1ZMTA

Structure of haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (r)-para-nitro styrene oxide, with a water molecule in the halide-binding site
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
molecule keywords Haloalcohol dehalogenase HheC
total genus 87
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zmtA00
1RJWA 1NNUA 2B36A 3AU8A 3G1TA 3Q1LA 2C07A 3MJVA 3SX2A 3RU9A 1PQPA 1AUPA 1CETA 1M66A 2Q3EA 7ADHA 3DDNA 3LZ6A 4I9HA 3PJEA 1YBAA 1KIFA 3WQSB 2I5PO 1BXGB 1Z7EA 5EPOA 2GRAA 2UVDA 5F5NA 1KETA 1LU9A 1Q7BA 2GN6A 3EYWA 3K2EA 3QV1A 5C37A 1PJSA 4UUMA 4QUKA 4NMHA 2E37A 1EBUA 3K92A 3L4BC 1ZBQA 3GHHA 3LT0A 4GWKA 2VZ8A 2JFFA 4OSOA 4BNMA 2J8ZA 1VSUA 1SC6A 1ZK0A 3CE6A 2PKQP 2UV8A 1MG5A 2YDXA 4OOEA 1HDZA 1T26A 3KYBA 3PLNA 1JU9A 1K6XA 3GDOA 4YAJA 4XR4A 2D5AA 3AI3A 3GVIA 4YJFA 2B69A 5FF9A 3SC6A 4BUCA 3W4IA 2JCXA 2G76A 3GZNB 4TQGA 3S8MA 3RBVA 3A9WA 2B35A 3DBRB 3PYLA 4BB5A 2CFCA 4L74A 1U3WA 1C0PA 3U0BA 3OHSX 4CMCA 1P1FA 3IUPA 3RASA 3FNFA 1SAYA 1YONA 3AY6A 1ULUA 1DC6A 3S2GA 1CJCA 5G0VA 3PVZA 3GEDA 3WSWA 4CM9D 1E0DA 3L07A 1PJ3A 1WMAA 3TZQA 4DA9A 1YB1A 2DTDA 1VI2A 1EUDA 5DBGA 2P68A 5GZ6A 4DPMA 3BTSA 1C0IA 1Z75A 3C8MA 1ZK4A 2HU2A 1A72A 1L1FA 3GPDG 4IJWA 4DQVA 4E21A 2Y1GA 1SOVA 4UVIA 4CLRA 4QT0A 3I9JA 4XQ9A 5KIAA 3BIOA 4BOYA 4JLWA 5B4UA 4TMFA 3GUYA 4II3A 2PZKA 2CDAA 2WJPA 5DP2A 3ZHXA 5IZCA 4UEKA 1BVRA 1PJLA 5IZCC 1EZ4A 3E5RA 1A27A 3Q2IA 3P2YA 3Q2KA 4FFMA 4RPLA 1IULA 1FJHA 4FJ2A 1UZMA 3O03A 1HYHA 4Z0HO 5I8WA 2AE1A 3HDYA 3BZUA 3IKVA 1J5PA 3OM9A 1Y81A 2DAPA 2X0IA 4NPCA 1IY8A 1LJ8A 4BKOA 4B3IA 1H2BA 4D3DA 3U49A 3ZHZA 1PQUA 1NR1A 1GEGA 4LK3A 2LDXA 5TT1A 5JMPA 1TEHA 3F4LA 1FDVA 1Z7BA 2ZCUA 1LDBA 3QVWA 4H15A 5KVCA 2Z95A 3H9EO 5EMHA 2ZYAA 1YH3A 2JD1A 4EUHA 1VL6A 5C3MA 5CDGA 2VOJA 5ES3A 2AQ8A 1DIRA 2PFGA 1I3MA 4XRGA 1N9GB 4NU6A 1GEEA 4L4RA 1T4BA 3TWOA 4IDDA 1ZNQO 1HTBA 4W7IA 1KEUA 3OJOA 1HE3A 4PG7A 4ZQEA 4BO4A 1UP6A 2QRLA 4N54A 4W9NC 1C1XA 3U62A 5FI3A 3DBVO 3WQQA 3JQGA 2Y0CA 3H5RA 1DOHA 4MP6A 2NSDA 1YL5A 5CG2A 5JAZA 1H93A 1H6DA 1MFZA 3DHEA 1EVZA 2PY6A 2Y1DA 4JN6B 4K26A 3JD4A 3F1KA 1VC2A 5BQFA 4BNIA 2I65A 4YJDA 4MVJP 4DMMA 3DC2A 3F46A 3HFSA 2NNLD 3AOEA 5IXSA 4E2ZA 5JNLA 4I5DA 1SCUA 2X7HA 4WLVA 3WIEA 1Y8RA 1WDLA 4J3FA 3HN2A 1E6UA 4D7AA 1AHHA 3TL2A 1EDOA 3GRKA 3MJCA 4O63O 1FDUA 1J4AA 2BELA 2C54A 3BA1A 5KWEA 4TKLA 1Q7GA 2B4RO 2EJWA 5FEUA 3PEFA 1K89A 1EQ2A 4Q3DA 5CPFA 1VL8A 1YQXA 4ZQHA 3UGKA 3I9MA 4P4LA 4KUEA 3D4NA 3ZZNA 1XLTA 4K6CA 3VZQA 1PJCA 5DCWA 3OQBA 3ITKA 2HQ1A 4U0KA 4LW8A 4BNFA 5B4TA 2R2GA 1T2AA 1YO6A 1HZZA 2B4TO 4BO3A 2X5OA 2ZKLA 4RZIA 4JX8A 3V1YA 4TZTA 2Y1EA 2O48X 2YW9A 2ZB8A 2C0CA 3WTBA 2PGJA 4DIOA 4CLEA 3EGOA 2ZB4A 4XJSA 4J0EA 4R69A 5MGBA 3VPSA 4NJMB 1HKUA 2NUAA 2YHUA 5BSEA 4RVGA 2Y67A 2NQ8A 3M1AA 4CV2A 3OJ0A 1NVMB 3ORFA 1KVRA 2EWMA 2TMGA 2A92A 7MDHA 2P9GA 1L7DA 4YAKA 1GCOA 2YJZA 9LDTA 4Z9FA 3JQAD 4J6FA 4R9SA 4LMPA 3NGXA 2VHZA 3UF0A 3W1VA 4IMPA 1EDZA 2DPGA 4YAGA 1ONOA 3KOUA 1F12A 1NVTA 2W8ZA 3F9IA 4Q3AA 4ZGWA 1H5QA 2EP5A 3INGA 1A9ZA 2O2SA 1NYTA 4J9VA 3F4BA 3A4VA 3KLMX 4DRYA 3IL2A 4PRLA 2FPGA 1Y9EA 3FR8A 1BMDA 3OQ6A 3EZLA 3SJ7A 1JWBB 3VH2A 1YJQA 2AQHA 1RWBA 4A7PA 4NK4A 4M87A 5FFFA 3TN7A 4R1UA 5AXCA 1MX3A 3EMKA 2NLOA 1EE9A 3GPIA 4BNUA 2O3JA 1HSOA 1NVGA 4IS2A 4N7RA 4AJEA 4LSWA 5JCJA 5IFLA 1ZJZA 2Z1MA 4WKGA 2VRCD 1ADFA 2OBYA 4FQ8A 4B7CA 1M6WA 4M89A 1NFRA 2AEJA 3R3SA 2J3HA 3LC1O 1R0KA 1HRDA 3ZHBA 3H2ZA 3OH8A 3A28A 4EDFA 3S2IA 1ONPA 3RC7A 4Q9NA 4DREA 3FF4A 3FSRA 3ETGA 1FF9A 1I8TA 1MA0A 4M55A 4MVJM 1F8FA 3ON5A 1HSZA 5C7OO 1U7HA 3JYOA 4XEHA 3WBFA 1YB4A 4MPDA 4RPGA 4S3MA 1PR3A 2A94A 2GD1O 3U4DA 4E5YA 1GUYA 3FI9A 2J3JA 2YV2A 4OH1A 4OQYA 2FR1A 5KJ6A 3WYEA 2Y1OA 4JQCA 5G4LA 1CF2O 3W6ZA 3U09A 4ND2A 1JKIA 2E49A 3VDRA 2Q4EA 3NRCA 2I76A 3UXYA 1DAPA 1XIVA 5L4NA 4QO7A 5L7WA 4A0SA 1LUAA 5JBIA 1P44A 3D64A 3IAHA 4IINA 3GAFA 3GEGA 4NH4A 3L9XA 2PV7A 1P45A 4JP2A 3LC2O 5I7VA 2C29D 3CZRA 5AOVA 1P9LA 1GV0A 2NU8A 1QYWA 3FPLA 2OUIA 5G4KA 4CMJA 1ENPA 3D1LA 4H7PA 2HO5A 4EUEA 1YOVB 4RF2A 1PGJA 2A4KA 4RVHA 1J49A 4NIMA 3S2EA 3FNEA 3BTOA 3DWFA 3ICCA 5JC1A 3EZYA 3H4VA 3JQAB 4DQUA 4PLCA 4E31A 3C1TA 4URFA 1PJ2A 2AQKA 3GDGA 3WGOA 3I23A 1ONNA 2VWQA 1SB9A 2FSVA 2F1KA 3ETDA 4RLHA 2FN7A 3ZWCA 4DXHA 5I8ZA 3DMYA 4OIMA 4EJMA 1S6YA 3ZU4A 1GFSA 2GZ1A 4E33A 4J4TA 1R15A 3OETA 3OJEA 3ZWVA 3V2GA 5GZ3A 1IPEA 1MXFA 2CDBA 2CSUA 2GLXA 2X23A 4YXFA 4H3VA 3G1UA 1ARZA 4XDYA 3RUFA 5IDWA 3RBZA 1P74A 3SXPA 2YQ5A 1GDHA 4FGWA 2GASA 1ZVMA 5JY1A 4OYRA 3L4BA 4IJVA 4PG5A 3WDSA 3JQ8A 4GKBA 4RVFA 1I3NA 3AUAA 4RF5A 4XGIA 1ZK1A 4R5HA 5DZSA 5T6BA 5TSDA 5F21A 3L6DA 4JBGA 2QQ5A 4HWKA 1QP8A 4IIUA 4K9DA 2BFAA 2LDBA 4G65A 3C1OA 3CEAA 1B3RA 2DQ4A 4YTEA 4XRRA 1O6ZA 3F3SA 4U7WA 3SEFA 3FNHA 4J1QA 5HA5A 3RKUA 3H3FA 2CVOA 3M2PA 4WPGA 4KP7A 4GVXA 2YHIB 4IJUA 5DOZA 3RFVA 1S7CA 2BRUA 4J16A 3DZBA 5BSHA 4NBRA 1I3KA 1P1JA 4J1NA 1ISJA 1W0CA 3IIEA 1HYEA 2NU6A 4LRTB 2HCTA 1A5ZA 2NADA 3AM5A 1SBYA 4U8GA 4BHTA 4KZPA 4IM7A 3P19A 4GVLA 5DCYA 2DFDA 3E1KA 1RYEA 4WEOA 3A1NA 5ER9A 3E6AA 4DGSA 1KC3A 1VKNA 1MFPA 3KYDA 2VHVA 1PZHA 2P4HX 1W73A 1NBOA 2X8LA 1B8VA 2VHXA 3ROQA 5THQA 5FI5A 4BNWA 1YDEA 1GZ6A 2H6EA 1R4NB 5A5EA 2P2SA 3PYMA 4BGIA 5L53A 4GLOA 3MJEA 2Y68A 4YR9A 2V7PA 4BB6A 1V3TA 2ZK7A 4DIBA 3UCXA 3TZ6A 3AFNA 2UUOA 2WE8A 3WYCA 1E7RA 1EK6A 1KVQA 5AQ1A 3HJAA 1N9GA 2GYYA 3GNQA 1XQ6A 3GVPA 5L45A 5JO9A 4Z3DA 5TX7A 4F45A 3JQDA 3M6IA 4IDCA 4UVHA 4YT8A 1UDAA 1ZK2A 2EEZA 4PLHA 4OOFA 3WLFA 5JE8A 4JROA 4B4VA 3ICPA 3JQ7B 1GTMA 2C2YA 1GR0A 2OMEA 4MVJG 2J3KA 3KUXA 2W98A 4DC1A 4H16A 1WDMA 1AHIA 4RVUA 1E3WA 4RDHA 3I4CA 3E9NA 4PG6A 5L40A 1I3LA 4OGWA 4J9UE 4YRBA 5IDQA 2DM6A 2BI7A 1IL0A 2VZ0A 4YYZA 4NU5A 4YQZA 3G49A 1VM6A 2OFPA 3WNVA 1UAGA 4FS3A 4J1TA 2EKLA 1LSUA 2O7QA 3HN7A 3NTQA 3DZHA 4L8VA 3JD0A 3ZW9A 4KWIA 1A71A 1ZKMA 3D5TA 5DN9A 3WOHA 3TZCA 2P9EA 2W2KB 5JDIC 4D44A 2HRBA 2FP4A 5A3VA 4FDAA 1NHGA 2DPHA 5AXBA 4BKQA 4MOWA 1E1NA 3U4IA 3DTYA 4L9RA 1FMCA 3K8ZA 4BS9A 2D8AA 5L51A 1MV8A 3D5QA 3RJ5A 4DYVA 1Z45A 1PJTA 3BMCA 5IG2A 1FK8A 5IZ4A 1PZFA 1PS8A 1I2ZA 1LNQA 4BO0A 4D43A 5ICSA 3UVEA 5ENVA 1UP7A 3BHJA 2FHSA 2GERA 4E5KA 2CNBA 5K0ZA 4BQRA 4CLHA 4MO2A 2YQ4A 5BNTA 4CODB 2IODA 2GZ2A 4Y6SA 5A9SA 1MLDA 3ABIA 4KTVE 3WSVA 5FYDA 1NFQA 1JKJA 1P3DA 4OKIA 3RUAA 4Z9XA 3ANNA 1J6UA 1O0SA 4RL6A 5KVQA 1CERA 5HTOA 1Q1NA 1OFGA 2P4QA 1Z73A 5EQFA 2HMVA 2J5RA 3DQPA 2GN4A 4DL9A 1TB4A 1OOEA 1VSVA 3CKYA 3OJLA 1BGVA 1U2GA 2VNSA 2OGUA 3AW9A 3PJDA 4NBWA 1PGOA 3ST7A 4IGFA 5G0UA 3DOOA 4BO1A 4CJXA 1EBFA 2PH3A 3GC6A 4DBZA 2Q49A 4HX5A 1ZMTA 3JQ7A 4TRJA 1R6DA 2Y1FA 1E5LA 1PSDA 2VYVA 3WWZA 2DKNA 1X1EA 2X4GA 4E13A 3IDSA 4DBVO 5CHEA 3UH1A 3F47A 2HKIA 4TKMA 1NWCA 3A14A 1IZ9A 2DUUA 3NDJA 2WD7A 1XDWA 3QE3A 4HUJA 4IZIA 4E2YA 1NX6A 1FDSA 2GSDA 4CMEC 3VZPA 3C24A 1WVGA 2HMUA 3GOHA 4GI2A 1P1IA 1PGNA 3VKVA 4CMEA 4OXNA 4QFCA 1LLUA 4PFJA 3DZIA 1XEAA 2W4QA 2Q2WA 1ZXBA 3C85A 3VH1A 1UDBA 1OI7A 2AA3A 1B8UA 1HZJA 1JW9B 1QYCA 2FR8A 4J49A 3T4XA 3BTUA 4QSMA 4YJHB 3BYZA 5HBRA 5EERA 3QSGA 1E3IA 4HKTA 1Y8QA 1GAEO 1UH5A 3ONEA 1N7GA 1JAYA 4CM3A 3DOJA 2DVMA 4LCJA 4GMGA 2GN9A 2Q45A 3WNQA 1H6AA 4FCCA 4J2OA 3DMTA 2BFMA 1YWGO 1YRLA 2IEBA 3OEYA 4D3FA 4ZJUA 2ZJ1A 3E8XA 3TFOA 2G82A 2FWMX 3DZJA 5CEEA 3V8BA 2QZ9A 3ZN2A 4NDNE 5ICMA 1OC2A 1KY5A 2B83A 1I2CA 2VOEA 4LSMA 2YHIA 3FCOA 4EZBA 4A73A 2PD3A 2GCGA 1H9BA 2UUPA 1BRMA 3E48A 5I9LA 1F17A 1WDKA 1EQUA 2HAEA 4GBJA 1E77A 1ISIA 1QYDA 2AMFA 1WZEA 4OSPA 3W8EA 3HDQA 3DO5A 2X0RA 5U1PA 3H9JA 4CM8A 3I9NA 3OP4A 3GLQA 1FDWA 2X0JA 4BGVA 3GVXA 5G0WA 2QG4A 1VLLA 5AXAA 4JJGA 3GNSA 4BMNA 1EMDA 1WMBA 4Y98A 4GAEA 2ZCVA 2JD2A 3ADOA 4OL9A 5GZ1A 4W7HA 1HT0A 2UYYA 3HDHA 1YL7A 2Q46A 1TLTA 3PFFA 2X22A 1E7MA 1YE3A 5TJ9A 2D5CA 3NYWA 1NQAO 4CQMD 2VHYA 3GG2A 3QJ5A 3K73O 4W99A 1EVIA 3NX4A 4MVJH 2YFQA 1R16A 3KO8A 4BO2A 1OAAA 4BO8A 4UVGA 2ZTUA 3PHHA 4MVJE 3RQSA 1QV7A 1GQYA 4I5EA 3TOZA 5I7FA 2VZ9A 3UCFA 3ZV3A 1RM0A 3K2BA 3X2FA 5A06A 3FWNA 3DHYA 4GX5A 5A3JA 4M86A 1DHTA 4PCVA 2I9PA 4NBTA 3JTMA 3JQBC 1HDGO 5JMWA 1NP3A 4Z0PA 1NAIA 2XPCA 4Q3NA 1E1LA 5A04A 3OF2A 2C7VA 1E6EA 2X1HA 4MIYA 1ZUD1 2H63A 2OORA 4AJOA 3WJ7A 1EK5A 4BKPA 5H83A 5C5IA 4CPDA 1BTOA 3RAJA 2O3RA 2BGKA 2EERA 1IZ0A 1JVSA 4MVJI 1YB5A 1HETA 2BI8A 2Y99A 2NM0A 4ALKA 1X0VA 1YQGA 5ILGA 4NNJA 1A4UA 4RF3A 2HK9A 2CY0A 2VUTA 4PLZA 3FRJA 4RF4A 4ITUA 3RIHA 4PVDA 3QVOA 3E9QA 2PD4A 3Q9UA 5T64A 5A5FA 1AXGA 1ISHA 3PXXA 4M49A 3OBBA 3HSKA 4XA8A 1E7WA 4RPJA 3F6YA 1MC5A 2HJSA 4D0RA 3OFSA 1TVEA 4TRMA 4UREA 4PIVA 3VH3A 1HDCA 1YVEI 3RD5A 4M8SA 3MWEB 3ZNQA 4J4HA 1ZSNA 3RBXA 2NVUB 1X7GA 1E1KA 3IS3A 3DBHB 3L9WA 3C1AA 3PJFA 1LRKA 3QVTA 4OKNA 2AW5A 1B8PA 5BT9A 3SC4A 4FFOA 4PZCA 1ULSA 4NZ9A 4WOKA 3VPHA 3GVCA 4WEQA 4ND3A 4R1TA 1I0ZA 3PZBA 3L77A 4J91A 6ADHA 1X7DA 5TNXA 3B6ZA 3B1FA 2H5LA 1I33A 1AE1A 3MOGA 1ZK3A 4QTZA 3DAGA 4TVOA 1I36A 3JQ8B 3DTTA 1HE5A 3WGZA 1CDOA 2IZ0A 1QLJA 1BXKA 1KYQA 3DL2A 2WWRA 5GMOA 3ZU5A 1F8GA 3WGGA 3WIDA 5ITWA 4GX0A 4FPXA 3TF5A 4GL4A 1TI7A 1KBZA 1LI4A 2A35A 4C4OA 1V6AA 4YB8A 5T8KA 1SOWA 4FGSA 1G0OA 3GHYA 4EITA 4D79A 5T8KC 5DT9A 3ZWOA 3GT0A 1T2CA 3CH6A 1UZNA 4B4OA 4D41A 1N7HA 3GF4A 4BGEA 3T7CA 1I01A 2ZTLA 2R6JA 2AEMA 2EGHA 4Z3KA 3ZWYA 4AVYA 5IDXA 4RORA 1NHWA 1UXGA 2TMDA 3HWRA 1X7HA 4UVDA 4B8ZA 4C7KA 1PZEA 4ZN6A 3ZHYA 1P1KA 3ZWWA 5EESA 4CLRB 4CUJA 4AJHA 4J90A 3PHJA 3PWSA 4XKJA 1DLJA 1DC3A 2H1SA 2PZLA 2NTNA 1I10A 2C20A 3FBTA 3OA0A 2Z5LA 1R0SA 1M6HA 3HB4X 2NVWA 1KS9A 4ONEA 2CVZA 3UFXA 2GN8A 2PA3A 2Q99A 3WGIA 1X15A 1NASA 3Q3CA 2GPTA 1E3EA 2VRCA 5KCZA 3DXFA 1OZAA 3NV9A 2E4AA 2FMUA 3QQPA 4CM4A 1NTOA 1DXYA 1X13A 3NGLA 2CF5A 4NJMA 2P9CA 2E6UX 3GN1A 1M75A 5L7YA 4CM7A 4DQXA 1PQWA 2HMTA 1J0XO 1WNTA 3OIGA 5BNFA 2BFOA 1T2DA 3FN4A 3KEOA 3PIDA 3DMTC 4NFYA 5DF1A 2ZB3A 4GX1A 5B12A 5ILOA 1QV6A 3IQDB 1H6CA 5L95A 5KKCA 3EAGA 5JCJD 5JFOA 1PZGA 3HADA 4WLNA 4M1QA 1Y1PA 3MOIA 4NBUA 4PLPA 5F1OA 4YVFA 3HZZA 1E6WA 3ZWBA 1VKOA 1YL6A 1HL3A 2BD0A 3QY9A 3QWAA 3CUKA 1XKQA 5TC4A 5EQDA 5T57A 3TFQA 2RH4A 3LVFO 4OM8A 4R3NA 1KVUA 1D4FA 5TJHA 2QYTA 4GH5A 4GLLA 2NACA 5LDHA 2X9VA 5T67A 4AICA 4E0BA 1KERA 1KEWA 2X86A 3H5NA 4XIJA 3QVSA 2AG8A 2DLDA 2Q2QA 1LDMA 1LDNA 4I5FA 1E1MA 1VL0A 2ZTMA 1NFFA 4GGPA 3GVHA 2C5EA 1WWKA 3FPCA 1O8CA 4YPOA 1PIWA 2QZZA 1O5IA 1D1SA 1I5RA 2C82A 1K3TA 4CLXA 3I83A 3G3EA 2QX7A 1DFIA 1C0LA 2DTEA 5TRTA 5EINA 5GY7A 3RU7A 4CM6A 3D3WB 2VWGA 3VZSA 3FR7A 5AXDA 4CM9A 4G5HA 4D42A 3PQFA 5HRUA 3C7CB 2YV3A 4Z6KA 3D4OA 2P91A 3N7UA 1JDJA 2I6TA 3GMSA 1SMKA 3LLVA 3AU9A 2C59A 1PS9A 1KC1A 4ALNA 5KJEA 5BNIA 3K31A 1C3VA 1T24A 3NT4A 4NFSA 4Q3BA 3NTRA 4YJGB 2PZMA 1P31A 2WYVA 3JQFA 4IPTA 4ZA2A 4BKRA 4EGFA 2I99A 3KSUA 5DP1A 2NTVA 3ZWXA 4A10A 4ZHSA 1DPGA 3LU1A 1U9JA 4RQUA 3KM0A 3AJRA 3WMWA 4BMSA 3JQ9C 5DBFA 4PLTA 3WTCA 4PLWA 3U9LA 2YV1A 2ZYGA 3DAFA 1KEPA 3FD8A 4PLFA 3HHPA 4HXYA 2JL1A 4PRKA 2DT5A 1ISMA 4DIFA 4A03A 1LLCA 1GD1O 2J5QA 4R01A 1HE4A 3LT4A 4LCEA 3Q11A 4EW6A 1BXZA 2NQTA 1U3TA 1Y9AA 3H7AA 2ZIZA 3T7EA 1I32A 3GK3A 3DBHA 3ASVA 3QRWA 2Q1SA 4OJNA 3UW3A 3ONFA 3Q6IA 5DBIA 3PJGA 5C7IO 2YYYA 2RCYA 4J7UA 1B7GO 1GZ3A 2JFGA 4DLAA 3E18A 3EK2A 2FPIA 2AEFA 4GQAA 3WYBA 3ZNOA 1A7AA 3AUSA 4TWRA 1HLPA 5G4KB 5JY6A 1B0AA 4L73A 2D3TA 1V0JA 3BMOA 3TDKA 3EW7A 4R41A 1LQTA 3NEPX 2EW2A 5LDGA 3KHUA 1MUUA 3DEYX 2CZCA 3JQCA 3MJ4A 4UUNA 2V6MA 1K0UA 3ASUA 2PD6A 1WPQA 1HEUA 5A9TA 4PLVA 4A2CA 1BVUA 2G1UA 1LBEA 2J5KA 2OXIA 1TXGA 3PHLA 4OQZA 3ROPA 2EF1A 2Q2VA 1EEHA 4E4YA 1JN0A 1QORA 2Y0DA 1G1AA 3ZWNA 4ND1A 3I9LA 4CMAA 1QKIA 2Z1NA 3VZRA 1X1TA 5CDTA 3E82A 4J4BA 1NQ5A 3CPSA 1PR9A 2VRBA 1C14A 1PEDA 4E12A 1Y8QB 4ZU3A 4QFDA 2Q1WA 3WR5A 1JLLA 4B7UA 3OSUA 1GUFA 5EIOA 4CUKA 3JYLA 2RAFA 4R4JA 4Z0TA 5CEJA 4FFRA 2X9GA 5JAIA 4AJPA 4WLEA 1MGOA 4J43A 1UXHA 3AM3A 3PRJA 1V3VA 5JAQA 4BKUA 2W2LA 1BW9B 5BSFA 2IZ1A 4PG4A 5G2OA 1SEPA 5F5LA 1LXCA 4YT2A 1TT7A 3DOCA 4E5MA 5G0SA 3NT2A 2Q1UA 2IXAA 4AJLA 4CQMA 4HBGA 1PL7A 4HFJA 4XIYA 4FR5A 1CWUA 3LLSA 3HQ4O 5I7SA 1NQOA 1WZIA 3MZ0A 5L3ZA 1PL8A 4R1SA 3IC5A 4BNKA 1UAYA 4X54A 3GDFA 4LISA 4KOAA 4ROSA 2Y1CA 5H82A 4DVJA 1UUFA 1Y5RA 4AG3A 4IZHA 1QYXA 1T2EA 4CM8B 4DTIA 3IKTA 4I08A 1YBMA 4GKVA 3F5QA 2PKQO 3NJ8A 4O59O 5I9NA 4ND5A 3LT2A 1Z74A 3INRA 4RPKA 2X6TA 3S55A 4FFNA 5HWSA 1DB3A 4YWJA 1DBVO 2BMAA 1VJTA 1UP4A 2PH5A 3MTGA 1G6KA 1U8FO 1UR5A 1C0KA 3CMMA 4I1IA 1MB4A 2XOXA 4YT5A 2EGGA 1H0KA 4LN1A 3GQVA 2XAAA 1DRUA 4BQPA 3GAZA 5K6AA 4MKRA 2X0NA 3M1LA 5I9MA 4Y67A 3O26A 3LF2A 2XXJA 2Y05A 1ZXLA 3PTZA 3V2UA 5JYEA 1Q0LA 2GZ3A 4Z9YA 3JD2A 4NI5A 2AE2A 3AUUA 2D4AA 2YZ7A 4AJ4A 4NG5A 4CMBA 3VVCA 1YGYA 4HV4A 1E3JA 2VUUA 3QWIA 5HS4A 4I8XA 3IJRA 1XCBA 2JAHA 1O94A 4CR7A 4B4UA 5BSGA 2HDHA 1XWFA 4G81A 1IHXA 4UUOA 3BMNB 2QRKA 4N5MA 1DLIA 1V9LA 3E5MA 4E32A 1Q2XA 2IE0A 2FPPA 3O8QB 4B4WA 1V35A 4FN4A 4ID9A 5TT0A 3RFXA 5CAEA 4JXKA 4U6SA 4E5PA 4CR6A 3OMLA 4R51A 4DPKA 3N58A 2B37A 1OMOA 1NM5A 4GWGA 1BG6A 4A26A 1EFLA 2RH8A 4IXWA 5DCUA 3GN2A 5IAAA 2B4QA 2JHFA 1N92A 1NPYA 3VKUA 3RJ9A 3VVBA 3X2EA 5KKAA 1ZFNA 3D3WA 1WLYA 4WNIA 2X9NA 3JQ6A 1DRVA 1EVYA 1BSVA 1XHLA 4ESOA 2JCVA 3ENKA 1JQBA 3QIVA 3VDQA 2X5KO 2O23A 4BNGA 4NK5A 4R5MA 2CMDA 2PNFA 1Q7CA 5EN4A 4RO0A 5KJCA 1FXSA 1E7SA 2JCYA 1CRWG 1JTVA 4RQTA 1JKFA 2ILTA 2WTBA 2WD7B 4OMUA 1QLHA 5KOIA 4OXKA 4RV9A 1P33A 4OHUA 3D7LA 3I6IA 2V6GA 1K2WA 3I4FA 4BNZA 4KUGA 1IPFA 4W4TA 3TSCA 5U9CA 4GMFA 2UDPA 3TOXA 4UEJA 1CQIA 1WP4A 3IJPA 3BMOB 3UICA 2BLLA 4WCFB 2Q1TA 4K6FA 3MJTA 1DIBA 4XQCA 1DEHA 1CIVA 4BV9A 3CSDA 2ZB7A 4YRAA 1HDOA 4IDGA 3U4HA 4Y8VA 1T2FA 2GO1A 3WGTA 1DFHA 5JYDA 2NTJA 5CFZA 3HNPA 3ZNNA 3LSYA 2FZEA 2NWQA 4KMSA 4PZDA 4QO8A 3SBOA 5DNAA 3STHA 4FOOA 2H9IA 1FDTA 3ZV5A 3OIFA 1EUZA 1HWYA 3PPIA 5BR7A 2EG9A 1QG6A 4CM4B 1GCUA 4WOJA 4II2A 4MKZA 5JPIA 4GGOA 4BNNA 4F6LA 3RFTA 5CP8A 2I3AA 3F5SA 1NXQA 3K9QO 5FWNA 1ADGA 2HSDA 1LLDA 2ZQZA 1LSSA 3DHNA 4B8WA 3OECA 4S1VA 3W4JA 3GFGA 4J7XA 4D0SA 2IEDA 2EV9A 3GGOA 3WB9A 1E7YA 1XR3A 2GF2A 3INTA 1LEHA 3BMCB 3GNTA 1F0YA 2VT3A 2CF6A 4PVCA 5JW6A 1EVJA 1LX6A 3KV3O 3BTVA 4CMGA 5H81A 4MP3A 2D2IA 3PFWO 3TRIA 3WX0A 4Y9DA 4CMKA 2JHGA 2O50A 5JS6A 5A1TA 4NQZA 3RCBA 1HLDA 2DFVA 1ZMOA 3DBLB 4FSHA 3HFGA 3W6UA 4B79A 1UXIA 1C1DB 4RVSA 3S1LA 3PQDA 4L4SA 4KUHA 4PZEA 3HB5X 3N74A 4PG8A 5B1YA 4P4NA 1DHRA 2AHRA 3O4RA 3E03A 4K28A 2VWHA 4CLOB 1EFKA 4CMHA 3JQAA 5KVSA 5B37A 3AK4A 2HJRA 3KBOA 3V1UA 5JAMA 5F3RA 2YDYA 2I67A 3GG9A 3KVOA 4HY3A 1HDYA 4B3JA 2B5WA 3B1KA 1N8KA 5JDCC 1G0NA 1NR7A 2VWPA 2WMDA 5TGDA 4Q3CA 3W8DA 4EEZA 2R00C 4L4XA 3WXBA 2FSSA 4XYLA 3KETA 1P0FA 4CL3A 2R00A 1VE9A 2F00A 1QXSA 2HRZA 1LC3A 5JO0A 3AWDA 1B14A 1R12A 3GZ4A 1H94A 4A27A 3Q0EA 3QWHA 4YA6A 3RC1A 3R1IA 3QHAA 3ZV6A 3IMFA 5ER6A 2VHWA 2PGDA 1R0LA 4R16A 2SCUA 3BHIA 1B16A 4CQLB 5T5QA 5CG1A 2P5UA 3G17A 3I9KA 1D1TA 3JQBA 3PGXA 4CQMB 1K6IA 1NPTO 1H9AA 3VOSA 3WGHA 4EUFA 3ENNA 5HS6A 2FZWA 3JCZA 3A06A 4W9NA 4MVJF 1V8BA 1OBFO 1PJ4A 4F6CA 1P1HA 4E2WA 3KSDO 3EVTA 3I52A 2BFPA 3CIFA 3AOGA 3H6KA 4QEDA 3JV7A 4BIIA 4BGUA 3FHLA 2OHXA 4AJKA 1Y8RB 8LDHA 4D3SA 2NU7A 1P1RA 3L6EA 3FTNA 4XZ3A 4BNHA 3H65A 1NQTA 1XG5A 3C3XA 1SZJG 2VTDA 5TIIA 3KLPX 1XA0A 3KZVA 5TF4A 1YBVA 4DLLA 1ZH8A 3RUCA 3ONDA 1JAXA 2VYND 3KYCB 1TA4A 4DWVA 1YXMA 3H9QA 3C7AA 4JBHA 2FR0A 1O95A 4DMLA 5JXWA 3BAZA 4TZKA 5ENDA 1HDRA 4AL4A 4E5NA 4E3ZA 2PWZA 2EIHA 2WYUA 4JJFA 1D7OA 3OJFA 4HP8A 5KTKA 3E9MA 4R9RA 4MVJD 1ZSVA 1LC0A 3UN1A 5JCXA 1XSEA 4E2XA 4UEOA 4ALMA 4IDBA 2RIRA 4JCOA 4N5NA 4OAQA 4BO9A 5CDSA 3NKLA 3P5SA 2ZYDA 3DZFA 3R0IA 2VYVD 1XQ1A 3MWDB 1MC4A 3NUGA 4RCVA 4CV1A 3PWKA 1GV1A 1XELA 1Y7TA 4RZHA 1R4MB 2GGSA 4HFMA 3EY4A 2EP7A 1GYRA 5JC8A 1LRJA 1YQDA 3L6OO 4YJGA 4IQ0A 2G0TA 1NWHA 2O4UX 4WNCA 5KNLA 4GSLA 1LDGA 2O3QA 2VQ3A 2C5AA 1PGPA 2IXBA 1ZO8A 1E7QA 4U6QA 1UXKA 4QECA 3ZU3A 4IDEA 3NAQA 1K6JA 1ZEJA 4CM1A 4IGEA 2YUTA 3ULKA 3DBRA 4R68A 1IE3A 2D0IA 2NVBA 3H2SA 5COQA 3WS7A 1DIHA 4EYEA 1LTHR 3DBLA 1I2BA 4LGVA 1A4IA 1IHYA 1ZIDA 1ENZA 3AI2A 2AXQA 2DTXA 1GYQA 3VTFA 4DC0A 1U3UA 3QWBA 4CV0A 1DC4A 3B70A 3IP1A 2WM3A 5A4DA 3DAPA 3UHAA 3LDHA 1GUZA 3LK7A 2EXXA 1B3BA 1T1SA 4WUVA 3G0OA 1UZLA 2XXBA 2Y0EA 4YQYA 3V1TC 4DPLA 3HUDA 3I1JA 3DFUA 4GSKA 4O6VA 2HK8A 1DJNA 2WD8A 1UXJA 3AUTA 4XWYA 4W82A 1MP0A 3ADPA 2NV6A 4IUYA 1KY4A 4LVUA 3WGYA 4N5LA 4FC7A 4C7JA 3R3JA 2YY7A 3WFJA 4K1LA 3KTDA 4CUZA 3GGGA 5IN4A 4ZICA 4XYBA 2V6FA 4FJ1A 2XF8A 2VNAA 4BNXA 4U5QA 2FY8A 1HDXA 4IQGA 5K6AC 3CINA 3ZGYA 1U5AA 4OXYA 2HMSA 3DZGA 4FW8A 2HK7A 4JK3A 2EKQA 1DDOA 1U3VA 4BO5A 4FB5A 3VC7A 5A02A 2BGLA 4WCFA 1TT5B 4IBOA 5K9ZA 1M2WA 1U8XX 3AOEC 2J6IA 5KJFA 1VPDA 3KB6A 4TRNA 3NDIA 3FWZA 4CM5A 1I30A 4R54A 4KDEA 4YJFB 3ZW8A 5A03A 5A9RA 1KVSA 3I5MA 4HFNA 4JIGA 2ZATA 2PKRA 3OEWA 2W90A 3GFBA 5DOVA 1KEVA 4XR9A 5U4QA 2QYSA 1AXEA 4CV3A 1O9BA 5COAA 1LLQA 4M54A 4RLSA 2D1YA 4IJKA 1RM5A 3PWZA 4P4GA 1B2LA 3UOGA 3V5NA 4E6PA 4BO7A 3P2OA 3HG7A 5L4SA 1KVTA 1U2DA 1F06A 4CLOA 1UDCA 5KJ1A 4N18A 4D46A 1BXGA 1LA2A 4U0JA 3VPGA 1N1EA 2O3UA 2OP0A 2ZTVA 5A9SB 3S2FA 1RM3A 3EDMA 1HE2A 1C1DA 4WLFA 1TT5A 1PJQA 1YDWA 2GUGA 2IDZA 4WASA 3W4KA 1JVBA 3WG9A 3FNGA 3D0OA 1ZW1A 1DIGA 3LC7O 4J2HA 3AFMA 2DC1A 4JJIA 3CTMA 4BL5A 4IY1A 3B1JA 1LSOA 3QVXA 4WLOA 2BHLA 5MDHA 4R3WA 2DBRA 1DSSG 5DULA 4BV8A 5JSFA 4I9NA 1GY8A 9LDBA 4CQLA 4RVDA 1AGNA 3EUWA 3O38A 3GR6A 1LQUA 3T4EA 1RPNA 3ZCXA 3EC7A 3OICA 3JQ9A 4LRSB 3RC2A 3HDJA 4FFLA 4RGBA 3NT5A 2I3GA 5TLSA 3NJ4A 5IN5A 1WW8A 2O3TA 4JNKA 2VTEA 1IUKA 3WGQA 2HUNA 3GGPA 4NBVA 2DUWA 3AI1A 4I9UA 4O0LA 4XGKA 4RDIA 3ROMA 3UUWA 3WMXA 5TQVA 4A5OA 3QW2A 3L0DA 2NVUA 4I5GA 1L7EA 4ND4A 3RI3A 5IJZA 1HYGA 2J3IA 1T4DA 3JD1A 3PLRA 3R6DA 1GQQA 1IB6A 4O1MA 4AJ2A 2YFHA 3BHMA 1VRWA 4FBGA 2QHXA 4YCAA 4IDAA 5C7LO 1E3WB 4RJTA 3QP9A 3ZWPA 1Z82A 1CQJA 3BMQB 4D45A 2O7SA 2W2KA 4HNGA 3B20A 2OBNA 1N2SA 4L75A 2IZZA 4KDFA 2HLPA 5F1PA 1D8AA 5AVOA 1T25A 1ISFA 4XX0A 3TPCA 5B4VA 1JWAB 2BKAA 4MP8A 3BXXA 3TL3A 3GZNA 3JYQA 4MJLA 4AJJA 1AN9A 1NPDA 1X0XA 3F1LA 4XYGA 1A9YA 1U1IA 1D3AA 4MKXA 3TZKA 1GU7A 4XYMA 4DYDA 2A9FA 4HNHA 4CR8A 3ZI0A 5IXYA 5I7EA 3PDJA 1V3UA 5LCXA 5CDYA 1ZEMA 3H5AA 3PIIA 1PS0A 4BO6A 4ZQGA 2GR9A 4YAEA 3VPXA 2B5VA 4FJ0A 3TZHA 1RKXA 3DFZA 2CUKA 3VTZA 4TSKA 3WWYA 2CDCA 4Q39A 3K5PA 3P7MA 5THKA 1BHSA 1BDBA 3PHGA 4TVBA 2B0JA 1I24A 3EHEA 3LF1A 1P0CA 4WE3A 4ZD6A 3LQFA 2VT2A 4QXMA 1Y6JA 3PYXA 6LDHA 4EJ0A 4UUPA 2EW8A 3D4PA 3JQGB 3U3XA 4PN3A 1WAMA 2WDZA 4WECA 3MEQA 2OZPA 4AJ1A 3AY7A 2BH9A 3DZKA 2EHDA 2Y93A 4TROA 1K5HA 4NJOA 3GA0A 5JDCA 3JYPA 1LRLA 1GQ2A 2OO5A 2ET6A 3FTPA 1IYZA 3KEQA 3M2TA 4G2NA 1EE2A 3VPFA 2GNAA 1Q0HA 4YBZA 3CMCO 2FRDA 2OL4A 4ALLA 3ZU2A 1PGQA 4KQXA 4INAA 3PHIA 2X58A 3SVTA 2VN8A 3ANLA 1XYGA 3ZV4A 1E92A 3QA9A 3SLKA 1SO8A 2CVQA 2JFHA 2RHRA 3VAZA 3JYNA 4EBFA 4ZVVA 3BMQA 4WJZA 3ROKA 4FFPA 3MTJA 3AY3A 3KSZO 2WSBA 3RWBA 2QIOA 4WLUA 1XGKA 4IIVA 4CLDA 3WBBA 5JLAA 1HXHA 1PU2A 3K6JA 3JQFC 4GX2A 3SLGA 4AJIA 4CMIA 4EJ6A 3EVNA 4XQEA 1E5QA 1QYVA 2G17A 4E30A 4YAIA 2PGLA 4QQRA 2IYOA 3AM4A 2POQX 3BMNA 3GUCA 1BDMA 4RPHA 5TS3A 4DUPA 1B15A 5CPBA 1QR6A 1W8DA 2DBVO 1ID1A 4WGGA 1SEVA 1MG0A 2G5CA 1M67A 1DRWA 4NFHA 4KWHA 4BNTA 2O3SA 4WCFC 4OO3A 1U4OA 4PGFA 3RUHA 2I66A 1ORRA 4XQGA 3WQRA 3WJAA 4XCVA 1U5CA 3PP8A 4AJNA 3LT1A 2C2XA 4YJHA 1SNYA 3DB2A 3GH3A 5COBA 1IOLA 3ZWAA 3G79A 2Y66A 5DDIP 2DBQA 1RM4A 1DJQA 2GDZA 3VHRA 5LC1A 2WEKA 4PLGA 5L4LA 2X5JO 4UULA 1N1GA 1ZCJA 4BNJA 1Y5MA 1MXHA 1GZ4A 3KXDA 1ADBA 4W6ZA 4LMRA 1OC4A 5IF3A 3IOYA 4XB1A 4MVJA 4ZQFA 3L4SO 3H8VA 3HE3A 5KVVA 4ZRNA 1RYDA 5A05A 1PWXA 1SB8A 3OQ1A 1QRRA 3VH4A 4F3YA 2W2LD 4IS3A 4WCDA 1XU9A 3RROA 1W6UA 3TJRA 3RUDA 2V6BA 4B3HA 1R37A 4AFNA 2QW8A 3WLEA 5ADHA 4IDFA 3PQEA 1BWSA 4EI2A 4ILKA 3PDUA 2JKVA 4IXTA 3ZDFA 3LYLA 1ML3A 4F46A 2Q50A 1R4NA 1T1RA 3WICA 1XU7A 4JBIA 4EEXA 2UAGA 3H9GA 2D59A 4Y6RA 1M76A 3V2HA 3OA2A 2BF7A 1SPXA 2DBZA 3KYDB 1HF3A 4HADA 2OP1A 1E3LA 4R1NA 4CL8A 3UAGA 1A7KA 1DIAA 4P22A 1JA9A 2E82A 3GMDA 1GPDG 3RUIA 4YEDA 5CEFA 1ENOA 3PGJA 1WXDA 3MCVA 4XYEA 3PI7A 4NHEA 4XGNA 4BNYA 3MJSA 5L7TA 3DONA 1PX0A 3PK0A 3H3JA 2HMWA 1U7TA 3O9ZA 2E48A 5G0TA 2CD9A 1PL6A 3K30A 4UVEA 3K96A 1B26A 1U28A 1VJ0A 4BMVA 3C7DB 1N5DA 1E3SA 4BNVA 2O2YA 1DO8A 3COSA 1LSJA 3TNLA 3GY0A 1C1XB 4XD2A 3ANMA 2PR2A 3U5TA 4NR0A 2IYPA 2EKPA 4YRDA 5ITVA 3OIDA 4UAGA 4Q3EA 4WK6A 8ADHA 2PK3A 3JD3A 4ZQBA 3DR3A 5J23A 3W8FA 2OOSA 3ZWMA 1GYPA 3D3EA 2IRWA 4HFRA 1LDEA 2WYWA 2P5YA 3SJUA 5F1KA 2VYNA 4LVCA 3RC9A 3RUEA 3U4CA 2VCYA 3JQEA 3RVDA 2VUSA 1GPJA 3QWFA 1ADCA 4XDZA 4YT4A 4FOSA 1U4SA 1YJ8A 1DC5A 3GEMA 2JJYA 3IP3A 3JSAA 4XB2A 3Q9NA 4FC6A 5CDUA 4DLBA 2RHCA 1YKFA 4P38A 1NAHA 4FD3A 1ZJYA 1Z6ZA 3NDRA 1PTJA 1GADO 2FOIA 4BNLA 3H9UA 4ALIA 3IUSA 1UJMA 2V65A 4QX6A 1P77A 1W4ZA 3UKOA 1ENYA 3WFIA 5EL0A 1PJBA 3GRPA 4JP3A 1LDYA 4J1SA 5JDIA 1PWZA 4MDHA 4J7CA 4ZRMA 3KRTA 1H2HA 5L9AA 2RBEA 5IDYA 4KTTE 2PLAA 4P8RA 1YOVA 1KOLA 1R4MA 3NTOA 3RKRA 5HM8A 1CEQA 2JD0A 4YACA 2NU9A 2ZQYA 1QMGA 3O8QA 2ZJ0A 1EUCA 4JGBA 1GL3A 2AG5A 4KQWA 1CYDA 1H6BA 2JAPA 3ZH2A 4XJTA 4MIEA 2PZJA 4IMRA 1O89A 3ETEA 3I9OA 2DU8A 2Q4BA 3CZMA 1ZZEA 2BGMA 2PTGA 4BVAA 4IQ8A 1Q0QA 4L76A 4MINA 3I3OA 3FBGA 2EJVA 1ISGA 1ZSYA 2WE7A 1R66A 2QRJA 4O5OA 3ZNPA 4ALJA 1X14A 3I6QA 1DFGA 4Y6PA 4B7XA 1VJ1A 4J0FA 4L0QA 1F14A 2AQIA 3ITDA 3RSHA 5AYVA 4YDRA 1QSGA 4FIZA 5EJ2A 4CMIB 1DAOA 2O4CA 4PLYA 3UCEA 4GPD1 4TRRA 3CXRA 3PZRA 2C7GA 3KYCA 3QLJA 1YS4A 1BW9A 4MIOA 3TQHA
chains in the Genus database with same CATH superfamily
1HE8B 4XD7A 1XDDA 4AQYB 3G1TA 1C2YA 1WLSA 2P90A 3AHIA 1R8XA 1BMTA 4DIMA 3OHMA 1AUPA 1J2YA 1G6OA 1UDRA 2ODBA 2Q3EA 4INZA 4KIGA 2IW3A 3LZ6A 3OOSA 2B7BA 3E22B 4TMVA 4AP5A 5EHNA 1UKVY 5EKUA 3UG6A 4S2EA 1BXGB 1LVUA 3SD7A 2UVDA 2GNPA 1XMJA 3AO0B 3UPTA 1KETA 1Q7BA 3O47A 2GN6A 1UC5B 4P58A 2GH1A 4UHBA 5IJ9B 2QK4A 1TC1A 3FNQA 4QUKA 1TJ4A 1SOUA 4RHEA 2D06A 3ZBUA 1SUAA 3L4BC 3U4GA 2NAPA 2QTVB 4RLQA 3LT0A 1JXMA 3T9FA 3VU0A 4GM0A 5LOVA 5H1YA 1E2PA 4DR7B 1VSUA 2WSSA 2WWGA 3D31A 4IOKA 1PG2A 3VX4A 3WGNA 4I1OA 4AWXA 2JFBA 1HDZA 1GAJA 1T26A 4PZUA 1D5CA 2YJGA 4YAJA 1GSIA 4XR4A 3AI3A 2IUTA 3OESA 3UYKA 3STXA 3V7UA 3TRJA 4BUCA 4KPUA 1M1XB 3EIFA 2OFWA 4WA7A 4ZCQA 4E09A 5J2TB 3A1TA 4CGYA 1X8JA 4OSEA 4BV3A 1QNFA 2C8KA 1DBWA 3U7QB 3LUBA 4BB9A 3DBRB 4OJQA 2I2AA 3JWJA 1ZJ6A 3CZAA 1YU6A 2CFCA 4FS8A 4I50A 1DUSA 1JIXA 2ZSDA 3ICOA 2QPTA 4MV5A 1U3WA 1QAQA 5B7NA 4KNVA 3U0BA 2PCJA 3OHSX 4J2TA 4MYHA 1RZRD 1SWWA 2ZYIA 1SAYA 3U61B 4N6OA 5J2TF 3HJGA 2BJVA 1NUSA 3N2YA 3OPVA 5CT9A 1RPJA 4AB1A 3LX6A 3SYLA 2HI0A 1CJCA 3GEDA 4CM9D 4U2EA 3ZX4A 4IGKA 4KGDA 4YO7A 721PA 1XZEA 5KYNA 4DA9A 2X0EA 5ALTA 1ZM2A 3IR7A 4WOPA 3MWDA 4CIXA 4Q4AB 4IKOA 3OPYB 4BOYA 4ETIA 3C8MA 1IUNA 1AB5A 1ZYUA 4KQGA 1NVXQ 2Q6IA 3CF4G 1KDYA 4B8YA 1WZNA 4JXZA 4L9SA 1L1FA 2XXAB 1HX7A 2Y77A 2NGRA 3DMRA 5IEBA 1TO1E 1VB5A 1P39A 4HAWA 4CLRA 2VJAA 1B1CA 1K4KA 4B45A 4XI9A 3PSHA 4ZC1A 2YMQA 2Z4RA 3J81A 3KEFA 4XQ9A 3W8EA 2HRDA 3AHGA 4C88A 4JLWA 2WTMA 2Z6QA 1ECCA 3GUYA 4HDKA 1IEQA 4HQKA 4II3A 2CDAA 1TU0A 1V5EA 4HQOA 2I7TA 2NUTA 2IHNA 2XB9A 5HOEA 1K7XB 1FU4A 1PJLA 3U3MA 3M4JA 1EZ4A 4OQXA 5ELLA 1XL1A 2AK3A 1NVVQ 2QLTA 3P2YA 4FFMA 4RPLA 1IULA 4FJ2A 4JKIA 4CG3A 3T1QA 2PUTA 3G59A 1PNQA 2PUDA 2AE1A 3AF6A 1P7PA 4GKKB 2PMBA 1Y81A 2DAPA 2X0IA 4PYMA 1LJ8A 2HHCA 1PWYE 1M1NA 4D3DA 1K3UB 2HL6A 1Y9JA 3ORRA 4G0YA 2PUAA 1YRYE 1QO9A 3B8EA 4JKYA 1NR1A 3AF3A 3QG5A 2FMIA 1IBMB 3BH7A 3GRCA 2GJKA 3RRYA 5IJ0B 4V0NA 4PN7A 4G5XA 1DU4A 2NZXA 2W8BA 1G55A 4PPGA 1I13A 5EMHA 5KVCA 2JD1A 1B41A 3R9WA 1G1MA 1NUUA 2PX0A 3R2JA 4I4CA 4BMCA 4EPXA 1L4GA 4ZU6X 2AQ8A 2H2GA 4M7OA 2ZSJA 1DIRA 1G64A 1U0LA 2NV0A 3UA4A 2QGFA 4NU6A 5DU2A 1GEEA 4Q47A 4V0OA 3FOZA 1ZNQO 4H35A 3WK6A 1HTBA 3ILXA 1KEUA 4PG7A 1QQ5A 3L02A 1RMQA 4ND6A 2AWNA 4ZQEA 4BO4A 5KNBD 4MS4B 5K0LA 1CS4C 2A5GA 2XTAA 3TVDA 1ESZA 4F3NA 4JVMA 5KDDA 4N54A 3EFOA 3WKEA 4W9NC 8AT1A 2NP6A 4Z53A 3WBJA 3WQQA 4KWCA 5F1YA 2V5UA 3SX2A 1DEXA 3I64A 1E1RA 1R6BX 2G72A 1EXMA 4QOEA 4HLUC 4TKUA 4ZXFA 3TKAA 1GPYA 3N7TA 4OMCA 4Y1RB 3AW8A 3PNYA 4F2PA 1A8UA 2Z5FA 3F1KA 3KJZA 4M76B 1MZVA 2HQRA 2B92A 2OFFA 2I65A 1ECGA 1PLJA 3HR4A 1Z0JA 1SVWA 1VHQA 3F5DA 2BFFB 3R6TA 2IPMA 4HO1X 4TL9A 3EYAA 4DMMA 2OORC 3DC2A 3F46A 3WRYA 4N3NA 1SZCA 4DVGA 1EG2A 5E9AA 4POOA 3AOEA 4AS3A 4CI9A 4U63A 4PQYA 2IT1A 1S2IA 2X7HA 4WLVA 2AYZA 4F3KA 5LUAA 4LJYA 4J3FA 1GLGA 1KYWA 3HN2A 2J0SA 4P32A 1AHHA 2GVZC 2ZIVB 1EDOA 4CFSA 1ZI9A 3LZCA 1RI1A 4A0HA 3OZCA 3M6WA 4IGAA 2BELA 3B1ZA 1LH0A 2V4MA 1R5BA 2V98A 2G06A 2A1UA 2HTFA 3PI6A 3BIJA 4HZUB 1ODCA 2C4KA 4DANA 1NY6A 4GP7A 3EPHA 2LCQA 1MTOA 1SXJC 3I9MA 1JIKA 4P4LA 3B1XA 4KUEA 4B3BA 2OXFA 1VLHA 3FWKA 1G3MA 4K6CA 4LOIA 1YIOA 1Z0IA 1F38A 1XXHB 3IYLW 4OREX 1NXTA 4EHNA 1PJCA 3BD7A 3OQBA 2QDXA 3FPAA 5BVGB 3OPMA 3LP5A 3DNPA 2DXIA 2VF5X 2FSGA 1DAKA 3DE2X 4OFXA 4BNFA 5LYJB 1OLSB 3HGTA 3SHFA 1TVKA 1YRBA 2R2GA 4JR0A 2GPAA 4D9FA 1KTVA 2X5OA 3IQEA 4HGRA 3V1YA 4LXYA 2P2NA 2PYZA 3B9PA 4KJXA 2CNWA 2A5LA 3TTVA 2C0CA 3FPGA 5TR9A 5AVVA 1PUIA 1WCWA 4B2IA 4DLTA 4RKFA 4Q4JB 4CLEA 3H0KA 2BFCA 3STUA 4I1PA 3WK8A 1RZVA 4DV7B 5HBGA 1KGSA 3FNBA 1I2DA 4JQYA 1E1RD 4M1KA 4RW0A 3VPSA 3FOFC 4UARA 3OFND 2YHUA 2IITA 3HGQA 5BSEA 4RVGA 3UUFA 4W1QA 4QICA 2NSHA 1KVRA 2TMGA 4E5VA 4TN1A 5FLKA 7MDHA 3S0JA 4NAVA 3F8WA 3FIJA 3Q85A 4R7TA 3OCZA 2A9JA 5ALMA 3ROTA 1RAEA 1PZMA 3EC1A 2YJZA 4JI7B 4E70A 1ICIA 4REQA 3R0JA 4PO9A 1KSHA 1X3LA 3JQAD 3QUCA 3ENVA 4N9WA 4P4UA 4Z9FA 5BVHA 4WESA 1L1RA 4UUBA 3NGXA 5J2UB 2WKWA 3OZ7A 3L49A 4DWWA 4GOND 3UF0A 4Q3LA 1L5HB 3GQBA 1RKVA 1AQ6A 4IMPA 1X74A 1M1NB 2H7VA 4PO3X 5HIJA 3OZGA 2BIFA 4ARZA 1H8EA 5AM4A 3SLRA 2W8ZA 1GXSA 4LNAA 1KY2A 2X8JB 2IQ5A 2FFRA 1ATIA 4A6XA 1Z26A 4JC5A 3HZRA 3V55A 3UNXA 1LPOA 2BP7A 4DA4A 3INGA 1A9ZA 3IV7A 1G8AA 4AN4A 3E61A 4J9VA 3F4BA 3A4VA 2J87A 4DRYA 3OM0A 3LHSA 3BVPA 4PRLA 1Y80A 1NP6A 1Y9EA 3BM5A 3OQ6A 4Q01A 2IYSA 1GGKA 3GJYA 5IC4A 1N3YA 2OAQ1 2GPYA 1JG1A 4AP9A 5FFFA 1N6OA 1PYGA 2PQMA 3E22A 4IX9A 3M4NA 4Q9HA 4BCDA 5CB8A 3M1IA 4FNAA 4NMWA 4Q4HB 2KB0A 4BWFB 1Z25A 3I1FA 2O3JA 1HSOA 1S2GA 1J1IA 4IS2A 1FP6A 3NONA 2C99A 4HLQB 4MQEB 4N7RA 5LZ7A 4ZVPA 3RK1A 2EZ9A 2AWOA 3GEHA 5FP0A 1B8OA 2L42A 1GUBA 5IFLA 5KOHA 4S05A 1ADFA 2OBYA 2XCIA 3BIFA 3R20A 1D04A 4U2BA 3L8CA 4AMBA 1M6WA 2P79A 2CMGA 1WTAA 3VI4B 4BX2A 4RTKA 1RP1A 3ND5A 2AEJA 3KFXA 2J3HA 4C7OA 1G41A 3ZDEA 3G5UA 2IS4A 1BC5A 1EHCA 1HRDA 1X7YB 4LBZA 4PQRA 1O96B 4UTZA 1KIMA 1NDUA 3H2ZA 4HJXA 5EIAA 3ZHBA 4ENTA 2PPVA 3A28A 4HUQA 3LP6A 4NHOA 2RH5A 4RHXA 5HMMA 4EDFA 9ABPA 4CIYA 2WY2D 2NYAA 7ABPA 1M3SA 3G2NA 1KORA 4R2LA 2QVZX 1G3UA 3VDXA 2OYRA 1FF9A 2UZ0A 2HYDA 4FDLA 3UAXA 3ZLVA 4CQJA 4C76A 1KPIA 3STWA 2XWPA 2JJMA 1CD5A 2PKWA 3M9WA 4MULA 4FFVA 1SBCA 1FVFA 5DYYA 1CIPA 5HKBA 3KDPA 2F3QA 2GD1O 3LWZA 5AK4A 3KVYA 5TS2A 3STYA 2HU5A 3U4DA 1AVTA 2IIVA 2X6QA 4LVOA 4XEUA 3U1VA 4F3RA 3FI9A 3L7MA 2J3JA 3DM9B 4XM2A 3H87A 4UFPA 2YV2A 3N75A 4OQYA 1EE1A 2ODTX 5KJ6A 3U44A 4R83A 3RREA 4JQCA 5G4LA 5KHLB 4UBOA 4D5EA 4O33A 1LBIA 5HGXA 3UAYA 5ALIA 4YPVA 2E49A 1ZM4A 3IVAA 1P80A 3M34A 3OY2A 4MQEA 3EJWA 2I76A 1UKBA 2CUTA 2P67A 1FYFA 4E2FA 3GUUA 1EZ1A 3Q7QA 5JBIA 4BUZA 1Y5IA 4EVSA 3NRBA 3SPXA 3GEGA 4TTRA 3EXFA 4YMWA 1CRPA 1P45A 2DH5A 3AYXB 2OV1A 5LP6C 4DLVA 1P9LA 1P7VA 4PXYA 4MWCA 2D2EA 2Q21A 4BPRA 4Q5IA 2XMRA 3G2HA 4XX0B 2NU8A 3ZYCA 5HKKA 3FPLA 4URZR 5G4KA 1ENPA 4H7PA 2J7KA 3DV2A 3LYHA 3TQQA 5A5VA 3PEWA 4PPFA 5K3BA 4RF2A 4NECA 2BONA 1C7EA 3D6TB 3FHJA 2ZM6B 1J49A 1TYZA 2WAMA 2WQ6A 3R3UA 1AUXA 1KK0A 3BTOA 3T15A 3WK4A 4CKWA 1YZGA 1FLVA 2B9EA 2WHXA 1FZQA 3H04A 3QHPA 4P35A 3UWMA 1Y34E 5BR8B 3RHSA 2QW0X 1PF7E 4URFA 5MFPA 4IQFA 1AGYA 3FPEA 1QO0D 1AO3A 4FGUA 3VJLA 3BQ9A 3I23A 4BXOA 2C83A 3IR6A 2H9YA 5LA6B 2D4HA 3MPUA 1XP8A 3ZWCA 3B51X 2DX7A 3WAKA 1U2TA 1FNBA 1PFVA 4EJMA 1S6YA 3TLXA 2VPZA 5BVHB 5SY9A 4E33A 4J4TA 3QKUA 4BRUA 1G59A 3SBXA 3OETA 4F1KA 2M2IA 1WETA 3V2GA 4A1FA 2K7FA 4IMJB 1V8ZA 4ARCA 2CDBA 2X23A 2I34A 3QW4B 4P86A 5FTJA 4XDYA 2F7SA 5DX8A 1P74A 1UC9A 1LQ2A 2JLCA 1WBJB 3SXPA 3R9XB 1QVZA 5JSYA 4EFNA 2GASA 2C8LA 3WRXC 4BVHA 1JG3A 3QBVA 3A4IA 4MQ6A 3L4BA 2VP9A 1K7SN 4F3TA 3K8QA 3NH6A 3JQ8A 1CR2A 4JVNA 4QDJA 3KKZA 4GKBA 1WZCA 4RVFA 2Y6VA 4AYTA 4WD3A 2B2CA 4R8MA 3AUAA 1L4EA 4I4TA 4IO1A 4WVFA 4XGIA 1ZVVA 3TB4A 1I6WA 5EIBC 1FSPA 1NN3A 1JH8A 2QVBA 3WYNA 5KTPA 1PN3A 1APBA 4LE2A 5LDDC 2G0NA 1XKTA 5LQNA 4JELA 4BAZA 2WZDA 3MS7A 3G9TA 3K4PA 5BVGA 3RRNA 2HA7A 1T36B 4XRRA 3S2SA 1O6ZA 3G0GA 1O8BA 3PCTA 3QPWA 4KXLA 4U7WA 1PFWA 4J1QA 5JQWA 2C7QA 5JNSA 1F9EA 2YWHA 2Z2IA 3H3FA 1XZJA 3MQ2A 3HCFA 3LHFA 5HSGA 2EWVA 4GOLD 1NULA 1I4LD 1S7CA 1W0KD 3T7KA 5BMVA 3GMTA 4JB8A 5IDVA 4GXQA 5IU6A 4WUTA 1G63A 1HT3A 5SZKB 1IHPA 4BMZA 1ISJA 1W0CA 1KARA 5E3JA 3UK6A 3WV4A 3IAEA 3V48A 4EUKA 1PW5A 2NU6A 4Y3UA 1C4XA 3CE9A 3SHWA 1U0FA 2IZ6A 4MW9A 4RA9B 2CBZA 4BGDA 3OUUA 2JIZA 3RTDA 4KZPA 4IM7A 2AKAB 1P3Y1 4GVLA 1AQYA 3ECAA 1S9HA 2BGTA 1U1CA 1C30B 4LYEA 5I3CA 4GZ5A 2RI1A 3E1KA 1J70A 2EJTA 3F5MA 4FCTA 4PAWA 3U26A 1POXA 2VHVA 3ECCA 3DQQA 3SS8A 2K87A 3EZ7A 3NIDB 4S0ZA 4H3HB 1B8VA 2VHXA 2OV8A 4BZZA 1USUA 2KLHA 1YGPA 2GEVA 2OG1A 1YDEA 3ZEAA 1X1RA 2ZROA 2H6EA 1R4NB 1QRAA 3DE3X 2P2SA 4V0SA 4XPIB 2APJA 2JS7A 2W6NA 4ON9A 3SQDA 4RWEA 3DGFC 3PF9A 4GLOA 3MJEA 4HMOA 3NV7A 5IUKC 1G42A 3JY6A 5BY2A 4G1MB 5G1OA 4C0WA 4X44A 5HF5A 4FZRA 2DFKB 3SOZA 3VJRA 1EM6A 1V3TA 1T6YA 2ZK7A 3MMSA 1L8XA 3KUKA 4B75A 5MF6A 1KVQA 5JXHA 4ZTBA 4WY5A 3S7ZA 1N9GA 1NP7A 3THWA 2RC5A 4QUBA 2DY1A 4F45A 4OHFA 4IDCA 2AC4A 5K0NA 1PVOA 2OB2A 3BICA 2QP4A 3IP9A 3OY7A 1ZHFA 2MCFA 1UDAA 2EEZA 4PLHA 3ZHSA 4V0QA 4MKGA 1ZRHA 2PZ8A 1JYEA 5JE8A 5U4XA 2ZWVA 3KPJA 4KNWA 1GTMA 4E1BA 2KPOA 1BE1A 5T4FA 1MU0A 1CUIA 2W98A 1T5LA 5EXSA 4DC1A 4YXWD 5GPBA 1XZDA 1AHIA 5IJAA 1X86B 4R3UC 1QDLB 1H4SA 3LNCA 1EGAA 1FFAA 1Z12A 1NNSA 3TIXB 4G24A 1OI2A 3PS9A 4O1HA 4OGWA 1FP2A 4LPSA 2CVHA 2VJKA 3ZBPA 4YRBA 2ABWA 3QOYA 5IDQA 3F6RA 1RSZA 1PV2A 3UWPA 4LDZA 4YQZA 1P29A 1UQRA 3UT5A 1U9ZA 1VM6A 4NZNA 1PSZA 2QUBA 2CHFA 4MUKA 2P30A 4XUCA 5TXGA 3GEPA 4PWZA 3ZEIA 5CURA 4BN5A 3CNNA 3DZHA 1OHHD 3B7WA 1Z0FA 4JB0A 4OQNA 4D92A 4WOCA 1XRNA 1L7MA 1ZKMA 5HUQA 1XF1A 2W2KB 5JDIC 5BSMA 3F2IA 1QZZA 4YCDA 4BE7B 4GOXA 2GXQA 2HRBA 4CETA 2PUGA 4A8HA 1QQTA 2FP4A 1BAPA 1XQ9A 1BEEA 3PXDA 4FDAA 2VC2B 4YROA 3RVLA 3D6HA 3CIOA 2B21A 1E1NA 5FUMA 1R6UA 1EM8A 3FRIA 3U4IA 3HNRA 4QHSA 5A5DA 2XYRA 1FMCA 1IOZA 5FA8A 3ILHA 2DWCA 1FOEB 2JF0A 4NZYA 4RS4A 3FPHA 3D5QA 5BSRA 3RJ5A 3ZGNA 3SYNA 5LXTF 3IIIA 3ETLA 3BMCA 3GCZA 1DKRA 3HBNA 1OTHA 3WGUA 3TK1A 4AZ0A 5F7XA 5IG2A 3MW8A 1PK9A 1D2RA 1PZFA 1I2ZA 5JI2E 2VCEA 3UOAB 2RGNA 1U8YA 2RGEA 3BHJA 4AURA 1U0OC 4AUEA 2GERA 2CNBA 4BQRA 5E95A 1MENA 3IEPA 3LD9A 1VZ2A 2VHTA 3HYTA 1NQVA 1Y1KE 1BFKA 1R64A 3NHFA 3I01M 1YS2X 3P2IA 1ZH0A 2F6RA 1VDZA 4HLNA 1TO6A 5EJ8A 3CH4B 3WSVA 5FYDA 1K8ZB 1NFQA 2RHJA 2W22A 2BGIA 5AVJA 1E94E 4Z86A 5CFLA 3G5LA 1FX0B 4Q7MB 2UZIR 4X66B 5G1PA 5HFAA 1CERA 4ARAA 1Q1NA 2V9CA 1GAQA 1K98A 2NZVG 4Y2TA 3U16A 3J80A 2GFIA 3FOEC 3GZJA 1ZG3A 4QLAA 1U0EA 1T4CA 2AEEA 2C5LA 1X7WB 2J5RA 3N8NA 4H7EA 3CPEA 2HSEA 2RK4A 3PPVA 5BPFA 2XUZA 3CKYA 1NONA 3ECSA 4HGPA 1N2GA 3RLIA 3PGVA 5KU7A 2J3DA 4L07A 3K0FA 3FE2A 3SJZA 1HOTA 4UCQA 4IGFA 3ST7A 4BO1A 1YZUA 2JLQA 1EBFA 2IBTA 5CXUA 4F5WA 3JQ7A 1RRGA 3GLHE 1R6DA 2AFIB 2IW1A 2PFKA 3ILYA 4TRJA 1E5LA 5DVZA 1PSDA 4YUZA 3Q8MA 2BCJQ 1CJKC 1QHEA 4WVLA 5DSZA 3TSWA 3W7AA 4E13A 1QBKC 4M0DA 1N5JA 2F4VB 1UT5A 4G36A 3PA6A 5FTWA 4UNQA 2WJ6A 2H2IA 1ADYA 1WPXA 4YI5A 4G4GA 4B9EA 2GWHA 4QYIA 3A14A 4EKEA 3NDJA 3IVGA 5B55A 2V74B 4HUQB 3VYTB 3QE3A 2LE0A 4KQCA 2GN2A 3BL5A 3S99A 4ZP1A 1NX6A 1GNPA 2GSDA 3KB1A 3UB3A 5ALXA 1V3QE 4NPAA 5ARDA 2PJUA 4CMEA 3RYCA 4LFCB 3FMVA 6PFKA 4AZWA 5ALZA 1XEAA 2NYUA 3TSZA 2Q2WA 2R8ZA 5DRYA 3JTEA 4JLUA 5K51A 1GU0A 2ATXA 2IY9A 5AW5A 3GGCA 4ZO4A 1YRHA 1ZVKA 4PW0A 4ZAYA 3OQJA 2FN8A 5JJCA 4W5QA 3EISA 2V58A 3BTUA 3IEXA 3QZUA 4QSMA 1RLUA 5AJUA 3LCMA 3MTBA 8ATCA 1R8QA 3QSGA 1G20A 2XBLA 1T9HA 4LDQA 5AJTA 4JI0B 4EG1A 1V48A 1R4AA 3L7BA 3OQMA 1UH5A 1T35A 2F9FA 4DUGD 3HCWA 5C7YA 3ND7A 4G0WA 1VIVA 5CFOA 5K99A 3O4HA 5JXGA 1ULZA 4GMGA 2GN9A 1QUEA 2CHEA 4XCQA 5CB4F 1XRLA 3QNWA 4FCCA 4J2OA 5C46F 3LOQA 1YWGO 2IEBA 2JA1A 1GGNA 1JLSA 1PAUA 3TX2A 2ZJ1A 3V32A 4KLNA 4ZJUA 4ZHQB 2G82A 2FWMX 5ALLA 4ZAXA 2QRVA 1Z4PX 2XOEA 4J75A 2R1VA 4TWIA 1JMVA 2PH1A 3FWPA 3E0QA 3T3OA 3LNTA 1KY5A 4B43A 1VYTA 5F52A 3OX4A 2YHIA 2P7IA 3L4EA 1VFPA 4RSGA 4CTKA 1O08A 3GRUA 2ID7A 2UUPA 2W2XA 2A59A 5CYPA 4EKIA 1RXSA 3E48A 2FPGB 1ICEA 4YRIA 1YZLA 3H42B 2ZE6A 2GTPA 2JPDA 1TTPB 4UHJA 4Z99A 3O2NA 1QYDA 3VTAA 3QKSB 2QSUA 2OKCA 3WIUA 4X20A 5ULLA 3HDQA 2ZT6A 1QE5A 2XECA 2X0RA 2E89A 3L2OB 4LZPA 1T3ZA 3GB9A 5U1PA 4G26A 2VSYA 4GZ3A 2Y92A 3TLGA 2EEPA 2X0JA 1YQUA 4HWSA 2H0AA 2QG4A 5AXAA 4W5OA 3C3MA 1EP2B 1IAQA 1QO7A 2OENG 2JJ1D 2OAEA 4M7RA 1FMTA 1MNQA 1DDIA 4GAEA 1ANKA 1DQPA 4O4HA 4ETMA 2JD2A 1E4EB 2C7BA 2B6NA 3KU4A 1EIWA 4W7HA 2ORED 4J76A 3HKEA 3R3YA 3TZLA 3W5BA 1ZGGA 4KO3S 3HDHA 3AP1A 4OQFA 1YL7A 2A9VA 2WWXA 4B46A 3TRHA 4LV5B 5F2NA 2GUWA 2WTUA 1C81A 1SUBA 3FYSA 5M3BA 4W5NA 1QRUA 1XFDA 4FUQA 4KMOA 1V5FA 1YK1A 1P5JA 1W1IA 3SCZA 4E22A 2WJHA 3NX4A 1TQHA 3KO8A 1R16A 1DJOA 4BO2A 4D9JA 4HF7A 4UVGA 3HC7A 5JRZA 4LAFA 4BBJA 1QH9A 5BSTA 2ZRBA 3M8KA 1Z13A 4CNBA 5C53B 5DYTA 2VZ9A 4Q0MA 2BMJA 2PVCA 4LSZA 3U7HB 3DHYA 3B1YA 4M86A 1M54A 1V2HE 3S5JA 2HT1A 3JTMA 3VSDA 5AKJA 2H4XA 4HGQA 1YA6A 1WQ1R 5C1DA 1NP3A 4TL6A 1WVMA 3DMNA 1GZ5A 2XUKA 1DV1A 2P1RA 3B52X 5K0EA 2BISA 1Q3TA 1FFEA 1E1LA 5DYNA 1U98A 2B1IA 5AMXA 3E81A 1ZUD1 2ECFA 1XD9A 3BXFA 1GR1A 5C5IA 1IQ0A 3KJGA 5EZYA 4HAXA 3U3DA 2KJQA 1JXOA 2J32A 2N0SA 2WM9B 5E7JA 3TTSA 3ZDDA 1MEEA 4HB2A 4JITA 2OPHA 2L17A 4YCLA 2YFYA 1VSBA 2BGKA 5EYPB 2EERA 1IZ0A 3T99A 1F2VA 3Q0TA 4K8OA 1HETA 1U1GA 1MX9A 3ETJA 2Y99A 3PNMA 4G67A 2V4ZA 5IYZF 4C7OB 4WTOA 4BVLA 4C6RA 4DRXA 4YV0A 1XROA 1BHJA 1X0VA 1YQGA 4CCSA 1X9IA 1SHTX 4NNJA 4F21A 4P3XA 1JG2A 3OO0A 3IEMA 1QPBA 2OCIA 1V25A 3BIWA 4RF4A 3RIHA 2O1WA 3CEPB 2BDEA 4MEAA 3QVOA 4CE6A 2A9QA 1A2KC 5T64A 3UFBA 1T3LA 1E2IA 2R5FA 1V45E 3AVOA 3PXXA 4M49A 3OBBA 3HSKA 5CYOA 1AB6A 3T38A 3VR2A 3RAFC 2Z43A 3HP4A 3KAKA 3Q3IA 2JKYA 5FAXA 2XMPA 3OFSA 2UUBB 2XLBA 4PIVA 1HDCA 4BX8A 1FDIA 2HEGA 1E66A 1O77A 4M8SA 2DFPA 3OIVA 3RD5A 1KDOA 3CRZA 3MCTA 1GP2A 2FW0A 5FBLB 1SKYB 3HS3A 3QEBZ 1E1KA 3PJFA 2BFDA 2VSQA 3C1AA 3TXAA 1LRKA 4PBSA 2UVQA 4OKNA 4CI0B 3LYUA 2C4VA 2IGBA 2AW5A 5BT9A 3IR5A 5FHRA 1VMKA 4JBLA 3HR7A 1FRQA 4NZ9A 1ZVQA 2ATEA 2E4YA 4ND3A 4WEQA 4R1TA 1C4WA 4Y2YA 2PXCA 3NHBA 5LLDA 4OX9B 4QDZA 4ZK2A 3GU3A 1ZRNA 3WKCA 3QE4A 4DV2B 3B6ZA 5D51S 4B35A 2H5LA 2ZRNA 2K2QB 2VHEA 1ZK3A 5FUQA 1Q91A 1YCHA 3DAGA 2Z2ZA 4BJ1A 1XTRA 3A9TA 4IR7A 1I36A 4AW9A 2RBKA 3P94A 4N4AA 2DHRA 1ZD1A 1JHXA 2G9RA 1FLNA 2IZ0A 4FGZA 1MCZA 3N8DA 1BN6A 1BXKA 1KYQA 3EVGA 4JL8A 4G9EA 4IJ6A 3HCDA 1A8HA 1NJSA 2IPAB 1AKWA 1F8GA 3ZU5A 4FWTA 2ZAOA 5ITWA 4CT5A 1EJ0A 4GL4A 4TTTS 5EVJA 4R8KA 3KDAA 3S44A 3QXGA 4DT1A 5KTMA 5LVAA 5T8KA 4RXUA 1K4MA 4RH3A 4PHCA 2VKTA 3T1HB 1T0PA 3CUTA 3EZXA 3OZDA 2CL0X 1OBHA 5T8KC 3ZWOA 2JGDA 1T2CA 3GWGA 3UMVA 1UZNA 2W58A 1KMNA 3K1AA 1M7HA 1KP2A 2AEMA 4F84A 4Z3KA 4HMQA 4YLYA 5IDXA 3OKAA 4LF7B 5DGHA 4B8ZA 2YVUA 1VJDA 1X7HA 1RYMA 1UINA 2HV8A 2XR1A 4LNHA 4C7KA 3P2EA 3ZHYA 4CYMA 3OKPA 4ZN6A 1P1KA 2Z6AA 1EHIA 5CM8B 3ZWWA 2ZI9A 3EZ2A 5EESA 3E2IA 4ER7A 2EKZA 3OZWA 4B6SA 1MEOA 1Q1EA 2ERXA 2W71A 3KXKA 3PWSA 4N0PA 2R4UA 2AVDA 1DC3A 2H1SA 4LKRA 2PZLA 2NTNA 3AETA 4OJTA 5EJMA 3FUTA 3CUYA 4BC1A 4F6RB 1HDIA 2RGRA 1Z3IX 3L7CA 1FTQA 2QAJA 1EP3B 3OLZA 3HCOA 3OQIA 1ZICA 2YZKA 1ORIA 3B6EA 3JPWA 2VT6A 3W1EA 3T5AA 2OGWA 2YY5A 1J20A 4TV9A 4WI1A 2J6BA 2NVWA 1KS9A 1SXJB 1L4HA 1DO0A 4ONEA 4NJEA 4EPYA 1AQNA 2CVZA 5LQRA 3OZTA 1NURA 1UK6A 1D2HA 2H92A 1XJCA 4ZEOA 5CFRA 3WGIA 1NASA 4ZOLF 2YXDA 1FTYA 2VRCA 3BGDA 3HKCB 3N2EA 4OB6A 5EIBD 4L1KA 1OZAA 3TAUA 3W7VA 1PEYA 3NWJA 2XNSA 3MRTA 2E4AA 1T3SA 3AIKA 1KFBB 3QQPA 3RB8A 2VAVA 4QNMA 1LK0A 4NJMA 3K5HA 5L7YA 4CM7A 2C42A 1XEWY 1PQWA 2HMTA 1J0XO 2J4CA 1W7AA 4BDTA 4W9RA 5KAPA 3JVEA 1ZY2A 2QE7A 2JJQA 2Z3WA 1QM5A 3KEOA 3PIDA 5HJ2A 1O2DA 2IP2A 3V4VB 2VSXA 2P3QA 4GX1A 3R5KA 5GM1A 1E2GA 2QRNA 3UWKA 1JRLA 3IQDB 4PX2A 4UTOA 5KKCA 3JQQA 1XVAA 4DXDA 4RTQA 5JCJD 5JFOA 3RT1A 5FAKA 4ISCA 4PO1A 1B74A 4HC4A 4WLNA 1CP3A 1SIBE 1HUQA 1ODIA 2QM0A 2R44A 5DMXA 4BP8A 4EB8A 3TQCA 4OHPA 5I48A 3E9ZA 1GUDA 1J42A 1OKKA 4ZVLA 1VE7A 3N2GA 2OMKA 4GW3A 4O8CA 2HIMA 3ND9A 1Z29A 1L5GB 4EDHA 5T57A 3ZXYA 4PZYA 4GBED 3CLUD 3MGCA 4EGJA 5EKDA 1OFUA 4GH5A 4GLLA 4XB6B 3LK6A 3AV3A 3SZOA 4R1MA 3G23A 3SXJA 4CT0A 3VDNB 1TQDA 5KNCA 1NVKA 1KEWA 5EKTA 3HKBA 4KQMA 3ESZA 4EG8A 1D09A 3IAM6 2HNBA 3SHTA 1ZU4A 2ID4A 2OXCA 2Q2QA 1LDNA 1VL0A 4JZYA 2ZTMA 2PMKA 4URVR 1ZJWA 3SNKA 1R7RA 1PIWA 1IN7A 1UXOA 3BB4A 4FBLA 2O8BB 1L4KA 1ULHA 3KJQA 2VHUA 2W48A 1K3TA 1Q77A 3G3EA 3DEZA 2XODA 2DTEA 2HBRA 3DVRX 3GRRA 1ZUIA 3I83A 3K94A 3H97A 1MHPA 3IVCA 2F9LA 1P0IA 4UXIA 4CFYA 4CM6A 4G0VA 3M83A 2VWGA 1BCSB 1ETUA 1QX3A 4LDPA 1PZNA 3C8UA 3G2LA 3ZHTA 5DBOA 3S27A 3FUXA 4G5HA 3K16A 1ZGCA 1RKQA 3C7CB 2C5SA 3PQFA 4ZCLA 3WNCA 2VF7A 1AMOA 1THTA 3P9CA 1EFRA 2OESA 2P91A 5BSVA 2MIIA 2F17A 3AU9A 3HDGA 3UK2A 1XN4A 2YWCA 1EVQA 1M7GA 1PS9A 3A4NA 2PS0A 2Z2KA 4X1IA 5KJEA 5BYJA 2FPLA 3U7JA 3PE4A 2QBYB 1C3VA 1K88A 1P2TA 3JATA 4EBFA 3NTRA 2JIRA 1ZM9A 2XMGA 3SIPA 2KSQA 4F3CA 4YGYA 3U4QB 4LJSA 1E3DA 1SHJA 3O92A 3V9PA 4YRTA 1O97D 3WB1A 4EHLA 2I99A 4MQ4A 1LJLA 3ZJUA 2NTVA 1IJBA 1Q7EA 2DHEA 1DS6A 1ZC3A 3RIMA 5A2QA 2ZR7A 1RHMA 4RQUA 1HNZB 1Y3BE 2PU5A 1PK8A 5EWJB 2DCUA 1S7GA 2EFGA 1DQRA 2YV1A 1AKMA 2ZYGA 3DWEX 1KEPA 3JVIA 3ZH9B 1TZJA 2WU3A 2W9XA 4G85A 3HHPA 4P0TA 5SZJA 3TTTA 821PA 1XCOA 1Y48E 2W6PA 4FMBB 4QWMA 1V1MB 2SNIE 5ITZA 5JH7B 3LCCA 1QB7A 3T9CA 1WABA 2FW7A 1HE4A 1JALA 1U1DA 4HEJA 3R74A 3WK9A 5B6JA 2QIPA 3SAJA 1ESNA 4MI1A 4E7PA 3UB4A 3NWEA 3GLGE 3WLMA 1BXZA 2NQTA 4WN9A 1NDHA 1C9EA 1K66A 2NSYA 2ZIZA 5IAGA 4CIBA 3E9CA 2I78A 3I92A 3DBHA 2AL7A 3ASVA 4LYJA 2Q1SA 2H7YA 4PQEA 3ZOKA 4P3KA 4A0GA 2NZWA 5L3VA 4MAFA 2ZT7A 3SP1A 2R1TB 5C7IO 2YYYA 2YVQA 1L4BA 2RCYA 1XMPA 1I7PA 1X8XA 2D5BA 4J7UA 5DHAA 2JFGA 2NTEA 3TIGA 1DAIA 1OFUX 2FPIA 1BS2A 2HPHA 1BYIA 3EK2A 4GQAA 5H3LA 5FUBA 1A7AA 3ZNOA 4LF5B 3KLBA 2OBMA 5G4KB 2XGOA 5AM0A 2HA3A 5JJLA 2NU8B 2IX3A 5EHIA 2CXUA 2W4IA 5JY6A 2HBQA 3FTDA 1PQYA 4OIFA 1YMVA 2YS6A 4L16A 1Q12A 2BGJA 3BMOA 2P78A 2YZMA 3GBVA 1JE0A 3P0IA 3DVQX 2NO6A 2CCJA 4R41A 2VK2A 4JT4A 5JQGB 3NEPX 3PPXA 4KE6A 3BILA 3KHUA 4PEVA 1Z4MA 3DEYX 1U2ZA 1W9MA 3C4VA 4OU4A 3VA7A 2V6MA 5HTKA 1K0UA 3MQ4A 3OP1A 4H1VA 2QE7D 4YALA 1NRJB 4FD2A 2CKMA 1WPQA 1HEUA 1N5OX 2JIDA 2F3TA 1X1BA 3I04M 4PLVA 5A9TA 1R6AA 2BKXA 2G1UA 3V1MA 4OQZA 3PHLA 3AHJA 2HN9A 3T06B 4I1RA 3RARA 4OK6A 1KE2A 3CM0A 1S02A 3L46A 2ENWA 1QORA 3ZWNA 2BGWA 4Q03A 3UY4A 3OBIA 2PH7A 3AXTA 3EZNA 3VZRA 4DZRA 4JR1A 4J03A 3AB7A 1G98A 2P6PA 1U90A 2YMMA 3LZDA 1PEDA 1WRBA 1Y8QB 1YJ5A 2B8EA 3QELA 1X9HA 4HWRA 3R7DA 1WQ4A 3OG9A 3RT9A 3WR5A 4DMGA 1J8YF 1ZIXA 4QOIA 4DOMA 4RLFA 6Q21A 2MMCA 1C8BA 2RAFA 1K3FA 3QU4A 1U7ZA 3AEKA 2P1ZA 3DSRA 2Z6UA 5AKLA 1JFFB 4Z0TA 5AI4A 1LZKA 3PNLA 4ZO8A 3W6PA 1SCAA 3TLAA 3W5HA 2P2DA 6YASA 2W2LA 3AEZA 1XTSA 5A3QA 5JHGB 3OM8A 4F8JA 3FGZA 4WZAE 1A9OA 1ZNYA 2YXEA 3ENQA 1LXCA 4W5HA 4YT2A 1TT7A 2UZ1B 3DOCA 4L6CA 3X3HA 4Q18A 2Q1UA 4PHHA 3MUFA 3VR5H 4F86A 4F96A 5FXMA 2B98A 1DWPA 2H4HA 3QXCA 1J8VA 3SKXA 1TYDE 4MWGA 3X1WA 3ZHCA 2R4QA 1YULA 4XIYA 2XIQA 3U37A 3HQ4O 1NQOA 4F11A 1VCMA 4HDSA 3SWWA 2Y1CA 1SWVA 1UUFA 3EEQA 3JQRA 4X1YA 1TCAA 3WGKA 5K01A 1Z34A 1QYXA 4CM8B 4JHLA 2IYEA 5JRDS 3ONWA 1JDSA 3LWBA 3WGMA 5JQGA 3IKTA 2OV6A 3NJ8A 1L0BA 3WLSA 1EFCA 3IE2A 3G8DA 3IAAA 2X42A 4KH1A 3ZC3A 3RU2A 4XYBA 4RA9A 3WKDA 2XNDA 4GO1A 4UMEA 2NU6B 2DYKA 3QMVA 3LFHA 4QU0A 4YS6A 2P2GA 5B64A 2JFUA 3JARB 4XIFA 3K70D 2E5FA 4YO8A 1UR5A 3RIGA 4ENUA 1DWQA 2O05A 4D6XA 4P08A 3M7IA 1T8RA 3OE4A 1RAGA 1L5OA 3CMMA 2XKBA 4IWYA 3BCUA 3TJMA 1MB4A 1WDTA 5ALDA 2WVJA 3V7NA 1F51E 3WMFA 2A67A 4IRMA 4YT5A 4B85A 4CDGA 4Z51A 5KNCH 1L5HA 5CU7A 5G1NA 1H0KA 1QVAA 2X15A 4LN1A 4X7BA 3AR7A 2W6JA 4FB4A 3TO5A 1NY5A 1DRUA 2VKQA 2JZCA 2XAAA 3GAZA 5DGXA 4B82A 5K6AA 3DEFA 4N48A 2OD2A 2ECPA 2WTNA 2H4JA 3M1LA 5HE8A 5I9MA 1IZYA 4AU1A 4XWWA 2XXJA 1DI0A 1ZXLA 4FX5A 1D5WA 3V2UA 5ITZB 3B2NA 4L0DA 1O57A 3DNMA 4GI1A 2QZJA 1F6DA 4N47A 2WWFA 2D4AA 4YY3B 1NF2A 4AJ4A 3T7RA 1WKCA 3I9FA 3VVCA 2ZUTA 3KQKA 1QS0A 3BSFA 1N6KA 3IJRA 1XCBA 2GHTA 2N42A 2JAHA 3FDJA 4J7AA 4AO7A 4O08A 2HDHA 3OOJA 3V8RA 3UM9A 5IBRA 2ZBDA 1ORDA 4LZJA 1TKBA 1UM9A 2QRKA 3CB2A 3SZLA 3K6SA 1ZH4A 2FPPA 2IE0A 3B12A 1JAHA 2FDRA 4MS1A 4QBHA 5TT0A 4B4WA 1NBIA 4EEKA 4QQNA 4JXKA 4QTXA 2PPLA 4LDAA 4U6SA 3I3SR 5HK8A 1XCJA 2ECKA 4MUYA 4R51A 3THXB 3EZ9A 4R8VA 2B37A 4UQLA 5JEDA 2H07A 1FNCA 1BG6A 3I0NA 4FM9A 3ZGLA 1VL5A 5IM4A 1JQ3A 5IPFA 4DBLC 2QD3A 3FOCA 1CRQA 1NPYA 1OBCA 1JR3A 5JXJA 2QJRA 4MW6A 1OLUA 1XZKA