1ZMTA

Structure of haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (r)-para-nitro styrene oxide, with a water molecule in the halide-binding site
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalcohol dehalogenase HheC
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 87
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zmtA00
3FPCA 3OJ0A 1G1AA 3NGXA 1HE3A 1B3RA 2JFFA 3RJ5A 4OMUA 3H5RA 5DBFA 3PQEA 1KIFA 3V2HA 3W4JA 3QVTA 1XCBA 2PLAA 4QQRA 2ZTMA 4WLFA 5JC1A 2HDHA 4B3JA 1JWBB 6ADHA 2DFVA 4FPXA 3VVBA 3WFJA 1Y1PA 5BSEA 2VT2A 3DL2A 4E2WA 5DP2A 5G0UA 3OEWA 3CZMA 2I6TA 3RKUA 3I6IA 1NPTO 2NUAA 3F47A 3KXDA 3OJOA 4RPJA 1NM5A 4S1VA 5L4LA 3HHPA 2HJSA 3NRCA 1TB4A 3OEYA 1YB4A 2O3SA 2GCGA 1E6WA 2GN9A 4CPDA 2CY0A 1GV1A 2HMWA 4CLDA 3OP4A 5FI3A 2IZZA 3KYCA 4RORA 4Z6KA 2RH4A 5B4TA 4DIFA 2PZJA 3IKTA 4J4HA 1M66A 1QSGA 1EZ4A 2EERA 1HZZA 3GOHA 4AJIA 1ISJA 1LC0A 1YVEI 2D5CA 2O3RA 2NU9A 4FFNA 5U4QA 3ZV3A 2Y0CA 5IXSA 5IF3A 3DZKA 8ADHA 2I67A 4K6FA 3QW2A 2I5PO 2CDBA 5U9CA 1U8XX 2GN6A 1KS9A 3W8EA 3U62A 5I7EA 3GH3A 3JQAB 1IUKA 3PYLA 1R6DA 4XKJA 4WE3A 4YDRA 3UKOA 1E1MA 3EY4A 3MJTA 3PDUA 4HFNA 4AJNA 5A9RA 4R3NA 4PCVA 4YYZA 3C24A 5CPFA 3EDMA 1GYPA 3INGA 3NDRA 3C7DB 3KYBA 3LLSA 4DMLA 2AE1A 4CM7A 2VHXA 3R1IA 3TZKA 4DIBA 2P68A 4J1TA 4ALMA 4LK3A 1NPYA 3K2BA 1RYEA 4KTVE 4UUMA 4LSWA 1IZ0A 1NFFA 2HK9A 1PGJA 4J9UE 4KOAA 5TNXA 5B12A 5IZ4A 1NBOA 4IUYA 1R4MA 1YDWA 1VLLA 2EP7A 2ZYDA 1D8AA 1T2AA 3AI1A 1GADO 1V35A 4DYVA 1BW9A 4R1UA 2AQKA 2IODA 3AUUA 3DZGA 1T1RA 1EUDA 2NACA 2YHUA 4IZHA 4U7WA 3RC7A 2RAFA 3DQPA 3GAFA 2AXQA 5L3ZA 1A9ZA 1E7MA 4I08A 1P3DA 1QLJA 2JJYA 3CKYA 5DZSA 5COBA 1YGYA 4AJ4A 4YAIA 3OFSA 4PG4A 5A5EA 2HO5A 1I2BA 3OH8A 2HMVA 3GT0A 2Q4EA 2QYSA 5ER6A 4FC7A 4PZEA 5A3VA 1LRLA 1L7EA 4R5HA 1L1FA 5BNFA 4J2OA 4E6PA 4ALNA 4IMRA 4XQGA 3ST7A 3ZWMA 1UP6A 2PNFA 4QX6A 1EQUA 2C7GA 2QHXA 3I3OA 3D0OA 3H8VA 4ZQHA 5AXDA 4XA8A 2XAAA 1U2GA 2C7VA 1JVSA 3BA1A 5EJ2A 4EI2A 4JCOA 1ZNQO 3PEFA 3LC7O 3UN1A 1SMKA 1YOVA 3WMWA 1UAGA 3BMCA 2FMUA 4RDIA 5TIIA 2J3IA 1D3AA 3GNTA 5JO0A 4TRNA 2PFGA 1QYVA 1P1JA 1WWKA 3C1TA 4E5MA 2HMSA 3BMOB 3O9ZA 4RQTA 3PFWO 1GQQA 2VHVA 4LISA 1B8VA 1IULA 3E9NA 3L77A 4CM4B 4D3DA 3G79A 4WEOA 5T6BA 1GZ4A 3GZNB 2P91A 1KC3A 4HXYA 2QZ9A 5EQFA 3WGTA 3WWZA 4KP7A 2Q1WA 2LDBA 4IDEA 4PLCA 2J8ZA 4DQXA 1KEPA 4ALIA 1GUZA 3KYDA 1WZEA 3SBOA 1H6DA 4IJWA 4OOFA 4E12A 2D1YA 4YQZA 3G0OA 1OZAA 4TMFA 4ALLA 1HEUA 2NV6A 5TC4A 1ZK4A 5KNLA 4IZIA 1Y8QA 1X1EA 4M49A 3AY6A 3RAJA 1YL7A 1FDUA 2PKRA 1I5RA 4MKZA 1HDXA 3QSGA 1AHHA 1UDBA 3AOEC 3GR6A 1EUZA 3DTYA 4CQMA 3PJGA 1AGNA 4AL4A 3ITKA 2I76A 1BGVA 1HDCA 2E82A 2H9IA 4OQZA 2BD0A 1B16A 2QX7A 4RVUA 4H3VA 5GY7A 3UHAA 3PZBA 1FMCA 4GAEA 2WM3A 2VWGA 3U9LA 5KTKA 3H3FA 1P0CA 1AHIA 2HMUA 4YRAA 4J0EA 4CMAA 1KVRA 4PZDA 3H9GA 5ILGA 4IDCA 5KWEA 1NFRA 2VUTA 3VZRA 3L6EA 3HDYA 4R1TA 1E7YA 3EMKA 1E77A 1QRRA 4MP3A 3S55A 1U7HA 3LC2O 1JAYA 1SC6A 4IIUA 1AXGA 3ZWOA 1EDZA 3ULKA 3WICA 4J7XA 1VKNA 1UZMA 2JHFA 3ZNQA 3OQ1A 4BB6A 2EG9A 3DBHA 1NWHA 3NTRA 1JN0A 1PJSA 2YQ5A 3UH1A 4CM9D 2Z95A 3UGKA 1PGNA 1DAOA 4I1IA 3DFUA 4LRSB 2BELA 4PLVA 3RBVA 5BSHA 4CLOA 1JWAB 1ULUA 3PJFA 1V0JA 4WCFB 2BKAA 5THKA 4O63O 4J90A 4XRRA 4A7PA 3DMYA 4B4OA 1NAHA 1ISFA 2IYOA 2BGMA 3AW9A 4II2A 1UP4A 4ZGWA 4NK4A 4Q3BA 1DSSG 2YDYA 1PTJA 1LXCA 4UVEA 1PJ3A 3FR8A 3FTPA 3DOJA 2HJRA 1GCUA 3RBXA 3EVTA 4QECA 1PEDA 1EBFA 4J2HA 1P9LA 3M6IA 3LQFA 5DBIA 3O8QB 4IDGA 1XDWA 4YRDA 1N1EA 4YACA 3BTSA 2V6GA 5BT9A 4GKBA 5AXAA 4EITA 4S3MA 4GQAA 3D4NA 4HBGA 1D7OA 3ZGYA 4RQUA 4YJHB 1K6JA 3GEDA 3HB5X 3KTDA 1I2CA 4XEHA 4J7CA 3TZQA 1PQPA 1PS8A 1WMBA 4CMEC 3DOOA 1EE9A 1PQUA 4CMIA 2O7QA 1GCOA 1QYXA 3P5SA 4I5FA 5JY6A 4FQ8A 2HQ1A 2VWPA 3GUCA 1Q0LA 2OHXA 2DUUA 2QRLA 2DTEA 2D2IA 5BR7A 1VKOA 4P22A 2VRCD 4XD2A 2ZB7A 3KB6A 3RUDA 3ADPA 4HX5A 4R41A 3HB4X 5H83A 1DFGA 4K1LA 1NVMB 3D4PA 3OICA 4O59O 4AICA 3N74A 1GPJA 4IS3A 1K5HA 2OFPA 1AE1A 2X7HA 4Q3NA 1VE9A 4TRRA 1VJTA 3JQ7B 4W82A 4BKUA 1V3TA 3ANMA 4Z0TA 4CM8A 3FNEA 1MV8A 1ZK1A 5G0WA 4DWVA 3GUYA 1HZJA 3TL2A 2BRUA 2VRBA 2NM0A 2P5UA 4EZBA 3QVWA 5IG2A 3EC7A 2EIHA 1Y8RB 1F0YA 3RC9A 5A5FA 4MVJF 4FFRA 4JP3A 1RKXA 3W8DA 3IUPA 1P45A 1N9GA 2AA3A 5T8KC 5CEEA 3Q1LA 4BO0A 1AN9A 5L7WA 2JD2A 3ONEA 2W90A 3PHLA 5JMPA 4YA6A 4IJKA 3GQVA 4GX2A 4QO8A 1J5PA 1MFPA 2V65A 4Z3DA 3CE6A 4NJMA 3X2FA 3Q6IA 5A1TA 3MCVA 3GVIA 1P1KA 3H9EO 3V8BA 4B3IA 3GN2A 1V9LA 3H9JA 4BO6A 1T2FA 2EV9A 3JQBC 4D0SA 1A71A 4D43A 4IGFA 2J6IA 1XA0A 3WGYA 3D3WB 4MVJM 2JL1A 2PKQO 1W73A 3QV1A 1Y81A 2X5JO 3QWBA 4NK5A 1P33A 3AUSA 2ZKLA 3WYCA 3U5TA 3FD8A 3V1TC 3JD2A 3F1LA 4UUPA 3GGPA 5JCJA 5JYEA 1U4OA 3DAGA 1M75A 4WCFC 4WLVA 1KVUA 3O03A 1CDOA 1YBVA 4KUGA 4C7KA 4BNWA 5IZCA 1YRLA 4XRGA 4R01A 1LDNA 3DHNA 1GYRA 4TQGA 1KEUA 3PYXA 4JGBA 5EN4A 3FCOA 3G3EA 1JAXA 1SAYA 1HYHA 2CZCA 1J0XO 3K73O 3GVXA 4GSKA 1DFHA 4LN1A 3WB9A 1CQJA 4BNTA 1NHWA 3WGOA 5AXCA 3A1NA 2P5YA 5JDIC 3NDIA 3E18A 1LA2A 1QKIA 1DDOA 3AK4A 3IJRA 3TL3A 5G0TA 4A0SA 3PHGA 1BRMA 3PWKA 4U8GA 4GI2A 4YJFB 1P44A 2HUNA 4FW8A 4DQUA 3VC7A 2GRAA 4JNKA 1ZFNA 1I24A 2WDZA 1B8UA 2F1KA 4UEOA 3QRWA 4Z9FA 2VYVD 2HK8A 2Y1OA 4CODB 4CUJA 3K96A 2XXBA 2I3AA 1L7DA 3FWZA 4JXKA 3D5QA 2BI7A 3NT2A 4KDEA 1M2WA 1R0LA 1WMAA 3QP9A 3DBLA 3QE3A 3DAFA 3S2IA 1DC6A 2HK7A 1IYZA 2LDXA 3VDQA 3H9QA 4PVDA 1GQYA 3PI7A 4H16A 4II3A 5F1PA 4BQRA 4FD3A 2Z5LA 2CDAA 5I9NA 3GRPA 4IGEA 3H9UA 1PS0A 4AJHA 2IE0A 2DQ4A 1I3LA 3GA0A 2OZPA 1F8FA 1TEHA 4WLOA 1R37A 4CL8A 5CP8A 1M67A 1PZHA 2JKVA 2Y05A 4UVDA 4G5HA 4FFOA 4E32A 1K2WA 2O3JA 3NEPX 1QYCA 2WWRA 2EGHA 1D4FA 3JQ9C 2B5WA 1BDBA 1PL6A 2OP0A 4F6LA 4EEZA 4NU6A 1VM6A 4CLEA 1FJHA 2NNLD 1H0KA 4KQWA 3RUFA 4CV0A 4IDFA 4R54A 4KQXA 3UW3A 4YT5A 1RYDA 1XGKA 3C85A 4FGSA 4BGVA 3FF4A 5KOIA 3I83A 3T4EA 3GHHA 3V1YA 1WVGA 3MJEA 3LYLA 2J5QA 4ID9A 2YDXA 3HZZA 3UVEA 4NNJA 2B5VA 4PLWA 4CL3A 4RDHA 3MOGA 1A4IA 2PGJA 1E5QA 3WGZA 3BIOA 4BV8A 5HTOA 2GPTA 3PQDA 1RM3A 4EEXA 1F8GA 4OO3A 3FBTA 2QW8A 5ICSA 5IXYA 1QP8A 3IJPA 3KRTA 5ENDA 4NR0A 2ZYAA 1HDGO 1H2BA 4N5NA 4P4NA 5LCXA 4B7UA 1X7DA 5A9SB 5L4SA 1K89A 4HNGA 1Y7TA 2FWMX 1FDWA 1DB3A 3ADOA 5C7LO 1PWZA 3ICPA 3JTMA 2WEKA 1DIAA 1DHTA 3N58A 1PL7A 2NWQA 2XOXA 3NUGA 3QVSA 1UZNA 3F4LA 4JJIA 2AEFA 3U4DA 4CR7A 3OJFA 1LUAA 2C0CA 1O5IA 3B6ZA 4AJ1A 1LNQA 4DVJA 1ONNA 4XQEA 1H9BA 3LZ6A 3DB2A 1OC2A 3BAZA 5JAQA 1T1SA 3MZ0A 2XF8A 3H5AA 3BMNA 1HE2A 4DMMA 2O50A 4CLRB 4E0BA 1C1XB 4M55A 5TGDA 4WK6A 5T64A 4NPCA 1YL5A 4U0KA 1LX6A 4B7XA 5ITWA 4ZQGA 4W7HA 2IRWA 4RPHA 3RUCA 1C1DB 1DPGA 2DFDA 4BNFA 1UDAA 1XLTA 4NBTA 3I4FA 1I3MA 1EE2A 4INAA 5COAA 1U2DA 2VHYA 3VVCA 4XDZA 3E9MA 4DYDA 4CLHA 1ZK3A 3WDSA 1EBUA 1SB8A 1T4BA 2O2YA 4CQLA 3LT2A 2GN4A 5G4KA 1P0FA 2HRZA 4QUKA 4W4TA 3PHIA 4PG8A 3HJAA 1C0PA 4H7PA 4HFRA 4Z0PA 3EW7A 4NI5A 1ENYA 1KY4A 4A5OA 3RBZA 3KBOA 3ORFA 3RC2A 1O6ZA 3L4BC 3VPXA 2JHGA 5EPOA 3S2FA 5BNTA 2X0IA 1AXEA 2YZ7A 2DKNA 2GF2A 3F5SA 2DLDA 3JSAA 1ZIDA 1W8DA 4TVBA 3T4XA 2OP1A 3LF2A 1T25A 3WOHA 1N2SA 4LCEA 1TLTA 1BHSA 2YFHA 3IP3A 3OJEA 4UUNA 2VCYA 1UXGA 3OBBA 3ZV4A 2EGGA 2PZMA 1R12A 4RF3A 3K9QO 4ZA2A 4ZRNA 1NTOA 3IMFA 4IJUA 4UVHA 4J9VA 3PWZA 2Y67A 1SBYA 3QQPA 1VL0A 2NU6A 3W8FA 5TX7A 4DC0A 3SEFA 1A7AA 1E6EA 1E3IA 1LRJA 1ZH8A 4WASA 1E3WA 2UYYA 4B4VA 3NYWA 2JD0A 3BTOA 3W4IA 4IJVA 3JYQA 3W6ZA 5KKAA 1P1RA 2YW9A 2P9GA 4IMPA 2NVUA 1SEVA 2EKLA 2P2SA 1BTOA 3K31A 5DOVA 1U5CA 3ZNOA 5DCYA 3WX0A 5KJ1A 1IB6A 4BO8A 4YJGA 3EAGA 3GVPA 2PWZA 1MA0A 3DFZA 2GUGA 3OMLA 4MVJE 3LC1O 4MVJA 3D4OA 3ZWBA 2VOJA 4BL5A 1Y9EA 3FSRA 4E3ZA 2X0NA 3EZYA 1BXGA 1U3TA 2IDZA 3MJVA 3WBBA 4A10A 3GK3A 4EBFA 1IL0A 2G82A 1I32A 3NJ4A 3WGGA 3WMXA 1ZXBA 2EW8A 1E1LA 3G49A 1KBZA 2VTDA 3ETEA 3H6KA 5DCUA 5TQVA 2I65A 4FDAA 1YKFA 2WD7B 2DVMA 1EMDA 3CTMA 4QXMA 3VH3A 2ZYGA 4FJ1A 2NSDA 2Y0DA 1MLDA 4BO1A 1XWFA 1ZBQA 2I3GA 3I6QA 3VKVA 3ZWXA 4TKLA 1PR9A 1C14A 1RM0A 3BTUA 5AOVA 4CM1A 1W4ZA 3F6YA 5L51A 4IXTA 4D3FA 1ENZA 4MVJG 2NU8A 3H4VA 5EQDA 4XYGA 1P74A 3PVZA 3WGQA 4F45A 3D5TA 1SOWA 4MIOA 1UR5A 1NR7A 1TXGA 4UVIA 1X15A 4CQMD 3K2EA 1GYQA 2FZEA 2ZTLA 3DBRB 1R0KA 1X7HA 3PHJA 4HNHA 4ZU3A 5DN9A 2DM6A 3FPLA 3M2PA 5CEJA 1ZSVA 3ZHZA 1LSUA 1LEHA 1PJQA 4YAGA 4ESOA 3P19A 1NXQA 2XPCA 4BQPA 1PWXA 2E4AA 3WXBA 4D0RA 1Z75A 1PU2A 1TA4A 1B2LA 4BO2A 1HRDA 4CLXA 1U5AA 3GF4A 5DULA 5L53A 4YBZA 1PJ4A 1WDMA 4TRMA 4E5YA 3TSCA 1D1SA 2I66A 1Z7BA 4MP6A 2ZB3A 1F14A 4YJDA 5AVOA 3ANNA 2FR8A 2AQ8A 4D7AA 5CG1A 3IS3A 4I8XA 3QLJA 4IXWA 2ZCUA 4CMCA 1DJNA 1GAEO 2Q4BA 3AOEA 4OJNA 2GO1A 1H2HA 5EINA 1SNYA 4GVLA 3OIFA 1HT0A 4O5OA 5FFFA 4HFMA 1I10A 2Y99A 3TZ6A 3JQAA 2QIOA 4PLTA 4MIYA 3TPCA 4BNYA 3PDJA 2DT5A 3O38A 3QJ5A 1LDYA 2VN8A 4FFLA 2RH8A 1GY8A 4FS3A 3K92A 3IOYA 3PGXA 4WLEA 5G2OA 4DC1A 3ZHXA 4AG3A 3ONDA 4NHEA 1CRWG 2OXIA 1LLCA 1M6WA 2E6UX 4RO0A 3DZFA 1O95A 3GMSA 1Z74A 5BSFA 1CJCA 3SVTA 2PH3A 4K26A 1CERA 1JTVA 1IE3A 1E1KA 3JQ6A 2X9NA 3LU1A 1QYWA 1E3JA 2HSDA 3HDJA 4Q3AA 4L74A 3U4CA 2X5KO 3I23A 4L4RA 3LT1A 4D46A 5A06A 5JW6A 1H94A 4CUZA 1W6UA 2Q2VA 3MJ4A 3RJ9A 1VRWA 4JBIA 1QYDA 1Z73A 2FR1A 1B15A 3DONA 4FOSA 1KY5A 2EW2A 4M89A 3RCBA 1K6IA 2WYUA 2BHLA 2FN7A 4CMHA 3GVHA 3L9WA 4L73A 2AHRA 1DJQA 2VQ3A 4G81A 5EL0A 3IKVA 1KETA 2BFAA 4MDHA 3ABIA 3RUAA 3R3SA 3ZU4A 1TT7A 2VHWA 2Q99A 3Q9UA 2YYYA 3E9QA 2WYVA 5EESA 1XR3A 3EGOA 4Q3CA 3A4VA 5MGBA 4ND5A 1MUUA 1DC3A 3SX2A 9LDBA 2H5LA 3TWOA 3VH2A 4QO7A 1E5LA 3KV3O 1I2ZA 3JQEA 4OQYA 3CEAA 4GX5A 2BFPA 4KWIA 2X22A 4CMEA 3W4KA 2B37A 2IZ0A 4C4OA 2GERA 2WE7A 3BMOA 4XYMA 4IQ0A 4TVOA 3ZZNA 2GNAA 4FN4A 4IINA 4CM4A 1V6AA 5IDQA 3GZNA 1N7HA 4IBOA 3DXFA 2SCUA 3S2GA 3KM0A 3AUTA 5FWNA 2AW5A 4NZ9A 4OH1A 4X54A 3PRJA 1Z45A 1WDLA 3GMDA 4BNNA 8LDHA 2FY8A 3PWSA 4WOKA 1H93A 2FOIA 4NFSA 4U6SA 4IY1A 2C20A 3ENNA 4L4XA 4PFJA 1DRVA 1OOEA 3WS7A 1BDMA 3O26A 5A03A 3RUEA 3ZWWA 1Z7EA 4XDYA 4YTEA 3RU7A 4RLHA 3RSHA 4BNIA 2IYPA 4GVXA 3F1KA 2A9FA 2EJVA 1E3SA 4H15A 1ONOA 3PJDA 1KVQA 1V8BA 1GPDG 3C3XA 1ADFA 1ENOA 3K30A 2CMDA 5F1OA 2UDPA 4R5MA 4IDDA 2E49A 3H2SA 1YQGA 3FHLA 1JDJA 1PJBA 3OIDA 1M76A 5T8KA 4PN3A 1EFKA 2J3JA 5JCJD 4JBGA 3ROPA 1JKFA 5KVVA 3JD3A 2VWQA 2ZQZA 2A94A 1UZLA 2NQTA 3AY3A 1E3LA 2Q46A 2YUTA 3H65A 3VOSA 5CHEA 1UUFA 4CV2A 3B70A 3L6DA 2ILTA 3N7UA 4G65A 4YT2A 5U1PA 1ZEJA 5HWSA 1QR6A 1LSOA 3AM4A 3GDGA 1O8CA 1ZKMA 3JQGA 4RV9A 4BIIA 3PFFA 4DUPA 4RVFA 5CDTA 1DBVO 3JQBA 1GEEA 3RU9A 4PZCA 4A73A 3C7CB 3B20A 2EKPA 3ZWYA 5DOZA 3BXXA 4Y6PA 3C8MA 5CPBA 1U3WA 4PG7A 4D41A 6LDHA 1H9AA 4EUEA 2BFMA 4JLWA 3I9MA 1ZVMA 4ZVVA 2NTNA 2ZTVA 5F3RA 4NFYA 2Y1FA 4WCFA 3PGJA 5B4UA 2OUIA 1SZJG 1LLUA 4XGKA 1R15A 2PD6A 3WBFA 3I9OA 2TMDA 2GGSA 1A4UA 3KLMX 5I8ZA 2WE8A 4ZRMA 3DZBA 4W9NC 3K5PA 4OL9A 4GMGA 1F12A 2FSVA 3JYNA 2YY7A 2B35A 2FPIA 1NVTA 1U1IA 1PGOA 1R4NB 1XIVA 3O8QA 5IJZA 5ER9A 2Q50A 1HSZA 1NP3A 5A4DA 3F4BA 3GG9A 1WW8A 4KUHA 4HY3A 3I9NA 4Q39A 5ADHA 4YJHA 1VC2A 3KOUA 2Y66A 1HYGA 5KVCA 4J6FA 3ZV6A 2BH9A 1LQTA 2HAEA 2C2XA 3M1AA 1CYDA 4XB1A 2Q1TA 1H6BA 4AJKA 1DC5A 4E30A 4A26A 3Q3CA 2JFGA 4ND1A 4LCJA 3CZRA 4IQ8A 3T7EA 4AJOA 3GNQA 1CETA 4LSMA 1ADBA 2R6JA 4RPLA 2PKQP 5IDYA 3WSWA 4D79A 5JNLA 4BO9A 1VJ0A 2C07A 2FP4A 3UFXA 5LC1A 3IDSA 4K28A 3TFOA 3JQ7A 1GD1O 4RVGA 4FJ2A 3KZVA 4RVSA 3F3SA 2DBVO 1PJTA 1J4AA 1YONA 4Y98A 2O3QA 2GDZA 5LDHA 1MX3A 2Q1UA 1MC5A 1Y8RA 2VZ8A 2VNSA 4IS2A 1Y5RA 1Z6ZA 4CMBA 4N7RA 3SLKA 3LDHA 1F17A 1Q7BA 5KIAA 2PR2A 5GZ3A 5KJFA 4NBRA 4YAKA 2Y1DA 1LDBA 3JQ9A 4PLHA 1DAPA 1KVTA 5JSFA 1I0ZA 3GHYA 5TJ9A 2UV8A 2Q1SA 3AY7A 4NFHA 2GASA 4OSPA 2EEZA 2VYNA 1WDKA 3ETGA 3MTGA 3TRIA 2C2YA 4GWKA 2FR0A 2PD3A 3WLEA 2GZ2A 3HSKA 3WTCA 3GEGA 1OC4A 3KSDO 1I30A 2J5RA 2ZATA 1YB5A 3AI2A 4K6CA 1X14A 3LSYA 1HSOA 3D3WA 1R0SA 3ZCXA 4YWJA 3U0BA 4B8WA 1SEPA 1DC4A 4EJ0A 3FNHA 3I9KA 1OFGA 1I8TA 2AEJA 2UUOA 4J16A 3HFGA 1NPDA 3PJEA 4I5GA 1MG5A 5THQA 2BFOA 2EXXA 1K6XA 4D42A 2DAPA 5KJ6A 2FSSA 1VSUA 3F5QA 3RFTA 3UXYA 1JW9B 2YFQA 4ZN6A 1T2CA 3OETA 1TVEA 2EWMA 1A72A 2R00C 4DIOA 2BGKA 4DA9A 4GMFA 5ES3A 1OAAA 1YL6A 3JYLA 4MO2A 2X86A 3NTOA 3AUAA 1MC4A 5IN4A 2WTBA 1P31A 3RKRA 3WGHA 5DNAA 1GU7A 1YBMA 4FFMA 1NWCA 1KVSA 5EMHA 3OA2A 4HKTA 4BNGA 5L4NA 4ZJUA 1XEAA 2V6FA 1WLYA 4O0LA 1UDCA 3VAZA 3Q9NA 3BYZA 4WEQA 2VT3A 4P4GA 2P4HX 3PZRA 4YJFA 3MWDB 1O89A 4CM9A 1SCUA 4ND2A 4WLNA 5TT1A 3HQ4O 5HM8A 5ITVA 1JQBA 7MDHA 1NQ5A 2Y93A 1UAYA 2GN8A 9LDTA 2Q49A 3TJRA 5L7TA 4OXNA 3ZWVA 4ZD6A 3WR5A 5K0ZA 1CIVA 3AU9A 2WSBA 1BVUA 2O3UA 1PZEA 1PZGA 4D45A 2X9GA 4NH4A 3CIFA 3PHHA 2QRJA 2W4QA 4IDAA 4PLFA 3PIDA 1DIHA 1T2EA 2QRKA 4DTIA 3Q2KA 5BQFA 5DCWA 1ZSYA 3DBLB 4HWKA 1C3VA 1DRWA 1G0OA 4BHTA 4JP2A 5JPIA 2ZJ0A 4XR4A 4ALJA 3EUWA 5IDXA 1QG6A 5L40A 2OGUA 3ZWCA 4RVDA 4WNCA 2HCTA 2NTVA 3P2YA 3JD4A 5TJHA 2O48X 4GPD1 1QLHA 5L9AA 3ENKA 4MVJD 1FF9A 1JLLA 1Q7GA 4KUEA 2O23A 4IPTA 2CDCA 1W0CA 1WNTA 2FPPA 2X23A 4ND3A 3SJ7A 2AG5A 3NGLA 1GDHA 1CEQA 3ROMA 1YH3A 5AYVA 3RI3A 3JQ8B 4OKIA 5GZ6A 1LLQA 4AJJA 2BMAA 4ND4A 2VRCA 3QIVA 2AQIA 4YEDA 3ON5A 3PXXA 4O6VA 2C59A 1YO6A 3VZSA 4TSKA 3HN2A 1C0LA 1LU9A 2VOEA 3KO8A 1E7WA 1TT5B 2O2SA 4DPMA 4E2YA 2X58A 3KSUA 2GZ3A 4N54A 1GQ2A 3K6JA 4NU5A 2X9VA 3UICA 3FR7A 3RFXA 4XJSA 4FR5A 4LMPA 2VWHA 3AFMA 4LRTB 3EZLA 2W8ZA 2PY6A 4O1MA 5A9SA 4OXKA 2VZ0A 4CV1A 4RJTA 1QORA 1EEHA 3OHSX 4G2NA 3JV7A 3BHMA 3JYPA 5B4VA 4R1NA 3QWFA 5IZCC 5T5QA 1N5DA 3ZI0A 2CF6A 1H5QA 3DHEA 3OSUA 3STHA 4EDFA 2RHCA 5F5NA 1AUPA 1F06A 4FOOA 5FEUA 1U9JA 1YS4A 2I9PA 4OIMA 3RASA 2DUWA 4I9HA 2JCVA 4YB8A 3PPIA 3Q11A 2P4QA 2DBZA 5HS4A 4JX8A 3GGOA 3U09A 4CLRA 1ZZEA 3GFGA 1C1XA 2EJWA 1JKJA 4MINA 3ZV5A 3ZU3A 4BGIA 4E2XA 1ZW1A 2BGLA 3PTZA 2FHSA 3SC4A 5I7VA 3AI3A 3WNVA 3V5NA 2AMFA 3GN1A 1KERA 3D1LA 1FXSA 1T26A 1C1DA 3RD5A 3WTBA 3JQAD 5HBRA 3DMTC 3KHUA 4NDNE 1GFSA 3G1UA 4DBVO 1DRUA 2JCYA 4PLPA 4BKPA 4GKVA 3BMQB 5DDIP 3TQHA 2EF1A 2NADA 3JD0A 4U6QA 4WJZA 3A9WA 3CMMA 3LT4A 1PQWA 2DPGA 1E3EA 4ZQBA 3MWEB 4ZICA 5G0VA 3DTTA 3RWBA 5JAZA 4JROA 3GEMA 3BTVA 5DP1A 4XYLA 1U4SA 4CM5A 4MJLA 4AJPA 4GWGA 1BG6A 5C37A 3JCZA 3WQSB 3SC6A 1NNUA 1XQ6A 5KVSA 3NTQA 1YBAA 1X7GA 2VYVA 3ROQA 2BLLA 5B1YA 4WUVA 2W2KB 2Y1GA 3E48A 3PQFA 3A28A 5TT0A 5JAIA 1HYEA 2JCXA 3IIEA 4OXYA 4EUHA 1FDSA 4BNLA 3EHEA 3JQFC 4YT4A 4BO7A 2D0IA 2QQ5A 2J5KA 5FF9A 4XYBA 5F1KA 4GSLA 3IQDB 3Q2IA 2B4QA 3ANLA 4RF2A 1UXHA 4WOJA 2F00A 1J6UA 2DBQA 2Z1MA 3AJRA 4KMSA 3U3XA 4A2CA 3AM3A 3ASVA 2ET6A 4QFCA 2YHIB 1JU9A 1QMGA 4B3HA 1ISGA 3ONFA 1RM4A 2CVZA 4DBZA 1S6YA 4J1SA 4Q9NA 4RGBA 3C7AA 3ICCA 4NG5A 4YAEA 3OIGA 3OJLA 1HKUA 3EK2A 4WNIA 1P1IA 3WQRA 3SLGA 4QFDA 5HRUA 4NBWA 4XIJA 2UUPA 4YT8A 1LTHR 3P7MA 2O4CA 3RUHA 5KJCA 5JDCC 1RWBA 1DLJA 3E8XA 5A05A 4BV9A 4RPKA 4B8ZA 3SXPA 3EVNA 2NU7A 2VZ9A 5C7IO 1EUCA 1ENPA 2WD7A 4PRKA 5AQ1A 1B7GO 4PLYA 2ZTUA 4PG6A 2PZLA 1MG0A 4CMGA 1HLPA 2ZK7A 4PVCA 1HWYA 1EVJA 2FPGA 1GUFA 4R4JA 4YQYA 1B3BA 4YXFA 3QWIA 4BNVA 1O9BA 1ZUD1 1FK8A 2PGDA 4JN6B 1EFLA 2QG4A 1UXKA 4L8VA 2PH5A 4E33A 4LVUA 5GMOA 5HA5A 1N7GA 1WP4A 3GAZA 3DZIA 2G5CA 1KEWA 4Z0HO 4XJTA 4XR9A 4TZTA 4AJLA 4FFPA 5HS6A 1Y6JA 3VTZA 1PJLA 1LI4A 2J3HA 5TF4A 5CDGA 3DBRA 1IHYA 4FC6A 3NV9A 1Q0QA 4R16A 3GFBA 3KYCB 3CINA 1XHLA 1Y9AA 3R6DA 2BI8A 2D5AA 1E7SA 1WPQA 3CXRA 3WJ7A 1GL3A 1ZO8A 2X6TA 4RF5A 3FRJA 3L4SO 4FSHA 4PLGA 2Q2QA 1BWSA 3LF1A 3CPSA 3Q0EA 4DRYA 4RLSA 1S7CA 2IXBA 2WMDA 2X5OA 5ENVA 1B8PA 1JVBA 1KEVA 1PIWA 2BF7A 4I9NA 2HMTA 1E0DA 3QVXA 1R16A 3CMCO 1YXMA 3DR3A 3KLPX 3VH1A 1C0IA 5MDHA 4D44A 2H6EA 3HWRA 4BUCA 3UCFA 1A7KA 2GD1O 4ZQEA 5I7FA 4MP8A 1DIGA 1QV6A 3WYEA 3I9JA 4CM3A 3G17A 3C1AA 4XGIA 5T67A 5C5IA 2X0JA 3NJ8A 1EVZA 3W1VA 3P2OA 3HADA 4BKQA 1C0KA 3TN7A 1N1GA 1HE4A 1H6AA 3K8ZA 4L4SA 4BMSA 2VNAA 1DLIA 1ISMA 5I9LA 4E5PA 1V3VA 2OORA 1ZMOA 4BO3A 2NVBA 3KSZO 4JQCA 1HETA 3O4RA 2ZB8A 1FDVA 1U7TA 1R4MB 4L0QA 4LVCA 4Z9XA 4RF4A 2B4RO 1UJMA 4BNJA 3UOGA 4WLUA 3NAQA 1BW9B 4F6CA 1EVYA 3GPDG 5IFLA 5K9ZA 4UREA 1LJ8A 4L9RA 3TFQA 1VPDA 5K6AC 1U28A 1UXJA 4OYRA 3HFSA 4NBUA 5CDYA 4TWRA 5JCXA 2O7SA 3H2ZA 1BXKA 4B4UA 1NX6A 5JXWA 4XZ3A 5JY1A 4QTZA 4N5MA 1HDZA 2D3TA 1LRKA 2B36A 3GZ4A 5JS6A 2YV1A 1U3VA 2X4GA 1U3UA 3DAPA 4ALKA 4F3YA 3JD1A 2G0TA 3IL2A 1E7QA 5JYDA 5A3JA 3E5RA 1EVIA 2OMEA 1ARZA 4XQCA 4ITUA 2B69A 5JMWA 1G6KA 3UF0A 4W9NA 3D7LA 3E6AA 5EERA 2EP5A 4BGEA 4CMKA 3TF5A 2Y1CA 2Y68A 3TZCA 4CR8A 1YOVB 2C5AA 2A35A 4OKNA 1NQTA 1HL3A 3GLQA 5L95A 1LSJA 4XIYA 3BMCB 5IN5A 1LSSA 3QA9A 3PLNA 2ZB4A 2JAPA 5GZ1A 1NVGA 1ZJZA 4WECA 4J0FA 3V2UA 1E7RA 4E13A 2V7PA 4XB2A 2TMGA 2JFHA 4B4WA 1ID1A 3ITDA 3WGIA 1RPNA 4J3FA 1Z82A 4TKMA 1GR0A 2W2LA 3WQQA 3FWNA 3INRA 3DO5A 3QWHA 5KKCA 2HU2A 1QV7A 2CVQA 2ZQYA 2DBRA 4YPOA 3G1TA 2RCYA 1BVRA 3KYDB 4Q3DA 4UUOA 4TRJA 4GGPA 5BNIA 5G4LA 2VYND 4PGFA 5H81A 1K0UA 3ZU5A 4BS9A 4W7IA 3UCEA 5FI5A 1Y8QB 2A4KA 1E6UA 3WIEA 4R9SA 7ADHA 1HDRA 2CVOA 2RHRA 4FJ0A 4WKGA 4CQMB 1RM5A 1X13A 4BNUA 1KYQA 4Z3KA 4J7UA 1N92A 3OQBA 1I36A 3WNQA 4Q3EA 1ZXLA 3RIHA 2O4UX 1V3UA 2C54A 2PK3A 2RBEA 2H1SA 3OECA 4PRLA 1B0AA 3CUKA 3NT4A 3ZHBA 4ZHSA 4DLBA 4Y9DA 2JAHA 3VPHA 2VTEA 1P1FA 1Q0HA 4XX0A 3ZNPA 4M8SA 1LDMA 3S8MA 4CV3A 1X0VA 3NT5A 1ADCA 3OM9A 1T4DA 2DC1A 5I8WA 3JQGB 2ZIZA 1D1TA 4M1QA 1CWUA 4KZPA 3VPFA 3DBHB 4C7JA 4TZKA 2CD9A 2WJPA 4FIZA 5COQA 2Q3EA 1IY8A 4PG5A 3WG9A 4LW8A 1DIRA 4BMNA 4CLOB 3WLFA 1ORRA 4Y67A 5TRTA 3ASUA 3VTFA 1NYTA 4UAGA 4LGVA 4N18A 1ULSA 4DQVA 4PLZA 1I01A 1WXDA 2NTJA 4Y8VA 4BMVA 2GLXA 1YJQA 3RQSA 4DPLA 1XU9A 4D3SA 3KVOA 1PJ2A 1BXZA 4UEKA 1NQAO 2R00A 4BOYA 4E21A 1ZMTA 2DU8A 4F46A 5G0SA 2CNBA 1NQOA 4U5QA 1DEHA 4UEJA 3SJUA 4ONEA 5JDIA 3VDRA 5JLAA 3VZPA 1ISHA 5L7YA 1MXHA 1DO8A 4XCVA 1KC1A 1B26A 1R4NA 4R1SA 4DLAA 4BVAA 2QYTA 4AJEA 1QXSA 2EHDA 4M86A 1ZSNA 3DEYX 1XU7A 4DPKA 2IXAA 5CDUA 2WYWA 1XQ1A 4EUFA 2FRDA 1H6CA 3M2TA 4JBHA 4QEDA 5F5LA 3TOXA 4CMIB 2DTDA 5ILOA 4R9RA 2CUKA 1I3NA 1O0SA 2Z1NA 1ML3A 4E2ZA 2Y1EA 1ZK0A 1PZFA 5AXBA 3UCXA 2AQHA 2YJZA 1XSEA 4YVFA 4A27A 3ZWAA 3V1UA 3I4CA 5A9TA 4DL9A 4J91A 1FDTA 1NASA 5C3MA 4HV4A 1HDYA 3DBVO 2DPHA 1NR1A 3TZHA 4EJMA 4OHUA 2RIRA 4EW6A 3ZHYA 4EJ6A 4NMHA 5J23A 5I7SA 2Q45A 4HP8A 4BGUA 4MIEA 1LDGA 1MGOA 3AOGA 4OGWA 3LK7A 2OL4A 4CM8B 3DHYA 4WCDA 1PS9A 3MOIA 3OA0A 1IOLA 2B0JA 2V6MA 5JC8A 1LDEA 4J1QA 1Y5MA 3R3JA 1ISIA 4L75A 3MJCA 3AFNA 1LLDA 1RJWA 1XELA 3RUIA 4MVJI 4K9DA 1WZIA 4RZHA 4EYEA 1GTMA 1LC3A 3ZDFA 1A9YA 1N9GB 4XYEA 1M6HA 1SPXA 1YDEA 4JJFA 4MKRA 5KJEA 3BHIA 4OM8A 4YR9A 2OO5A 3WIDA 3PIIA 3PP8A 3ZWPA 1YJ8A 3A14A 4BNZA 4HADA 3GNSA 4NJMB 4UVGA 1XG5A 2V6BA 1PX0A 3H5NA 2D8AA 3VKUA 3X2EA 2IEDA 2Q2WA 1YQDA 3A06A 2A92A 1E92A 1HDOA 1LBEA 1N8KA 1E1NA 3UAGA 4R68A 5C7OO 5CAEA 5CG2A 3H7AA 3ZW8A 3HUDA 2I99A 1VI2A 3ZU2A 1GV0A 4MVJH 4ILKA 2G17A 2G76A 4RPGA 3S1LA 3R0IA 1G0NA 2VHZA 2YV2A 3M1LA 3I5MA 3L9XA 4I9UA 4DXHA 1OMOA 3IP1A 4MKXA 1DXYA 1EDOA 2PZKA 3GDFA 4BNXA 2GZ1A 3KEQA 4DGSA 1UP7A 4Y6SA 4I5DA 4M87A 4HUJA 3TOZA 2NLOA 2GYYA 2EKQA 3MEQA 4OSOA 1WAMA 1ZCJA 2J3KA 3BZUA 3ZN2A 1P1HA 5F21A 5JFOA 1PL8A 3B1FA 3JYOA 3CSDA 1XYGA 1X0XA 4W6ZA 3F9IA 1NAIA 2XXJA 4NIMA 3QVOA 2IEBA 3E03A 1MFZA 1J49A 1HTBA 2X8LA 4OOEA 3OQ6A 4BO4A 3WYBA 2D4AA 1OBFO 1Q2XA 3WFIA 2PA3A 4WGGA 2B4TO 1XKQA 3E1KA 1DHRA 1O94A 4L76A 1MP0A 1UH5A 4J1NA 1IPEA 2FZWA 3HE3A 4IQGA 3QHAA 4KDFA 4BNKA 1SO8A 1JKIA 1GUYA 4BNMA 4E4YA 5IAAA 3NX4A 3WWYA 3W6UA 1YE3A 4FGWA 3DMTA 2AE2A 4GGOA 5CEFA 1IHXA 4GH5A 4DREA 1Q1NA 1PJCA 3IC5A 3LVFO 5DT9A 5H82A 3MJSA 3I1JA 4N5LA 3L4BA 3ROKA 4U0JA 3KEOA 3FBGA 3U49A 2AEMA 1KOLA 3HN7A 2CF5A 3PYMA 4LMRA 3I52A 2C29D 2YQ4A 2HKIA 3D3EA 5ICMA 5KCZA 3H3JA 3AU8A 4RCVA 4P38A 4AJ2A 1ZK2A 2AG8A 4M54A 1NFQA 1HLDA 1HE5A 5JAMA 4W99A 1VL8A 3GG2A 5TSDA 2Y0EA 4BO5A 1P77A 3DWFA 3E82A 3GC6A 3QY9A 4GL4A 3GDOA 3JQ8A 3JQDA 4JK3A 3B1KA 1PR3A 1YWGO 4IDBA 1YB1A 3GRKA 4J43A 3JQFA 3DOCA 3U4IA 2NQ8A 4HFJA 2VUUA 1Q7CA 1EK5A 3S2EA 4R3WA 4YRBA 3GGGA 3HG7A 1CQIA 1TT5A 3RVDA 3QWAA 4QT0A 1T24A 2WD8A 3ETDA 1MB4A 2C5EA 4E31A 3DZJA 5LDGA 1LQUA 3ZWNA 2R2GA 1EQ2A 1VSVA 4OAQA 1K3TA 3HDHA 2W98A 1OI7A 3WJAA 4CJXA 2VUSA 3TDKA 5JBIA 3V2GA 4Y6RA 2P9CA 4MPDA 4GBJA 4J49A 1TI7A 4UULA 4XGNA 4ROSA 5JDCA 4WPGA 4CMJA 3BHJA 1X1TA 3F46A 3L07A 3LT0A 5JE8A 4YAJA 4BKRA 5DF1A 3OF2A 2PTGA 3FI9A 1A5ZA 3DC2A 3AWDA 3T7CA 5I9MA 5JO9A 4B79A 1JA9A 4CR6A 3BMNB 5TLSA 2UAGA 2GSDA 5L45A 1IPFA 1GEGA 3NDJA 4GLOA 3RC1A 4GLLA 3VPSA 4BB5A 4EGFA 1PGQA 4ZQFA 4FCCA 1BSVA 2YV3A 1SOVA 1U8FO 2O3TA 2X0RA 2JD1A 3IUSA 3HDQA 3U4HA 3LLVA 4E5KA 3UUWA 4P4LA 3GVCA 1SB9A 1PSDA 2P9EA 4PIVA 4IIVA 3COSA 4JJGA 4XQ9A 3RFVA 3JQCA 2PD4A 3AM5A 1I3KA 1GZ6A 4FB5A 4BKOA 1IZ9A 5A02A 4CQLB 2POQX 2ZCVA 3BMQA 3FTNA 3E5MA 5G4KB 4XWYA 3VPGA 2E48A 2QZZA 3GPIA 1A27A 2OOSA 5KVQA 2G1UA 3NKLA 4GX1A 3FN4A 4R51A 3VZQA 4AFNA 1ADGA 3DZHA 3L6OO 5TS3A 4NJOA 3D64A 4Z9YA 3PK0A 5CDSA 3IAHA 1YQXA 1ZJYA 4R69A 5EIOA 3PLRA 4RVHA 1MXFA 3WSVA 4QSMA 4YCAA 3KETA 2OBYA 2CFCA 4I5EA 3KUXA 2HLPA 2X1HA 3ZNNA 5B37A 3EYWA 1HXHA 2C82A 1BMDA 3HNPA 3INTA 3FNGA 2UVDA 2DTXA 3B1JA 2HRBA 2ZJ1A 4NQZA 3L0DA 2W2KA 3ZH2A 3TNLA 3ZW9A 3I9LA 1DFIA 4RZIA 3C1OA 1E3WB 1I33A 2PGLA 1CF2O 4J4BA 1NHGA 1DIBA 3FNFA 4JIGA 4URFA 5IDWA 5BSGA 4J4TA 3RROA 4A03A 4TROA 5T57A 3GY0A 1EK6A 2NVUB 3DDNA 2E37A 4IM7A 2CSUA 1R66A 1VJ1A 4FBGA 3VHRA 4YJGB 2H63A 4CUKA 2YHIA 3MTJA 1T2DA 1UXIA 4DLLA 4E5NA 2B83A 5K6AA 4MVJP 1PGPA 3CH6A 1DOHA 4NBVA 1BXGB 5CFZA 4BNHA 1ONPA 1GZ3A 4P8RA 1B14A 4KWHA 2NVWA 2OBNA 4MOWA 2IZ1A 2D59A 2PV7A 4GX0A 4KTTE 5DBGA 4AVYA 1ZEMA 3VH4A 5FYDA 1HF3A 4CM6A 2GR9A 2W2LD 5A04A 4RL6A 1VL6A 4B7CA
chains in the Genus database with same CATH superfamily
2PGOA 5LOVF 1L7VC 5CX1A 3A1EA 4TVKA 4JUIA 2REQB 4H1HA 3PFIA 5F7XA 1KTIA 2AFIE 3RJ5A 1EDEA 2J6HA 4CNQA 3P2MA 2AFIA 1U9YA 3H5RA 3K1TA 2OBBA 5AUOB 3PX3A 5E38A 4BVEA 2VDOB 5BT8A 2G0AA 2BMFA 2K7FA 2HDHA 2E3JA 4B3JA 3IQIX 1EHYA 2PUTA 1ZINA 3PNLA 4S2UA 1WXHA 4HI0E 4FPXA 1QGUA 4Q6WA 4ZVLA 5J2TF 3VVBA 1X8LA 3WFJA 4BVJA 5EPUA 5BMVB 2GYVA 2XA1A 2DUNA 1ZNXA 2Q2NA 3DVSX 3Q15C 2EF0A 1KZHA 4W5QA 5LQSA 2B7BA 4GIBA 2JKYA 5G0UA 1RHRA 3OEWA 4S1PA 5JNVA 3CZMA 2HQOA 5FFMA 1VE6A 4O0MA 1KTVA 3TFWA 4OHOA 3QBVA 2FDXA 1NW5A 3CQ9A 5KQGA 3MYYA 1XLTC 1LK0A 1TB4A 2HJSA 3IQHX 4D9BA 2GN9A 1E6WA 3KJFA 5FLYA 1DWOA 2O2CA 1QU3A 4FX2A 1V37A 3N8GA 2IZZA 1PUJA 4CGYA 4RORA 4Z6KA 1GNRA 1RCFA 1COWD 1YR6A 4L02A 4DIFA 3H2IA 4WFJA 2R48A 5FIUA 2UVPA 3F7OA 4I66A 3IKTA 5IJWA 3A1FA 4J4HA 1H5NA 2HYDA 3AG6A 3O74A 2FW6A 3BWEA 1E64A 3A04A 5JRZA 1M6YA 1Z38A 2P2NA 3OQHA 3O84A 2EERA 5FTJA 5DM60 1LC0A 2C88A 4FFNA 2Y0CA 1VZ2A 1S2GA 3P20A 3UBMA 4QXOA 3WYNA 4LGCA 5HHTA 1UEJA 3KQPA 1SGWA 5ARBA 4YCMA 1S8OA 4ZGBA 4B1FA 1FW8A 2ZT7A 3VC2A 3U62A 1TAQA 3NGMA 2QRUA 3JQAB 4UBLA 1IUKA 1E5TA 3BREA 1E1MA 4RA9B 4ZDJA 3LLUA 3MJTA 4MARA 4AJNA 3DQZA 3FKJA 2HNAA 3GJ7A 3COVA 3NPMA 4MRNA 4R3NA 5JROA 3DLCA 3A8TA 5A3SA 2QGNA 1YZHA 3NAGA 3PWTA 5AM0A 4AP5A 3O0TA 5JCOC 1DJLA 1I2MA 3A1WA 2ETXA 1E1CB 3LLSA 3LQRA 5AHRA 4CWAA 2JZNA 2VHXA 3PNKA 3C2QA 3MN1A 1UM9A 3EXHC 1MNQA 2ECQA 1KJJA 3MWLA 4DCMA 2ZFUA 1VKZA 3ZY5A 5AJUA 3N5KA 1IONA 3LVQE 5TNXA 3RS5A 4IG9A 3GI1A 1NBOA 3H1PA 2WIJA 5C35A 2HRCA 3FGOA 3S70A 1VLLA 2YXPX 5GJVC 5JMTA 3AI1A 4DA0A 1O87A 4MR9A 3AHGA 4AKIA 2QN1A 1DXOA 1BW9A 1J23A 1R9MA 1WMEA 1E99A 1F6WA 3DZGA 3GFFA 3C16C 4R1UA 4ZHQA 1T1RA 4HZGA 5MFZA 8ATCA 3TTTA 3MD9A 4LV5B 2Y2UA 4KXMA 5ICCA 3AF3A 3DLTA 4COKA 4I08A 3CKYA 2JJYA 1LS1A 2EHJA 3ZGOA 4B3RB 4CKBA 1JXMA 3DTVB 4PG4A 1KEEA 2HO5A 1I2BA 4LYGA 1XWIA 4U7JA 3OH8A 3WB2A 2WIBA 1FVFA 4RS4A 3GV0A 3OPYB 2NP6A 2WWVD 4AZ0A 3HJGA 2QM8A 3SS7X 1K88A 2OHFA 3WLLA 1MPXA 4Q4AB 3DV0B 4J2OA 721PA 4DMUB 1CQZA 4QARA 3ST7A 2Z8ZA 3VJKA 3ZBTA 4HD8A 3HVJA 4R2KA 1YKGA 4S0XA 1Q3TA 4OYHA 1VG8A 1BEEA 4ZQHA 3R7AA 4DGQA 3RS4A 1G7CA 1YV9A 2WUGA 2XAAA 2JHPA 5L3QB 3VX3A 3BA1A 3GDWA 3JPWA 5EJ2A 4ISBA 1E2KA 3OEHA 2X13A 3FYUC 3WMWA 4BTVA 1KGDA 4EABA 5BP7A 1UAGA 3BMCA 7AT1A 5TIIA 3DZCA 3H2HA 3GT7A 3UPUA 1D3AA 3DTNA 3O4FA 5LQAA 5JO0A 4NZYA 5EZQA 4IXDA 2RK3A 3T6KA 3URKA 3CE9A 1QYVA 1P1JA 5HILA 5D86A 5EZYB 3HB1A 3TIIA 4DFDA 3OQOA 4JI8B 3NVAA 3KSMA 5FDFA 2DCMA 4RQTA 1H0RA 1E89A 1NXXA 1K8QA 2QNRA 3C43A 3KDPA 1POWA 4V0NA 1FC0A 5SYNA 1IULA 3E9NA 2ZR0A 3KE8A 4QA9A 4BFWA 2SBTA 4MITA 3GZNB 1EZZA 2P91A 1TIKA 1KI1A 1ULZA 4OQDA 2Q3HA 5EQFA 3WGTA 2JBAB 1W44A 1W9MA 2VNHA 1M5RA 1GZHB 3FAZA 4AZ3B 1GA1A 2Z58A 1KEPA 2YXNA 2B98A 4ALIA 2P2LA 3KYDA 4AZTA 5D3KA 1H4VB 1XTPA 2IYWA 3A4YA 3F8WA 4LZWA 4EY5A 1SBZA 3ROZA 3IR6A 2O8FB 2BV3A 2K2WA 1DWUA 1CG6A 1YTLA 1HEUA 1ILWA 1XZCA 5TC4A 3MHPA 1C7FA 1X1EA 3EZ6A 2FR8C 4MKZA 1NI4A 1Q6ZA 1BDHA 3A2KA 1R5OA 3QSGA 5FPHA 5EJEA 1PK8A 5T6MA 3C3PA 1UDBA 4RA6B 1B41A 3O3NB 5FTLA 4XW2A 5KX5B 1KQ3A 3EPPA 5ERXA 2Y9MB 1VE3A 2BF4A 4AWAA 4AL4A 3UBTA 4EX7A 3ITKA 4LNUA 3K0CC 1HG1A 1I2AA 4M0UA 4OQZA 5B1HA 1B16A 4FX5A 3EAQA 3MWGA 4N0PA 1NI5A 4V03A 3OIVA 4DJ5X 4FHCA 1FMCA 3PNYA 4WT7A 1ZUNA 2VWGA 2BBOA 2FEOA 1XRQA 2FW8A 3GBVA 1RWPA 2OZVA 5CX4A 4D5GA 5FHRA 1EG7A 3EODA 5IHPA 9ATCA 3N1UA 4EGCB 4EHIA 2VUTA 4JT2A 5JCZA 1EJ6A 5AH0A 4D8YA 3OCYA 3F8SA 1I6KA 4M1TA 3I9FA 4UMEA 4YUWA 3LM8A 3K8YA 4MP3A 3S55A 1U7HA 2QR5A 2AIRA 3VNAA 3F74A 3LC2O 4F6RA 1JAYA 3KPVA 4QJ3A 4X7BA 1EDZA 4KQKA 3TLKA 1M34E 1E9AA 2I3DA 3FZNA 3O4IA 4BLOA 1M34A 1AMNA 3EXFA 5EMJA 1VKNA 2JHFA 3OQ1A 5LMUB 3LO5A 4D9JA 3DB1A 4F93B 1T0JB 1OBCA 3DFUA 2BELA 1T3ZA 5BSHA 4CLOA 1JWAB 5THKA 3KIPA 1CUUA 4J90A 2PUCA 4A7PA 3B3AA 3D3JA 2QMHA 1ISFA 2CNWD 2IYOA 4CTJA 1ZOSA 4D9KA 4Q5IA 4LJRA 2AVNA 4IO0A 1LXCA 3KAQA 3ZQ4A 1PJ3A 1LVHA 2ZJOA 2XD4A 3VYSB 3BFXA 3D8UA 3RYTC 1GKUB 1C9NA 1XB2A 5DHPA 1P4AA 4QECA 3ZCPA 4JP5A 1GITA 4ZYLA 4GC5A 1P9LA 1XKLA 3LQFA 4G0VA 5JQGA 3ZJ4A 1VP3A 1T2NA 3TL6A 1Y5LA 3DHVA 4EX6A 1MW8X 2EL9A 2PLNA 5BT9A 2OKGA 1VCOA 2CNOA 4GKBA 2BT4A 3D4NA 4GQAA 4HBGA 1QQTA 1SKBA 2X0FA 3ZGYA 4B4DA 1W4BA 1WV0A 4HCJA 4YJHB 1E6CA 3GEDA 3PENA 2OM6A 2ISQA 4LGYA 3TZQA 3USCS 3UJ8A 3AP2A 4LJKA 3ESXA 1KOFA 1VTKA 2KBEA 3IUQA 4G1FA 4CU2A 1QKJA 2VDKB 5J4LA 3INYA 4BN5A 3QNMA 4M0CA 2IY9A 1PQUA 4GI1A 3SC2B 5AUPB 4UMFA 3P5SA 5DO9A 3A9VA 2QS9A 3ZKWB 3EWAA 1Q0LA 2OHXA 3KSAC 2NAFA 2V58A 4W9RA 3GZTB 1Y82A 2DTEA 3ZD7A 4I4TA 3HM2A 3A1TA 1FUKA 4GKKB 3SCZA 4EHDA 1JDPA 3MCAA 5F77A 1VKOA 4LMAA 3U1BA 5BQXA 2IK8A 2ZB7A 3L84A 1RJDA 4KH1A 4HX5A 1I4TD 5H83A 2IS1A 4AICA 4O59O 2RI0A 3ZDZB 1QTIA 3N74A 1GPJA 2FP4B 3D6NB 2DT8A 1TZ2A 2RARA 3NEAA 1QH8B 4JLPA 4Q3NA 3PC7A 1VE9A 4KXVA 1HK7A 3ZJ5A 1XTIA 5GP1A 2DQSA 4AECA 3AC0A 2B8WA 3H0CA 1NXTA 5EFZA 2QLNA 2JGLA 3A4NA 5FTMA 1MV8A 4Z3OA 4DWVA 2ZIVB 3I5AA 3GXBA 1SOUA 1JU4A 2BEVB 4G56A 4QAJA 2VRBA 2P5UA 3P9IA 2W0SA 5IG2A 2R7KA 1N2OA 1YJAA 2H1IA 4BTEA 4BKMA 5REQB 2JHAA 1F0YA 3GJ3A 4YRRA 3RC9A 4MVJF 4FFRA 3F6SA 4JP3A 4LF4B 3QXGA 1JHDA 1KFJB 2AA3A 2QVZX 5IEBA 4KQ2A 3V7YA 5GOTA 4BO0A 1O08A 2GKSA 3ONEA 1K0FA 4EA7A 1M0SA 3R20A 4IJKA 4NZMA 3GQVA 4YYEA 3NBXX 4BFVA 2RGCA 1DAEA 4QO8A 3NDPA 5DHAA 1MFPA 1Y63A 2HCRA 1TYBE 1CS4C 2WPDA 3CE6A 3ELUA 3EZ7A 5EJ5A 1L4GA 3F49S 3IUMA 1O96B 1OX4B 3MCVA 5ADVA 1YZUA 2C2GA 2C96A 1K7CA 3V8BA 2IGBA 2IXDA 4KAXA 2ZYUX 2V97A 1SU4A 3G7UA 3H9JA 4OGLA 2EV9A 4QUIA 2UUBB 3HA3A 4K9QA 1MV5A 4N3AA 3R7NA 4DDTA 4M2LA 3VM6A 1HNWB 2F3PA 3RSLA 4GW3A 1XRRA 3UJ6A 5I3ZA 1R64A 1UJNA 3D3WB 3PC3A 4E4RA 2WAMA 4BVHA 1BDIA 1C41A 2G77B 2VA8A 3UTCA 5KQLA 2GMWA 5ITZB 1Y81A 2X5JO 2NYRA 4NK5A 2P3OA 3AUSA 4FDLA 5LPNA 2F3SA 1C3OA 3OFVA 4NKRA 5BWNA 5KNBH 3D1JA 3WYCA 2HHHB 3PSAA 4MEJA 2HEIA 1XLVA 2OCAA 1XVVA 3W5HA 3WLJA 3OHMA 2G3YA 3TX2A 1ZA1A 2O57A 2QD2A 1CDOA 3T1VA 1E20A 1Y98A 1QIHA 4UAUA 4HEHA 4BNWA 2AI2A 3E2PA 2DR0A 3L7KA 3Q4GA 4R01A 4REQA 3QF7A 4OIFA 2WWXA 3NFYA 3OQJA 1VSBA 4LJ9A 4V0OA 1KI8A 3GLFA 2FSIA 3LV8A 4QPJC 1SAYA 1J0XO 1U90A 3GVXA 4XLZA 4G4IA 1OU4A 1DFHA 3DMPA 3N3BC 3DG9A 2FSVC 4K40A 3EBOA 4LTMA 4ICIA 3IOEA 3LAWA 3PQCA 3JVVA 1PDOA 3Q3HA 2IUUA 2P5YA 3UNXA 1TFRA 1DMRA 2DHEA 1P8AA 3GPLA 2JG3A 2COEA 3CNNA 1BYUA 5CHYA 4M0KA 3X1KA 1NVDA 1JHVA 3M4ZA 4LNHA 1JLKA 2GRAA 1KP3A 2QXUA 1ZOPA 4AKSA 3QXXA 1I24A 1J07A 4FFDA 4GYKA 2RHJA 3TMKA 4Y2YA 1RAHA 4IRMA 3QRWA 5LNK1 3KAJA 2VYVD 1ZI9A 1ZI8A 2HK8A 3C4JA 1P5FA 3O92A 3K96A 4B34A 2VXYA 2XXBA 2F1HA 4BEBA 2GEFA 3LA8A 4JXKA 4OX9Y 1RDFA 3I76A 3PDCA 5FCDA 1M2WA 3RS7A 1WMAA 2QL7A 1GT6A 3DBLA 5E3JA 3QPBA 2IV3A 1FX0A 4ZV7A 1NOIA 2OMKA 4RHUA 4Z2AA 1KMNA 4JWKA 2RGBA 4PVDA 3T1TA 1GQYA 3PI7A 5FPPA 1UBOS 4II3A 1WG8A 1XROA 3D8RA 2G80A 4EARA 2M2IA 4JLUA 3H9UA 1GFZA 4G0YA 2G9QA 4TUYB 1YJXA 2DQ4A 2PZEA 3B3QA 2OZPA 4G5FA 1KSFX 3R74A 1Y3IA 3FNRA 4WLOA 3VR5H 5DMHA 3BULA 1M67A 1PZHA 1UPXA 5CP8A 5BYAA 2E5LB 1U81A 4L8YA 1G2PA 3PFGA 2FFRA 4YR7A 2YRFA 1WXQA 4HK4A 3I92A 3PD1A 4HXEB 4G5HA 4UVDA 4G63A 1XRSB 3RRMA 1BHJA 1ATIA 1I80A 1K2WA 1ORHA 1YI1A 4YP6A 4JNCA 5ANRB 3H4MA 3PXEA 1JR3E 2ORED 2ZIEA 4Z1MA 2FPPB 3SDSA 4UQLA 1JR3A 4QG3A 4WRRA 3T5TA 1IY2A 3UKDA 1U0BB 1BDBA 1PL6A 4TZ0A 3UTDA 2JLYA 4WSOA 4AKHA 4KCGA 2QSZA 5SYMA 1TQHA 1V1RA 1EM6A 3ID6C 3MJFA 4TS1A 4F71A 3V8NA 1FJHA 2FX5A 1CVIA 2I6GA 2NNLD 2W93A 2XDYA 3N2KA 1NR5A 4W1SA 4IDFA 3EW9A 4Y2HA 3UW3A 2QORA 3LPMA 4YRLA 1X77A 1HQYE 1XRMA 2QYHA 3FUUA 4CKCB 3O7MA 5K2OA 1YHYA 4FMCF 3RSQA 3KVVA 4BGVA 1DQYA 3I83A 3V1YA 3W04A 2WU3A 3MJEA 3PDHA 1F2UB 4UCQA 2J5QA 4ID9A 2YDXA 3UVEA 2B5VA 3D6VA 1V2GA 4BV8A 3SSAA 3BIOA 1RM3A 4JA2A 3O2NA 3VUFA 1Q22A 4PE5B 1L7PA 1MO4A 4F3CA 2PSSA 3AEQA 1T1IA 5FAKA 4KQ6A 2JB9A 3EB9A 1WUJS 3EEBA 3H83A 1C2YA 2ZDGA 2OV1A 1HDGO 1OA0A 2ZYAA 3NHKA 3HUFA 5E4YA 5FUXA 3AETB 2BBTA 5GOZA 3OTGA 1K89A 3QXHA 2ZWPA 1CBUA 2B30A 1Y7TA 3F97A 1U3DA 1VZ3A 3WKCA 1DB3A 3RTDA 4B44A 1V95A 4QUEA 2ODEA 2Q3LA 2YV5A 1PWZA 3ICPA 3JTMA 2WEKA 4HQ0A 4UQOA 3H11A 4J07A 4RHCA 3ZDRA 4BMZA 3CX7A 3Q3EA 1SWVA 1FU7A 1QGDA 4ZDKA 2D00A 1PL7A 3K70D 2XOXA 1E63A 3P9RA 5B2EA 3NUGA 3KBBA 3QVSA 3C3DA 2HZBA 4JJIA 5ELMA 3FLBA 2C0CA 3SBXA 1O5IA 1RP7A 1MAAA 1PR1A 5C2JB 4DVJA 3O8OB 4K8OA 1H9BA 4O2AA 2HWXA 2H2WA 2PH7A 1GL9B 4A2QA 1OC2A 1VKRA 5JAQA 2UUCB 4LPKA 4QFBA 3ORHA 1P3JA 2AFHE 3K0KA 2V7EA 3BMNA 4CIDA 2AFHA 4CLRB 1BCRA 1DELA 3VHLB 2J4FA 4LZJA 4E0BA 1JPUA 4ZI3A 1WU8A 5EIBD 1J8YF 1JIVA 1JKJB 5TGDA 4JT9A 4AKEA 4M37A 5LN1A 1YL5A 4DUZB 4B7XA 3ZD9A 1FNDA 2QNBA 5CFPA 4C08A 5ITWA 1XAGA 4ZQGA 1SQ6A 3N70A 2PAAA 2FPMA 1NF9A 3RYCB 3RUCA 2YWFA 1MB2A 1DPGA 3I5XA 3ORRA 4IXNA 1SHUX 4ZK2A 3K2IA 3I4FA 1TEZA 3U16A 6YASA 1FYWA 1MH1A 4UOZA 2GCIA 4BBPA 3OMXA 3CC8A 3U13A 4Q03A 1G6Q1 3IPXA 4P93A 1GGNA 1RJFA 2BPOA 2IFTA 1RZVA 5K4GA 1ISRA 2GPSA 4G86A 3ODGA 5J2UF 1OWLA 1M6EX 1RI3A 1PWYE 3JQPA 1G8MA 2LPMA 4K8RB 3COZA 4QUKA 4LHVA 3UK1A 2ID7A 4PG8A 3DO6A 4Z0PA 3EW7A 4NI5A 4EHJA 3RBZA 4LDPA 3KBOA 4CG0A 2R1VA 5HKKD 2PGAA 1MIOB 1LVGA 4UXIA 4MQFA 4I46A 5TQ0B 4CYMA 2ODQA 5A5GA 5M5BA 2X0IA 1Z4JA 1QFZA 1I7DA 4KXNA 2DLDA 5FTNA 3SK0A 4C29A 4F2HA 5F12A 1BE1A 1VIDA 3H75A 4TVBA 2C2HA 3WOHA 3N6XA 2OUKA 1GP2A 3ETCA 3BXHA 4Z7QB 2H11A 2D0PB 5KWVA 2WVGA 1BHSA 4MTCA 3IP3A 2OM2A 4GD3Q 1XD8A 2Y9PB 5IKOA 5ICGA 3T5BA 3OBBA 2C1XA 4MUEA 1K75A 4OP2A 2YZ2A 1R12A 1X7ZB 1ODTC 2H9YA 2VXCA 4Y2SA 4POOA 1UBGA 1FP4A 3IMFA 2IX9A 4UVHA 3PWZA 1O8BA 3FCEA 2D0DA 4O4IB 4AMZA 1U98A 5KKNB 5FUQA 3W8FA 4HQKA 2NU6A 4DC0A 2ZREA 3KQSA 1A7AA 4NICA 1AF4A 1E3IA 3H13A 4KSYA 4JVMA 4MQ6A 4MQEB 4YRFA 4D3XA 3CRVA 1EU1A 4B5LA 3SQMA 3S68A 3QPWA 2HMYB 1XJ0A 2OLEA 3FLAA 3JYQA 3LBAA 5JALA 4KREA 1WXEA 1MDBA 2XE6A 3O7WA 2YW9A 4FBLA 1CRQA 2E2WA 3BORA 4HUQA 5DHUA 3ZI7A 4IMPA 1XNHA 3KJQA 2EKLA 2P2SA 2PHZA 1LK7A 2MU1A 1I9GA 3KUCA 3WX0A 4LJSA 4PYOA 3RAPR 1L5KA 3GVPA 4BE4A 4DV6B 2PWZA 1MA0A 4OATA 1YZFA 4H17A 3LC1O 1W87A 4EA8A 4AXXA 1Y9EA 1G1MA 1EB9A 2Z0MA 3EZYA 4YN3A 1BXGA 3KQVA 3UV7A 3D5EA 5K6RA 3LSTA 4BAGA 4A10A 5JXIA 3ZY3A 3AHCA 4LTDA 3GK3A 5AR1A 5FBWB 3E7PA 1YMVA 2G82A 1YDGA 1W2HA 1KSGA 5JWOA 2EW8A 4M9SA 1U1EA 2XE4A 4P3PA 5DGHA 1SIBE 2VTDA 4HHEA 2RG7A 2HNKA 1W0JD 2ZIUB 4FNMA 3VI3B 1QPZA 3F5FA 2HSGA 3JALA 2I65A 3DCYA 1SCNE 2AF4C 2YIDA 1U99A 2WD7B 3M9XA 3NP7A 4UHKA 1IXRC 4XTRA 4EY6A 4O4HF 1BU8A 1TUIA 3IILA 3O83A 3QG1A 2VP2A 3EAFA 4BO1A 5CYPA 3CS3A 3K71B 1FIUA 3VKVA 1WXXA 3K1ZA 4XSGA 1ZMBA 1LWOA 1C14A 1PR9A 3GBSA 2F1IA 5E6UA 2C7BA 5L51A 1JR6A 1NW7A 3NXKA 2NU8A 1XAIA 3H4VA 5DM1A 5EQDA 5F33A 1ZIOA 2CBGA 3SR0A 3D5TA 1MQ9A 3KR2A 5IVHA 2VJDA 4KN9S 5A6SB 4MIOA 4QYIA 4UNRA 1UR5A 1US8B 1TXGA 4P4TA 3FOZA 1UMCB 3ZGZA 1I1NA 2ZZKA 2FZEA 3PHJA 1E2DA 1X7HA 3GRCA 3WGMA 4HZUB 5DN9A 8OHMA 3FIUA 3FMFA 5HQJA 1KU0A 4QYTA 1AURA 5CK5A 5F23A 1H8ED 2PSJA 3ZHZA 4JBLA 4A91A 1UBKS 1LSUA 2JJ2A 1PJQA 2C5BA 4QOGA 3UMGA 3TG8A 3K70B 2A9PA 5JHGB 2ACWA 3L8MA 2PKEA 3CVYA 1Y7PA 4D4MA 1PU2A 1P1BA 3GLVA 1G8HA 1OTXA 1TA4A 3VXKA 4K9SA 3HXPA 1C9JA 1U5AA 1YI0A 3RU2A 3GF4A 2PX3A 3ZY6A 1PJ4A 5IJ0B 1NY5A 2PZBA 2R8BA 2ZG6A 4E3WA 3VAYA 3EYAA 4IQFA 1NJGA 3MQ2A 4Q3OA 2LCIA 4FYHA 1GSIA 1MB0A 1T9DA 2C7PA 2RHOA 3IAEA 2ZCUA 3LXRA 1DJNA 3LI2A 2FEXA 4WY8A 1GAEO 2Q4BA 4OJNA 5EINA 5HKAA 3O9VA 2WU0A 2AKEA 2BISA 5HCNA 3OIFA 1Y3DE 5C3UA 4DB2A 2WUFA 3KTAB 4GI3A 4RHTA 4M0MA 4F7DA 5LQMA 3AEKA 1LTKA 4MIYA 3UAVA 3PDJA 2DT5A 1Z39A 1VBNA 3EQ7A 5IXJA 1LF5A 1W0KA 4OGFA 4FFLA 2PYZA 1YFJA 4FS3A 3THXB 5BOSB 4OQQA 2ZE6A 3RVRA 3BKXA 4HWTA 4NHEA 2BDEA 4MZDA 2M6SA 4ER5A 2PKXA 4UTOA 4D9MA 5DX8A 1SHJA 4WNAB 4RO0A 3IOCA 1XCMA 1TQ4A 1GCGA 4IF6A 3GMSA 3P9PA 4OFWA 4PAMA 4W63A 1ZWLA 4FSXA 4KV7A 3AVYA 4RK1A 4EF4A 1JTVA 5B1IA 4B45A 1UC4B 2YJ3A 3U3OA 1Z9BA 3AG5A 1YC5A 5K09A 2HR1A 3CVVA 2H1OA 1Y3BE 1BX3A 4ZCMA 1HNNA 1XTSA 2HSDA 2OBMA 4Q3AA 1CUJA 1DCTA 4DXDA 2ZE5A 3P4YA 1V8ZA 2GBFA 5DYTA 4ZXPA 4D46A 4F86A 5A06A 5IAKA 1MOPA 2NP7A 4TLCA 3RVQA 3Q3IA 2C3PA 3TI9A 3HVHA 2C31A 4JBIA 2VQEB 4FOSA 5AW8A 2YBDA 3RCBA 3BHNA 3W5CA 1K6IA 2PUWA 3JZFA 1YHZA 2VJQA 1CUYA 4Q0MA 2GN1A 1N2ZA 4DIMA 1FQWA 3CR7A 4X7PA 4ER6A 2BHLA 1OR8A 5JVDF 1E2BA 2G4VA 2C4KA 4JLKA 2OHHA 2YMMA 4UFPA 5B1SA 2CFOA 2ZR8A 5LU8A 1JFSA 2JH8A 4OLAA 3G2KA 4L73A 4DV1B 3LQQA 4GKJB 2PX0A 3AX6A 1SG0A 1KETA 4M0DA 3RUAA 5LR6A 3ZU4A 4DZTA 2J59A 2GF9A 2ECKA 1EAYA 1WL8A 3N2GB 5AHWA 3E9QA 2HTEA 3QH4A 1DKOA 1R9JA 4DQ0A 1XR3A 3A36A 5BQOA 5BYKA 5AM5A 5HW0A 2Q5FA 2AOTA 4R8RA 1SVNA 2H57A 9LDBA 4PAOA 3SX2A 1S1MA 1GVNB 1KJ8A 2A88A 1H4TA 2AR7A 1Y9JA 2P75A 4QO7A 3T52A 4BFSA 4YFYA 4R2XA 2GAAA 1TTPB 3I37X 3KV3O 3RKSA 2EWVA 3WZ2A 3JQEA 4O4JB 1TF7A 1TUEA 3DGFC 1S4MA 5KB3A 5JS8A 2BFPA 2ETVA 2OG2A 3WHPA 2H3EA 4KWIA 5ALZA 4CMEA 2FWIA 2XBUA 2VP3A 1L4UA 4YUVA 3C5EA 3PDIB 3BMOA 2R62A 4YDQA 4FN4A 3QNWA 4F5EA 2G88A 1NJ8A 1NBMD 3CLSD 3FE2A 1VHJA 5ERGB 4L6CA 3JRWA 3U7RA 5A0VA 3CBGA 1N7HA 2JBHA 1HMPA 3P4XA 3TLAA 1SELA 1Z12A 3BWCA 3FF1A 1W5SA 3P4UA 3TUIC 1IBLB 4IMIB 3PRJA 1HOXA 1Z45A 4FXOA 4FD2A 5IBRA 3D3NA 4PS1A 4WOKA 1D2AA 1H93A 2Z2KA 2GD0A 3DE0X 3QYFA 4Y2VA 5EP4A 4IY1A 1P4GA 3IMEA 5NLLA 3WL6A 2UXCB 2P2YA 4K87A 2H2FA 5A03A 4P53A 4QU9A 3KJNA 5JAPA 5IM4F 5DX1A 1PAUA 2OAP1 4LXQA 4P84A 4RLHA 1XZNA 5CW1A 1MRNA 3ECSA 2WFZA 2AZDA 3P71T 4GLBA 3F1KA 4GVXA 4P54A 5CLHA 5P8WA 3WWCA 4D25A 3VKGA 1PYDA 1U4NA 1KMMA 2EJVA 5IVIA 1ONOA 5KOJA 3UGJA 1KVQA 4DQDA 1CYEA 3DFMA 1MJGM 4LS3A 4M1ZA 3C3XA 3ELDA 1ENOA 3K30A 2QV7A 1WP9A 1HBJA 1M54A 1Y4ZA 4R5MA 3CXUA 2E49A 3STTA 3FHLA 3VKWA 1M76A 5T8KA 1EFKA 2J3JA 3GD5A 3KZMA 3M34A 3NXSA 4JBGA 3ROPA 3UXMA 4AU1A 5CTAA 1B74A 3K09C 2ZQZA 3QFFA 1TYEB 1U2PA 4UM9B 1UMDA 4UE2A 3KOMA 3Q98A 4NCJA 1FSGA 3H65A 3ZGVA 1P7PA 3B60A 2GO7A 5I5GA 1N75A 3HCEA 4YT2A 6NULA 1ZEJA 1BFKA 2AZ4A 2FLWA 2JGKA 1G64A 1O8CA 4U63A 1PNOA 3E3OA 4HEQA 4DLXA 1FS5A 3CRMA 3PFFA 4BIIA 5AOCA 4RVFA 4LDNA 1DBVO 3OZVA 1N6OA 1TX4B 3OWHA 2JLZA 4DB4A 4XJXA 4MRAA 2EKPA 1JFFA 1KYTA 1KQNA 4ERNA 2CBZA 3BXXA 3OI7A 2IWRA 3CFYA 4L5YA 4U5XA 3C8MA 3L1UA 4CF7A 4D41A 5CH5A 3AUYA 3R9XA 3IEKA 4K6KA 4EUEA 2A1TS 4JGIA 4JLWA 4INOA 3ND9A 5E1MA 1KAMA 1YQQA 4MWZA 3AR3A 2P4SA 3I9MA 1RFLA 5JNTA 2BR5A 5KYKA 1ZMRA 3QOFA 3QYJA 1SIWA 1H8HA 4OP1A 3ZQUA 1AKEA 1I4EB 1FB5A 3ZE8A 3OF5A 1U0NA 2OUIA 4MS1A 2CVHA 2WU1A 4X1YA 1HDIA 1SXJB 4JR1A 2FJ0A 2PFSA 2YZKA 4P35A 1A4UA 1UKCA 5J59A 3SQNA 2GCPA 4IR7A 4U1RA 2QRZA 2XB9A 1JJVA 3IP6A 3DZBA 1IG0A 1U1GA 1XT6A 3L6CA 4JR2A 4KVAA 2HF9A 3LY7A 4V2UA 1Y9ZA 2PCJA 4IV0A 2WJWA 3LK6A 4EA9A 3C6QA 5CBKA 2BKXA 2XMCA 3OE7D 1NVTA 1WPRA 1CP2A 4JJ8A 1AM4D 3WHKA 4NE2A 5H16A 3D43A 5ER9A 2H07A 1DKNA 5A3QA 5A4DA 1NP3A 1SCQA 3F4BA 2WAYA 2HW8A 1JPNA 4I3GA 1DPFA 3EIUA 4MKIA 1VC2A 3KOUA 2Y66A 4Y9UA 4J6FA 1KFBB 2MYTA 2BH9A 1RKVA 4XB1A 5JS1A 3LY9A 5AK3A 3EVCA 4YMHA 1Y1RA 5IU6A 1N77A 2I7TA 1L7MA 1Z0UA 2H4HA 2CHEA 2FSUA 4WVFA 4B3CA 4E07A 1Z5UA 1XRPA 4JOCA 5EZ5A 3UHJA 4P4SA 3ZUGA 2IDKA 4A26A 1JAHA 1ETUA 3TSOA 2VF8A 3ITNA 1ZD9A 1S2LA 3STXA 5JNRA 3AKZA 2D5BA 2DB3A 2WILA 2QQGA 3CPHA 4ENSA 1J06A 2W2MA 3CZCA 5FT9A 2HBZA 3RABA 4BO9A 1DAHA 1VJ0A 4WZAB 1N3IA 4FR0A 1ZH4A 3S2ZA 2VJMB 3TLYA 1J2UA 3GLHB 5LMCA 3UJCA 3WRXC 3JQ7A 3PFHA 3TFOA 1GD1O 4LA4A 3KZVA 5B1DA 4Y1RB 5IKPA 3DOHA 3MUFA 4IYJA 3VR3D 1VL1A 1TC1A 1YONA 1NT4A 3CF2A 1CVLA 4GOOD 4DSNA 1Y8RA 5F7ZA 1F4LA 2ZVQX 2GPAA 3KT3A 4K9KA 4X66B 1W6RA 4EELA 2PAFA 3LCUA 4X7RA 4YWHA 2A5DA 4N7RA 2CJWA 3SLKA 5FOWA 3D4LA 4DILA 1O57A 1GZ7A 3ROEA 4DR7B 1E61A 3DV9A 1QIJA 2FZ5A 1M8PA 3R5KA 1A5BB 1Z5ZA 1DAPA 3N8IA 4HDCA 5CD1A 3AEXA 1SXIA 2XYVA 5BXYA 1J0CA 1DKQA 3AY7A 4J0JA 421PA 4K3UA 5LIRA 3FIJA 2ZAMA 5EAIA 1LTQA 3E3LA 3MTGA 1K4KA 2C2YA 3OEEA 2UZ1A 1X3SA 3JZAA 5FA8A 2JEYA 4DKXA 3EG5A 2E18A 4L9SA 3V6LA 2CJXA 3M89A 3R7LA 5JSZA 3GEGA 2GPYA 3E9EA 4OAPA 3FUTA 4G24A 1OD6A 1R0XA 2J5RA 3T3HA 1TO2E 1YB5A 4JHXA 4OFZA 4GMKA 2NO5A 4KFTA 2C98A 4FHFA 3ZBUA 3ZDBA 2ZBPA 3ZDXB 3RHZA 1J9GA 1NC1A 2BM9A 3MAGA 4H1VA 4MA0A 4NMXB 4RJ2A 1IOZA 1BFDA 2LVBA 4F4FA 2AEJA 3NM5A 1IAVA 2ONYA 5ETJA 1XZFA 4I5GA 3VNRA 3CRZA 5THQA 2I6UA 4Q4CA 2W9XA 1I1HA 3LHIA 5EWLA 2FSSA 1VSUA 1ZRMA 3F5QA 4CMKA 2FFQA 1E1QA 3A3YA 4MV9A 3VDNB 3EBLA 3K0SA 4CKWB 10MHA 2HYIC 1A72A 2R00C 1TVMA 5MN4A 4LF7B 4MLPA 4GMFA 2G9NA 2NZVG 1OAAA 4DA9A 3GB9A 4X20A 3PGKA 2I7VA 3K5WA 3LX6A 1L7QA 3NTOA 1KH2A 2W8BA 4AP6A 4E08A 4TN1A 2ZZMA 1LW7A 1W75A 4JEIA 3Q88A 2PM8A 2XKJE 2ZANA 4RGVA 2CLEB 3R3XA 2XLBA 3LDGA 2WJ4A 3N8NA 2QLTA 3QEMA 4XLLA 4E22A 4RHFA 1GGFA 2ZUVA 4WXEA 5EYPA 1CZNA 2DYKA 3HRIA 1KVSA 4PC6A 2JH9A 1RQLA 2WJ3A 3I4LA 5ALSA 4BNGA 1G8KA 5BSRA 1RIIA 2ZXFA 3H18A 1WU7A 3FFXA 1A9PA 1JA1A 4ARCA 1WLYA 3FM9A 1KP9A 3PXBA 3VAZA 3Q9NA 5SY4A 1NV8A 2C1EA 4BPBA 1RWVA 4YRTA 5IAGA 4DUYB 1BN6A 5LLSA 2ZWMA 2OQVA 1O0CA 1JEQA 3MWDB 4NX2A 1JE0A 1F2TA 2QNIA 5EJ6A 5LZ2A 1KBOA 4M9XA 1OWMA 5JD3A 1SCUA 2YWCA 4HN4B 4TL7A 2WC1A 4WLNA 1EXVA 1UK8A 3KQYA 1PR0A 2AOXA 2PX8A 3BZBA 3QE2A 5K20A 4ZCQA 4P3OA 3ZYZA 3ZWVA 3WR5A 3UZUA 2OCIA 3BH0A 5FB3A 3LCMA 2I4RA 4D45A 2X9GA 3AIMA 3B48A 4G1VA 3CIFA 3PHHA 3TB4A 2YINC 2W4QA 2W2PA 1EFPB 3IUEA 4OEHA 4I4IA 5FR1A 3U48A 1DIHA 5JH7B 1FA9A 3W1WA 3CEMA 2OFXA 3T7DA 4ZIRB 4YJ2A 4HWKA 1FFDA 2ATIA 5HMLA 1KWKA 4FOPA 2GAJA 3MIZA 4BX0A 4C88A 5C32A 1XALA 3KB2A 5JPIA 3T3OA 4XR4A 4ALJA 3EUWA 5L40A 1QG6A 4JV5B 4IHKA 4E6EA 4JLNA 2XNDD 3ZWCA 4WNCA 1E2QA 1IAQA 4LI3X 3PUZA 2GFQA 2EP8A 2Q1YA 1QAQA 3H9BA 1TK3A 3VR0A 2VNIA 2JF0A 2ZZNA 1JG7A 1Q1ZA 1H4SA 3ENKA 3V8RA 2E4YA 3QU5A 1P7WA 1JLLA 1L4EA 4IPTA 3VR6D 1DDIA 1W0CA 1WNTA 3RT1A 4GPBA 4NLLA 1G98A 5C53B 3ROMA 1VJRA 5AYVA 1M6VA 1KPHA 3ZXIA 1E3TA 1CD5A 1F51E 2Z08A 2B20A 1QC5A 1LLQA 4RY0A 3CA8A 5GZ6A 2BSAA 2VRCA 3U6BA 1SBQA 1QHXA 3CX4A 3E84A 4JITA 4C01A 2Z2JA 3FUVA 3SXUA 4DY4A 3UQZA 1JHXA 2L2QA 3F90A 4BFUA 2PQ0A 2C59A 4DEXA 1Y6FA 4TSKA 1FVOA 1C0LA 1LU9A 5EIHA 4MR7A 4LNAA 1L8QA 1PJRA 1L7XA 1POXA 3LCVB 2ZJBA 2XADA 1A2BA 1QANA 1ZCAA 3KSUA 3NHMA 3SM3A 1DBWA 5EZYF 4JC8A 2EBWA 2PIDA 4XJSA 1FY2A 4CN9A 4LXIA 1MAUA 3TI7A 2QTVB 3IEMA 1Z0ZA 5C8YF 3VU0A 4C3UA 2XBLA 2ZAOA 3EZLA 2QMQA 4DM3A 4DUGD 2PY6A 5CVEA 5DSXA 2YWGA 2FF5A 4WJKB 2VZ0A 1PV2A 3AVVA 4W8GA 3Q9SA 4EJFA 3WLIA 4S1NA 3UJBA 4L22A 1WR8A 4FMBB 3LHFA 2A57A 2H18A 3BHMA 3OIYA 4CEHB 3O1LA 5K3AA 4C14A 1TCUA 3I30X 3OSUA 5E7QA 2WOOA 4EDFA 3TNFA 4V1CA 1RPZA 4KQJA 1UJ6A 2B78A 4TM8A 3U5ZB 2HK6A 1AUPA 1YU9A 1F06A 2V7UA 3O90A 2VYQA 4FOOA 1HURA 4J75A 4EWLA 1YS4A 1Z25A 2D8MA 1P2BA 3EA4A 4JJEA 3SIRA 2JEZA 2VS1A 3U3JA 4JX8A 4F1KA 3IAFA 3K0HA 4A1FA 5I48A 4DA7A 4ZOQI 4QODA 2EJWA 5CCXA 4P33A 5LL6P 1SN7A 3MC1A 3REOA 5AOAA 5GONA 3PX7A 2O05A 1ZW1A 1NVWQ 2BGLA 1OPXA 3HCPA 2Z6QA 2PKYX 1DAFA 2R44A 1NOJA 2EIXA 2VAVA 3PITA 3V5NA 2AMFA 2B9VA 3GN1A 5E7IA 1V96A 2BMDA 1XN1A 2RAPA 4FYMA 1FXSA 4OB7A 1OFTA 5CYFA 4YRGA 4B3TB 3RD5A 3B1ZA 6Q21A 1AB5A 3TX6A 2GNPA 3DMTC 1XZPA 4GOJA 3LVBA 4NDNE 1GFSA 4PPQA 4RH0A 3TLGA 1DRUA 2H51A 4I81A 1EB8A 4D57A 4DHEA 1GFWA 4GKVA 5KNCA 5LUAA 3HVUA 3TQHA 4KXLA 2AMLA 3IB3A 4AIIA 2QX9A 4A92A 4F56A 1JE1A 4PC7A 2NADA 1KP2A 2RGNA 4U6QA 4R9UC 4WJZA 3IXMA 1YQUA 2W0MA 1QBKC 1X6VA 1S8AA 4PC3A 5BN5A 3E53A 4YPFA 4BE9A 1E3EA 2NO4A 4QUAA 3I1IA 2VZLA 4KQIA 5FTWA 2OYRA 2BBSA 3JATA 3WZLA 3QBDA 1O95D 1AZWA 2BFEB 3BGOS 1QGYA 3GEMA 4UM7A 1P80A 3JVUA 3R7BA 4XYLA 1T43A 1J8VA 2EJCA 4X1OA 2P6OA 3QKRA 1F0KA 4HT3B 2AXEA 3LGXA 5SY9A 1KI6A 4I50A 1ZIPA 2DH6A 2HPAA 1G8AA 4G4SP 4GWGA 1BG6A 4RTMA 4W1RA 2EZUA 4Q9JA 4GPTA 3WQSB 2C5LA 4GICA 1EH5A 4MWTA 4WCVA 4YH1A 1JXAA 5EHIA 5FUMA