1ZMTA

Structure of haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (r)-para-nitro styrene oxide, with a water molecule in the halide-binding site
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Haloalcohol dehalogenase HheC
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 87
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zmtA00
5KCZA 2R2GA 1ZXLA 3EAGA 2FSVA 1QMGA 3CH6A 5JDCC 1N9GB 3C3XA 1N92A 3W1VA 2O3UA 4FQ8A 3IKTA 3UUWA 3KOUA 4Y8VA 4PZCA 4JJGA 5AXBA 4PG4A 3LSYA 5KVCA 4YXFA 1YE3A 4LCEA 1MXFA 4AJ4A 2FPGA 3ICPA 4KDEA 4W99A 4G65A 4YRAA 3L6EA 3GVPA 3QIVA 2J5RA 2JFGA 1ZBQA 5AOVA 1T25A 3GAFA 4YRBA 4Z0TA 5HS4A 5IJZA 3PQEA 1H6CA 2P68A 2BFPA 5BR7A 5KVSA 1X1EA 4I9NA 3ZW9A 2Y68A 3AOGA 3VKUA 4BO4A 4DQVA 4EGFA 4GMGA 2P4HX 1HDRA 2DBVO 1HF3A 3FD8A 4E5MA 1QYXA 3RJ5A 5FEUA 1E77A 1GD1O 3HE3A 1XHLA 3QVTA 4BNUA 4K1LA 5A5EA 3WR5A 1IY8A 4YQYA 4CLOA 4PN3A 4IMRA 1I01A 4YJFA 5G4KA 4EYEA 4NBUA 3LT4A 1JWBB 3BMCB 3GRKA 4NBVA 5JCXA 3GPIA 4UUNA 2O3JA 2IXAA 4ALLA 4QX6A 4PLTA 3F5SA 5TF4A 3RUCA 3VDRA 4PVDA 4XQ9A 5A3JA 5JDIC 3NUGA 1QP8A 4K26A 3K5PA 4B4VA 1S6YA 3LC1O 2C2YA 1PZFA 1EFLA 1WZIA 3DZHA 1XYGA 1Y6JA 2Y1DA 4H16A 4QO7A 3OEYA 1PJCA 4Z9FA 3W4KA 4CMBA 4WLOA 1TVEA 1CIVA 3FTPA 3ZWWA 1EVZA 3DOCA 5L45A 4DXHA 4TWRA 2YHIA 5DOZA 2NNLD 2Q1WA 3CZMA 5JCJA 3F46A 1H94A 5B12A 2ZJ1A 3DOOA 3WOHA 3WGOA 1GFSA 2ZB8A 3PDJA 2V65A 3GPDG 4J7UA 1ZW1A 4BO0A 2Q1UA 4CMEA 1NWCA 2AE2A 3QVXA 5H83A 3PK0A 5DP1A 3IDSA 2H5LA 3AUSA 2PH5A 1HRDA 4JBHA 5DCYA 3IJRA 5IZ4A 2J3JA 5L3ZA 3FR8A 3SX2A 1IPFA 5A1TA 1V3UA 1XELA 2PZMA 4XX0A 5K6AC 4MIOA 5CDYA 2WE8A 3C85A 3D4NA 4XEHA 3KTDA 3JYLA 4MKRA 4BL5A 3C7AA 4NPCA 4PRKA 3ZU4A 1H6DA 1V9LA 3G17A 4WKGA 3HNPA 2X0JA 2W2LA 5ADHA 1MUUA 2O48X 1XDWA 4IINA 1O5IA 3OA0A 4QSMA 4IM7A 3GN1A 1EEHA 1C0LA 3UHAA 1QKIA 7ADHA 4ESOA 2NLOA 4FBGA 3U0BA 3E9NA 4IJUA 3ZDFA 1QLJA 4JNKA 4L8VA 1SC6A 1EUZA 1PEDA 3FI9A 5CDSA 2HMWA 4OKNA 4WLVA 3JQBA 4FFMA 4W4TA 4E4YA 4BO8A 1T4DA 1MG0A 4K6FA 2YFHA 3GVHA 3MWEB 3G3EA 1ZUD1 1P1RA 3G0OA 2G17A 3KYDA 3U49A 4MVJM 4DREA 5ES3A 3WJAA 4QO8A 2HRZA 4O0LA 4FGWA 3RD5A 2JCXA 1GPDG 2VRCA 1LC0A 1WDLA 3ZNOA 1VPDA 1VRWA 3WGGA 1ZH8A 4FB5A 3DAPA 5JY1A 2Q49A 3MJVA 1KEPA 3D64A 2VUSA 4GLLA 1PJSA 5C7LO 5IAAA 2VNAA 1FDUA 4FJ1A 1NVMB 3IC5A 3AI1A 3HDJA 1HE3A 3EK2A 4NG5A 3MJ4A 2RAFA 5DZSA 2BRUA 3LK7A 4CMGA 2YZ7A 3INGA 5EPOA 1R16A 1ADFA 1P1JA 1YOVB 4WK6A 5DF1A 3RUFA 3W6ZA 4RORA 4EEZA 1ADCA 2Q2QA 1M6WA 2PLAA 3RBZA 1HDOA 3RU7A 2WD7A 4C7KA 2GGSA 2I3AA 1WZEA 4UUPA 2FMUA 3F4BA 3QSGA 2V6GA 1E3WA 5DCWA 3VPSA 5HRUA 1Y9EA 2X86A 4RVGA 2NU9A 5G0WA 4CLRB 4G2NA 4EJ6A 2UYYA 3ASUA 1M6HA 5TJHA 1N7GA 4PG7A 4HP8A 4BO3A 2Y0CA 1GADO 1S7CA 1AHIA 1YGYA 2DFVA 1QG6A 1C14A 4CMIB 1DBVO 1EQ2A 4FS3A 2PGJA 2VT3A 4DUPA 3WMWA 1Y5MA 5TC4A 2BFOA 1KEWA 2C59A 1LDBA 3MJTA 3UFXA 1TI7A 2AXQA 4F3YA 5ITWA 4XDZA 1GQYA 2VZ8A 1NHWA 3E03A 1WVGA 1SBYA 3PWKA 4CMEC 2NACA 2WSBA 4RZIA 4CLXA 3F5QA 4XYBA 4BO9A 1LLCA 2A4KA 3ENNA 4TVBA 1CETA 4CM1A 1OI7A 1PZGA 1T4BA 1VL8A 2AEJA 4J3FA 4BIIA 1T26A 4CM9D 4RGBA 3ZNPA 1DIGA 1BVRA 2DLDA 1PWZA 3HADA 4KUHA 3WDSA 5L9AA 1OFGA 1BWSA 3TPCA 1UJMA 5JE8A 5A9SA 3ZV6A 5I9MA 1Q0QA 3D0OA 4O5OA 2X7HA 2FZEA 2V6BA 4LVCA 2DBRA 2D2IA 1LDYA 2O2YA 1FXSA 1PQUA 2HMTA 1HDCA 1HZJA 3HN2A 5TT1A 4WCDA 3JYQA 3L6OO 4AJ2A 3Q9UA 3ZW8A 2VWHA 4FSHA 1E7WA 4CV2A 4OOEA 2XPCA 4CMAA 3L77A 4NR0A 2EV9A 4IZHA 4YB8A 5I8ZA 4BNNA 4BNGA 4BO6A 4Z0PA 4B7XA 1T2AA 3JQFA 1EZ4A 2AEFA 2PWZA 1WDMA 2E37A 5HWSA 4FJ2A 1AXEA 2GR9A 2HKIA 4LK3A 4J6FA 3VAZA 3UW3A 3UKOA 1RKXA 4QFDA 2CD9A 3JQBC 4EDFA 4RQUA 1NYTA 1ZNQO 4RDIA 3RWBA 3ULKA 1AGNA 4AJHA 2DUUA 4D45A 3OQ1A 2G5CA 5C37A 3L9WA 3DZJA 4PLZA 1KVQA 1AUPA 3IMFA 4O1MA 1V35A 2VHZA 2QX7A 3INTA 1DC5A 4D3FA 1DC3A 2WDZA 2I5PO 3A06A 2P5UA 3OM9A 3FRJA 3Q3CA 2JFHA 3HZZA 3ORFA 2OXIA 3PHLA 4PLWA 4EUFA 3RBVA 3RC9A 1MP0A 3F47A 2B4RO 1Y5RA 1DOHA 1HT0A 5C7IO 2CF5A 2AEMA 1V3TA 1CEQA 4CODB 2NVUA 1IE3A 1Q0HA 3JD3A 3UVEA 4CLEA 5IDQA 1TA4A 1JA9A 3EMKA 3KYBA 4UULA 2O23A 4BQPA 4XRGA 3ROQA 2D5AA 2R00A 3JYOA 3TL2A 1I36A 3GVXA 1B16A 1ZK1A 4Z9YA 4PZDA 2OL4A 1UAYA 1A7AA 4Y6PA 2HAEA 5GY7A 3WNVA 4NJMB 3A28A 4OXYA 1I5RA 4BKUA 1HEUA 1DO8A 1LLDA 4CUJA 1WP4A 3GY0A 2YQ5A 2D0IA 4RVSA 1DAPA 3SC4A 5FWNA 2J8ZA 4FFPA 1HE5A 2ZCVA 2GLXA 1CWUA 3FN4A 3UXYA 5ICMA 2Z5LA 3OJFA 1ID1A 3S1LA 4EZBA 4L4SA 3ZHXA 4BMSA 2ZJ0A 4E2WA 2W90A 1HXHA 3K6JA 4R16A 2X4GA 3VHRA 4R3NA 3RKRA 4UAGA 1P1IA 1D7OA 1LLUA 4AVYA 5CAEA 1LEHA 4U6SA 3JQGB 1ZMOA 3H5NA 3H6KA 4BVAA 2I9PA 5A9TA 3QV1A 3WIEA 3Q9NA 4J9UE 3ZWXA 1N9GA 4IQ8A 1P0FA 1EBUA 1YKFA 4P8RA 2IZZA 3NTOA 1IHXA 4YAKA 3GHYA 1E1LA 3FNGA 2PD4A 1KEUA 5I7FA 3PFWO 4P4LA 2B0JA 4CQMB 3DTYA 3IJPA 4IDEA 5CP8A 4W9NC 4A73A 3DL2A 2CVQA 2FR8A 4I5DA 4CM5A 1PJQA 4H15A 2NV6A 1VL0A 1M67A 3E9QA 1UXJA 1I0ZA 5TX7A 4GGOA 2PFGA 1ZEJA 3KM0A 4R3WA 4M8SA 4DTIA 4I1IA 1I24A 2PD3A 4Y67A 3RFVA 3ETDA 5IN5A 4CM9A 4IXTA 5COAA 5JMWA 4CR6A 4LRSB 4JGBA 1GV0A 1I3NA 5KJ1A 1I3KA 2VN8A 4AJEA 2NVBA 3INRA 2PH3A 2E4AA 3GN2A 1PGOA 5HA5A 4JK3A 1YDWA 3BTUA 1GUFA 3LT0A 4L73A 4YJDA 1JLLA 3S2IA 4KWIA 4GVXA 2EJWA 1LSJA 3S8MA 3BMCA 4IIVA 3DZIA 3RC7A 1VLLA 3A4VA 2Q1TA 1PR3A 1U5AA 1LDGA 3U9LA 3SJ7A 4BNWA 4HUJA 1HDYA 5CHEA 3ANMA 3GNTA 4E5PA 3AU9A 2JFFA 2YV2A 3IUPA 4OQZA 4A2CA 4PLHA 1UXIA 3GUYA 5A04A 4XQCA 3GQVA 4NFHA 5JY6A 2ZTMA 4PLFA 5L7YA 2D4AA 4J1QA 1SAYA 2WMDA 4J2HA 3RIHA 4Q9NA 3H3FA 4OSOA 5BSHA 2PGLA 2AHRA 1M75A 4GX0A 3RCBA 4BHTA 1SEVA 3RUDA 2DC1A 1DC4A 4D46A 4BGUA 4E3ZA 4XDYA 2WJPA 1FDSA 2R00C 4BNXA 4U0KA 4BNFA 5IDWA 5MGBA 2EKPA 5CDGA 1PL6A 1Q2XA 2X8LA 3H9UA 4BB5A 2JD1A 4KUGA 5GMOA 1Q7BA 3AJRA 1YBVA 2IXBA 3OJOA 2QRLA 3BZUA 4ONEA 4R68A 1LBEA 5A03A 4CLDA 1FF9A 2ET6A 3PYXA 1H6AA 1ADGA 3VZSA 2B69A 2E82A 4B4UA 3B1FA 4TZKA 5F21A 2VTEA 3VC7A 3WGZA 1GL3A 3RU9A 1NR1A 2ZIZA 3NAQA 3WSVA 4R69A 4GX2A 5KVVA 3I9KA 5DCUA 3WQSB 3OA2A 4ZVVA 1Z6ZA 3PIIA 3K8ZA 5JDCA 3FBTA 5KJFA 1LX6A 1Z82A 4EUEA 1SB9A 4WNIA 4J91A 3RC2A 1ZMTA 1ENOA 1ISGA 2X0NA 1F06A 1UR5A 2G1UA 2FN7A 3Q0EA 3UCXA 1M2WA 1X1TA 4D3DA 4DC0A 3SEFA 4YBZA 5H82A 2A94A 4XGNA 4ND3A 1EFKA 1EDZA 1NAIA 1SO8A 4OAQA 1U1IA 1OMOA 9LDBA 2Y1OA 5I9NA 5L7WA 1ISJA 3MJSA 1GDHA 1SPXA 3JD2A 1DAOA 2NWQA 1EK5A 4B3JA 4YJGB 2VWQA 4MO2A 2VZ0A 2GUGA 4U6QA 2Y1GA 2W2KB 1ISFA 1DXYA 5IFLA 1MC5A 4WNCA 3JSAA 5KJCA 2DKNA 2PZKA 4XYGA 4BS9A 5G0TA 4AJ1A 4GSKA 4DQUA 4MIYA 3M2TA 4GMFA 4JP2A 1MV8A 2TMDA 3C24A 2HMVA 2J3IA 1YOVA 3DDNA 3C7CB 4ZRMA 3FTNA 1L7EA 4F46A 1XIVA 2ZYAA 3DBLB 4NMHA 3ZI0A 1RWBA 2P2SA 1UP4A 1X13A 2ZK7A 3LC2O 5DN9A 4AJOA 1Q1NA 4AL4A 1XA0A 1GPJA 3KBOA 4IIUA 1A5ZA 4OQYA 4M54A 3ZU5A 1HDGO 2D1YA 2I3GA 3WNQA 2AG5A 4IJVA 3K73O 4OM8A 2PY6A 3WG9A 2DPHA 3QWFA 2BFMA 4GQAA 3NDRA 2HO5A 5CDTA 2Q2VA 4C4OA 2X5KO 4ZHSA 4FD3A 1E5QA 4RJTA 4D0SA 3ZU2A 3C1AA 3P19A 4MP6A 1PZEA 4IDGA 4PG6A 4CQMD 1SOWA 3AFMA 3DR3A 2GCGA 4XYLA 4HBGA 3PZBA 4CMIA 4RVHA 4YRDA 2F00A 3S2GA 1P0CA 2WWRA 1LSSA 2Z1NA 4I5GA 4OGWA 3TFQA 4L76A 3GNSA 1YB5A 4INAA 1I2CA 3QA9A 1NM5A 2EIHA 4I08A 4RCVA 5C5IA 3RBXA 1KETA 1Z73A 3JQ8B 2AW5A 4RF2A 3BMNB 1PS9A 2XXBA 3PYLA 3TL3A 3U4DA 4BNTA 1ZJYA 2NTNA 4XD2A 5A05A 1U8FO 2YV1A 2PV7A 3DHNA 3TOXA 2HU2A 2P9GA 1PWXA 3MTJA 1E3JA 2PA3A 2IEBA 3ZWBA 5I7SA 4RO0A 1U7HA 4ZQEA 2NU8A 3RUAA 4CL3A 1C3VA 4EITA 4L4RA 3C7DB 3OQ6A 4MP8A 1NWHA 1SOVA 1YO6A 2RH4A 3PHGA 1GZ4A 3WFJA 2GYYA 2Z1MA 8LDHA 3PGXA 4ZQHA 2DT5A 4ZQFA 5JAIA 2PNFA 3F3SA 1WXDA 5IG2A 4GKBA 2AQKA 4MP3A 2GNAA 3H9GA 5TQVA 1NTOA 4LMRA 3UF0A 3GT0A 4LSMA 1WMBA 5KOIA 4NBWA 4CMKA 3Q2IA 2JHGA 3U62A 1NAHA 1RM3A 2Y93A 2ZTUA 3E5MA 4XQEA 1T2CA 3EVNA 5HS6A 3VH4A 1D1SA 2RBEA 4EEXA 3ZN2A 4MJLA 3GZNB 3BAZA 4JROA 3DAGA 2J5QA 3E1KA 3KUXA 4D0RA 5DULA 1J0XO 1IB6A 1SNYA 1ULUA 1P1FA 3LVFO 1O89A 1IULA 3OIDA 3WICA 5JO0A 4OXNA 1WAMA 1X7DA 2Q3EA 3KO8A 4ZA2A 2DVMA 3H5AA 2GDZA 4NZ9A 4PRLA 5TSDA 3ST7A 2CDBA 1Y7TA 5MDHA 3ON5A 4YT4A 4I9UA 4I5EA 3WFIA 1D4FA 3A1NA 3RAJA 4UVDA 1HE4A 5H81A 1A4IA 1HDXA 2Q4EA 1FDVA 4PFJA 4BV8A 4Z3KA 1EUDA 1MA0A 4WEQA 3V1YA 3BTSA 3K9QO 1ZSVA 5G0UA 3ZU3A 3NJ8A 1A27A 1VSUA 1TEHA 1U3TA 4NJMA 2YDYA 5BNIA 2GZ2A 3NGXA 4AICA 1GZ3A 2OO5A 5CEEA 3Q11A 5TRTA 3ADOA 1JU9A 3PYMA 3UCFA 1ONOA 1QV6A 2O3RA 5B4VA 4BO7A 4IS2A 4Z0HO 2OGUA 3GAZA 4LN1A 4NI5A 4ZN6A 4KOAA 1C0IA 1LA2A 2YYYA 4FW8A 3WYEA 4GX5A 1LI4A 1OZAA 3H9EO 1MFZA 3PJDA 1T2FA 3NEPX 3MJCA 4S1VA 3LLSA 1GCOA 2RH8A 1LSUA 2J3KA 2WEKA 2GPTA 2W98A 1MFPA 3JQGA 3W4IA 2G82A 1PGPA 2VYNA 1LUAA 1KVTA 3EHEA 4XCVA 3WGTA 3I9JA 2DU8A 3TQHA 1A7KA 4IGFA 1ORRA 3GF4A 2EHDA 3ABIA 3NGLA 4N5NA 4AJPA 1C0PA 2Y1CA 4IDFA 1XCBA 3L4BA 2AA3A 1NVGA 2P91A 4CUZA 1G0NA 1DDOA 1UUFA 1NQAO 1DB3A 1VJ0A 3OETA 4PLVA 3I52A 2E6UX 1ML3A 4TMFA 1K89A 4CQMA 3T4EA 5G0SA 3P7MA 3LYLA 3GR6A 3IQDB 1O9BA 1YVEI 1Q7CA 4DBZA 2YQ4A 3KSZO 1HDZA 4AJKA 4FC7A 3F6YA 3HDHA 1R15A 4OHUA 4ZU3A 1R0KA 1Y8QB 3E9MA 3TZ6A 4M1QA 4YTEA 4HV4A 5KWEA 3D5QA 5FF9A 4Y6SA 4BV9A 5A4DA 2HMSA 3HHPA 4Q3DA 1CYDA 2NUAA 1ENZA 3WIDA 1DFIA 2YFQA 1T2EA 2O3QA 3LQFA 3M6IA 3C1OA 2FPPA 3JQCA 4XB2A 2NQTA 4FDAA 1UP6A 2VHWA 4KP7A 4J2OA 4BNLA 5CEFA 1U3WA 1SMKA 3ONDA 2PTGA 5HTOA 1R6DA 5JXWA 1F0YA 1V3VA 1R66A 1WPQA 5JYEA 2ZCUA 3ONEA 2EKLA 5DDIP 3JV7A 1R4NB 4XB1A 4XQGA 3PIDA 1M66A 1T1SA 3X2EA 1U2GA 3NYWA 4G5HA 1B3BA 3L9XA 4DBVO 3MEQA 3HB4X 2GN4A 2X0RA 4CL8A 3ROKA 5TNXA 3W6UA 2DTEA 4XZ3A 2JL1A 5DT9A 5JC8A 3D7LA 5U9CA 1EUCA 4BGVA 3EUWA 1GR0A 1OAAA 4DIOA 4GH5A 1AN9A 3GVCA 3EC7A 4ND5A 4ID9A 2EKQA 1O95A 4XYMA 1Y9AA 5KVQA 5JMPA 1P74A 3GLQA 4R51A 2EXXA 3F4LA 2GN9A 4EBFA 2C2XA 2X6TA 2Q1SA 1E3IA 4QUKA 2C5AA 1QV7A 5EQFA 1FDWA 1B2LA 5U1PA 2BI8A 1VI2A 1DIBA 3KLPX 2Y0DA 2OHXA 4WJZA 4DMLA 2HLPA 3A9WA 4OOFA 4DIFA 4B8WA 2VUUA 3MCVA 3RUHA 3V2HA 5AXDA 2ZTLA 1HETA 2IZ1A 3N7UA 4BMVA 1TT5B 5IXSA 5AYVA 2FR1A 4A26A 4DGSA 4AFNA 3O8QB 1K6IA 1ZXBA 1H6BA 4KZPA 5IZCC 3TZQA 2GERA 2J5KA 3PHHA 2QYTA 4OKIA 3MOIA 4R5HA 1XWFA 2VHYA 2W4QA 4QXMA 3VVCA 4KDFA 3B1JA 3PPIA 1HLDA 4FFOA 4P4GA 4PGFA 2DTDA 4K6CA 1DLIA 5GZ3A 4Q3NA 3WBBA 1QSGA 1CQJA 3DMTC 1DEHA 1OBFO 4WGGA 2QYSA 4J9VA 3KV3O 3NT5A 3R6DA 1GYPA 3HN7A 3HFGA 3W4JA 2C5EA 2PR2A 3IL2A 1BVUA 5HBRA 3P5SA 2FRDA 4W9NA 2I66A 3F1KA 3WGYA 3WGIA 2HK8A 3G49A 3GDGA 3S55A 5CEJA 4MOWA 2VRBA 1O6ZA 4GGPA 3L4BC 5IDYA 3L4SO 4OL9A 3ZNNA 4YWJA 1E5LA 3AM3A 3DBHA 4J43A 4WASA 1I3LA 1DJNA 4J1TA 1BRMA 3DEYX 5CDUA 4YJGA 4RVFA 4YDRA 5FFFA 1VJTA 3L0DA 3RQSA 4YYZA 1K5HA 4FFNA 2D3TA 5CPBA 3SLKA 4IY1A 4GX1A 3ADPA 3GZ4A 2W2KA 2I76A 1RYDA 2JHFA 1IL0A 1Z45A 2J3HA 3WXBA 3CXRA 2OFPA 3ASVA 4JJFA 5TT0A 2J6IA 1IOLA 3RUIA 4BOYA 4E32A 1ZK4A 2BELA 2CDCA 1KC3A 3IP1A 3NKLA 4PG8A 3NDJA 1CERA 2XXJA 1IPEA 2H6EA 3DBLA 1HTBA 3WWYA 1E7QA 1YWGO 3GMDA 3WS7A 2ZTVA 3OQBA 4JJIA 1KC1A 1DIHA 1FMCA 1EVYA 4J49A 4RLSA 2BH9A 3D5TA 1KEVA 1ULSA 1GAEO 4R1UA 4WPGA 4RDHA 1TT7A 3R3JA 2ZYGA 4ZICA 2C0CA 2DAPA 1RJWA 3QWHA 1BW9B 3TZCA 1P9LA 1BDBA 1BXGB 4B3HA 2EGHA 1VM6A 3JQ9C 1YL5A 4KTTE 4WOJA 1J6UA 2FR0A 5JFOA 5T64A 3GEMA 4LISA 3RSHA 1A4UA 3D1LA 1Z7BA 4YEDA 2ZB4A 3IUSA 2D8AA 5LDGA 4JP3A 3TWOA 5EERA 2GASA 4IBOA 5F1KA 3JQDA 4W6ZA 5JPIA 2JAHA 4CPDA 2FPIA 1P31A 3JQ8A 1AE1A 1TB4A 3JD1A 3BMNA 1ENYA 1VC2A 1B26A 3GH3A 4TRJA 2ZKLA 4S3MA 2YW9A 5IDXA 3KZVA 2HRBA 4CMCA 1PQPA 1ZCJA 4FFLA 1YQXA 2HMUA 3QY9A 3PVZA 3D3EA 2VWPA 4BNMA 3DFUA 3AI2A 1J49A 3ZWPA 3ZHBA 1GCUA 4YT2A 5DP2A 4Y98A 4MVJG 1GV1A 2CVOA 2C29D 4OMUA 3DBVO 4WE3A 3U4CA 1I2ZA 4IQ0A 3U3XA 1LQTA 3FF4A 3GNQA 2WD8A 2O4UX 1E3LA 2FWMX 2IEDA 2NU6A 4AG3A 4M86A 1W8DA 3HG7A 4A7PA 4MVJI 3FSRA 2VQ3A 1Y81A 4NHEA 1NPYA 1Z74A 2PZJA 4EUHA 1ZVMA 3CINA 3GZNA 1QR6A 1V6AA 1BXZA 3CTMA 2FSSA 1E92A 3BHIA 1I30A 3GG9A 3X2FA 5KNLA 3HDYA 1CJCA 4RLHA 4WEOA 5EIOA 1UXHA 4MVJF 2OOSA 3G1TA 1PJLA 2XAAA 4ALKA 2DFDA 3BMOB 4UVEA 1DRVA 4E12A 3AY6A 5T57A 4IQGA 5IXYA 4BNZA 1ZJZA 1SEPA 4M55A 3BHMA 2C07A 3WYBA 3C1TA 5JO9A 1FK8A 3JTMA 5DBIA 4Z9XA 4MVJE 1U2DA 4R54A 4UEOA 1PX0A 4E31A 2AQHA 3QVOA 1LNQA 2O3SA 1H5QA 1LC3A 4IJWA 1XU7A 1W0CA 4XJSA 3I83A 3PTZA 5CG1A 1NNUA 1HSZA 1B8VA 4E30A 3V5NA 4CR7A 4KUEA 4WLEA 5THQA 4NNJA 3WX0A 4IPTA 2QW8A 4XGIA 1N5DA 4LW8A 1BMDA 2A35A 2B5WA 4B8ZA 4ZQGA 5L51A 4Z3DA 5JAZA 4M87A 3UOGA 3TRIA 2ZATA 4Q3CA 2QRKA 2DUWA 4X54A 1JN0A 5DBGA 1ZK3A 5CFZA 6ADHA 1E3EA 4U0JA 1VKNA 1QYCA 3FBGA 4Z6KA 3K92A 4R5MA 4UEKA 3VTZA 1H2BA 5I7EA 1X7GA 3CZRA 4JQCA 4HADA 1UZMA 3H2ZA 3RFXA 5ILOA 2JJYA 1WMAA 1J4AA 1FDTA 2HK9A 1ONNA 4N5LA 3UN1A 2UV8A 1LRLA 5ER6A 3MOGA 1C0KA 2NQ8A 3LT2A 4BB6A 5A02A 5AVOA 1EBFA 4E6PA 4JBIA 3QWIA 3DMYA 3BYZA 3HWRA 4M89A 1P1KA 4AJJA 4B7UA 2DPGA 3D3WB 3FNFA 4J7XA 4HFJA 5FYDA 4WUVA 1R4MB 4QECA 1GQ2A 1B8UA 4DWVA 1A9YA 1Y8QA 5KTKA 5KJEA 3E48A 5FI5A 4ALJA 4URFA 1F8FA 4MINA 2HCTA 3I9NA 3DFZA 2WYUA 1E1NA 4J0EA 1DC6A 3AUUA 1K0UA 2YHUA 4DRYA 5A5FA 3EZLA 4J1SA 3BXXA 1I8TA 4WLUA 3PJEA 3R1IA 4GLOA 3WLFA 3DTTA 3M1AA 1UP7A 3N58A 1Z75A 3WB9A 4MDHA 2CY0A 3HSKA 2PKQO 4L9RA 1ZSYA 3QRWA 2BGKA 3KEOA 5K0ZA 1PL7A 1U28A 3IKVA 1BG6A 1R4NA 4PVCA 4NK4A 1KERA 3ROMA 4YAEA 2EW8A 5T5QA 4F6LA 5LC1A 4JCOA 1YONA 4D42A 5GZ1A 4NH4A 5A06A 4CUKA 1MG5A 3ITKA 4BKPA 5JC1A 1IZ0A 1L7DA 2YY7A 4P38A 3AOEA 3WJ7A 1LSOA 1F17A 3SVTA 3QLJA 1D8AA 2BKAA 2NSDA 3PXXA 5BQFA 2HUNA 1T2DA 3EZYA 1U5CA 1YRLA 1X7HA 1KVSA 4IJKA 1R0LA 3GEDA 4YPOA 2JD0A 4D79A 4RQTA 4KQXA 2CVZA 4OJNA 4BNHA 4MVJH 1ISIA 5JBIA 4A5OA 2JCYA 1R0SA 1GYRA 4GWGA 4HWKA 5DNAA 4CLRA 5JS6A 5ENVA 1YQGA 1UDBA 2YUTA 3PZRA 3V1TC 3BA1A 3E5RA 4BKRA 4IGEA 1BXKA 1TT5A 3FWZA 1X15A 2IRWA 4GSLA 3KB6A 4IZIA 3O8QA 1W4ZA 2EWMA 1YBAA 1P33A 4RZHA 1HYGA 1ZZEA 3GHHA 3UGKA 1F14A 3DBRB 4M49A 1G0OA 4TROA 4J4HA 4PLPA 3LT1A 1VL6A 1QYWA 3MJEA 3HFSA 4U5QA 3I9LA 3WGQA 1Y1PA 4QTZA 3EVTA 3KETA 3ZWNA 4NBRA 2LDXA 4RVDA 2RHCA 4JLWA 2FOIA 1B15A 4NK5A 4PLGA 2PKQP 3S2EA 2IYPA 2ILTA 3F1LA 3VDQA 3K31A 4GL4A 3R0IA 3OEWA 4F6CA 4RV9A 4ND4A 1P3DA 2NU7A 3OJLA 1TLTA 1M76A 4CM8B 3VH1A 2B37A 4ZJUA 4O59O 2CMDA 2UUOA 4KTVE 3L07A 3I3OA 4UUOA 2H63A 5JSFA 1MX3A 3JQ7B 4CQLB 1EK6A 3RKUA 2F1KA 2B35A 1LU9A 2I67A 4ZQBA 3GUCA 2GRAA 4ND1A 4RL6A 4J90A 4JXKA 3HQ4O 4HFRA 1ONPA 4WLNA 1MC4A 4B7CA 2X22A 1HYEA 3KVOA 5JYDA 3K96A 1GYQA 3OJEA 3MWDB 4N7RA 4MKZA 2OP1A 2WE7A 3GDFA 4ROSA 5JLAA 5AQ1A 4Y9DA 5CG2A 4U8GA 2JAPA 2C20A 4Q3BA 1HYHA 1IHYA 4I8XA 2QZZA 3PLNA 1I33A 2OBYA 4E13A 4E33A 2PK3A 4A27A 3VPXA 4DLBA 3OHSX 4D7AA 1ZK0A 2VT2A 1DLJA 2YDXA 1WDKA 1EVJA 1QXSA 3KYCB 4J7CA 5LCXA 3ETEA 3STHA 2G76A 1DFGA 5G0VA 3G79A 3O26A 5K9ZA 1U4SA 2Q50A 1NHGA 5IF3A 1LRJA 3TZHA 3B70A 1DPGA 3DZGA 4OIMA 4CR8A 1JKJA 1YXMA 4XIYA 1BW9A 5A9RA 1YB1A 1BXGA 2ZB7A 4WOKA 5F5LA 3FR7A 4TRMA 1I32A 3BMQB 3ONFA 3AUTA 1XEAA 4R1NA 5L40A 2ZB3A 4QEDA 3DWFA 4L74A 4E5KA 3AOEC 5B1YA 5BSGA 1LDNA 3WQQA 4FR5A 9LDTA 3OP4A 4WCFB 1PJ4A 3LF1A 3DAFA 3JQ6A 1CF2O 2O2SA 8ADHA 1DIRA 2FY8A 1D1TA 3E82A 4MKXA 3DO5A 3P2OA 5L53A 1G6KA 5I9LA 3IS3A 4BMNA 3CPSA 3Q1LA 2H9IA 3I23A 1RPNA 3GGPA 5TJ9A 1NQOA 4II2A 5F1PA 3H3JA 5IZCA 3IP3A 4N54A 4EJMA 3V2UA 2TMGA 3NDIA 1KYQA 3NT2A 1WW8A 3TOZA 1X0VA 2VOEA 1E6WA 4MVJP 1YQDA 2UDPA 3ZWAA 5L4LA 3U09A 3DZFA 4DMMA 1VJ1A 2CFCA 3ZWCA 3CSDA 2BLLA 4IS3A 1U4OA 3DMTA 3PLRA 4YAJA 2BGMA 2IZ0A 4RPKA 1A72A 3ZWYA 4E5YA 4YCAA 4CJXA 4YAIA 3VZPA 3WBFA 2QZ9A 3B20A 2X9NA 5F5NA 2EP7A 4D44A 1P1HA 3U4IA 4LVUA 4NIMA 1UDCA 1ENPA 1H9BA 3VVBA 4BKOA 4XRRA 4N5MA 4CLHA 4I5FA 5L4SA 3MZ0A 1JKFA 4XGKA 1B3RA 3H65A 4B79A 3RUEA 4BO1A 3WWZA 1IZ9A 2VOJA 4FC6A 1FJHA 4U7WA 2EEZA 2NVWA 5TS3A 3ZHZA 1N1EA 2AE1A 2OORA 3H7AA 4PIVA 5T6BA 4HFNA 5B37A 4IUYA 2BI7A 4R9SA 1JAXA 2AQIA 3E18A 1CQIA 2QIOA 5FI3A 3GGGA 3BMOA 4HXYA 3PHJA 3TZKA 3FNHA 4DPKA 1WNTA 1HWYA 4YA6A 2B36A 2OZPA 1ADBA 2WM3A 4NFYA 1GEGA 4RF4A 3O4RA 1NVTA 3ZV5A 2V6FA 4XKJA 4DYDA 3LU1A 3DQPA 4H7PA 4CM4B 1Y8RB 3GOHA 2NADA 4GPD1 4UUMA 4BNJA 3S2FA 4GKVA 3AM4A 3CMMA 1KVUA 1DHRA 3SXPA 2O7QA 3N74A 1XQ6A 4FOSA 1HSOA 2W8ZA 2X9VA 2VTDA 3NTRA 2EERA 2ZQZA 1W73A 2EP5A 2QG4A 1Q0LA 4DC1A 2E49A 1LDMA 2NTJA 3V1UA 3WTBA 1IUKA 3DHEA 1NPDA 4JN6B 1BSVA 3JQ9A 4AJLA 4BGEA 4NQZA 3GMSA 3RFTA 3TNLA 1QORA 2Y0EA 2P9CA 1I2BA 4FOOA 2BGLA 4IDDA 4HNHA 1HKUA 2LDBA 1DHTA 3VPHA 3M1LA 3OMLA 3QW2A 1SCUA 1ISHA 5B4TA 2QQ5A 3TJRA 3DB2A 1KY4A 3OF2A 2XOXA 1W6UA 3H2SA 4NU6A 4Y6RA 3QWBA 4J4BA 4ALNA 3K30A 4II3A 3I1JA 1JVBA 3FPLA 4L4XA 4EI2A 3E8XA 4KMSA 4W7HA 3TDKA 4YACA 5ITVA 2WTBA 3FNEA 3RC1A 3OJ0A 4TKLA 2X1HA 4CV1A 2EG9A 2OMEA 3JQAB 2CF6A 4DLLA 2VYVD 3JYPA 5EQDA 1BHSA 3FHLA 3PJFA 5EESA 4YT5A 4K28A 3RJ9A 1ZEMA 2JKVA 2Q4BA 2HJRA 5THKA 3CMCO 4A03A 1K6JA 2BFAA 2D5CA 3PDUA 1RYEA 3CEAA 1KVRA 3I9OA 4D41A 4GWKA 1ZFNA 1SB8A 1U3UA 4YJHB 1OC4A 1YBMA 5BNFA 1C1XB 2JD2A 3D3WA 3EW7A 3ZHYA 4YQZA 2OUIA 1X0XA 1R4MA 3BTOA 4PLCA 5F3RA 5IN4A 5I7VA 3GA0A 3T7EA 4TRNA 1D3AA 1PIWA 1TXGA 5ICSA 1YL7A 4OXKA 3VH2A 1O94A 4IMPA 3VPFA 1F12A 1N1GA 4EJ0A 2DTXA 3PFFA 1PTJA 2Y67A 3TN7A 4IDCA 3UICA 1C1DB 1H0KA 4XR4A 4ALMA 1B14A 4FJ0A 1NFQA 4OSPA 4LRTB 2I65A 5L95A 1XG5A 3ZV3A 3ZWMA 2CDAA 3QVSA 1ZO8A 2P9EA 1EE9A 5T67A 3OIFA 3LLVA 1P44A 2GD1O 3CIFA 4CM7A 4ITUA 1YL6A 3NTQA 1VKOA 2IODA 4NBTA 1QLHA 1WLYA 3QVWA 4FIZA 3JQEA 2Y05A 3DZKA 2B5VA 4G81A 4ZGWA 3EGOA 3W8FA 2VCYA 1PU2A 4YAGA 1GUZA 3Q2KA 2P4QA 1CDOA 3U5TA 1R37A 3M2PA 3WMXA 1PJ3A 1DJQA 1P45A 3GFGA 2POQX 1MGOA 3QP9A 1U9JA 4GBJA 2FHSA 4KWHA 4XJTA 1MXHA 2PZLA 1O8CA 2B4QA 2X5JO 4RF5A 3W8DA 1QYVA 4Q3AA 3OIGA 4IXWA 1H2HA 4BO2A 2UAGA 3CE6A 4JIGA 3WQRA 4XYEA 5COQA 1R12A 5JAMA 1U7TA 3JD4A 3HB5X 2DBZA 5KKAA 4FGSA 4NDNE 4D3SA 4E21A 1NR7A 3DZBA 1E1MA 1UZLA 1DRWA 1BTOA 3T4XA 3I6QA 2C82A 3O9ZA 3ZH2A 3TSCA 4PZEA 5G4LA 3GC6A 2VNSA 2X58A 4OO3A 4BQRA 2RIRA 3ENKA 3HDQA 2DQ4A 3B1KA 2GO1A 1P77A 3UAGA 4MIEA 3OECA 3KRTA 4NU5A 4B4OA 1EMDA 3KSDO 5AXAA 4CM3A 1GEEA 4UVHA 4ZD6A 1EVIA 3AM5A 2FZWA 2I6TA 4B3IA 2OP0A 3DBRA 4GI2A 1JQBA 2AQ8A 5BNTA 4FPXA 2P5YA 1UDAA 3AW9A 3VKVA 1NFFA 3H5RA 1H9AA 1V8BA 2EJVA 3OICA 5G2OA 3V2GA 4WLFA 4K9DA 2AG8A 3PQDA 1PZHA 4CMHA 3I4CA 2RCYA 2Y66A 3PQFA 4CLOB 1YB4A 4HNGA 3GG2A 4P4NA 5EL0A 4A10A 3CKYA 1PGQA 3DXFA 4YJFB 3AY7A 3R3SA 5G4KB 4CM8A 3JCZA 3PGJA 3H4VA 1NQTA 2Y1EA 2GZ1A 1MLDA 5AXCA 5C3MA 1OOEA 3GRPA 1YH3A 4DQXA 6LDHA 2D59A 3JQ7A 4CQLA 2PGDA 5C7OO 5HM8A 4XR9A 4R01A 1N7HA 4BGIA 2VHXA 3KSUA 3PEFA 2Q99A 1ZK2A 2A9FA 3D4OA 1F8GA 3V8BA 4E2ZA 1LLQA 3EYWA 3VH3A 3UCEA 3BTVA 4H3VA 2V7PA 4R1TA 2VYVA 4YVFA 1RM5A 1N2SA 2Y1FA 4MVJD 1KS9A 1PJ2A 3LF2A 2G0TA 4XIJA 2YHIB 3AI3A 1K6XA 4N18A 1XU9A 5F1OA 5T8KA 2CNBA 1NASA 1ZSNA 3A14A 1PS0A 1DSSG 3AWDA 2BMAA 5L7TA 2X5OA 2O4CA 4IDBA 3K2BA 3IAHA 2YJZA 4DVJA 3PI7A 3GEGA 4J4TA 4W82A 1HL3A 1ZKMA 2B4TO 1HZZA 1UAGA 2GSDA 3U4HA 4NJOA 3KEQA 3W8EA 3KYCA 4QT0A 3EDMA 1PGNA 2QHXA 3O03A 1E7MA 4HKTA 5DBFA 3VTFA 3JQAD 1MB4A 4AJIA 2C54A 2SCUA 3RVDA 5JNLA 4BNIA 3COSA 2XF8A 4R41A 1RM4A 5JAQA 1ARZA 2HDHA 3H9QA 3MTGA 1EE2A 3QHAA 3VZRA 2IE0A 3SJUA 2R6JA 5U4QA 4W7IA 1QYDA 1YDEA 2E48A 3NT4A 4I9HA 4TRRA 3BMQA 4QQRA 1PJBA 2Z95A 4J1NA 3ROPA 2UVDA 5TLSA 3QQPA 1T24A 4DA9A 3JD0A 1DIAA 2GN8A 4WCFA 1E6UA 5GZ6A 4WECA 1QRRA 3VZQA 4C7JA 4TKMA 1X14A 2O50A 1CRWG 3PWZA 1A9ZA 2AMFA 2EW2A 2CSUA 3ANLA 2Q46A 2X0IA 4Q39A 4R1SA 1Z7EA 1ZIDA 3OBBA 2A92A 4RF3A 1PGJA 1SZJG 5BSEA 4XA8A 2EGGA 3JQFC 2B83A 3LDHA 2BF7A 5ILGA 4E5NA 3ETGA 1KIFA 3QWAA 3SC6A 3KYDB 5TGDA 2PKRA 3WLEA 2C7VA 1JDJA 1JVSA 3ZGYA 3F9IA 1NBOA 2O7SA 2UUPA 4JX8A 3GK3A 4RPLA 3WGHA 1KY5A 4BNVA 5BSFA 3WTCA 3IIEA 4R4JA 4DYVA 1ISMA 4CV3A 3ICCA 1U3VA 3TF5A 4O6VA 2DM6A 5COBA 1LDEA 4CV0A 1WWKA 4BO5A 1NPTO 1Q7GA 3H8VA 3QJ5A 2Y99A 4OYRA 4E2XA 1K3TA 1XGKA 4TQGA 7MDHA 1PJTA 3PRJA 2GF2A 4LCJA 2V6MA 1AXGA 1KOLA 4PCVA 2YV3A 3ITDA 5A3VA 3ZV4A 3FWNA 3I4FA 3BHJA 5I8WA 2QRJA 2WD7B 4GAEA 4IDAA 3ZCXA 3DONA 4J16A 1HE2A 2WYVA 1E3WB 2O3TA 4AJNA 3DC2A 4HFMA 2I99A 1NQ5A 1OC2A 1UZNA 2VZ9A 2PD6A 1JTVA 5KJ6A 5ENDA 3EY4A 4RPHA 1EQUA 2RHRA 3NJ4A 4KQWA 4BNKA 4JBGA 2NM0A 3DHYA 1K2WA 3NX4A 3IOYA 3ZWOA 1JW9B 4ILKA 4OH1A 1NXQA 1NFRA 2H1SA 3PP8A 4CM4A 4DPMA 1BGVA 5T8KC 1Y8RA 4DL9A 1YJ8A 3OFSA 4LMPA 3VPGA 1GY8A 5BT9A 4RPJA 1LXCA 3AK4A 3QE3A 4D43A 3KHUA 3GVIA 1XSEA 1H93A 3C8MA 1LTHR 2CUKA 5EMHA 2CZCA 1NP3A 2HQ1A 4FN4A 2C7GA 2X23A 2X9GA 2ZYDA 3HUDA 3AU8A 3RROA 4RPGA 1UXGA 3K2EA 1LRKA 3VOSA 4F45A 5A9SB 4O63O 1DRUA 1EDOA 4MVJA 5LDHA 2OBNA 3DBHB 2NTVA 2IDZA 4LSWA 4L75A 1PS8A 4A0SA 4FFRA 2WYWA 3DOJA 5EJ2A 4UREA 4E2YA 1GU7A 4QFCA 1E3SA 1YS4A 4EW6A 3PHIA 3T7CA 4R9RA 3RASA 3WSWA 1NX6A 4DIBA 2HK7A 2IYOA 4LGVA 3KXDA 4DPLA 5EN4A 4BNYA 4UVIA 4YR9A 5JW6A 3SBOA 4WCFC 3KLMX 5EINA 1G1AA 2VWGA 3P2YA 2VUTA 3CUKA 4TSKA 3WYCA 3OH8A 3JQAA 3NV9A 4YT8A 3GFBA 1I10A 2BD0A 1JWAB 2GZ3A 1JAYA 1E6EA 4TVOA 1IYZA 3G1UA 5JCJD 3I9MA 1VSVA 4GVLA 2Q2WA 4ALIA 1PQWA 4CM6A 5JDIA 1VE9A 3O38A 2Q45A 2ZQYA 1V0JA 4YJHA 1A71A 1C1XA 3PWSA 1LQUA 1PL8A 3L6DA 1J5PA 2VYND 1XR3A 2BHLA 2VHVA 5TIIA 1E0DA 1E1KA 2DBQA 3FPCA 5CPFA 1RM0A 1XLTA 3LZ6A 3TFOA 4ZRNA 2JCVA 1U8XX 3UH1A 3PJGA 1E7RA 1C1DA 1GZ6A 1BDMA 5ER9A 4TZTA 1PR9A 2NVUB 4XWYA 4HY3A 1E7YA 4E0BA 2EF1A 4BUCA 2W2LD 4P22A 3SLGA 4UEJA 4MPDA 2FP4A 1LJ8A 3RI3A 5KKCA 3H9JA 4Q3EA 1O0SA 3AY3A 3E6AA 3AUAA 4FCCA 1N8KA 4PLYA 1I3MA 5K6AA 1KBZA 1XKQA 3ANNA 4BKQA 1GQQA 3B6ZA 4B4WA 3FCOA 1AHHA 3GDOA 4HX5A 5KIAA 4UVGA 1GUYA 5L4NA 4J0FA 1HLPA 1UXKA 4DLAA 4L0QA 1E7SA 3NRCA 3ZWVA 2HSDA 1T1RA 3ZNQA 1GTMA 3AFNA 1YJQA 3GGOA 3I6IA 3JYNA 3Q6IA 1UH5A 5J23A 1B8PA 3BIOA 1DFHA 1PSDA 3OSUA 1B0AA 1B7GO 1XQ1A 2HJSA 1L1FA 4NFSA 4CMJA 2GN6A 5B4UA 2VRCD 3I5MA 4PG5A 1JKIA 3ZZNA 4ND2A 3LC7O 5DOVA 4RVUA 3D4PA 3HJAA
chains in the Genus database with same CATH superfamily
1RLMA 3D6MA 3H9BA 2PHZA 4N12A 2X2EA 5BSRA 1TFRA 2HEIA 4KK4A 1NW5A 2GZHA 1X8JA 3MPUA 2JS7A 2R3SA 2FSVA 3C4VA 4MEBA 4N82A 4PQEA 4TPKA 2IEAA 3X1YA 2GZRA 2NO0A 4AO6A 4Q66C 4HDCA 2PG3A 3LA8A 1ZCAA 1N92A 2BBOA 1QBGA 2HGZA 5EE3A 4ZAVA 3W1VA 1ID8A 1OAOC 3O2SB 3UUWA 4KRGA 2CSXA 3KOUA 1YI8A 4NE7A 5GV8A 3OPYA 2X0KA 5AXBA 4CKWB 2AYZA 3SYKA 4YXFA 4FHZA 3UK7A 5LWHA 2FZKA 2Y0BA 1L7QA 2Q6TA 3L6EA 3PC8C 3QIVA 3T1QA 1Z16A 1M6VA 4WTOA 5F1YA 4XVUA 3F3MA 4A0HA 2O8BA 3WJ1A 3VR2D 3KKKA 3WZMA 1SU4A 1OWLA 1HNNA 1X74A 2FYTA 3IAAA 4ICIA 3RQIA 4FINA 5CB4B 2O8FB 3B78A 4DQVA 3SQWA 1TRHA 1YZ3A 4EGFA 2BDUA 1N6IA 5EY5B 4BBZA 3ZOKA 5IBQA 5FBHA 3DLPX 3CO0S 4Z4GA 1GD1O 2I4RA 2CYBA 4QT4A 4TKVA 3HUTA 2JFOA 2HBYA 2XDAA 3EXHC 1SRRA 2PS3A 2QRVB 3I2FA 3IUNA 3MB5A 4K1LA 4BNUA 4YRRA 1M7HA 3GARA 1M2NA 2AJBA 1I2AA 3E5NA 4JUBA 2ZBQA 1I01A 2ZSUA 3OTIA 3TJZA 3TTXA 1JLLB 3U60B 2GBGA 2XYQA 1VCIA 1IM5A 2P2DA 3MELA 2M98A 3OFND 4ARAA 3D0KA 1QHSA 2AC2A 4NBVA 5JCXA 1M9NA 4UUNA 2WM8A 2Z6UA 3LHKA 1PR2A 1EX7A 2IXAA 1XZAA 4PLTA 1Z0JA 3F5SA 4QX6A 3UXHA 4ALLA 3KQYA 2V45A 1ZM7A 1ZUIA 3QX7A 5JLJA 2G5TA 2POCA 3LG2A 3NUGA 4K26A 4B4VA 4AQYB 2V74B 1OXUA 4MRRA 2AMVA 1DCMA 3J7AC 1FS5A 3W7VA 3L06A 2ZRJA 3BILA 1KTVA 1D0VA 1PSWA 1QF9A 2BZ0A 2C2BA 2CLOB 1F8UA 1JEQB 3O1JC 4JVLA 1AKVA 4KYIB 2H9AA 3KYIB 2WC1A 4L78A 1XYGA 2Y1DA 3B85A 3HJCA 5AW2A 3SHWA 2O14A 4JLAA 1M1NB 1PFWA 1TVEA 1CIVA 2YH2A 3MT9A 5L45A 5FTWA 4DXHA 1H3EA 2NNLD 5DHTA 5DMHA 2IUUA 5FA6A 3LDFA 3HXLA 1IZYA 3O21A 1FJXA 5H4HA 1ZW1A 2QG9A 4HPJB 4OFXA 2AE2A 5J58A 1U4NA 2AFHE 4F9GA 3UBTA 4LRXA 3DV0B 3IDSA 2G07A 2WLSA 5CYGA 1RWMA 2O8EA 1J5XA 1O97D 5DGXA 1HRDA 2XGGA 1KQPA 2VO1A 1OIVA 1G8GA 4RVCA 5L3ZA 1X1DA 3BX1A 3MCUA 1VJGA 2SKCA 5EPEA 4NZNA 4DJDC 4JJ7A 5CDYA 2WE8A 5IT4A 2DBYA 1KMNA 2PFKA 3GU3A 4TN1A 2JBHA 4PGHA 3HRKA 2D6FA 3GLIE 4PRKA 1OPXA 4KNWA 3FUCA 1XXHA 4DLXA 1WY5A 1H6DA 4CT4B 5FLXA 2PSJA 3NONA 2ZB2A 4C4PA 2IW1A 5A6SA 1QHIA 5B2ZA 2C3UA 2H2DA 4BEVA 2W2LA 5JNRA 3ZLJA 2OHHA 4NPAA 3LE8A 3RSSA 1WQ4A 3R44A 4EDFA 4U2DA 4HWOA 1XDWA 2P0AA 3OA0A 1NX9A 3BE8A 4IINA 1U5BB 3G6KA 5F5XA 2A0XA 2PZ8A 2WUGA 4DDHA 5FORA 1JYEA 1I4DD 3ZDZB 1VIYA 3G5TA 2MYPA 4QREA 1NN3A 4ESOA 7ADHA 3OCYA 4KXLA 3PPVA 3ZD7A 1P5FA 1I5OA 2ZBUA 3E9NA 3IAUA 3QUBA 3ZDFA 4WBNF 5JPCA 5LXTA 1MRSA 3CKKA 3PT5A 1XMSA 1PEDA 1JU3A 1WBJB 2BMVA 2BEWB 1FNDA 2I7CA 2HMWA 4KACA 4K05A 3JQBA 4E4YA 3EMBA 4BO8A 4M0PA 2JI8A 4ZO7A 1L3IA 1J21A 2IH5A 1H23A 1KI7A 2ZITA 4S1WA 3GVHA 5K0LA 3G3EA 4JI7B 1CZKA 3KYDA 1FRFS 4MVJM 5DLEA 1ESNA 5ES3A 3VRHA 1FFEA 4EY3A 3K0FA 1FMTA 2HRZA 3GXBA 3OPMA 4O0LA 5CVDA 2JCXA 2QT0A 2RHTA 4GMHA 5IDVA 2CK3D 3RD5A 2VRCA 2W5UA 3DLCA 3PNSA 2N1BA 1P91A 3OQIA 1LC0A 4M76B 1XAGA 1JI0A 1VPDA 1G64A 2CXSA 2VQSA 1BHJA 3KEMA 1N5JA 3WRYC 2K7FA 1KO8A 2Z2JA 3OCUA 4BV3A 4EHLA 5A7FA 4LYEA 4PIPA 4DR4B 2VHJA 3HJNA 4GLLA 5I7UA 4JJEA 2FPSA 2DH6A 2ID4A 1Q7RA 2GWRA 2G28A 1UFQA 3BF8A 1ZVQA 3OZUA 4OEHA 2XF2A 3O5AA 1XO1A 3CPEA 3DNFA 5AT1A 1NY5A 3UYLA 3THWA 2Q3CA 1L5GB 3V4RA 1ADFA 2B7LA 4JOQA 4H4CA 5IUJC 1I7DA 3ICWA 3GD5A 5DF1A 5EZYF 2XTNA 4KXNA 5JYBA 1ADCA 3BL6A 1KI9A 4M1ZA 2XDQB 3QMWA 5AO9A 1AGYA 3ABSB 4HNSA 4FYVA 1VSQA 1FTNA 1E99A 1TYDE 2WD7A 1EPUA 3ZVKA 1KY2A 2XMQA 3BXPA 1Z9BA 5DM1A 5K2MA 1XAHA 5FAKA 3VR2A 3QPDA 4RTJA 4QQNA 4TS9A 1Y9EA 4YCLA 5HCUA 2NU9A 4V0RA 3WNBA 2MYNA 3IURA 4G2NA 5C9ZA 1FC0A 3U31A 1P3Y1 1JALA 1W2WB 5AK5A 1M6HA 3TOVA 1T4CB 3CF4A 4PYRA 3RF7A 4ZEMA 5HIMA 1CUXA 5BRJA 1HL7A 1GADO 1UOOA 1M8FA 2Y0CA 3A1VA 4ZZ2A 4NESA 2WNSA 2OBXA 1P73A 1AHIA 2HIHA 2V59A 1QZUA 1VL2A 2IOHA 2WABA 1QH0A 4MCIA 2DFVA 1QG6A 3UJAA 1IHOA 3N3BC 4GXNA 4U3JB 2VK1A 5F35A 3TUIC 5EMMA 4DUPA 4MW5A 3TUZC 4AKTA 1WB6A 4RZSA 1KEWA 2BMJA 4JI0B 1LDBA 3OFNA 5K2OA 3UFXA 4Z4IA 1NVAA 2VPTA 5IARA 3VX3A 5K4AA 2X8WA 4B82A 4F3YA 5LP6C 1EFRD 5TQ0A 1YR2A 4KQHA 1WVGA 2YR0A 3PWKA 4OGGA 3ZCUA 2VCHA 2NACA 1AKRA 2OXEA 1L8OA 1MX5A 3F5QA 3U16A 3RVSA 1U7UA 2A4KA 2M9MA 4TVBA 1CETA 3JZFA 4NZZA 1PZGA 2IEYA 3GWGA 3H6HA 4F1JA 1UBNA 1T26A 2JZNA 4PFSA 3GB9A 3Q6MA 5IWCA 3O8BA 4LF5B 1A98A 1PWZA 5LL6P 2EC5A 2HNAA 4FFSA 3GW8A 4GOJA 2H18A 1BWSA 1DO2A 4G5FA 1Y63A 5JE8A 3SF8B 5A9SA 4PO9A 3J7TA 2HPAA 3ZIAD 5I9MA 4COOA 4IHKA 3IIKA 5DYTA 1Q20A 4I2NA 2KWIA 4HN2A 2DBRA 1JB1A 3L8DA 2IBSA 4YFYA 1KXJA 4OI0A 3CS3A 4C05A 2W6QA 3HCEA 1FXSA 4IIJA 4QDXA 1JZTA 3VR3D 1HZJA 2J7PD 4HD8A 5TT1A 3JYQA 4M37A 3WIOA 2R6R1 2GM3A 4OMCA 2CZQA 1FQJA 1K8RA 1TGYA 3VPBA 3PTLA 2ZANA 3I8XA 2C31A 4QPJC 4DT1B 3HBAA 1YI1A 3ZGNA 5I8ZA 4GMDA 3QLVC 4BO6A 4B7XA 2CXXA 5GZ3A 1FDIA 1KK3A 5KMGA 5CDFA 2AEFA 2QJFA 2BDTA 3RRFA 1WDMA 2E37A 3IYLW 5D51S 3WLIA 5AHOA 1R88A 1P2VA 1PVDA 3V9PA 2HKIA 3LHSA 2UZ4A 5BSKA 2VJDA 1B6GA 3JVUA 1FS4A 1RKXA 2FW6A 3OPQA 4WXYB 3RYHB 1GSHA 2GPNA 3HH8A 3NHMA 4RDIA 2WW8A 3QKIA 4Q3LA 5WRFA 5DLYA 2J9GA 3W7AA 1VTKA 4AJHA 4I1UA 5EXPA 4DCGA 1QIHA 4RD4A 2GWHA 2NO5A 1OHHD 1NP6A 2A7XA 4N7BA 5FD8A 2XV1A 4PLZA 4M53A 1AUPA 3ZS8A 2H1VA 4Q19A 3QEKA 4CEIB 4DQ0A 2Q9CA 3GLIA 1XPUA 2QX7A 3FKQA 1DKPA 3INTA 2BFDB 3LP5A 1XJ0A 2QI9C 3A06A 2P35A 2P5UA 3FMIA 1DUVG 2XHZA 4CEJB 4RVOA 4KHZA 4NE2A 4LF4B 4EUFA 3OQMA 1FE8A 1CUCA 2A6PA 1AURA 2C4MA 1MP0A 1RHMA 2HMAA 3A36A 3EE6A 3IAS1 1SKBA 3MW8A 3E61A 1ONBA 5C7IO 1P0QA 2CF5A 1DXHA 1CEQA 4BFWA 3IJEB 7MHTA 3JD3A 2Q3FA 5HFAA 1W75A 4CLEA 2DLCX 3EARA 4EGJA 2X42A 2C2ZA 1NT4A 4FVTA 4AIIA 2JFWA 1JFVA 1EUDB 4ZCSA 1M10A 4BQPA 1NC3A 4XRGA 5JBIA 2D5AA 2PX0A 3JYOA 3T5DA 2DUNA 3TL2A 3U7QA 4RTLA 3KQNA 1U3FA 2P4SA 1ZK1A 2JI7A 2GAIA 3HYCA 1Z5VA 3ZOZA 2C9DA 4KQEA 1N57A 2HU8A 1H1DA 4MLPA 5AJXA 5GY7A 4NJMB 5J4YA 3L4EA 3WWEA 1SZPA 3A28A 4IIBA 2OXTA 4I1PA 1JH9A 1JECA 1HMYA 1X86B 1LLDA 2ZJ2A 1TVCA 2VF7A 2CV2A 3V8RA 2QBYA 1P0MA 1RHQA 2J8ZA 4NV0A 3A1EA 3QMPA 2VSFA 4RA6B 3WFZA 4CTKA 4KMOA 4FFPA 5JADA 5KQSA 2GLXA 1IAQA 4QNRA 4LJRA 4RAOA 4DV1B 1JPVA 5ICMA 2Z5LA 1GTVA 3OJFA 3QELA 4G1MB 4X6XA 3S1LA 2JANA 3SN6A 4EGCB 3IDZA 4RSGA 1XCPA 1BU8A 1TQ8A 4JR0A 4YALA 2B94A 1ZL2A 1HXHA 4G5GA 3VHRA 2X4GA 4P2GA 4O2AB 3RKRA 2QD1A 1P1IA 1YUBA 3G2NA 3PGA1 4F86A 2KX7A 1CUIA 2WG1A 3DG9A 3IB3A 4U6SA 1TYAE 2ZRLA 5JHGB 2D0OB 3H6KA 3ESBA 4A9AA 4TXMA 3ZWXA 4ZVKA 5LQNA 4QVKA 4YO7A 1MX9A 2IZZA 3D1VA 3F74A 3THXB 1SBQA 1IHXA 4YAKA 1E9CA 2EFHB 5LYJB 1CY1A 2A0UA 3HEMA 4UMFA 2C7QA 3PQ3A 4CKWA 3LZCA 2V5UA 1E9FA 4I8IA 5J5AA 1JV2B 1UBCA 1W88B 1FXWA 1ZS9A 4U2GA 3U3JA 4NCIA 2CUZA 2C4HA 2DH5A 3F4KA 1YIOA 1AV7A 4J0JA 3ES9A 4F85A 1V5FA 5EWLB 2XUGA 3T61A 1RPTA 5J2TB 1PJQA 1UODA 2L19A 3AG6A 3DVLA 3R8FA 3DW3X 1KYTA 2RJ3A 3AGPA 1UXJA 4ZCQA 3OZWA 1T8PA 4DDKA 1T6ZA 3LGXA 4GGOA 4YJ2F 1EFRA 1ILEA 3C43A 4DTIA 4EHJA 2O8FA 3HKEB 4HS9A 1XVLA 4LI0A 5IEJA 1DXQA 1RWKA 1F60A 1PK8A 3RFVA 3RR2A 1VG1A 3NNSA 2JC3A 5B1DA 3RT7A 3V1NA 1NF8A 1UPCA 2NXEA 4KOEC 4Z86A 1FYDA 1QZXA 4EF4A 2IL1A 1QX3A 3K2IA 3Q10A 4B74A 5J4HA 1B8NA 3HPRA 2AFIE 2XWBF 3GNLA 3IX7A 2QRVA 2WWTA 3L1IA 4KI0A 1NY6A 2IYAA 2OQ2A 3L02A 3L92A 4M7OA 4AJEA 2VQFB 4JV5B 1E18A 2E4AA 1GGVA 4QUHA 5HA5A 1B4DA 5BWCA 2I1VB 5EGNA 3ZIAA 1JLLA 4NP6A 5AW6A 3S2IA 3LQ4A 4H6XA 4ER0A 2EJWA 5MFPA 4QULA 3S8MA 1GPMA 3AHCA 1WHSB 3R41A 4B35A 2Q1TA 1KI1A 1PR3A 3H04A 4R71A 1QP7A 5AI4A 1Z2CA 2J7PA 4PGMA 2YW2A 5E4YA 3ANMA 1ORWA 2P2LA 3GRCA 4BBJA 1ZP6A 4E5PA 3IUPA 2QTWB 1UXIA 2WNIA 1LVGA 3T5CA 1M2GA 3GQVA 1JEQA 4XUCA 4NFHA 5K03A 1IC6A 3H1GA 3SICE 5DFAA 1EUYA 1M8PA 3CVOA 4G85A 4KN9S 4BRWA 1M1NA 4UU7A 4W8HA 3MJDA 2H9YA 3RIHA 4YDSA 1JIKA 3RRJA 3EFEA 1XCGB 3IHTA 2DGDA 2BMEA 2DE0X 4GX0A 3RCBA 3UJDA 1VZ3A 1PR0A 1Z62A 5ALPA 1ZXXA 3FOCA 1YR8A 1SEVA 3RUDA 2WINI 4UC0A 4DLPA 2DC1A 2VSXA 1OHHA 3K15A 3GFOA 1OKKD 2IZ6A 2WJPA 3DV0A 1HH4A 1EJ2A 1Y4AE 2WTNA 1FUKA 3QMMA 2YX1A 4DVGA 4U0KA 4ECEA 4GP7A 1AV6A 2A67A 5IDWA 2R1UA 2WHXA 3J81A 4TTQA 4MMZB 2P5SA 3EG9B 2B2CA 4DEYA 1KE2A 4QFMA 5GMOA 4KUGA 1KKUA 2O06A 2Y77A 1YBVA 2PO5A 3AJRA 3DF9A 1Q1GA 2I2WA 2NZYA 3T8YA 2QRLA 3AZQA 3GEIA 4ONEA 1LBEA 4D9FA 3H5WA 3OZ7A 1H6AA 1NVEA 3AVPA 2A5LA 3DDUA 2RMKA 4N6GA 4QDZA 4D8UA 1XTUA 3B1FA 2AFHB 4YRNA 4JL6A 1CB7A 4HEJA 1I4OA 4M88A 4URWR 3VPCA 5TVGA 3A6FA 3OTOB 2WMOB 5BYBA 3WSVA 4R69A 3E22B 2Y6UA 3QHPA 5KVVA 3LUGA 3DPSA 3I9KA 1T5HX 3L7DA 1A50B 1REQB 3OA2A 1G5QA 1U5BA 3P0IA 4KN5A 4TX1A 1PLLA 5DSZA 3KFXA 2WYOA 4GOOD 5JDCA 2C97A 2RI0A 1G291 1Z82A 2H51A 3ORSA 4I4CA 4EQ6B 3IHWA 1HOTA 3IEKA 2W2PA 4EUEA 5EIHA 1ENOA 3B1WA 3ER9A 2YVUA 1VCOA 2ZI9A 4OHPA 1TAUA 2BEWA 3LLCA 5LA6B 1M2WA 1T0UA 1AK9A 1X1TA 1UFOA 3WIBA 1N7JA 3BE5A 3EJ6A 1S1CA 4PIMA 5H82A 3AX6A 1KIAA 2VP5A 2VDRB 1EFKA 2IHYA 1FA9A 1E6LA 1NAIA 9LDBA 5I9NA 4ZC8A 2HX1A 5HM6A 1CRLA 3SS8A 1GDHA 3OQJA 5AM5A 3TDNA 1H0RA 2AN4A 3GX1A 3TLXA 3ZTTA 4KL8S 3CSSA 5HYVA 2P6PA 2VWQA 4YJGB 3FSJX 4MO2A 3RC3A 2OCYC 3MGCA 1KP9A 1B43A 2PRJA 1T4GA 4AWAA 2XCOA 2AXNA 4C6TB 1KK1A 2OQIA 1OBHA 5CCEA 5AM0A 3JVEA 3I2YX 4Q47A 3W79A 4MWCA 3LX6A 2H4ZA 1J99A 2JGJA 2QF7A 3H2KA 5ECWA 5AR1A 4QTTB 2QD4A 5KJCA 3IEVA 4L28A 4XYGA 4GG1A 3N39C 4IDQA 4IR7A 4BRUA 4GSKA 4K81B 1N5IA 2DKFA 3OTWA 1NF2A 5CFPA 4ARCA 4M9XA 3OIVA 2VF4X 3M2TA 4I55B 4IGKA 2VA8A 1IPHA 3KKQA 4PZZA 3DDNA 2HLNA 1IHUA 1GKKA 3NMUF 1L7EA 4F46A 1JHYA 1RWBA 2XDQA 3EHDA 3NM6B 3OOYA 4AJOA 3W8RA 1GPJA 1TYCA 2R6ZA 3MCZA 3NW9A 4IIUA 2CLEB 4NWIA 4PICA 4W5WA 3RYCB 2WWHA 2D1YA 2WHPB 2PS0A 3SHOA 8OHMA 2PUAA 3GJXC 3K73O 1G7SA 3S6JA 1XQXA 2QIPA 4LRYA 2BKXA 4OKSA 1H3FA 4RM3A 1FP1D 4Y18A 1T4CA 4KPGA 3WG9A 4EG5A 2UXDB 3RWMB 1QGDA 2D5LA 4GQAA 3FYUC 3Q15C 2R1TB 3M3HA 5CDTA 1NUPA 3DB1A 2X5KO 4NS1A 4XSHA 3ESCA 1OZ0A 4A8JA 4HTFB 3E9YA 3HXTA 4MS4B 3AFMA 3UTDA 4XYLA 3TZLA 1U0HC 2BY4A 4HDSB 4HYEA 4LOJA 1TC2A 2P6OA 4U3JA 4ZZIA 4ETIA 1VJ5A 1GLVA 2FJ0A 4WUTA 3KKEA 2QP4A 4K7JA 4QDUA 3NHPA 4L76A 4ZI7F 1P7CA 1YT5A 4INAA 1H4VB 2FEOA 2EIHA 4I08A 2OZVA 3PC2A 2AW5A 2XMZA 2VPIA 4LYAA 2QTHA 3BMNB 1PS9A 2C9ZA 3HRIA 3EBLA 3DHWC 3PYLA 1ZJYA 5KREA 1QF6A 1U8FO 1QPGA 1V11B 4JOCA 2A5JA 3NKFA 3DHNA 4ZGBA 2L2QA 5GONB 4DCOA 3HL0A 1ZUNB 1IU9A 1E60A 2PA3A 2ZBPA 4FILA 2IEBA 3SK0A 4EW1A 1Z6QA 2Y71A 5I7SA 1HGXA 3P4XA 2NSLA 4US1R 1MABB 4GFDA 4M9RA 3SF8A 3SQLA 2NMVA 3O9MA 4ML3A 4EITA 4L4RA 4H6WA 4DQKA 2RH4A 2XBLA 4GPBA 1O3YA 3WHIA 4ZQHA 3CVJA 1UEJA 3T3MB 2I9KA 4G8JA 4WFJA 1ZNZA 3QFSA 3B1ZA 1WZ2A 1WXDA 4RX1A 3DFIA 5KQGA 4GKBA 4DT1A 1Q7EA 4MP3A 2GNAA 3TNJA 1JB9A 1MQSA 4LMRA 3GT0A 1PO7A 3IODA 1YGPA 1JPUA 4LSMA 4NBWA 5HBGA 3UF0A 5C80A 4OK6A 1L3CA 3TKAA 1MU0A 1U8AA 3BZWA 3PC6A 4OBBA 3SYMA 2V3WA 2ZTUA 2XQKA 4XQEA 3EVNA 3VU0A 4KXFB 3ZY5A 1UBMS 4KIWA 1DP4A 5FQOA 3ZN2A 4B4DA 4MJLA 3GZNB 1UMBB 4PRZA 1JL3A 4PV7A 2JNWA 1HTTA 1MOSA 4RMNA 3RYHA 1J00A 2YWXA 1J0XO 4D0RA 1IB6A 1SNYA 1ULUA 2C9OA 4QUIA 3EFBA 3LVFO 3SP1A 2FP3A 2J6HA 2VYCA 3EGIA 4AN0A 1O89A 1IULA 4GW3A 2CVPA 5JO0A 3MTIA 1P29A 1X1BA 1DVRA 4R8VA 2NZVG 5C4MA 5EHNA 5E8RA 4CEIA 1U3GA 3KO8A 3V1MA 1SHKA 2W4IA 3EISA 3EVZA 1NKTA 2BFDA 1W87A 5HKOA 5A4IS 5A0FA 3TLAA 3MG9A 4K9SA 3C8ZA 3IHLA 4CEJA 1MBZA 3GFVA 3MMPA 3S2YA 2CDBA 4FLEA 2AD5A 4IOLA 4U2CA 2H29A 4X3OA 3LHDA 4L07A 1WBBA 3AUYA 3HJBA 2PU5A 1D4FA 3A1NA 4PZAA 1RI2A 1VL5A 2ZUVA 4XGRA 1E98A 5H81A 4O08A 4R83A 3R3YA 1C9DB 1HDXA 2Q4EA 4PFJA 4BV8A 5M5BA 1EUDA 2RK6A 3D6FA 5EYPB 3WLNA 2BMDA 5L8VA 2V7VA 2V8OA 2HDNB 4LFCB 1RLUA 1KNQA 1TEHA 3FVQA 1R1DA 1T1IA 3B1VA 1QQ6A 3GRRA 4HDMB 4NJMA 4CRWB 4ER3A 2DWPA 2D0PB 2FW1A 1IOZA 2QMUA 4Q24A 2ZE7A 3DWEX 1ESDA 3NGXA 3UAYA 5CIYA 4NCAA 2C9CA 3IKLA 5BW4A 1GZ3A 2GBLC 4HGYA 1R8YA 1CP2A 3L82B 2ZLBA 3BFKA 1ZD5A 3L6CA 3PYMA 4M0DA 1ONOA 1S01A 3RU3A 3UCFA 4RA6A 4EPXA 4MV6A 5C8VA 5JAUA 2ZDHA 3V48A 5B4VA 2W22A 1EFUA 1N34B 4LN1A 4JKIA 4IH9A 2FH5B 2WHEA 4G0UA 4RTOA 3NHYA 2ZXUA 2I54A 1W1UA 1SRQA 1I1HA 2NO1A 3QU2A 4A8PA 1RKQA 1WM1A 3WYEA 1OSNA 3E0QA 4PTLA 3O94A 1MFZA 3PJDA 1T2FA 2QMQA 4O2AA 1QO0D 3U3ZA 2REBA 2D4HA 2GPTA 3UT5B 3RWOA 4NONA 2DLNA 2Q7XA 2VYNA 1QK5A 3EHEA 4JSYA 4EG1A 2EJTA 1W47A 2B7BA 3K53A 3VAYA 1L6RA 4BC0A 2IDKA 1T9CA 4OXIA 1NUQA 3THXA 2AA3A 2P91A 3KB1A 4HLDA 4QQ8A 5FPHA 2QROA 1DWQA 5LYJA 3UJPA 3PVCA 3I52A 2PGOA 4OU4A 5F78A 3VPAA 4JH0A 3IQXA 4K2HA 1W88A 3B60A 4MEAA 1SD1A 2WJGA 5KYKA 3EQZA 3BVPA 1G2IA 2HNBA 2VQ6A 5EWLA 4K3UA 5GM1A 2P2NA 3FCUB 5J2TA 1NURA 2NN3C 5ECDA 1J0DA 1I2DA 2CXHA 1R15A 3RAFC 4FBLA 2ZZNA 5AVVA 1J8QA 4M0UA 5FUWA 4EJ2A 1LBQA 1YQQA 4Q37A 3HKEA 1OCEA 3DMPA 5IASA 4V02A 4YTEA 4HV4A 1OV6A 4RJ2A 2VT6A 5UKDA 3D5QA 3DE3X 1RWOA 5FF9A 4DLTA 1S2LA 1G5IA 2ODAA 2IDJA 4Q3DA 4R1PA 1UK6A 3EXFB 3FA2A 4K88A 1NW6A 5K0SA 4HSGA 1HFEL 1W96A 4HQNA 4L0DA 4YK7A 1LV7A 4XWTA 1Z4QA 3PDWA 4LZNA 3V8PA 5CVEA 3C3WA 2NUBA 4IOKA 5AJUA 4BNLA 3ONDA 1L5QA 1NULA 5JXWA 4FMDB 4MUBA 3A11A 4QWWA 4RKWA 1V3VA 3FH0A 1S4MA 4MUHA 2FAXA 4DA7A 4B43A 3O84A 5I6DA 3VC2A 1WHSA 3ONEA 1GTSA 3SQNA 3FZGA 3UAWA 1OU0A 1JG7A 4MB0A 4KVAA 1BAPA 1QVWA 2YXLA 3LRXA 1L7AA 3EZ9A 4MUKA 3FPFA 1U2GA 1YB2A 3NYWA 1B3BA 1IM2A 4LYDA 4IVNA 2FPWA 2WKQA 2X4DA 1YMUA 3IV9A 3LXUX 3MEQA 3HB4X 2GN4A 1EK2A 4MROA 5E2IA 2VDNB 4MPJA 3IH5A 1G3IA 3DEFA 4P31A 3W6UA 2REXB 2QZJA 4D8YA 3A6LA 3PHCA 1QU3A 1TM5E 5DT9A 2CXQA 3HZRA 4NE9A 4P84A 5I3CA 1CY4A 3D4BA 1Q3HA 3MBIA 4I6EA 4JA2A 3EUWA 2Z56A 4IZOA 3I2IA 5DIZA 4BLOA 3NDBB 3ZGXA 4WZBE 1JXOA 2R8BA 1AN9A 1KDYA 4B3FX 4E14A 4YS6A 2EKQA 3ZDCA 3RS9A 3LDGA 3SXUB 2GA8A 2O54A 3F4LA 3LPAA 3UA3A 2IOFA 2EP8A 3DOHA 2OK8A 4P35A 1X2BA 1JR6A 2H1WA 1ELOA 1FDWA 1RE0A 3DL4A 4JBWA 4WJZA 1W4AA 2WG0A 3IQGX 2Y0DA 2OHXA 2YS6A 4IYJA 4F2HA 4F38A 5IVHA 1RAIA 4B8WA 3C74A 3LK6A 1KPGA 3RUHA 1LTQA 2QTAA 1P81A 1PG5A 3ENVA 2ZTLA 3EG9A 4JUAA 2QXTA 3UT0A 5CA0B 3WYDA 5IHXA 1MW8X 2ZVPX 2F90A 4D8WA 5LM3A 3AV3A 1P5RA 3K0AB 5BV1A 4A26A 4AFNA 3A6EA 4EKDA 2CXRA 2YNMD 3K0HA 1YZFA 4C1NA 1FP7A 1WVIA 3ANTA 2QYTA 1CUJA 1GZDA 1L0BA 3MOIA 2AFHA 5GOTA 4R5HA 1VL1A 1XWFA 2FZGA 2IU4A 3RKSA 4DOMA 2VHYA 2O8DB 4BXOB 4QXMA 4B1FA 1K6MA 4KDFA 3E22A 1HLDA 1X38A 2DX7A 2J9FB 3Q6NA 4FFOA 1REQA 3AINA 4GPZA 1QZ3A 2W83A 3I8OA 2I4TA 1WUTA 1KMIY 2BDEA 1K68A 1M34B 1OX4B 2AOTB 2QU8A 2TECE 2Q0SA 2Y3IA 1V2GA 3M6MD 4Q3NA 4FDTA 4R8RA 3ZY6A 3BPSA 2ISSD 3L0OA 5DISB 4DCPA 1GPWB 3DMTC 1D2MA 2EL7A 1TUEA 3DZ8A 1G3UA 4EQ6A 4LZPA 2O07A 4J9VA 3N87A 2I87A 4FYYA 3W4JA 4XLZA 2N9UA 1DKQA 2Y2VA 4ZMSA 1TW3A 4ESHA 2B2NA 2EIXA 1XCOA 5LA6A 2G0AA 2ZRHA 3UB4A 3F1KA 1GNRA 1IMOA 1GGMA 4G1UC 2VRBA 1AKNA 3I92A 1MEEA 4GGPA 1WXWA 1XNQB 2C84A 1I3LA 1PBNA 3K0BA 5KYGA 3QJYA 4QYSA 2HSZA 1DI0A 4Q4HB 4B47A 3OPXA 1OB2A 3TNFA 4QUJA 4HLUC 1Q0SA 4P5EA 4YJGA 4YDRA 1VJTA 1XQ9A 3L0DA 5LYYA 3DFFA 3HYNA 3I32A 3Q3EA 2HR1A 4C6TA 1QO0A 1Y80A 1RE1A 3RSZA 1OH6A 1R0YA 2FA9A 2R25B 3I04M 2G9QA 4S05A 3SYTA 1PNRA 3LFHA 4WKOA 2UYHA 1TECE 4Z5XA 4WV3A 5AW3A 3TXYA 3NOOA 1TKAA 5TT0A 2J6IA 1YCGA 2YCBA 2ZWOA 4I55A 2L17A 2PH7A 1F7UA 5K0TA 1OZFA 4H0NA 3NDJA 4LG1A 3VUFA 1A96A 1IPEA 1NV9A 2IZ5A 4NBLA 4DCUA 5AW7A 3K0KA 2C2OA 1DOAA 2H6EA 1HTBA 1E7QA 3GMDA 1T0JB 4DMFA 1AQLA 2XCTB 2D3WA 4IKEA 5K3FB 2V03A 2AGVA 5HKLA 5FBQB 1FMCA 4REOA 2RBKA 1C9YA 4RHUA 4HLNA 3GIWA 3B2EA 5DTRA 3FI0A 4B17A 4BJ6A 4B0PA 4BZZA 2GD6A 3RYCA 2WHPA 3TSWA 3ZGZA 4AU1A 3ROZA 4NOMA 3F7MA 1R9JA 1PNVA 3LFTA 4FHCA 1WDTA 4IJ6A 3ESZA 1G9TA 4TVSA 1ULSA 3OCJA 3M6AA 1OA1A 2JAOA 3R7DA 3S5UA 1GAEO 1W36B 1YZTA 2H1HA 4MRNA 4RDHA 3DVRX 4XLTA 3K70B 2DAPA 2R1TA 1YS2X 2G25A 2I6UA 1ESEA 3QWHA 3ROFA 4J0CA 5LUAA 2H11A 5C1DA 4CGZA 3MT8A 1VM6A 3JQ9C 4QVGA 5C8YF 4HTFA 5CBPB 4MS4A 3BJIC 4WACA 4F6RB 1W8IA 4HDSA 2SBTA 5T64A 5HNKA 2PL5A 3SZRA 1AY0A 3ESAA 4DEXA 4EMTA 5J5VA 1L5KA 3AO0B 4S1NA 1IUNA 4OQ4A 4JP3A 2Q5JA 5LDGA 5LJIA 3CW9A 1NONA 3X1DA 1GGKA 4N65A 4HPWA 3EDCA 5DM2A 1QIJA 2D0DA 2WMNB 4RLQA 3VBEA 5LMZA 1CUSA 1KTIA 3LIPA 2PLNA 4HAZA 7GPBA 1GG2A 3BMNA 1FFGA 1ENYA 2WFLB 2ZKLA 4OBEA 2HRBA 3T3OA 4RDXA 1DELA 4KDRA 1XHEA 1V11A 2DUMA 5GONA 2C3YA 3PXDA 1S8OA 1ZUNA 4RPIA 3D3EA 1W76A 4EI8A 5DYIA 1C9EA 1E2JA 1ZIYA 1HOXA 1MABA 1ZBDA 2RIPA 4AO7A 5LQRA 4JVNA 1JIQA 1V45E 1SZDA 2ZRKA 1Q0PA 2IU3A 4AROA 1BS1A 3MT0A 2XYRA 3BORA 1ZOOA 4GI7A 3A2LA 3CRMA 3FPEA 4BAGA 1V5WA 3GAMA 2QSJA 4PS0A 2HRRA 5G02A 2FGJA 1PHRA 2O7NA 4B81A 4WE3A 2CFIA 3AHGA 1B76A 1BA3A 5IYZF 5HG0A 4QRIA 3U3XA 2B3DA 1NNI1 4DA8A 3PUVA 3G7NA 4AG3A 2O4UX 1E3LA 1GGFA 4M86A 4K6KA 1A76A 4A7PA 2GFQA 4FIDA 1RWWA 2Z3VA 2PGAA 3HYLA 5ALNA 4TZ6A 1LPAB 3FSRA 3IOBA 1C9KA 2ZVQX 3EGWA 2AZXA 3II6X 4Q4AB 4D4KA 3EYAA 3L7KA 3N5CA 4NHEA 5IKXA 1K9SA 2PZJA 4M2LA 1ODCA 2C61A 1COWD 1G6HA 2J9ZB 1TUBB 1A04A 1QR6A 1XVUA 1BXZA 1UMBA 2YNMA 2FSSA 3CTMA 3AILA 1DL5A 1Y4UA 3BHIA 3PT9A 2CGEA 4JGIA 1BS9A 1TAHA 1T4MA 2GCOB 2Z2KA 3JASB 4P3OA 4MHTA 5C8XA 1C7RA 3RNLA 1CJCA 1NMZA 2XCLA 1W48A 3O8NA 4IMIB 3WLLA 4WL0A 1ZLXA 2UXBB 1XAJA 2OOSA 4ZKEA 4L2IB 5IVPA 4ALKA 2QTZA 5LNK6 4UVEA 2NSJA 1DRVA 1RXYA 1NW7A 3A4LA 1OGIA 1E79D 2I6SA 1CIJA 1DT5A 4MQEB 4ZFNA 3DE1X 3L0BA 1RWVA 5CNJA 1J90A 2LUOA 1D2NA 1SEPA 3QBEA 5IVKA 3A6KA 3NIWA 4G0ZA 1A9XB 5EE1A 3WAKA 4R8KA 3L1KA 3BMXA 1M33A 4MVJE 4BMOB 3CRZA 4R54A 4UEOA 4D9JA 4GYJA 3TK1A 3TM5A 3H1TA 4URVR 3IT2A 3KX2A 5DW3A 5TEVA 5EYPA 4EIWA 4UHJA 3ZDBA 3TI9A 2WM9B 1DKMA 1LNQA 2O0HA 1YZVA 2UXCB 2VJBA 3I6BA 1B41A 4IJWA 4Z4EA 3DD1A 4JODA 2QY9A 3V6MA 1AQUA 5F4ZA 1SOAA 2MSLA 1OBCA 4HDMA 3ZHSA 2JI6A 2RGDA 3H16A 1QFYA 1N75A 1AA9A 2JEOA 4E30A 1IQPA 4EF5A 4F84A 4KUEA 3OJCA 1QQ7A 2R62A 4I6JA 2QMYA 4NNJA 1TVKB 3WX0A 3OBIA 3ASYA 2BM9A 2OVFA 1M1YE 4ITVA 1V8FA 1W85B 4H9GA 5L51A 4H7HA 3FDFA 4LDZA 4TMXA 3UOGA 2ZATA 1SCUB 2DUWA 2ECKA 2UUBB 1XMIA 5DBGA 6ADHA 1P5ZB 5HK8A 1FNBA 3OZAA 4FR0A 1W1WA 4DSZA 3LOQA 2I6FA 4O2RA 5A2GA 1YZLA 5IVDA 3ZWQA 1EDBA 3UT5A 1SVKA 3RFXA 1M54A 5ILOA 3IE2A 2WPNA 4FMPA 1HT1E 3I6MA 4YROA 4YUWA 4J0HA 3NWJA 1J4AA 1ZRNA 2HK9A 1QHYA 1P2SA 4L4YA 1XZEA 2XMSA 5F77A 3A1FA 2VHQA 1PVOA 4ARZB 2QU7A 4BB6A 2I2CA 1OH8A 5F7ZA 4FOLA 2DYKA 3LP6A 4DZZA 4RY0A 1J2TA 3BYZA 1CP3A 4B7UA 1A2KC 3D3WB 3EFOB 4HFJA 3C6BA 4AY4A 5KQLA 1O0CA 1BJTA 1P18A 1GM5A 1B8UA 1P7WA 2E1PA 1RQXA 1XZMA 4LV5B 4LA4A 5KTKA 3FGPA 3IQFA 4Z1MD 5FI5A 2AF4C 3N0VA 1HG0A 1BO6A 4W5TA 4LHWA 2QGZA 4KBYA 4KCGA 4B8YA 4UUQA 3I9NA 1K7FB 2DF8A 2HCBA 1ZR2A 3IBCA 1W36D 3C3CA 1QANA 1UKZA 1C50A 3QVUA 3ZI7A 3K70D 1WEKA 4J0EA 3UJNA 4K6MA 3EXFA 3EZLA 1NDQA 3CG4A 4G07A 5DWDA 4BWFB 4WLUA 1AOXA 4GLOA 3SYLA 2EFGA 1S2MA 1DKOA 5KEIA 1I0LA 2FPMA 2KYRA 2O8NA 3NG1A 3HSKA 3H2JA 2IQ5A 3ZCTA 2X15A 1ZSYA 4ZVOA 3STYA 2BGKA 3KEOA 4GYKA 4IH4A 2FFAA 4G2TA 4QTUB 1YB6A 5K0ZA 1U28A 1XVTA 2H07A 2JFYA 3TAHA 4F5YA 1NLYA 2H7XA 2B99A 2H85A 3C7KA 3DJFA 3M33A 2G83A 3O4FA 4KDCA 3ROMA 4YAEA 3VTKA 1O4WA 3GPCA 1M1XB 2QMEA 5LBIA 2YY6A 3KT8A 1X1CA 5CH3A 1GPLA 4WKBA 3ADDA 4DG5A 1RXIA 2PPLA 1GQSA 4CUKA 1BVYF 3C3YA 3PNLA 4IIHA 5B57C 5CD9A 3HJRA 2OSVA 4G5RA 1A8UA 4L7QA 3NXKA 3E9EA 3O3OB 4UOEA 2GJ4A 1FX1A 5JC1A 1UEIA 3VO9A 3ZDYB 1AO0A 1W30A 3V7YA 4C7XA 4Y30A 1F17A 3QYPA 5EE0A 5EGSA 4A0FA 1D8AA 3O8OB 4UE6A 1TRKA 1XZNA 1EP2B 4OTZA 1WXXA 4GM4A 4MXDA 4ZTBA 3ESDA 4NU8X 1U5CA 1A95A 1YRLA 3GWZA 4JJAA 2HSGA 1KVSA 5EMLA 3SXUA 2YMPA 3VX4A 4WBNB 5A1JA 3KLBA 3B3GA 4F3CA 3MUNA 5FI0B 1Q16A 5KC8A 3IO3A 2CVZA 3CT4A 2L0XA 4BNHA 5B7PA 4MVJH 5BMVB 4DG8A 2JCYA 1R0SA 1GYRA 1TD1A 3SNHA 1SVSA 2C4KA 1G55A 1II9A 3H11B 3P9ZA 1WD7A 3H3XA 3IP8A 1E94E 3FMVA 5ENVA 4B09A 4W5QA 4PZPA 2F8MA 3K1YA 2CHUA 4LI3X 2IYLD 2Q21A 2XYGA 3PZRA 4WZBB 4XDGA 5CA0A 1E79A 4NAUA 4JI6B 3K0AA 2BBSA 1CUWA 4BLWA 1A5AB 1BHO1 1OFUA 1DBSA 1Q21A 1FNNA 3E15A 5CYOA 3PFKA 5AWFC 4C3UA 1Q74A 3L7OA 4Q4JB 4UHHA 2PMWB 4EEKA 3IP5A 5E6SB 1VCHA 5JARA 2JFQA 1F14A 4YP0A 3UGKA 3L0IB 4M49A 1KYVA 4TROA 1A4RA 1GN9A 4J4HA 5D3MB