4G4GA

Crystal structure of recombinant glucuronoyl esterase from sporotrichum thermophile determined at 1.55 a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
b'CSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-O-methyl-glucuronoyl methylesterase
molecule tags Hydrolase
source organism Myceliophthora thermophila
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
total genus 134
structure length 367
sequence length 367
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4gA00
5LZ4A 2BFNA 2XE4A 1CUXA 2DCMA 2PSEA 2RGUA 5LZ8A 1UKBA 4Y2SA 4DSAA 1QGED 4GECA 5HQ3A 1XZAA 4MYDA 1QIJA 1E3QA 2VTVA 4BB0A 1A8SA 3R3UA 1ZIYA 5FRDA 1YSCA 4B83A 1P0PA 4OU4A 1ZD4A 1SCIA 3WKCA 3N2ZB 4B82A 2BGNA 1CVLA 2AXEA 4BRZA 5AIBA 1CUFA 2HA6A 4Q1VA 3QH4A 3G0GA 1AX9A 4WFKA 3FLEA 3STWA 4C4XA 5HQ3B 1TK3A 3WWOA 3IB3A 3OTQA 2QR5A 3W05A 4OSEA 2AJDA 5AH0A 1XQYA 2BUBA 2ACKA 4WY5A 1UFOA 3IUMA 5ALZA 4Y2VA 3G9ZA 2I3ZA 1UWCA 5KREA 5FP0A 1JMYA 1B6GA 2G5PA 3HRHA 3AZOA 3GUUA 3ICVA 3PFCA 2XUHA 4P08A 2WTMA 1CR6A 4GDMA 2O2GA 3I2FA 2DHCA 1XZDA 3ESCA 3W9BA 4K6GA 3H2GA 4N5IX 1CUVA 1I6WA 2C5FA 2XUGA 4UHDA 4BVLA 4RNCA 3LLCA 1K6EA 4F0JA 2GBIA 4GHWA 3ILSA 4Y2TA 2C58A 4I19A 3GBSA 1N8SA 3ESAA 4F60A 4MEAA 3UUEA 2HFKA 4HTAA 1UOOA 5K3EA 1M33A 4WDQA 3W2TA 2C4HA 1TKRA 1VA5A 3AIKA 3WIBA 5FPQA 3H2HA 1QTIA 1XRPA 5IH7A 4DYHA 2OCGA 1XKTA 3M82A 4GW3A 4FWBA 5T4FA 3R3YA 3I1IA 5IVIA 3STXA 3G0IA 3BE8A 1CUZA 4X7BA 3V9AA 5KBYA 1ETHA 3L1JA 5JALA 3S2ZA 4BVKA 5JD6A 1AGYA 3VJMA 1HBJA 2CEKA 4U2DA 3U1TA 2XQIA 4AZ3A 3FOBA 4XIIA 1W6RA 4XX1A 4RE5A 3I2JA 4C4ZA 5CH3A 5AKKA 2HA5A 2G63A 4G1FA 5FUMA 1ZJ5A 4Y2QA 2OGZA 1DQYA 2QJRA 2JGMA 4KE8A 1EDEA 1XKLA 1ZD3A 4C89A 1J2EA 5ALMA 4W9RA 1UK7A 3RKSA 1K63A 1GGVA 3D0KA 1XRNA 3OM8A 4CI9A 4QDOA 2XUPA 2X8BA 4CIAA 3DEAA 3B3QA 3WA7A 5AJHA 1DQZA 3A70A 1DT3A 4FHZA 5DLPA 3ZLTA 5ESRA 1EB8A 3H2IA 3UMJA 4PO3X 5DWDA 4EA6A 1SOMA 4Q34A 3ZLUA 3DLTA 3D2BA 2PSFA 3R0VA 2P8SA 3L1HA 4G5XA 1XQWA 3DD5A 5HK8A 1BEZA 1PFQA 3ESBA 1R9MA 5AKLA 1EVQA 2WFZA 4LKOA 1QE3A 4FMPA 3I6ZA 2QMQA 1DU4A 2Y6UA 1E8MA 3D7RA 3AZQA 2ONCA 2XUJA 5KWJA 5D7BA 5D3KA 4NVRA 3ZWQA 5EHXA 3G7NA 1JU3A 4ETWA 4K2AA 4X95A 1ZI8A 3AFIA 1R1DA 4BZWA 1DWQA 5AKYA 1DWPA 3WWPA 4V2IA 4OYYA 2WHPA 4KAAA 2AJLI 1QO9A 4YASA 3A6ZA 2QT9A 1BN7A 5AKZA 5AM5A 4FFWA 3K9BA 2OAEA 2PBLA 1Y7HA 1ZIXA 3TRDA 2WLSA 5CT6A 2FX5A 1YASA 5ALGA 2VT6A 2JGFA 2CB9A 3I2GA 5ALIA 5AI5A 4NMWA 1HKHA 1TIBA 3HABA 1QIFA 4X00A 5LZ2A 1U8EA 4KEAA 3T4UA 2QRUA 3SX4A 4UBLA 4PV7A 4QE3A 3HXKA 5ALEA 3H1BA 2PU5A 2B61A 1VXRA 2XMBA 4B85A 3P2MA 4MWSA 5AOBA 3HC7A 2QXUA 1U4NA 4I3FA 1DTEA 3WIOA 4H0CA 4UFOA 4UBKA 3W9UA 3ZLVA 4HRXA 2NW6A 3STVA 4K6KA 3NOXA 1E5TA 2PL5A 5LLSA 1P0QA 1FFAA 5JIBA 4XVCA 1YCDA 4BC1A 5JARA 1XZMA 4P9NA 5ALLA 2JBWA 4GXNA 4LYDA 5ALVA 3PE6A 4E15A 4AO6A 3FYUA 4JH0A 1XQXA 3A2LA 1DT5A 3WZMA 4JUIA 1ZD5A 3C6BA 3BIWA 2FUKA 3SK0A 4AMZA 3GFFA 4HXEB 2HA2A 4DMCA 1MX5A 5D3ZA 1VJ5A 3C8DA 1H23A 3DKRA 5AI6A 4X92A 4L72A 1AUOA 1J1IA 2J4FA 4FFVA 2ZJFA 1FFCA 2QUAA 2FJ0A 2I3DA 3ED1A 1MJ5A 4IH9A 4QWWA 2WG0A 3ESDA 1FFBA 4GLBA 3D3NA 5CMLA 4KAFA 2XUOA 4AZ0A 1CUWA 4GI1A 1TCAA 1YA8A 4QEKA 5EIAA 3OURA 5EIHA 5JZSA 3X3HA 2VAXA 3V1LA 2XI4A 2C0PA 2EEPA 1NU8A 1WOMA 4XJVA 3O4GA 3F8SA 3PICA 5AK5A 3KD2A 1GXSA 4LXGA 4DNOA 1LPBB 2CMFA 1YA4A 1XZFA 3DOIA 2HIHA 4QLOA 3FBWA 4N8DA 5C8ZA 4J0HA 2G4LA 4RE6A 2XQJA 5JANA 3BXPA 1IMJA 2DQYA 3WI7A 5EI5A 3C6XA 2JGJA 1Q0RA 4G9EA 2EDAA 2ROQA 3T52A 1H22A 5HZGA 1R4ZA 4EY4A 1EB9A 2E3JA 2VSQA 3VKFA 1DWOA 3V1NA 3W04A 4LXIA 1JMKC 2Z8XA 2DSNA 4FLMA 1ACLA 5KWIA 1K5PA 1LBTA 3OC0A 1YAJA 1EI9A 2DHEA 4ZRDA 4BDTA 2G5TA 1CRLA 1L7AA 3DOHA 1NX9A 4UFNA 4AO8A 2RAUA 3HYSA 3B5EA 3WK4A 3F9CA 3M3DA 1O6FA 1CQZA 3G9XA 2Y2UA 3CN7A 1ODSA 3HACA 3RK4A 3V1KA 4PSUA 3QYJA 3KOOA 4P93A 3KDAA 4TVKA 2YH2A 4JYPA 3LIIA 4UBIA 3WWDA 5AI0A 3R3ZA 1OCEA 2RIPA 1CPYA 1A8UA 4H18A 3VISA 5ALHA 5E2IA 4OYLA 4S0XA 2ACEA 3GROA 1R50A 1H2ZA 4EHBA 3H04A 5ALTA 2AJ8A 2WUFA 4B80A 4LXHA 5J3JA 2WUEA 4CCYA 2XMQA 1ISPA 2PPLA 2WFLA 5K3AA 1QO7A 3FCYA 5EIEA 1G42A 3EQ8A 4E46A 3H2JA 1Y7IA 2VQ6A 1HLGA 1VZ3A 3EQ7A 2WU3A 1ORWA 2JGLA 2I03A 1LNSA 4J03A 3FNBA 5BWCA 1QIGA 4ARAA 3WMRA 3D5EA 5FLKA 4X6XA 2CZQA 3H19A 3QMVA 2O7VA 2K2QB 2XUKA 1QFSA 4L9AA 1RP1A 4BAZA 1N5RA 2GBCA 3HI4A 2WJ6A 3IUQA 3CCCA 5JAPA 2XMSA 4FLEA 4BAUA 3HZOA 3HJUA 4QLAA 2ECFA 1W4LA 4PF1A 5EHNA 1WCYA 1K4YA 3DKKA 2WJ4A 4FLFA 5C81A 4C88A 1CUCA 1CUDA 3WA6A 4HAIA 5K3CA 2VJDA 5FPPA 3IIIA 3C70A 3QPDA 4OUKX 5AKIA 4YX9A 5JAUA 1ACJA 4KJXA 4X71A 4FOLA 3F98A 2PM8A 4IH1A 2HRQA 5LYYA 3IDAA 1MAHA 2H1IA 1UZAA 5C7YA 3WKBA 5BOVA 3M83A 3OOSA 4MEBA 4YK7A 1UOQA 2OQVA 2HU8A 1WB4A 3E4DA 1W1IA 1OXMA 4H7JA 1EHYA 2XQKA 1XZCA 3I2KA 1T4MA 2Z3WA 4EY8A 5HF6A 2H7YA 5DJ5A 4HS9A 4KYVA 4DIUA 5DTIA 3HEAA 1EDBA 2AJBA 3WKDA 1XZHA 3WLAA 1X2BA 2VJBA 4UHBA 3S8YA 1THGA 5ISMA 5CH5A 2WHPB 3BDIA 4Y2YA 1D07A 5BWBA 1KU0A 4ITVA 2GBGA 1DX6A 4BE9A 3E0XA 4KAJA 1AMNA 4AMYA 4WY8A 1JU4A 4F5ZA 2CBGA 4H7HA 1QIMA 4BZZA 4BC0A 4FNMA 3PUIA 4DGQA 2WJ3A 1AC5A 2QS9A 4X91A 4LHEA 4DLNA 3O0DA 4G4GA 4A16A 2CUTA 4QNNA 1QIIA 1HQDA 2ZVDA 4Q05A 3WK7A 3R3WA 1CUBA 4J0DA 2PKYX 4EY6A 3I2HA 3PI6A 5ALQA 3RARA 2BAGA 3L1IA 3NUZA 5AKEA 2ZYIA 1KEZA 2UZ0A 3C6ZA 4M0FA 4OB8A 2OXEA 4QWMA 4U2EA 1B41A 4L0CA 2PX6A 3WK8A 5AM3A 3IULA 4UBNA 4UHHA 4PNZA 3PDCA 2JGIA 1W76A 3DL7A 5K3FB 5LZ9A 1IZ8A 4CCYB 2XUQA 5JASA 3G9TA 1VOTA 1T2NA 3IURA 2PSJA 2WG2A 3WK9A 1UOPA 2H7CA 1MTZA 4BBZA 3C43A 1E66A 3O9VA 4BDSA 1CLEA 1LPSA 2ZJ7A 4KE9A 4MQMA 4HXGA 4M0MA 2QTBA 3FYUC 5AI9A 4HXFB 5DYYA 3LCRA 2OG1A 1LPMA 1QFMA 1AKNA 2O7RA 1UK8A 4X97A 4J7AA 1GKLA 4CIBA 3HSSA 1UKCA 5ALFA 3DJYA 3UUFA 4EB0A 2VT7A 3C5VA 5I9IA 2BCEA 3H2KA 1FJ2A 3F67A 4BTVA 1H2YA 2ZSIA 3PFBA 2HA0A 4YPVA 1Q0ZA 3FSGD 3IVMA 1MO2A 4ZV7A 2ZSHA 5AO9A 2Y2VA 4Y9SA 1BCRA 4X3CA 1O6GA 1TCBA 4FNGA 4G8CA 1ZD2P 4H35A 1ZJ4A 4X94A 2JIDA 4UPDA 4IHAA 1EK2A 4DMHA 1MX1A 5A7GA 1Z68A 5JD5A 2GYVA 4MJ3A 1JFRA 4W1QA 5A6VA 3GZJA 5A2GA 3NGMA 5LIPA 4Y2XA 2W22A 2OPHA 2GZRA 5F4ZA 1IUPA 4CFSA 4H77A 1UK9A 2Z8ZA 3WYDA 2Q0XA 4NZZA 2RI6A 5JD4A 3GA7A 3FWHA 2YASA 1BEEA 3STTA 2XMRA 1UXOA 4J0GA 3OPMA 5E4JA 5JYCA 3QBJA 3M81A 4PQEA 4W1PA 1C4XA 4QDZA 1L7QA 4J0JA 3AJAA 4BVJA 2VJAA 1U65A 4BRSA 4DTCA 2CJPA 4CG2A 3I6YA 2HU5A 4DNQA 1F0NA 4TGLA 2XLBA 5HF9A 4B81A 1VXOA 3EIOA 2BKLA 1BRTA 1SCQA 5CT5A 1ZI9A 2ZYHA 3G8YA 2RONA 2V97A 5AOAA 5DNWA 3I6MA 3FCXA 1OILA 2RHTA 1JJBA 1UKAA 5AKHA 5CXXA 4O08A 2QVBA 3FYTA 4Q3LA 3BJMA 2VAVA 2XDWA 3O4JA 3U0VA 1IUOA 2ZJ6A 4OCZA 5HFAA 4C01A 1GPKA 4C6HA 5C8XA 1HDEA 5T4BA 3WJ2A 1VE6A 4A5SA 1L7RA 1WHTA 1USWA 4KACA 5AIAA 4KE6A 1Y37A 5CBKA 2VEOA 1DINA 1UK6A 3WL8A 4IQ4A 4D9JA 1Q84A 1E8NA 1IVYA 7YASA 2WILA 3VVMA 5AI8A 1W52X 2OQIA 1XQVA 4OPMA 5C8VA 1AQLA 2IX9A 1YR2A 1CUSA 3RM3A 1LGYA 4H7EA 1XZIA 1CUYA 2OLEA 4N8EA 3QM1A 1BS9A 3DS8A 4WFJA 5IKXA 2OCIA 2JEZA 3D2AA 3QPCA 5SYMA 3V48A 2VJCA 4FKBA 4M0EA 3H0CA 1QIKA 3STUA 1XZLA 5CW2A 3FVTA 2QM0A 4UBOA 2DR0A 3PF8A 3YASA 2BUAA 1MU0A 2IIVA 2PVSA 1MAAA 3WL5A 3QZUA 3WKEA 3ANTA 2J3QA 1DX4A 2OGSA 2ZYSA 3PF9A 4WFIA 4EY7A 4AN0A 2Z3ZA 1QTRA 3LP5A 5K5EA 2CKMA 2VF2A 1QLWA 2WU4A 4I4CA 1EINA 1H2WA 1J06A 3ICWA 5FV4A 4U2BA 5FDFA 1YB6A 5AICA 2YYSA 4B6GA 4X6UA 1MX9A 5E4YA 2DFPA 2WG1A 5CRIA 5HKBA 1XFDA 5ALUA 2H9YA 4CG3A 2OCLA 1VE7A 1ODTC 1JKMA 5ALWA 1XZGA 1BCSA 5JAHA 4BP8A 3VJLA 4CCWA 5HFNA 5LKAA 3FLBA 1LPAB 5CXUA 5CURA 1EXWA 1THTA 4BP9A 4WDRA 3ANSA 3WK5A 3LS2A 4HVTA 1S8OA 1YB7A 1RYYA 4K5QA 3AINA 3FAKA 2XUIA 3C45A 3AIMA 5DNUA 3SC2A 4H7IA 4HRYA 2GBFA 4QDXA 3STYA 3E1GA 5FXMA 3KSRA 3DDUA 4EY5A 2HA7A 1MT3A 5CH8A 1LZKA 2BGRA 2VATA 2XMCA 3WWEA 3O4HA 5AKGA 1N1MA 4BCCA 3WL6A 4U2FA 3MGAA 3FYUB 2XUAA 5AK6A 5ALPA 5JATA 5ALJA 4Y2JA 1CUIA 3K2IA 3H17A 1TAHA 1A88A 1LBSA 1YS2X 3I1YA 5ALSA 3G9UA 2QXTA 2R11A 4U2GA 2J4CA 3EF3A 5A62A 2XLCA 4DMFA 1EDDA 4OU5A 5E4TA 5DYTA 1QIDA 4UBMA 5LZ5A 1ODCA 5T4HA 4DSZA 4H7FA 4B0PA 3D59A 5K3FA 1G4HA 1GQSA 5IVDA 2QJWA 5AK3A 5JAOA 1GZ7A 3LIPA 1WB6A 2DHDA 2JF0A 4G4IA 1CEXA 4BCBA 1LPNA 3QVMA 2R8BA 5HF8A 1XZEA 5SYNA 4B0OA 2C7BA 4MYSA 2V96A 3F96A 1CUAA 2QZPA 4C4YA 2GYWA 4QZVA 5AM0A 5IVKA 4ZGBA 4GWLA 3BJRA 5LP1A 1XLUA 3EQ9A 3DCNA 1P0MA 4OD0A 1QZ3A 1GKKA 2J3DA 2B20A 4B9AA 2D0DA 1QIHA 3E3AA 1KU6A 1C7JA 5AKXA 5H3HA 1A7UA 1TRHA 3DQZA 3WWCA 2WHQA 1E89A 1BN6A 4MQLA 3PUHA 1MN6A 3R40A 4J3JA 1ZOIA 1PV1A 1LPPA 3WJ1A 3V1MA 1AZWA 5JZBA 3AZPA 3DYIA 4UFPA 1BU8A 1IZ7A 1XLVA 1CQWA 4KE7A 3TJMA 1WPRA 4IO0A 3H1AA 2HA4A 3C5WP 4OB7A 4RPCA 1SC9A 3K6KA 2GYUA 3RLIA 3DNMA 2I78A 4QDTA 3R3XA 3JW8A 4QDUA 4BTLA 2JGEA 1SCKA 3DL4A 2XUFA 2XT0A 1J07A 2AJCA 1R9NA 2WIGA 5BV7A 5ALDA 4AQDA 4OB6A 4GEGA 1WB5A 4W1RA 4X93A 3CN9A 4MWTA 3WYNA 4UHEA 5A7FA 2WQZA 3R3VA 5CT4A 4LIPD 4DM7A 4G9GA 3TEJA 1JI3A 4XWGA 2RHWA 3JYHA 5ALXA 3DYVA 4B7ZA 3CCBA 1YAHA 2IITA 2PSDA 2QOEA 5CT9A 1GPLA 2O2IA 2WKWA 2C0QA 2WFMA 3BL8A 2QKYA 4DNFA 4BCDA 1AURA 4EUSA 3B12A 4U2CA 4BYMA 2XB6A 5HF5A 5ALRA 1TCCA 5AM4A 2WUDA 1W75A 2WUGA 5AK4A 4INZA 1QJ4A 3ZV7A 3A2MA 1ZI6A 1VKHA 5HCUA 4H7KA 1EA5A 1CUEA 5YASA 4ARBA 3AUKA 6YASA 3AIOA 4CG1A 2JGKA 1QOZA 4K6HA 4C87A 5A71A 2XMZA 2WM2A 1N5MA 4H7DA 3G0BA 3A2NA 5DYWA 3VJKA 4AN1A 4UHCA 1XZBA 1ZICA 3C87A 3W06A 1HL7A 1U2EA 3N0TA 2B9VA 1XRMA 3CXUA 3G0DA 3D4LA 4UBJA 4J0IA 1EVEA 3QPAA 4JNCA 3C6YA 4UUQA 3IUNA 5JZ9A 3VXKA 1NU6A 1CV2A 4FDMA 4NS4A 1R88A 4JEIA 4DMKA 1XZKA 1WPXA 2ORYA 5AM2A 3BF8A 5DTJA 1GQRA 4Q3OA 1PJAA 2HDWA 5AHXA 1XLWA 1XRQA 1YS1X 2OGTA 1CUUA 1G5FA 3TGLA 5ALKA 5JADA 2XQGA 5CTAA 3QMMA 1K8QA 5HK9A 1VZ2A 1VA4A 1WM1A 2Z5GA 1E8DA 1QONA 3ZI7A 1SFRA 4KRXA 4Y2RA 4FTWA 4J0CA 1CUGA 2WTNA 4B84A 3MVEA 4N8SA 4Q82A 1Q83A 3ZPXA 5AOCA 4AX4A 4L3WA 2V9ZA 4HZGA 4A23A 2HADA 2BUCA 1F6WA 5K3BA 2PSHA 2V98A 3SWWA 3IBTA 1LZLA 4G8BA 4X85A 1CFJA 4Y2UA 2YXPX 1UT6A 3MUOA 2HRRA 2PU7A 3G02A 4F21A 1P0IA 3FSGA 4JYMA 3QITA 3GELA 3D2CA 5LKRA 2WSLA 2XMDA 4E11A 3VVLA 1MNQA 2X5XA 5ALNA 3I28A 3NWOA 3R41A 4UHFA 2W6CX 2DQZA 2QUBA 1GPNA 4X90A 1JJFA 2H7XA 3OG9A 4Q3KA 5DNVA 3WKAA 5HKAA 3C8HA 4ZXFA 2Y6VA 4PSCA 1XRRA 5ALYA 2ES4A 5AM1A 1ZGBA 4EBBA 1TQHA 1BROA 3KXPA 4FBLA 3KWFA 5EHQA 5I8PA 1H2XA 5EGNA 1CUJA 4PW0A 5FKJA 5EHZA 3HLKA 1RWQA 4KR0A 3F97A 3WK6A 5A7HA 3MUNA 5T4EA 1LLFA 4W1SA 5D6OA 4AB1A 4FBMA 2GZSA 4MXDA 3O95A 1CUHA 1CIJA 4G4JA 5AP9A 1C7IA 1FSSA 4GBGA 4E14A 2HM7A 1BE0A 1ZGCA 1X70A 1ORVA 3O4IA 1F0PA 2BJHA 2LIPA 4EZIA 1X2EA 5K3DA 4BATA 2XUDA 1JT2A 2O2HA 2HA3A 1HPLA 4BE4A 4WCVA 4ZREA 3IUJA 1LPOA 1A8QA 3JWEA 4QA9A 4W63A 2B4KA 1IUNA 3Q8WA 5I7UA 3QMWA 2WIFA 1G66A 3AILA 5AI4A 2WIDA 3VDXA 1EK1A 1FFDA 5EFZA 2XMGA 3I2IA 5ALOA 4J0KA 4N5HX 4P92A 4ZWNA 3FVRA 3WL7A 1EX9A 2X76A 4X6YA 5AKJA 4WJLA 4BAGA 2FJPA 2HL6A 1EH5A 2Y1KA 4ROTA 4B9EA 2HHAA 4Z49A 3O9MA 2WIKA 3H18A 2D5LA 4ZI5A 2EDCA 2OAGA 3G0CA 2HFJA 5FOQA 4TPKA 1XRLA 2WFLB 4DNPA 1VLQA 2WIJA 5LZ7A 4ZV9A 4AO7A 4PSDA 5IVHA 1MPXA 1FFEA 3EBLA 3WQHA 2OCKA 2C5GA 4LYEA 2XQFA 2PUJA 2JEYA 1QIEA 4RGYA 4Y7DA 2PUHA 2WHRA 2HU7A 3Q0TA 3BDVA 1XZJA 3BIXA 5CT8A 1JJIA 4IH4A 1F8UA 1GT6A 2VA9A 3BF7A 4G8DA 4KRYA 3BWXA 1WHSA 1R3DA 4Y2PA 1XROA 3IA2A 2ZYRA 1MNAA 3WZLA 4AXBA 3KWJA 3FLAA
chains in the Genus database with same CATH superfamily
2TRSB 3MWYW 5IDQA 2PRYA 3K32A 2BMFA 2O7SA 2HHCA 1BA2A 4XUCA 2IDMA 2XE4A 2OO5A 2Q4OA 2Z98A 2DBVO 3F49S 1ZJZA 4OQFA 1A2BA 1PX2A 3G5TA 2FZCA 3WLPA 5LZ8A 5I4IA 1UKBA 2JFGA 2Q1TA 1K6XA 2ZWOA 4OP2A 2VOEA 1Y42X 3DP9A 3QX9A 4KMRA 1SUAA 4OL0A 1FXSA 1WA5A 3JD3A 4R8LA 1WXHA 2GYYA 4AKTA 4LX0A 3SJZA 4BV9A 2QE6A 4HT3B 4I9GA 3IEVA 1QC5B 3V9PA 2VZ8A 3I8XA 3NDIA 2IXGA 1AUVA 3G68A 4UPVA 4EZBA 5KYTA 3DE0X 1M6VA 3QUSA 1WP9A 1ZO8A 3R3UA 1I94B 3R5JA 4I9UA 5A0VA 5JZOA 5IC5A 3TAXA 5ABPA 1ZIYA 2IRWA 2E6UX 2YICA 3KB1A 4NESA 4YMGA 4GKJB 1NNUA 4PINA 3GJRA 4H6VA 1YSCA 1M7HA 4EB6A 2E21A 2JGNA 2DBQA 3TE6A 1EGVB 3UENA 3IBGA 4YNBA 3KZ1E 1I0IA 5FBVB 1N2SA 4AMUA 4P82A 2R8RA 2I2AA 5F7ZA 4EOGA 4BX2A 3OM0A 1P9WA 2O57A 3GXOA 4WGFA 5ITZB 3QBEA 1RYNA 2YDYA 2AVDA 5ULLA 2BTQB 4HN2A 3EXG1 4C4TA 4DE5A 1WO8A 4A91A 2IS1A 2Q46A 4HTFA 2BTQA 1JG1A 2ZANA 3IOYA 4RKQA 4CF5A 2O50A 421PA 2BGNA 3PJDA 4HDAA 1YTLA 3T4XA 4Y67A 5D8DA 1T6YA 4WVFA 1A4IA 5HMLA 5AIBA 4LI0A 3TZQA 4GBED 2DPXA 4M99A 3DQPA 3DEIA 3IMGA 1QXSA 3G0GA 1I7LA 3KJEA 5KMGB 4M9RA 1YA6A 4TSFD 3FLEA 1Y3BE 3KUDA 3N2KB 3ET4A 1MMFB 2PNFA 3R3HA 4KQEA 1GLVA 2IGTA 4GM4A 2PRZA 4LG1A 1KZHA 2QQEA 1T36B 1ORDA 1TC1A 2DMRA 3E22B 3FYSA 2YL2A 5HQ3B 1ZCZA 4GR9A 3ZY6A 5F9FA 1JBKA 3GFRA 5SZKB 3DE7X 4U63A 1CF4A 2E5FA 1NWHA 4X20B 2QR5A 2RK3A 3JYQA 1ZJ6A 2ILTA 2CNDA 4EG8A 1MB3A 2D74A 3HP7A 5JO0A 1EIZA 2IOHA 2J3LA 1X80A 2ZE8A 3AVQA 4XRRA 3PC7A 4NONA 3PP8A 3SVTA 4LJKA 3M5WA 4L8FA 4NBSA 1CJCA 1DKNA 1MKYA 1NJGA 2P0EA 3U9SA 4AJEA 5LBUA 5C8YA 1EQUA 3P26A 3TPFA 4E88A 1R4MB 4TMYA 5JYBA 3SQOA 4E3WA 3DV0B 3X2FA 2FKAA 1KORA 1L5RA 2P6MA 1XR3A 1FA9A 2FOIA 2BW0A 3I09A 1UWCA 2NO7A 1YE8A 1XZ8A 4HR7A 4MQFA 4TWRA 4DQXA 2VA8A 1Y33E 1WOYA 4EKNB 4QASA 1IXZA 1JHMA 4F38A 2V7TA 1YI0A 3HRHA 3OQ1A 4JVNA 4NZMA 2BM8A 1KBQA 4WX2B 3RUDA 1QYWA 4Q4JA 4ZQFA 3PTZA 3CS3A 3U49A 4M1KA 3W4IA 3W2FA 1E1QD 2XUHA 5THXA 5HWSA 1NYQA 2WTMA 5FUYA 4JI6B 2VUUA 2XRYA 1SNYA 2R48A 2ZB7A 6LDHA 4ZVLA 1D2EA 1JEEA 1FMFA 1G1AA 2E48A 4GVXA 2WSSA 2VP2A 3AGQA 5DE3A 1ZFNA 4YQEA 1RPNA 3IIMA 1YJXA 4L5BA 1E1MA 1R10A 3NP7A 5JNWA 1W36B 1JG2A 1JA0A 3BHIA 3H2GA 3K5IA 4LJ5A 1NXSA 4UVHA 5GP1A 5BN3B 4YQFA 3D64A 2CB0A 1I6WA 3ETDA 3I9FA 3GUCA 4PC1A 3ND5A 3INRA 4ZAGA 3M34A 4EKYA 3ZDDA 5D00A 4CM7A 3RYCA 3RC2A 3MTGA 3ROPA 4QU9A 4BVLA 3EGDB 4YDHB 2G9NA 2YTZA 2BDTA 3BIJA 1WHSB 3PQDA 3UKOA 3LC2O 1JECA 2YHSA 4I50A 1E1KA 1Z0IA 1ENYA 2XBUA 3IVCA 3K1JA 4FNAA 4JYCA 4O8CA 4TKLA 5CA0A 2X0EA 1K6EA 3GV0A 3OKAA 3OOYA 1CRQA 1SIWA 5FBLB 4YRKA 2QZJA 4RKRA 4MGHA 1YHYA 3A9TA 4HATA 4TXHA 3I83A 3L3BA 3VAZA 5IHXA 2JIMA 3T3HA 4RZHA 5F2EA 1I2CA 3MMPA 3BKXA 1GTZA 3WMWA 2OUIA 3FHOA 3GBSA 2B69A 1W34A 3EIEA 2YX1A 1KDYA 1F4VA 1GG5A 2JFHA 1U6IA 3NJ8A 3BXZA 4RY8A 3UUEA 3WNDA 3NEYA 4KX3A 1NMEA 1R0CA 3OZXA 5BYAA 4M98A 1CLUA 1UF9A 5BPHA 5G1PA 3KQSA 4HZUB 1UOOA 2IVFA 3E5HA 2VCEA 1OI2A 3HFSA 3HKCA 2JC3A 1G1MA 1GZ3A 2BF4A 3PK0A 4AS3A 1E2JA 4F84A 4JUFA 3WWZA 3DOUA 5BN1A 2BGWA 2C4HA 1X86B 1VA5A 1NVTA 1YBFA 2OAQ1 3GZNB 4DUZB 5C32A 5JMOA 4GX1A 3OU7A 3LF1A 1A5ZA 1V5GA 3CHYA 5JCOA 5AVRA 2OZPA 5FPQA 1YBMA 3CVOA 1X1QA 5EIBD 3K0KA 1XRPA 2E18A 2IE0A 2KBEA 3AHIA 5IH7A 2VZLA 5B7QA 3SEAA 5DWVA 3T3DA 4OX9B 3CCFA 3NDJA 2HLPA 4X1IA 4ND5A 4GRDA 4UC0A 1UJ2A 5E1BA 4ZVTA 4E1AA 4P38A 1M74A 3VR2D 3STXA 3VSEA 3GIDA 5IJWA 2ZIXA 1B0AA 3DMNA 3KOWA 4TWJA 2FVXA 1RPZA 1JPVA 5D1NA 1JDSA 4X7BA 1OV6A 2WW8A 1FLDA 5EIOA 221PA 1IVNA 1TVCA 4LJ9A 5PNTA 5TVKA 2GB4A 3L1JA 5JALA 5K4GA 3KTAB 1CRZA 2KX7A 2QMZA 3S2ZA 4BVKA 2JAQA 5KQGA 1Z6ZA 5E7MA 2Y1LA 2BFEA 3CWQA 1L7VC 2XADA 2GEFA 1FDTA 3PXEA 1J0EA 1D1PA 1HBJA 4TSFA 1YCGA 2CEKA 4U2DA 4YO8A 3DOCA 4QPPA 1ZA2A 3VUEA 1YL5A 5TDHA 4UDNA 2OBMA 1ODJA 1DHTA 3FOBA 4G01B 1Z2DA 5E9JA 1GUFA 2HSZA 3IS3A 4RE5A 3L4SO 4DYDA 4N18A 4DZTA 4PAOA 1PGJA 4BLWA 1YRWA 3GDWA 3ILHA 1MGPA 3VU9A 4DV0B 4IX9A 4LXUA 1SC1A 1JIVA 2OV6A 3FSEA 3N3BC 4G1FA 4LHZA 1NI4B 2GSWA 1P4HA 2QRMA 1BD3A 4FZ5A 1ZRNA 2IXBA 1EUCB 1V2GA 1IAQA 1YS9A 2JIRA 2JA2A 3L2OB 4IOJA 4Z1MD 1PR6A 5SICE 4A9AA 3ANNA 1EWYA 2G8NA 1CZHA 1DEXA 1H69A 1PX0A 2QJRA 2VDJA 2YHBA 3HVIA 3O5AA 1EE1A 3Q7QA 4XQGA 5IT5A 4YJFB 3U5ZB 5B2ZA 1XKLA 5FR1A 2C4NA 4IS3A 3L82B 2EQ5A 3K9GA 5H8WA 5ALMA 4G26A 4W9RA 4URWR 2R8YA 3N2GB 1B4DA 3VPHA 4RTJA 4JHXA 4NOKA 2QN8A 2VP3A 2WJGA 2C31A 2XQVA 3VOAA 5CBPB 1EHIA 1GZ6A 3VNVA 1T0JB 4M8LA 2KI5A 3JQ9A 4MW6A 2WSYB 1GGVA 2OR3A 1NV9A 1SELA 2W93A 1QCZA 3D0KA 1XRNA 2VLBA 4QXQA 1K66A 5EMJA 3RBAA 3DZBA 2K7ZA 2A9PA 2BR3A 3QXHA 4QDOA 3ZHQA 2GI4A 3HA2A 2XYQA 3PJEA 4RPJA 5KWEA 1YZGA 3WA7A 3QY9A 5JJIA 5AJHA 1GYRA 4BQPA 4EMUA 3V4PB 4FHZA 2CYBA 5DLPA 3VC3A 3TGPA 1L5ZA 1OOEA 2FCRA 3EE6A 1DKUA 1SZCA 4E5MA 2XWSA 2A84A 1JBEA 1FNSA 2BFEB 3H2IA 3QSYA 1HC7A 2WJHA 1PO7A 1M0EA 1VL5A 4AFNA 4EA6A 3I2YX 2V0GA 2Q3FA 4N39A 5KYKA 3DLTA 2PSFA 3R0VA 4P3XA 2NZJA 2YQ4A 3L1HA 4FDUA 4G5XA 4F85A 1Z47A 5LL6P 4D82A 4JVMA 1CKEA 4XVHA 3IB6A 4M9SA 3DD5A 1SZPA 1RZRD 4KQFA 2OKCA 1LQUA 1VDMA 4B4UA 1RM0A 1ISHA 1HNXB 3D31A 5KNDD 3KB6A 2VYVD 1N2EA 4ZVKA 4DILA 5JSHA 1VYTA 4OYRA 4OI0A 2ZJAA 5I7AA 5L3VA 1W4BA 2X2OA 2G72A 1SQSA 2W2QA 3ZI7A 5IWAB 4JLBA 4IILA 1NDQA 1YJAA 2ZIZA 2NUTA 4FMPA 4BHTA 2I4IA 5J2TF 1T36A 3E22A 3W8DA 2HREA 1V5FA 2R7NA 1SG0A 2YY7A 5B6JA 1KOGA 1FMCA 1GLGA 1O95D 1PUIA 2C5EA 2QUIA 2Y6UA 4CQLB 5BWMA 2CJWB 4FFSA 3VGPA 1USKA 5MN4A 4RAQA 3C8UA 4KREA 3OWXA 4XWAA 3MT8A 5D3KA 5D7BA 3VPBA 3DUFB 4NVRA 2R4QA 4KQCA 3QBTA 5HOQA 3UHPA 3CO5A 2ONJA 4S2EA 3T99A 1H4TA 1MHPA 3AFIA 4UNQA 2ANBA 2VK1A 3LLMA 3DV2A 1O08A 3M4YA 1ZQ1A 3UAVA 4ZYWA 3FTDA 3GZ4A 1FP1D 4RDIA 2GTPA 4MV6A 2GDZA 4MVYA 4V2IA 1GRVA 3EOBI 3NHYA 1KI2A 2WHPA 3VR5A 4BGUA 1IE3A 5K0FA 2PA0A 4TV8A 4YASA 4FM9A 2RK6A 3JZAA 2MSEB 5MN5A 1WIWA 2ILVA 2FMKA 2PKQP 3PWZA 1BN7A 2ZULA 3B1WA 1N2CA 2O3TA 2GAIA 3LSTA 3I62A 2BCGY 5FAXA 2V6GA 4Q1BA 1MOSA 4FJ2A 2GCPA 2GCOB 2VPIA 4UE3S 4OAQA 2ZJ5A 1ZGGA 1K27A 1C30B 3B6MA 2R7AA 1KOJA 4AKSA 4B3BA 1YMQA 1PIWA 3ONEA 5ALGA 3W79A 1AMOA 4Z4QA 1G7RA 2GN9A 2J5XA 5DHPA 3AI3A 1SCNE 2Q0QA 3AB7A 3G7UA 2EQBA 1U0EA 2X13A 1WDKA 3PR3A 4E2FA 3L7NA 3TQQA 1HUQA 1TEVA 2RG7A 4EBFA 2O5VA 4DCNA 1J5PA 1WUKS 4NE7A 2BEUA 1RVV1 2PR2A 3KZVA 1QGAA 2BBTA 3GA5A 4OHBA 4A2WA 4RIHA 4F1WA 1AQNA 1S2LA 1A9SA 3UK7A 1L3IA 1SBIA 5DHAA 1F38A 3ZEAA 4RKEA 4A8PA 3RRJA 1L5LA 4ZXPA 4BFWA 5LOVF 1Z2EA 3ZCQA 1W19A 1JJ7A 2EKPA 3ZGYA 1GPUA 1BNCA 2LKCA 2P1DA 3H1BA 3N2GA 4NZOA 1JE0A 2RAVA 2VXYA 2P2SA 2H8KA 3B2QA 2EFDB 4IXWA 1QK4A 2G17A 4A6XA 4E5KA 4CQMB 3MXTA 4DSOA 3R6DA 4NYJQ 4RK1A 4Y0VA 1YUNA 4HO1X 4FYJA 4C7VA 4MWSA 1RBQA 1WXGA 3JQCA 3QHQA 2NLOA 2QG4A 4YBRA 1TM2A 2QXUA 1Z8NA 3I76A 1NN5A 3QEJA 4I3FA 1OROA 2I8LA 5HFJA 2MSDB 4DR1B 1LVHA 1RPJA 2FE4A 4UBKA 3COYA 1G5QA 1GILA 2X0NA 3TNYA 5DCUA 2IDZA 3ZK8A 2XBMA 4H3VA 1TA0A 4KFTA 2IXTA 4Q37A 3FE2A 3JQRA 4HRXA 2X0RA 2NW6A 4JAVC 5KYWB 4NHEA 3EWSA 4FT4A 1NNSA 3D8HA 3STVA 1LJ8A 2ZBPA 4FCCA 3OD1A 1W36C 5K8TA 3H5VA 4KXVA 4PZPA 2WZCA 3LD9A 3GT4A 4I9NA 1FNCA 3X0DA 3GA0A 1CIVA 3JVUA 4RDHA 4R01A 3WLKX 2YRFA 4MB2A 5BMVB 3QE4A 4NL4H 3DBVO 4NCXA 4OQ4A 3CM0A 5JIBA 3LA6A 1VBKA 2J67A 4MARA 1XMQB 2DEUA 4XVCA 1N0VC 1ES9A 1XZMA 3LBHA 4P9NA 5BSHA 1NW3A 5TMEA 4E4TA 4LRSB 3PC8A 3IPLA 1QH1A 3S7TA 4LOLA 1XOIA 4YP0A 5I6DA 3F6PA 1U28A 2CCJA 3O8QB 1N3IA 1PL6A 3JQ7B 4PGGA 3SXJA 5I4KA 4E15A 1OKKD 1Y8QB 1RHMA 1NBMA 1E2KA 5HZHA 1WUHS 4QJIA 5G4KB 1T4BA 4LNUA 1O97D 5LQSA 1OXTA 2PIDA 3NTVA 1LSUA 3OQIA 4MPJA 3BWBA 3TTTA 1QGOA 2RB5A 3FYUA 5BQ3A 1RR6A 4U7JA 1FX0A 2CUKA 2H59A 4I1YA 3PGMA 3OZCA 1D4OA 4L4RA 3ADOA 4IGKA 5D2CA 1KK2A 1OWLA 5J4YA 1ONNA 2I4RA 3TNJA 1OFGA 4U3JB 4N03A 5CITA 5EVJA 3AI2A 2QF7A 4EUHA 1C8BA 2HA2A 5JDIC 1O6BA 4ENQA 1MX5A 4EHIA 2WJWA 4TS9A 4F71A 5IVPA 3GT0A 4FNOA 5LQDA 1BOOA 1J1IA 2O0KA 3A6LA 2CF6A 4EL0A 3FTCA 1GDTA 1GR0A 4NOJA 3TL3A 3T9FA 4V0OA 3QOFA 1EXVA 3RNOA 4QGBA 3TLGA 1MJ5A 2OECA 4FB4A 4UNPA 5IBQA 2JLUA 5GPBA 2OGWA 4QWWA 3UJNA 4JZYA 2W42A 3FYDA 4OKIA 1UPTA 1CFZA 1EBUA 1M1XB 1R37A 3JQFC 5C3UA 2PZ8A 2XNJA 4M1YA 1FFBA 4EG7A 2JGAA 1WKVA 2QTCA 2YBEA 1DAMA 3ENZA 4DR6B 3B1FA 4PONA 4EB6B 3LCCA 5BQOA 2BMAA 3C6QA 2VHWA 1U7OA 3BE6A 4R9VA 5EIHA 1NY5A 1L8XA 3WDLA 3RVSA 2P75A 3TLXA 5JZSA 1CR0A 1J8MF 3AERA 3IDOA 3Q7TA 3V1LA 3DEZA 2EEPA 3E5RA 4L9WA 4CKWB 2D8MA 5BN3A 4HFMA 3PV0A 1GUYA 2LVBA 4XJVA 3MTQA 4HGQA 5KCZA 1NATA 1R0SA 3FDFA 1CF2O 1XD9A 2FRDA 4KTTE 5CA1F 4NYIQ 1QYRA 1AF7A 2R5NA 1KAQA 1G21A 2ZJ3A 3OZGA 5DT2A 3RASA 3IQDB 3KD2A 3ELBA 1GXSA 3JYOA 4LXGA 5DV9A 1OT3A 4OG2A 3MD9A 2CMFA 2XPCA 1E1YA 2WKPA 1MW9X 1J0DA 1O97C 2AWNA 2BM9A 4QLOA 3ZS8A 4JITA 4C4AA 4MO2A 4D96A 3K8OE 1X1TA 4UNSA 5GOTA 5JANA 1ID8A 2F1OA 2VJOA 2MSKA 4G2TA 5FBQB 3EVFA 5B1HA 1KY4A 3TPCA 3WI7A 4FXOA 1U2DC 5EI5A 3TOZA 1HG0A 4I1SA 4MS1A 1N3LA 4IVNA 4HF7A 2CJXA 2EDAA 1I14A 1GCIA 3H11B 3PRYA 1H2HA 1NJ2A 3RR2A 3V8VA 1LC0A 4NU6A 2DP4E 4BMCA 4Q3DA 5LBTA 6AT1A 3P9YA 5LN1A 3BS4A 4YP7A 3GN2A 3M1LA 1EB9A 1O9GA 3TEFA 4C08A 4RF5A 2RGCA 1G0NA 1ZH8A 2PQMA 4PBSA 3DOOA 1WEHA 1J21A 3BRWA 3IPCA 4JENA 4R69A 2E3JA 2VSQA 4Y6SA 3QK7A 1MLDA 5U4QA 3SF8B 2FN7A 1CF9A 1PUXA 2J1LA 3WSVA 3VKFA 5IAAA 2Q6TA 5BSTA 3OEWA 2RHRA 2IY8A 2OQ2A 3KL4A 3AXTA 4FDAA 3U3DA 5HJ5A 2GKSA 3V1NA 2C2BA 1VPTA 2PTHA 1QNFA 4EJSB 4ZI7B 4Q4HB 1JMKC 4E7OA 4QBIA 3MTBA 3AY6A 1N33B 5DIFA 1LWNA 1QHHB 3DPSA 4FD2A 1NQOA 1R15A 3OT1A 3VSCA 1Q6YA 5EZYB 2V7QD 2VTEA 4MWCA 5KUTA 1V1JA 4YMUA 1KIAA 1YAJA 3NH6A 4E3ZA 4G8JA 2ISQA 5LMZA 2O2CA 3V46A 4IIUA 2GWHA 3AL0C 3B9BA 4RGQA 2OO7A 1HX7A 1N8NA 2WPDA 4TMKA 5IM5A 2B2NA 4LK3A 3UMSA 3DOHA 2HTEA 1YRLA 3B2EA 3OJCA 1GTRA 3BSSA 5LMUB 2WLTA 4S3MA 3EISA 4MSUA 1YXMA 1VMKA 2A9JA 3EWAA 2CXXA 2QN9A 3EEQA 4XD7D 4OLBA 3AVWA 4JC4A 5BNTA 4L95C 3FHCB 2WHEA 3ECCA 5FX2A 3PUYA 3KWMA 5E8RA 1YMUA 4BN5A 2RARA 3D8RA 4MLCA 2YJ6A 2R6DA 4W5TA 1SIBE 2GCIA 1TAGA 4M9QA 5DM4A 4FN4A 1L4YA 1YU9A 4JSYA 3BPSA 2SKDA 3R0JA 3T54A 1GNLA 1WW3A 3N5KA 4PSUA 3IUEA 3TLCA 4TZTA 1Q0PA 1WXWA 4MULA 1ZN2A 3WIVA 1IAVA 5TEVA 4R1MA 4BN4A 1M54A 3OLVA 4B71A 1BX0A 1BHJA 1C0KA 3HV2A 4R83A 2B3TA 3QTLA 3UVEA 4KZPA 4F9EA 5BQXA 2C20A 4QDJA 2O8BA 1XX6A 1B26A 4PLPA 2EC5A 4GIBA 4UU0A 1DZIA 3K70C 4C0AC 1KO4A 1ENOA 3WWDA 1Z5VA 3AEZA 3RIHA 1E79D 3NYWA 1A9XB 4ZRNA 3DMYA 3NOOA 4CU2A 1FTNA 2ZRCA 5JXIA 1PLKA 2ZYGA 1X87A 3F4LA 3D6AA 4LVUA 4HSGA 3VR4A 4PYJA 4EMBA 5KWSA 4IQGA 5KJ6A 1CS0A 1OZAA 1DDGA 3G89A 3UFXA 4EKDA 3KSDO 4KPEC 5TXGA 3P9KA 1GKUB 3DNPA 2MU1A 5KSOA 1CCWA 4LVCA 4O4LB 1MOZA 2PZFA 1L4EA 3D0OA 1H2ZA 2COEA 2D4HA 2FPSA 3T0GA 4D6PA 1ICEA 4BQOA 1ZUIA 3I9NA 3UA3A 2PMEA 3VKVA 2C9ZA 3HYLA 1JWAB 3J80A 4LXHA 5FNVF 2XMQA 4X1KA 1VHDA 2W6JD 4KB5A 1JDJA 3TZKA 5KVCA 2IKSA 3IH5A 1GRRA 5BRAA 3FCYA 5EIEA 1G42A 2D06A 2GN4A 1RHRA 1TC2A 2I99A 3H5OA 3H2JA 3M9LA 4E46A 4NWIA 2CBXA 3HBFA 4HNSA 3DW3X 4N5DA 2HNAA 3GUVA 3VH2A 1K06A 4B43A 2ZETA 1VZ3A 1OX4B 3FHLA 2OZLB 2POCA 1EG7A 1SVSA 2C3MA 1C4KA 4LRUA 2O3UA 2O2JA 1DTSA 1SAYA 3LYHA 4OKNA 3GGDA 3L6UA 4DIMA 4M1QA 2XD4A 4B8WA 4BFSA 2D5AA 2ZJZA 2XX3A 2YOGA 3KZCA 4XJSA 1SOAA 1NXWA 4ARAA 4AYXA 5ICGA 5FLKA 4X6XA 2E4XA 4FGWA 2GEVA 1RKQA 1PR9A 4ZQIA 4NENA 4JC5A 1E0JA 2O7VA 3DWEX 2XB4A 1KAOA 1RSZA 4HDNB 3KXIA 5CIWA 2DETA 1T9KA 2YCLA 1X39A 3QPVA 3SBOA 2XKKA 4I55F 1A7JA 1JVBA 2BF7A 2EGGA 4M4SA 1ISRA 4ZDJA 2DBRA 1RP1A 2CE2X 2P2GA 2A4MA 3DDSA 4LYAA 3A9VA 4JY7A 5C31A 1TECE 2AFVA 2PWAA 4O2AF 3DT9A 4MHSA 4D5EA 5LNK1 2V55B 1LI7A 2B1JA 3CCCA 4ZTZB 1QP7A 5KSPA 4MVJF 4Y0AA 2DAPA 1UKZA 5F2NA 1L9KA 4CT4B 5JVDA 5CB0A 2P2ZA 3TF5A 2D5BA 3BDAA 1M2WA 2PUTA 5JG7A 4A3SA 4CV2A 1HT3A 5JVDF 1UIRA 3HZOA 1YRHA 1GTL1 4Q3BA 2JFXA 2PEZA 3E4CA 5H0IA 4XYEA 3RFTA 4BNTA 3PEWA 2JL1A 1JALA 2PYIA 3K1YA 2GHTA 1UBCA 1OTHA 1YULA 2V7WA 5CLGA 3WX0A 1KQPA 1MUUA 1S4QA 1WCYA 2C9YA 1P1JA 2ZBGA 2VSYA 2NZVG 2VHJA 2PT6A 1YZQA 3HCFA 4FZRA 4Z9FA 4MYRA 1VRVA 3SAJA 6PFKA 2GEDA 3EAGA 1ZLYA 3KT6A 3E84A 1S2MA 2VJDA 3OZUA 4KQ2A 1KNXA 3C70A 3IIIA 2NAPA 3TXAA 1PJCA 4LTMA 2FLKA 4INAA 2P27A 2AHRA 1FS5A 3NI2A 2YC4C 4JI2B 1ACJA 4X71A 1ZGAA 4W5QA 3CNNA 4I55B 2VOJA 3KX2A 3ULKA 4LPSA 2A5JA 5CU7A 4LSGA 1FJXA 4KXUA 1ZMTA 5EC8A 1NLYA 2A1TR 3MWDA 4NG5A 4JVSB 3OZAA 3AERB 3DF9A 5DM0A 2D1SA 1XLTA 1TUEA 1YO6A 1Z0DA 2CL0X 3HO8A 1E3DA 4MEBA 5BOVA 3T94A 4ACAA 1JAHA 4R1UA 3AK4A 3ZQUA 3ZNNA 4MTCA 4INJA 3F3KA 2J5QA 2ZREA 3RABA 1OBFO 4AKGA 2VZEA 1UOQA 1HFKA 4YJ3F 3GH3A 1Q2XA 1LX6A 4XEUA 1EIWA 3EB9A 2HU8A 3K6SB 1MB4A 4UMVA 3WHIA 4Q9LA 1RAGA 4X1YB 1HURA 3QE3A 4R1SA 3CEHA 1A4UA 3ZWOA 2N1BA 4Z8XA 5BR1A 1NAIA 4ZVVA 1Z45A 1Y7TA 4N5LA 1II0A 4Q3NA 3HCCA 2P3QA 3LAWA 3PT9A 4YPOA 1J1ZA 4O4LF 4H6XA 3TFOA 4DBVO 2BELA 1U2GA 1YFLA 2X5JO 1LDEA 4C7OA 4F4JA 3ZI4A 2ASVA 1P4SA 5EIBC 3E8MA 1XZCA 2LE0A 1Q7GA 3NRBA 4RY9A 3EVTA 4DLBA 4EY8A 4RETA 3TZ6A 1XD2A 4KW7A 2MYTA 1NOKA 2PYDA 2FWAA 4D56A 2Q5QA 3TUJC 4IDBA 5FNVB 5HYVA 4DIUA 5IMBA 2WDPA 2FWMX 4PNEA 5CFPA 3SVLA 3ZHOA 3Q5DA 2FPWA 3UHJA 1NVVR 4ZPXA 2AJBA 1TCVA 3ZNQA 2NYAA 4G4SO 4LSWA 2IV7A 1L5OA 2Z6UA 1E4YA 1S2IA 5KQRA 3F6EX 3C1OA 4G85A 1P1HA 3GLFB 1OVGA 4YQYA 4WXPA 2C4VA 4EAQA 1OZFA 5ISMA 1KP9A 4CLRB 2ZBEA 3VA7A 4MVJD 2HYDA 2WHPB 3BDIA 3NXKA 4U7FA 2RJOA 2W6JA 3DOEA 4Y2YA 3Q9UA 4B33A 2J59A 1DO2A 3WYEA 4ITVA 4Q1DA 2ZYWX 3JPYA 3KV3O 4D8YA 1F51E 1N8KA 1TJ5A 1PLJA 3SCZA 4BZXA 1YCFA 4YMSA 4WY8A 4AMYA 4DSUA 4BOYA 2P30A 5KNBD 2O2ZA 1QOPB 4J29A 4JBGA 3EPLA 1OI7A 2X1MA 1ESEA 2FMHA 2B7CA 3OCJA 4JFAA 4N0DA 1GN8A 4U7GA 4YJFA 4EVQA 3R24A 3L8YA 3HWRA 5CB6A 2XOKA 4FFLA 3A25A 4FD3A 1U3GA 1XCJA 2F6RA 3PUIA 1GA4A 3IHWA 3QVJA 1NQ5A 1AC5A 2CLDX 1OB2A 1O1YA 1TA4A 2FG7C 2QS9A 4FFOA 4X91A 4RTLA 6Q21A 4LHEA 5EA2A 3B6ZA 1PNOA 3RAPR 1YZTA 3ZZMA 2YS7A 1ZPDA 2A1UA 2CVPA 3T8YA 1FTQA 2G80A 2FZKA 1TOAA 1Q7CA 3EH2A 4JA0A 1SUEA 4MMZB 1O95C 4KO2S 6ADHA 2ZVDA 3PJFA 1G291 4Q05A 3KFLA 4R16A 1GAQA 2NUAA 3AB8A 4YCBA 1QRDA 3IEIA 4FDTA 1VLMA 4GOKA 1DP4A 2WKSA 4GQAA 1A2OA 2G1JA 3UB2A 4HWOA 1SEPA 2DTXA 3I2HA 3PI6A 3AUFA 3GRRA 4GM0A 5HA5A 2BAGA 4JBWA 1I4TD 1PSDA 1QDUA 3QIAA 3NUZA 5AKEA 5G41A 3ZK9A 4EVRA 3R5TA 1V39A 4MUXA 1ZJYA 4HAUA 4IL5A 4DSTA 5CEJA 1M1NB 2UZ0A 5ERYA 4KUGA 3ZGLA 1Z74A 3BMQA 2NP7A 2OB1A 4CKCB 5J2UA 1LDBA 1X19A 2HXGA 1HGXA 3CVUA 5GY7A 4YRMA 3ABOB 4BO8A 2VRCD 2VSFA 1E32A 1K7XB 4O1HA 4U2EA 3LFHA 3DHVA 2BONA 3BB4A 1E96A 3LCVB 5GQSA 1R7RA 1XTTA 2BDEA 1KYWA 4BLUA 4ZYTA 3A6JA 4LDQA 1RM5A 3KT8A 1ZNZA 1KC3A 4DV5B 3CNLA 1NM5A 2E4YA 3PDCA 1NTOA 1WSBA 2ZR0A 2JGIA 2REOA 3B1KA 4IPTA 2W6ZA 3ZDCA 3DL7A 1ZESA 1E1RD 1DAPA 3UJBA 3W8EA 4PRZA 4QOIA 5FA8A 4UUAA 2VHXA 1PEDA 2G0AA 2G77B 1G63A 2OSVA 3G9TA 3BD8A 2FFRA 1ZD1A 2Q1YA 5HQJA 5CAEA 4TQ9A 4D0GA 1EEHA 2WK1A 1JBQA 4K9RA 3VR6H 4JXXA 3T34A 5ELXA 3CVWA 1UOPA 1VGQA 1A8IA 2YV2A 4WBNF 4P4TA 1A9PA 4BV8A 3DPIA 3PFGA 1TADA 4BBZA 4TLMB 3DZ8A 3KKOA 1A71A 4N9QA 3TW4A 3O9VA 3FNHA 3TBHA 5AD1A 2AV6A 1MRZA 2BLNA 1LY1A 4BDSA 3GT3A 5FNZA 4DNXA 2X0FA 4MH0R 2NTJA 5KJ1A 3HYNA 3RF7A 4MQMA 3OQ6A 3ST7A 1VE9A 4K1XA 3AUAA 1CD5A 1J56A 2I65A 4N3AA 4EG6A 4GYJA 3MJVA 1YIDA 3NBZC 4YRPA 5EG5A 5C4IA 1GPYA 5D84A 4HGYA 4KWEA 3ORHA 2A67A 3NV9A 3ZJUA 1PP4A 5AI9A 3TW8A 4HXFB 4L5IA 5FEMA 5KYVA 5EMLA 1NUPA 3QKTA 1ZISA 3EZGA 4YAIA 2EZ4A 2AQ8A 4PFKA 5F21A 1JHDA 3F90A 4MRNA 5TEWA 2VDOB 3GYGA 3PKZA 4ZOLF 3VNUA 3PX7A 3MCVA 3U3XA 1E18A 1AKNA 1PL0A 2O7RA 5CLJA 3BK1A 5IYZB 3AESA 3KE9A 3DO5A 2IHVA 4RYLA 2AYXA 3PTLA 4X97A 1RYBA 4M38A 3WL3A 1HE5A 3DJYA 3UUFA 2VT7A 2D2IA 4CV3A 4HAOA 1OGIA 1OC4A 1PJ3A 3HP1A 3BCUA 3F67A 4PG6A 4WUTA 1XU4A 4P81A 1H93A 2HZ7A 2FG6C 1UODA 1G8GA 2KMLA 4BP3A 2BE9A 4GU5A 1E6CA 4LK2A 3PLNA 3BTOA 4JBHA 5D3QA 2F1JA 3KOYA 1H2YA 4LJLA 4XZ3A 5FFMA 1XMXA 4Q4JB 2AR7A 3PFBA 4DKXA 4WRRA 5DW0A 1KAEA 2HA0A 4UQPA 3IAM1 5CVJA 4DV6B 1KFCB 4JSTA 2HLNA 1UM9B 2VP9A 4H1WA 1DXHA 3V4LA 3LL4A 2H5JA 2ZSHA 2WWWA 1RJ9A 3NNSA 1HOTA 3C5HA 4LS3A 2FQ1A 4PC6A 3TW0A 3R5KA 2FPKA 3OZVA 4QREA 2HCFA 3HBAA 1U9ZA 1C7FA 1AKWA 3PNPA 1F5SA 3GEEA 3KAKA 2HRDA 3PVSA 4QQKA 4OI2A 4RK0A 5AW2A 3B8EA 3SHOA 4D9EA 3LRPA 1G98A 5BR4A 1E3SA 1IN5A 1B93A 1UDBA 3HP4A 1CP3A 3N5CA 4NSNA 5HS6A 3BE4A 4RTQA 3PGKA 4UPDA 1RKUA 1JZSA 4IHAA 4RK7A 4QEZA 4X66B 2YQZA 1KYTA 3HJBA 3CV3A 3HB1A 5AXCA 4ER6A 4R1NA 1X7XA 5A7GA 2ID7A 2C77A 1NJ5A 1ZVKA 1SURA 1LNQA 2XJ9A 3IIKA 5F2KA 3TNDA 2AB0A 4XVRA 3HBLA 1AGRA 1Q7EA 1VBMA 2YMLA 1QVWA 1XWIA 3AFOA 1TLLA 2CHVA 2HX1A 3KM0A 3LRXA 3VH1A 3GZJA 3SQWA 2G1AA 3LUPA 5D3MB 1P4AA 1MG5A 1GDHA 2RGBA 3EX7C 3BGVA 1E59A 3WIEA 3G2KA 1ORHA 2H2AA 2H1FA 2AOUB 2O1SA 2OFWA 2UYGA 4WERA 1G3UA 3CT4A 1T5DX 3UGJA 4YC7A 1Y8CA 1NVGA 2PMCA 1EFHA 3K70D 3HU5A 2F64A 1JIIA 1J9GA 2HWKA 3WRYC 1N0WA 3WRVA 3QVWA 1ZEJA 1Y8RA 3W5CA 1GP2A 4JP8A 4RA6B 2OM2A 1Q44A 4QEDA 2RI6A 4W9NC 5KPJA 4Y18A 2H7VA 2R8ZA 4HMQA 5DYGA 1P8AA 2RHHA 4KGVA 4MI3A 1WBBA 2PX0A 4LBVA 4KGXA 3V00A 2XMRA 3UT0A 1HM5A 5A03A 2FW6A 4Q9DA 4KR9A 5JYCA 3LFUA 4HDMA 1NBMD 2DUJA 1DC7A 4L4XA 1O94A 2P0YA 1FNDA 3J7TA 5A9SB 4OK6A 2OGUA 1OAOC 5KVSA 1BJTA 4YRFA 4MQEB 1E4EB 3ORRA 4IJVA 5F7JA 1QE0A 3UOGA 5EKXA 1XV5A 3FF1A 4X45A 2C4WA 4GOXA 5HXAA 4HV4A 1S89A 1LLCA 4ZDIA 1L7QA 1L8QA 4MMXB 3W6OA 1GARA 3DQQA 1XD8A 3CE6A 1FUYB 3LSYA 2ZSUA 3K8QA 1DSSG 3PR1A 4XIJA 1ML3A 4JBLA 5CVVA 5ELLA 5GWXA 5JOQA 5IKMA 2AN1A 5ESDA 3SHQA 4HAXA 3F9IA 4LHXA 1L9XA 2ADFA 1G7SA 1G20A 1KEWA 1OZGA 1S7CA 2QL9A 3DBHA 1O5TA 2DGDA 4G36A 4TGLA 2O8CA 4TWBA 4OQPA 2V6MA 5T7BA 4P3NA 1SHUX 3O8OB 5DHQA 2ET6A 5IBCA 1XELA 2HPHA 1IOZA 1O77A 1DAEA 1XTKA 2RG1A 2YS6A 3DDOA 1J5EB 2IHYA 3FUCA 1SCQA 5CVUA 1IU9A 5KB3A 1OE0A 1N5KA 1VYHA 2ZYHA 3GDOA 4IIJB 4OTZA 2GFQA 4YRDA 1F8XA 1UADA 2VT2A 1V7QA 3HVJA 5IT0A 2ZUDA 3RYHA 5EIXA 3NYQA 1RYEA 4MGIR 4TS3A 3KPWA 2JIBA 2Y76A 3I5AA 1UXKA 3N2IA 3UGTA 5L6MB 3P9RA 5MFPA 3I5UA 1SC3A 1JJBA 2GM9A 4KI7A 1UKAA 1V4BA 4NK5A 5AKHA 4HKTA 3GLIB 1BXGB 2OP1A 3VZBA 3FYTA 3NVKI 3OO0A 4Q3LA 5AJTA 5EZYA 5C53B 2O1EA 1BMDA 2XIQA 3GP5A 3O4JA 4GXQA 2UXDB 1BXGA 5BV0A 2A1IA 1BD4A 2XMPA 4ZALA 1D4FA 3DDZX 2YVUA 1O87A 16PKA 1EX7A 4IHJF 5HFAA 5J2TB 1JH9A 4M9XA 4YR9A 1RI5A 3B5IA 4R2LA 5LDGA 4DLYA 1GPKA 2NXEA 4O2RA 1TYAE 621PA 5AJVB 2EYQA 5E9WA 1NNLA 3PQEA 5T4BA 3Q1KA 1VL0A 2FMIA 1KO7A 4WN3A 3NC1C 3KYBA 2Z2ZA 2ZI7A 1TF2A 2HSJA 1L7RA 4G25A 3UO8B 1FDUA 5IS2A 1V6SA 5EXTA 5IFKA 3I53A 1USWA 1CDZA 1VJRA 4IGEA 3TTXA 2BE7A 4D3DA 4Q93A 3HXOA 4MV4A 1YRYE 3H0KA 4XYLA 2H18A 4IIBA 4CF7A 1V7ZA 4RVNA 1BO6A 3UHAA 5T67A 4RJ2A 4G5RA 4NCBA 1CULC 3U9TA 4HDCA 5CBKA 3KZNA 2VEOA 2XTMA 4FILA 1SVUA 2BSXA 4MVJG 1KYYA 3ZJTA 1Q21A 3CBQA 1RJWA 3WL8A 1B76A 4IQ4A 4GEKA 3AFNA 1NUSA 2R87A 3C16C 7YASA 5U4XA 1P74A 2R6GA 5AI8A 3NT2A 3DZFA 3VOTA 2YIVX 2SCUB 2BBWA 4IGFA 2RHJA 4CIXA 3OOHA 2Q3DA 1DIAA 4ZOAA 1OWPA 3NHJA 3MRXA 4HB4A 4D3ZA 2QRNA 5B4VA 3IJRA 4H7EA 4OBWA 4TYPA 1EFPA 3U6BA 2XZOA 2Y1DA 1QB8A 2Q3LA 3E8XA 3T95A 2G0TA 4AJ2A 3GAMA 7ADHA 4FDVA 3QM1A 3PEEA 4WFJA 3RFUA 5CM8B 1UDXA 1KDRA 4IZ6A 1PS8A 1FQJA 4XDZA 4YJ3B 5LOVA 5B2EA 3H2SA 3IDQA 5EJGA 4DQVA 5SYMA 2VJCA 4N6GA 3T38A 2P78A 1N78A 1I2AA 2BL4A 3Q3VA 3FETA 3F78A 4FKBA 2Z56A 3DE2X 5DASA 5L7YA 3PDIB 3I8SA 1I2MA 2BFBA 1GXSB 3GLHB 5CW2A 2W83A 1LFDB 3LKZA 5DH9A 1HMPA 4KXXA 4N5NA 5DGXA 2D0PB 2R8EA 3PF8A 1CETA 4IDQA 1NBME 3CX3A 1T26A 3RTAA 1UC8A 3YASA 1GR1A 3OPQA 5FTJA 2IYAA 2KHZA 2WTUA 3LC1O 5BQ5A 3T5PA 3S0JA 4U3JA 1GPMA 3FPKA 3Q41A 2P9FA 3EDYA 4OQQA 5B4UA 1JEAA 3F73A 3THXA 1MAAA 1E5XA 1G16A 1J70A 4PX2A 5ESXA 2FRXA 5HTKA 4B7UA 4RF3A 3PNOA 1JAIA 1SZJG 1TLFA 2P40A 3HY4A 1QO0A 1G3IA 2GVZC 2QN2A 2B25A 1YACA 2MSCB 4I4NA 3BMCA 3EFBA 5AW1A 4RTNA 3KQNA 4NV0A 2VF5X 2DU8A 4GKKB 4K6OA 2XGOA 1QTRA 4DLXA 1UC4B 1P6XA 2VF2A 3JVIA 3LWNA 4GP7A 5K4HA 4QOFA 4L8VA 3G82C 1KO8A 3FCUB 3CKKA 3QQ5A 3QVUA 4I4CA 4NDAA 2GPBA 4F2PA 1NR5A 1S3SA 2JDID 2WQ6A 4JOQA 2PH5A 1FTGA 1N4DA 4YRNA 1NASA 3CH7A 1K2VN 4M0LA 3QLEA 10MHA 4E13A 5FDFA 2V6JA 1LLUA 1T6NA 1TZ2A 3FZQA 4D9GA 5E4YA 1YVPA 3IP7A 1ID1A 4YXFA 1VPEA 1XFDA 1ADGA 2D5IA 3NOVA 4KXLA 3V4FA 1LK0A 2JVKA 3HN7A 2ZJYA 2FI1A 3QEKA 3UCEA 4CG3A 4W5NA 4XCXA 2WD7B 1L5GB 5L8VA 4RHYA 3LPLA 1SPXA 4CTNA 2Z6VA 3CY6A 3V8RA 1JKMA 1FDRA 4PBTA 2AEEA 4C0WA 2Z95A 3EGVA 2UZIR 1FFXA 1U90A 1DAGA 4RTKA 4MW1A 2QNIA 4CCWA 3NETA 2YYAA 1T8UA 5HFNA 3TS1A 1K08A 4AICA 3IHLA 3OOWA 2Z09A 4UJ5A 2B37A 3TLMA 1XTZA 2PHZA 2WQ7A 1VGVA 3V8QA 2CLSA 2WOOA 3WGNA 3EVZA 2C8LA 4PX3A 2P9ZA 3KLOA 4G1UC 4K46A 3HCNA 1F20A 1ND6A 2D1QA 3CF6R 1LJLA 3Q7RA 4CKBB 1KQ3A 1S1CA 4F5DA 1E1QA 3BJIC 1F2TA 2DT5A 2WMYA 5FIUA 2QTNA 3ZWAA 4HN9A 2WYVA 3ONWA 4GBJA 1KIFA 4NPAA 5E3HA 3CFYA 3DP7A 4PPNA 3DGFC 3GEMA 1LU9A 3AINA 1NW7A 3K6RA 2F17A 4JLVA 2CLCX 2XY4A 3W3AA 4WOBA 4X8MA 2Z8YM 2QPOA 1LRLA 1QUFA 3FAKA 1WU7A 2QVLA 3LRTA 3ILXA 4YROA 2JAPA 4RQBA 5IDVA 3OQOA 2NG1A 2O14A 4CKWA 3CC8A 5DNUA 1N6PA 1Y1TA 3SS9X 3CNQS 3RV4A 1KJJA 1IBMB 3PTAA 3PEVA 3SC2A 1WUTA 1RLMA 2RGNA 4BBAA 4LZAA 1SCDA 2OZKA 3VO9A 4EUKA 1P9LA 2G28A 4J4HA 3ZDEA 4ATNA 4MQUA 5K9ZA 4PPFA 3NJ4A 5JO9A 2B3DA 3ZE1B 4CPDA 1C7RA 4DA4A 3KSRA 1P4GA 3AGPA 3DDUA 2AJTA 1CT9A 2I7XA 2RGEA 3SIPA 5HJEA 2QPAA 5DCYA 4BFUA 3EY4A 1OI3A 3OZIA 4KBYA 1OXXK 3TLJA 3WJ7A 5CH8A 2BGRA 3BWVA 4F5WA 2VATA 2XMCA 3PQ6A 1F6BA 3A3PA 1TYZA 1YB5A 1MQSA 2JCSA 3MFYA 3O4HA 1X9HA 1XDDA 1Y89A 2EKBA 3D6JA 3K0AA 3QVKA 4MWGA 5AKGA 3QE9Y 4Q9NA 4EG3A 3GJ3A 2K87A 1G8FA 1GNQA 1M67A 5AK6A 1AN0A 2ZIFA 4M1ZA 3U37A 4DLVA 1YIAA 1Z56C 2B8NA 5TARA 5IULC 2LPMA 3WDSA 3B1YA 3K2IA 4KN9S 5EMNA 2Z58A 4AWBA 2FE1A 4LVOA 3BL5A 3AJEA 1JLHA 2OFPA 1TLTA 5HM6A 1GNRA 1VPVA 2DECA 3SFZA 2E5LB 4NEHB 1K7FB 1GCAA 2IGBA 2IZ6A 2JLXA 4UREA 1QLHA 2QXTA 4QNMA 4RJKA 2QDXA 2IX3A 1E7MA 3L4BC 1EJ0A 2WWYA 4WK6A 3L7AA 4IDNA 1T2DA 2G5GX 2WYIA 5A62A 4XASA 3PHCA 4OJKA 1BDJA 1IN6A 3AQIA 2V7EA 3ELDA 4XB1A 5HUQA 1H2FA 1KQGA 3BTSA 1HTWA 4OFZA 2BFCA 5JH7B 4FWTA 1IIBA 1TJ4A 2XA9A 4FCTA 4LYYA 4XARA 4ER7A 3X44A 2R5FA 5IBRA 3N2EA 4UCXA 3J81A 4LBZA 3KCQA 1J0XO 4M88A 4CYMA 3IP8A 4ETMA 4ZZ3A 2J3EA 4UBMA 2H31A 1U9JA 4F6CA 1FQKA 4GMFA 1TJ3A 4E22A 2P2DA 1E6MA 1LBHA 2KM1A 3C15C 4LVNA 3RREA 4WOKA 1QO0D 2JI4A 3O3OB 4H7FA 3D59A 1ADYA 5EZYF 4B0PA 4ZGWA 2D54A 1FS4A 3FZEA 1PJ4A 4M53A 2O59A 2R00C 1B1CA 3IPYA 2V0NA 4UVDA 3U80A 1IM5A 1P0FA 2X9VA 1TIPA 4IIHA 1GQSA 1C8KA 1IXRC 3I34X 4W4TA 3T3OA 5AK3A 4ZA2A 3LIPA 3JQPA 3VPCA 2CXQA 4G4IA 4MB6A 4OP1A 4R2IA 4AL4A 4DHEA 5BORA 1KPIA 4MA5A 1N2ZA 2MIIA 4IYJA 1G55A 2C5LA 4RH3A 3OP1A 1ULBA 2CJWA 4INOA 3W5JA 1YOBA 4IV8A 4KYTA 1XZEA 5HF8A 2PV0A 2RH8A 1EZ1A 4B0OA 1O03A 1B42A 2REQB 2OEPA 3SJ7A 3ANXA 3F96A 4JBNA 1CUAA 1TTHA 4UXHA 1OX6A 5CXQA 3ENNA 1W9MA 9MHTA 3SEQA 1XHEA 1XTIA 4C4YA 5HBGA 4CMBA 1Q50A 5F5LA 4Z1MA 4E5DA 5D01A 5AM0A 4M1TA 3E9RA 3ZTYA 3H9EO 1ZOLA 3HBNA 3OU2A 3TLYA 2Q6LA 2RCNA 4GWLA 3E81A 4JB3A 4V02A 1S6YA 1U2DA 1XEXA 1GA1A 1OJ7A 1YFZA 3CINA 1XLUA 3EQ9A 4TMXA 5LP1A 3CVVA 5SZJA 1QYDA 1P0MA 2Q4EA 1GKKA 2JIZA 2XSZA 3JYNA 4WZBE 1PNRA 2GAFA 1D6JA 4DCVA 3RROA 4NBLA 3IVAA 2VHCA 5AKXA 3S4YA 3RVBA 4BX8A 1OLXB 4HAYA 5H3HA 2P5YA 1VI5A 4PNHA 1XTBA 3L43A 1Z2CA 1R16A 2VK2A 2PR7A 1XJCA 3KXKA 2C88A 5T6MA 1KDVA 1U0JA 3CX8A 4RD4A 4A0GA 1CE8B 1IULA 1E89A 2JH9A 3PYMA 3L4BA 2JHAA 1BN6A 3FDXA 1E0DA 3MBKA 4JR0A 1Z3CA 2TECE 1ZGHA 2ZBRA 4CL0A 3E0QA 1KHTA 3E05A 2ZJ0A 1NVMB 4NE9A 1JHUA 1L6RA 3PUHA 3JSXA 3B5JA 3R40A 4M8SA 3WV5A 2YINC 1Q91A 2GARA 5C7OO 5TSDA 2GZ2A 4OJYA 4EATA 4E5SA 4W9MC 1W4CA 2HH9A 1LPPA 2C2YA 4XSGA 4ZHQF 5IM4A 4ILEA 4JUDX 3KETA 3QP9A 4IHQA 1KFJB 1BU8A 2IBSA 2NU7B 3TTYA 2BGJA 1L4BA 3VNRA 4FPXA 1C14A 3LVRE 4HPJB 1YR6A 1IZ7A 1FXUA 3EEYA 5BQPA 3VKWA 4DWVA 3AVTA 1V1MA 3PQ5A 4ZCIA 3EMKA 1VE1A 1E2EA 4M6WA 4BV2A 4HNTA 4R5HA 3BCHA 3T5GA 5B57C 3VTKA 4E12A 2VHVA 4MV5A 2O6LA 2GASA 3IQXA 3NM6B 4R54A 3D0QA 1AXEA 4I5EA 5HG0A 1N2IA 4D43A 4DF3A 3ZJ5A 4MUKA 4RSMA 5JCPA 2PANA 3CSSA 1Z5GA 1FRZA 2ZRGA 4OB7A 5CLQA 4QOJA 4QELA 1AQJA 2D62A 2VH2A 3BXGA 3TTVA 1J00A 1U8YA 4A0RA 3FNIA 1PTJC 3E23A 3ZCSA 1E5QA 2FFJA 1XJWA 3EGEA 1YHNA 3JW8A 4GSLA 4IDEA 1EVIA 4I6GA 4QDUA 3IAHA 4TOIA 2JGEA 2C8KA 1JDVA 1SHZA 4JQZA 4O1MA 1PFWA 4MPPA 4RM2A 2PUCA 2M6KA 1LUAA 1VP3A 3RUEA 2CZGA 1D5CA 5C9ZA 1PNQA 1BG6A 2V8BA 5H4GA 2ARKA 5CUQA 3RU3A 3H1EA 2WIGA 1DBSA 4M8IA 3UCFA 3SVZA 1D4ZA 4JB8A 3OKCA 4CFYA 1BVHA 4OB6A 1LFAA 3FKJA 3P2OA 1I1QB 5AT1A 4GEGA 2Y93A 3BHMA 1O57A 1EZZA 3UC5A 4W1RA 3EUWA 1TTPB 2EERA 4RLQA 3JAMA 1DUSA 1NLMA 1PV2A 2EWWA 3CN9A 1TJNA 4KQKA 4D74A 2KW5A 1II8A 1X7DA 4YT8A 3M3HA 3ZHSA 3RUHA 3RWOA 3VFDA 1T4CA 4PZ9A 4BLVA 2UUAB 3OX3A 3R3VA 2W2VA 1XMVA 2BHSA 3HY6A 3LU1A 1KVRA 4PFJA 5KQMA 4TYNA 3HUEA 1FMTA 2FZGA 4FX5A 4RVCA 3W90A 3AL2A 3MJRA 2BYTA 5JSFA 2AD1A 3CJQA 1T34A 5CT4A 4BYGA 2YR0A 5BMVF 4B7XA 1CDEA 2C9BA 4NE2A 1W0JA 2C96A 3TQHA 4NBTA 2P7HA 1U4OA 4UZSA 5JJ5A 1G9SA 2XUZA 4YDQA 1VBFA 2CFIA 3OZEA 4B7ZA 1KYXA 1E7SA 1O8BA 1ONPA 2WA2A 3VSDA 3ZDXB 2IHUA 3U3MA 5BXQC 3AR8A 4R7TA 1WVMA 1YUMA 1E2MA 1YAHA 2NVBA 4RCYA 4C22A 4NMHA 5A4MS 4QU8A 4L9RA 5ERGB 4DOMA 3JCZA 5DNEA 1T8PA 3JQQA 2QOEA 1GPLA 4DQUA 3GK3A 2G09A 5JQGB 2OQRA 4PZZA 3BL8A 4BFYA 1JLMA 3MPOA 4YV1A 1SG6A 1ZNQO 3JWIA 5BN4B 2G40A 5F35A 3BRQA 3UANA 3QUCA 4KIFA 4TSKA 4ZVQA 2MINA 3B12A 4XOIA 5C1DA 4ENWA 3NRCA 2XB6A 3SX0A 4X1YA 4Z2AA 5ALRA 1TCCA 3K9WA 5AM4A 1EWTA 2WUDA 1K9SA 3QG5A 5AOVA 4DMMA 5ITSA 2HMSA 4MINA 4R6XA 1DFGA 5C5EA 1VKHA 1Z2PX 1H2RS 3CUYA 3GOHA 4KQXA 4RZ3A 5HCUA 4H7KA 3ZNOA 3IUPA 2F3TA 4PGFA 5TC4A 1VG8A 2WU8A 3WLNA 4ECEA 2BD0A 1CUEA 4I66A 4L4SA 1LI4A 1QM5A 2ZUWA 4ARBA 2VF7A 3B48A 3RVOA 1UXHA 2HMWA 3DGEC 2ETXA 2XTNA 3BFVA 4JCOA 4CG1A 5JI2E 1OFVA 2RHGB 2JGKA 2OCYC 4YPFA 4D8TA 1ZXBA 2NIPA 2DFVA 4C87A 4TRMA 3RT1A 3GUZA 2R96A 4AY4A 1EAYA 3TZBA 3ROGA 1IN8A 2NZWA 5F1YA 5FLXA 2DSTA 4NZ9A 1N5DA 2IEZA 3HFRA 3NHWA 4AN1A 4UHCA 2RAFA 3UJDA 1I33A 1VM6A 3H8WA 3L41A 3TVTA 3C3YA 1PS9A 1U2EA 5LQAA 4HX2A 3KVNA 1FRNA 1T24A 2EW2A 3IHTA 1YHZA 4LGCA 4RD2A 4RMHA 1JQDA 1L7NA 1T5OA 4CLOB 4LNAA 3DM9B 2H1CA 3G0DA 4UM8B 2PUVA 4J0IA 1EVEA 3P2EA 5BVGA 4OHCA 4EMTA 2CV2A 3NBKA 3CX4A 2QAGA 3HJGA 1FSZA 4S2UA 2I2WA 5G1OA 3OIUA 4RLHA 3FCSB 4AUMA 5JZ9A 2BI7A 4MQ4A 4CM8A 1D09A 2PV7A 4JHLA 3EVBA 3ZVLA 5CB4A 4AI6A 4E4YA 4F2WA 4JEIA 3QTTA 2FPGB 5TT1A 2QX4A 4AIIA 1XZKA 2OAP1 5I7SA 1EBBA 5T3UA 4BNYA 1BYIA 2BH9A 4J76A 3TG8A 1ZWLA 5DTJA 1PV4A 1GQRA 2AEJA 2Y66A 4IMJB 4P0PB 3F5MA 2CNLA 2HGZA 3AJRA 4MP8A 4TTIA 3UWMA 4Y6PA 1C0LA 2HDWA 4QHSA 3H1FA 1D04A 4G86A 1YS1X 2OGTA 3MXOA 4JX9A 2YY6A 4PCVA 1RDFA 1XUOA 2IQ5A 2JAXA 2WSSD 4KTVE 2F43A 3BJEA 1DWUA 3DLAA 4HLCA 4O0LA 2XQGA 4QYTA 3TLKA 4ODIA 1SCJA 2XGSA 4PYRA 3ZGZA 2O07A 1VZ2A 4I2VA 4LZZA 1IONA 1Y9DA 1IYZA 2NVOA 4LCEA 3S68A 1KMQA 4EEKA 1G6HA 3GFVA 2WM8A 4BNVA 3TKLA 3KK0A 4AMVA 4F3RA 2YYYA 1T1GA 4Y2RA 2G88A 3D6FA 3ROKA 4EX7A 5LQJA 4KWTA 1W8DA 4DC1A 4ND3A 4B45A 3R0ZA 2OCDA 3LVQE 2OHHA 2WSBA 3HKBB 4FGZA 3UMMA 3H3XA 1X7ZB 3MVEA 1G4AE 3PI7A 2B35A 1CJVC 6CHYA 1PT5A 4RPGA 3BMXA 2EP8A 1A95A 1T1SA 2UXCB 3DO8A 3V2HA 4FC7A 2F2TA 2G36A 3MS7A 5AOCA 2P8JA 1E92A 4AX4A 3NBAA 4DIOA 3CVXA 4IXTA 2H08A 4WJKB 2V9ZA 4RF2A 3LPNA 2HADA 3OF5A 1EGMB 2OYRA 1E2QA 1F6WA 2RFLA 3B7GA 1Q3HA 3CJTA 1NONA 3JZIA 1DNPA 3RD5A 4BUJA 1R6DA 3CZRA 4IEIA 5DKFA 8ABPA 4F93B 1FW6A 2P9YA 4RH1A 4R68A 3I52A 2WAMA 1XRJA 2WNIA 3PVCA 3S2EA 4MYTA 1QP4A 4ND1A 4JNKA 1SCBA 1HR0B 1NT4A 3LOQA 2HTFA 4II3A 1ULSA 1NKTA 4AYTA 2YXPX 3IBFA 3GHHA 4FOSA 4KXWA 1L3BA 3Q40A 2QL6A 2IXAA 4V39A 3ZQ6A 4CMHA 2PU7A 1W6UA 2HD4A 3AF4A 3G02A 4H3SA 4LDAA 4PO8A 5A9SA 3SNKA 4E5PA 1NKSA 1L1EA 1ZMXA 4YJGA 1G9XA 1L7MA 3OBBA 3ZG6A 1MAVA 1ULHA 3KZMA 3LHFA 4KQ6A 3JQ8A 5TQ2B 5A05A 4JYMA 4J94A 3GELA 3IQIX 4LRXA 5DBGA 3UTCA 1F4PA 4DHWA 3U5TA 3P4YA 3BFXA 2P2CA 2XMDA 1BVYF 3DXXA 3F5DA 3OBIA 2ZRFA 1Y9EA 3H75A 3N7AA 1JR4A 4UJ3A 2X5XA 2C2MA 3EMVA 4M1EA 2ZDHA 4GYYA 4I3HA 1KEUA 1SA0B 1PZHA 1SKBA 4I5GA 2UAGA 4QUJA 3GIWA 3FGOA 2FY8A 3I28A 4HWKA 3VH3A 3KSZO 5M29A 4BU1A 3RRXA 3CZ5A 3O8OA 1UP6A 3F3MA 3T5TA 1XJ0A 3UATA 2FW8A 3UJPA 3IKTA 4O5OA 2XB8A 4JBYA 1G8SA 3KR9A 4KDEA 5LQRA 4CGZA 1IQRA 2AMFA 1JJFA 2CVQA 4PFQA 3LQ1A 1VDZA 3T1QA 3ZU4A 3TLEA 1RRMA 2ZIUB 3AX6A 3DSRA 3V7YA 1AZTA 3AYXB 4AJ4A 3PQ4A 2J87A 4XFKA 2WZBA 1TZMA 1C8LA 5BP7A 4ZZ2A 4JYAB 1XRRA 2NUBA 5JSYA 5IZ4A 1E3TA 2ES4A 4G5HA 1KEKA 4OREX 2W4MA 3GVPA 5E3JA 3OE4A 4C43A 1RQNA 2QPTA 4PPQA 1E2DA 1OHHD 1PJ8A 3UOAB 1W49A 1A76A 1ZM7A 1LNZA 1TQ4A 2XT6A 1H2XA 4ALKA 1HORA 2I4NA 3B3GA 3SZ3A 3D5QA 1VB3A 4ZHSA 2PBRA 3I04M 3GLRA 1SUDA 3T4EA 4TSRA 1DRVA 2H9AA 5A9TA 2B82A 2HLHA 3PE4A 1OF1A 3IVXA 2IP1A 5JFTA 1XVIA 4OAPA 4G41A 2GZ3A 2IYFA 2ZFUA 2ZTLA 5M04A 1Y7PA 3NBQA 4X20A 1GGMA 2R751 2VHUA 2WC1A 3EASA 1GVHA 3GVIA 5EHZA 4N5MA 4U7TB 5KJEA 3HK2A 4P4SB 3V1UA 1I7SB 2D3TA 4ND4A 4IDFA 2FN8A 2G07A 4LN1A 4KR0A 2I6TA 1JTEA 3E9YA 3ZJ4A 4CLDA 3WK6A 2ZUEA 3V6MA 1AA9A 2ZI4A 5A7HA 3MUNA 3ZJVA 2AQIA 3O91A 5KZMB 5JRJA 4U7WA 4YI5A 3FHTA 1NXOA 2G1UA 3P9CA 1PYOA 2EX0A 2PL1A 1N9ZA 4WLNA 2CLHB 5LUAA 4E5YA 1YQEA 2XCIA 1YMVA 2HDHA 4AB1A 4TS1A 4UPEA 2YRWA 3ICPA 2I4LA 2YV4A 4F8JA 2MSNA 4JT4A 5KC9A 3R9IA 4YY3B 1C7IA 3D54D 1HFEL 4GBGA 4K9SA 3UWPA 4E14A 2C8JA 2EZ8A 2HM7A 2ZQZA 1XMSA 5B58C 2F7SA 4B6SA 2XOKD 3SDBA 4LY3A 1AIPA 1IHOA 2A9RA 1QPZA 1AZSC 4DCCA 3OEYA 4C29A 3O4IA 5EJ5A 1KSGA 3FFWA 1TVKB 2ZROA 2LIPA 3LPDA 4NAVA 4EI8A 4M0KA 1G20B 2E85A 3VM6A 4JKYA 4GX2A 2AUTA 3D3WB 3F8WA 3W2HA 2AS0A 1NVKA 2VUTA 3PSHA 2WWVD 3SSOA 1SVLA 5AW9A 4BUZA 3WGKA 1G20E 4IIJF 1KH1A 1TL7C 4QA9A 1OUMA 3ESRA 5EJEA 4F3TA 2B4KA 1IUNA 1Z17A 2C82A 2ZU6A 2FN9A 3GGJA 3H84A 3MWJA 3Q8WA 4LNUB 5D5PA 1QHNA 2JLQA 1XBTA 2G25A 2ZS8A 1NIPA 2QX9A 1AUXA 2YWEA 1DKMA 3MWKA 1EFPB 2WIDA 4HDMB 3MCZA 1C81A 3MYYA 1EK1A 5DGTA 2FPPB 4YJ2F 3FUWA 2ZRKA 5DNAA 2IPXA 3S2UA 3I2IA 3P0RA 5H81A 4WA8A 1PEKE 4J0KA 4RK6A 3OCVA 3V7NA 4EM6A 4WAUA 2NSLA 4MW9A 5FOSA 2X42A 3FVRA 3OFNA 2Q99A 4O59O 2GA8A 2MSWA 2UVQA 3ANMA 5A5DA 1KZ4A 2JHPA 3CEPB 3HJRA 1Q57A 1OA1A 2WSMA 5EESA 3GBVA 3ZW8A 3UGKA 5AYVA 5BPFA 4YT2A 3HCDA 4Y1RB 4E5NA 1JG3A 4ZT6A 4IJ5A 2RE8A 4DWJA 1ZVVA 1UFKA 1EH5A 2HL6A 4FB5A 3ETEA 4L07A 2AW3A 2ACWA 2HHAA 3DLCA 3EIHA 3RS9A 3S2FA 3UY4A 1P4RA 3C41J