4G4GA

Crystal structure of recombinant glucuronoyl esterase from sporotrichum thermophile determined at 1.55 a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
CSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
source organism Myceliophthora thermophila
molecule tags Hydrolase
molecule keywords 4-O-methyl-glucuronoyl methylesterase
total genus 134
structure length 367
sequence length 367
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4gA00
3DS8A 5FXMA 2EDCA 1IUNA 3ESBA 4LXHA 1WCYA 1QFMA 2AJCA 3Q0TA 1JMKC 1DWPA 3G7NA 2LIPA 1YS1X 5K3CA 4UFPA 4FOLA 1XZHA 2J4FA 1QIEA 5CH3A 1XRNA 4Y2XA 3AZQA 4NMWA 2GBFA 2XB6A 4CI9A 1GT6A 4FNMA 1O6FA 1THTA 3PUHA 3FVRA 5HQ3A 1TAHA 4I19A 5FLKA 2H7CA 3AIOA 2WQZA 1IZ8A 3G9ZA 2RHTA 4YPVA 3K6KA 4BTLA 1G4HA 1NU6A 1JKMA 1G5FA 3I2IA 3AFIA 2XMGA 4H0CA 1BN7A 1WOMA 4C01A 1QIGA 2JIDA 3WL7A 1XROA 2QOEA 3G0CA 1XLWA 4Q34A 2G4LA 1UOQA 1QFSA 5AIAA 5I9IA 3H2IA 4GHWA 4RE6A 4DMFA 1U65A 4ARAA 1CUCA 5ALHA 2V98A 3I2FA 3WMRA 1MN6A 3PUIA 4KR0A 2EEPA 3DYVA 1TK3A 4AN0A 5CURA 2H1IA 4JH0A 4OD0A 3PI6A 3FSGA 5ALKA 2XUHA 3STXA 2BUBA 4BAUA 3AZOA 2DSNA 4ITVA 3FLBA 1FFDA 1RWQA 4RGYA 2QUBA 4UHEA 4B7ZA 1XRRA 1LLFA 2FX5A 5AK4A 1K4YA 2X8BA 5LZ2A 2YASA 2HA2A 4INZA 3HRHA 2XUFA 5SYMA 4EY7A 3OM8A 4EY5A 3O9MA 3ESDA 2BGNA 3L1HA 4EHBA 1CUGA 3N0TA 5C8VA 4CCWA 3G0GA 2C7BA 3WLAA 3G0BA 1CUSA 4FMPA 3ANSA 2OCLA 2JGLA 4OCZA 4QDZA 3HEAA 1QLWA 1WB4A 3STVA 2BAGA 3P2MA 4UFOA 1LGYA 1XKTA 1THGA 4AQDA 3IVMA 5FP0A 1R3DA 1EK1A 2O2HA 1Y37A 3B5EA 1E89A 2QXTA 2G5PA 3I1YA 5HFNA 1F6WA 2XUDA 4AX4A 2VSQA 4G9GA 1EVQA 5DWDA 1GQRA 2WM2A 4IH9A 5AKXA 2GBCA 2QMQA 1HL7A 3HI4A 4K6KA 4G4GA 2JGFA 3H2HA 3VXKA 2ZYHA 5JADA 2XQGA 3C45A 1CFJA 3DEAA 1G42A 2XMDA 3WKBA 4FLFA 4UBJA 1XZKA 3ESAA 5HKBA 1EDDA 3X3HA 2GZSA 1H2YA 4TGLA 3UUEA 4CG3A 2ZJFA 3NGMA 3PICA 3WL6A 1F0NA 4I4CA 5JAPA 1YASA 3W2TA 2X76A 2JEYA 3OTQA 4XJVA 1ODTC 5ALTA 4DNFA 1DX4A 3SWWA 2HFKA 5ALWA 2I3DA 3D59A 2VAXA 4X6UA 3BL8A 3QYJA 3F96A 3YASA 4XVCA 4X85A 4J03A 5CT6A 1Y7IA 1JI3A 1WPXA 3AIKA 1BRTA 3HABA 5LLSA 5AICA 1IUOA 2CUTA 3HSSA 5JARA 2WIDA 3VVLA 5ALOA 1CIJA 2VAVA 3ESCA 3F98A 4TVKA 4Y2TA 5AJHA 1HKHA 2VATA 1YR2A 4WY5A 1BS9A 2R8BA 4KE9A 1SC9A 1UWCA 3DNMA 5JANA 2OLEA 5D7BA 4W63A 2FJ0A 1CV2A 2PX6A 3V1KA 3IDAA 1QZ3A 5KBYA 4DMHA 1VZ3A 2HL6A 2IX9A 3SX4A 1BEZA 2WFZA 4LXGA 2E3JA 4BAGA 4JUIA 1F0PA 2EDAA 1N5MA 4Q3LA 2DCMA 2OGSA 3BF7A 2WIJA 5KREA 4P08A 4K5QA 3DOHA 5ALQA 5ALIA 1YAJA 2JGEA 4X94A 1A7UA 5DTJA 5AKKA 4PSCA 1XQYA 1K63A 2WIFA 1ZIXA 4BE9A 4B85A 3UUFA 2QVBA 3KWJA 4PF1A 1JU4A 1SFRA 1XZDA 4QWWA 5ALJA 3WK8A 2YXPX 2QKYA 1KU6A 4Q3OA 3FNBA 3A6ZA 4J0CA 5CT9A 1TQHA 1CUIA 1QTRA 3VJKA 1AURA 1WHSA 4J3JA 4UBKA 4YX9A 2HRQA 4EZIA 2HA6A 1ZJ4A 2JGKA 4BZZA 2OGTA 1VXOA 2Y2UA 4O08A 3B3QA 1PV1A 1L7AA 2WIGA 5CT8A 1K8QA 2WHQA 1T4MA 4AO8A 3O4JA 5LZ5A 1A8SA 4H7FA 2PM8A 1JMYA 1WB6A 4EB0A 5A7HA 2XMRA 2OAGA 3BJRA 4QE3A 4V2IA 1YB7A 1UFOA 3E3AA 1EB8A 4KEAA 1U4NA 1XZGA 3C8HA 5AO9A 1JT2A 1B41A 3IURA 5K5EA 4HRXA 1MX1A 3RKSA 1E8DA 3I2GA 3E4DA 4QZVA 3STWA 5AKGA 4M0EA 4NZZA 5CBKA 4B80A 3GBSA 4QDXA 3HC7A 1W6RA 4GI1A 1CUZA 5K3FB 1EXWA 5C8XA 4XWGA 5EIHA 1S8OA 2RAUA 3STTA 5ALNA 5FOQA 5CXXA 1LPOA 5AH0A 1KU0A 3C6YA 1ODCA 1ZD3A 3VISA 1CUFA 3O4HA 4UPDA 1W1IA 5HFAA 3DL4A 4X6YA 1J07A 1MAAA 5A71A 5CRIA 1TCCA 3CN7A 2PSFA 2XDWA 4U2DA 1XQVA 5LZ7A 5A7GA 1H23A 2I3ZA 2OPHA 5ESRA 2O2IA 3I6ZA 2XMQA 2PL5A 5AM4A 2XQIA 3WKCA 3R3YA 4W9RA 3R3XA 4C4YA 1E3QA 2WHRA 3WJ2A 3C70A 2WU4A 2GBIA 2I03A 3GA7A 4UBMA 5SYNA 4BVKA 1VE7A 4HRYA 5JD6A 4J0GA 1QE3A 4U2GA 5CH8A 3WZLA 1CUJA 1DWOA 3WK7A 2CMFA 4XX1A 1GKLA 4PO3X 4G8BA 1X70A 3EF3A 3FLEA 4H7DA 4DMKA 1H2XA 3AJAA 4QDUA 4DTCA 3WKAA 1ZI6A 4J0DA 4CIBA 4LXIA 2OGZA 3PFBA 2VF2A 1DT5A 1U2EA 3G9XA 4QA9A 5BWCA 1CUVA 4I3FA 1CUXA 1DWQA 3DYIA 5HQ3B 5T4HA 2VJAA 2HA5A 2BGRA 4HTAA 1EH5A 4BC0A 1W52X 4AB1A 5AM5A 1AMNA 2ZJ7A 5ALEA 2I78A 4WFKA 4EY8A 5DYTA 1T2NA 1QIJA 1QTIA 4P93A 2RGUA 3E1GA 4MYDA 4ETWA 4FKBA 5AI9A 3QMVA 3KSRA 3H19A 1B6GA 5JIBA 2WUDA 1C4XA 3IULA 2OAEA 1D07A 4UBNA 5AI5A 3ZWQA 5AM2A 1ZICA 2C0QA 3H2JA 2O2GA 4DNQA 1W4LA 2ORYA 1J1IA 1OCEA 3IUNA 2Z8ZA 1BEEA 3V1NA 2WU3A 2AJBA 3H1BA 3C8DA 3QPDA 4BP9A 2HDWA 2XMCA 1BN6A 1C7JA 1LPAB 3O4GA 4M0FA 5HF9A 4BVJA 3R3UA 3CXUA 4IQ4A 4AMZA 2WJ6A 5KWJA 4N5IX 1W75A 4B82A 1BCSA 5ALYA 1BU8A 1XQXA 5AHXA 3FYUC 3O0DA 4KAJA 3MUOA 3Q8WA 4MWSA 5E4JA 4FFVA 3FAKA 2CJPA 1CEXA 1CPYA 4YASA 5ALDA 2HFJA 2WLSA 1UK8A 5AKIA 3WI7A 1J2EA 1LPSA 4AZ0A 1YAHA 2HIHA 1GXSA 3QVMA 3IBTA 1VKHA 4FTWA 1LNSA 4G4IA 2PUHA 2XUIA 1YA4A 5JD4A 5LZ9A 4L9AA 4QLOA 3OC0A 2Z5GA 3LS2A 1NX9A 3AINA 3ED1A 4HVTA 5CTAA 5ISMA 3F67A 5EHXA 3JYHA 1HLGA 5T4EA 1E5TA 2OG1A 3F9CA 4PQEA 4J0JA 5HZGA 2QZPA 1EK2A 1QOZA 1P0QA 3DQZA 3WA7A 3EIOA 3STUA 4B9AA 3I28A 3HACA 5LKAA 3JWEA 3RLIA 1EI9A 4AXBA 3WL5A 3BIXA 1I6WA 4A5SA 1QIMA 1ETHA 3I6MA 1KEZA 4S0XA 4MEBA 5HK8A 4BTVA 1EX9A 1L7RA 5AM3A 5C7YA 1TIBA 4BB0A 4H7IA 4W1QA 3AUKA 3WZMA 2XUQA 4HXGA 2ES4A 4GXNA 2ONCA 5KWIA 3D3NA 1LPMA 4OU5A 5IKXA 2QXUA 3S2ZA 3PFCA 4B84A 4PNZA 4CCYB 1ZOIA 1A8UA 2H7YA 3D4LA 2WFLB 3ANTA 3W9BA 3I2JA 4ZGBA 3OG9A 3QBJA 4Y2JA 1FFEA 2XQFA 5AK3A 2HA4A 1XKLA 5AI4A 4EA6A 3KDAA 1DQYA 2WFMA 4OSEA 3IIIA 2VQ6A 2XMSA 2BFNA 5EHZA 2RONA 4MYSA 1Z68A 1P0PA 1XFDA 3STYA 2OQIA 4U2EA 4UHFA 1QIHA 2HA3A 3PF8A 5AI8A 2QTBA 4H18A 3VJLA 2FUKA 2CBGA 1CUWA 1ZIYA 5K3EA 4KJXA 5C8ZA 2VJCA 5I7UA 2CEKA 2HADA 1ZD5A 3R0VA 1H22A 4ZWNA 2ACEA 3W04A 3WK6A 4BYMA 4K2AA 2WTMA 5EHNA 3LIIA 4WJLA 3TEJA 1XRPA 1YS2X 4N5HX 4B0PA 1PFQA 1ZD4A 5YASA 1Y7HA 2O7RA 5D6OA 1AZWA 4CG2A 1TCAA 5E2IA 2WKWA 1CUHA 1YSCA 1JFRA 5K3FA 2H7XA 4X6XA 3AZPA 1N1MA 2NW6A 4BCDA 2QR5A 1N8SA 5AKYA 2HU8A 4Y2RA 3A2MA 1QJ4A 1DQZA 1MX5A 1LBTA 1AC5A 4MQLA 2XQKA 4BCBA 1CRLA 4OB8A 3WK9A 1EB9A 1QONA 3D2BA 5IVKA 3M82A 1L7QA 4BDSA 3G9UA 1FFAA 4ARBA 1SOMA 1HBJA 2QJWA 4BRZA 1WB5A 1MO2A 2XUPA 2XI4A 4FBMA 3WKDA 2QS9A 1LBSA 2DFPA 4QLAA 4E46A 1AQLA 5JASA 5EHQA 2WG1A 3WK5A 1R4ZA 3BDIA 4HZGA 4IH1A 3WL8A 1AGYA 3C6BA 2XUKA 3RARA 2VEOA 1MNQA 4FBLA 5ALZA 2VTVA 1QIKA 2JGIA 5AM0A 2AXEA 1XRMA 4ZRDA 4MWTA 4F21A 1DTEA 1PJAA 5ALSA 1ZD2P 3WQHA 5BV7A 4AMYA 4B9EA 5AKHA 5ALPA 5EFZA 4QWMA 5AK6A 2AJDA 3ILSA 4J0IA 2BJHA 2G5TA 3I2KA 3M3DA 5JATA 3CN9A 3ICVA 4LYDA 4ZV7A 1IVYA 1UOOA 1JJFA 1EDEA 1AX9A 1J06A 1UK9A 5DYWA 2JF0A 3RK4A 5F4ZA 2GYUA 3AILA 1MJ5A 3G02A 4CCYA 3TRDA 3IUQA 3QH4A 2D5LA 2OCIA 5E4YA 3WWCA 2OCKA 2DHDA 4KRYA 1UK7A 2XLBA 1VZ2A 4K6HA 3I6YA 3QM1A 4KE8A 4W1PA 5FKJA 2WG0A 2BKLA 4FDMA 1MTZA 1GPLA 2C5GA 1MNAA 1YCDA 2XMZA 2DQYA 5LIPA 4UBOA 3JW8A 3D2CA 1HPLA 3EBLA 4GW3A 4KACA 4G9EA 1X2EA 3DLTA 1E8NA 1GKKA 1CLEA 4Y2VA 1F8UA 4Q82A 1Q84A 5I8PA 1SCIA 1C7IA 4OPMA 5ALUA 2WTNA 1MAHA 1GZ7A 4XIIA 5ALVA 3WWDA 3A2LA 4GBGA 1IUPA 5IVHA 5JAOA 3O9VA 1USWA 1XZAA 2WJ4A 3F97A 3KOOA 4C4XA 3H0CA 3ZV7A 3K2IA 5JYCA 4BE4A 2ZYRA 2JBWA 2RI6A 4C88A 4DIUA 1H2WA 2OQVA 3BWXA 4PSUA 4E14A 1W76A 3C43A 1Q0ZA 1N5RA 4G8DA 4OU4A 7YASA 5A7FA 3O4IA 4UHBA 3WIBA 5AKJA 5HF6A 4PV7A 1XLUA 3BDVA 2WSLA 3QZUA 5JD5A 5AI6A 1EA5A 1SCQA 1VA4A 5AKZA 2PU5A 1AKNA 2GYWA 2Z8XA 4FWBA 4N8DA 2PU7A 3DD5A 4QEKA 2Y2VA 2ZVDA 2HRRA 1TCBA 2W6CX 4BAZA 4UHCA 2CB9A 1O6GA 3AIMA 1R50A 4GDMA 4C87A 1A88A 2GBGA 1CUDA 3BXPA 4X92A 1CUUA 4MJ3A 1BE0A 1EVEA 5BWBA 2VJDA 3QMWA 4L72A 4B81A 4YK7A 1CUYA 2BCEA 2Y6VA 1LPPA 3C6XA 2HA0A 3I2HA 3V48A 1G66A 5JALA 1ZI9A 1K5PA 5HKAA 1WPRA 1ACLA 4JYPA 1YA8A 1UZAA 3ZPXA 3VKFA 5T4BA 5T4FA 1RYYA 5D3ZA 5C81A 1CR6A 5AOCA 4Q3KA 1QGED 1ZGCA 3O95A 4GWLA 4F60A 1XRLA 4W1RA 1LPNA 1R88A 2GYVA 3EQ8A 1BROA 1IZ7A 1XZFA 5E4TA 4ZXFA 5CXUA 2YH2A 3FCYA 4X71A 3NUZA 1OXMA 2Y1KA 3QPAA 2VJBA 4KE6A 4X95A 3V9AA 1XLVA 5FDFA 2ACKA 3FYUA 4FLMA 5HF8A 3B12A 3L1IA 4CIAA 4FLEA 2HU5A 1UKBA 1HQDA 3OPMA 3LIPA 1WHTA 3LCRA 1VOTA 1TKRA 4E11A 1XZLA 4RE5A 3WWOA 5DYYA 3R40A 2BUCA 1EDBA 3GROA 2RIPA 3DOIA 2AJ8A 2QUAA 3HJUA 2B9VA 3R41A 2WUFA 3RM3A 3G0DA 1UXOA 4UFNA 3K9BA 4A23A 4KAAA 5DNWA 3CCCA 4BCCA 3G0IA 1VE6A 4DMCA 3TJMA 3BE8A 3VVMA 4CFSA 1BCRA 4H35A 5AP9A 4WFIA 4X90A 5EI5A 5ALGA 2FJPA 2XUAA 3WIOA 4DLNA 2JGMA 3QPCA 1CUEA 4RNCA 1Q0RA 3U1TA 1UT6A 3FYTA 2CKMA 2W22A 4H77A 3EQ9A 4C89A 2HA7A 3W9UA 3R3ZA 3ZI7A 1NU8A 4OUKX 4CG1A 1R9NA 4J0KA 2WUGA 4Y2UA 2B4KA 1ODSA 1Q83A 4DSZA 1VXRA 4W1SA 5CT4A 4AZ3A 2WG2A 4UBIA 1TRHA 1ACJA 1LZLA 2WFLA 4BRSA 3H04A 2IIVA 2YYSA 3IUMA 3GFFA 4E15A 3V1LA 1XZBA 4AO7A 3DKKA 4P92A 3M83A 3C87A 4Y9SA 1VJ5A 1RP1A 2XQJA 3BF8A 1VA5A 4MQMA 5FRDA 1MT3A 4G1FA 1MX9A 1QIFA 4K6GA 3BIWA 5ALXA 5CT5A 4LYEA 3H2GA 4F0JA 3L1JA 5LZ4A 2X5XA 5JZBA 3U0VA 1XZEA 3IA2A 5AIBA 5K3DA 2D0DA 3F8SA 4NVRA 2OCGA 2XE4A 1GPKA 2QM0A 5A62A 3V1MA 2ZJ6A 1ORWA 1WM1A 3FYUB 4DM7A 4G5XA 3DCNA 4J7AA 3FCXA 5IH7A 3WA6A 2XUGA 3PDCA 3QMMA 2PVSA 4GLBA 5FPPA 2DQZA 4H7EA 5AOBA 2WILA 4M0MA 3DL7A 1OILA 1ZJ5A 4OYYA 2WJ3A 3HXKA 2HHAA 4ZI5A 2BUAA 1CUBA 4JNCA 4MXDA 2C5FA 3IB3A 4DYHA 3D2AA 1GQSA 1EINA 3FOBA 2PBLA 4DSAA 2VT7A 1MU0A 1GGVA 1R1DA 4IHAA 2QJRA 4KRXA 2HU7A 3VJMA 3G9TA 4HS9A 4X00A 4WFJA 2DR0A 4U2CA 3CCBA 2IITA 4BP8A 3VDXA 5DJ5A 1VLQA 4UBLA 4L3WA 5HK9A 1P0IA 5IVIA 4OYLA 3M81A 3NOXA 4F5ZA 3OURA 4Q1VA 1JJIA 4N8EA 4HXFB 1H2ZA 5JAUA 4AN1A 1ISPA 5AKEA 2Z3ZA 4Y2PA 4GECA 5EIEA 4X7BA 4UHHA 3MGAA 4DNPA 4IH4A 5IVDA 5EIAA 3D5EA 1YB6A 4Y7DA 4U2FA 4WDQA 4WY8A 2J3DA 5J3JA 2ECFA 3ICWA 3DKRA 4KE7A 1CUAA 1QIIA 3E0XA 4OB6A 4Q05A 2P8SA 2XMBA 3FWHA 1JJBA 3BJMA 3T52A 3S8YA 3ZLVA 1M33A 5JZ9A 2PSJA 2XUOA 4BBZA 5D3KA 4BATA 1UOPA 2Y6UA 3WWPA 4FNGA 2DHCA 1MPXA 2HM7A 2WUEA 2C0PA 1FSSA 2WHPB 2JGJA 1UK6A 2B20A 5ALRA 5ALLA 2ZSHA 2ROQA 3QITA 4FHZA 5HCUA 3UMJA 3GZJA 4PW0A 2C4HA 5AOAA 4EUSA 2VT6A 1JU3A 5AKLA 2ZSIA 4G8CA 4RPCA 5FPQA 4G4JA 3ZLTA 4WCVA 2QT9A 4BVLA 3I1IA 5JAHA 4A16A 1DT3A 2ZYIA 1ORVA 4HXEB 3WYNA 4EBBA 3OOSA 4GEGA 3D0KA 2XLCA 2PKYX 2UZ0A 4Y2YA 5K3AA 1QO9A 3HLKA 5CMLA 2PSDA 2V9ZA 4X97A 4B6GA 3H1AA 1XZCA 2PUJA 1X2BA 2PSHA 3W06A 2CZQA 3WWEA 5LP1A 4LIPD 4JEIA 1UKAA 5ALFA 3MVEA 4NS4A 1ZGBA 5JZSA 4BC1A 2H9YA 5DTIA 4JYMA 4H7HA 4UHDA 4MEAA 4LKOA 2DHEA 2ZYSA 2O7VA 1LZKA 2WHPA 2V96A 5BOVA 2Z3WA 3KXPA 3GUUA 2J4CA 4BDTA 3PE6A 5LKRA 2XUJA 4Z49A 3IUJA 4FFWA 1QO7A 6YASA 2JEZA 4QNNA 1DINA 4L0CA 1GPNA 4H7KA 2J3QA 3R3WA 1E66A 4C6HA 1HDEA 3W05A 5CH5A 5FV4A 3KD2A 2B61A 3GELA 4EY6A 1XZJA 5DNUA 5AM1A 5AI0A 4Y2SA 4X91A 3N2ZB 3WKEA 3SK0A 4C4ZA 1R9MA 3FVTA 3EQ7A 5A6VA 5DNVA 3FSGD 3R3VA 3C6ZA 2R11A 4ROTA 3H17A 2WIKA 4B0OA 3PF9A 4AO6A 3HZOA 4D9JA 4EY4A 2G63A 4HAIA 1CQZA 2PPLA 3KWFA 2OXEA 4OB7A 5K3BA 5DLPA 4ZV9A 3TGLA 2VA9A 3WK4A 4BZWA 2Q0XA 3A2NA 4QDOA 2PSEA 2C58A 1XQWA 3H2KA 1AUOA 1EHYA 3A70A 1UKCA 2GZRA 4IO0A 3D7RA 3LLCA 3MUNA 4WDRA 1P0MA 1XZMA 3C5WP 1XRQA 3H18A 1FFBA 4P9NA 5EGNA 5ALMA 5LYYA 1DU4A 2AJLI 5AK5A 4KYVA 2QRUA 1DX6A 3WYDA 1K6EA 4X93A 4ZREA 5A2GA 4X3CA 1XZIA 1CVLA 4UUQA 4B83A 3ZLUA 2XT0A 1CQWA 3NWOA 2K2QB 3SC2A 3G8YA 4PSDA 3DDUA 4Y2QA 3T4UA 4DGQA 1SCKA 2RHWA 3LP5A 1FFCA 1LPBB 1A8QA 1IMJA 3FLAA 1FJ2A 4U2BA 5LZ8A 1U8EA 4H7JA 3FBWA 4LHEA 3C5VA 4TPKA 2V97A 1QIDA 4QDTA 3HYSA 4KAFA 5CW2A 4J0HA 5FUMA 3DJYA 1E8MA 3WJ1A 1ZI8A 4DNOA 5H3HA 4N8SA 5HF5A
chains in the Genus database with same CATH superfamily
2A4MA 4MHSA 4YLYA 3K1TA 2ZB2A 3LBNA 1FLNA 1QG0A 1NTRA 4IKPA 4MRAA 1CW2B 2OP0A 5FXMA 1SAYA 4AS2A 3ADOA 4WCFC 4CM8B 1MRSA 2YVLA 4HRAA 4ZVRA 2HMSA 3ZI4A 2ACWA 3ONEA 4MP6A 2FFHA 3ESBA 3GT3A 1DDGA 1YRQA 4ND7A 3ROZA 1Y8QB 4LXHA 1IXZA 1QFMA 3Q0TA 3ZWXA 4QT4A 2B21A 4L74A 3DTVD 3HJNA 3M3HA 5KYXB 3R9XA 1HX7A 1WU7A 4JYBA 3TOXA 3MWLA 4J7CA 3KAJA 1M5UA 1FPQA 4PXYA 1GYPA 4H31A 3UBMA 2J4FA 1OFUA 1QIEA 3I9MA 1MENA 3NNSA 1BJRE 3OVMA 1ZNZA 2V7EA 3PHBE 2O3TA 4L7VA 4LCEA 1ADGA 3ESQA 3TM5A 3T4PA 4I99A 1T1EA 5HX7A 3GYGA 3P32A 4FYWA 1HDYA 3W6NA 5J59A 1XAHA 3ZHBA 2BGGA 4MB0A 4XR9A 4YDRA 3V8VA 3C3YA 2DLCX 4YP7A 3UAWA 2GBFA 2P9TA 2QRQA 1GT6A 3BT7A 1TD1A 3ONWA 4KGXA 3S28A 1J99A 5LPNA 5LMUB 2ZT7A 1BJKA 4QU9A 2P9FA 5BSVA 1EFPB 5IWCA 3HB1A 2EBFX 2NV0A 2O3QA 4TWBA 1QF6A 3FVRA 4HDRB 2E9SA 1AUXA 4J9UE 1TAHA 4IEEA 4PCLA 5FLKA 3UYLA 4LPKA 3O90A 3Q10A 4KWIA 1JILA 2EKBA 5L6LB 3H97A 2RHTA 5C3UA 3UQZA 4CI0B 5I4CA 4BTLA 2ODPA 1G4HA 4IX1A 1GSAA 3NBAA 3VR6D 3FUVA 1P9OA 3ZK8A 3K1ZA 3NDIA 1AK1A 1R6BX 3AX6A 5TS2A 1Y81A 2JG3A 8LDHA 2ZG6A 2XMGA 3P9RA 4MRMB 2Y27A 2FP4A 2JL1A 3SIPA 2E82A 3ONDA 3LC1O 3QELB 3AR7A 3KJFA 2COKA 2EZUA 3JD0A 1OWLA 4D6YA 4C7JA 4OH7A 3RYCA 3VH3A 2JIDA 3GUVA 2GJ9A 3GCWA 3WL7A 2RJNA 4YXWA 1M1UA 4MITA 4XWWA 1HNWB 2QOEA 5C34B 5HQJA 4RF3A 1NSTA 2IELA 5EAIA 3L7KA 4NMMA 4URHA 3G0CA 4FSDA 1F2UA 4JUFA 2GRUA 3W79A 3QEMB 1WMBA 3GLFB 4ZV4A 5J9FA 3AFOA 4Z5XA 5TQ2B 2F3TA 2B4AA 2C7GA 2G4LA 1DADA 1QUEA 2D7CA 3AR9A 3E7XA 2P3LA 2VDUE 2IC5A 3QBVA 4DLTA 2BGJA 5DIFA 5E1DA 1F2TB 1M8KA 1ZP6A 1YR1A 1Y7LA 1YDFA 2CXXA 2WZQA 5CDFA 4PYJA 4IDGA 1TK2A 3ZV6A 3CVXA 2JB9A 2OD2A 2Q4OA 4LQ4A 1NSFA 2VF5X 1ZU4A 3FLMA 1E6UA 1H0HA 1R5JA 1XKXA 4Q18A 4MWZA 4WKOA 3GYBA 3O2JA 3C4JA 3SYRA 4B35A 4D41A 4D98A 3HY6A 3KLMX 1E1CA 1OLSA 3DQQA 4DMFA 1YQWA 1VIMA 2CNWD 1BSVA 3HP4A 2ZWPA 3FG9A 1QYVA 4MKRA 1DC7A 1CUCA 2AE1A 3U4HA 3CE9A 3I2FA 1MN6A 3WMRA 3PUIA 5AW0A 2EEPA 1B6SA 4IFBA 5LP6B 1KOGA 1LW6E 1RTKA 2CYAA 4LHWA 2YMPA 3PENA 4KX3A 3RS9A 1DG1G 1Q0HA 4UU0A 3ND9A 3A27A 3OIUA 3BTOA 1J5EB 2AIRA 1VRCA 3KJZA 1EFLA 2GYYA 2HQRA 2XUHA 3DTYA 1G20B 4FD2A 2V7TA 2JIMA 3GA5A 3GCXA 4TLBA 1AMUA 3HJRA 4XRRA 1ZGHA 2Y0DA 2FKAA 4OQMA 3I9JA 4K9KA 3BWYA 4D9FA 4B6OA 1FRNA 2OO5A 2QLJA 2ZROA 4FGUA 2ZU0C 3VTFA 1Q44A 2R44A 1EFCA 4Z99A 4RGYA 4BTEA 4N47A 4AJKA 3BH0A 4JLSA 3ZGOA 3JWPA 5M2QA 1YR7A 2HMWA 2RHMA 3B51X 1Z8DA 1M2HA 1XNGA 3ONNA 2HPVA 4RHCA 1C1XB 1XRRA 2YZGA 2BJVA 1LJLA 1W1UA 3QG1A 4IWNA 4PZDA 1ZGJA 3HPQA 3L8MA 3O26A 4KWTA 1EVZA 4MRPA 3NFRA 5DHAA 5I3ZA 1VIYA 3PE3A 5BVGB 1DJLA 5JAMA 1OASA 1C8BA 2NAFA 3HRHA 3JQ9A 4QG7A 4BMYA 4H27A 4JI3B 1PVOA 3HY3A 3UQYS 1GAJA 3QKTA 5FUBA 4EY5A 4YPOA 1ZK0A 1X7YB 3O9MA 4HWSA 3ESDA 3FH0A 2BGNA 4RA9B 1RXUA 4FI3F 4FOPA 4NBUA 4GAEA 5DO9A 3UF0A 5L53A 1W73A 3L8HA 1TUEA 1SXJC 10MHA 5DN6A 3N0TA 3F3MA 4LXQA 4P34A 2PEYA 1JFSA 2R7MA 4CCWA 3ZGZA 2ZT5A 2C7BA 1GTL1 2JZNA 3JSXA 2ERYA 4JFRA 3AJ9A 4L4XA 3V4FA 4E5SA 3AF1A 4EY3A 2CDBA 5LJIA 4K26A 4RA6A 4QDZA 4S0ZA 5AR1A 5DM0A 1U8CB 3IQGX 2DCUA 2QZ9A 1RLTA 3ZXIA 4P3XA 3SYLA 3BVPA 2UZIR 4N9WA 3BREA 3HYLA 3LECA 3VQTA 3RRYA 4GKBA 4B5KA 3P9NA 2P27A 5C4GB 3ADCA 1K7EB 2AYZA 2II6A 2FE4A 4TQ9A 3EXHC 4EITA 5LA6A 2BAGA 3DMTA 4PLVA 2WTAA 4QQFA 5DGDA 3JASB 5IPFA 4R40A 3W3ZB 2GERA 3NJ4A 1H94A 4F2WA 3ZHVA 4Z7JA 2I87A 1KQ3A 4KN8A 2OV2A 1R3DA 3TQOA 2AOWA 4IUDS 4LRWA 1TW2A 1X0VA 1H1LA 1QDEA 3LGSA 4JBLA 3OKAA 5LMZA 2GR9A 1D1QA 2XCOA 2OCDA 1E9DA 4PLGA 3NJRA 2XBLA 2XITA 3NIBA 4NCJA 5HFNA 3R7DA 2F1HA 3RW9A 1V35A 2NNWB 2WP0A 3MINA 3A4NA 4R6WA 1QGUA 4AMGA 2VSQA 3EXHB 2TMKA 4WZAB 2B30A 3CLHA 4WGGA 3KL2A 1J24A 4TTAA 2WWHA 2HC9A 4E6PA 5CXSA 3DW3X 3INNA 5KJ1A 5AW4A 1GQRA 3TSZA 2WM2A 4H08A 4OY3A 1E9FA 4E2YA 3OIYA 1PS9A 4FYIA 1CR0A 1HL7A 1AY0A 4K1LA 3TWOA 3MWEA 4OUDB 1JSZA 2PMKA 1MJGA 3JR7A 1QP4A 3R44A 1VBKA 1PR0A 3G6KA 5J2UA 3H2HA 5EPEA 4BX2A 3A3KA 1GR0A 1X7ZA 1QC5B 2CVZA 2CKDA 2ZYHA 3H6KA 4H1WA 3NTQA 1CFJA 2FZLA 3SJCA 1G42A 2VF7A 1RFGE 2R6GA 3GJ5A 3EGDB 3WKBA 1YH3A 4YCCA 3ZKWA 1I7NA 4A0FA 5BUZA 1ND6A 2AR0A 1TAQA 1T2VA 2BISA 3NHJA 4IXDA 1RAFA 3PIIA 4IQGA 2GN0A 2AVDA 1KWKA 1NQUA 1NYLA 1AH2A 1YCHA 3OX2A 3EC2A 4P80A 4RH3A 3R0QA 4A7PA 2FR0A 4KU4A 4TYQA 2OZLA 2GZSA 4JBHA 5DLEA 4WKBA 3UUEA 2RC5A 3EGWA 1IWOA 2EFYA 1L5LA 3PICA 1EA7A 2OQ2A 2P65A 2XDYA 2RKOA 2J6IA 3NIGB 3P0FA 2R8ZA 4CCSA 2P2DA 2EJCA 1VBFA 4I4CA 2E5FA 4UZFA 3GOHA 3W2TA 4HPJB 3AU8A 1RRVA 4ZYXA 5ALTA 2GVDC 3GNLA 2YCBA 3TLGB 4EKGA 5D2CA 3SWWA 4M60A 1UJ4A 4IQ0A 5K3SA 4C7KA 1ZRSA 4ENTA 1F7VA 4B7CA 1PGQA 1N78A 3OKCA 1UM9A 2C8VA 1UOEA 5C37A 3L7BA 2ZIZA 3GCGA 4UUOA 4ZARA 5G3YA 2Q29A 2R6ZA 3T1OA 121PA 3RVOA 2OP1A 5C2JB 2W5UA 4Q1AA 3TQIA 1US8B 1MB0A 1Y7IA 3CO5A 1JIIA 2PJUA 3NT5A 2IDKA 3GJ8A 3FTQA 3LWZA 4LMAA 2AX3A 1Z0IA 1BRTA 1JFFA 5H1YA 1SD2A 2CVPA 4S1WA 5LLSA 1KVUA 4ZJZA 2LNDA 3ZJYA 5CTJA 2ECPA 3HSSA 1REQA 2IV3A 4FILA 1HH4A 1T4DA 5ALOA 1YKGA 1OREA 4RJTA 1CIJA 4AUEA 4JUDX 3GFVA 3F98A 2OFPA 1LBHA 3V4SA 3A1FA 1ZEJA 2R8BA 1TYEB 2GSWA 4FM9A 4KE9A 1X9HA 1HI9A 5ICEA 3DNMA 5HFJA 4B6EA 3GJZA 5ES4B 1CB7A 2FMUA 3O2NA 5BR1A 5D7BA 2CLLB 4LZAA 1II8A 5FWDA 3VSDA 4J16C 3T5AA 4MQBA 1Z62A 3DDNA 4KH1A 4KI0A 3NMUF 1YZUA 1QZ3A 4KJZA 3BXFA 1M6EX 1KVQA 4UTRA 1OKKD 1RRFA 3Q7TA 4H9GA 2X22A 4DMHA 1VL0A 4ZCIA 2O59A 4BMOB 3PYMA 1GLVA 3A9VA 1L4GA 1J0DA 1IY8A 1L6RA 2HL6A 1AO0A 4ESVA 1BEZA 2CK3A 3L6CA 3WDSA 1CKEA 4IDOA 4LXGA 3NIWA 4QPPA 1OH5A 4PC3A 2AFHE 2COEA 1F0PA 4MHOA 2AMFA 2A33A 4D82A 5HKBA 1EESA 3K9LA 5IXYA 4TQUS 4F8YA 5HYVA 2VBGA 3PC2A 1KSGA 4GBED 4Q3LA 1OXBB 1NE2A 3SFZA 1NXQA 4PLFA 3SU8A 4B4WA 3BGWA 1Q7EA 2GMWA 3WHIA 3AF3A 5U1PA 3BF7A 3IIJA 1N6KA 2WIJA 3QMPA 3P0RA 5KREA 1JG7A 1T36B 4N6GA 5DI3B 4K5QA 1EWQA 2GX6A 3ASZA 4ZOBA 2JAPA 3DOHA 5ALQA 3G2IA 1F2UB 4R05A 5BQXA 1YAJA 3F7NA 1K27A 4MGKR 2Q2QA 3DUWA 4JOBA 1EXMA 2JGEA 2WAAA 4LRSB 3VHQA 1DVRA 2YWBA 4B40A 1ENZA 2FSIA 4OGWA 5DTJA 4ALIA 1PZHA 5IT9A 3A4TA 1XQYA 1LS1A 4PBRA 1AGXA 4OJYA 2WIFA 4U7PB 4PLWA 2GM4A 1ZIXA 4NF2A 4P0PB 4JJGA 2KW5A 4D6PA 5I7OA 4JBYA 2CMKA 3MK31 3HN6A 2QVBA 1FC0A 1XXHE 3UKJA 2VHJA 3ZS9A 1BYUA 3CRMA 3KHUA 2Q3EA 1E92A 4EW3A 5KJFA 5KO2A 2OK8A 4DMMA 2CMGA 2QRZA 1HYEA 2VLBA 4JI4B 4RY0A 3ENQA 3WK8A 4TV8F 4KUGA 1UMKA 4DT1A 5NLLA 4RDIA 3W5HA 2C61A 4MR7A 3RVJA 2ZYGA 3CH5A 1KJ8A 4LN1A 4D0GA 5FWNA 3NAQA 2BMJA 2WB4A 2Q5JA 4G0OA 4NWIA 4JLVA 1GJRA 1TYCA 1DTWA 3N75A 4RPKA 4EP1A 1P1BA 5E6SA 1PGNA 1T4CA 2QI9F 3R7WB 4UBKA 1WZEA 3FRIA 4JJZA 3GJ3A 3Q9NA 3NOVA 4HK4A 1B15A 5K0ZA 1WZIA 5D85A 4EENA 4ZCRA 3ROFA 2QD5A 1A77A 3AMVA 1ZA1A 4TKMA 3G13A 1P77A 3ACBA 3F3SA 4FU0A 1ZJ4A 2HUPA 2QMOA 3TGPA 3DOOA 1QH9A 1FRVA 5T67A 2ZIVB 3LNTA 4BZZA 1GAWA 2WJJA 4NBWA 3J80A 3BCUA 4IIYA 2WD7A 2X1LA 2JIPA 2OGTA 1Y42X 1VXOA 3SSAA 3BD9A 4KIFA 1NW3A 4NPHA 5FV7A 2GPTA 1CZOA 1Q0UA 3AHFA 3KZ1E 3LLUA 3JVEA 4AT1A 1NVDA 1RLUA 2FSGA 3QKRA 4PR0A 5BSEA 1U0OC 4LV6A 2V6FA 3PJDA 1QS0B 4L85A 4U6SA 3RVLA 1E7QA 4KHZA 4UAUA 1A69A 4IQFA 1XWWA 3Q3VA 3D6MA 5LZ5A 1WABA 4PYKA 2QN8A 3E9RA 3OPYB 2XNDD 5FL3A 4C6TA 4JIMA 3PRHA 2GO1A 4JXJA 5JDIA 1NHWA 3NUGA 3PFHA 3QOXA 4Z2YA 5GOZA 4ZAYA 4QU5A 1MIHA 3CGGA 1PP4A 2QLFA 3KU4A 3PJEA 2QBYB 1P1IA 1QDUA 4AVYA 1DV2A 1KYQA 2PVCA 2BTEA 3FDIA 5JRJA 1IBRA 2E85A 3ZBTA 1G98A 1E18A 4HGZA 2F8LA 1BDJA 1UFOA 1UL1X 2H7VA 4ZOLA 1XVUA 2P9CA 3LNCA 2C7QA 4DV6B 2DMRA 4NZ9A 4CTNA 4MOWA 4EGQA 4B3MB 1DDOA 2C3YA 4GZ3A 4P7GA 5D8DA 5E6RA 1JT2A 4MDHA 3GQBA 4E51A 5K5EA 1NP3A 3HNRA 2QBYA 3ZWMA 3RKSA 1QGZA 1U2PA 3AEZA 5CPBA 3GHHA 2GOYA 1QK5A 1CIVA 5KI6A 4QZVA 4DR1B 1NW7A 1ODJA 4KXUA 1B7GO 1AXEA 1VHWA 1PKEA 4UHJA 1G8JA 4BQOA 4C5AA 4CM6A 1Z7GA 4B32A 4NZZA 3KKPA 3E5NA 2HF9A 4QODA 5J4YA 4A0QA 2C42A 4Q0MA 3S2EA 1I1NA 4ZC1A 3QJGA 4KB5A 2ETXA 3ET5A 4O4IA 3USCS 3VSAA 3RJ9A 1YRLA 1CY0A 3GV0A 5EZ5A 3UMVA 1X1TA 3JV7A 4XWGA 1P7WA 13PKA 1T3ZA 2HQOA 2RAUA 3A7DA 5FOWA 3STTA 1U9IC 4NJOA 4KIUA 1H6AA 1XT6A 1WQ3A 1S2NA 3J7TA 1Z3IX 2GDJA 4U4AA 2W2QA 3CX8A 4QOFA 5AH0A 4YQZA 4A2CA 4YHBA 5EXDA 2PKCA 1IC6A 3K30A 3VISA 3JS5A 2IPOA 2GHIA 4LQLA 3SFTA 5GIPE 2G1JA 2ZM6B 4UPDA 2YHIB 5CNIA 2CHEA 5LUBA 3C7DB 3EFEA 3LF1A 4GPZA 5HZHA 4IICA 3BWDD 3IL2A 4QXPA 5ICFA 3TG2A 1YS4A 5A71A 1EK6A 1RMYA 2VPQA 3DXFA 2R8EA 3COWA 2R00C 3OWHA 5BORA 1TCCA 3CN7A 1Z2PX 2V0CA 4RD1A 3VPCA 3BTUA 1Q5PA 3Q12A 2G17A 2XDWA 3PD7A 1UDCA 2I5PO 3AF5A 4HVAA 4JYZA 2XEDA 3IMCA 5LZ7A 8MHTA 3GDHA 1H23A 2BFEB 3PWKA 4G24A 4DSNA 1SUIA 3G8CA 2OPHA 2FW6A 3FMVA 2OBYA 1E3SA 4LJ6A 4OHRA 2C4KA 3RODA 4QJIA 1ZOSA 1AKQA 3T7AA 2B99A 3GLIE 2PL5A 2ZRMA 4GX1A 3LQFA 4HWTA 5HKOA 2UYYA 1U0BB 1NXXA 3DEHA 8ADHA 1Y1PA 1Z17A 1KP9A 1D2AA 2ZUVA 5FX2A 1CYDA 2VWGA 3KKNA 3H0EA 3SOPA 4OK6A 4KMMA 5KNBH 2G8NA 3EB9A 3EVBA 3G17A 2JD1A 4KUEA 5FBQB 4ZJPA 3CF4G 4M98A 2X6TA 2F7SA 4C08A 4JI2B 4EHFA 4RK5A 4CMGA 1RBMA 4BKMA 2ZRGA 3B3FA 4A9AA 3K4HA 3SVTA 1FUIA 4JT9A 4RTNA 1EX6A 3E5RA 2CUNA 3EGOA 3R0JA 3H5NA 1HE1C 1UM9B 3VJRA 3SMVA 1XPJA 1CEQA 2WHRA 3GQVA 1G2QA 1PYGA 2XTMA 3QXGA 4K7JA 2VXBA 3U7HB 1TAGA 1EEHA 1E3LA 3GA7A 3E23A 2VZLA 3KQUA 3QV1A 1QYCA 4ZQBA 4BVKA 1TE2A 2DE0X 4CMEA 2IXFA 3GJ6A 4HRYA 5ESDA 1REQB 1U6IA 2R4QA 2YIVX 2ZIFA 4AZTA 1QE3A 3NXKA 3PGVA 3S1LA 3WZLA 1CUJA 1E7SA 4HDNB 3USES 3VYVA 3MBOA 4YT2A 3BD8A 4RLQA 4XX1A 4BMSA 2ID9A 4CMKA 5EUCA 1SC6A 3KHKA 2FWNA 3QI2A 2B8JA 1KNQA 1A9QA 4R2KA 3FLEA 3SDZA 1V8BA 3KLBA 3W8NA 4OXYA 2P9YA 3GPLA 1C8LA 5HZKA 4CBVA 2FSPA 4B46A 2Z9CA 4GQIA 1H2XA 4R3WA 1QG2A 1BDBA 1NG1A 3W3AA 2VXCA 1DV1A 2WINI 1UDBA 4J0DA 1L4UA 2GETA 2PH3A 4OP2A 3FOCA 3PU6A 4YRQA 5C46F 3E9EA 1CP2A 2Q4RA 2PZEA 3IO5A 4A1OA 2UXDB 4EPXA 4LK2A 2BZ1A 1K7FB 1G2OA 2JGRA 4XE5A 3UJNA 3NIFB 2GK6A 1BE8A 3RR2A 4ESOA 4I3FA 2PDAA 4KL8S 4MHTA 2ZYAA 1B00A 1GPDG 1QGYA 3SF0A 1DWQA 1E7WA 3A3OA 4DE5A 3DE4X 4K9SA 1PZNA 3U2QA 4LX0A 4M1ZA 2WRZA 4IRXA 3C7TA 2HCTA 4POAA 1EH5A 1SBNE 2V4UA 4UUPA 5B4UA 4BC0A 3ABZA 2R8XA 4JL5A 2HJSA 4F45A 4IBOA 1W52X 4AB1A 5ECGC 1AMNA 3B6MA 4ZYWA 3PEVA 1I6KA 1GCAA 4GL2A 5ALEA 1NBAA 3MQ2A 1JSXA 4WFKA 1T6YA 1LLQA 5ABPA 3MAAC 5EJ4A 5HRAA 2AXNA 1QGAA 3MWDB 2XCRB 5DYTA 3D6AA 1IXSB 1T2NA 3DNFA 5AHOA 1SKUA 4LRTB 1E3EA 2IYAA 3ZCSA 1W5FA 1G3MA 3AKDA 4RETA 1QTIA 1USUA 1N0WA 1QOQB 4P93A 2SICE 2VPTA 3TPZA 4ECEA 4HLQB 3II6X 4M76B 2XAAA 4V0KA 4MV9A 2G1AA 1HFWA 1SBQA 2V5VA 3TRJA 4BNKA 3QMVA 1TMYA 1ISIA 1JR3E 3A2KA 1E3MA 3M9WA 4AKEA 4YBZA 3N2KA 1ZLXA 5LNK6 1W44A 4IJWA 2WWVD 1KFKB 1B6GA 2EFDB 2Q5LA 3AUXA 3U44B 1BXRB 1EDOA 1I36A 4XQ9A 4HCJA 4EI2A 2VHVA 1YBMA 1ESCA 3FMOB 4WA8A 4UM8B 2PZJA 2CXUA 3AHEA 1MZPA 1U2DC 1BD4A 1OI7A 4Y9UA 1Z0UA 1PK7A 3ANXA 3BMXA 3JQEA 4A92A 4W5HA 1IB0A 3PKZA 2QU8A 1JXAA 2VPYA 1OLXA 5AI5A 3L7AA 3ZWQA 2B6NA 1UR5A 2QLBA 3CVOA 1EUQA 1C1HA 1DG9A 2O2GA 1C4OA 1UWVA 2WVAA 2P9ZA 3HY4A 2FUNB 3IBYA 3NHRA 3WZ2A 4DIFA 1C7QA 1OCEA 1Z8FA 2CEAA 2FCAA 2NVBA 4L51A 1GTZA 3SMQA 1LH0A 1BFDA 3BL6A 5K8JB 1SWWA 3HKDB 3C8DA 4M0UA 4CZ2A 3K53A 4UEWA 1JHDA 1LPAB 3O4GA 2WNHA 2RE8A 3ZX4A 1BCSB 5FOTA 4DAEA 4L5AA 5K6RA 3QSYA 1L8AA 1NOJA 1ZUNB 2J9XB 3BK7A 1P5HA 2RKBA 4QUKA 2NUTA 3SAJA 3T99A 4IOLA 3ZOKA 2XYVA 2JGDB 3EE6A 2JHCA 3RROA 4BO8A 2WJ6A 3GBPA 4RK7A 5KWJA 1IG3A 1USGA 1X7GA 2A9QA 2QD2A 3KEQA 4QJ5A 2G04A 4LFBB 1FFXA 2P7IA 4RMIA 3LPMA 4C05A 5K8LA 1UPXA 1JIQA 2IW3A 1GZDA 4PBSA 4HWOA 4Q9DA 3EK2A 4YDQA 4P4SB 5AHXA 2QRVB 3DWEX 3FYUC 3SC6A 3D4NA 1Y0BA 3MUOA 2H5LA 4P1ZA 2F2TA 4WECA 3W5VA 2QZJA 2IHKA 3SQWA 1JR2A 1ZIOA 4N4AA 1GARA 1MCZA 3OIGA 5L3QA 4JR1A 2CMHA 1CG6A 1XKQA 4FFVA 3DE2X 1XWFA 4LWZA 3KDPA 1OC2A 4HUQB 2B5WA 4DLZA 4GGOA 2X4DA 3CSDA 5DIZA 5KTKA 2R6FA 3ZY4A 1BHJA 3EFBA 3GGGA 4PFQA 4YASA 2OE2A 1Q20A 2E89A 1JBQA 4EMUA 2EERA 3WI7A 1Z5OA 5DMHA 2I2WA 4QL3A 3CUTA 2JZOA 3EWIA 3ISTA 1SVKA 3VU8A 1AN0A 3BWMA 3O82A 4US1R 2PKQP 3B5IA 1LNSA 3GK3A 1XDSA 2XB4A 4RH0A 5D5QA 1I2ZA 5JBQA 4PNPA 2XKKA 5B1IA 1I6MA 1PL0A 2UZ3A 5BN5A 1LUAA 1BS1A 1OE0A 2FCRA 3ED1A 4HVTA 5E9JA 3U0BA 1IQRA 4RF4A 2FZEA 4B33A 4R5HA 1Z2NX 2GVNA 3NVKI 2ZANA 3BZWA 3H2SA 2R47A 2XTJA 3B9BA 2R7KA 2FUG6 5BWOA 1EIZA 4BNZA 3TKYA 3TTTA 1S8NA 3G1WA 2Y3IA 1E1LA 1IEVA 1NF9A 3LHDA 2WAOA 1FOEB 3HYRA 3RIHA 4PIVA 3S4YA 1K8YB 4I14A 3ZGYA 5IKEA 4BV9A 5JZVA 4OQPA 1TZJA 3WRXA 3OJCA 4AG3A 1L3CA 4A15A 4YJFA 2M32A 1DHTA 2GPAA 1RM0A 3ABRB 3VOTA 1E3WA 1J5PA 1C0KA 1YS9A 3G85A 3WV4A 2Q46A 3WA7A 3STUA 4B9AA 1Z83A 3HACA 4RS3A 4UNRA 3RS7A 5A4AA 2IBMA 1ESEA 3LOUA 1H8ED 2NVOA 2IIBA 4LVUA 3JWEA 1LB1B 3H4IA 1R0ZA 4P3NA 2A1UB 3RLIA 1P5ZB 2PT6A 2BRUC 4M1KA 1YR6A 4EARA 4S05A 4TS4A 2CDAA 3EY9A 1ST2A 1RBZA 4QYXA 5GONF 4FCVA 5JSYA 1MHPA 3ZD9A 4DPKA 1X7ZB 1LY1A 4JXZA 2BY4A 3AR3A 3I6MA 3PQCA 1DPGA 4WACA 2CLDX 4X84A 4OSOA 5F77A 4DCCA 3H4VA 5DGHA 2XCSB 5JSUA 3MCWA 4XVRA 3JAMA 4H1VA 3PBKA 1NR1A 3VO8A 5E9WA 2FSVA 1RPTA 4QGGA 3SE0A 2N0SA 1M1YA 1YZQA 2VDQB 1ZCAA 2DWQA 4ZZ2A 3V7WA 4A8PA 5C7YA 1B23P 5FOVA 1ZOPA 4WK0B 2WICA 4I3HA 1IM2A 4OYRA 3N7TA 3OOEA 4JOSA 4KOAA 4LYJA 4UVHA 3RREA 3TMAA 4I1PA 2R3SA 5EIBD 2XIQA 2CVHA 1S3IA 2QGNA 2VPXA 2W83A 2KI5A 1SUPA 3H11A 1JQAA 5CEFA 4B3GA 3S2ZA 4DCNA 4E5YA 2V59A 3LCCA 4HAYA 2B25A 4TYWA 2HMVA 2HSZA 4O2AF 2JLZA 1KJWA 2XB2A 1A5TA 2VYFA 3REQB 3S8EA 1K9SA 5K0NA 1ZOIA 2QTMA 2HN9A 4LBWA 1ULSA 4L2IB 4CCYB 4IV0A 5DHFA 5AUOB 2C8KA 2J3HA 2HK8A 4ERNA 2R25B 4UOQA 4URWR 1IHPA 2GTIA 2YFKA 3OG9A 2ZJ0A 4V3BA 1JLLA 3QBJA 5KHLB 3C6QA 4UU1A 3NIDB 4JBWA 1BOFA 3CIOA 3I92A 4YRJA 1T5IA 1UBEA 5AK3A 5HRCA 3NANA 3DHNA 4K8OA 5TVKA 3SJBA 5KC9A 2JLRA 2WFMA 1H9CA 1RXVA 3A6FA 5G1NA 3T06B 2XMSA 1V4VA 4C1NA 3T7DA 5AJZA 1HA3A 4JLBA 1COZA 1BA3A 1T1SA 1R6TA 3EEFA 2FY8A 4UM7A 3HJCA 5A4JA 1CWUA 4JXKA 2R5NA 2IRWA 4YJ2A 2J3IA 3B38A 4DARA 2BEWB 1V1RA 1KNXA 3M2TA 3EMBA 2DU8A 3MXTA 4OV6B 4TL7A 4C14A 3AHCA 2X8JB 2B0JA 2PFGA 3PHCA 3L8YA 4TS3A 3P0IA 4H18A 2FEAA 1SVMA 5FFNA 4LX8A 4W4TA 5KHAA 3VJLA 5K0FA 4KPUB 2ZPAA 1RCUA 1P61B 4DCUA 1L7OA 1OFHA 2Y92A 4C78A 3MLEA 4BNXA 1RXSA 1ZA2A 2Q9CA 2HADA 3R0VA 2C3MA 3QXSA 4ZWNA 2RHBA 4BLSA 3K94A 2ZUBA 5CB8A 1I14A 3AV3A 3ORSA 4IUCS 3WOVA 4F8EA 4K2AA 4C22A 5GINE 5EHNA 2PRSA 2JDID 3ZX5A 1XMOB 4PLPA 3WJ7A 4ZCQA 1O97D 3TEJA 1M1NB 4WLEA 1NXTA 3K5IA 5IAKA 2BEKA 4N5HX 3WLJA 4B0PA 4FZRA 3B1FA 3S1AB 4FDAA 5YASA 1O96B 4O3MA 4GZ6A 4TT3D 4HPWA 1PJSA 1E32A 5HEKA 4WZZA 5DXFA 5AWFC 3KV1A 5C0OE 4N03A 2O2XA 4FT4A 3FMPB 4CG2A 3DYBA 4EGCB 2BR5A 1YACA 2WKWA 4LI3X 4B6FA 3K0BA 2FPPA 2JH3A 3DR5A 1KZYC 4XI9A 1QQ6A 3PD1A 3DE0X 3VR5A 3ZE8A 2W6MA 2BWJA 1AQIA 1TUIA 3AZPA 1RNLA 2I34A 2D3TA 1U0JA 2NW6A 2YBEA 4Y0VA 4BCDA 4DLVA 5BV8A 5J58A 1OBVA 1M72A 3AG6A 1N8SA 3QPUA 4J90A 4BGDA 2IS6A 2BTQB 3A2MA 1DQZA 4C7BA 1MX5A 3D0OA 4WOPA 2G9VA 5FBWB 3SEFA 3L82B 3NHUA 2ZRPA 5E7MA 1PFWA 4PGAA 2O1XA 3C41J 2XHEA 3DONA 5THXA 4PTYA 4QLBA 2O19A 2D0OB 4HBZA 2FW8A 5IDQA 1J2JA 4EYOA 2AVNA 1U7TA 1IM5A 1BH6A 1VLVA 4OK5A 4R8RA 3ZHOA 1JUDA 2P2CA 4R16A 1U1IA 1WEKA 4TV9B 3OIFA 5I8ZA 1QMPA 2H85A 2VHWA 1U5BA 3BFKA 3FYHA 3WL3A 4I4TA 1Y8RB 4BRZA 2DQ4A 3W0LB 2NSLA 2FMKA 2FEMA 1GZHB 3PGXA 2WA2A 3KALA 5IARA 3T3PB 2R87A 1NLZA 2YJGA 3PT5A 4OHPA 4PZEA 3RK1A 2P9HA 1V3TA 3UW1A 5KPDA 2IHYA 2VT3A 3DLIA 1E6MA 2G25A 2E4UA 2LGJA 4F3RA 1DO2A 3WIVA 1LBSA 4FJ0A 2WQ7A 2ZRHA 1HDOA 3PV0A 5CVEA 2AEMA 3UW3A 4QLAA 4H3VA 3B9RA 3DA8A 4GR4A 3V1UA 3IHTA 3VC3A 3DAPA 3GZTB 3GCZA 5HBRA 3A4VA 2A9FA 5GWXA 2Q8NA 4M0PA 4DREA 3IAM1 4D3ZA 1G21E 3OTIA 3OUUA 2ZCJA 4FQ7A 1NDHA 1AKYA 1ECCA 1Z39A 4ZEOA 2CD9A 4X41A 4N6NA 1KR2A 4DLRA 3L84A 3FZEA 2VEOA 4UU7A 1UCFA 3E8XA 3CF0A 4FBLA 4U7TB 5ALZA 2VK4A 5BXQC 5DYGA 2JGIA 3ZIUA 4B3TB 1YHNA 2AXEA 1DRWA 3CA8A 4JB2A 3I61A 3JWHA 1DTEA 3VYUB 4I9NA 3OJFA 1IVSA 2PANA 5TY0A 3U3DA 1SU7A 3TVYA 4E5PA 5G41A 1ZD2P 2I7XA 2MSDB 3U1VA 3C16C 4Y9DA 3I37X 3JYQA 2PYIA 4QWMA 5EFZA 3R6WA 1YGPA 5AK6A 2AJDA 2CFRA 4JT2A 3VR5D 4YC7A 3I2KA 3I5MA 1H6CA 3MWJA 3PNQA 3IJRA 4A26A 4BQQA 3AERB 1I10A 3GFQA 5JCOC 3CN9A 3ICVA 2A7XA 5KOYA 3ETNA 1IVYA 4YCMA 5F2EA 1MC8A 1Z29A 1JFVA 2Q7XA 3RS8A 1EDEA 4REQA 1GIAA 3ZWNA 1KQPA 5BP7A 1V11B 1NZDA 4B48A 2Q1UA 3WX0A 1KI8A 4IZHA 5BSHA 3NALA 5EPUA 1VIVA 2H9IA 3H9GA 1GA1A 4ZAZA 1X94A 3AILA 4R01A 4QUAA 3OPNA 2AG8A 1OT3A 1RIIA 3HA5A 4JCOA 4B47A 5CPFA 3U4IA 4PANA 3GLFE 3ZBUA 3AHJA 4D79A 4OATA 1RHQA 5DLQC 4CM1A 4ZCTA 4CEJA 4H1TA 1TGYA 1LSSA 2PV0A 2D5LA 1KSHA 1E5LA 4NPAA 1YZTA 2ZTSA 2BFFA 5K6TA 1BVYF 2O0KA 3OQHA 2JW5A 3FYCA 3VZQA 2OHOA 1ZSYA 1FFGA 1KH1A 1UK7A 5JNLA 3DZJA 3H5AA 3MCVA 2FN8A 1VZ2A 1L7PA 1SQSA 3QEOA 1LXCA 1EBBA 3C7AA 3EVFA 4KODA 2FSUA 2GEUA 2UDPA 2IDZA 3N58A 3RRXA 3QM1A 4FFNA 2O1EA 4PXAA 2ZBGA 3ZHUA 1B16A 2DAPA 1VIAA 4P7FA 3KQSA 2ID8A 3EC1A 3SN6A 4RPGA 4XB2A 4ZT2A 1ML3A 1P19A 4AW9A 2C5GA 1MNAA 5TPZA 2NU8A 3GPDG 3WHPA 3HUUA 1MG0A 4L0DA 4DWVA 1G8GA 2CDNA 1WRBA 2DQYA 4E31A 9GPBA 3A37A 4A1FA 3MRSA 4YIKA 1NPDA 3DDHA 3VM6A 2K4MA 1ZUD1 3D2CA 5EEGA 1HPLA 2WWFA 3HU3A 4S1TA 2IKSA 3EBLA 3W77A 5IAOA 1DEXA 1GQYA 1Z2OX 1HYQA 3MXOA 4BP3A 2P90A 2QV7A 2PUDA 4AWBA 1M1YB 1NV9A 2BLLA 4GSYA 3BGOS 3LVBA 4YMWA 1E69A 6REQA 5A9SB 1TQDA 4XPIB 3JY6A 1RZVA 4HQRA 2AQHA 5JAZA 1NN5A 1RC8A 2IUSA 2I4TA 1XMPA 1EP1B 2C7VA 3AR5A 4CN8A 1UDXA 4Y2VA 3FHTA 4ZFNA 3R3HA 2HSWA 1IJEA 2BM0A 1VI2A 4Q82A 2VKQA 1O77A 4OP3A 4EF5A 2UYGA 4M8KA 4DIEA 1ULTA 1KYVA 5I8PA 1C7IA 3OZTA 1CDOA 4XGNA 5A9SA 4OI0A 2W43A 1X1SA 1OAOA 1VTKA 2FWBA 1P6XA 4XGRA 3HVIA 3EPHA 3G2PA 2OCPA 2PPVA 4DDKA 2QM3A 1SU8A 2JKZA 3IELA 1OTXA 4JX8A 3JQAB 4EHDA 2PTHA 1JYEA 3A2LA 4IIJB 3KKOA 2C04A 1WKCA 3CF4A 4HZIA 5IC6A 5JAOA 1L5ZA 2P78A 2R8RA 4FDTA 2B7CA 2OD7A 2YFHA 3CZQA 4MGIR 4ZVPA 1QFZA 2HLNA 5ESWA 3S7TA 4GXTA 1FNDA 1D0SA 5K8IA 2CW5A 4HVLA 1QVRA 1DFGA 1TEXA 5P8WA 4RNDB 2A5FA 4GG1A 4MZXA 5A6SA 3K71B 2BP7A 3CKKA 3EUAA 2VK2A 3K0FB 4QUEA 3UMBA 2ORIA 2EJWA 2PRJA 3K2IA 3ZV7A 2P67A 2ZRNA 4G1CA 3NS7A 5JYCA 1HE5A 2B4YA 2PSSA 4BMVA 4C88A 2IY9A 3Q2IA 3SBOA 1J2UA 4JAVC 1MABB 2REBA 3KKMA 3N28A 3I5AA 2RB5A 2ZWMA 3DKVA 1BJTA 2FMHA 2OQVA 2C2KA 2PUAA 1T1IA 1IJKA 2V6MA 1OV4A 1W76A 2BFDB 2OEPA 3BYZA 4YQYA 3RKRA 2C4WA 1Y8RA 1GV1A 1XTJA 4OU4A 4RJ2A 4PR3A 3TVDA 2ZKIA 4RHUA 2R6CA 1GRVA 4MVJM 2I1WA 4R8MA 4BNHA 1GYRA 5TJHA 2RHOA 3PA6A 3T94A 1L4MA 1T2DA 5I7RA 5IU6A 2HEIA 5AKJA 5T6BA 1MFPA 5BR7A 1IQ0A 1I2BA 3PC7A 5AHKA 3N6VA 1U7ZA 3NGXA 2WE7A 4PRLA 3TH5A 5BVHA 2WSLA 4CIWA 1OXKB 1EA5A 1EVIA 1L8LA 1SCQA 4AY5A 2IZ5A 1ZVKA 4DNXA 1KYXA 1T3LA 1F06A 2PU5A 2ZB3A 3PNLA 4YRNA 3IQHX 2GYWA 3S1AA 4Q93A 4G01B 5CHYA 4KVGA 4PG7A 4I1YA 3I5YA 5A02A 4FSXA 3Q7IA 1CIPA 1CHNA 5GOTA 5EJ5A 2XAUA 2D1SA 1MEJA 3BHJA 4QEKA 1KDRA 2RHLA 3DMNA 3D64A 1YB1A 1G9XA 1PEYA 1BDHA 1BGWA 1X8JA 2I8CA 2GPBA 4KR2A 1P2DA 1SBCA 1MW9X 1XEWX 2JFXA 2NAPA 1NBOA 2SKCA 3DVRX 4PGHA 4UHCA 1I5RA 4M22A 5T7BA 1NW4A 4I8DA 4Y6GB 2PA3A 4RVHA 1PQPA 3D2LA 4EYSA 4KO1S 1T0IA 1V4NA 5AUPB 1V8ZA 2C3OA 1BFUA 2C5AA 3ZD8A 1Z7EA 4BO9A 4Q3EA 4EK9A 5IBQA 1DIGA 3DCJA 4YCBA 2PKWA 2X86A 4BV8A 1G18A 5FNVA 1CUDA 3UWKA 1NF8A 4DBVO 4HT3B 2NP7A 1I2AA 2OAP1 4RHEA 4X92A 4TX1A 3UY4A 4FFBA 1YBAA 4LDJA 1W5AA 4D8XA 2J5KA 1N2BA 3WTBA 1W0JA 1VLLA 2E4VA 2WAMA 3ESXA 2DBVO 3N2KB 4LJ9A 3IAHA 3SSOA 3HVJA 3DE5X 4Q4AA 3UJ3X 3QFRA 1U1FA 4LRQA 5SV2A 1UFRA 3HMQA 1V7QA 2SKEA 5JNVA 3EJWA 4US2R 3BIJA 1JDVA 3DVAB 3G79A 2Q41A 1Z5ZA 4TV9A 4DCOA 5HOEA 3OFNA 3RIEA 3V48A 2OENG 3HU1A 5TQ2A 5FWXA 3A4LA 3WQBA 1Z73A 3AL0C 4YFVA 5E6UA 1IEWA 1P7YA 1Y1SA 1TM1E 1WPRA 3D7NA 4TLDA 3DV0B 4DMLA 4UOZA 4TLAA 3Q72A 4JYPA 3VO9A 5HCIA 1ZJZA 2GPSA 4GP6A 2HQSA 2POCA 2ZB7A 1FDRA 4RQAA 3DVAA 5T4BA 3B1ZA 5D3ZA 4ENRA 3LXRA 5AOCA 1A82A 1ZGCA 5EOVA 3WNDA 4GWLA 2FEOA 1E0SA 1OJ7A 1M2VA 1RPNA 1XRLA 1K9VF 2V1XA 4NMHA 4LF5B 2PUGA 5F98A 4RJJA 3EQ8A 4NYJQ 3JQBA 3PC4A 4KQCA 2HZBA 4G5SA 3ZU4A 1ELOA 2H29A 4UPVA 1WEHA 1XD2A 3BG5A 4NAUA 4YQEA 5IKMA 3QA9A 4ZXFA 1YC5A 1KO8A 1T9CA 2REQA 5D3QA 3GL9A 1LVGA 3RTEA 3LQ2A 1L4NA 3OQOA 1PHPA 3HI6A 4TQGA 4YCDA 3FCYA 3G1TA 2BELA 3SR0A 2EZ8A 4Q4CA 2C88A 4EVQA 1J49A 1FMLA 4DZTA 6AT1A 4QO7A 4L4RA 1VPLA 1I4WA 3RRMA 3LUPA 2NG1A 3DP9A 1XLVA 3KUXA 4TV9F 1WP9A 4HB3A 1EXVA 5HF8A 1NVGA 1VHQA 1C2YA 2I67A 1P3Y1 3Q3CA 1JHVA 3AJDA 3IEMA 1C81A 3BMQB 1W87A 2GRJA 3OMXA 1NQVA 3SYNA 5I7FA 2XWPA 4FLEA 1BDMA 1JR6A 4RAOA 1UAAA 2ODAA 1G3IA 4IKOA 2GK3A 2N46A 3CLTD 3WMXA 4TKZA 4D8UA 3OCWA 5T5QA 3ZDXB 4QAJA 4IIJF 3MS2A 3TLBA 4E5KA 3OPMA 4IQ8A 5DBIA 3LCRA 1VOTA 3JRNA 4E11A 1T9AA 5AW8A 3E18A 1E96A 4RE5A 3WWOA 4Z9BA 5CAEA 4TRMA 4MKHA 1VL8A 2L82A 4A03A 2PYZA 4WLFA 1T1RA 4NY1A 1GPMA 1E6WA 4KSCA 2JLXA 4FMBB 4XSHA 1U02A 4L9SA 3AGPA 2RIPA 2XNCA 3GROA 1COWD 2ZJ3A 3HGMA 3LM8A 1S8FA 1XJ0A 2B9VA 3QW4B 3FPBA 2WUFA 1C0LA 1O6ZA 2CJFA 3TTUA 2W2LA 3TPFA 3G0DA 2GJSA 4JLAA 4H15A 2G0TA 3FNQA 5LYJB 1ZL2A 5FA8A 4AZWA 4DA8A 4KAAA 5JISA 2XVYA 3QKSB 1XZQA 2WSYB 3TMKA 1YQGA 2CNNA 3ZTYA 4EPVA 4L8FA 4UAGA 4Q7MB 3PTZA 5IJ9A 4BO3A 2FFQA 4BCCA 4ZTUB 5CCEA 3ITKA 4HLCA 5C80A 3I2YX 3HCEA 3IXLA 3KLPX 5KU7A 5A4DA 3DZCA 4G36A 1U2DA 2IYYA 5JQGB 1JR4A 3ICQB 1WKBA 3KQVA 4RTJA 3UUGA 2GN8A 3KT6A 5LA6B 3UCFA 3TSAA 5FULA 3TJMA 2I80A 3KLNA 3HV0A 4Q66C 2GEVA 1Z4OA 5F1PA 3DG9A 4MQEB 2ZRJA 1T25A 1ISFA 1T9ZA 2AHOA 1OYOA 1PL8A 3DFKA 4S1NA 3UKDA 2YMLA 4TZKA 5CLIA 1CJVC 3U60B 4C5BA 1PJ2A 3LQ4A 1MQAA 5JS2A 5IJXA 3UWSA 4ZICA 4EO7A 1VGQA 1BIFA 3B6IA 3DMHA 4X1KB 3CY6A 5LFAA 2ZRFA 4R69A 4UTXA 3HJTA 3SC4A 1W85B 3HCBA 3BAZA 4FEGA 4DA6A 3KR2A 1L9KA 1E7MA 3DB1A 1T3SA 4MX8A 3CRVA 5JJIA 1KRXA 4HNGA 5CLJA 2GWHA 2ZR8A 2JGMA 4JL6A 4PG5A 5DKFA 3PKJA 3C85A 4MPJA 4U9IS 2VPWA 4XPIA 5FBLB 1KH2A 1E3DA 3ZIDA 3NHYA 4RTLA 3HBNA 2WWGA 1LDNA 1Q0RA 3IP1A 3EPRA 4TT8A 1P1HA 4ZXPA 4B73A 5I9TA 1P4AA 2ZIXB 2FYTA 2IY8A 5I7WA 1U8ZA 3VC2A 3W9YA 1N9GA 3HN7A 1IHDA 5FNZA 3R3ZA 1UP7A 5LBTA 4O4HB 4QOIA 4WXHA 2FMFA 4DIBA 1S2MA 4JP2A 1XXLA 1R9NA 1Y4SA 2OVBA 4J0KA 4V38A 2XH8A 3RHFA 2SCUA 3CLUC 1ZINA 1SCUA 1I3MA 2XWSA 3DBHB 7REQB 2HREA 1CU1A 1I4EB 2Y4OA 4KTVE 4Z0PA 4L8YA 3DEYX 3UGTA 1GUBA 3K9CA 1HL3A 1OXXK 1T3GA 2HWYA 2Q9UA 5B7PA 3BKWA 4YR7A 1BAPA 5A1TA 1E2JA 1B8OA 1VXRA 1NQ5A 1ZUHA 2X5OA 4LJ7A 3F3YA 3PT9A 4JGGA 3S2UA 4CM4B 1AZLA 2WTBA 1VMKA 4FE7A 2AOVA 3MELA 3PGLA 4BEWA 2W4MA 4KQXA 1U80A 3URMA 4FYXA 1AS0A 1ZVQA 3KQMA 1D2EA 1LZLA 1Y6GA 4JLKA 3PDUA 3WO1A 1PNQA 3SQMA 2IOFK 4JQOA 3FTPA 3PEYA 3BM5A 3Q7RA 4BO2A 4ZVQA 5CITA 2Z2XA 4P98A 5EWJA 5BMOA 3VYTB 2ZVJA 1ZAYA 1HOXA 2OC9A 2P2LA 4AO7A 4UXJA 1YT5A 2QV0A 1K97A 2DSTA 1YS7A 1UC8A 4YA6A 4D43A 1FW6A 3AG5A 4R8KA 3LQQA 3LKBA 1WXIA 3UMSA 2C2ZA 2XQJA 1M7GA 1F3LA 2Q1YA 2XNSA 1QQBA 2QVYX 4W7HA 3S3TA 1VPDA 4AJJA 4G0QA 3A32A 4AYTA 1G0NA 2CLMB 4JQCA 5FRDA 3IUYA 2H08A 1MT3A 1I7DA 3NHWA 2HHJA 1N2ZA 2QRPA 3BFPA 3D6VA 4G1FA 1BFKA 1RD4A 2VBFA 4IG9A 1QIFA 3BIWA 2NZYA 1IHUA 1MGOA 4RM2A 2SBTA 3N86A 4BJ1A 1E2KA 1DXYA 4CMCA 4KR7A 4F0JA 1GEEA 1QRAA 3LX8A 4CJXA 3THYA 4GDFA 2VPZA 3FHJA 3LC0A 4MJXA 3CNOA 5LZ4A 2HSGA 3MJFA 4DEXA 5HBGA 3V42A 3ZIAA 5KYGA 4GPTA 1XZEA 3U0VA 4MV5A 4ZC8A 3VR3A 3CPEA 1I80A 4NOKA 3TQQA 5JLJA 2C2BA 4JOQA 1DSSG 3QP9A 1PSDA 2XRFA 4QM6A 3BJIC 4UTNA 3M1IA 2ORVA 1ZZEA 4NVRA 2Q3BA 1E60A 4KI7A 1D6SA 1T9BA 2R2GA 3HHPA 2FEXA 2YW2A 1GDDA 2XE4A 3HVRA 4CL2A 4NH0A 1ZGGA 5A62A 2QP4A 2ZR9A 3T35A 4FIDA 1OA0A 2WM9B 1WXFA 4MS1B 1N6OA 2G1PA 3FYUB 2PUTA 4BLPA 1RYDA 1EFPA 2XWJI 2X77A 4DM7A 2UV8A 3HFRA 5GVSA 5FLEX 1BXZA 3DCNA 1NIJA 2PRZA 3RTDA 5IH7A 3WA6A 2FPPB 2G3YA 4M8LA 2V6IA 4S1OA 1H4VB 5JNTA 1THMA 1YJBA 2GDZA 1N2CE 4KYTA 4U63A 4CMHA 4DS3A 1CR4A 4IIGA 1UMBA 2WMDA 4OA8A 1WUHS 5CX4A 3FFTA 3O7WA 4EA9A 1TKCA 5LMCA 3WL4A 2MR6A 3KR1A 1O08A 5AOBA 2WWRA 2WILA 3UO8B 1XGKA 1P73A 4RQBA 4C0HA 3AY3A 2YJ4A 1MJNA 4KITB 3I3SR 1OILA 5H7XA 3CPHA 3SHTA 3PSAA 2HHAA 2RAVA 2BUAA 5I6DA 1UZLA 1M0TA 2GHQA 3QJ5A 4PXSA 4NICA 5EEHA 1QR6A 4FHFA 5JNSA 2H4FA 2BHLA 3FOAA 3ZWOA 1A9SA 2Y1FA 3FYDA 4LKRA 4MUNA 4ZCLA 4LF9B 2KLBA 2WMOB 3ZDDA 1PZFA 4K9QA 4PX9A 4DA7A 5I7HA 1G7RA 2RGXA 2PGAA 3VNBA 4QJ3A 4BQNA 4D9BA 4CQMA 2BPOA 3BORA 2JLAA 1VYTA 1U0TA 3DDSA 4RIFA 1KDYA 4XZ3A 4KQIA 1IZYA 2VT7A 4GIBA 3CFYA 2PWZA 3PDHA 4AY4A 3O1LA 1MU0A 3O7MA 4JFAA 4Q5IA 4IHAA 1UPUA 3SHVA 1SXJE 2FOXA 4U39A 1H6BA 3B2NA 4JYCA 5IP5A 3ACDA 4MJ7A 1X0XA 5KVCA 5FT9A 2DR2A 4H7PA 5T3UA 4ZI7A 4GI7A 4MS4B 4KXLA 1VG9B 4RV4A 4RIGA 2Z2IA 1KSJA 2KS6A 4U2CA 3B1WA 3CCBA 5CGQB 3FWZA 3T5MA 2FSFA 8ATCA 1TVCA 4M83A 3EVZA 5EWMB 1PTJA 4LXXA 2YL2A 5LC1A 3U62A 4I4TF 1SHLA 3HKCB 1XTZA 2Y05A 5TVGA 3OP4A 4OO3A 5FORA 5HK9A 1LQUA 3U56A 4DLUA 4KAXA 1U11A 1WD7A 4OYLA 4DLBA 3U4MA 1R74A 1AKUA 1R10A 4MMYB 4AKSA 3MBIA 5B12A 4Q1VA 2HJRA 4OIFA 2L42A 4KQJA 3CVYA 2FZCA 2E55A 3HP7A 5A9TA 3RJ5A 1FP4B 3VR6H 5EWMA 2PZGA 1RKUA 2Z3ZA 4JR0A 2PMFA 3NTOA 4Y2PA 4G65A 2QN2A 3PA8A 4J8PA 1IPFA 1N3YA 2BFMA 2BH9A 3L0OA 2AN4A 3KZOA 4RF5A 3TLZA 3TLMA 2HPAA 3TK1A 4LOIA 4DNPA 4GMXA 4FS3A 1TZKA 1WBJB 1YB6A 2H07A 2Y1CA 3DULA 1RSZA 2WDPA 4YCJA 5B7NA 1MAVA 2R6HA 1ZCJA 2HLDD 4WAUA 5IEJA 5IZCA 3OEWA 5DMXA 2WWXA 1I6LA 3THRA 1QRRA 2R6AA 2A5DA 7REQA 4TMKA 3UFBA 2B9EA 2O3SA 4Q9AA 4QSMA 3OOYA 1N4AA 3L6OO 2AFIB 2GEJA 2UU9B 1PLJA 1JXMA 4ND3A 1KZ9A 3LJKA 4WUTA 4B2LA 1RZRD 3GJYA 4CUZA 2HPZA 3GT7A 4BJ6A 3CZMA 2VAWA 4Q05A 2O5EA 1E2QA 3IRVA 3JALB 3LPNA 1WY7A 3DBVO 1FS4A 4FYVA 4IMIB 3T52A 3CWQA 3A10A 4M3NA 1ULZA 1SPBS 2GF9A 4KXVA 5IF9A 3PLAE 3IE0A 1HNXB 1JDJA 1U3DA 4M7PA 3IHKA 2QI9C 2YC4C 5K4GA 1T8PA 2FPMA 3VDRA 3AQIA 5D3KA 1MOQA 4KP7A 1QHSA 2Y6UA 3TBHA 1BTOA 5IC4A 3LY9A 1P44A 5JXGA 2H63A 1TX4B 3FJYA 2DXIA 4FKZA 4KKVA 3Q8MA 2LKCA 5CDHA 1ZW6A 4GE3A 5EIXA 2J31A 2WHPB 3JWJA 4ZO4A 1HT1E 3S7ZA 1S3SA 3ZCRA 2ZI4A 5ALRA 1QAQA 4IOMA 3GN2A 1Q11A 1V9CA 2Y1WA 2X5NA 4W5JA 4D3YA 3QITA 2Z2KA 3K5HA 4EIWA 1K92A 3UMJA 3PFNA 4QOGA 1HK7A 5L40A 4ONEA 2JVIA 2YWXA 2VAPA 1Z35A 2Z4RA 5ENZA 5FFMA 2JFQA 3WNCA 4HL6A 2ZJ5A 4FWIB 3LVQE 1LTQA 4G8CA 1JZSA 2J33A 2YVKA 1U7WA 1NUHA 2J09A 2NYRA 2FRVA 1LVHA 4O1MA 3ZLTA 1N5JA 1N6PA 4NZPA 9LDTA 1F1BA 1PD1A 1TYDE 3F5MA 1QYWA 3LYAA 1CRZA 1NL3A 4KN5A 4Q9HA 5C5DA 4KFSA 2C4VA 3OU7A 4INPA 4WCVA 1RXCA 2QT9A 5C1PA 3EPLA 2XE6A 2FTKE 4LHXA 3TXYA 1E4VA 5F4BA 4J4TA 3OLXA 4NJEB 3OE7A 1UKVY 2PYDA 2ZBEA 4PO9A 1XWIA 1UBTS 3QU4A 3WYNA 2BSQA 3T7SA 4TL9A 1IG0A 1NI3A 3OOSA 4A6DA 5ARBA 1N34B 3R6LA 5LWHA 2XLCA 1P3DA 4QXRA 3ZBQA 3PRYA 4F1KA 1VRWA 3DC2A 5K3AA 3IC5A 1QO9A 3WGZA 5CMLA 2PZBA 1M0SA 2I6TA 1RHMA 1WB9A 5CEEA 5IMSA 2AQKA 2PN1A 4GMKA 4B6GA 4FYKA 4QVKA 3QELA 5IT4A 1C7RA 1CCWA 1XZCA 3D31A 1HUQA 1SOWA 3ZCVA 2RHGB 4BFSA 3EW9A 4LC1A 4P7KA 2ONKA 3DUFA 1B14A 2CZQA 3W06A 4DG8A 1GG9A 3HM2A 1OR8A 3PQ3A 4C3ZA 3WWEA 4O4LA 2ZIUB 2BBSA 4LIPD 2ECKA 5FTWA 4OG2A 1K4KA 2PO5A 3FPCA 2FUCA 3QX9A 3JWIA 4D3FA 2WWYA 3W8DA 1Z0KA 4E2XA 4BRWA 3HWX1 3IJEB 2IIPA 2VUIB 2FW9A 3K9WA 4MGYR 2OY0A 1Q0LA 1XEXA 3EZYA 5H5JA 4PBTA 5LSAA 1QU2A 3KSZO 3RF7A 1JZQA 5F1OA 3THSA 1FEZA 5JPCA 1NSYA 4KQ6A 2FGJA 3AWIA 1UBNA 3C3BA 1HORA 4M54A 3EEBA 4RXMA 4JJ6A 2ZYSA 4DSTA 3IKTA 1XNHA 3H3XA 1H8EA 2OM2A 4DVJA 4EJFA 3U40A 2WHPA 2V96A 2WPNA 2GCEA 3LDUA 2Z3WA 2FW7A 4DIKA 1LBIA 3VYWA 5FBVB 1GKYA 3LQKA 1KK3A 2QK4A 3CB4A 3ONFA 5TJ9A 1I32A 1U7OA 3MJCA 4Q3CA 1J0CA 2RGWA 3PE6A 4JQYA 3EYAA 1NVBA 1Z0SA 1FDWA 2AQ8A 3BICA 3RU3A 5AVUA 3MJVA 2C5EA 4HMQA 1YMVA 4ZAVA 1QP0A 2VFAA 3WGKA 1FJGB 4FFWA 3UHFA 1QO7A 4X54A 5JNUA 4QNNA 3IUEA 4N5MA 4L0CA 4FBGA 3FWKA 4IZIA 4LW8A 4RESA 4ZQCB 4CQLB 2VR1A 1KEUA 2VF4X 4TS9A 1FRFS 4KZPA 3VNQA 1WCV1 4C6HA 1AD2A 4GKAA 4ZVLA 2O52A 4LE2A 4Y7CA 5CH5A 2X0EA 3NH9A 2XCTB 1Z28A 2PD3A 2GPWA 2NLOA 3UMCA 4FT2A 4EY6A 1Z25A 1FX1A 3J7AC 3ZK9A 1I1HA 1DI0A 3ECCA 5DNUA 5B3AA 1NI5A 5HNKA 4WJZA 4IF4A 1OKKA 4WVFA 2Z5FA 4X91A 5BYBA 4A6XA 4UQPA 5MN5A 3DOUA 4LECA 1U5CA 3SK0A 1G8KA 4MVCA 3FVTA 3V4OA 3FTEA 3CX3A 3U7GA 4OI2A 3ELYA 3VI3B 9ABPA 3GEBA 4RXUA 1WXQA 3IV9A 3G5UA 1HG1A 3EISA 1NW8A 5A6VA 1FMTA 1Y1RA 1Z47A 3HB7A 3R3VA 3SI7A 4AYWA 1T6NA 5DH9A 5I7AA 1B3RA 4FFSA 2WIKA 3MJHA 2R1VA 1GTJ1 3PF9A 4XUCA 3UENA 4GVXA 1KDPA 4X45A 4D9JA 3VU1A 4RTKA 4MIOA 1ZD1A 4ENSA 3OO0A 1P72A 3QIAA 4JJ4A 5C7OO 3O1IC 3T5TA 2HF8A 1VM6A 2REOA 2H4WA 1JNYA 3LC2O 4DUZB 2C9CA 5F9FA 5K3BA 3O6VA 1U0GA 1WL8A 4ER3A 3BWEA 1MO5A 4QEDA 2ZE8A 1Z7BA 1U2SA 4PTLA 3EIFA 5HIIA 4DYDA 5KNCA 1W4AA 4PN3A 2CXOA 4NU5A 4HX5A 5F5XA 1U81A 2XF8A 4AU1A 3TAUA 1NFQA 2IODA 2QQFA 4BZWA 3S81A 3RFUA 3A2NA 2B1JA 1A97A 2C58A 3H7AA 5L7WA 1AUOA 1WZ2A 1U99A 5HA5A 5FO1A 3UHPA 3W2IA 1RZ3A 2PX2A 3D7KA 3M3PA 2DT8A 2BFOA 3C5WP 4WT7A 1NHGA 1M74A 3DMDA 3H18A 3AESA 3T9FA 3N7AA 1E5VA 1FFBA 1G9SA 3PXCX 2IWRA 2BMEA 1SD5A 5EMJA 2FSHA 1T8YA 3DL0A 5E4FA 5LYYA 1KMIY 1XIVA 4FD3A 3HB4X 3SYTA 4ESEA 1H1LB 1H9BA 1SB9A 2C2GA 2R7AA 5JCPA 3OZWA 3PSHA 3QHQA 3QKWA 4FFRA 4IIVA 4NBLA 4AJ1A 1U9YA 1M8FA 4TVBA 4AWXA 1UXHA 3UT5A 2MMCA 4RJLA 3KE8A 4QT0A 4N9QA 2XE8A 3IX7A 3IXMA 4HLUC 3BPSA 3RVMA 2J7KA 3WYDA 3Q8KA 1C1XA 1U0FA 2CZGA 4F4UA 2AN9A 5ED0A 1TTPB 2BKAA 2J0EA 4QPZA 4YRKA 4F3KA 4A0SA 4WZAA 2ZE7A 4OLBA 2QL7A 3QF7A 1L7NA 1MIOB 1XZIA 2H48A 3VVBA 4E2ZA 2XGJA 3E5MA 1VL1A 2R86A 3OZCA 1PZGA 2XT0A 1DCKA 4XGIA 2P4SA 3BD6A 4KC0A 4M1SA 1P9WA 1XAJA 4EH1A 4R7TA 2R8PA 3Q6MA 4X62B 2VNHA 3G5LA 1HXHA 1P5FA 4MUAA 1OXVA 2K2QB 3CNEA 4N12A 3SC2A 1GL9B 1PDWA 1Y3CE 4ZYUA 1KIFA 1Q74A 2GJAA 2EYUA 3DDUA 4RENA 3AO0B 2JZCA 4BE7B 1XDZA 4FPXA 2DX7A 4RSHA 5HDQA 4MLZA 3QRWA 4B76A 4MUHA 4EW6A 4X6LA 1FUUA 1J33A 2EHDA 1BXGB 2V0NA 2W8BB 1Z82A 1A8QA 4MW5A 3ND5A 5IM4A 5FYDA 2B5VA 2OXRA 1N9KA 4NYMQ 2OCAA 4WFQA 3TPCA 3SZUA 3FLAA 4FYHA 1TM7E 2P0EA 4U2BA 2WKPA 5CXQA 2G82A 3CW9A 4IDBA 5LLDA 3GLHB 3FBWA 3WGQA 3IIEA 1I3CA 2ZSFA 3HSKA 4TPKA 4GR9A 5BOSA 2Y8EA 4GYKA 2GBLC 1UXKA 2POQX 4F5EA 4KO4S 2B8EA 5CW2A 4FB4A 1Y8QA 4U7HA 1L2TA 3H4TA 1OBOA 4UREA 3IR5A 3NM5A 4PCAA 3PXGA 2QRKA 2W58A 2ZKLA 1P1RA 2ZJZA 3BXEA 4PRYA 1RE0A 3WJ1A 1UWKA 1FDIA 2R751 2DFKB 3WLIA 4EEZA 1X1BA 1KERA 4HGNA 5H80A 4NDNE 2PZFA 1QMGA 3N8DA 4N8SA 1YZ3A 2GQ0A 1J2RA 1UBFA 2QT0A 3DS8A 3NM6B 1F14A 3HL0A 2PH7A 3OPXA 4HDNA 3SHWA 4HLUA 3ESRA 5DLYA 4PLYA 3WDMA 4LISA 1YWGO 1BZYA 2QP3A 1CQJA 1P4GA 4KFCA 4DG9A 2NADA 2QL6A 2VLIA 3MF4A 4KO8A 4YEDA 1DWPA 2OXCA 2LIPA 1E2HA 1FBNA 3OMWA 1KYYA 1VGRA 2A0YA 3FFBA 3DWFA 3AC0A 1VHDA