1ZMTA

Structure of haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (r)-para-nitro styrene oxide, with a water molecule in the halide-binding site
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
molecule keywords Haloalcohol dehalogenase HheC
total genus 87
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zmtA00
1MC4A 3OFSA 1U9JA 1ZJYA 3GFBA 4MJLA 4PLWA 5CEJA 5IDQA 5FI5A 1WZEA 3H5RA 3R3SA 4J1NA 1ENPA 5JLAA 4WCFA 2DT5A 2E49A 2DFVA 4OIMA 1Y8QA 1PS9A 3VPGA 2I67A 4J6FA 4PIVA 4LMPA 1ISFA 3ORFA 3OJOA 4WOKA 5L51A 4XQGA 2EV9A 4HNGA 3PTZA 4YAKA 4BGUA 1SEPA 4WK6A 3PXXA 3VVBA 4G81A 3W8DA 2QIOA 5DP2A 4Q3NA 4FFPA 4W7HA 4DWVA 1PQWA 1DDOA 4U5QA 3OQBA 4DIBA 2IODA 5TIIA 2O3SA 4TKMA 4XGNA 3DEYX 2QG4A 3PHHA 3E03A 1E1MA 4U6QA 3RASA 1PX0A 3PHLA 3AWDA 1Y5RA 4NJMB 3U62A 2W98A 2YY7A 1NTOA 2CVZA 1T25A 1JAYA 1YQDA 2RH8A 3KRTA 3LQFA 2CDAA 2VUUA 4BNUA 1HETA 3JD0A 3F46A 4NPCA 2CSUA 3ETDA 1PGNA 5EQDA 1GTMA 1JW9B 4EDFA 4TVOA 5T5QA 4ALLA 5KCZA 1P1FA 4BNVA 4JJGA 1FMCA 2R00C 5JCJD 1D1SA 4J4HA 1NXQA 2HQ1A 1WMAA 1U3VA 5T8KC 3ZW9A 3IQDB 3MTGA 3E1KA 4R68A 1DJNA 2NVWA 2Q99A 1ZK0A 4YT4A 2HCTA 3AW9A 3U4DA 3RUAA 5CDUA 3PZBA 3VAZA 3FBGA 4H15A 4E32A 2HMSA 3JTMA 3QP9A 3BIOA 4J1QA 4UUMA 3PJGA 5I9LA 1E1KA 3I5MA 2JHFA 5EERA 3SEFA 2I66A 3L9WA 3DTYA 3PHIA 2JAHA 4LSMA 1A5ZA 4BMSA 4DBVO 2O7QA 5L4LA 3IL2A 1PJ4A 3P2YA 3C24A 3FI9A 4OM8A 5FF9A 4K28A 5DT9A 4JGBA 3BHIA 4RDHA 4GGPA 3VPXA 4A0SA 5G0TA 4XEHA 7MDHA 3OIFA 4W4TA 4A27A 4BNHA 3BYZA 1HDXA 4KZPA 2X23A 3ONFA 2EF1A 5IXYA 5B37A 3VH1A 1R4NB 2HMWA 4YAGA 3AFMA 1N7GA 3KV3O 1E1NA 5I7SA 3W8EA 3I9MA 2P9GA 3RFVA 1ADFA 8LDHA 1DAPA 2O3UA 4HKTA 4OKIA 4TQGA 5BQFA 1PSDA 5IDXA 1ZK2A 3CZMA 3EK2A 5EL0A 1DIAA 3IKVA 1PWZA 5DDIP 4XZ3A 2NU6A 3ZWOA 4CM1A 2BFMA 4NBTA 5KJFA 3C7AA 2NU9A 1WZIA 1ZXBA 3EGOA 5JYEA 2BELA 3VVCA 3ZV3A 2GYYA 1XR3A 3TZQA 4XB2A 5ER9A 1LDBA 5AOVA 4WLFA 1VJ1A 3VPFA 4ND3A 4BHTA 5EQFA 4BB5A 1RJWA 3AOGA 2J5KA 4ND5A 4R9SA 4BO8A 1E7WA 1F14A 5IZCC 4NFYA 3BAZA 4ZU3A 2RAFA 3BTOA 4YT2A 3RIHA 5TLSA 3K5PA 3CE6A 3DR3A 2VRBA 2PLAA 2QYTA 3AU9A 3BHMA 2Q1WA 1Q7CA 2E37A 1PJ2A 4GSKA 1ZEJA 4JJIA 2GZ1A 2YJZA 4IDAA 3S1LA 4N7RA 1DJQA 1J0XO 1SB9A 4FCCA 3QRWA 3QVTA 4R4JA 5A3VA 3KEOA 4L9RA 5TRTA 1LSSA 4FFRA 3TSCA 4JQCA 1NQ5A 4DXHA 3AU8A 3GPDG 2Q2WA 5EPOA 2Q3EA 4GPD1 1ZEMA 2Q45A 1HE2A 5I9MA 3NT5A 2AEFA 4GSLA 2EERA 4S1VA 3HNPA 2YDYA 3WSWA 4A26A 4MOWA 4TKLA 2PZLA 3GN2A 4P4LA 5ER6A 2ZCVA 2P68A 1SO8A 2AQHA 4Y67A 3P19A 2TMDA 1OI7A 3PHGA 3KYCB 5L7WA 3ZNOA 4XB1A 4YVFA 3MZ0A 4DLBA 4CM5A 4FN4A 4MP8A 1MV8A 1GR0A 4IM7A 4QECA 2DTDA 2ZB3A 2CMDA 2OBNA 1V3VA 1IL0A 3DZFA 5I7EA 1GCOA 1KVSA 2DFDA 1X15A 3N58A 2O2YA 4MVJI 3NTQA 3ITKA 4CM8B 3L77A 1X1TA 2CF6A 4L76A 3PK0A 5JAZA 5JMWA 2WD8A 3NGLA 5JMPA 4HP8A 4IMPA 1GDHA 4RPKA 2A92A 3VPSA 2EJVA 3NTOA 4PGFA 4UEOA 1YDEA 3JQFC 4RL6A 2D8AA 4RVHA 5HRUA 4HX5A 4ILKA 2NNLD 1PWXA 2HK8A 1HDRA 4RVFA 2D0IA 5G4KB 4CUZA 4GBJA 1B3RA 1K0UA 3QV1A 5DP1A 4RF4A 3STHA 3AY3A 1OBFO 4NU6A 5COQA 3IP1A 4PG7A 5L4NA 3JQ9A 2X5KO 4PG5A 4OYRA 4OSOA 2D4AA 3RJ5A 4BIIA 2NU7A 3ZV6A 3NT4A 4EI2A 5CEEA 3DAPA 4DYVA 1YONA 4WEQA 3C1AA 3WFJA 3I23A 3AI3A 5B4VA 1CQIA 1VSUA 4RF2A 3FNFA 1DB3A 1UJMA 1U1IA 3E48A 1GV1A 4AJEA 2HMUA 1BG6A 1AUPA 1GUFA 3ZWMA 5L7TA 3SXPA 3TFQA 1I5RA 1Z82A 1V6AA 2CDBA 1PIWA 5DCWA 3DAFA 4S3MA 2CVQA 4TVBA 1NFQA 4FGSA 4NR0A 3PWKA 1LDGA 3ZWWA 5AXDA 3PIDA 4OKNA 3PGJA 3FNEA 5B12A 1DIBA 2UUPA 4XYGA 3ZHYA 2HO5A 3DBRA 1M6WA 1WPQA 3IUSA 2YW9A 4BO3A 1Y9AA 4FJ1A 4M87A 3INRA 4GI2A 5TSDA 1HDGO 4ZRMA 1M66A 3KXDA 1PJTA 2Q1SA 4YAJA 2IEDA 5F21A 1O9BA 1TLTA 4D3DA 3RQSA 4J16A 3ZHZA 4FIZA 3QVSA 2IZZA 3IUPA 2B37A 3F9IA 3G17A 1ONNA 1UP6A 4CMGA 4P4NA 3T7CA 3DDNA 2JAPA 1XWFA 2BF7A 1T1RA 3FD8A 2RIRA 4E0BA 4AJNA 1LRJA 1GYRA 5MGBA 1SNYA 1ZBQA 4DC0A 2PKQO 3LT1A 5H82A 5KVSA 3MJVA 3RUHA 4J43A 3Q11A 1DXYA 2BD0A 2XF8A 4O59O 1GV0A 1IB6A 3GLQA 2FPIA 2B69A 4W82A 1A9ZA 2YHIA 2RHCA 4J9VA 4NBVA 4XWYA 3DHEA 4Y6SA 3JD1A 1PGQA 1GQQA 3AY6A 1HDYA 1N5DA 4JROA 4BO9A 1R66A 3BMQB 3H5NA 2VNAA 3NJ4A 2PFGA 1NASA 1BDMA 1VRWA 1O89A 4OOEA 2X9VA 3V1TC 1JVBA 1DFGA 3OEWA 1B8UA 5BNFA 2EKQA 4J3FA 3DZGA 1UH5A 2X4GA 5U1PA 3RWBA 2XPCA 3EVNA 1U3WA 1WXDA 4I08A 3Q3CA 1I8TA 4GWKA 4EUFA 3C1TA 2PZJA 1HL3A 1XCBA 2B4RO 4ZHSA 2Q2QA 5JFOA 1C1DA 3AJRA 1VC2A 3HG7A 4IDEA 4IJKA 2DBVO 3VZRA 1P31A 3EZYA 1JKFA 4JP2A 4PLTA 1F17A 4HFRA 3F47A 1E3IA 4OXYA 5IDYA 4B7XA 3A14A 3KYCA 3L6OO 4WASA 1U3TA 2D59A 3VKUA 4CUJA 5JNLA 3ADOA 1CEQA 4DQVA 5F1KA 4BNZA 3PJDA 3HDHA 5JSFA 1IPFA 4R9RA 4GX5A 4ESOA 1EQ2A 2FZWA 5G0UA 2EXXA 4FGWA 3NGXA 1Q0HA 4CM8A 1FDTA 1HLDA 1TA4A 4CLRB 1YE3A 4H7PA 4J2HA 1E3JA 3JD4A 3PWZA 4J1SA 4CLOA 4W6ZA 1EUZA 2EGGA 4TRMA 1X13A 3GNQA 4IPTA 1UXHA 3LLVA 2Y0EA 1MC5A 1ZO8A 5CDSA 3ICCA 4CQLA 2PY6A 4RCVA 4PLZA 4CMAA 2X8LA 5JCJA 1QYCA 3OJEA 1X0XA 1TT5B 3NRCA 5KNLA 1EBUA 5L40A 3I6IA 5FEUA 4Z0PA 1SPXA 4E12A 1UZLA 3WGQA 1P44A 3GZNB 2WDZA 2IXBA 4RLHA 3RKRA 1NWHA 4K6FA 3NEPX 3O9ZA 1E6UA 2Y93A 4K26A 4IUYA 1ISHA 1JDJA 4GX2A 2ZB4A 1YB4A 3BMQA 4R01A 1B15A 4E3ZA 3DONA 4ALNA 3F1KA 1LNQA 2YFQA 4BNYA 2AQKA 4PCVA 4UVGA 1FXSA 3GAZA 5KKCA 2BFPA 3V2GA 2VNSA 3Q9UA 5GMOA 4NU5A 5CG2A 3CMMA 1MXHA 1ZK3A 3OP4A 4R51A 4CLDA 6LDHA 1P1JA 4MVJA 3GHHA 5B4UA 4AL4A 4LVUA 4DA9A 4BKRA 3GGPA 4RO0A 4M89A 5KJEA 3ZZNA 1M75A 3UCFA 1QMGA 3AI2A 4DQXA 3FR8A 2JJYA 3ZN2A 3FPCA 5JYDA 1MA0A 2RHRA 4ZICA 2DKNA 3GZNA 3I1JA 4OH1A 3UUWA 4RORA 1I3MA 3O8QB 4N5MA 4JNKA 1DC5A 2UDPA 2B0JA 5KOIA 4LVCA 4A03A 1S6YA 3H9GA 4LGVA 3TZHA 2C5EA 4NQZA 2VZ8A 1P0CA 2Y1OA 3T4XA 1V0JA 1VM6A 5I8ZA 3RC2A 1MG5A 2FP4A 2PR2A 3G0OA 4L0QA 1HZZA 2V6GA 3TN7A 4B8WA 4CJXA 1E3WB 3MTJA 3TDKA 4O6VA 4NFSA 2LDXA 1I01A 2QX7A 3CZRA 3GGGA 4DRYA 2Q4EA 1NQOA 3H5AA 3WLEA 4AFNA 3GK3A 2C54A 4DLLA 4PFJA 1CRWG 3RFXA 2E4AA 1FDVA 2R6JA 4J0EA 2VHZA 2O3RA 4YJDA 3D3WB 5K6AA 4K6CA 2IZ0A 1LQTA 1TI7A 1YOVA 2GPTA 5FYDA 4KOAA 2DC1A 5HS6A 4XYBA 5IJZA 3AFNA 4MIEA 2B35A 1A4UA 5DOZA 3U4IA 2ZYGA 3IC5A 3LF2A 4IMRA 1IOLA 2AE2A 1TXGA 2OOSA 3EC7A 4IBOA 5A06A 3DOCA 4JX8A 3JQCA 4DUPA 1PU2A 1BHSA 1TEHA 4RPHA 1LUAA 1GEGA 4OQZA 3DO5A 4PVCA 1U7HA 3RUEA 4Z0TA 1QV6A 3H8VA 4NBUA 4EJ0A 2F1KA 4CM9D 3G49A 4MKRA 5JXWA 3ZV4A 1CF2O 3BZUA 2W2LA 3PPIA 2NM0A 1T2CA 4I5EA 1K6IA 2X7HA 3U09A 2EIHA 1D8AA 3GDFA 1L1FA 3RBXA 3GNTA 1ONOA 2DLDA 3V2UA 4U8GA 3S2IA 1P0FA 3MOGA 4X54A 4ZVVA 5ENDA 4D0SA 3WNVA 1ZH8A 3WQQA 4IZIA 3QW2A 5GZ3A 5LC1A 4DPLA 2O48X 3C1OA 1AHIA 4IJUA 3F3SA 2C2XA 3I3OA 4AG3A 1GZ4A 3SLGA 1VL0A 3O8QA 2JCYA 4YQYA 5T57A 5DNAA 3GF4A 3KLPX 5FFFA 1FDUA 3BTUA 4WOJA 4YXFA 2C29D 4TZTA 4FPXA 2AA3A 3TFOA 3TNLA 4CMEA 3FF4A 2VYVA 3FN4A 1N8KA 5BSFA 3PLNA 3FTNA 3DC2A 3INTA 1AE1A 2VZ0A 4AJLA 1PGPA 1KVQA 3EMKA 4PN3A 4J4BA 4ZQFA 5BT9A 1D7OA 1V3TA 1B2LA 1PTJA 1TT7A 2X0NA 3GMSA 5A02A 2BHLA 4IDFA 5A9TA 2D5CA 5I7FA 2QRLA 4KMSA 4XYMA 4YJHB 1KVRA 4B4UA 1B26A 1I33A 4QX6A 4RDIA 1FJHA 1N9GA 1BXZA 1OC4A 4JBGA 3GDGA 2NADA 1A27A 5KTKA 3U5TA 1OMOA 5F5LA 3PDUA 3DAGA 2GN4A 1E5LA 4YRAA 3BMCA 4RZIA 4BO2A 1E7QA 3KSDO 1QKIA 1GL3A 1HE3A 3I6QA 2PTGA 4CM4B 2JFGA 4D45A 1N2SA 4PZEA 1GUYA 3ZI0A 1HXHA 1N1EA 2Y05A 4L4RA 4XX0A 4OL9A 4J9UE 2JD0A 3E18A 3BMNB 2AQ8A 2C5AA 1JQBA 5AVOA 4LRTB 2Y99A 4RPJA 1RM4A 2UAGA 1Z73A 3WBBA 4A7PA 3EUWA 2XXJA 4XDZA 3UCXA 5IN4A 1U3UA 1PJBA 2TMGA 5EMHA 3V2HA 1HT0A 5L45A 3HHPA 4MVJM 5L7YA 1I36A 3WYCA 3L6EA 1QYXA 3DTTA 3MOIA 1VKOA 4E5NA 5K6AC 1PZGA 3RUCA 5BNIA 2J5QA 3KYBA 1HSOA 2I5PO 2H1SA 4GX1A 4GKVA 1ZFNA 3TPCA 5JW6A 5HWSA 2AQIA 2EW8A 4HNHA 5CDTA 2NTVA 3QVWA 3GG2A 3UHAA 4AJJA 4YPOA 2NWQA 1Q2XA 1HDOA 1KVUA 3FRJA 4JLWA 3EW7A 4C7KA 4BKPA 1MFPA 4I5FA 1C0IA 1LJ8A 3M1LA 2JFFA 3T7EA 1YS4A 1P45A 4E2YA 1W73A 1DC4A 4ID9A 4WGGA 2JKVA 3KBOA 5L95A 7ADHA 3HADA 3O4RA 2O7SA 3GQVA 4A2CA 4BNNA 4EUHA 5TT1A 2EGHA 2PA3A 1T1SA 4DTIA 1F12A 4MO2A 3ZWYA 2ZTUA 1PJQA 3HB4X 4PLYA 4WECA 2QZ9A 3VH3A 3M2TA 1ISMA 4UVDA 3KTDA 3L4SO 4CMHA 3LT0A 3HJAA 1H93A 4UREA 1ZCJA 2VRCD 4D3FA 1MXFA 1LU9A 2VWHA 1IHYA 2J5RA 3A28A 4M54A 5EESA 5TX7A 1LC0A 2ZJ1A 1UP4A 3OJLA 4IGEA 3GY0A 4BNXA 3ZNQA 1MGOA 1E7YA 1HYEA 2GERA 1DRVA 5F1OA 4LCEA 3PJFA 1G1AA 4PG8A 3WICA 3JCZA 4PVDA 3LVFO 4TMFA 2XXBA 1T2FA 1J49A 1E92A 3OQ1A 4DMLA 3DZBA 4UUOA 5DULA 3TF5A 1SCUA 1C0PA 1KEUA 2Q4BA 3H7AA 4HFMA 4QO8A 1Q1NA 1PS8A 2QRKA 4MIYA 4WLOA 4OO3A 3V1YA 3OICA 3CMCO 4KP7A 3ROKA 3BMNA 4EGFA 2YUTA 2GRAA 1BTOA 3OF2A 4GMGA 4WPGA 1Y6JA 2NVUA 3MJEA 2P4HX 4CM4A 1E3SA 1SAYA 4YR9A 3D64A 4BO5A 1AN9A 5TC4A 2NACA 3KM0A 3LC2O 2DPGA 1VJTA 1O94A 3VHRA 1PL7A 3UH1A 4B3IA 9LDTA 3PI7A 5KWEA 4UEKA 3H9QA 5DOVA 4DPKA 1IZ9A 3M2PA 5TF4A 4IJVA 3HSKA 3C7CB 1DBVO 5IDWA 3IOYA 3NUGA 4CL8A 3GNSA 5AXBA 3GT0A 2ZB7A 1ZXLA 4HBGA 2YYYA 1LEHA 4Y6PA 3E9QA 1NVGA 2O2SA 5AYVA 5HA5A 4D46A 1FDSA 4DIOA 2PV7A 3H4VA 4ROSA 2X0IA 1DAOA 4CODB 4PLHA 3UW3A 1O5IA 2O3TA 3M1AA 5THQA 1T24A 5KVQA 1HWYA 1DSSG 1PQPA 2BI8A 2D2IA 3UVEA 2FN7A 3CEAA 4JP3A 1YH3A 4CR6A 3SVTA 3WTBA 3EDMA 3ON5A 3RU7A 4AVYA 1EZ4A 2Y67A 3VTZA 4WE3A 5T8KA 3ZHXA 4GLLA 4CQMA 3RC9A 3WSVA 1HRDA 3RC1A 5KJCA 2NUAA 4G5HA 2OFPA 4BO6A 1T2AA 1UDAA 4R1UA 3WWZA 3W6UA 4AJHA 4YTEA 2C20A 5H83A 3P7MA 4CQMD 2AEMA 4GAEA 1GAEO 1BSVA 8ADHA 3RSHA 3WXBA 4BL5A 5L4SA 5HM8A 1PJ3A 2EKPA 2VWGA 4I5DA 1PZHA 3JQAA 4MINA 4N5NA 4Z9YA 3C8MA 1EVZA 5CPBA 1DHTA 1GYPA 4RQTA 3E6AA 4RV9A 4YRDA 1QYDA 5G0SA 1GZ6A 3ZW8A 4FJ2A 4QXMA 4EUEA 2FR0A 4II2A 4Q39A 2P2SA 3I52A 4EZBA 3BTVA 2VHYA 3NDJA 3WGOA 3LDHA 1UXKA 2FSSA 3OETA 2C07A 5TQVA 2X6TA 1WP4A 3G3EA 3K8ZA 1WMBA 4CM7A 2I76A 4I9UA 1UXGA 2YHUA 2EHDA 4D41A 3QWAA 2OO5A 3HFGA 4MPDA 1JVSA 4FOSA 3WJAA 2Y1EA 4KWHA 3CTMA 4Q3EA 3BA1A 1I3KA 4UULA 1HYGA 3M6IA 1JN0A 4DC1A 1XLTA 3GUCA 1UXIA 1WDLA 3KB6A 1R0LA 3CKYA 2GGSA 4IY1A 1ISJA 1Y8QB 3ENKA 3EVTA 4TRJA 4NJMA 1KYQA 1PJLA 4KTTE 3WQRA 3D7LA 3N7UA 1HLPA 3OJFA 4IS3A 5C5IA 3G79A 4R3WA 1XSEA 2EW2A 1LA2A 4B7UA 4B4WA 4NDNE 1GYQA 1NM5A 4MKZA 2Z1NA 3H65A 1XG5A 1ZSVA 2D1YA 4CR8A 4MVJP 5CFZA 3JQGA 4D42A 1EK5A 4TRNA 3RD5A 3KSZO 3FCOA 4XD2A 3DHYA 4BNIA 4CL3A 4NBWA 4PLVA 5TJHA 2VT2A 3FR7A 1DC6A 1UDBA 4DREA 3I9LA 5I9NA 1YWGO 2DM6A 1OOEA 2Q1UA 4W9NC 1DOHA 5A4DA 4BQRA 2X0JA 2ZKLA 1Y5MA 1N92A 3H6KA 3UKOA 2ZATA 1G6KA 1CDOA 3WYEA 1ENOA 2ZQYA 4FC7A 2NVBA 3TJRA 1H6BA 5EJ2A 3V1UA 4D7AA 2WWRA 1QP8A 3UAGA 4OXNA 4HFNA 4CM6A 4FSHA 2CVOA 4R5MA 3D4NA 1TB4A 3PLRA 1OFGA 3HDYA 4R3NA 3UOGA 1DFHA 1JKIA 2AG5A 4OHUA 3VH4A 2HK9A 3ETGA 3SBOA 1W8DA 3LK7A 4ZA2A 4BV8A 4I8XA 2OP0A 4YAIA 2ZYAA 3NTRA 2PD4A 1NQTA 4KTVE 4XYLA 3L4BC 2CUKA 2Q49A 1Z74A 4XR4A 3A9WA 4CLRA 4NBRA 5COBA 1ZVMA 2YV2A 1LBEA 3E82A 3KHUA 2GZ3A 1L7EA 2VYNA 1SC6A 3UCEA 4XCVA 2EP5A 4QFCA 5EN4A 2ZTLA 2VRCA 3PQEA 3WDSA 3WB9A 5KVCA 4HXYA 3HN7A 3L9XA 2HDHA 3SC6A 3SLKA 3GEDA 1VLLA 2P4QA 3PHJA 2IEBA 2BMAA 3U3XA 1LLQA 3N74A 4HFJA 3O03A 3FWNA 2ZK7A 1R0SA 4BNJA 3PFFA 3G1TA 3JQFA 4F6CA 1YB5A 2WE7A 4YEDA 2EEZA 1ENYA 2E48A 3ZU5A 2B5WA 1IUKA 1CETA 1R15A 1VE9A 1N7HA 3GC6A 1SOWA 2QYSA 3GVXA 4GVLA 3UICA 4RJTA 2OBYA 2VUTA 3ZWPA 3K9QO 1U28A 2D3TA 2OZPA 1Z7EA 3JQ9C 2YZ7A 1LC3A 4RZHA 1A7AA 2GN6A 5IFLA 2X1HA 3HE3A 1DIRA 3VZQA 1EK6A 1F06A 2ZCUA 3EZLA 3OIGA 1E3EA 3QWHA 4QT0A 4TROA 3VH2A 1CQJA 1YQGA 2C0CA 3GMDA 3ST7A 3QJ5A 2NVUB 3ROQA 1W4ZA 4PRLA 3GRKA 3WNQA 1H9AA 1KY4A 4AJOA 4ZN6A 3DMTA 2VZ9A 2Y0DA 4CMKA 3MWEB 4BKOA 5HTOA 1NWCA 3MCVA 4P8RA 3ZNNA 5T64A 1A9YA 4JCOA 4ZGWA 1SMKA 1GU7A 4XRGA 5AXAA 3QQPA 1IYZA 1FDWA 4KUHA 2DBZA 3ONEA 3PWSA 5BSGA 1E6WA 1GFSA 1I2ZA 1EVJA 3DB2A 5ITVA 1DO8A 1WAMA 4CMBA 4IIVA 1L7DA 3ADPA 4CMEC 4EBFA 4Y9DA 1B8PA 3U4CA 2AW5A 1WDMA 3QVXA 3K73O 1NR7A 3EYWA 4EJMA 3AOEC 5CDYA 5TT0A 1EVIA 4IINA 4W9NA 1KIFA 4A73A 4Q9NA 3RBVA 2X9GA 1H0KA 4LISA 3RU9A 2IYPA 2XOXA 3B20A 2ZYDA 3KZVA 2H5LA 4O1MA 4O0LA 5I8WA 1R0KA 1F0YA 1NR1A 4E5PA 2C7GA 2BFAA 2EJWA 3WMXA 4E33A 1EFLA 4CV2A 1GADO 3GUYA 5G4LA 5TNXA 1YRLA 1P9LA 3PGXA 2IXAA 3JD3A 2O3QA 3JQ8B 5FI3A 1BW9B 2HRBA 3MEQA 1YJ8A 4YJGA 1DHRA 5DBIA 4CQMB 4ND2A 1SEVA 4FDAA 1ZMTA 1QV7A 3D4OA 2UVDA 3TQHA 4RGBA 3TL2A 1YL6A 4PRKA 1LXCA 1U7TA 2O50A 3NV9A 3KETA 3WS7A 3SJ7A 1U8XX 4RF5A 1I2BA 2GN9A 4Q3BA 5KIAA 4HUJA 4Z3KA 1NHGA 4U0JA 1P1HA 4E6PA 4NK4A 2FR8A 3JQGB 1H6AA 4RVDA 1KS9A 1PL8A 3AM5A 3DBHB 5JCXA 4FFNA 3PYLA 2HU2A 4CR7A 5JY6A 1QYVA 1ZK1A 5A1TA 3I4FA 1DRWA 5G0VA 4DMMA 2UV8A 4MVJD 3WQSB 4BNWA 4CM3A 1K6XA 2W90A 1RM0A 1A4IA 2OGUA 2VYVD 3GZ4A 4BVAA 3G1UA 4CLHA 1WNTA 2FZEA 5IAAA 1HDZA 1XDWA 5JC8A 2P5UA 1O95A 5THKA 1I3NA 4I9HA 4IXTA 3K92A 5K0ZA 1EBFA 1K2WA 2VT3A 3ZU2A 3S8MA 2DUWA 1HE4A 1VL8A 3ANLA 4BNGA 3GVIA 4PLFA 4KDEA 4TSKA 4NK5A 1UAGA 3R1IA 4CLXA 4HV4A 4WLUA 3IMFA 3AUSA 1BXGA 2Q2VA 3DBLA 2A9FA 1X14A 2V65A 1TT5A 2GF2A 1AXEA 1PGJA 2VHWA 4J2OA 1Z75A 4IQ8A 1M6HA 2JCVA 3DMTC 2O23A 1M2WA 3HQ4O 4MP6A 2GDZA 1RPNA 1O0SA 1XELA 3F5SA 2JD2A 2ZTMA 3GA0A 4QTZA 1R4NA 1T4DA 5JO0A 4CMCA 1HTBA 2VN8A 1H94A 1OAAA 1SBYA 1BWSA 2GZ2A 3LC7O 2BGMA 4ALMA 4ZJUA 5F5NA 4BKUA 2FSVA 4KDFA 4TWRA 3ZV5A 5C7LO 1HE5A 4RVSA 1KY5A 1E3LA 1X7HA 1EEHA 3IAHA 5KKAA 1KEPA 4CV3A 1Q7BA 3K6JA 3DMYA 4OQYA 5K9ZA 1G0NA 4URFA 4FFLA 3CIFA 3IIEA 4GLOA 3RBZA 2JFHA 3V8BA 4YQZA 4ZD6A 1C0LA 5IN5A 1LRLA 1RWBA 2I3GA 3B1FA 1T2EA 1R16A 4QO7A 4L75A 1VL6A 4XQCA 4ZRNA 2Y1DA 4D3SA 4XIJA 3AUUA 1NVTA 2OMEA 3ROMA 3DFUA 3CH6A 5DF1A 4WNIA 2WYUA 3WTCA 4YB8A 1HYHA 2W4QA 5B1YA 2LDBA 3WGZA 1UAYA 2C2YA 3GVHA 5TS3A 4JBHA 2O3JA 5JC1A 1XA0A 1ZSNA 4FC6A 4PZCA 5A5EA 5BSEA 3F4BA 1HSZA 4IXWA 2HAEA 2VOJA 2GR9A 4BUCA 5ICSA 1T2DA 3VDQA 4LCJA 1GPJA 1I10A 1VKNA 3BTSA 3RKUA 1A71A 3B1KA 3FWZA 4OOFA 5EINA 1LSUA 3JQAB 4DQUA 3U0BA 5ES3A 1YKFA 4YA6A 1CYDA 4EEXA 1V8BA 5TGDA 3U49A 3ROPA 1R6DA 4EW6A 5DZSA 3PEFA 2HLPA 3Q0EA 2E82A 3VTFA 3D3WA 1F8GA 2I65A 3WIDA 1MP0A 4YBZA 2O4CA 2G1UA 4ZQBA 1XEAA 3AM3A 4AJ2A 5CDGA 1ZKMA 1ZK4A 4M49A 5EIOA 2PH3A 1JA9A 3B6ZA 1Y7TA 3X2EA 4BO4A 1ID1A 4Y8VA 5CEFA 4O63O 2IYOA 1YJQA 1YBMA 3ENNA 3SJUA 4WUVA 1H2HA 5JAMA 4II3A 3ULKA 2C7VA 1NHWA 2CD9A 3GR6A 1U4SA 2C59A 2GNAA 2OP1A 4BV9A 3IKTA 4DYDA 4GH5A 3GVCA 4YRBA 2JCXA 3WGYA 3OH8A 4CUKA 3JQ7B 4OGWA 5LCXA 4CQLB 3I83A 5ILOA 4ZQEA 3DZKA 3JYNA 4BS9A 1BVRA 4YJGB 2FOIA 3UF0A 3PZRA 2JHGA 1ONPA 4CLEA 3R6DA 4MVJF 2HJRA 1ZIDA 4E2WA 4BGVA 2ZTVA 4J90A 3SC4A 1P74A 3WIEA 3S2FA 4DL9A 1Z45A 4LMRA 2J6IA 4GGOA 3RAJA 2Z1MA 4N5LA 3TL3A 4IQ0A 1JWAB 2IZ1A 3E9MA 2Q46A 4P4GA 2PGJA 1JWBB 4NH4A 3JQ7A 1CWUA 3DZJA 1CERA 2UYYA 3VKVA 4N18A 3ZWXA 1E1LA 1NYTA 1E5QA 4R1SA 4ZQHA 1P33A 4UVEA 1C1DB 2PGDA 2VYND 2VOEA 4FS3A 2B36A 5IXSA 3CXRA 1ZJZA 4D44A 2WD7B 3C3XA 4E5YA 4ALJA 1PJSA 2WYWA 1Y8RA 5JE8A 3GN1A 4JIGA 1XU7A 2P5YA 2PD6A 4MDHA 5J23A 1ORRA 1ISGA 4UVIA 5JPIA 3OA0A 1PGOA 4H16A 4LSWA 3L6DA 3HDQA 2X5OA 4KWIA 4RPGA 3GAFA 4NJOA 4J4TA 3IJPA 5JDIA 1B8VA 4IDCA 2JL1A 4B4OA 1IULA 3W4KA 1SZJG 2W2KA 2WM3A 1X7GA 4MKXA 2VWPA 4ITUA 9LDBA 5CPFA 4A5OA 1DFIA 1ARZA 3MJCA 3QWBA 4Q3AA 4WLEA 3WLFA 1EDZA 4I9NA 5JDCC 3RCBA 3PQDA 4LRSB 5ILGA 1XIVA 2AMFA 2X58A 1YBAA 2FHSA 4O5OA 4CMIA 4AJ4A 4E5KA 4DLAA 2BRUA 3OHSX 1Q0QA 5L53A 2P9EA 3IP3A 2A4KA 2Y68A 2Y1CA 3PQFA 3S2EA 2GLXA 3GG9A 3BMOB 1UDCA 3OA2A 4BGEA 1E6EA 3PP8A 4ONEA 2J3IA 4WNCA 1E7SA 2V6MA 3VZPA 3L07A 1UP7A 3H2ZA 3EY4A 3B70A 2RBEA 3LYLA 1W0CA 2EWMA 4YACA 1MG0A 2H63A 3K31A 1O8CA 5F3RA 3HB5X 3E5RA 2WE8A 4U0KA 4WCDA 3VOSA 3I9JA 3ZWVA 5A9SB 1XQ1A 3ITDA 3RUFA 2Y1GA 5LDHA 2BGLA 1Y1PA 1NAIA 1PEDA 1HKUA 1C14A 4WEOA 4EYEA 1KBZA 4BNTA 4I1IA 1BGVA 2HSDA 1P3DA 3E8XA 2F00A 4MVJG 2V6BA 3JQ6A 4RLSA 4XA8A 5GY7A 5IG2A 3NDIA 2H6EA 1IPEA 4K9DA 1P1RA 1I32A 2NU8A 1M76A 1I30A 2VHVA 1RKXA 1V9LA 2PWZA 3DHNA 1MFZA 3WJ7A 3RUIA 1C0KA 3WGIA 2V6FA 3D3EA 3QA9A 3GEGA 4MVJE 4WJZA 2NLOA 4P38A 4E21A 1PQUA 2EKLA 3CSDA 1H6DA 3DBVO 4L74A 4OXKA 4RPLA 1NVMB 3OEYA 3CINA 2AE1A 4M86A 2OL4A 4UEJA 4R5HA 3WG9A 4FOOA 4Y6RA 3IJRA 2GUGA 1EUDA 1IE3A 1ZZEA 1QLJA 3Q9NA 4YCAA 2BKAA 1U5AA 3NX4A 4D43A 3JQDA 4ND1A 1NBOA 2QHXA 4ND4A 3K2BA 1C1XA 4R1NA 1H5QA 3C7DB 1UUFA 3ASVA 3WOHA 3INGA 1NX6A 1Y9EA 3X2FA 2IRWA 1IY8A 1MB4A 4XR9A 3RVDA 4KQWA 2W8ZA 4UUNA 3W1VA 3D1LA 5CP8A 1JAXA 4WLVA 3S55A 2GO1A 1LDEA 3VDRA 1GPDG 3HDJA 2QRJA 1X0VA 3ONDA 2OHXA 4XKJA 1DPGA 1XYGA 4OMUA 2B4QA 4Z9XA 4NNJA 2ZB8A 2DAPA 2VTDA 3OECA 5GZ1A 5A04A 3BMOA 4W99A 3F1LA 3KO8A 3SX2A 4EEZA 3OIDA 3NYWA 3T4EA 3VC7A 4J1TA 1VPDA 2AXQA 4GQAA 1CJCA 4CMIB 4RF3A 1I0ZA 2DUUA 4NFHA 4BNKA 1V3UA 2RH4A 5ICMA 4XDYA 2NSDA 3F4LA 4QQRA 2GCGA 3Q1LA 3AUTA 1AXGA 4J7XA 4LN1A 3PDJA 4BMNA 1FK8A 1P1IA 1EFKA 1JLLA 1LLUA 4LW8A 4M1QA 2IE0A 2OXIA 3GH3A 5C3MA 3PFWO 3IS3A 1F8FA 1ADGA 1ZW1A 3I9KA 3GDOA 2G82A 5ADHA 2PKQP 1MUUA 4XQ9A 1A7KA 1LLDA 4NHEA 1DC3A 5KVVA 4PLCA 4HY3A 1PJCA 2J3JA 4KUGA 4FW8A 4FB5A 2VHXA 2AEJA 1YL7A 1ULSA 1YBVA 2RCYA 5JDCA 4XQEA 4Z9FA 1XHLA 4QEDA 5A03A 1IHXA 1U5CA 3E9NA 4JXKA 1Y81A 5DCUA 3JYQA 1Z6ZA 4A10A 3JSAA 1K5HA 5DBFA 4CM9A 5A3JA 3W4IA 1ISIA 4B3JA 1R12A 1T26A 4L4SA 5AQ1A 2YHIB 1SB8A 3HFSA 2V7PA 1BVUA 1X1EA 3KLMX 5CHEA 2QZZA 3QHAA 5BNTA 4E13A 3GRPA 4WLNA 1GQ2A 2FPPA 3GOHA 3KSUA 1DLJA 1ZMOA 3GFGA 2R2GA 3JQEA 2HK7A 1KEVA 3UN1A 4FJ0A 1GCUA 2VQ3A 4IIUA 3QWIA 1Q0LA 3NKLA 4EJ6A 5C37A 1K6JA 5KJ6A 1ENZA 4UVHA 4KQXA 2CZCA 3FNHA 4RVUA 3EAGA 2A94A 3I9OA 1UXJA 3TOXA 4GL4A 1GD1O 4ALIA 3R3JA 4CLOB 1KERA 1PL6A 4IDGA 3ASUA 3Q2IA 2Y1FA 2CY0A 2FR1A 4FFOA 1SOVA 1B3BA 3V5NA 2IDZA 5DCYA 3LT4A 4BQPA 1J4AA 5A9SA 1XU9A 1HDCA 4YDRA 2HUNA 1EE2A 3MJSA 5JAIA 1TVEA 4J7UA 1GEEA 3D0OA 3DWFA 3DZIA 5G0WA 3DZHA 4YWJA 3ZGYA 5C7IO 4IS2A 3DL2A 4M55A 3I9NA 3E5MA 3ABIA 4J0FA 1U4OA 5COAA 4BKQA 2QW8A 3H9JA 3OBBA 4YJHA 4BNMA 4DBZA 1NPYA 2D5AA 1I3LA 4I5GA 1GY8A 4FD3A 4R16A 2H9IA 1QRRA 2R00A 2Y66A 1LSJA 3U9LA 4MIOA 2NQ8A 3W4JA 1BW9A 1K89A 5BR7A 3AM4A 1NQAO 4DVJA 1HZJA 1DIGA 3JYLA 3FSRA 5MDHA 2X22A 2FY8A 4NIMA 1R37A 3BMCB 4F6LA 1WWKA 3GHYA 3HZZA 4IDBA 2J3HA 3KOUA 3ZWAA 3ZNPA 2G0TA 4Q3CA 1UR5A 4XGIA 2WTBA 2Z95A 3DOJA 4G65A 1QYWA 1LDYA 4JJFA 1PR9A 4B79A 1HEUA 1QORA 1QG6A 2EP7A 1FF9A 1U2DA 3HN2A 1NNUA 3BHJA 5ENVA 5JS6A 3F5QA 5AXCA 1B16A 1BRMA 4INAA 1E7MA 2FPGA 1KOLA 4JK3A 4RVGA 2JD1A 3I4CA 2UUOA 3WMWA 1WVGA 5BSHA 3B1JA 1B0AA 1JKJA 5GZ6A 1ML3A 1IZ0A 4E2ZA 1YB1A 3RC7A 2QQ5A 4YT5A 1GUZA 1ZNQO 2OUIA 3A1NA 2HKIA 1NPTO 4MVJH 1BMDA 2WMDA 2POQX 3WYBA 4R41A 2PNFA 4JBIA 5JAQA 1LLCA 2AG8A 5JBIA 1S7CA 2YDXA 4C4OA 3JYPA 3KVOA 2W2LD 3L4BA 4E30A 3VZSA 1Z7BA 2I3AA 4R54A 5IZCA 2WJPA 4L73A 1C1XB 1LI4A 3AI1A 2G5CA 2PZKA 1G0OA 2SCUA 2YV3A 3COSA 1YO6A 1KVTA 4E4YA 3ICPA 3MJTA 1CIVA 4B8ZA 2DTEA 3H3FA 3QLJA 1RM5A 3LU1A 4BNLA 5JY1A 4L8VA 2J8ZA 1ZSYA 3JQAD 4PZDA 4E31A 1K3TA 4QUKA 4XRRA 3GEMA 1OC2A 1P77A 3KUXA 5DBGA 3OSUA 2ZJ0A 4B3HA 2HMVA 3TZCA 2PH5A 1LQUA 2P9CA 1JU9A 4YT8A 3FHLA 2WYVA 3Q6IA 3JYOA 2VCYA 3F6YA 4PG4A 1YVEI 5LDGA 5U4QA 5TJ9A 3OMLA 3H9UA 4GWGA 2DQ4A 2BFOA 4PLGA 5I7VA 3K2EA 4U7WA 1EVYA 3H2SA 1Y8RB 4J7CA 1YL5A 4F45A 2CFCA 4TRRA 1QR6A 3PIIA 1LRKA 2WSBA 2AHRA 4CPDA 5CG1A 4B7CA 2YFHA 2E6UX 1NFFA 3H9EO 1BDBA 4CV1A 2X5JO 2NQTA 4IQGA 5B4TA 3NT2A 1NPDA 4BB6A 1LTHR 3QIVA 3JQBC 2DBQA 3RFTA 3ZDFA 2YV1A 1DIHA 4DGSA 1KEWA 4AJIA 3PRJA 1A72A 2G76A 3ZU3A 3AK4A 1D3AA 2FRDA 3JQ8A 3DOOA 1WDKA 3LSYA 4J49A 4YJFA 2PKRA 3RJ9A 4Z3DA 3TZ6A 4AICA 2VWQA 5JDIC 1QXSA 4JN6B 2GN8A 3FBTA 3O26A 2DVMA 2DBRA 1PZFA 3KEQA 1RM3A 2OORA 3AY7A 4QSMA 3AOEA 2I6TA 2GASA 1H9BA 2B83A 5HS4A 1XKQA 2O4UX 5DN9A 1Q7GA 2C82A 2GD1O 4AJKA 4K1LA 1OZAA 3ZWBA 3IDSA 1VJ0A 1E0DA 4XYEA 1O6ZA 1YGYA 3TZKA 1PZEA 1V35A 4FR5A 3RROA 1DEHA 2BGKA 4LK3A 4NZ9A 1R4MA 4NG5A 2EG9A 2HJSA 4FBGA 4H3VA 3UXYA 4CV0A 3L0DA 1UZNA 3DBLB 4QFDA 2WD7A 1LDNA 1W6UA 1BXKA 3S2GA 2Q50A 1YOVB 3WWYA 1QLHA 3W8FA 4XJTA 3JD2A 4ALKA 3QY9A 2P91A 1I2CA 4WKGA 4PG6A 4W7IA 5ITWA 3RUDA 3KYDA 4AJ1A 2X9NA 1N9GB 3Q2KA 1YXMA 4M8SA 1LX6A 2X86A 1HF3A 3OJ0A 3GGOA 1T4BA 4C7JA 3CPSA 3PJEA 3LC1O 2B4TO 4Y98A 3TOZA 3ZH2A 1XGKA 3A4VA 4N54A 3MJ4A 1DRUA 1QSGA 3A06A 1YQXA 5KJ1A 3ZWNA 4YYZA 4D0RA 3VPHA 1R4MB 3EHEA 1BXGB 3D5QA 1UZMA 3WFIA 1EQUA 1X7DA 1RYDA 5A9RA 1ADBA 3FNGA 3LZ6A 4R1TA 3TWOA 4GKBA 4OAQA 4PLPA 4R69A 3D4PA 4XGKA 2BH9A 1P1KA 4WCFC 3RI3A 4F46A 3NJ8A 3WX0A 2NTNA 4IGFA 4F3YA 5HBRA 2A35A 4XJSA 1EUCA 4BGIA 2ZIZA 4J91A 3K96A 3WR5A 3ZHBA 4BO0A 4YJFB 4OSPA 4GX0A 5T67A 4AJPA 3NDRA 3K30A 5L3ZA 1KC3A 3R0IA 1NP3A 2PGLA 4BMVA 2PD3A 2ET6A 2CNBA 4Z0HO 2DPHA 2FWMX 3D5TA 3ANMA 2BI7A 5U9CA 2CDCA 3WGHA 1E7RA 5IF3A 2X0RA 1XQ6A 3FPLA 1GZ3A 3QSGA 3LLSA 1AGNA 2I99A 3UFXA 1J6UA 1NAHA 2YQ4A 1D1TA 3LT2A 2DU8A 3GVPA 1AHHA 1YDWA 3C85A 3WGTA 3ZWCA 3KYDB 3JQBA 4IJWA 4G2NA 1U8FO 1M67A 1N1GA 4DPMA 3DBRB 5FWNA 1RYEA 2XAAA 3P2OA 4FQ8A 3PVZA 3QWFA 3UGKA 2G17A 1B14A 1JTVA 1U2GA 2WEKA 2NV6A 2W2KB 5IZ4A 3DQPA 4WCFB 4Q3DA 3H3JA 4CMJA 4IZHA 4DIFA 2DTXA 5G2OA 4BO1A 1EE9A 1PR3A 3ZCXA 1MX3A 2J3KA 2GSDA 4HADA 4IDDA 5JO9A 1J5PA 1WW8A 3CUKA 4MP3A 4BO7A 4FFMA 5CAEA 3PYMA 1E77A 5A5FA 3HWRA 1I24A 1EDOA 3DBHA 2CF5A 3MWDB 2VUSA 3QVOA 3OM9A 4KUEA 3WBFA 1E3WA 4P22A 2Y0CA 1C3VA 4Z6KA 4NMHA 3PYXA 3AUAA 4B4VA 4D79A 3O38A 3HUDA 1ZUD1 3TRIA 2Q1TA 3BXXA 3JV7A 4BOYA 4UUPA 3DFZA 5H81A 2BLLA 1MLDA 4L4XA 4TZKA 4E2XA 2PZMA 2I9PA 1D4FA 2ILTA 1KETA 2YQ5A 4XIYA 4U6SA 4YAEA 5F1PA 5C7OO 2VTEA 3NAQA 4UAGA 2B5VA 2HMTA 2NTJA 1LDMA 3GPIA 5T6BA 4OJNA 2ZQZA 4EITA 3W6ZA 1ADCA 4E5MA 4NI5A 4GVXA 1EMDA 1H6CA 1VI2A 2FMUA 3U4HA 1GQYA 1B7GO 1VSVA 3ANNA 4HWKA 2HRZA 2PK3A 2Z5LA 1KC1A 1NFRA 1DLIA 1ULUA 5L9AA 3P5SA 3OQ6A 3QE3A 3WGGA 3ZU4A 4BNFA 3DXFA 5G4KA 3ETEA 4ZQGA 4RQUA 3FTPA 1WLYA 3LF1A 4GMFA 1LSOA 6ADHA 5A05A 1PS0A 1H2BA
chains in the Genus database with same CATH superfamily
5DRYA 5EXXA 1N5RA 4PLWA 1RHJA 4JC5A 5FI5A 3Q15C 3NC1C 2G9ZA 4HTFA 4AMGA 4J1NA 2PLNA 2YBEA 3GCZA 2C00A 3AP1A 3KD3A 3R0VA 3FCXA 4UDNA 4IJMA 1KDPA 1VPVA 2NN3C 5DNUA 5K3FA 1TFUA 1Y8QA 4JXXA 2BF4A 1BDHA 1X87A 4D1YA 3OUUA 2GN1A 1OFVA 2QG9A 3MQFA 4EUKA 4PIVA 4PR3A 3ADBA 4F3KA 1ISFA 1UMDB 4ASUD 4G0NA 1OKKA 4TTSA 4WOKA 3IODA 4LV5B 4XQGA 1N5KA 1NW7A 1YKSA 2R6CA 3M6LA 4LJYA 4WY8A 5IJXA 3UK7A 1SEPA 4DA0A 4G9BA 1VLVA 4DNFA 4QBIA 4BBAA 3EH2A 3JATA 4JAVC 1BE0A 4C0QC 2QPLA 2BL4A 2QJFA 3N5KA 3I3SR 1EFVB 1MHPA 4JOSA 5JARA 1YFLA 2RJ3A 4G1BA 4KMRA 5HM6A 2ZSAA 2AKEA 5K3BA 1YB2A 5TIIA 5IAJA 2O3SA 2J07A 4L4ZA 4DMRA 2GFHA 5G41A 3X1XA 2ATCA 5JOQA 1P61B 1XQYA 2YXBA 5F2OA 4I1OA 4NEGA 3RASA 4EJSA 1PX0A 4IX1A 2QMZA 4Z1OA 2FFHA 5K0NA 5P21A 1Y5RA 4NJMB 3TK1A 4O4JA 2YY7A 1NTOA 2R8YA 5CNMA 3RAPR 3U0VA 2H4YA 2CDAA 4X24A 3SEZA 2VUUA 3U44A 3HMQA 3NNNA 1DXQA 4JZYA 1JFRA 3F46A 3FH0A 2GWRA 3WOVA 5I4KA 3FNRA 2IYFA 4X1YB 1UMBB 5JHGB 3KG2A 5JCJD 1EP3B 1X80A 4LYAA 1NXQA 2HQ1A 3R7FA 4ATNA 3ERCA 3R7SA 2XGJA 3MWGA 4BU1A 3ZW9A 1NQVA 3ND7A 4C07A 2KLHA 3E1KA 5BP7A 4R68A 4YRQA 2XT9A 2NVWA 3AUYA 4C0JA 1YIAA 2OFXA 3U39A 1E2JA 2CXQA 4R40A 3U4DA 4WHMA 1OYWA 4H7FA 3ZCUA 3PZBA 3QELB 4NL4H 4XSVA 2HMSA 3EFBA 2HLHA 2OLKA 4J1QA 4ZP1A 4E2FA 1FC0A 5I9LA 5IKXA 1E1KA 1GQFA 4LSZA 2JHFA 5EERA 4DR3B 5KO2A 3N07A 3PHIA 4HWPA 2JAHA 4M0KA 4QOGA 4B7ZA 4BMSA 5L4LA 3H99A 4GGMX 4DZZA 3IL2A 4HX9A 3H2BA 3L7LA 2JLCA 1IZ8A 3L0IB 4W1RA 4AZ3B 4MZDA 3C24A 4OM8A 3H86A 2YOHA 4K28A 4JGBA 4I19A 2HNBA 4KACA 5JXHA 1JEOA 1L7MA 4A0SA 1QPBA 1DAFA 4U2DA 3IUNA 4R1PA 4AN1A 2IVZA 4K88A 3R5FA 1DAIA 2ZR7A 2X23A 4B48A 3KSMA 5B37A 1J0BA 4WOBA 3VH1A 4EPRA 2RE8A 4ZVSA 3AFMA 1VMKA 3MILA 4M8IA 2RGGA 4G1VA 3CEPB 2I34A 3RYCB 3ZQUA 2GAFA 4ZCPA 4ETWA 1REQA 4GUAA 4FB4A 3NIGB 5ICFA 3T95A 1DAPA 2O3UA 4KSYA 2OO5C 4JUAA 4F4IA 2R4QA 3HMKA 4ERXA 1M1YB 4ENVA 1U3CA 2WIJA 1BU8A 3CZMA 3EK2A 4PYIA 1DIAA 1UK9A 1PWZA 4L5AA 1F6WA 2BFMA 5KJFA 1XZFA 2C5HA 3E2PA 3INNA 3MOSA 4J6EA 2NU9A 2XCQA 2QVZX 3H3XA 3EZXA 3EGOA 1FW8A 1G6HA 2GYYA 2OB2A 3JS5A 4XB2A 5AOVA 4FYMA 4WLFA 3OWHA 2KSQA 2RKBA 2YH2A 4ND3A 3VPFA 4BHTA 5EQFA 4AECA 2OQ2A 4BLPA 3AOGA 3O9VA 3T1YB 2WFAA 1BEUB 1F14A 3O82A 5IZCC 1N9ZA 4QOJA 4I2NA 4NFYA 3ZY2A 4KXLA 4ZU3A 1TIPA 2RAFA 4U9HS 1POWA 3ZXSA 1YCFA 1C9YA 1LPMA 1G2QA 4HMOA 1J0CA 3RIHA 2C3YA 3KVVA 3ZDAA 4I4CA 3AU9A 3BHMA 4L7QA 5KX5B 3G0IA 2I4NA 2ERYA 2N3ZA 3ZD8A 5KQSA 2AOTA 3ZIAD 4GSKA 4J0DA 4I1UA 2QGZA 2F6RA 4G0QA 2YJZA 4IDAA 4UM9D 3SKXA 2CUNA 4TUYF 4N7RA 3SG0A 3FGPA 1J0XO 2Q29A 3STVA 2C2GA 4L9RA 5HQ3A 3P45A 4FFRA 1ETHA 1ECJA 4JI0B 2EFHB 1G2OA 2A5JA 4B43A 1L3BA 1M8KA 3EWNA 5ESXA 5KHLB 3ISVA 3QK7A 4FYKA 2VS1A 3UJPA 2Q45A 3NT5A 2O2EA 1BJTA 1AKRA 1NJ8A 3L1VA 4ROTA 2ID7A 3ZLJA 1BHJA 1GQSA 5A0TA 5JPDA 2XUQA 3RJTA 4LY3A 3PV0A 5DYTA 1U5BB 1WPXA 4IHJA 4QHYA 1SVKA 4A26A 4QT4A 4TKLA 4P4LA 2VYFA 3MWEA 1R00A 2G07A 5E2BA 5LYJB 4JI8B 3H16A 2AQHA 1WV0A 3CW2A 2IX3A 2BSXA 3A4TA 1JA1A 4XVCA 1L5FA 3E70C 3KYCB 3VR6H 5IT5A 1P4SA 2M6SA 1XNRB 3BGSA 1E2GA 3C3CA 4KQ2A 4KDCA 2J85A 5EP4A 5KHAA 3RG8A 3ZNOA 3PCXA 3VNVA 4JT2A 4MP8A 2B7BA 3AR2A 2XDAA 3PUKA 3OU6A 4MW2A 4NDAA 3WYGA 2H5JA 2QZJA 3PA6A 4G1UC 2DTDA 5T4HA 3TOSA 4C2BA 2CMDA 2PRSA 3CZQA 2OBNA 1V3VA 3QMPA 4CFZA 4DIUA 5I7EA 3N58A 4PHGA 5FOXA 3NWJA 4AS3A 3OPMA 4OBEA 2ZJYA 3A0UA 3BEDA 1CUGA 3ITKA 4X91A 3TCNA 4BEVA 4C4PA 5A4FS 1X1TA 2ZZNA 1FLVA 2I3BA 4OHVA 2YXDA 4JQYA 2VSFA 2AF3C 2O2XA 2XB4A 4QVKA 1MVNA 1GPLA 4UE6A 4HNAA 2DQKA 2XSZA 3Q3JB 3RYIB 2A92A 2F3RA 5DM60 4GE0A 2EJVA 3TX6A 4N3NA 4RM2A 1H1LA 1YDEA 1RDFA 3EDOA 4EWLA 1AA6A 3B7GA 4AQYB 2A4MA 4ZYTA 2E4XA 2YRXA 2WU3A 2N9UA 1UFKA 5J5AA 3TVTA 2D0IA 4DA8A 3OZCA 4GBJA 1K0UA 2FX2A 4RF4A 4CKCB 5JRDS 3STHA 1GARA 4FYXA 1JHAA 2C5SA 5BNWA 2R9VA 3QG5A 2ZAIA 4JVNA 3BRQA 5COQA 2GZMA 2ZJ8A 5L4NA 5MFPA 4ZGGA 3G2IA 3EDQA 3O6VA 2Z1DA 3FUCA 2BEWA 2BKVA 1IBRA 2NU7A 1L5QA 5H4HA 4BIIA 3FMVA 3AY0A 4I81A 4EI2A 3LUJA 4HRVA 3TI7A 2EFEB 2O8EB 2H9YA 4L0DA 5D2CA 1V11A 1V7QA 4LVOA 2C42A 3LBYA 3UAZA 4NCAA 5HE8A 3AI3A 1E9VA 1CQIA 1KTVA 3MK31 3FNFA 3PLAE 1H2FA 2FP4B 4E15A 4Y2VA 3E48A 4BLQA 1KZ9A 5CVJA 1QZZA 2HMUA 3CW8X 3IIKA 3FSGD 1AUPA 1FYFA 4AXXA 4B81A 2QU8A 4Z9BA 2REQA 2Y1WA 1MZVA 3BGWA 3BM5A 3SSAA 3TR6A 4DSTA 5L7TA 4EENA 2M6KA 4R6XA 4ZJZA 1Z82A 3IESA 1GPKA 3TLKA 3A1TA 2O1WA 4S3MA 5CBKA 1BJRE 2ONCA 4N47A 3SQOA 1M10A 5JFGA 3PWKA 4HDKA 1T0IA 2ZPTX 3MTEA 1MVOA 4JDPA 3I28A 4X66B 3NAZA 2D2EA 4OKNA 5ALZA 5B12A 4IKPA 1XRRA 3FYHA 1M6WA 2AJTA 3I5UA 1KAQA 3CURA 1PLKA 4TKUA 4BO3A 1X9GA 2WZBA 3ZBPA 4FJ1A 4M87A 4GI2A 3GUUA 1JJFA 2L82A 2CC2A 2E1RA 5TSDA 1VLZA 3KXDA 1PJTA 5DGDA 2IEDA 4PZ9A 3KUCA 2CXHA 2V0NA 2OD9A 1V1RB 3MRXA 3RNLA 4IJ5A 4BUJA 2H17A 4J16A 3MUEA 4WXRA 4YUWA 3G88A 5GGYA 3WRWA 3RS5A 3F9IA 4QUIA 3FYDA 3QX7A 3ICWA 4P4NA 5FEMA 3DDNA 2JAPA 1WBBA 2JZOA 3A9SA 2Q4OA 2YMMA 3SYKA 1XKLA 4YMSA 3UFBA 1DKLA 4NCNA 1GYRA 5CLJA 2IUSA 1RWKA 2MHCA 1JV2B 2FW6A 2XHZA 3LBAA 3O4FA 1T3LA 5KVSA 1NSFA 2BHSA 3DOHA 4JJ8A 1AKMA 1PW5A 3FMIA 2BD0A 2XF8A 1C3LA 3SJZA 4EUSA 3DE3X 4LRXA 2Q3LA 1GV0A 5J40A 3GLQA 3KTAB 3NHSA 2ONKA 1ESDA 2ZIVB 5ESWA 3V7FA 3WP0A 5SY9A 3FFBA 3UPUA 1A9ZA 4NAUA 4C04A 2YHIA 4WRRA 1HZZC 1G3QA 2YZNA 3D2LA 4OGGA 3T5AA 1Y1SA 3DHEA 2HBRA 4Y6SA 3MT9A 2JIMA 5KTOA 1VDMA 1GQQA 3AY6A 5I9TA 2CMHA 1OLXB 2FPSA 1OZGA 4C7BA 4G9EA 1E2FA 4MV8A 5KOYA 1ZINA 2Y2VA 1SVSA 2VNAA 3NJ4A 4CKEB 5IFKA 1P7YA 4KAAA 1JVBA 3M5PA 4EQZA 3QSYA 4P0PB 1B8UA 5BNFA 3RWBA 5U1PA 4R1OA 3EVNA 2EDAA 3OT5A 2QVLA 4BWFB 3AVVA 4Y6LA 1URPA 2Q3HA 4MHOA 3SIXA 1QPZA 1YS1X 5DGHA 1ZM9A 4NYJQ 3O5AA 4LQDA 3HRIA 5JFOA 2QN9A 4NRDA 1IWBB 1C1DA 1OXTA 3AJRA 1P2DA 3D7KA 3DDWA 4OHBA 1BC5A 3VJMA 4IJKA 5CMLA 3IDZA 3W3AD 4CCYA 2CHUA 3ZWQA 5HRAA 3EZYA 3OAAA 5LXTB 2CFSA 4TPKA 2DUNA 2VQDA 4YIKA 4OMFG 3FHOA 1LI7A 3T7KA 1VG0B 1I7PA 1OREA 4OXYA 2VPXA 4B7XA 1UJ6A 1PG5A 2W2PA 1MB0A 3KYCA 4DLUA 1L5ZA 4UCFA 5D7NA 3R0JA 1U3TA 4XI9A 4E1AA 1XTTA 3UMGA 1IWPB 4DQVA 2O0MA 4RHTA 4JJ7A 3ANTA 3HU5A 4LV8B 7ABPA 2AI3A 4BNZA 2C0PA 1KFJB 3CRNA 1IPFA 3I6ZA 1FVHA 2MYPA 3BJZA 4R9RA 5A1JA 3K94A 1EQ2A 3KZMA 1I4LD 2PSHA 3KUUA 4FGWA 1NG1A 1BE6A 2EG5A 4RD3A 1FMJA 3NV7A 1DKUA 4FGZA 1FNCA 3BGIA 1FU4A 1VLMA 3NC4A 4QOEA 5C1PA 2CYAA 3SSNA 1ZN9A 2GPNA 2ODBA 3PWZA 4NFLA 4CLOA 4K3UA 5LJIA 1CY0A 1XZPA 1A04A 4Q1VA 1EUZA 3WLRA 2OZEA 1RS0A 1VKRA 3GNQA 3B51X 1UXHA 1NW8A 2FSVC 4US2R 4RGVA 1ZO8A 4A23A 3TJZA 3N2IA 1V16B 1BX1A 4FINA 5JYCA 3BGVA 3G7SA 2ORYA 2YWJA 4RCVA 1XXHB 2QXUA 4CMAA 2IY8A 2HCBA 4W5RA 4RBNA 3OJEA 4KAXA 2AF4C 2B0CA 1TT5B 3BDIA 2ERCA 1X19A 3A2LA 4HMPA 2WYHA 3PQCA 3U1TA 4MW1A 3ZV7A 5FEUA 3BIJA 5KINB 2JPDA 4HDQB 5F9HA 1Y4UA 4FDMA 4QHSA 3OZBA 1U2QA 4MQEB 2WDZA 2JEZA 1JT2A 3K32A 2AN9A 4RLHA 3RKRA 1C3JA 4G4GA 5I7WA 3Q8KA 3GLGB 2XCIA 4RGQA 3ZKAA 3O9ZA 2Y93A 3PIRA 1TPZA 4NBLA 1JDJA 1MEEA 4GX2A 2L18A 3QE0A 5HMMA 1NNSA 2AR9A 3DONA 4MYTA 3KCNA 3VSDA 4D9MA 1OHHD 4RL4A 4CL0A 5F64A 4BNYA 4MCIA 2XA2A 1P91A 4KG7A 4G6ZA 4UVGA 1FXSA 3IERA 3NORA 221PA 2VJAA 4KX3A 5FOVA 5J2UF 5FUBA 5DM4A 3V2GA 2GTHA 1J70A 2P1DA 3IP9A 1L8OA 2ZULA 3CMMA 1MXHA 1I7NA 2P5TB 1JHDA 1VMIA 4FT4A 4ZREA 4BU0A 4D8TA 3N8KA 2IS4A 5IAOA 3TPFA 3HI4A 2FW7A 1T9AA 4QGBA 4WK2B 5KJEA 2JFVA 3T9EA 4CL2A 3UCFA 1QH9A 1MQ8B 3FR8A 2JJYA 2B7CA 1QH0A 3FPCA 5JYDA 1A8HA 1MA0A 3W2EA 3SYMA 1A0OA 2NO5A 3PWTA 4PF1A 4ZICA 3GZNA 2PQ0A 2W6JA 4IQ4A 3UUWA 1I7SB 2QMUA 4RORA 4X93A 3O8QB 3GLFE 3SBXA 2IEAA 3T1NA 4E7OA 4JNKA 1SVWA 1CUAA 2B0JA 5D85A 2PX2A 1WCYA 5FNVB 4ARZB 4U6NA 3T3MB 2A2ZA 3NAMA 2BMDA 3TZHA 2JLSA 2Z08A 2GCNA 2GD6A 3U4GA 3LFUA 4MWOA 4LA4A 1JJ7A 4AC9A 2Y1OA 3DVAB 1RKQA 2XUAA 1UMKA 1Y48E 3RC2A 3CNOA 2CUZA 3UOAB 5JZVA 4DTCA 3TI9A 4YRRA 1OB5A 2J9GA 1HZZA 4HWGA 3KTOA 1IQRA 3LLUA 2H07A 3MTJA 4LBVA 1CVIA 2WHRA 4HDCA 4TV9A 2AN3A 4D97A 1I01A 1MQAA 4WA7A 2WKWA 3IAFA 3TBKA 1P72A 3NHFA 2YRWA 2Q4EA 3ADDA 1AA9A 2R60A 1NQOA 1AN0A 1UMCA 3OFND 2C54A 2QV0A 1CRWG 1NKTA 2JZCA 4XD7A 3U3OA 3VR5D 1T5HX 4YJDA 1FDVA 3RFXA 3ZBTA 5B57C 2O3RA 4K6CA 5AKGA 3BWVA 2FFBA 2RONA 2GS9A 4CEHB 4H27A 1LQTA 2GPTA 2IYAA 3LG2A 4KOAA 1ACLA 1W85A 1O54A 2FX3A 1S2DA 2IEYA 6PFKA 5HKKD 1KDRA 5IJZA 3CVVA 3AFNA 4MIEA 3A2KA 1RRKA 2FZKA 2ZYGA 3IC5A 3KQVA 3LF2A 3FUVA 4NYMR 4FKMA 4OQDA 1IOVA 4RK7A 1YCDA 2AE2A 3TXXA 1Q19A 1WF3A 2OOSA 3LOUA 3ND9A 4JBYA 1ORIA 3JQCA 5A06A 5LQMA 1PU2A 3D8TA 4UCWA 4HWOA 1GEGA 1WG8A 2XUHA 2ZWMA 3ND8A 3DO5A 1I1OA 4G8BA 1H0SA 2QNIA 1SQ5A 3G5MA 4TKVA 1RJFA 5HG0A 4EJ0A 2HQBA 3OY2A 4MS3A 3KWLA 4XWOA 2IIQA 2FLWA 4MKRA 3ZHOA 3MWYW 4L5IA 3ZV4A 4C20A 3PPIA 1KMNA 2FYTA 2W2LA 2PM8A 4RKEA 4YP6A 3IR7A 1JX6A 4KRYA 1YVDA 3GLRA 1K6IA 1TM1E 2IFTA 3THRA 3DFFA 3L0YA 2YR0A 3I9FA 2EIHA 4W8GA 1D8AA 4D9HA 2IK8A 3HJBA 3L46A 1XCOA 2RB4A 3OQOA 3MOGA 4X54A 2SKEA 4QAQA 3AR5A 4KODA 1CVLA 1FTYA 2ODAA 1TTHA 5AKKA 1CTQA 4AF7A 1YIDA 521PA 1VMAA 4KO3S 4KK3A 5DTJA 5LC1A 2O48X 4DPLA 3F3SA 3IMCA 4YAFA 4YFVA 1GZ4A 3SLGA 3CF6R 2ABWA 5FTWA 1ZD2P 4DABA 1NOKA 4MA5A 5DNAA 4ZMRA 3AV0B 1OI3A 3AUJB 1EI9A 5AIAA 5FFFA 1OT3A 2Z9BA 2J4CA 4TZTA 3PRHA 4IDQA 4AUEA 1O94C 4GZMA 3TM4A 4C06A 4HATA 3WYFA 1BEEA 3FF4A 3EA5A 3O93A 3AKZA 5BSFA 2W2MA 3PLNA 3ORYA 3DC2A 2OQRA 3TGPA 2VZ0A 4AJLA 4BMOB 1HFEL 1PGPA 2QUHA 1F3OA 2IHTA 3LAWA 5B6PA 5I5GA 5BR4A 3AEKB 4ZQFA 2E4VA 5BT9A 3RVQA 2O54A 1TT7A 3GMSA 3VKGA 3A2MA 4RESA 1KEEB 4DT1B 2VDPB 1B0UA 2FZLA 1FTWA 4HLUA 4IDFA 4KE6A 4UATA 2J6HA 3ZG6A 4DEVA 4NZZA 4M8KA 4EMUA 2GXAA 4IGAA 5K0FA 5I9IA 3EEYA 4MA4A 1YU9A 4X7BA 4U7PB 1KVRA 1X74A 3FVRA 1Z88A 4ZPXA 2RFLA 4RDIA 2JFUA 4GP9A 1FRNA 4UQOA 4UFNA 1S2NA 4HGZA 4LZAA 4P3OA 1U04A 2RGNA 5CVUA 4RIFA 5F3WB 2WWIA 4HXGA 4IIFA 4TLAA 1DQPA 1OX5A 4EGQA 1E7QA 3IKLA 4QPPA 1U8CB 2OK8A 1GL3A 4WIAA 5LL6P 4QD3A 4NF2A 1R2QA 2QN6A 1N1EA 1TZBA 1UKEA 2FAXA 2AG1A 2Y05A 3SLRA 1AOXA 1N25A 4OLFA 1RQXA 3JVVA 3OX4A 3E18A 5KNBH 2HMAA 1C9KA 2VXYA 3MM4A 4ZODA 5JUWA 3ZE2B 1JR3E 3KQTA 1W36B 1RM4A 3C3BA 3KKOA 5HK9A 3RT7A 3BCRA 1WVMA 3LY8A 4ZVNA 2PT5A 3DYVA 4ZO7A 5E9JA 3GLKA 1P7ZA 3GJ4A 4Z7QB 1VE3A 5EMHA 3UGQA 1QFSA 4MW0A 3BGOS 3HWWA 5L45A 4RPIA 1XL1A 4BP3A 1SKBA 1Z8DA 1PZMA 1A8SA 1HBJA 5J1TB 3P2KA 1QYXA 5HUQA 2XNJA 3ZGXA 3EGEA 4MYUA 4TKUB 3RUCA 4ZEXA 3TUJC 5K6AC 4GX1A 5TF0A 2I5PO 3JRXA 3HRHA 1ZFNA 5C4MA 1P2GA 2PS0A 3JWJA 3VVMA 1RQ2A 3EPKA 2AQIA 4HNHA 2YJ6A 1WHTB 4CTKA 3EIQA 3QVWA 4N49A 2R6FA 4JUDX 4FM9A 3EW9A 3THWB 2C57A 3DDHA 3ENVA 2XT0A 2NWQA 2OCYC 1HDOA 3A4MA 2BOVA 2OAEA 3FRJA 4C7KA 2D6FA 1MZPA 4WOPA 3IXLA 1C0IA 3AEXA 4JLNA 2JLZA 1TZCA 2FPMA 1UL1X 5K8CA 2BSAA 1HNXB 3EEBA 2W6NA 4MQ4A 5EMNA 5BYAA 2GO7A 3MT8A 2FPKA 3WWPA 4ID9A 2HHHB 2DHQA 4QJ5A 3KBOA 1RIIA 5L95A 4H6WA 3HADA 4MWCA 4P6VF 3UTCA 3UB4A 1YTLA 1UFVA 2EGHA 3NTXA 2PX4A 2QM8A 4FZ3A 2OMKA 3T5DA 1F0PA 2P7IA 3N75A 2WU8A 1JF8A 2OCIA 3ZWYA 1M6NA 2ZTUA 2IKQA 2UZ1B 1ZM4A 1GGEA 3OU7A 3DNFA 2HX1A 4PSKA 4PLYA 4WECA 2SBTA 4HUQB 1ORDA 3T3HA 3X1MA 1SD1A 4B80A 1MD9A 3M2TA 1Z0AA 2AS0A 4UVDA 2Q0QA 1ESZA 2C4HA 2KBFA 3L4SO 1WPRA 3LT0A 3HA7A 1L2TA 1Z6PA 2J1LA 3MGGA 4HN4B 4O25A 4UREA 5HKBA 3CO5A 4QOIA 3AWIA 3B6JA 1AGXA 2QAGB 2VWHA 2W2QA 4ARAA 4J76A 4BRZA 4C3UA 2P0YA 3AIKA 4C1BA 5AJHA 1R9MA 3L7AA 5TX7A 1LC0A 1UP4A 3Q3GE 3KELA 3UV7A 4BNXA 1X1DA 1E1YA 3ZNQA 4TXHA 5KKNB 4N82A 3KVRA 4M3NA 1HYEA 1J09A 1IUOA 2F3SA 1IRIA 3UHFA 1AKEA 1CU1A 2WMOB 3WICA 4TMFA 4U9IS 4PGHA 1J49A 2QUZA 3QLEA 4R0NA 4UNPA 5HF5A 2DETA 3MWJA 4BBJA 1BGWA 2W6OA 4LYDA 2WWHA 3H7AA 1CQXA 4RD6A 3EZ9A 4E88A 3OICA 2FF5A 5FO0A 5C46F 1MT0A 3OKAA 2GLTA 5AJZA 1ZRSA 4BZXA 1GWNA 2QAJA 3FYCA 2ZAOA 3Q7TA 4DMHA 4BE4A 1ZJ6A 3I2KA 5I7RA 1EGQA 3CRMA 10MHA 1AZWA 3DULA 5FP0A 4CM4A 5FH9A 5HJ7A 1TKCA 1E3SA 5YASA 3ZW7A 1G9TA 4BX8A 4G85A 1DAGA 1M5TA 2ACEA 2VXOA 5IKOA 3P9CA 1KPGA 1R74A 2X8JA 2GHTA 2MYUA 3QITA 3BH0A 4LHSA 2JI8A 2NXNA 2QAIA 2QL9A 5CA0A 3S44A 4EG8A 3MJDA 3GA7A 2A1UA 5L3RA 1Q0SA 2XZPA 3L8MA 3TEFA 3IMEA 1F0NA 2I2FA 1V6SA 4KHZA 3O0DA 4UEKA 3TKAA 3OT1B 5JLJA 2HO4A 3S2ZA 5MGNA 1BS9A 1YHNA 2J67A 4QFBA 3FZYA 4D81A 2A58A 5JS8A 3NUGA 1JAIA 4G07A 2UXBB 4LF7B 1T4CA 5AXBA 4BN0A 2R0QC 1K3FA 2VJPA 2GWHA 1ORHA 5AVVA 4AN4A 1UM9B 2OOKA 4XWWA 2VDWA 5HA5A 4Z54A 3UXEA 2DERA 3WI7A 1ZN8A 3K4QA 2B61A 4ZIRB 3Q0IA 3FSJX 1DAOA 4CODB 4LWOA 4PLHA 5IU6A 1T4GA 1R6XA 3U1BA 1QRTA 1U8YA 1EFRA 1O5IA 3GJTA 1J00A 3CX3A 1Y42X 1T24A 4OREX 1O0CA 2IX9A 2IIPA 1S1MA 3DKVA 5HILA 1RAIA 3LXMA 4TLDA 1KRXA 2VKQA 4C9BA 3AH8A 2GILA 1SCNE 2BI8A 2BZSA 2CFTA 4F1KA 3EJWA 3ZWDA 3WAJA 3S0JA 1E9EA 1L9XA 5AM0A 5E6RB 1ITZA 1L5NA 3HCNA 3SVTA 1C50A 2BZ1A 1XMIA 4FUQA 4PZLA 3H2KA 4RAQA 5EGNA 1Z22A 4AB1A 1EZ4A 3VTZA 2QT9A 1T2NA 1EGMB 2G40A 2XV1A 2EZ8A 1ND6A 1G5RA 1NRJB 1XVIA 1P0PA 1TF5A 2C4UA 3Q12A 1KSHA 4I50F 1SIOA 4UHFA 4B2YA 4ZEWA 4LI3X 3KWMA 2H1HA 2C84A 1AGRA 4KOEC 3WSVA 5DHPA 3CLUC 4R2MA 1XT6A 2F17A 3AYZB 1Y7HA 1HRDA 2LKDA 2VNHA 5HDBB 4RS3A 2NUAA 1Y3DE 4B32A 1X1SA 4D8UA 1NBIA 4OMCA 1JG1A 3ZBQA 3M4ZA 4F4FA 2BGWA 2O8BA 1Z5ZA 2QE6A 1T8RA 2IPLA 1FXUA 3H4IA 4MWBA 4WACA 2W8BB 3QKUA 4FCVA 4GAEA 4ECAA 4IOKA 3DBIA 1KGDA 3G2HA 3PXCX 4IHQA 3O84A 3KXLA 3S8EA 3U56A 1KZGB 5KQGA 1XBTA 1KO1A 1PJ3A 3W7VA 2VWGA 4OFBA 1YR3A 2H8GA 3EXIA 2ZBDA 1EVZA 3FPHA 5IVPA 2ZI9A 2OHJA 3E6AA 4RQTA 5K5EA 1A1VA 2WFMA 4RA9B 1JG4A 3H1TA 4II2A 2P2SA 2PSEA 3NDJA 1UCFA 1UXKA 3OETA 5FD8A 4R2IA 4BVBA 4NCKA 4PPQA 5KWJA 1CJTC 2O2CA 2QN8A 4NMWA 4OA5A 1RNLA 3G3EA 1QCCA 1WMBA 4IIYA 4R1MA 3REQA 3WB0A 1T9ZA 2EHDA 4YALA 1ML4A 2ZGVA 3VDNB 1JIKA 4G5YA 1KMCA 2EZ4A 4HN9A 4L57A 4MPDA 2C5LA 3WJAA 4G1CA 3CTMA 1UOOA 3EXEB 2EHJA 4FR2A 2YINC 3BT7A 3GUCA 3C6ZA 4V2UA 1WDLA 3KB6A 2OD7A 4H7IA 3ENKA 1KYQA 3GUVA 3C70A 4TLBA 2REXB 4EW1A 4ZJPA 2RAPA 2VAPA 4NDNE 1VGRA 3CF2A 1GYQA 2H1OA 2H54A 2PZAA 4YO8A 2WT4A 2D1YA 4M0MA 4IMJB 3VR1A 3C6MA 1JSCA 2HA6A 3EXHB 1KFKB 3OJCA 2I0FA 3MLBA 3DE2X 4CR8A 4D42A 4B2LA 5CJPA 3FCOA 4N3CA 2CXTA 4XLZA 1JEAA 2WIAA 4CTNA 4X7MA 1N36B 5KYTA 3AZPA 4AKSA 2XYGA 1XC7A 1YJAA 4PLVA 1P29A 5TJHA 1ZAYA 2VT2A 1CR2A 1UDBA 5GP1A 3RODA 1IEVA 3PFNA 3TLMA 5BQPA 4DDVA 4ESVA 3F2VA 3MUNA 5J4YA 1JH9A 4PO1A 1KH1A 3RYFA 5A4DA 4HPXB 3V4SA 1EUYA 2MINB 2D1SA 2NXJA 2X0JA 1LFAA 1NJ2A 1Y5MA 2ZKLA 1M8PA 3PBKA 3DLIA 5DSTA 5B1IA 1CDOA 1FTQA 2I22A 3WYEA 2ZQYA 1ZGBA 4FC7A 4KXYA 1E63A 2AKAB 2ZE7A 2OD2A 2OGTA 3DGEC 3V1UA 5EHZA 1ID8A 1PT5A 3L8ZA 4LX8A 4NOMA 1TPYA 3T3IA 4L6AA 4JWKA 5KU1A 3CR8A 3PHBE 3I09A 3W1EA 2HHLA 3UQZA 3TDNA 4DF3A 5JQGF 4GM4A 1Z6XA 1TB4A 3PLRA 4M7WA 2X8AA 1Z4LA 1E9RA 3EUAA 5G1NA 2SNIE 3L5OA 1L7OA 4LWPA 2EX4A 3DDOA 1N0UA 1W1UA 4W5WA 2WG1A 4M1KA 4Z1MA 3R7DA 4MW4A 3VOAA 4AWXA 4C14A 4XYLA 4BFTA 2CUKA 2D4HA 2Q49A 1UPXA 4KQ1A 1AQIA 4BYMA 4XR4A 2C5BA 2L42A 4FNGA 4TWAA 4CLRA 3QLVC 3DFIA 2IT1A 3ICEA 1CUEA 2NUPB 2GNPA 2B8WA 2QS9A 1L7EA 3AMVA 4RC9A 1P19A 2ZU0C 2QV7A 4XCVA 1SUWA 3Q85A 1TM7E 5EN4A 5GAJA 3VBCA 1WD5A 5FLEX 4JI4B 3GLUA 5IVKA 2VRCA 4HG2A 1K9VF 4M2LA 2ZG6A 1KK2A 1WETA 4FKZA 4OHMA 1R64A 3CLSD 4F5YA 4Y0AA 3VYSB 5LZ2A 1LKZA 2CXSA 5DU2A 2DYKA 4JOCA 4XFDA 1E96A 2V5AA 5M2QA 1BVYF 1VL2A 3O03A 1D1PA 4LOLA 1R0SA 5E0KB 1E9BA 2WSYB 1JEYB 4CIYA 2XCUA 2DRIA 4FE3A 4ZMBA 3HXQA 4YEDA 2EEZA 3PX7A 2E48A 2WJAA 5IJAA 4K6MA 2B4AA 2J59A 1NF8A 2EKBA 2FSUA 4ZCTA 1GAQA 4ODIA 1N7HA 2A84A 1TRHA 4NARA 3GVXA 3UICA 2P8SA 4JVMA 5LWHA 4HDRA 4FFWA 2G0AA 1X7YA 4B9EA 2W48A 4PC7A 4UUQA 3JQ9C 2HRDA 1A69A 2IEIA 1A7AA 2GN6A 4B6OA 3GYBA 4NP6A 2X3UA 4RSHA 4EFDA 5IFLA 3HE3A 1DIRA 3K0AA 2B2XA 2PWYA 4TLCA 2BBOA 3ZDDA 3OIGA 3R5XA 1U8AA 4QT0A 1K86A 5IMSA 4KXVA 4R0MA 1TCAA 1YVRA 4US1R 4UBMA 4WINA 5F76A 3QMMA 1CXZA 3AJDA 1CUFA 3DEFA 1RR6A 4TOIA 1WCIA 3GFTA 2XHEA 3OQIA 2NVUB 2YWHA 4C3VA 1W47A 3DE0X 4EM6A 1YK1A 1GRRA 3A6GA 3P97A 4PRLA 5KBYA 3WNQA 4ZN6A 2PKXA 3EVAA 3JWEA 5HUHA 4W6QA 3FUXA 3MCVA 4PFSA 9MHTA 1QC5B 1EVQA 1XZNA 5C7YA 1XRQA 2FEWB 1GU7A 3IE0A 2CLDX 1Z4NA 2VJBA 2XXAA 3OZWA 3PWSA 4H77A 3IVCA 4ZAVA 2VK2A 1BOOA 3V4FA 1HNWB 4GDFA 2BEUA 2XCTB 2VP0A 3VQTA 3L0BA 3SEQA 5ITVA 1DO8A 1KHTA 4Q9DA 2I6SA 2O8EA 3ADPA 5ARDA 1IVYA 4OQNA 4Y9DA 1B8PA 4CMEC 5AW2A 2Q0SA 2X1VA 3F3KA 1RJ9A 1OU4A 3EY9A 3EYWA 3NEYA 3MMXA 3CPJB 5AMXA 1QG2A 4U8HA 1EVIA 5TT0A 3VNAA 2O0HA 3DZCA 4A73A 1PR1A 4LISA 1NI3A 1O6GA 3L92A 4W9MC 2QSUA 4UM8B 2QE7A 2ZT7A 3RU9A 1YA6A 1QVWA 2XOXA 3STWA 5DTRA 5FT9A 4BY9E 3GROA 3QUTA 2SKCA 2BGRA 5JCPA 1JEQA 5I8WA 2HA4A 4JB3A 4LKOA 5DWDA 1NR1A 3VA7A 4CEIB 4UEQA 2BFAA 5IT4A 1E8MA 1V45E 2QRGA 4TTTS 1IBLB 1RYNA 2CCGA 1EFLA 3AILA 3H19A 3RVNA 4C3ZA 4UFOA 3GUYA 4GKAA 4AMZA 3VI3B 1YRLA 4HAYA 1P9LA 1TADA 2ZS7A 3H05A 3JD3A 4KQ9A 2WUEA 2O3QA 5FI3A 1AS0A 4ZO4A 2KQUA 2HRBA 2WT9A 2Z2IA 4ZV7A 4CQMB 2VK8A 1DHRA 1G3IA 1TQ8A 2DJIA 2GJ4A 4YJGA 3DVAA 1G2PA 2QF7A 3PEYA 3D4OA 2UVDA 2PSFA 2YWEA 4N3BA 3P4XA 2EQAA 1YMUA 3QGMA 1OFTA 2ZIXA 3PENA 1IN6A 1IQPA 4ZT7A 3VOBA 1HM5A 4PRKA 2P1RA 4TMTA 1LXCA 4L3VA 4DNPA 2HHCA 2HRRA 2FW0A 3MA0A 3GRRA 1TTQB 4YRJA 3KSRA 3GOQA 1QQTA 1YQ9A 4HUJA 2O20A 2YHSA 4RXTA 3U3KA 1A5AB 1B2RA 3FROA 4F4CA 3BWEA 3OQJA 3VO2A 1FYEA 1Z34A 2FR8A 4DEYA 3K2IA 4RVDA 3DBHB 3QX9A 4EX6A 1V1JA 3EZNA 5C8VA 5LQUA 1HKHA 4EG4A 3RQIA 1JHMA 2HU2A 4ZYZA 1KEZA 4CETA 3VR6A 5A1TA 3DF7A 2QVBA 5G0VA 3HS3A 4A8HA 3DPIA 2UV8A 3TVDA 2M6LA 3TSWA 1U63A 5G3ZA 3ZGZA 4MK4A 1QE5A 5DISB 1RM0A 1A4IA 1UKVY 2OGUA 3DE7X 4RMIA 1R5OA 3U3RA 1BMTA 1K4MA 4LIPD 4CLHA 2X13A 1IZYA 1HDZA 4GOXA 4DV0B 3T0IA 2EWWA 3QLVA 5JC8A 3TIGA 4I9HA 3RE1A 3KTFA 3K92A 3F3MA 2VT3A 1OGIA 4EELA 5EE1A 3ZU2A 2J4DA 1T13A 4HQ6A 4RJKA 5EKDA 1T36B 3GVIA 4D96A 1E98A 2D5LA 5LZ5A 4KDEA 2Q5FA 4NK5A 1UAGA 4KL8S 4CLXA 5FA8A 1ZHFA 4AO6A 1MOSA 3PFCA 3FSGA 3QVGB 1II0A 3DBLA 3V1LA 5CBPB 4MA0A 4ZEMA 1DX6A 4Q6BA 1AY0A 1PGJA 1AHNA 2CK3A 5BQXA 3U7JA 1M6HA 4EI8A 1OWOA 3DMTC 2VSOA 4FKBA 3J7AC 1P6XA 1U7OA 2HA3A 2L19A 2O23A 3LO8A 4LS3A 4TS4A 4UTXA 2CD7A 5KYUB 3F5SA 4QTZA 3GA0A 3LCJA 3N28A 2YWXA 4B3XA 2A0UA 3AERB 3K1AB 1Z5OA 2VN8A 3OP1A 5DM1A 4XCQA 3AVWA 1LGYA 1EHYA 5EFZA 4ALMA 4ILEA 5SZJA 5PGMA 5HKKA 4HJXA 1A5TA 1HE5A 1NVUQ 2CL0X 2AT1A 4LAFA 4P7FA 1EEHA 2YV4A 1V8DA 3W9BA 3FPBA 1JHZA 2ZRJA 1F2TA 3AETB 1VA4A 3GYGA 5JCOC 1Q7BA 3DMYA 2XUDA 1HO3A 4MYDA 1RACA 1MRZA 4NMMA 4OQYA 1C0EA 3E81A 3A4IA 1A9OA 1G0NA 1LW6E 5DI9A 5K9ZA 1ZAKA 4GPEA 4URFA 3K70C 3FXAA 3QFRA 4YQZA 1GTSA 1N6RA 4ZD6A 1JILA 1RWBA 2IHZA 4TTPA 4GOMD 4HAWA 4F11A 1V1MB 1K7YA 4QO7A 2E55A 1QIEA 2FWAA 2GVZC 1E0SA 3SX0A 2Y1DA 4BX3A 1B42A 4D02A 1FNNA 4XIJA 3AUUA 1NVTA 3RU3A 1FFCA 3B48A 3LS2A 4WNIA 2F1JA 4UCQA 3GLGE 3WTCA 4EKIA 1WSDA 3DOUA 4Q0MA 1CZLA 1TKRA 1CZKA 2B9EA 3EIHA 3IT0A 5EWMB 5KSWB 2BJWA 1GT6A 5A5EA 1VSQA 3KVNA 2J3MA 4FDUA 3LIIA 1A96A 4DADA 4IXWA 1TMYA 5BMOA 5HZHA 1UQTA 2H1IA 3OC0A 4I7EA 4BUCA 4P7GA 2P40A 4QM6A 5ICSA 3D7RA 5AO9A 1OWLA 1RQLA 4FTWA 5BSMA 1OU0A 5FUVA 4XAQA 1N2JA 4YBRA 4DQUA 1A77A 3U0BA 4F0JA 1E2PA 2ZIUB 3KT3A 4YX9A 2JAWA 4YA6A 1V8BA 3L02A 5LOVA 4FYIA 1DARA 3PPXA 1BWPA 1ECFA 3IDOA 3NBKA 3ROPA 3V6MA 2W22A 2HZ7A 3EGDB 3V4ZA 4RZ2A 1XVUA 3D3WA 3Q3HA 2P9FA 2QMOA 1F8GA 4LK2A 1XN4A 2HADA 1OW3B 1HOXA 4Q1AA 5L3QA 2YZKA 2O4CA 4GYYA 1QANA 2A67A 1XEAA 3AIIA 4ZQBA 2WWFA 3CBQA 4ZAFA 3ZVKA 3FPKA 2GF9A 5F77A 5IVIA 1QKJA 2QTMA 4M49A 5KOJA 1BYIA 4Y1EA 4BTVA 2PH3A 5KC8A 3TYXA 1Y7TA 4S2UA 4U7HA 4NSNA 3RTBA 1LBIA 1C7RA 3L49A 4MUNA 4R71A 2E9SA 1X8LA 1XQVA 4S1NA 4HWSA 1CY7A 1YBMA 1YJQA 1OGJA 2NZUG 2YWFA 3ENNA 3Q88A 4WUVA 5FBZA 3WWDA 3FTCA 1NE2A 2CBGA 5LQKA 1NHWA 5LB4A 1U4SA 1DXOA 2C59A 2O6HA 4NZPA 1HQCA 1KI4A 2GTIA 4BV9A 4DYDA 3K70D 2WB2A 4GH5A 3LUBA 4YRBA 4CUKA 2EATA 4OGWA