 4PAMA 4NZZA 3QUQA 1BN6A 4GKAA 3I5MA 4Z0NA 1PS9A 2AWNA 2NOAA 2YCLA 3I2YX 2DWCA 3DOFA 3QVKA 4LQ4A 4Q3DA 4JZYA 3AUJB 1RXSA 4UVGA 5CJJA 5EIBD 2B3TA 3VTKA 1T6BY 4BLSA 3K4HA 4C0AC 4DA4A 1FFXB 3LM8A 2PZ8A 3NV7A 1GGKA 4ZAYA 2A86A 3NHPA 5AI4A 3E3LA 1I4WA 2CVHA 3ZJYA 5DNVA 1YJQA 3COJA 2CYCA 3JVUA 2YS7A 1T8UA 2VSNA 1JVNA 3AUSA 4HMOA 4X97A 3BILA 3OOHA 4LRWA 1E2MA 2OBMA 2Q4OA 3BE5A 1CQJA 5FHRA 3MHTA 1DX4A 1PT7A 2PKRA 4BVFA 1P4JA 4CM8A 3UGJA 5HFAA 2QLBA 3UMFA 1ADFA 1THTA 4QO8A 4D41A 5JYBA 4KPUA 1T5HX 1V5EA 3GFRA 5B58C 1DADA 1E9AA 1CETA 2PYDA 2R00C 5AUQA 1EEXB 1Y7TA 2PE5A 1V4NA 2JEYA 3BOSA 2OGUA 4UTZA 1ZICA 1DFHA 2HCFA 2JAWA 3GRZA 1IXZA 3OIDA 4OD0A 3JR7A 3OLYA 2H1HA 3K09C 3WSVA 1NLFA 2C2XA 3R09A 3HMQA 3IEXA 4TXMA 2BFCB 3HY6A 4ALJA 4Q7QA 1R4MA 4KR3A 2RHWA 4G1CA 5KX5B 4GF5A 2PZFA 1M2EA 2FF5A 3I5AA 5JI3E 3ABIA 5JAZA 5LOVA 1WZNA 4BP9A 1TQHA 1NJSA 5EJMA 3ZJVA 4IF6A 1KAHA 4UM9B 3CZAA 2YXPX 3PT9A 3KSAC 1YI0A 2GGSA 2WQZA 5I7AA 1XZCA 2CLCX 1EVLA 3DBOB 5GVRA 5KTRA 2HW8A 1WM1A 1OB5A 4KPYA 4W6ZA 5LQRA 2BEWA 1WKVA 1Y3BE 6AT1A 5I4IA 4D4JA 1S2LA 3F3YA 3R7AA 1A97A 4OAQA 4EUEA 4EYGA 2J7PD 1AB5A 2G9VA 2VG8A 3WNZA 3LFUA 4CQLA 4V1CB 4GO1A 1CUWA 4XD7A 1XAGA 3NM5A 5EIFA 4JI5B 5BRJA 1US8B 4D4LA 1YR7A 3H6GA 2HB6A 3ZGZA 3A9WA 5AXAA 5EVCA 5JYCA 1FQWA 5CM2Z 1ISGA 1JI3A 5BYJA 4DWWA 4CL3A 5AUNB 1WW8A 2IZ7A 1A9OA 5HQ3B 3DV2A 2NZYA 2ZM5A 4AVYA 3NKVA 2C5LA 4YXWA 1VQ1A 3C3DA 1JHQA 3SYKA 3FPEA 1NM5A 5E3IA 3BSYA 1WOYA 1Z0ZA 3EFOA 3HR8A 4OGFA 2IIQA 3JASA 2QD5A 3IALA 3NPAA 1VSBA 2J0UB 4ETIA 3AM4A 4LHEA 2B99A 2G08A 4EGJA 4B3HA 1LH0A 3E05A 4BNYA 4HXEB 5T6BA 4DQVA 3D4IA 1MPXA 1JLKA 3U9LA 5A7GA 2VNHA 4F4CA 1ODJA 3TRIA 5GJVC 3MWEA 2C7VA 3BTVA 4QM7A 4B6FA 1AVTA 1Y5IA 2PX8A 4P2GA 2QTFA 4Q24A 4CI0B 4EA6A 3VJLA 1S3FA 4QGHA 3ZZMA 2I2XB 1Z9BA 3D1JA 3GJ0A 4F4IA 4BLVA 1NBOA 2JRLA 2GZAA 2G8NA 5F76A 4NCBA 1YB2A 4CKWB 1DTWB 4JSRA 3L6CA 2YBEA 4MUGA 3P4XA 1K7YA 1O9HA 1Y98A 2QD2A 1Q22A 2O7RA 3SZRA 1JEYB 1KEKA 4FGWA 2VRCD 2O3TA 1KY4A 4TRJA 3ROQA 4FOPA 2VQEB 3PYLA 4O4LB 3G82C 4EUKA 2ZR9A 3A31A 1E18A 4Q02A 4UMVA 4Z3KA 2VPIA 3B1VA 4FKBA 3U4GA 2AZDA 2C29D 4XSVA 4V2UA 3AXTA 1E1RD 1Z0JA 1NXTA 2VWGA 1JR3A 3GC6A 3CS3A 3OZRA 4RFVA 4XCQA 4PN3A 2J9FB 2JKYA 2AQ8A 4AG5A 4L4XA 5COQA 1WPGA 3KS9A 3IKLA 3MWFA 1FFBA 4EB3A 1QQAA 2HK8A 2IVZA 3GEPA 4ND4A 5EIAA 2F9FA 4ODIA 1UIMA 3WL4A 4F3YA 2GA9A 3PXCX 1JEOA 4QJ4A 3Q8LA 3KE9A 5LA6F 2HK6A 2PYZA 3L1KA 4Q15A 1TO1E 1K7SN 1EJ0A 3KXLA 1YA8A 2F8MA 2ZSKA 3HCBA 3DVQX 3VC2A 3QEKA 3UCXA 4YQYA 3UMJA 1VBNA 3UWOA 3RASA 4Z4IA 3WOVA 4ZANA 4E2FA 1U3FA 2H5LA 3RCBA 2QVYX 4R5HA 2WC1A 4IDAA 4PAQA 3SCZA 1DBWA 4AO8A 1M6NA 3JRWA 3E1KA 4AJNA 2I4OA 3W05A 1Z4MA 5K0TA 3NC0C 1U2RA 3AJAA 1MD9A 4O4LA 5FV4A 1W34A 1O57A 1J2EA 4OM7A 3H1BA 3NEYA 5AKEA 4IIUA 1SCJA 1NN1A 1I1NA 2PPLA 3AUYA 3FBWA 3GLHB 3OFKA 4XDHA 5T8KC 3ESYA 3V46A 3FUXA 3IP3A 2P62A 3NATA 2VF2A 1K2VN 1QJ4A 3K0AB 3PP8A 3H17A 5BQ5A 5K3FA 4GLOA 3I39X 4EY4A 3OZTA 2R1TA 3AUUA 5AESA 2EHJA 3UV6A 2QMQA 1K3UB 4ZGGA 4KIWA 2ZRCA 4KKVA 3PXGA 3LDAA 2GCGA 3IAM6 3TQIA 5JBQA 1U6KA 1DOAA 1RI2A 4DIUA 4F71A 1NW6A 2H2FA 4FFLA 4NJEA 1KFJB 3PQCA 3PX3A 4I6EA 4EA9A 2HR1A 3I45A 1C3JA 2C2GA 3I0ZA 1OH7A 3GRKA 4GZ6A 2JARA 3JQFA 1CS0B 3CUVA 1XJQA 3BXZA 4E5YA 2JLWA 4KIUA 3CX8A 4CIDA 4HATA 2X0KA 5E4TA 3F3KA 1Q1QA 1FDIA 1T8WA 3K0EA 4KWCA 2VHXA 1YU9A 3ER8A 1IB6A 2C1EA 2PKEA 2J59A 4P7GA 5JQWA 1WX1A 1L8XA 1NQVA 1TUEA 5TVKA 4JKYA 1MFPA 4C1NA 1CIVA 1E5LA 4ZXPA 1EP2B 4OQYA 1L5HA 3TJMA 1KYVA 3KYIB 4M9UA 3AZPA 3AFOA 2J0VA 4UHJA 4DNPA 4A15A 2RONA 3Q3JB 4X61A 4BNTA 4ENUA 2WWYA 1VDZA 3ASYA 2J5QA 3I5XA 1W88A 2G9NA 3UFXB 1MENA 3O4VA 1J56A 2ZWOA 1XD9A 2C2YA 3U3MA 1RPJA 1ZSVA 1O96B 2OENG 1E1DA 2GZ2A 1OYYA 3CN7A 4JN6B 2QGFA 2FWAA 2H9AA 2VK8A 1TECE 4UJ5A 2XGMA 1P8AA 2K6GA 3ZGXA 1L4UA 5BQFA 3VMMA 1N6IA 2XMCA 3BYZA 3VGJA 1F06A 1CUZA 4OHUA 1U2GA 1CRZA 4FLMA 3KOMA 1UBFA 3I9NA 3SQNA 4YRGA 2G07A 1K86A 3JQ8B 4QE3A 2DH6A 4OPMA 1NDQA 1X1DA 2G17A 4DSZA 5LOVF 1ZIXA 1R3DA 2QW8A 1WMAA 2EIHA 2NZXA 2PCJA 3HCPA 4OK6A 3UJDA 3ER6A 4EW3A 1WUHS 5KJ6A 5C51B 1CUVA 2B7BA 3FWHA 1D7AA 1EXMA 3REOA 2NQ2C 3K35A 3WLSA 5AVRA 2VPYA 1MX9A 1OD6A 1CR0A 4M0LA 3ZWQA 5DRYA 4LBWA 3IGFA 1EIWA 4L8WB 2RJNA 1MRSA 4UMFA 3NRCA 5KDOA 1UODA 1VJTA 4E6EA 3TE7A 2NPOA 4JOSA 1ZXXA 3IJ5A 4U1RA 1GP2A 1QC5B 3OCJA 4ZPJA 4EI2A 2P5YA 1QHGA 1CQPA 4WK0B 1ML3A 5CB6A 3MYRA 4UASA 2W6JD 4OU5A 3AJDA 1SIBE 2QLFA 3SLGA 2ZJ7A 2QYOA 3KKEA 3O0TA 4MGYR 5GGXA 3TINA 5LJIA 1EUYA 2HYDA 2CXQA 3U4QA 4ISCA 3VVLA 2C82A 2JIQA 3OQIA 4HGYA 3W5VA 4OHYA 2I2DA 2C88A 3PNSA 1O6BA 5LLSA 1SKMA 1GN8A 3E2PA 4TT3D 1XLVA 4M1SA 2ZRPA 2PZJA 3WTCA 2G83A 5KNDA 1M9NA 2FMFA 2NZUG 1JTVA 1CRLA 1FFGA 3B1WA 4XTCS 4C88A 3PPXA 3I30X 1CIPA 4DQDA 1HFKA 3BHIA 2CL0X 1TGVA 4QDZA 4WKGA 3WHIA 1XI2A 3LQRA 1PK9A 1MB4A 3EMDA 2V7XA 1VG1A 1U65A 3OJCA 4DF3A 4F1KA 2I9KA 4JVOA 2C4TA 3C6XA 3PEVA 4RK1A 4DDMA 1MJFA 1N9KA 1T9GR 1SULA 1IBCA 2POCA 3K5HA 4HWOA 1N2HA 3U13A 1A82A 4PCVA 4XXHA 2H59A 4QGBA 4GD3Q 1VYHA 4TV8A 3NXKA 4BP8A 5DHRA 1RLTA 3Q9SA 4NFHA 3AZOA 1N8NA 2M6LA 5JFOA 3PUZA 1B6GA 3QE4A 5G1PA 3WGHA 5CITA 2JKVA 2ACEA 4IOMA 1TYCA 1N1DA 4JHLA 2DGDA 3RSFA 2YY5A 2YZMA 1N92A 3QMPA 4K9LA 4Y7DA 1OV4A 4D98A 3K72B 4EARA 1E5XA 3F4KA 4Z4FA 1WCWA 1SA0B 4CL2A 1HR0B 1YRBA 3E6AA 4LYDA 1PJZA 3CZ9A 4FMDB 4K8OA 5K8TA 3P2OA 1EFCA 1ZJYA 4QHYA 4EDFA 1PTJA 4EGFA 3WO0A 5M34A 3SAJA 2Q5EA 2JBWA 3FOFC 4FC6A 2JD1A 4RENA 1A8SA 1ATZA 1ESMA 2X8WA 3CR7A 4FFBB 2OCYC 2CDAA 3D5TA 1ZZGA 1OASA 1CU1A 3HI4A 2EFDB 1H2RS 2Y4NA 2DJIA 1NYLA 3GLUA 3FJ1A 3DE7X 1KEZA 5AD1A 4I4IA 4L2IB 2OAP1 5K9ZA 2D2EA 1R0SA 3B6MA 4HLNA 4KJXA 5BMVA 2NXEA 4YC7A 3G5AA 5KDDA 5EJ7A 3FKSD 3IDOA 4Y9DA 4KMSA 1QJCA 1VE1A 1XT6A 4RDHA 1OT5A 3PHCA 4FPXA 5FBLB 1JU9A 3DS8A 4DDUA 2UKDA 3AEKB 1ST3A 2J5KA 1IN4A 3HDYA 1NHWA 3D2AA 1E60A 1IAVA 1U3WA 4EO7A 2PV7A 4J7XA 2WQ6A 1H05A 5JVDB 3ADDA 4GG1A 3AQIA 3FLMA 5CGQB 4FDVA 3C5VA 1WAMA 4RAOA 1PKEA 3D3EA 4ZVMA 4DY6A 2BMAA 2GPNA 3TQTA 2FPMA 3S27A 2CXNA 1VHQA 3IILA 3QNUA 3RM3A 4BNGA 4NONA 4H3SA 1NSYA 4TMZA 4WDQA 3RVPA 5JC1A 3N5KA 3KQYA 4FYWA 4UU8A 4C6RA 1ZINA 2PM8A 4MR9A 1MAUA 1A2OA 2BDTA 2NO7A 3G2IA 4UFOA 5F1PA 5FO1A 4RF3A 4HVCA 3FZGA 3FDIA 1UXKA 4JP5A 2I3DA 4JI1B 1OIVA 4G1BA 5A0VA 2IE8A 5BR1A 4PXYA 3TTSA 2OUKA 1EDBA 4A03A 4JIMA 2YOHA 1P3JA 3TLCA 1WY5A 3HU5A 2ZUVA 4JOBA 4XB2A 2ZFUA 2C57A 2ZQYA 3I6ZA 1VHWA 1UAYA 3IPCA 3LXRA 4LK3A 5KYUA 5C18A 4U3JB 2GTHA 1TYEB 2VL7A 2Z5LA 3KKNA 3D0QA 3KV3O 4UDNA 1NXPA 1R6XA 2VSYA 4FI3F 1C41A 4RF4A 3O9ZA 4RWZA 2QRUA 3CPEA 3DTVA 3R6DA 3A9RA 1XDUA 4UTVA 1SVMA 4R51A 1PZNA 3TX2A 1Y3FE 1VBMA 4OMDA 3V3TA 4EG1A 2AEFA 3IB6A 2ZBQA 2NVUA 3DE6X 3RS5A 2PX6A 4G5YA 4J7AA 3L9XA 4FDUA 4FNAA 4KE6A 5E7MA 3DZBA 1TIKA 1MR3F 4IFTA 3EWSA 1O8BA 2CKMA 3K9LA 4B3GA 5KREA 3QKRB 3JYNA 4X65B 5B6JA 2ACWA 4X90A 2E4ZA 2VP2A 4NICA 1ENOA 5HE9A 1VG8A 5K8IA 2OORC 2V7QD 3EEOA 5JJLA 2NADA 1M66A 1CBUA 1DELA 2X2PA 3N0XA 1NW4A 3R5JA 1SXJD 3M1AA 4M60A 4BFXA 4ZYVA 4O4HA 3FBTA 3HJRA 1ZZEA 4AWAA 3IHKA 5LMZA 2GM4A 1ZS9A 1AO0A 2HLNA 1XXLA 3MVEA 5GAJA 1Z08A 2H7VA 1SCAA 3AX6A 3EDRA 4L02A 5D00A 1EFAA 5HXAA 2Y1EA 3KKMA 4I1OA 1IJBA 1I3KA 3EVAA 1X74A 2FETA 1GZ4A 2XUJA 2E4AA 1X7YB 3H8SA 1P0IA 2CDCA 3LYUA 3UT5B 3V1KA 4YAIA 4G9GA 4BLPA 5GY7A 2M32A 4C4SA 2WVGA 5C8ZA 2QN6A 4J0JA 1YFJA 3DMHA 3PFHA 4MB2A 2WYWA 2W58A 2Y68A 4RJJA 1KEEA 2F00A 2AD1A 1VSQA 4RX1A 2X86A 2D1TA 2PJUA 5CH3A 3VYUB 3VZSA 5KWJA 3HU3A 4KHZA 1SU7A 1FLAA 2E89A 4L8GA 2RJ3A 1R6TA 4US0R 1N5KA 1YJAA 4OXXA 4W1PA 3GRRA 4BB0A 4EG0A 2RHDA 3O7WA 5L3RA 2QX6A 4QATA 1A4IA 2HBRA 1YNOA 4GBED 1ND6A 1LSJA 4H1UA 5TQJA 3TSOA 4RVSA 1O87A 4WESB 4EKYA 4UEOA 1NMYA 5J40A 3UB3A 4C7MA 2G5TA 1GTRA 1IC6A 1B14A 2C2BA 3OSUA 4QPCA 2Q5JA 2H4ZA 3AONB 4GPBA 4L28A 4OSPA 1AQNA 3FX2A 4HJRA 1GWNA 1EX1A 4J1SA 1U81A 4HDCA 1TK9A 1EFUA 3MWYW 1T1SA 3U3ZA 2J6HA 8ATCA 1G55A 1GQYA 1J8YF 1OR8A 4KXFB 2PMFA 2Y05A 3W9BA 3KQKA 3KZMA 5EXSA 4W9MC 4ARIA 2C54A 1K8ZB 3QU4A 4O5OA 5LDDC 1COZA 4FFDA 4FD2A 5DNWA 1J39A 3E15A 1M2NA 4JQOA 1PT9A 3WLFA 2EFHB 3WGIA 4FHFA 4KVAA 3K6SA 2OBYA 2H8KA 3TR0A 3H97A 4TVOA 2ZCJA 1WCIB 3S1AA 5KNCD 1P9OA 3RC2A 1R8YA 4DLKA 1JKJA 2X5KO 3ECCA 3KUUA 5HIJA 1K6EA 4ROSA 3HU2A 3FUWA 3OCYA 2FW7A 1GARA 1KI7A 2C20A 4LI3X 1GPUA 2OUIA 5CHEA 4R8VA 1XF1A 3O2SB 2Q4RA 4C4AA 4CFYA 4E0BA 4CQJA 1UJCA 2PJZA 3IAEA 1OLXA 4GYJA 4V38A 2RKOA 2BJHA 3AT1A 5DCUA 2XE7A 5K1ZA 2CWWA 3ZD6A 1AC5A 4GP7A 3T9CA 4ZXFA 4RKEA 4DWJA 3LBFA 3GDFA 4J0EA 5AJTA 4NDNE 5JDCC 3K9QO 4GMFA 5LZ8A 1MN6A 2WY2D 3RAPR 4D99A 1N5LA 4IWXA 2FHPA 4J91A 3ITNA 4YLGA 3A6ZA 2EKBA 1R9MA 5FTJA 4H7EA 4QNRA 3WIVA 5CDYA 5G0SA 3GPBA 1SBZA 3A36A 2GPYA 2QAGB 2J46A 1S02A 5LUAA 1WS6A 1SVNA 1FDOA 5AKYA 3EUWA 2IHVA 3TLKA 3LUBA 1ECBA 2XXBA 4QOGA 5DM2A 4JLNA 1NW7A 5I4BA 2NO5A 3SZOA 4A0HA 1TKRA 2O4UX 1VRCA 3ELUA 8ADHA 2AJBA 2AG5A 1ODFA 1EGQA 1QTRA 1TMKA 3L0OA 2QY6A 2EQ5A 1Z37A 3N2YA 5G0TA 1TOAA 1AKVA 1QSGA 2AJTA 2REXB 3CRW1 5AQEA 1ZJJA 4DHEA 1FTSA 1S1CA 5TMBA 5JYDA 1WF6A 1NT2A 2DBVO 3ICPA 4H4DA 5EKDA 4P58A 2WWVD 3LT2A 2OHGA 1OXXK 2QUIA