3EPPA

Crystal structure of mrna cap guanine-n7 methyltransferase (rnmt) in complex with sinefungin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
308
structure length
265
Chain Sequence
b'IFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Crystal structure of mRNA cap guanine-N7 methyltransferase (RNMT) in complex with sinefungin.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 265
sequence length 308
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3eppA00
2IBSA 2YR0A 4QQKA 3SGLA 3HTXA 2BM8A 3Q87B 2Y1WA 1VE3A 2IH4A 1HNNA 2ZBQA 5DTRA 2OZVA 3I64A 1D2GA 3C6MA 2P35A 3OE5A 2G1PA 4DF3A 3FPGA 4MTLA 2ZZMA 3WSTA 2JH9A 3JWJA 4P7KA 4IV0A 3LBFA 5C1IA 2FRXA 2BR3A 5D1HA 2Z6AA 1BOOA 1ZKDA 1Z3CA 5EIWA 3OFKA 4KIGA 3PVCA 3HCDA 5LSAA 3DUWA 2QRVB 4LWPA 3FTFA 1O9HA 2HNKA 5JR3A 3BXOA 4GOND 4P7GA 2AS0A 4EK9A 4RVHA 2G8NA 5M5BA 3AXSA 3LSTA 3I9FA 2ZCJA 5HIJA 5FUBA 5EEGA 4YUXA 4X41A 3UJ7A 1ZGAA 3UJ9A 5K0FA 3G5TA 5HZMA 3BWBA 4GOLD 3VSEA 1OR8A 3B5IA 3PLAE 1P91A 1QAOA 2ZBPA 2OO3A 1G60A 3MAGA 3TOSA 3P9NA 4OA8A 5FHRA 3GRUA 2OXTA 2CMHA 1L9KA 2FPOA 3MTIA 4GQBA 2IFTA 4MWZA 1RJGA 3UA4A 3JWGA 5BW5A 1I1NA 1L3IA 4QPPA 1JG4A 2YUIA 2ZIFA 4R6XA 5E1OA 2XBMA 3LL7A 5FQOA 4RTPA 3OU7A 4QPNA 5CIYA 1AF7A 5E2AA 2AOTA 3EPPA 3OPNA 3FPFA 3B3GA 1TW3A 1FPQA 3PS9A 1SQFA 4M37A 2N47A 3GIWA 3FYCA 4QDKA 3FUTA 5G02A 3KPWA 2O07A 5DX8A 1TPYA 2UZ4A 5FWAA 2VDWA 3P2IA 2EX4A 2UYQA 3B89A 4R05A 3TRKA 4QVKA 5E2BA 5EVJA 3CJQA 3SSOA 4LG1A 3TMAA 4EVIA 1L3BA 1XXLA 4DKJA 3P2KA 5U4XA 3FPHA 2F8LA 1QANA 2AVNA 1D2CA 1L3CA 2IDKA 2ZLBA 3OE4A 3FPJA 3HVIA 5KYGA 3DMFA 5E8RA 3P8ZA 1WY7A 4RTJA 1TW2A 2UYHA 3THSA 2ZBRA 3AWIA 1JQDA 5EOVA 4FS8A 2ZTHA 3IHTA 2ZWAA 1UWVA 1XDSA 5LQCA 3G2PA 4XUEA 4MQ4A 4YUZA 2AN5A 2YQZA 3TM5A 5E1DA 5CD1A 5EHGA 1I4WA 4AUKA 3SX0A 3HVJA 1IM8A 3KQQA 3P71T 3O7WA 2GAFA 2PSSA 1QZZA 4HC4A 4H0NA 3M70A 4RV9A 4RTRA 5EQJB 5DX0A 3HCBA 2P1DA 3TQSA 4PYKA 5K03A 1DUSA 2ESRA 1ORHA 3LKZA 8MHTA 2VDVE 2HR1A 3A27A 5IH3A 4FT4A 2Y1XA 5DX1A 1VLMA 4GOMD 5ICCA 3SR4A 2P3OA 2P3QA 3E23A 4RVGA 5H02A 1VPTA 3MERA 5CVUA 4FZVA 4GC5A 4NECA 3V97A 3BKWA 3KKZA 4O29A 4C07A 4OQDA 4GOOD 2GB4A 4ZTBA 2NNWB 2NP6A 5HFJA 4AX8A 4E2YA 3LX6A 1R18A 5DRYA 4AZTA 1NT2A 2OYRA 5EMLA 2QRVA 3HVKA 4X60A 2ZULA 1NBIA 1DCTA 2P41A 2ERCA 4PINA 5C9ZA 2PX8A 2B25A 3R9XB 1B42A 1JG2A 1SUSA 4ER6A 3PTAA 1FBNA 5FA8A 1YF3A 1KXZA 5HIKA 3R0QA 1INLA 3KPUA 3EGIA 4OA5A 5GIPE 1ZHFA 3REOA 3LCVB 7MHTA 2AN3A 4JXJA 4QVGA 1X19A 1UFKA 1YFJA 4FSXA 1WZNA 5T64A 2FYTA 3Q7EA 1DL5A 3G2QA 5JUWA 2G70A 1WXWA 5DLYA 3R6TA 3GWZA 2P8JA 2ZFUA 1JQ3A 4LWOA 3DXXA 3JWIA 1WXXA 4P7FA 3HCAA 3M6WA 5EG5A 4RTQA 5LQJA 1G38A 4KRGA 2AR0A 3ER8A 2NYUA 5EMMA 2VZ9A 3P9CA 2O06A 3HA7A 1JG1A 4WVLA 3G8AA 3FYDA 4HTFB 4IV8A 1QAMA 3CC8A 1V39A 2PKWA 3ELDA 1NV8A 3LPMA 1SVUA 3MB5A 3DLIA 3P9IA 2V74B 2GH1A 3O31A 5DTMA 4BLVA 4DZRA 3UJAA 2XYVA 3GRZA 3NVKI 2JHAA 5CM2Z 3K0BA 2V7EA 4HGZA 1KPHA 3A7DA 2IH2A 3CVOA 1VIDA 4BP1A 5KQSA 3NVMB 1EJ0A 2A14A 3FRIA 4FSDA 3BGVA 4PIMA 4HG2A 5GINE 3OZSA 3RW9A 3NMUF 3LDFA 4P7JA 4PCAA 3T7TA 1JTEA 5CCXA 4C05A 2C7QA 3EVDA 3GO4A 2I7CA 3KPJA 3OZTA 1RI1A 2HTEA 3F4KA 4RVDA 1KPIA 5EIFA 2BH2A 1X1BA 2ZIGA 5E1BA 3IEIA 3QOXA 5CVJA 5EMKA 5FA5A 4GF5A 1YZ3A 2PLWA 3HA3A 3DR5A 3L8DA 2K4MA 3DXZA 5DPMA 5K0NA 5FQNA 1VP9A 4PGHA 5DRTA 2AOWA 3A7EA 3DH0A 3HP7A 2IGTA 5BXYA 1M0EA 10MHA 2P7IA 4L7VA 2ZVJA 3SSNA 4PNEA 2PT6A 2Z6UA 1N7JA 3GNLA 1H1DA 4RTOA 3PFHA 4CKCA 1RJFA 3E7PA 4X1OA 1XTPA 1Q0TA 2QM3A 4Y30A 2CL5A 5GM1A 3I5UA 2PY6A 2YXEA 1NW5A 3KQTA 3NW9A 2BM9A 2YVLA 3M4XA 4KDCA 4RX1A 2ZW9A 4BLWA 2IDJA 4XUDA 3GRRA 3I58A 5HIMA 3T0IA 5FHQA 4EKGA 3FTDA 5F2KA 2ZSUA 2QYOA 2OBFA 2XVAA 5FCDA 4EKIA 4E30A 2FCAA 1X1CA 4FT2A 2PXXA 3HA5A 3QOWA 5LQNA 1RI2A 3GDHA 4G56A 4X61A 5DSXA 5DXJA 4A6EA 5LR6A 2GLUA 3GGDA 1FP1D 2VDUE 1X1AA 3FTCA 4OX9Y 3CJRA 2OKCA 4UOEA 3LDGA 3OZRA 1I9GA 4HRAA 3UFBA 2OB2A 1MJFA 5EKXA 3RODA 1EJ6A 4Z2YA 4R8SA 1JG3A 3M33A 3I53A 4YUVA 3R24A 5DM2A 3UA3A 3V8VA 1AV6A 2JJQA 3LHDA 3PFGA 2EG5A 2PX2A 1G8AA 3R3HA 5F2OA 1FJXA 1BC5A 3HM2A 3OCJA 4QTTB 5E8JA 4AZWA 5EPEA 1EG2A 4XUCA 3KQMA 5T6BA 4DA4A 1L1EA 2PBFA 3CCFA 2FK7A 2JHPA 2HV9A 2ORED 1XVAA 2I9KA 3NWBA 3DXYA 3LCCA 5EKUA 5FTWA 3SSMA 1SQGA 3U81A 4DCMA 4BY9E 3T7SA 2CMGA 5T67A 1RI5A 4R8RA 1ZQ9A 1NBHA 2BR5A 3EVGA 3HCFA 1YFLA 1UIRA 5K05A 3UJ6A 3UZUA 4C03A 3GRVA 4FP9A 1XJ5A 3GCZA 5E9QA 5EHIA 3UJCA 2HWKA 3CBGA 4V0QA 4E2XA 3C0KA 1U2ZA 1WS6A 3KR1A 3MTEA 5ICGA 2XYRA 5EGSA 5BP7A 5GWXA 2ZWVA 3TPZA 1JQEA 4ER7A 2IP2A 4PONA 5KQRA 2KW5A 4CKBA 4F86A 3P97A 5K01A 3KQWA 1AQIA 3LBYA 4Y2HA 3MHTA 5CVVA 2GS9A 3FPEA 4IKPA 2PJDA 4KVZA 1XCLA 3ELUA 5FADA 5F2NA 1R74A 3D2LA 4KW7A 3G5LA 2B78A 1VP3A 3EEYA 4B17A 2OB1A 4M38A 2NXEA 3A26A 5GM2A 2AOTB 3DOUA 3EMBA 3HNRA 2C7OA 2GPYA 4MIKA 4U7TB 5HEKA 5CUQA 4E33A 2PX4A 3NWEA 3MGGA 4P58A 4RTLA 3KQVA 4YMGA 3TLJA 3ORHA 1PJZA 4ER5A 4C08A 1PRYA 2WK1A 2PX5A 5P8WA 4KDRA 1G6Q1 1VL5A 2BZGA 2AOUB 5E9WA 1KHHA 2PGXA 3GJYA 4M36A 4RTSA 3ELWA 2DULA 3NDJA 5LQUA 5GIOE 4C4AA 4ER0A 4PYOA 1EQAA 5EMJA 3FUUA 1VQ1A 4PYLA 4DQ0A 2E5WA 1EIZA 3GU3A 1YUBA 3EVEA 1R8XA 3NJRA 3P2EA 4HGYA 4KIFA 1MHTA 2B3TA 2EJUA 2PWYA 3G2MA 3KQOA 5B1SA 2C7PA 5K0GA 1QAQA 2H11A 3BZBA 3DTNA 3G8BA 4R6WA 3HEMA 5DSTA 4C04A 4EMSA 5DM4A 5K0BA 1NW8A 4EQZA 1M6EX 2GA9A 1ZG3A 3M6VA 1D2HA 4M7RA 1NW6A 3SM3A 2AVDA 3OU2A 4RYLA 3DLCA 4PIPA 5KVAA 3ME5A 3DMGA 1G55A 4YV1A 4PWYA 3B7PA 3VYWA 5K09A 1O54A 1WG8A 2AN4A 2YXDA 2OY0A 3GXOA 2EFJA 5K0EA 3EVCA 2JH8A 5HILA 3PT9A 2HMYB 3HVHA 2FK8A 3EMDA 3SXJA 3TFWA 3C3YA 2ZZNA 3MQ2A 1SKMA 4GBED 4GC9A 5DTQA 2QE6A 3ANXA 3LKDA 2CKDA 1KPGA 1KP9A 1X1DA 3VC2A 9MHTA 1G8SA 4DMGA 3AY0A 1RJEA 3ER9A 2PWPA 3BWYA 3PX2A 4WXHA 2O05A 4KWCA 5DM0A 5BW4A 4U7PB 4E31A 3C6KA 5K0LA 4FR0A 1YZHA 3GRYA 3E8SA 3O4FA 3M6XA 2VS1A 3G89A 3UWPA 3IV6A 4X63A 2ONYA 4YMHA 1N2XA 2Q41A 2XVMA 2NXJA 3BGDA 1HMYA 3KR9A 1VBFA 3LECA 3S68A 5LQAA 3LDUA 4IWNA 2IPXA 4V0RA 2Z6QA 1KR5A 2FHPA 4MHTA 1R00A 1KYZA 1RI3A 4E32A 4QTUB 4F84A 2YX1A 3DULA 4DCGA 5ICFA 1BKYA 3C3PA 2YXLA 3EVBA 1BHJA 2NXNA 4E2ZA 5IKMA 2R3SA 5DT2A 3K6RA 3ERCA 4LECA 4PYIA 3EVFA 5E9JA 5FWDA 3BGIA 2P7HA 1QYRA 4PYJA 5ICEA 3UBTA 1Y8CA 1Q0SA 2H1RA 4PCLA 4E2WA 2PT9A 1JSZA 2CWWA 2P40A 3THRA 4PYQA 2PV0A 1NW7A 1KYWA 1NV9A 4OBXA 5LQRA 2AOXA 1O9GA 2QY6A 5K0JA 4YV0A 2PXAA 2G72A 2WA2A 3QV2A 1RJDA 2WA1A 4CKEA 5CCBA 2O0LA 3BWCA 3LGAA 3BWMA 2VP3A 2ONZA 2AOUA 3MCTA 5C0OE 2AOVA 1RI4A 3A4TA 2ZZKA 3DP7A 5HIIA 4HH4A 4HTFA 4OBWA 3FTEA 4FGZA 1P1CA 3PB3A 2AZTA 3IYLW 3KPVA 5EZQA 3TM4A 3T7RA 4RTKA 5DM1A 3NDIA 3G2OA 3UJ8A 4CTKA 1XDZA 4GUAA 4XCXA 5LQKA 5MHTA 1ZGJA 3P9KA 4A6DA 3JWHA 2UYCA 3ID6C 2YTZA 3VC1A 5K8VA 5EC8A 1NKVA 2EJTA 3PX3A 4PYNA 3UJBA 3KU1A 4K6MA 3HCEA 1IXKA 2R6ZA 3CGGA 3MCZA 1F38A 3EVZA 2LD4A 3A25A 4YUYA 4QDJA 5KS2A 2JHCA 2OPBA 3EGVA 3SMQA 1SG9A 4CTJA 2ADMA 4PYMA 3EEOA 3EGEA 3EVAA 3KQYA 4RVFA 3FUWA 4BP3A 1P1BA 3G88A 2JG3A 5EEHA 3HCCA 1M6YA 2IH5A 2NP7A 3OU6A 1P39A 2H00A 3SVZA 1SUIA 5CVEA 2I62A 3H2BA 5E1MA 3FRHA 2IBTA 2UYOA 4AZSA 5HOQA 3M6UA 4CXMA 4RSRA 3FZGA 3BKXA 5GP1A 3TR6A 3FUVA 5K0CA 3KR2A 2C7RA 4POOA 3E05A 5FULA 3TKAA 3DMHA 1YB2A 2B9EA 3KPYA 2PXCA 4AZVA 4HSGA 3BT7A 2PVCA 3B3FA 4ATNA 4YUWA 5DWQA 1JSXA 1NE2A 3AXTA 5ERGB 4BLUA 1ORIA 3RIEA 3UJDA 4C06A 1F3LA 2XYQA 4F85A 3B3JA 3OFJA 3AJDA 5CVDA 3FUXA 2O57A 3NTVA 4ISCA 1NW3A 4RWZA 2IIPA 3BUSA 3KR0A 4RTMA 2I6GA 3G7UA 4CWAA 2P3LA 2ZIEA 3KHKA 4GEKA 1JTFA 2G71A 4QQNA 1N7IA 2BR4A 4DM3A 4PGGA 4YV2A 3KQSA 1T43A 3LCUA 3TKYA 4E70A 1AQJA 3X0DA 4ER3A 5D1NA 1KIAA 1FP2A 1XCJA 5DXAA 2NXCA 1JR4A 1XDUA 4OQEA 2DPMA 5GOZA 2B2CA 4RTNA 3CJTA 1R6AA 3KQPA 1IY9A 1EAMA 1R8YA 3ELYA 3CKKA 5EZSA
chains in the Genus database with same CATH superfamily
3LPAA 1RHUA 1FVOA 5DGTA 1T2VA 5D85A 4OYLA 2PWAA 1SUCA 1ULSA 2P91A 3A2KA 1MAAA 1WDKA 1QFZA 2D7CA 3HJFA 4RPKA 1OZHA 1S4MA 4H7IA 4U5QA 2XTZA 3L9XA 3PA8A 5CYFA 3SWWA 1Q0RA 1S2NA 2XDWA 3EYWA 3CU5A 2JIRA 3FTNA 3NH9A 2F43A 3C70A 1Y4UA 2RI0A 3Q2OA 4KE6A 1SRRA 5CBPB 1WB5A 2O8CB 5C1IA 5ESXA 2FRXA 2PZEA 4Z49A 5DWDA 1JALA 1X38A 5D1HA 1NVKA 2FTKE 2GYVA 3EPHA 4BO2A 4N65A 5CLIA 1QF6A 2AHOA 4H6WA 5HYVA 2A2ZA 3LHSA 3MWGA 2EFHB 5LZ9A 2YNMD 4G4IA 4UUBA 1Q1NA 4XOIA 3RWBA 3PIRA 4MS1A 1N9KA 3VR5D 3WZMA 2WT8A 2DZDA 3ZGNA 5M5BA 3MK31 4IDQA 4OMCA 3D8RA 1LDBA 1G3UA 4CT5A 4X41A 3HJBA 4E5SA 2Z58A 3HUFA 5CW2A 5DZSA 1JR6A 1W88A 1R6BX 3A1DA 3A3KA 3NI2A 4GKBA 1P91A 3MAGA 4X1YB 2OO3A 5CHYA 3SIPA 4YYZA 3F2IA 1TJ3A 4UMFA 2RD2A 3ESDA 1NMYA 2P9BA 3HHPA 4CMBA 4F3KA 4K3UA 2PGNA 4S24A 2VNHA 5AKXA 2GR9A 1N3BA 3AERA 2HB6A 4EF5A 3UK6A 2AR7A 3PVZA 3NBQA 1GNLA 1RQ2A 1TU3A 3ND7A 1QF9A 1VPDA 5JYCA 4NV1A 3OTOB 1RKQA 2CDNA 2IYZA 3WAGA 2VP6A 3DO8A 3UMSA 2BGNA 2D0IA 1E9VA 3TQOA 5JV5A 5ALLA 1SQFA 1PYGA 3CUTA 3ZZTA 5U1PA 5B30A 1P29A 4R5HA 1BHSA 1PN3A 1JR3D 1BGWA 1Y0BA 2UZ4A 1SEPA 1A71A 5U9CA 5B55A 5J58A 5FB3A 3TEFA 4FQ8A 2WZCA 4KQ9A 3OHMA 3E9YA 1T4CA 4R9UC 1DDGA 1Q0LA 3JTMA 4FD3A 3W5SA 3C45A 2CUTA 4HN9A 4Q0MA 2PD3A 4MIOA 3VYTB 4EFNA 2GK7A 4X66B 4NLLA 4P5PA 1L3CA 4GKJB 3OE4A 3RS7A 3Q3JB 2P9CA 3LJKA 5IAGA 5IYZF 4O4LA 4IXNA 4G41A 1WXQA 3WNZA 1ITZA 4HNVA 4M60A 1XEFA 4Q3AA 2WM3A 4WJKB 3BGSA 3SQNA 4JODA 5FOQA 1DC8A 3JQBC 5CBKA 2VJAA 1E7QA 2VSFA 1FXSA 1RP7A 1CRWG 4QHTA 1WQ1R 3NXSA 2FUG1 2KB0A 2R87A 4II7A 4KQXA 1J9ZA 1EHCA 1W0JD 2F00A 2GRUA 1YL7A 4OH7A 3MCAA 4OUDB 1CKEA 4RA9A 2XVZA 1O6ZA 5AJYA 3FGNA 5A4DA 4MS3B 2ZWOA 2A94A 4MQFA 1XFDA 3L5OA 3NKVA 3PFFA 1RAEA 4H31A 8MHTA 3EFBA 1PDVA 3PHJA 1GG8A 3ZJ5A 4FNOA 3ZHVA 1N5RA 1CUHA 2OO5C 3ABSB 3EY9A 5B1YA 5C8YF 5G4LA 4PFQA 4QJ5A 4I36A 4QJ3A 1O5OA 2VF8A 4PEVA 1N9GA 1C9KA 3T8YA 4GOOD 4UQPA 1FS6A 3TDMA 1JLLB 1TTQB 2YDXA 2GYWA 3TSWA 3RU9A 2LXNA 3SJAA 3TGLA 2OYRA 1VHDA 2AC7A 1JDPA 2AMJA 2JNWA 4IJUA 1TGYA 5AW3A 2ZULA 4MRPA 4NX2A 1NBIA 5AOVA 5IAOA 2GD0A 1DAIA 1D2MA 1KFBB 1KZ4A 4O0LA 4HZUA 2UVPB 5TPZD 1NQ5A 2QD3A 4Y1RA 2X42A 1MCZA 4JJIA 1DXQA 2R11A 3AHJA 3DMYA 4X9XA 2VJQA 4BMVA 2XX3A 4RD1A 5JCPA 2HYDA 5HK9A 3L8ZA 2I87A 1FRQA 1YTLA 1G5IA 1H1LB 1W4ZA 5E2IA 1PKEA 3SEQA 4HVLA 3BXGA 2QOEA 3H4MA 2BDTA 1KOJA 4ZU3A 3R20A 2XSZA 3GAZA 4WCDA 1UDXA 3A0RB 5DBGA 3SX2A 4D82A 5ES4B 4BQNA 1GFIA 1P0CA 1U7OA 2H51A 4Q4AA 4M9ZA 1EJ2A 4CQMB 1QAMA 1SBHA 4IZHA 3LVRE 4RKRA 4BLVA 4DZRA 1FB5A 2PO7A 1Q3KA 2JHAA 3NGXA 1YRWA 5CM2Z 3W6PA 2V7EA 5BMVB 3WL4A 2O1WA 2W00A 2FN9A 3K9HA 4WVFA 3GYGA 4HOYA 3LX4A 4KUGA 2CSXA 3LS2A 3OX2A 1G1AA 3H5NA 3HJAA 4G0YA 1PT6A 3D3JA 3PTLA 3RW9A 3NMUF 5KMGA 1Y3DE 2FWJA 1PKXA 5JQWA 2PS3A 4M1SA 2HTEA 2OKGA 2OORA 1O8BA 1EFRA 2LP4Y 3E0QA 5HJ5A 3TIVA 3DTVD 2HUPA 3ZU4A 3H86A 1QOZA 1GPYA 3PXCX 3U7GA 1SK8A 1F2UB 1BRTA 3M34A 3AUAA 7ABPA 1VP9A 3P2OA 3PFNA 1J25A 4TMZA 3MWJA 1YVDA 4EJFA 1NA5A 3FM9A 2OM6A 4ZOBA 1APBA 4KQKA 3I62A 1RABA 1ZJZA 2P2ZA 3ZI7A 2AXNA 3FNBA 4CKCA 1SFRA 4JITA 5KTSA 4IIVA 3V7WA 4I4TB 4BO0A 4BFTA 1ZDMA 3IPAA 1TEHA 4UMEA 1WZIA 1U9ZA 2G1UA 4ID3A 4IR7A 4NPAA 3X1XA 2VXYA 3ILSA 5B1EA 3BF8A 2J46A 1B43A 2VPPA 3IPRA 4MRNA 1QUFA 4EQ6A 4IQ4A 2YV4A 1S3IA 1Q12A 2QT9A 4HWTA 4PPYA 3TTYA 4CUZA 4E1VA 3IEKA 4FHCA 1ZVKA 4KQCA 4PLZA 1K97A 3ULKA 4U3JB 1QRAA 3CPJB 4C0JA 2ABWA 2PUHA 3UXHA 4DBLC 4D0LB 4B3CA 1NWHA 1YZFA 2Z0MA 3KVVA 1PNRA 3W5VA 1VPLA 1W96A 2WR8A 2BISA 1RYMA 1YCGA 2G40A 4R2WA 5EINA 3ZE6A 1BX3A 2DUMA 2Y0CA 3N8HA 4FWIB 2IZOA 1QUEA 3I3OA 3OQBA 2YFQA 1JHXA 2IEZA 3GBSA 3SD7A 4DV4B 3H87A 4O2BA 3T5MA 5TQ0B 4PAGA 1F06A 1NXQA 4J9VA 3TVDA 5B12A 1GFSA 2XA9A 2R1TA 1IPHA 4HWPA 4O33A 3ED5A 4BECA 2XCUA 5EIOA 3O8BA 3LOUA 5DXFA 4DA4A 4C7OB 2OXCA 1R0SA 1YC5A 3R3ZA 3PXDA 1HOTA 1XVAA 2KE5A 3KJFA 3KL2A 4P5EA 4JJEA 1XTKA 3OJXA 4HTAA 1J5XA 1BXZA 2ZPAA 2GJ4A 1YHYA 3D6TB 1B4DA 2CUNA 1X80B 5ED4A 1OTYA 3ECAA 2Q7OE 3UJCA 1WSBA 4BKPA 2AMYA 1F4LA 2WV7A 4YASA 3IIIA 2BP7B 2FJPA 1WSDA 4KMRA 4ALIA 4E5MA 3I30X 2G1AA 3AP3A 4B0PA 3A2LA 1Z0KA 3IAXA 4ZPXA 3Q5GA 1XWIA 1W1IA 1YKFA 4QFDA 3K9WA 2KW5A 3AQ4A 3SXPA 4CV1A 5IJAA 1KFJB 2V8BA 5DGIA 3CLVA 1SC3A 2VL7A 3CY6A 3N8GA 1G2OA 3MGKA 1ZM4A 1OU4A 1WIWA 2Z2XA 4ZWNA 1P5ZB 4EB0A 2ZYRA 1T9DA 5IJWA 5EWJB 1QX3A 5H1YA 4FWTA 3A58B 2BEKA 5KJ1A 2QTLA 1QG0A 2RG1A 1GL7A 1KDOA 4M38A 4PG5A 3BXXA 2NX2A 1DKOA 1Y9EA 1SQSA 4RCYA 5CUQA 3DCNA 4IIJB 4NCHA 1OLOA 4P58A 1QCZA 1GQ2A 1NVTA 1N6RA 2X5OA 4J1TC 4RLHA 2DWOA 2FPUA 2QLTA 3KUXA 4UU7A 1UM9A 3LXRA 4D79A 4U6SA 1Y33E 1Y6JA 3IIKA 1H3EA 2NUBA 2P4QA 4WBSA 3M6FA 2H57A 3WOHA 3NDPA 4AU1A 1Z5PA 3ET4A 2ERXA 3VO2A 1GZ5A 5CVTA 2AOUB 3Q41A 4W8GA 2VDWB 1D2RA 3CLUC 4BX0A 2FSVA 5LQUA 1WVMA 3QQPA 3ZE8A 5IARA 1QJCA 3ZHZA 4OBBA 4XVRA 3ZWOA 2VDRB 1MPTA 1ZUIA 2UYGA 5IU6A 2OHXA 4W7HA 3T35A 3ETDA 1R8QA 3O9MA 3NJRA 4C0XA 4HWSA 5I9MA 3ZD7A 3OKAA 1DJOA 1YR7A 3D8UA 5K8TA 3Q8XB 3VSBA 1OXSC 1S2MA 1VDZA 4OXRA 5KX5F 2I91A 3GX1A 1HFWA 3JVUA 3R44A 4KE9A 4LDAA 2F8MA 4LQCA 4M7RA 5G41A 1KDVA 3SM3A 4RYLA 4YWHA 4DAOA 3DLCA 5TLSA 1RRGA 2O3SA 4M8LA 3Q85A 4PWYA 5B1DA 1YJ5A 2IP4A 4DDHA 5BV0A 4Q21A 5ESWA 4IVRA 5K0EA 1YKGA 1NU8A 1P1RA 3W9UA 1AZSC 5B3LA 4QPZA 1HKHA 1BWRA 1NKTA 2QDKA 3RSSA 3WBKA 4D42A 1NXPA 4KPYA 1NQXA 1F9EA 3FMVA 1VSUA 4XH9B 3C5WP 3T9CA 4ZVLA 2Y1EA 4P3KA 4A8PA 3CUYA 4BVJA 4DA7A 2XUGA 4KE8A 4PU0A 4EW2A 1G16A 2P67A 4Y8VA 3LA8A 4J2OA 5FL7A 1CEYA 1UBMS 3BWYA 5C4GB 5J1SB 4DV0B 2XB8A 2A5JA 1S2GA 4NDZA 1CHDA 1TM3E 1TM5E 1Y8QB 1Z4OA 3EH1A 4P3NA 2WICA 4AIRA 4EKYA 1W4AA 4N6GA 1EESA 4HPXB 2H4HA 3BGDA 4GSYA 2FPRA 1SPBS 1X9GA 1NC1A 4G9BA 2CYBA 2FEOA 2ZBDA 1A88A 2G88A 3DE5X 1P62B 1KR5A 3E9ZA 2HX1A 1C5KA 3UV7A 5ILOA 2V0GA 4BNZA 1CUIA 1EAYA 3BD9A 5FL3A 5EXPA 3C3PA 5FTMA 3ZCUA 4DJAA 4Y0NA 3VOTA 4E7OA 4D9HA 4AJ1A 1XZMA 3DVQX 2IV2X 3ZXSA 2FOXA 2G6BA 1GGNA 2HAEA 4NVRA 4BEVA 1U65A 4P86A 4TWRA 1JHAA 1GQSA 2P7HA 4IDGA 4GBMA 2WAXA 1HXHA 2V4ZA 4H7KA 4ZA2A 3TDKA 3VZSA 3KSAC 2WTUA 4TSFA 1GL9B 2Y6VA 3E7WA 2PT9A 4JLPA 3TXYA 4Z0HO 4EJSA 2BZ1A 4DDUA 1B26A 1L1RA 2OFXA 4EHFA 3AOEA 4PYQA 4TLAA 4RLQA 1TQ2A 1ZK4A 4YBZA 4BX8A 4YR7A 3O92A 3NEYA 1LC0A 4UDNA 1ORDA 5CLHA 4QNMA 3WWOA 2FVXA 1GTG1 4RD2A 1GZ3A 1E1YA 1RJDA 3OE1A 4LJ9A 4QUEA 1EBFA 1YBAA 2J3KA 1J6UA 3N28A 1KE2A 3BRCA 2CMDA 2VP3A 2LWIA 3HU1A 4MWCA 4Y1GA 1RI4A 5HIIA 3SF8B 2JC3A 1V4VA 2I2AA 4O25A 2IZZA 3ABZA 2NV2B 4WCFC 4YV7A 3QIAA 1J7JA 5IAAA 3N2KA 2NV6A 3ZY6A 4B85A 1K4YA 2JJ8A 4K9KA 3ZGXA 4B4KA 2ZATA 4L4XA 3T0FA 1DV1A 5ALNA 221PA 5LQKA 2YVAA 121PA 1V7PC 2JLAA 2LR0A 3QGMA 1EX6A 2CEKA 3VC1A 4FFSA 5IPFA 4MRAA 4EYSA 2XCRB 5JG7A 3W3AD 4HPWA 4PYNA 5AVZA 1L8OA 4HXFB 3T12A 4LCEA 4W4TA 2REXB 1Z68A 4S1OA 5EHZA 2WF7A 3SQOA 4GOXA 5KWJA 2FWIA 3QEJA 4GYWA 1E1CA 4WDRA 2ACKA 4TXMA 1EVQA 1WDWB 3KQYA 5IYZB 1K0FA 1M73E 1PNVA 1XP5A 2QAIA 2JG3A 2O8NA 4IUDS 1H4VB 2ZSFA 1V25A 4G2TA 2YOGA 2IH5A 3DFKA 4AN0A 1P39A 4F9FA 2GCNA 3IAHA 4ZJZA 3SVZA 5B58C 6REQA 1E6KA 5DMHA 2H52A 5EJGA 1UDRA 3O1HB 5ADVA 2DT8A 4RULA 3KR2A 5HF8A 4MQEA 4YCAA 2COUA 4PLYA 1E2DA 4IZOA 1EK1A 3BFPA 3NALA 2HPVA 4U2CA 3NB0A 3EGXB 1PZNA 3SYTA 5A9RA 2PVCA 4HDSA 2A4KA 1JSXA 2CLIB 3RIEA 1J2YA 4LJLA 5C1OA 1J24A 3UK1A 4LYAA 1YMQA 4PPGA 1ZOPA 5C8YB 2R86A 2IZ1A 3RYTC 2DH5A 1GKKA 2Y1FA 3NTVA 4FUTA 3T15A 2G04A 2OV3A 4M0LA 2Y1KA 3GMTA 3T4EA 1UC9A 3MINB 2ZIEA 4ONEA 1NW4A 3RT1A 3SC2A 2RGXA 1VA5A 3GC6A 5I45A 1U80A 4ETWA 2FE1A 2VRCD 4NJOA 2CLFB 3JQBA 3KSUA 1KSGA 3DFIA 3P4UA 4ARIA 3H05A 1A72A 1Q1QA 4Q82A 1XP8A 2W2PA 4JT9A 1KH2A 5CJJA 3RSQA 3VJMA 2J6CA 3OICA 2DPMA 5AI9A 3CRW1 1BD4A 1XPJA 2C0QA 4GOKA 1MGPA 3B1WA 2OMEA 3V2HA 5IJZA 1BDBA 1YRAA 4G1CA 1W7AA 1IVSA 1T9CA 5C3MA 1R0KA 2QBYB 4LMRA 4CCSA 1R0RE 4FVTA 5IEBA 3RWMB 1NATA 1SCKA 3R75A 2DLDA 2BAGA 1ISRA 2JFFA 2Y1WA 3F2VA 3HBMA 3Q87B 2X8LA 5AIAA 4AG5A 5KNDA 3TCXB 1Y1PA 4XR4A 3ITEA 3N0VA 3BTSA 5BURA 4ME6A 4J1NA 1N2IA 1TF7A 3MBIA 3PNBA 3RTBA 3UK7A 3BYZA 1KKMA 5AW2A 2NUPB 3QXGA 3UT5A 1B0PA 4MTLA 3RNLA 1SG0A 5F7JA 4PXYA 3QPCA 2QVGA 4LIPD 3JQAB 4LF7B 3DEIA 1XFAA 4QOGA 1GDTA 4E7PA 3GVCA 1JHZA 1ULAA 1WMFA 3OQHA 2ZJ2A 3B1ZA 4L8LA 2P9JA 1YASA 2ZRLA 3ZV4A 5H80A 3AU8A 1GSOA 1XC7A 4TRRA 5CHEA 4YRSA 4P7GA 2WIDA 1WKBA 4B6QA 2FW9A 1UT6A 3UB2A 1JU4A 4C2TA 3EAGA 3AVOA 3Q6MA 3U2QA 5LZ4A 5KWVA 3RFCA 4PRKA 1FYFA 2QPOA 3FUCA 4AP6A 3AVYA 1Q95A 1XMXA 1TKCA 4INJA 1LNQA 2BL4A 2MR6A 2CSUA 2ODEA 4Y6QA 3TLZA 4MWZA 4BLOA 2VTKA 1BX0A 2CXHA 2PDAA 3K1AA 4IS2A 1OFGA 3CRZA 2JAQA 1O96B 3DWGA 1J22A 4R2JA 1IXRC 4JC5A 2HYIC 4XYBA 1QIDA 2YJ6A 2ZI3A 3LT4A 5DGDA 1T8TA 4N9QA 3OZWA 4OYRA 1A8SA 1YH3A 2M6RA 2X4LA 2ZCUA 3DZ8A 5CLLA 1E3MA 1P0FA 2PKEA 4P3XA 3LV8A 2GEBA 5IX8A 3AL3A 3NM5A 1RKBA 1T9BA 3U0VA 4EPTA 1K92A 1A9OA 1TPYA 2MINA 2ZAYA 2XUAA 3PXAA 1V4BA 5A5FA 2ZJ8A 3PUZA 1R10A 2E4AA 1FZQA 5E2BA 3RYIB 1GGKA 3UK0A 1TCBA 2GXAA 3MWDA 3ZGLA 3ZGYA 5C37A 4LXGA 4ZO6A 1KYXA 1SIBE 2CK3A 2NPOA 4HQ0A 5E8RA 2XTMA 2ZWPA 3NNSA 1R6DA 1L7XA 1QLHA 4MVJA 4OP3A 4UU8A 4WFKA 5LA6A 4FS8A 1MW9X 3VR4D 2WG1A 4EI7A 2ZWAA 4GUDA 2WKSA 2MSEB 3PGMA 3IP6A 4MGHA 4XGIA 2IODA 4ZVKA 4EATA 5ITWA 4CTOA 3RAJA 4NS4A 4COKA 3K8ZA 2CBXA 4J0FA 5DEOA 1TVMA 3B8HA 2X22A 4I3HA 2RH9B 3K15A 4AF6A 1XI2A 1PFUA 3P71T 3WO0A 4HC4A 4CMCA 4HCJA 1XVVA 3RUEA 4ZAXA 5EQJB 5LMNB 4R3NA 4PYKA 4KPEC 1EWYA 2IV7A 1T6YA 1B8UA 1OB5A 1Z28A 2VAVA 4AZ3A 1QMPA 2FQ1A 2VDVE 1ECFA 4MPJA 3V6MA 1RYYA 4TS4A 3TK1A 3ZV6A 1W5EA 3D0QA 2AXEA 2ADFA 3JATB 4AUEA 3AQIA 4OB7A 2EAUA 5KNCD 2NVUB 2GK4A 4E07A 2HIHA 2O3JA 1PCXA 3IVGA 1R18A 3LX6A 1SVMA 2YHSA 2IYOA 1A5BB 2NOAA 2WUEA 4D56A 1W1WA 1E2EA 3HSSA 3WWDA 4O4LF 3VTKA 1KZHA 5ITZA 1CJTC 9LDTA 4OLHA 1R64A 4KDFA 5JY1A 2TMYA 4DC1A 4ER6A 4Z1OA 1G5TA 2O5VA 2VJKA 3UUFA 1TJ5A 4ADSG 3N3BC 2R68A 3FROA 1X7YB 2I3BA 2UV8A 4FYKA 4WY8A 5FBHA 2C4KA 1TVKB 4EABA 7MHTA 1WX1A 3ZDXB 1R0XA 2ZETA 4C3UA 2J3JA 4EUKA 2D13A 3EPRA 4JC0A 4ZV9A 2H4YA 4UUNA 4HO1X 1JNYA 1V11A 1DQYA 1RRKA 1JEEA 2FLVA 2IELA 3GLSA 4OYHA 1I2AA 1KAEA 4Q39A 3T7EA 5E6RB 2GASA 2UYYA 3NOVA 4L28A 4EI8A 1NE7A 4DY4A 3NIGB 4FGWA 3PCRB 2CBGA 2A1IA 4LVNA 3ZE0B 1RAAA 1Z0ZA 4DSOA 1JG1A 1VMAA 3TX6A 5MN5A 1I7SB 4WFIA 2GCOB 4L75A 4B81A 1I32A 4K6CA 2C7PA 3PUJA 2O3RA 4KV9A 4INZA 2A9RA 4HFNA 3NVKI 3HG7A 4CHGA 5IEJA 3LGSA 2VAXA 3LUFA 2DUNA 4EARA 1VG1A 1BA2A 1HEIA 1KFEB 3WMFA 4G8DA 1XKQA 5CCXA 2A0WA 5JDCC 1D0IA 3C43A 1XVUA 2X3FA 2DPLA 2I1WA 2OQVA 3IKTA 3W4IA 1KY2A 3F4KA 3HYRA 1X74A 2GHTA 2O8DB 2CN1A 4OOFA 1GPH1 2VSNA 1GPAA 4Z0PA 5KX5B 2K4MA 5L4LA 1IL0A 1GRCA 3L5KA 3ON5A 2L2QA 3DT8A 4DQKA 4E21A 2JFZA 3GJ3A 4J1TA 4L7VA 4IMPA 1JH8A 3B6MA 3S55A 2FSGA 4AMYA 4NU0A 1DRVA 1E2QA 2VEDA 4JFAA 3RRXA 1UBOS 2PY6A 4G4SO 1NW5A 1J8YF 1VLLA 3IBTA 2ZYWX 1HG1A 3D3WB 3IIJA 4F4DA 1T8WA 1GQFA 3S2IA 5KYXA 1Q74A 2JGIA 2YWEA 2JCVA 1FFXB 1O03A 5BWBA 4L95C 2OEPA 3NBYC 4I5EA 3R7NA 1P0QA 1P3Y1 1U04A 4F9EA 3EIQA 5LLDA 1UJ2A 3AWDA 5C52B 1YGPA 2I4LA 4BRWA 4AURA 2PXXA 2O8EA 2R84A 2CXTA 3N8IA 1UKCA 1JHUA 3X2SA 2PCJA 1E8DA 4D9KA 4I2VA 3C98A 3GEDA 5I9TA 1CEEA 2OZPA 2V3CC 4LZJA 3L0OA 5DXJA 1L4NA 4CL8A 5KOHA 2QVCA 5H83A 4C21A 2GLUA 1BW9A 3BGOS 2Q3CA 4NCXA 3EULA 3QPWA 4LGCA 1L6RA 2BIFA 2P6MA 4LZLA 4MWDA 3IILA 3K32A 1U3FA 5I7AA 3U39A 3VDXA 2XZOA 4J7XA 1IQ0A 5FD8A 2R2GA 1BH2A 3OZRA 1JFRA 1I9GA 3M6LA 1MB2A 4HRAA 3FTQA 1JG3A 3O47A 4TS9A 2YC2C 1GXSA 1M34B 2XD9A 3V8VA 1Z4IA 3DDWA 1CFJA 3LHFA 3OLZA 1TYEB 2DCUA 1BWSA 4O8ZA 1X7ZB 1OH6A 1D4AA 3N6XA 1IN7A 2IWRA 1C7IA 1NLYA 2IIBA 3D4PA 3JQGA 2HV9A 3C6BA 3FFXA 5LL6P 3F7OA 3VYSB 5AVVA 2JCXA 1Z13A 3TJMA 1JAXA 2DWUA 3G5MA 1XWFA 3ESAA 3KELA 3QVOA 2GYYA 4RVCA 3ZTYA 3CTPA 3KOWA 1M9NA 2H18A 2YJ5A 1VKRA 4KQIA 3DAYA 2CUZA 3L0ZA 1G20A 5A1TA 4XSGA 3RAGA 4XXHA 1XQYA 2WPDA 1SUBA 1JDBB 2W6PA 3B3AA 1DBPA 4D9JA 2QM0A 3R2JA 5GWXA 3WADA 2WFLB 1JDZA 4M1YA 2I33A 2DR0A 3TAUA 4JBNA 4O2BF 4LSZA 4WZ6A 4IKPA 3PU6A 4OGLA 3WIEA 4E46A 1GRNA 1I8TA 2FP4A 3DJFA 2YYAA 1T0PA 4X24A 4C6RA 3ITDA 5CT4A 4OVKA 1BFDA 4MRSA 5SICE 1UMBA 4RZ2A 4RF5A 4HNUA 2NXEA 3MYRA 5ICSA 2H92A 5KHOC 1T35A 3L1KA 4M7WA 1NF9A 2W7TA 5AJVB 5HCNA 1XJWA 5SZJA 4D5GA 2FZ5A 3T1QA 3BCSA 4ZDWA 5JRDS 5L3QB 3HKBB 1B6TA 4LFCB 5ADWA 3A6ZA 4WCFA 2PSEA 4D6XA 2RGRA 2WOOA 1I4EB 4MVJP 2XUIA 5GADl 3RVQA 1EK6A 1LVHA 2X6QA 5HP4A 4FX5A 5CGQB 3W2FA 3T9FA 1KNQA 4V1CI 1SKQA 1U9IC 2VJPA 4Q24A 3GPCA 5BNFA 1Y80A 4Z5XA 2WT9A 1EWQA 4C4AA 1NVUQ 2XHEA 3R7LA 4BV3A 1QV7A 4KLCA 3F5DA 3PJRA 3ROGA 2GJ8A 2K7FA 3P9ZA 2PZMA 1R8XA 4E13A 2GILA 2ZIXB 4B8WA 1DOAA 1Z18A 2IYEA 4R16A 5HTKA 3BK2A 3OY2A 1QIHA 4JFRA 4OHFA 3ZU5A 3L3BA 4D3DA 1X7HA 1VSTA 1P7CA 1LRKA 4HVTA 5FNZA 4ZVMA 3OECA 4D8YA 4GIBA 1P9RA 2IXGA 3O8RA 4HAWA 1CERA 2OILA 2R48A 5G0UA 3EEIA 2CEAA 2XCIA 3IEMA 4Q3EA 2BEUB 3ESXA 4CM6A 4I50A 3WLMA 1O54A 5A5EA 2LRHA 3EVCA 5LMZA 2VHJA 1ZW6A 4DSNA 3GA0A 2JIQA 1O94D 2OBYA 2OR3A 2XCQA 5T3YA 4CIYA 1B1CA 3NQ41 1Y9DA 3JYNA 3IEUA 1X1DA 1X6VA 1N0HA 3O3OB 1SQ5A 5ALWA 4XM0A 5AW8A 1KGDA 3I3SR 1Z7BA 2PWPA 1AHNA 4K9DA 2O2GA 3A04A 4O0MA 3RRBA 1LZKA 2WSIA 1S9HA 4ESHA 5IT5A 3FOFC 2BEJA 3DQZA 5HS6A 1V8BA 4Y2SA 4B71A 1MQSA 1ILWA 1US8A 2WJVA 3HJHA 5EWLB 4Q01A 2QRQA 3SS8A 3GY0A 3CUUA 3FIUA 3GJZA 4LMBA 1M1NA 3HB7A 1R6VA 3UWKA 1EHIA 2XDQB 4TVKA 5SYNA 3T3PB 2OSBA 1YR8A 4UNPA 3UFXB 4BFLA 5CAEA 2AL7A 3DBHB 4A6PA 1XEWX 1G9TA 2HJVA 1M6HA 2O8BB 2YHIB 2Q3JA 3IVXA 3BXZA 4DLUA 4QTUB 1QWOA 3LQ4A 3B6EA 3EVBA 1OAAA 3KETA 1OYVA 2HFKA 2VQFB 1V4NA 4TX1A 3ERCA 4PNPA 1REQA 4Q3KA 3CNHA 3IAFA 1P5RA 2AYXA 3B9BA 2Q8NA 3QX3A 1QYRA 3W7BA 4L02A 5DCWA 2PSDA 1U7WA 1R88A 3K2IA 3G7NA 3MN1A 3ETGA 1O87A 4FMBB 2GZ1A 2QMYA 3LT5A 4DLAA 2E0IA 3SDBA 4FLMA 5HHTA 2DJ5A 2RBGA 3GEIA 3M1IA 4LKOA 2GZMA 2XB4A 4JR1A 3WLFA 3NUQA 3LNCA 4FOSA 3CNOA 3UXYA 4DIUA 2HMVA 3HL0A 3NIBA 2FPSA 3EFOA 3ZY2A 1RQPA 1O4VA 4KLZA 1ELOA 2FMFA 2AFVA 5I47A 2AOVA 3O82A 5FXMA 5E7QA 5ALJA 3ZH2A 2YHUA 3Q7RA 5KYXB 4Y2RA 3R7BA 1P1CA 2GX6A 4OJTA 5KTMA 2AZTA 1RYDA 3KPVA 1LBSA 3QWAA 5EZQA 2ES4A 3DZBA 4PZLA 1GGVA 3TQRA 3OJCA 4LTMA 2WSLA 4QFMA 4CN8A 2OGTA 3AETB 5FI5A 4GUAA 4RVUA 2Q3BA 2ZI6A 3I9V6 3P9KA 2FEWB 5P21A 2CLDX 4EVRA 4EHNA 2H07A 1IM5A 1SBTA 3BS4A 4ILEA 3SYLA 2WVJA 4MS1B 4I19A 4QBHA 3WV5A 2PANA 1GPBA 4H1VA 2X4GA 2R6ZA 3GEEA 5A9SB 4I9NA 2VOJA 1SQ0A 3V00A 5KJCA 3P1JA 3STTA 3R6WA 3NTQA 3GUCA 2WJAA 1ZLXA 3UAXA 3ZIDA 3IJEB 2P9FA 3MMSA 3OSZA 4MW2A 1W88B 1ND6A 4FOPA 1ARZA 4M22A 1XOIA 3SJBA 4JYAB 1P1BA 1FP6A 4K26A 3S7ZA 2YMMA 3WGHA 2I71A 3HCCA 1DC4A 3AGPA 4ERXA 3BWDD 3DW3X 3FKSD 4QBTA 4COOA 4N76A 4ZMRA 4L0DA 4EB3A 1T13A 4NENB 4DANA 1RM3A 5IULC 4HEHA 4KXMA 4PBSA 1YB1A 3CLUD 4JN6B 3S28A 1D6JA 1QIEA 2ACWA 3ACDA 3EA4A 3TR6A 4BAUA 1JFTA 1YONA 5DJ5A 2LV8A 1M76A 1DO2A 3LSYA 2HSZA 5E6SA 2B9EA 2X6TA 4RDHA 3RYCA 2PWZA 2EP5A 4RMNA 4CNQA 3ETEA 1K1EA 1N3IA 4LE0A 3SN6A 4E09A 3ONNA 2QTBA 4UJ3A 4F85A 1ORIA 4G1VA 4MYCA 1LDEA 2HJGA 1PJ8A 5T4FA 4KMSA 3TI7A 3W90A 2JZOA 4FHGA 4JLSA 4JP2A 4ZT4A 2V3VA 3FCEA 3N70A 4NG4A 1T4CB 2JW5A 1J0AA 4NJMB 1Y81A 1PG0A 2XV1A 4N7BA 2NYAA 1YQGA 1GUDA 1I30A 4FDTA 1E2LA 4DM3A 4RXMA 4I1YA 3K5WA 2CFTA 4O4LB 5DIZA 5G0TA 3K0SA 3E1GA 5HFAA 2NXCA 5FO0A 4YECA 2RGBA 5JH7A 2GPBA 5DISB 2R751 2B2CA 4D9GA 1NVVR 5BR7A 2HBYA 1QGOA 1ZHOA 3E5HA 4H7HA 1GRRA 3RUAA 1XNHA 3SX4A 2Q3LA 1UBCA 5LP6B 3SGLA 2PKQP 1C9EA 3H1TA 4OKSA 2Z2ZA 5CT6A 4NFYA 1Q7EA 2RAVA 2VYVD 5C8ZA 4UMVA 3CUVA 1HT3A 1KI3A 3MXOA 1CLEA 2ODNA 2PU5A 2WWTA 1XZAA 1NQAO 3OE5A 3SLRA 1T5IA 2HO5A 1E58A 1T24A 3VR2A 1ZCFA 2JI6A 1IUPA 3U7QA 4G1UC 3WSTA 3F8WA 4WLFA 3SBEA 1XWWA 1VJCA 3PPIA 3TAXA 4FHZA 4DR3B 4GL2A 2JD0A 4IV0A 3Q5DA 4JLJA 4XPIA 2A1TR 5C53B 4N8SA 1N9GB 2IOQA 2RJ3A 1V1MA 1RYZA 4XQ9A 5IS2A 1CRZA 2PL9A 4ZHSA 2X86A 4KIGA 4V0NA 1E6LA 1FMTA 3PVCA 3FB4A 4F45A 3E18A 1VHQA 3B53X 3DUWA 1AGRA 4GT1A 3ROMA 2ZUUA 1YZQA 3G9QA 3IUNA 3B82A 3MNFA 4B74A 1OXBB 3OCWA 3UJ3X 2R96A 2KQUA 3UJ7A 3EIHA 1ORVA 3AF3A 1ESNA 4XDGA 3MW8A 3MA0A 4BX9A 3GR6A 1V7CA 3A1FA 1R9JA 3CB4A 2C5GA 1NXTA 4IOJA 2RI6A 3T1VA 1OASA 2QRHA 3FOEC 1RJGA 3RIYA 5JTTA 3GGCA 1L3IA 3RRZA 5GZ6A 1PR2A 1LSSA 1OT5A 1XTUA 1LPNA 5FUWA 1WLSA 5BMOA 2J8ZA 5BWNA 2I3ZA 1UM8A 2L42A 3DAHA 1FEZA 2IZ6A 2WTMA 5FFNA 1AF7A 3V7FA 3EXEA 3V48A 2QTTA 5IH7A 4QBIA 2A0FA 5BQXA 4DA9A 4BQRA 2DBQA 1TCVA 1V5IA 1G8KA 1XRSB 4GVXA 1YI0A 2Y66A 1PR3A 1UKAA 4LUCA 4IUBS 2XNDA 3GARA 1EUDA 4LDRA 5TEWA 2WC1A 4MUXA 5AICA 2XWPA 3R5XA 1YIOA 3B89A 3UF0A 5A0FA 1MX1A 1NQWA 2DF8A 4QVKA 3KKLA 2HF2A 4BIIA 4Q4JB 1X7WB 1XXLA 4MV4A 2LDXA 2QSUA 3SXUB 1L4GA 3PUVA 2WF8A 2NW6A 4AP9A 4DLVA 5B3KA 4LJRA 4DIDA 3P8ZA 1QOPB 4QSMA 1YIDA 2JA1A 2HBZA 4JJKA 4ZZ1A 1DWUA 1UBHS 2XF8A 3K2EA 2E4ZA 2CDCA 2DFVA 1BGXT 1DXOA 4J0HA 4XD2A 1XTBA 1NU6A 2ISSD 3EFHA 2D3WA 2PV7A 2WAYA 4HFMA 4HI0E 5E1DA 4AUKA 4OIMA 1T3ZA 4Q37A 1C8BA 3K4PA 4C3VA 2JH3A 3A3OA 4PSVA 1RWBA 2EHJA 3H1EA 3TJRA 3D5TA 3KBBA 5D3QA 2GESA 4BFWA 4H6PA 1FDSA 1NLMA 4DVJA 1SHZA 1U3CA 1B76A 2AE1A 1Z5WA 2XHZA 3LUCA 4EUHA 2QN9A 4BNJA 4OLJA 1XEXA 4UUPA 2CUKA 1N5MA 3BE8A 3UCXA 4CIDA 3U7HB 1KKLA 2VPXA 4Q12A 2X0JA 1CUGA 4PZ9A 2NP6A 3KXLA 3VJKA 2FZVA 1VSBA 2YWRA 3ZJYA 4EYOA 1VKHA 2WYVA 3KJHA 3F1LA 4PZDA 3U44A 3N0XA 5L45A 4CYMA 5LZ5A 2SNIE 4XI9A 4ACAA 1WETA 4QGFA 5H70A 2BGMA 4YJ3F 2H0QA 4MVJF 1DWPA 1TRHA 1U31A 2D6FA 2E55A 2IE8A 1V45E 1SUEA 1PK8A 5FOVA 5IAJA 3T4PA 3WWYA 4IWXA 3I76A 2VF2A 3OEWA 5GIPE 4F1KA 2YWFA 3EX7C 1PUJA 4I8XA 1IK4A 1KZ7B 3SIWA 2D62A 3VSAA 1NRIA 4PXAA 4TRJA 4BVGA 4Y2UA 2RHWA 1HDZA 4F7WA 1MRZA 2BTQA 1I1HA 3V3TA 4AW9A 4B2LA 4KK4A 3JAMA 2A0YA 3GWZA 5B2EA 1JQ3A 1KK1A 3T1NA 3JWIA 4RZSA 3TSCA 4ETMA 1NNEA 1F51E 3B3QA 1KK2A 1CP3A 2QV0A 2R85A 2VPQA 4PHHA 3Q9NA 2R62A 2XW6A 1ND5A 2XUFA 3TOZA 1HK7A 1NLZA 3FYDA 3K96A 1GN9A 3NC4A 3O74A 4DHWA 1NJ5A 1D2AA 4HVCA 3THXA 1XMSA 4CKWB 5LB4A 3G0GA 3NBMA 4QQ8A 2V74B 1JEYA 2HK7A 4TKVB 1D6NA 1EEXB 3HY6A 4BP1A 4R7GA 3NEAA 2JLWA 2W6ZA 1LW7A 2M6KA 1K2WA 5CA1A 1QVAA 1F1BA 1R5JA 4PNZA 1H5UA 2PVSA 1DTWA 3C2QA 4QOHA 4Z9XA 4DIFA 4JR0A 2AXPA 4MHSA 1IXYA 1L0BA 2OV6A 2W0MA 3R74A 3QUCA 5EIFA 4P8RA 4JENA 4TL6A 3ZE1B 3L7MA 4M4SA 1ACMA 4DSTA 5K6RA 2A9PA 3EQ7A 3QOXA 4HNSA 4KGDA 2C0PA 3O83A 4QULA 3LLSA 3S7TA 1H94A 1F2VA 2QLLA 5E4JA 3V1YA 3REGA 1SBCA 1E98A 1N7GA 2BKUA 2FXVA 3K9NA 1MN6A 1FMFA 1SUWA 4MWTA 4KZKA 2HHHB 3AVXA 4LYGA 1FSFA 4QUHA 4BAGA 3SSNA 4CM8B 3DAFA 3PA6A 1GOTA 3OCVA 1S7GA 2QX6A 2XNJA 2DQ4A 3HKDA 3PFHA 4JBGA 1V2HE 3DMTC 1LQUA 1EQ2A 3AY3A 1CUCA 3Q10A 4J7CA 5AKGA 2WILA 4BYMA 3S2ZA 5A04A 4KR3A 3LUBA 1N75A 1LLDA 1Z7YA 1U9IA 2NZ8A 3GJ6A 3M4XA 2ZKIA 5EIHA 2Y2VA 3K92A 1UM9B 4OHOA 4YVFA 1JECA 4CF7A 4JYZA 3PF8A 2YOFA 2BE9A 2HQRA 1OPRA 5KIAA 2YY6A 5ERYA 1IJFA 3R3WA 4R84A 1G8FA 4UTZA 4D44A 4EKIA 5I9LA 3JWEA 4N3BA 2UUBB 1Z62A 2PMCA 2DHCA 3F8TA 3NR2A 2GZSA 3TRIA 1NLUA 2JIZA 4U6QA 3I45A 2EL7A 3A1CA 2YIDA 2PIDA 3GGDA 4KFCA 1YA4A 3UK2A 5DTEA 5BYJA 4L8VA 5CH8A 3PQEA 5ALGA 5EYPA 4YHBA 1MTOA 2VWHA 2YICA 5A5VA 2PLAA 4UCFA 4XVQA 2NUTA 2PYIA 4HY3A 3RTEA 1AXGA 2I80A 2VCYA 4AS1A 2V0NA 5KKAA 2PX2A 4MR8A 1P7YA 3G8YA 3LX5A 3PT5A 1BC5A 1EGHA 3AB3A 1GG2A 1PQWA 1JHPA 1ZGHA 4V3CA 4WXYB 5EPEA 2HF7A 2B1QA 5F1YA 1XALA 5HGJA 2PBFA 4XJVA 3RS9A 3CCFA 2ZSBA 2JHPA 1X7DA 3A6GA 3AEQA 3HXLA 4ZRDA 4DQLA 4QYTA 1QH1A 3N2GA 3DXYA 3RBXA 2FUG6 1NN3A 4FFLA 3M8KA 1MAWA 1DBRA 1JFLA 1JUDA 3LOQA 2IS6A 3EBLA 2BFEB 1KVSA 1T1JA 3U26A 2CXSA 4NMXB 2FR8C 4X1KB 2NU8A 5EY5B 4FYIA 1GARA 1WV1A 3NT5A 2YW9A 3CBGA 4YDSA 1JI0A 1N33B 1U4SA 4X8OA 4E2XA 4P32A 1JR3E 1YS1X 3AUJB 3HY4A 5DN6A 2XB2A 2PX3A 3IQEA 4NU5A 1U8XX 2QRNA 3BERA 2PM8A 3INYA 1G4UR 4TTJA 1U8EA 2PX0A 4BRUA 4G0UA 4AKHA 2HCFA 1XPUA 4URUR 3G2KA 4HNAA 3ONVA 2GN0A 3Q7PA 2E3JA 5H3LA 3ZHXA 1CB0A 1E0DA 4PC1A 4Y1FA 3A9CA 2J08A 3TMKA 4CM7A 5JVDF 1E2NA 2GS9A 3E5MA 4CKYA 2A84A 3E1KA 4AKTA 3Q3CA 3M5CA 1GQRA 4CQLA 1NNLA 4CVNA 2UUAB 4ZGBA 5D5HA 2B78A 2A9VA 4C2BA 1P4RA 2C82A 3OKFA 4GZMA 3G59A 3JQCA 1TC1A 2WFAA 4G5SA 5CFZA 5IZ4A 5CCBA 1AGPA 4HDNA 2FPLA 2G0AA 3HUDA 1YMVA 1LU9A 4BS9A 4GP9A 2A67A 4JD5A 2J07A 1L7VC 2APJA 4DCNA 3OF2A 2JI8A 2J67A 4P83A 5EI5A 1E3WB 3DE4X 3MG9A 4DRXA 4JB3A 1OBHA 1CLUA 4I3GA 3KTAA 4TXLA 4M1TA 5KQGA 1UR5A 4XB2A 4JVLA 3ZV7A 4M1WA 2NADA 1GUBA 3S5UA 5A3QA 4XKJA 3TD9A 3FH0A 1H8EA 3DZFA 2ZE7A 3GH1A 5A2GA 4OHCA 5HW0A 2GERA 3FUUA 3N2KB 3F5QA 5KVSA 4PQGA 2C5SA 4GI3A 4GGOA 4KIFA 5L3VA 3S44A 4DCVA 2PN1A 3PRHA 1ST2A 1XL0A 4X3CA 1DT5A 1Z07A 2HA2A 4B6OA 4RGQA 2BONA 4CL3A 1SA0A 1ZM3A 3PNMA 4YJGB 4POOA 4OFXA 5IN5A 2XLBA 4GPD1 4XWKA 3VNVA 2AVDA 1Q1AA 1JG7A 2J5QA 3QU7A 1O08A 1EWRA 2EBFX 3HJRA 5LKAA 1VGVA 2ALJA 4EYKA 2ORIA 2G7MC 4RSMA 1FTYA 5KOIA 3FNRA 3HCPA 2ZTUA 3QKUA 3H5IA 1HE8B 2Q2VA 4N01A 4WJZA 4BKRA 4EW3A 4RMJA 4DIMA 2JGMA 1AQLA 4QGGA 4UVDA 4GC9A 1LBIA 1ZUWA 3JZMA 4LY9A 1D2NA 3MJHA 2JKYA 2PE5A 3ET5A 4LPKA 3SU8A 1R6UA 1RYHA 5CLQA 1XMPA 1FLNA 3HJTA 3FMPB 3JAKA 4XIGS 4RYDA 4WXHA 3PXBA 4I5GA 1G0NA 3IUMA 3FWPA 1CF2O 3K9FC 1GWNA 4KXFB 4Q7LA 1MOSA 2CCJA 2GFIA 3C6KA 2JAHA 4Q66C 4MLPA 4D0SA 4YAKA 4B44A 1NT4A 1GUAA 2D4AA 4Z6KA 2WQ6A 2ZBEA 1Q77A 2JGJA 3OIWA 3IMKA 4LRXA 4AT1A 3I0NA 4IXMA 4RKYA 5B7QA 5ITSA 2DHRA 2Y3IA 4G89A 1ZNYA 4ND5A 3EJ6A 4BN4A 4A8JA 2VDMB 3PI6A 2REOA 3TLGA 2MMCA 1G9XA 3S4YA 1QFJA 4WERA 2X5KO 2AD1A 3R5FA 2JCGA 3E2PA 1V6AA 4QVIA 5J1TB 1UZAA 1U02A 4MQ6A 3U40A 3ZKWA 4I50F 1KETA 3OVMA 5JSQA 4CMKA 1UEIA 1I51A 1CR4A 3PQ8A 2WJHA 2FZCA 3E2MA 3IHLA 1M7HA 3M3HA 2P5SA 1KYTA 2X2PA 3BRWD 3SOZA 4QJIA 5B1HA 5ESDA 4D4JA 2O0MA 3IP5A 4PC2A 2OXFA 5J47A 1K9SA 2EC5A 1FRFS 3WLKX 3AUKA 1KYWA 2F62A 4D0GA 2OYSA 3C7TA 4BNGA 5HA5A 3E7DA 5TV2A 3WDLA 5LIPA 4GQIA 2J09A 1NQVA 3NYIA 1Z7GA 2PX6A 3WLJA 2O0LA 1JHMA 3FVWA 1HTWA 1QVZA 3LUPA 2G76A 2JKVA 2QTRA 4JGIA 3VH1A 2VWGA 4ZYVA 1GGHA 1YR2A 2WIFA 2DWCA 2NTYC 3FFAA 3IDSA 3OY7A 4MINA 4EFLA 4HH4A 3RVBA 2WJZB 4XYMA 2JLSA 4TWAA 3K70C 1J8VA 2GF0A 1XZQA 2GZ3A 2O2ZA 3ANNA 3AFIA 3IYLW 2P2YA 4QUKA 7REQB 3GLUA 5KOJA 4PANA 1CULC 2C99A 3CRRA 3HKCA 3O38A 1Z4LA 1ZGJA 2YJTD 3JWHA 4QU8A 4WOCA 2YTZA 1YFKA 2ODQA 16PKA 2W8BB 1BSVA 3AEKA 3D59A 4PGFA 3THYB 1HDOA 3PX3A 4ZQGA 1PFKA 2H7VA 3P96A 1SCDA 2ORWA 3A25A 4AJNA 4YUYA 1GSHA 3B5EA 4DNOA 1IZ9A 4DC9A 2GT1A 5EAIA 2ZTVA 3K6KA 5AYVA 4ZKEA 3EVAA 2P8SA 4QHYA 1Z2EA 4IH1A 3U3DA 1A9PA 3BILA 1JKFA 1RIFA 4EG6A 3LC1O 2PL5A 1PFYA 1IM2A 4ON9A 5DNUA 2H00A 3JQ7B 3SE7A 2YFYA 1IY2A 4RJ2A 2FPKA 3FZGA 4O2RA 4JBXA 4DLRA 3NRBA 1KO5A 3IB6A 3TKAA 4U02A 3RI3A 5AM5A 2WTXA 1A9QA 2I34A 4B6GA 3QEMB 1Z06A 1IBLB 3VKHA 1Z5VA 5CDFA 3ZNNA 1Z25A 4ALNA 1ZBDA 4Q1VA 3N5CA 4H3SA 2FW0A 2GZRA 2MINB 3RVSA 4Z7JA 5JANA 1BS1A 2BFFB 3FHJA 3FUXA 2GEUA 2IUSA 1J8MF 3ANLA 1NW3A 3PL1A 5HDBB 3KR0A 1SBIA 3OD1A 4HH0A 4BB5A 1Q50A 2H63A 3EQ8A 4ZVOA 5LU9A 1C1YA 2QLNA 2EP7A 2UUPA 3H8JA 3MWDB 3A6KA 4FOTA 4WD3A 2IS2A 1TK2A 1Z2PX 4IQGA 5THXA 4PGGA 1HC7A 3RUIA 3SC4A 3V8NA 4AJHA 1AQJA 2OZLB 1AJEA 1D1PA 3I2HA 4ER3A 4DLPA 4H59A 1XCJA 4YJ3B 2F3SA 4C7XA 1U0NA 1Z83A 4QPJC 1QR2A 4L85A 1XMVA 4S3MA 3DPSA 3IPXA 4G5OA 4RF2A 4TKMA 2BKVA 3RB8A 3OQNA 3GLGA 2AMVA 3PC8C 1IY9A 3R3XA 1LY1A 5KB3A 1I7NA 1KC3A 1LSUA 3EOAI 4IO1A 2ZK7A 1QTNA 1YHZA 4BFUA 4HADA 2VJYA 3ZOZA 3MM4A 1CRLA 2ENUA 1D4ZA 1E61A 2R65A 3QEOA 3S2UA 3TN7A 3CZAA 3CNQS 3U9TA 1AG9A 4BQIA 1ESEA 5K3CA 1DCFA 4B2IA 1DEOA 4PLTA 3F74A 1B6RA 1K7SN 2NO0A 3KZXA 4UFPA 1P73A 1TEZA 2JK1A 4QUBA 2NO5A 4MV7A 1AO0A 3LA6A 4I1UA 1TK9A 1UP7A 2XUHA 3FPCA 4QU9A 1B0ZA 4FFDA 4MR7A 3I73A 4RHYA 3HLYA 3V5NA 4UBLA 1J8FA 1ESDA 4URFA 3UYLA 1GDDA 3HCDA 1FDRA 4EY8A 5HPYB 1AKNA 3JVDA 2XRYA 2OL4A 2HNKA 4BWYA 2NTVA 1II9A 2FPGA 4FIDA 2OYCA 2A33A 4YCJA 1E96A 1GKYA 1OI7A 2DKFA 2BFNA 3CR3C 4RKFA 3GT0A 5KYYA 3I72A 4PSUA 1FIUA 1E6EA 3UTDA 4AECA 5HM6A 4ZC1A 3TTWA 4A16A 4C43A 4EHIA 4ANFA 1T0HB 3JZAA 1LSOA 1D4OA 1PJRA 3GZNB 3O3MB 4EYQA 2G5CA 3TNJA 3JQPA 3BL5A 3KXIA 1V11B 3UA4A 3WLLA 1Z8NA 2W6OA 3VZQA 1PV1A 1L5ZA 5TGZA 4PFSA 1IAVA 1TM4E 3SI7A 1H5NA 4YCLA 3UGQA 1NMXA 4Q15A 2GCPA 3Q40A 4PTZA 5AM4A 2AR9A 3EPKA 2GTIA 1QP7A 1T1GA 5BN5A 2Z57A 1DAKA 1ZK0A 2B92A 1P1KA 1R12A 3B3GA 2RGYA 2F9MA 4M88A 3FW1A 3USES 4Q9AA 5IAKA 1T5HX 1A50B 1VXRA 3PQ2A 3OEED 4KX3A 2QTZA 4U0JA 1Y7PA 4KB5A 1ZXLA 4RESA 2OPHA 1TUEA 3WGOA 2FFHA 1LZLA 3IEXA 2DWQA 5DX8A 2H4XA 4D3YA 3AJ9A 4X3OA 2UYQA 1YRQA 2QN2A 3CNEA 5G1OA 1QNLA 2H54A 1RC0A 3QEAZ 3M83A 1KJYA 2NGRA 2J1LA 4QXPA 1RZRA 2IDKA 5KYGA 3FPJA 3HVIA 3MELA 1F2DA 1QC5A 3BH6A 5J4VA 4RTJA 1VKNA 4J76A 1WBBA 3QVGA 1Q7CA 4G8JA 3AWIA 4MEJA 1JQDA 4R1MA 2QR3A 4R1PA 5F7XA 3QENA 3RKRA 2I4TA 5AK6A 4AJIA 2ZR7A 2X5XA 3DTTA 3Q8WA 4JI1B 4RHFA 1KQGA 1ZIYA 5WRFA 1NPDA 1GAWA 4YJHA 1P0MA 1Q19A 3D8BA 2D5CA 4IM7A 1T0BA 3ED1A 3M4JA 1KJNA 2OQIA 4RV9A 2QROA 3V7NA 1Q20A 1XZJA 1T36A 4B6FA 5I8WA 4AJ4A 1E3LA 3ZXIA 4F93B 4HGOA 3CVJA 1QDUA 1OBFO 2Q2WA 3IVMA 3QI7A 3CV3A 5D87A 2O4CA 4B7XA 1OU0A 1G6OA 2A92A 1EXDA 2VQDA 2X0IA 2C9MA 2F3TA 1MZVA 3JQ8A 2YXPX 4JDPA 2OMKA 4IF6A 1MJGA 1JLSA 1TPZA 4GC5A 4OH1A 4MV1A 2HOQA 2J3DA 4PE5B 1RR6A 3PFBA 3V97A 2BUCA 4EA6A 3QLTA 3P0RA 2Y1OA 1TJYA 3FOZA 2DCMA 4QJBA 3RWOA 4BP9A 1Q0UA 1M2HA 1RXCA 3EXFA 2ERCA 4JI3B 5C9ZA 2QZSA 2IHBA 1XTVA 2GCGA 2XIJA 3EUAA 5ENZA 3V42A 5KPDA 2CF5A 4EB6B 1MB4A 1I36A 1KXZA 2LIPA 1AXRA 3RC8A 4C0WA 3Q7TA 2H65A 3REOA 1EB9A 3FDZA 3PFCA 3OJFA 4ZC8A 5F98A 4L8WB 4JXJA 5ELXA 2YJ4A 1X19A 2ZJAA 2DAPA 4G63A 4YCDA 4D8XA 1R8SA 1A69A 5JVDB 5CDTA 1BCSA 1XN4A 2FYTA 1GXSB 4YLGA 5DYGA 1YCHA 1J9EA 2WDZA 2PD4A 1ULZA 5DLYA 3WB9A 1UAGA 1EE1A 2IYTA 3R6TA 4A7PA 3SZ3A 2QMOA 3CR8A 3E8MA 4CEIA 3ZCRA 1FFYA 4FB5A 2B7BA 3OLXA 1I7LA 3T3EA 3TIXB 1XPOA 1C3VA 2X8AA 4LNHA 4QBKA 3JQGB 3R3VA 4UVEA 1RCUA 2DU8A 4KKXB 4WVLA 4Z0TA 5B37A 1L5HA 5JE8A 2VH2A 2JB9A 1GT6A 1P1JA 3DLIA 3K35A 5C8DA 2FOLA 2P6OA 3MSXA 3KU4A 5U4QA 1IZ7A 4KOEC 5HSGA 2C3OA 1HDEA 4MJ7A 1JEQB 1PV4A 4QTYA 1VIDA 3CKYA 1T5BA 1FSZA 2X77A 1BMFA 3NVMB 4WXMA 5ER6A 2C4WA 3NHYA 4GGMX 4CLRB 1VJ1A 2PKYX 4NNPA 2JBAA 4JH0A 4MR9A 3WKEA 2DQKA 4P92A 3B7GA 4NTZA 5JAHA 5CD9A 5GZ3A 2JGAA 1FQKA 1M0WA 1LDNA 4F72A 4LJ4A 3FFTA 1CUZA 1JAHA 2AF4C 4XGKA 4JYCA 1L5YA 5FX2A 2KM1A 2A0KA 2EU8A 1JQLB 1II0A 3DR5A 1PWHA 1WHSB 1NJ1A 3PL5A 2D2VA 3CYFA 2XTNA 3STHA 2XGJA 1SO8A 3N87A 1YJBA 4XDZA 3NT2A 3NP9A 1K63A 4YP5A 3I28A 2KS6A 3DB1A 4KL8S 4OQXA 4E6EA 2Z6UA 1W5FA 2HN9A 3IULA 4A73A 3HGMA 1OAKA 1ZWLA 4JQCA 3L8EA 3OOEA 3SAJA 3DDCA 2QP4A 3UGTA 3KSZO 1QQBA 1JAIA 2QM3A 4ZGGA 2I1QA 5HZHA 2YXEA 1JGTA 1QDEA 3K5PA 3PLNA 2VR1A 4XUDA 3IVCA 3GRRA 4WCFB 2W2LA 4R69A 3N75A 2VNSA 5DTJA 3FTDA 3UGKA 4NYJR 1DVRA 2CHFA 5EQTA 5BUCA 5I4BA 1GTZA 3UH1A 4O3FA 2X6RA 1VBMA 3VO8A 4ZTUB 2QPLA 1ISMA 3T9AA 4L5IA 5LOVA 4AY3A 3ADCA 2BDEA 3D6HA 1E9EA 3EC2A 4I55F 4YROA 5CVCA 2DFNA 2IU6A 1ATIA 3GMSA 1IONA 2HJ9A 4F4FA 1C30B 5KTTA 1G7SA 3D3KA 5JJLA 4QASA 1RPJA 4D45A 4Q1EA 1E0KA 4TLDA 1XEWY 1EFCA 2LPMA 2OLJA 3OBIA 3RPEA 5C35A 3GLHA 1PQUA 4YCNA 1W48A 2Z8YM 2DFKB 4JQOA 1DGQA 4I50B 3UKJA 1QO0A 2HRRA 2JJQA 2O0JA 2YWXA 3LHDA 4RL4A 3AYXB 3WGTA 3ZNPA 1KJIA 4BYGA 5F2OA 5HIAA 2X76A 1MOPA 3NHFA 3DLHA 4FE7A 4P4NA 4M76B 3WGUA 3RCBA 2HD4A 1ZD8A 3TW6A 2FK7A 2YZGA 3NM4A 9LDBA 4YDHB 1NX9A 2CL7X 4IW3B 1FUEA 5LBUA 3STVA 4N5NA 3G0CA 2REQA 3DMDA 4AO6A 1HL3A 5JNRA 1Z8FA 3NCTA 5B6JA 2P1ZA 3USCS 1NXWA 3EVGA 5HDQA 2PZ8A 3RC1A 4MUYA 2FZWA 4OK3A 2YN4A 3GLTA 4ZO8A 5K05A 1US8B 3QYFA 1TMYA 1XLUA 1G3IA 3GPDG 1RPNA 4GLFA 2FY8A 3O3NB 4V0QA 2I7DA 4KN8A 3NONA 1M1NB 2CLOB 1PWXA 4NHEA 4PPFA 5EGSA 4LW8A 2CMKA 1C2YA 2VJBA 4GMHA 1JQEA 4GP6A 4KGVA 1LB1B 4CU5A 3PWKA 4ER7A 5HCUA 1EXWA 4F6RA 2D5BA 2DVMA 1OKKD 3F6PA 1WUJS 4H1HA 5KQRA 3P97A 3QX7A 2W6JA 4X93A 3DOIA 3MHTA 3ES9A 1QIJA 1IWOA 4XFKA 4ZU1X 1H0SA 3VUFA 1D1TA 1R0WA 1XCLA 3A1TA 1IXZA 1GIAA 1Q0ZA 3TOXA 1KZ6A 3G5LA 4RZXA 1SXGA 5C8VA 2GEDA 3U6BA 2EV9A 3H2HA 2PRYA 3A6LA 3I0MA 1BVYF 2OB1A 5DULA 2JRLA 3CW2A 4L0QA 4AY5A 2D4HA 2J59A 3HNRA 1HYEA 1XE3A 3G6KA 1L4HA 2J6IA 2GZHA 2ON6A 2ODAA 4TKUA 1JIIA 3UO8B 7GPBA 3H4VA 1Y8RB 2VK1A 5E0OA 2ZJBA 1LRJA 4E5KA 4ZHQF 5ILQA 3UG7A 3V46A 4PWZA 5FUYA 2F1IA 1B8PA 3OOWA 4BL5A 1J0CA 1PFQA 5KVQA 1WNTA 4R1TA 3HWWA 3VNQA 3G79A 1G4HA 4WCVA 2VF5X 4ZP1A 3VR3D 1EQAA 4AKSA 2H9YA 1PR6A 5HG0A 1JPJA 2NPFA 2PPLA 1G7TA 4N7MA 5CB8A 4XTRA 2BZSA 4MGIR 3AUUA 1LQ2A 3HDTA 5HX7A 1SCUA 3V2GA 4Q1CA 2RHMA 1C7JA 1EM8B 1PZHA 1K27A 2C2ZA 1G7RA 2IIVA 2OHOA 3B6ZA 3ESYA 2JFOA 1BXRA 4HDQB 1KY4A 1M6EX 1TUGA 1UBTS 2CNWD 2QWXA 4HD8A 1N0IA 4IJ5A 4LQLA 3D6UA 4ZOCA 5KYWA 4BQSA 4ILKA 2I4RA 3LQFA 4YV1A 3GPLA 4UD6A 1QE3A 3IVRA 1WG8A 3IE1A 2OY0A 3WB0A 1R37A 3D31A 2JH8A 2GRJA 1BDIA 5LDGA 1DRWA 2CFIA 4H7FA 3CEPB 2VP4A 4OGWA 3I01M 1L7RA 1DJQA 2ZYHA 3RLFA 4OHWA 2I6SA 4MDHA 2JL1A 5I7UA 5SYMA 3AEUA 4QTZA 3CX3A 3LFTA 4NY1A 1BQEA 3G3EA 3KFXA 4LMAA 3PPYA 2WUGA 5DLEA 2WD7A 1G66A 3QM1A 3WWCA 1N92A 3RYCB 3WGLA 5JS1A 4U7PB 5EWMB 5IC6A 1KF0A 2BRUC 3PSAA 1FL9A 2P9TA 3QSYA 3SHWA 3SOPA 1OTXA 5K3EA 2A1TS 3H5OA 4ZALA 4G9EA 2QV7A 2QPTA 1UP4A 2YVKA 2GD6A 1RCTE 3E22B 1KSHA 3MJVA 2QX9A 4YRBA 3HFSA 1T6ZA 3HR8A 3FWYA 4GLJA 4U7JA 4W7IA 4X71A 4J4HA 1N8TA 4QHSA 3HB9A 2CDBA 4V0RA 1CUDA 4DPKA 1CHNA 3R7WB 4RKQA 1RYFA 1NQTA 4F84A 2CXRA 1VOTA 3EXIA 3K6SA 2JAXA 3BH0A 3OF3A 4H17A 5KHAA 2OZKA 2R3SA 1QP8A 3PC8A 3K6RA 1XAHA 1ZNWA 1YZTA 3QVUA 3QX8A 5E9JA 1E9RA 1RM0A 2Q07A 1GCOA 1OIWA 1JG6A 1RQGA 2IEAA 1ANKA 2YMLA 3IR5A 3WHKA 2ODWA 2CE7A 2BT4A 3KK0A 2FZKA 2PJZA 1IHYA 1MT3A 4TTTS 3F5SA 1AD2A 1MIOA 3IAS6 3RBAA 4FNGA 3I8SA 2VK8A 4J0QA 1N2BA 3FLBA 2BFDB 4L5CA 2CF6A 2PFGA 2AMLA 3QVSA 4ALJA 2GFQA 4KRFA 1YR9A 1JAYA 2EW8A 4DTIA 5K45A 3QV2A 4HAIA 3U0BA 1Y9AA 4GPAA 4GX2A 5IHXA 3LZDA 5J2UA 3JASB 2EQBA 5TY0A 5MF6A 1PT5A 2Y77A 1MFPA 4E12A 1WP4A 4QZVA 4EA9A 2OCYC 2BMAA 2Q28A 5HMMA 4XB1A 3U3JA 1CQPA 2YFKA 1NVBA 2RSLA 3LYUA 3QBTA 5EJAA 4BMNA 4EUNA 3RF7A 2R7MA 2VF4X 5F64A 5B7NA 1C7ZA 2V7GA 1V1MB 1O6FA 1W35A 1JIKA 2F7SA 2VPWA 1FJGB 5BVGA 3ZWBA 3JVVA 3OE7A 4JLUA 1OLXA 3AW9A 3DTYA 3DXFA 4B3GA 4MAMA 4OU5A 1T5DX 1J97A 4R83A 2GQ0A 1IQPA 3KOMA 4ZT2A 5KTYA 2R4QA 3EIXA 4GI1A 5THKA 1GU7A 3RK1A 1DCKA 3F3KA 2A78A 3IHWA 1K7FB 5KS2A 1JP7A 2XVXA 2LBPA 2PA0A 3LHIA 3SMQA 4YP0A 4HZGA 3KXKA 2ADMA 2VPZA 1DQPA 4IRMA 3PUIA 4KE7A 4DG5A 2FEPA 4LI0A 5J40A 2WHPA 3ZDEA 3QXCA 5ISMA 1CZOA 1M6YA 4CMEC 1EFLA 1MJ5A 4ZRMA 5KYVA 1QQTA 4B6SA 5JALA 3EIOA 1CD5A 3K1ZA 1WB4A 3EXEB 3R0IA 3FLMA 4WL0A 1TI7A 3F3MA 1YO6A 3TZHA 4ARUA 1Z37A 2RMKA 2VHCA 2Z2KA 3AY7A 3T95A 5BN4A 4UU1A 4UM9B 2P30A 1IJBA 2P2NA 3FD8A 4IYJA 4JYPA 2PNJA 3SNHA 4R2HA 1TD9A 2FLKA 3DUFA 4D3XA 3FDJA 4B46A 2PKQO 2W6MA 3FNFA 3ZDZB 3FYSA 1DQZA 3OFJA 2KBEA 3GGOA 1E3EA 3CUEF 5LQNA 5CA0A 4LJ7A 3QOYA 1ZMXA 3OT1A 3N0TA 3W5AA 2G71A 3DZCA 3IKVA 3OLQA 4QQNA 1DSSG 2BR4A 3KQSA 3LCUA 1P60A 3Q1LA 5D1NA 4BO9A 3L07A 3NBXX 2G7ZA 4CI9A 1LD3A 4FYVA 1PF7E 3NTRA 2BI4A 4RZUA 4UNSA 3HXMA 2E4WA 4GU5A 2Q1WA 5KWEA 2EATA 3FRJA 2IHUA 4KN6A 2JK0A 3D5EA 2SHKA 1NUPA 1VL2A 4QFCA 5EZSA 4F9TA 2YR0A 4LZAA 3RJZA 2ZRKA 3KVNA 4FMPA 2O20A 5E3JA 1T6XA 4GW3A 4EO7A 1QOQB 2GZDA 4RPLA 5KDDA 1ENOA 3OZVA 4RJJA 3IPLA 3PITA 3C6MA 4TN1A 2DEUA 1TZCA 1HLGA 3WIDA 2RHDA 3C3DA 4AVYA 1GITA 3ZJVA 3CSUA 1BO6A 4WY2A 1T1RA 1XCBA 1XEXB 3SDSA 5A3RA 1GD1O 3CN9A 3CR7A 4W63A 2C77A 2H2IA 2KSQA 2A7QA 3ZIAD 1EP2B 3TBFA 5B7GA 5I9NA 3FBTA 4CM4A 5JROA 1R0BA 4Q9DA 4RFVA 2P69A 1OAOA 4QYIA 4EZBA 2FW7A 3U44B 4WBXC 4YB8A 5LKRA 5KCMA 2QIPA 1M74A 3DHYA 1DU4A 3NFRA 4GOND 4DKXA 3WL5A 4WESA 4LJ8A 1RRCA 1N5OX 4LDJA 5AKHA 5TVGA 1Z6XA 1HE4A 4YUXA 4UQOA 4DCCA 1UK6A 2XUKA 4OHBA 3IV9A 3VBEA 3H9GA 5JMPA 5HWSA 1DRKA 4BVHA 5MFZA 1F60A 1QHHA 1CSEE 3ZWYA 2ZB4A 1KOLA 1D2EA 3ROXA 3WQRA 2JFYA 4NBNA 5FHRA 3QXXA 4MV3A 4FKZA 2BTQB 2EZ9A 2IFTA 4I9FA 4FMCF 4WLEA 4I1VA 1J5EB 1I2DA 2M9MA 4OOEA 2XBMA 2VQ6A 3GLVA 3D3EA 1EVEA 4MLCA 4S1PA 5L3SA 5I4KA 3OIGA 3OU7A 2PKCA 3RHZA 3LRTA 1V8ZA 2C07A 3MPUA 4FXPA 4JAVC 1NR1A 2PL1A 3V1KA 1BE0A 4DIEA 1Q44A 2QX8A 4Q3BA 1RWOA 1OXXK 1WDTA 1DKRA 1DRJA 3H9EO 3IIEA 4H18A 3VJLA 3V4FA 5B3JA 4V0LA 2IYPA 3F7NA 4TZKA 3KQNA 1E2IA 4QG7A 4DBLE 1LTHR 3VGJA 4MARA 3JQRA 3ISTA 1NF3A 1WSWA 3P0HA 3UXMA 2W43A 2C3PA 5EVJA 5KEIA 1DTWB 1QYDA 2QVXX 4DG8A 4DKJA 5COBA 3P2KA 4ZODA 4HDKA 1QPZA 4C78A 4OHKA 2VT2A 3I9LA 1C2TA 4I55B 4BGEA 5C32A 6AT1A 3E03A 2Q3EA 1YMUA 1UPUA 3DDUA 1OE0A 2QYSA 1HPLA 3LL4A 3M5DA 3VU1A 2Y9MB 4BLSA 1JH9A 1I4OA 1JLHA 1WEHA 1Y3CE 4P84A 5DCYA 4FMDF 3C3MA 4HF7A 1UMCA 1PDWA 1AKQA 1K9VF 1VPVA 1I01A 4EITA 1ZCJA 5CDGA 3GLQA 4GYYA 5AKEA 3DEKA 2XOXA 1XKTA 1ZOLA 2WPNA 3N8DA 1F5SA 3MJSA 3HKDB 1GAEO 4OMFG 2QJFA 1GRQA 2IZ0A 2V59A 3VHQA 3KKMA 4HEJA 1VCHA 3D7MA 2XE7A 5JASA 4FN5A 1YV9A 2VA9A 5BQPA 1JPNA 4KCGA 4V24A 3RS0A 3WLEA 3E23A 3OJ0A 5JBNA 4OL9A 5JSHA 1NVMB 1K0UA 3A9WA 3NIWA 2XMRA 3DVSX 4OQDA 1JJ7A 2GB4A 5KSPA 4K8RB 1SB9A 3IBSA 4MP8A 2AZ4A 1IDN1 3OTGA 1ZN2A 4NE9A 4OXNA 3PKJA 4RQUA 2HEIA 4L9AA 5JNTA 2UUCB 1H2EA 1E4YA 1XU7A 5EMLA 3HVKA 5LMCA 5AUPB 2YXBA 1EM6A 1H2YA 1QH8A 4HNGA 4NDNE 1G2QA 1XZCA 3KB2A 4NULA 4RM3A 4YFYA 3VO1A 4Z7NB 1V16A 4E03A 4FINA 5IWAB 2FWNA 4LJ5A 4NZNA 4JV5B 3FZEA 4MW6A 3C8ZA 4YRLA 3PLRA 1UQRA 2FFJA 4P4GA 4L0MA 521PA 1NXOA 2C1EA 2VHWA 1J42A 5M34A 3UOWA 4MR8B 5K3FA 4EIWA 1VB3A 3DEAA 3ZDQA 1NDHA 5EG5A 1Z33A 3EGDA 3KWMA 3WDMA 1KXJA 3HB1A 3LQ1A 1QP0A 3TNFA 5EUMA 4KK3A 1DWOA 5BSKA 4DLBA 1QH1B 2OO7A 2C96A 5MN6A 2PLRA 4H9GA 4KAFA 3CZQA 5DTMA 4CCYA 5SY9A 1MZPA 5CK4A 3UJAA 2XMPA 4G1MB 5AXAA 3W2HA 1UXIA 4EHLA 2ATIA 2QZ9A 4QWWA 4ZHQB 1BQ4A 3QUTA 4Z3DA 3C87A 4FSDA 1TCUA 2BYTA 4BNMA 4HG2A 3NPAA 3MUFA 1YDGA 1U2TA 1U9JA 3LDFA 3UMMA 1BXKA 3TO5A