3EPPA

Crystal structure of mrna cap guanine-n7 methyltransferase (rnmt) in complex with sinefungin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
308
structure length
265
Chain Sequence
IFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Crystal structure of mRNA cap guanine-N7 methyltransferase (RNMT) in complex with sinefungin.
rcsb
source organism Homo sapiens
total genus 97
structure length 265
sequence length 308
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3eppA00
3OPNA 5HIIA 3GWZA 3PFHA 5HILA 3KPYA 1ORIA 2AOUA 2QM3A 2HMYB 3KQPA 1SVUA 3TPZA 1NBHA 3O31A 4PYQA 1PRYA 5GINE 4YMHA 1YFLA 2P8JA 1XDUA 2XVMA 3FUTA 4P7JA 3KQMA 5K8VA 3FRHA 2H00A 4YUVA 4LECA 3KQWA 3NTVA 2R3SA 3SXJA 2UYHA 4E2ZA 3C6KA 4HRAA 5C9ZA 3FUUA 3PB3A 2I9KA 3BGVA 3NWBA 4FR0A 1JR4A 5EIFA 5LQKA 2ZULA 4KDCA 1RJGA 2ONYA 3T7TA 5K03A 1SG9A 5DTQA 1EIZA 4E2WA 1RI1A 5DX8A 4ER7A 10MHA 3MHTA 4XUDA 2IPXA 3HA5A 4PGGA 1QAQA 2UYQA 4QQNA 3FPJA 5KYGA 3EGEA 3L8DA 1Y8CA 1Q0SA 1RJEA 3BWMA 3SVZA 4BLUA 4ER0A 4YUYA 2OY0A 3I58A 3EVAA 3LCVB 2O57A 2G8NA 1U2ZA 5FA8A 2QY6A 4RTLA 1X1CA 2G70A 2WK1A 2IH2A 5M5BA 2JHCA 2QRVA 2YXLA 3MTEA 4PYMA 2CL5A 1L3BA 4FSDA 4FS8A 3B7PA 3TKAA 2QRVB 4A6DA 5K0LA 5HIMA 3DLIA 2H11A 3Q7EA 3VC1A 2UZ4A 5E1BA 1JG4A 4QQKA 2PT9A 3Q87B 2DULA 3PTAA 2ZSUA 5ERGB 3HA7A 3GU3A 3TKYA 4F86A 2ZCJA 3WSTA 2O0LA 3G2QA 4QDJA 4FSXA 5CM2Z 3BGIA 3BXOA 4RX1A 1FBNA 1DL5A 2Q41A 4YV0A 4PINA 3EPPA 2ZBRA 3M70A 2JHPA 2C7OA 1KPGA 5IH3A 3ER8A 2AOVA 3IV6A 3OU2A 5F2OA 3KPUA 2JG3A 2P40A 2A14A 3LGAA 4POOA 3NDIA 4CTJA 2YXDA 2Z6UA 1TW3A 1D2GA 4KVZA 1P91A 1R18A 3KR2A 4R8RA 2C7PA 3CBGA 5EHGA 4RTJA 4G56A 2PX2A 5FHQA 4CKEA 4ISCA 2XBMA 2FCAA 2QE6A 2CKDA 2FHPA 4EKIA 1JG1A 5ICEA 3LL7A 3D2LA 2FK8A 4DCGA 3QOXA 2XYRA 1KYZA 3EVEA 3PX3A 1H1DA 1YZHA 1I9GA 4KRGA 1RI5A 5BW5A 3IYLW 2NXCA 4IV0A 3R6TA 3DH0A 3EMDA 5JR3A 5HZMA 1SUSA 1UFKA 3FUXA 2NXEA 3OZTA 5EQJB 3DLCA 1RI2A 3FUWA 5FCDA 4LWPA 4DF3A 2OBFA 3P71T 1RI3A 5DM4A 5FULA 1VL5A 3B3FA 2B78A 1KHHA 2OXTA 1XTPA 2O07A 1P39A 2YUIA 2P3LA 5EZQA 1FJXA 2PY6A 3M6WA 3M6VA 5FADA 3GRRA 5EEHA 1Q0TA 4BLWA 4XCXA 2ONZA 1NW7A 3BKXA 4MTLA 3FZGA 1G8AA 1T43A 1VE3A 4PGHA 4RTKA 3EMBA 1XCJA 5GM1A 4PYKA 1R8XA 2H1RA 3DXYA 3O4FA 3CJTA 3FTFA 1NW5A 3MTIA 1UWVA 2ZBQA 4R6WA 3ELYA 5DLYA 5BXYA 5LQUA 1JSXA 5F2NA 1NKVA 3EVFA 3G2OA 4BP1A 4HG2A 2FPOA 1L3CA 3LHDA 1QAMA 4PONA 3A7DA 3LCCA 4EMSA 4PCAA 4P58A 3C6MA 5P8WA 1ZQ9A 3R9XB 3TR6A 2AVDA 1IXKA 3KR1A 3LDFA 4QDKA 5IKMA 1G8SA 1JQDA 2VDUE 5FHRA 1ZGAA 4RVFA 4V0RA 4CWAA 1M0EA 4MWZA 2FYTA 3PVCA 3ERCA 3BT7A 1G55A 2PBFA 3OU7A 5G02A 1IY9A 4EKGA 3OE5A 3SSOA 1P1CA 3BWBA 4YUZA 5DWQA 1DUSA 2VP3A 1KPHA 2ZVJA 2JJQA 3GDHA 5GOZA 1NE2A 2HTEA 2PXXA 3GNLA 5EC8A 2AOTA 1NT2A 5E9QA 3PLAE 2HWKA 2YVLA 3DXXA 5E8JA 3TQSA 2AOTB 3LKZA 3B3JA 1QYRA 4KWCA 2FK7A 4OA8A 2NNWB 2ORED 4UOEA 5KS2A 1WXWA 1PJZA 5E1OA 3KR0A 3EVGA 3FRIA 5E9WA 5JUWA 2IH4A 4AZVA 5K0GA 3AXSA 4JXJA 1FPQA 5E9JA 1NW3A 1F3LA 2QYOA 3R3HA 5DRYA 2PLWA 4Y30A 3HEMA 1SUIA 3LBYA 4PYLA 1ZKDA 3IHTA 1O9GA 2B3TA 5GIOE 2O05A 3LPMA 2C7RA 2ZWAA 3DMFA 4BP3A 5EMKA 5LQCA 2R6ZA 4MQ4A 4OX9Y 3EEOA 3O7WA 5CVDA 4GEKA 3HCBA 4GF5A 4WXHA 1TPYA 1ZG3A 3DMHA 3G89A 4DM3A 3G5LA 1G60A 5K01A 4HGYA 5EKXA 3TOSA 4KIGA 5K05A 4RTNA 3ELUA 4R6XA 3MGGA 1KIAA 1YUBA 2ZIFA 4NECA 5FTWA 5DTRA 4C03A 1YFJA 1YF3A 2LD4A 4YV1A 2GPYA 3UJBA 3E05A 4YV2A 2G71A 2ZIGA 3AJDA 2AN5A 2GB4A 3ANXA 3C3PA 3HCFA 3HNRA 3I5UA 5K0FA 3GRVA 5E2BA 5E1MA 3ELDA 2P3OA 3EVCA 3KPJA 4GUAA 3ORHA 3LECA 2ADMA 1EJ0A 3DMGA 2OO3A 3HVHA 5ICCA 2UYCA 2PX5A 3MCTA 3OCJA 5F2KA 3R24A 2O06A 4U7TB 4M37A 3SR4A 2AOWA 3GCZA 4R8SA 2VDVE 3V97A 3MQ2A 5EG5A 4E70A 4QVGA 1WY7A 2PKWA 4P7GA 4X1OA 2ZIEA 4YUWA 1R00A 1SQFA 2OZVA 2ZFUA 2GH1A 3FPEA 3LBFA 1DCTA 5GWXA 2P7IA 3M33A 2OYRA 4C4AA 4PCLA 3P9NA 3KPWA 3A7EA 1NBIA 1B42A 2P41A 2NYUA 5FUBA 4E2YA 1NW8A 1HMYA 5FA5A 5LSAA 3MCZA 4CTKA 2BM9A 3P97A 3AWIA 3G88A 3M6UA 5DPMA 4DMGA 3TFWA 1VIDA 2YTZA 2F8LA 3JWIA 2I7CA 4F84A 5ICGA 4C06A 5EPEA 3EVBA 3AY0A 3G7UA 3NWEA 1RI4A 4DQ0A 5CVVA 5EKUA 3UFBA 4IKPA 1SKMA 2WA2A 3RW9A 5DX0A 3GIWA 2V7EA 2NXJA 2JH9A 3KQOA 3PFGA 5FWAA 3S68A 2XYQA 3T7SA 4DZRA 3R0QA 4E30A 3EGVA 2B2CA 4P7FA 4RYLA 5E2AA 2C7QA 5HEKA 1EJ6A 4L7VA 4AZSA 5K0JA 4BLVA 3RODA 1VP3A 2XVAA 8MHTA 4IV8A 3ER9A 3UJAA 3QOWA 2BM8A 3HM2A 3LSTA 2YQZA 3JWHA 1EG2A 2ZBPA 4RTPA 4U7PB 4M38A 2IDJA 3IEIA 2EJUA 1X1BA 3VSEA 4DKJA 3BZBA 4M7RA 1D2HA 3JWJA 4HGZA 3THRA 2BR5A 3UJCA 3UJDA 1HNNA 4F85A 4PIMA 1JQEA 1MHTA 4KW7A 5GM2A 1JG3A 4RVHA 4HC4A 4PYNA 3PX2A 3KQTA 5EHIA 1XJ5A 2CMHA 2NP7A 3SX0A 4GOOD 3M6XA 3UZUA 1KXZA 4HH4A 1X1AA 4R05A 2CMGA 1R6AA 3FYCA 4PYJA 5BW4A 1XDSA 3DTNA 3OZSA 1XDZA 3GRZA 2NXNA 3FTCA 2AR0A 2UYOA 1D2CA 3CC8A 2P35A 2ESRA 1RJDA 2PGXA 3I9FA 4GQBA 2G1PA 5DSTA 4HTFB 3G8AA 2P1DA 5EOVA 2VZ9A 4ATNA 3HVIA 1M6EX 5K0BA 1XXLA 5D1HA 4Y2HA 5CVEA 3M4XA 1VPTA 5H02A 5T6BA 1KR5A 3DP7A 5GIPE 1XCLA 4OBWA 2KW5A 3ME5A 4GOMD 3BWYA 4OQDA 4Z2YA 5C0OE 1X1DA 1L3IA 1YZ3A 3TM4A 3CJQA 1X19A 3G2PA 3P2EA 2P3QA 3KU1A 5HIKA 2PV0A 3OE4A 1NV9A 1F38A 5BP7A 3T7RA 1JSZA 3DULA 4PIPA 2IP2A 3SSMA 5T67A 3ID6C 2Y1XA 4MIKA 3SSNA 2ZW9A 3TMAA 3HTXA 3VC2A 1INLA 3MB5A 3CKKA 4X60A 1ORHA 2PXAA 1JTEA 2GA9A 2N47A 4DA4A 2IBSA 3TM5A 3A4TA 4E32A 3UJ9A 3C0KA 2PX8A 2AVNA 2ZWVA 4QPPA 4MHTA 2AOUB 1I4WA 3DOUA 3P9IA 4GOLD 5D1NA 3RIEA 3HCEA 1NV8A 2BR3A 5DM1A 4A6EA 5CUQA 5K0CA 1AQJA 1QZZA 3G5TA 3KPVA 5EIWA 3THSA 4FT4A 5LQRA 2AN3A 4GC5A 1VP9A 5EGSA 5C1IA 2Z6AA 2OKCA 3GRYA 3KHKA 3DXZA 9MHTA 3B3GA 4KIFA 5CVJA 3U81A 2EX4A 3K0BA 3FPGA 4FT2A 1AQIA 3KQQA 3EEYA 5GP1A 2I62A 3EGIA 3NVMB 2NP6A 1WXXA 3P2KA 4PYIA 1KYWA 1BHJA 4O29A 5EZSA 3OU6A 2PWYA 1FP2A 3BUSA 2ZZNA 3OFJA 5HOQA 4EK9A 4OA5A 3OZRA 1AV6A 1I1NA 3UA4A 5KQRA 2IFTA 4QPNA 5K0EA 3HA3A 1BOOA 4HSGA 5EEGA 4X63A 4YUXA 4QVKA 4XUEA 3ELWA 2FRXA 4H0NA 4K6MA 1AF7A 2PX4A 5DXJA 5T64A 2OPBA 2K4MA 1Z3CA 3A25A 4RTSA 2GAFA 4RWZA 3CGGA 1VBFA 4IWNA 4CXMA 4RVGA 4B17A 5DRTA 4M36A 2V74B 2PT6A 4RTMA 5LQAA 1IM8A 1N7JA 5CIYA 2ZTHA 3EVZA 4E2XA 3P9KA 1G6Q1 1WS6A 1WZNA 1NW6A 2BZGA 3LX6A 4PWYA 5K0NA 1R8YA 4RV9A 3T0IA 3X0DA 1MJFA 4C07A 2OB2A 3KKZA 1O9HA 3H2BA 3HCDA 4X41A 2HV9A 3HCCA 3FPFA 4ZTBA 4AZWA 4RTQA 1G38A 1JG2A 3CJRA 1BC5A 1N7IA 3NW9A 3UJ6A 5DM0A 3G2MA 3PT9A 4RSRA 2JHAA 5LR6A 2AN4A 3B89A 1P1BA 5DTMA 4GOND 2BR4A 5DM2A 3NMUF 2Z6QA 2HR1A 3DUWA 4ER5A 5LQNA 2AZTA 3SGLA 1TW2A 3BGDA 3E23A 3A26A 3SMQA 4EQZA 3KQVA 3I53A 2VDWA 3QV2A 4AZTA 3CVOA 3GRUA 5DSXA 3G8BA 5CD1A 2I6GA 4DCMA 1ZHFA 2Y1WA 4FP9A 3E7PA 2PXCA 5KQSA 4ER3A 1JTFA 1L9KA 4RTRA 5EMJA 5K09A 4LWOA 3GGDA 2P7HA 4C04A 2G72A 4WVLA 2XYVA 2HNKA 1SQGA 5FWDA 4E33A 1QANA 3LDUA 1M6YA 1R74A 3P9CA 5CVUA 2CWWA 2PWPA 5FQOA 5E8RA 3UA3A 3KR9A 2JH8A 4RVDA 3FTEA 1KPIA 5U4XA 2OB1A 2ZLBA 3HVJA 4LG1A 1XVAA 2YXEA 5KVAA 3BKWA 2EFJA 4GBED 4QTTB 3FTDA 4FGZA 4AUKA 3UWPA 3I64A 1EAMA 4C05A 3NVKI 2B25A 1ZGJA 4PYOA 1EQAA 3AXTA 1BKYA 3BWCA 2GS9A 2IGTA 5B1SA 1L1EA 2ZZKA 2YR0A 5EMMA 4C08A 3LKDA 2AS0A 3JWGA 1O54A 3C3YA 3TLJA 3HP7A 4X61A 1JQ3A 1QAOA 5HFJA 4OQEA 5CCXA 2IH5A 3E8SA 4BY9E 2EJTA 2PJDA 4HTFA 4P7KA 4E31A 7MHTA 4QTUB 5HIJA 1RJFA 2IDKA 3GXOA 3TRKA 4EVIA 3REOA 4KDRA 3FYDA 2ZZMA 3MERA 1YB2A 2EG5A 5DX1A 2E5WA 4FZVA 4GC9A 5FQNA 4V0QA 2IBTA 1UIRA 2BH2A 5EMLA 3FUVA 3P8ZA 1V39A 3V8VA 4ER6A 1FP1D 5E1DA 3K6RA 2YX1A 1N2XA 4OBXA 5ICFA 4CKCA 1OR8A 1WG8A 5EVJA 3UJ7A 1VLMA 2ERCA 3FPHA 3HVKA 3UBTA 4RTOA 3MAGA 3KQSA 3DR5A 3OFKA 3GO4A 2IIPA 4XUCA 3SM3A 4PNEA 3P2IA 2DPMA 1KP9A 4CKBA 5DT2A 3NJRA 5CCBA 5MHTA 3B5IA 4YMGA 1VQ1A 3KQYA 2VS1A 3HCAA 3F4KA 2AOXA 3GJYA 5LQJA 2B9EA 4AX8A 3A27A 3CCFA 2PVCA 2PSSA 2WA1A 3EVDA 3LDGA 3UJ8A 3NDJA 2GLUA 3PS9A 3LCUA 5DXAA 3VYWA
chains in the Genus database with same CATH superfamily
1QM5A 2JIQA 4KQ1A 5I5GA 3KPYA 3NBUA 3QYPA 4EAQA 1B26A 2IPMA 2XUOA 5JBIA 4W7SA 1LI7A 2VKQA 3VKWA 3R7AA 5HOEA 1JWAB 4NCXA 1D2NA 1T2FA 4HQFA 1GL7A 3C4JA 3ABRB 3BC1A 4P7JA 4DCUA 1J90A 1T9ZA 1EHCA 1EE1A 3E3NA 2H00A 1HDEA 3FG9A 4LECA 2P4SA 3AX6A 1ZD1A 3FGOA 3AKZA 4C14A 3BGVA 3ZE1B 1T8YA 1D4FA 2J6BA 3NBZC 4DJFC 3OT5A 3URMA 1WU7A 2SKDA 3K2QA 3ON5A 5B1EA 5AXAA 4V1CI 5LNK6 1V5EA 2H9IA 3OZDA 4HOYA 2WY2D 3SM9A 3VU3A 1Q0PA 1T26A 1WX1A 4A0GA 4CBVA 1TB4A 1VJCA 3L8FA 5LLTA 2UUPA 4N9WA 7ABPA 4TYMA 2D1QA 2ZYHA 5TMEA 3FFWA 1EQUA 1RQLA 2CDCA 1BKDR 4YJ2F 4KSBA 3W79A 4YIHA 4DNPA 3WLQA 5CD9A 1UMBB 1F60A 4UJ5A 5KOHA 4WKPA 4LF7B 2QLLA 5KO2A 1RJEA 1B8NA 1DEAA 2OD2A 4L95C 4LQDA 3N75A 4KK3A 3WOVA 3I58A 4DDUA 4WUTA 3RREA 4WJLA 2AJDA 4RTLA 2G8NA 5HKOA 2Z8ZA 4OFZA 5B58T 1LC0A 1XO1A 2GJ8A 2GZRA 4H3SA 3ZD9A 3DOOA 3PGKA 1K5PA 4XRGA 1QNLA 4ZK6A 2Q9UA 4O5AA 5AW5A 5KC9A 5DBHX 3CZ4A 4MARA 2QLNA 3COPA 3W5IA 1XWFA 2IS1A 5HIMA 4S0ZA 1PTKA 2WIAA 3T4PA 2BFPA 1UBOS 4HEA6 3L6BA 1A50B 1R9MA 2ZSUA 2ZR0A 2ZCJA 1FFCA 4GP9A 2Q5HA 4LMRA 5FPKA 5CM2Z 4QTZA 4OQFA 3BXOA 2PZMA 3F9CA 2ZK7A 1FBNA 1SOUA 3NYWA 4DGSA 4HD8A 4WNCA 5C52B 2J5QA 3RE1A 1FFAA 2QX8A 2NU8A 2GD6A 4OLHA 5EE0A 3L4KA 2ZRAA 2IEBA 1BE8A 3DV0A 3OU2A 1UBJS 5I7UA 3E3LA 3DV0B 3NDIA 4EWLA 1RIFA 3I32A 3TJZA 5L4NA 5H16A 4D9JA 3LPDA 5BN5A 4RTJA 4GZ3A 1G1AA 3C5CA 4DLBA 3D43A 4M7WA 5F76A 5HA5A 1AXGA 1FQJA 2WJPA 3H5VA 1RYHA 1JDPA 2B2XA 3O8LA 4FVTA 4MR9A 4MS3A 2WWVD 1IZ8A 3SDSA 3TCKA 4MR9B 2VNJA 1YRYE 1U3FA 3FCAA 3MN1A 3PNPA 2CJFA 4ZZ3A 5EERA 3AL3A 4O2RA 3DOIA 1UFKA 1XDBA 4U02A 3T06B 2XAUA 4KFRA 1Q15A 3FMOB 3KZ1E 3LQQA 3SYLA 2MCFA 1JT2A 2QR5A 5B3JC 3MWLA 4XGIA 5HG0A 5BSVA 3A2MA 4G36A 4UPVA 2E1RA 2OHHA 3E35A 3N8DA 2C2XA 1GGNA 3VZQA 2O3UA 2VA8A 1ENOA 4AK9A 4D74A 2O2EA 1RHKA 2XCTB 2Q3DA 1IB6A 4KXMA 5D6OA 3LT5A 2RH5A 3EGOA 2PH7A 5EPOA 1AZTA 4KDEA 1EGAA 4FIDA 1I80A 3X1XA 4BFXA 4RF2A 1MV5A 1YRAA 5JY1A 2CB0A 1WA5A 2VPYA 5LD2C 1AD2A 3P0FA 3Q41A 5HHTA 2IY7A 2WLSA 4KREA 3SVTA 4CMCA 1EDZA 3FVVA 4JU8A 4R9UC 1YHYA 3D02A 1OYOA 5LZ8A 1NKVA 4BP1A 5A0TA 3QLEA 4TS3A 1SUPA 5CP8A 2PUGA 4OHPA 2IOQA 3PL1A 3W5CA 3H83A 5LMCA 3V1YA 3CF4A 4QPJC 4E03A 5EHZA 2E49A 3D6UA 3DFZA 3L4BA 4HT3B 1AZLA 3BWEA 2VBFA 3DO8A 3IODA 3W8FA 1QRAA 2WFLA 5LQDA 3TR6A 4E5UA 2WFLB 1PGJA 3ACDA 2B9VA 3F98A 4D6YA 3TSYA 3K8YA 4FEEA 4I6JA 1T5IA 3IOCA 5EY5B 3S2YA 2BGIA 4JLDA 2AZXA 3KAPA 3FDZA 3K1YA 1PDOA 2ZRLA 4MCIA 1WEHA 1HMPA 2JJQA 2GEJA 3Q0IA 1WNFA 3FDZB 1Q1ZA 5DP1A 5GOZA 2AW3A 1IBMB 3GNLA 4L6CA 3SZMA 4AO6A 4ESOA 1JVSA 5EYPA 2Q5JA 1RWMA 2WZQA 4RGQA 3IA7A 2FXIA 3WSVA 4ZVNA 2BWJA 3H2ZA 3CX8A 1WM1A 3MT0A 4S05A 3KR0A 3MRTA 3S7ZA 2PQ6A 4AXXA 4WZ6A 2E4WA 1MABA 3QU2A 3Q72A 4I8IA 1DIAA 5A4KA 5DRYA 2O7QA 5AM4A 221PA 4HQ0A 1MABB 3KSMA 5E4TA 2AMJA 4MPTA 3LUCA 1Z83A 1K92A 4HEJA 3JZAA 2GNPA 4HH0A 5GIOE 3P2YA 2QJTA 3W6ZA 4TT8A 3K94A 4L4ZA 4UAJA 2C8KA 7AT1A 1K0FA 3CCCA 4I81A 4M0DA 4OP2A 3LBNA 1RADA 4NNOA 1GARA 3ZQ6A 3LP5A 4YJ2B 3A58B 4JI0B 3OQHA 1WJGA 1NUTA 2G67A 5ES3A 1DDOA 2B4YA 1UZLA 1NC1A 1YF3A 5MN6A 3RFUA 3GA7A 5JDIA 2M6RA 3OCYA 2HCJB 5IC6A 4G63A 4QGGA 2J3IA 2R44A 5E1MA 4WZAE 4NAHA 3C1UA 5D51S 4D9FA 2FPRA 2R8BA 3F8TA 3GLSA 2J33A 3MRSA 1XVLA 3NHJA 4WHMA 1JHZA 2NQ2C 3KQKA 2ACVA 1DSSG 1Z8HA 4BE7B 5E7MA 2LKDA 1W4LA 3Q5GA 1V5GA 4MUJA 1N32B 3MLEA 3WP1B 1U7ZA 2YJ6A 1R7RA 2XB8A 4G01B 4N0MA 1LBTA 4UMEA 5ALLA 4YUWA 1FFHA 3FPEA 4Q6WA 4PRLA 2DYKA 2R48A 2PUEA 1Z5PA 5GWXA 1LU9A 3P2JA 2QT0A 4O59O 1HQCA 1YTLA 4I7EA 4ALJA 1T2EA 4KQEA 4UCXA 4DFDA 2X5JO 3SHWA 1J06A 1TMGE 3SYTA 3KJEA 1F17A 4LOAA 3LVRE 3OF5A 3MPOA 1Q1EA 3W77A 3O1IC 1RPAA 2NTEA 1K6MA 5CBPA 3KJFA 1SUEA 3QU5A 4FKMA 1ZPDA 2A9OA 3OOWA 1UPUA 4IZHA 5AP9A 3V1UA 4CMIA 2DWOA 4F84A 4G1CA 5ALOA 4HVCA 4UNSA 2LE0A 4CMIB 1W8DA 1BX1A 3W90A 3CNEA 4BNWA 1V6SA 4AKEA 1GTVA 2WDZA 5DNCA 1KS2A 2FP3A 1C0KA 1LBHA 1RP1A 3K2EA 3L7CA 3RW9A 5E3HA 2BSQA 3H3XA 3PFGA 1U5CA 2NZXA 1Q0UA 2V59A 4OMCA 3C3WA 2PGIA 4CNBA 1VBMA 3A4LA 3QLTA 1A5TA 1SUCA 3B2NA 4PZLA 4RK6A 2C04A 5CU7A 5E9AA 2HA0A 3USCS 4L7VA 4KGXA 1LBQA 1D2MA 1O57A 3TLEA 2HQRA 1FFSA 3FVRA 4QUHA 4JB0A 2J4DA 1SKAA 3NHAA 4H1TA 1CD5A 4MW7A 1PVDA 4X8MA 5TMBA 3K6JA 3JWHA 3MYYA 4DJAA 1P5HA 3PZRA 5AI8A 3A9CA 2QBYA 2RIPA 3WNQA 5BR8B 3IGFA 3H17A 2QBYB 1GGJA 1E6KA 2JJ2D 3NFYA 1UAGA 1ISIA 3FSGA 5KTRA 5K3AA 3RU7A 4GYYA 4NMWA 2J41A 4JQYA 5IEJA 1OX6A 2ZANA 3OPYI 4F85A 1TUIA 1FYWA 3VR2A 4IDFA 1UM8A 3JZFA 4ARBA 4PPNA 2ZIWB 2ZBUA 4HATA 2VK8A 3TLGA 4EG1A 1YKGA 3VHLB 2PMKA 2C2ZA 4K5QA 3TLGB 3WJ2A 1CIVA 1P9OA 1PEYA 2G6TA 4LA4A 5DNAA 1WW3A 4AMBA 2WSYB 4BU0A 1UK8A 4LJAA 5KHAA 2I8LA 2NXNA 3I12A 4OHRA 3WHLA 3O9VA 2EXXA 3I2JA 5BWBA 4JP3A 4O4JF 1H3EA 1YR6A 3FLEA 3U39A 2VZ9A 3ZI4A 1WABA 1DG3A 1ZD4A 1Y89A 3VMFA 3HJGA 2FEWB 2GK6A 4B4KA 4DLNA 3KALA 3V8MA 3PFNA 3JQDA 2IZ0A 3A6GA 3ESBA 2SHKA 3IT3A 2QD5A 2VJLA 4W5HA 1EVEA 1K27A 1XL1A 3ZVKA 3H18A 1XNQB 2PM8A 3U7JA 3TH5A 4CPDA 3C74A 1U2TA 2Y1XA 5AHXA 1INLA 2ZBDA 4AC9A 1P9WA 2NPOA 2O8FA 3F49S 1JTEA 2A9PA 2WJVA 2C78A 5EWLA 1CT9A 1JEJA 1FCJA 1LVUA 1WV0A 4OQQA 2XE7A 2IBSA 4KR3A 2O8FB 4HZUA 4MV5A 5EWLB 5HS6A 4RO0A 4G5HA 3UJ9A 1I7SB 5AQ1A 2DPYA 3W6NA 1JFTA 4FCTA 4HZUB 4M8NE 3QEKA 1ONBA 3WYEA 1TLTA 3VAAA 1DX4A 3AJAA 2M1ZA 1H69A 3WJAA 1VJTA 4GSKA 4EEZA 1UBRS 5F52A 3THSA 4Y6OA 3OJEA 1Z7EA 3NXSA 5C1IA 2QMOA 4KXVA 5D00A 4ZAYA 1N2CB 5M04A 1W59A 1QV7A 4L50A 7ADHA 3B8EA 2HNAA 1M2VB 1QCCA 3FPGA 6PFKA 2I62A 4BIIA 4K40A 5HRUA 1X87A 3A9WA 1PL8A 4DM4A 3MWDB 1A0OA 1VSQA 2A9VA 3BAZA 1C14A 3LH5A 4UQPA 3DGEC 1OKKD 3ORFA 1Z0UA 4KKXB 4AN4A 2GASA 1HEIA 2RE8A 5L6MB 1ZNWA 3OWOA 3WMGA 3E3AA 2CXRA 4C2TA 1LBEA 3ZCRA 3K53A 2G36A 2AW5A 1B6GA 2C00A 1MNQA 2D7JA 3DCIA 3RPEA 4L8WB 4DNFA 3OHMA 3T7KA 3ZPXA 1Z3CA 2JIZA 1E1RA 3DQQA 2F59A 4RWZA 3EXIA 1XR3A 3EZNA 1YZFA 2ZSAA 2OHXA 2GXQA 1JKIA 3CNBA 3EXIB 3K70C 4EECA 5ES4B 1CUVA 5K20A 2O20A 1V5WA 4GECA 4G5YA 1I7PA 2EQ5A 2YYSA 2J85A 1FFGA 3KEMA 1E1QD 4TQUS 4INZA 1G6Q1 4JB3A 5IYZA 5E6SA 3R7WB 1P8JA 2BLLA 5IYZB 1PV1A 4RFLA 1V45E 1IONA 5E6SB 3L8EA 2O3RA 4P08A 2F17A 2YN4A 4TTJA 3O6VA 4D3YA 2HV9A 4ZJYA 4RTQA 3PR3A 3GMIA 5EWMA 1IOLA 3DAOA 1NLZA 3ONWA 1C3VA 5DM0A 1OLXA 3EAQA 5EWMB 4PG8A 1I5EA 1KH2A 3DDNA 4RSRA 3TQQA 4YCNA 1OLXB 3RYIA 3OLVA 4QE3A 4A92A 1IVYA 4DYHA 5JWRA 1MO6A 3RYIB 5A2GA 3LP6A 4NRDA 1TW2A 4PRKA 4L8FA 4F4IA 4G5SA 3KD2A 5H7XA 3ZXSA 1PG0A 2OFFA 2QRGA 4KOAA 2Y1WA 3RK4A 4AUNA 1U9IA 1FFBA 4G4SO 1JTFA 3E0XA 5EMJA 1HSOA 3WL7A 3OP4A 2XTNA 1PO7A 1ZK3A 4WKOA 1YQTA 1C7FA 3OZFA 4H35A 5BVHA 2D0DA 4Y98A 1QANA 5J23A 1GN9A 4Q00A 4NY1A 3OIYA 2G80A 4LE2A 3EZ6A 5CEJA 3H2JA 4PNZA 1VE7A 3RHZA 1XZQA 1IY0A 5U4XA 4BMYA 3NORA 4PPFA 1U1EA 5LYJA 3MSCA 5JCJD 4NZ9A 2H65A 5CEFA 4HAUA 1G98A 3OSUA 4EPWA 5LYJB 2Y68A 3KQHA 2EYQA 3FF4A 1KNXA 2G5TA 3WNZA 1QG4A 4F9EA 3CF4G 1EUDA 2VZEA 3DBHB 3UWPA 2IODA 4C05A 3KHSA 2EIXA 2IZ5A 5TSDA 5G1OA 1W0KA 3BWCA 4F2WA 2GS9A 3OD1A 3E9DA 4BEJA 4PC6A 2GSWA 4ICIA 1ULSA 3T9AA 2O0HA 3A4YA 1I6KA 1DVRA 3BSYA 3MTJA 3ZHOA 1B2LA 1JQ3A 1SKQA 4IVRA 5CCXA 2WWHA 2EJTA 3IAEA 2EKDA 4ID3A 4GBJA 3AVVA 3DE2X 2JAPA 3QVTA 1YS1X 4G5RA 3KTFA 4HAWA 2WWWA 2PRSA 4MYCA 5H68A 3GFTA 3VVBA 1V6CA 5T7BA 5BXQC 1M66A 5IBPA 4YP1A 4Z6KA 2WU0A 2XUPA 3DPIA 3K6RA 2EX0A 4OBXA 2HU5A 4RV4A 4PZYA 1ZJ4A 2V9CA 2FJ0A 1RKXA 1SBQA 2F3SA 4P3NA 2YZ2A 4BLQA 4HDKB 4GRAA 3W06A 2YOHA 3QLVC 1QO7A 2H1LA 4OCZA 2NZJA 1P77A 2FX5A 2JLQA 2I2BA 2GPAA 2ZSHA 3ASYA 5BNIA 2VPPA 3RTAA 4BU1A 2AOXA 4GX1A 1HK7A 3V1KA 3A1TA 1PR1A 1T8UA 4G0XA 4QHSA 1P7PA 2ZRCA 3HACA 4PFJA 3Q8XB 4YHBA 3LCUA 4HGNA 5IT5A 2JRLA 5AVUA 4Z53A 1HEYA 2HRDA 5AJZA 3WYCA 3MMXA 2GBCA 4AS3A 1K9VF 2O8VA 1W19A 3BH6A 3IDQA 2XUIA 3AFNA 1G3IA 3DCYA 1AMUA 2FGKA 4ZOQI 4GXNA 2Q6OA 4RK1A 4AO8A 3TLXA 1A9TA 5LZ7A 2EIHA 3KS9A 4JJZA 2OG1A 3IIKA 4BVHA 1HL3A 1R15A 5I48A 2VG8A 1MB9A 1JLSA 4BNJA 4CM1A 4E5NA 3WGMA 4JVNA 4YX9A 4HQRA 4WBNF 5LUAA 2JKZA 4B87A 4E2ZA 4NJMB 1ZVMA 2AKAB 2CVQA 4HRYA 2VF5X 5JCZA 3I5MA 1B74A 5JS6A 3EZXA 3INTA 1RJWA 1M6VA 1NYRA 1Z0AA 3GP8A 2ONYA 3EFBA 1M6VB 2EFEB 4K9OA 4A27A 3TTUA 1JF8A 2R2AA 1E9BA 3BMOA 3W3AH 1SRRA 2FPUA 5DX8A 4HRXA 10MHA 1KDTA 3CUYA 3BMOB 3GJ6A 4M0LA 2P9YA 2MJLA 4QU9A 4KX5A 4DUPA 4JWTA 5EXXA 4ER0A 4MVCA 4ALNA 4KPGA 2ZB7A 2PL5A 2XDWA 3EVAA 3JQ6A 4TYQA 5D5PA 1QQBA 3T3HA 2CL7X 2O48X 5C4MA 2G70A 4O08A 2YRWA 4WK6A 3RS0A 4FSDA 4RXUA 4GR9A 4A6DA 1U1CA 3DLIA 2B4QA 3OQNA 3EDCA 3NV9A 4ZVOA 3V97A 2QENA 5CM9C 3E7XA 1M6WA 2RAPA 3QEBZ 2ZKLA 3EASA 3HA7A 1JR3D 1CUXA 4KQ6A 2JFOA 2R60A 4IEEA 4IYJA 1TTPB 2E4UA 2Z3WA 1KL7A 2IHUA 4EX7A 1VLVA 4OM7A 2H29A 4G0MA 4URXR 3FKQA 1N25A 1DIOB 1VMAA 3R7NA 1Z5UA 3UQZA 2GPNA 1IUOA 4RA9B 1MRZA 5CRIA 1X8XA 1RU3A 1N3LA 3FPAA 3IELA 2H8KA 1ONSA 1D2GA 3QXHA 1GYRA 4OTZA 2A1TS 3H3FA 4R84A 3ZNQA 4OHUA 1WD5A 3M1IA 3LXRA 4R7GA 5T3YA 4PHHA 4LYAA 4MA4A 4B6EA 2OHOA 3VUFA 1BFDA 4XZ3A 2QTLA 4A8JA 4PSVA 1RI5A 1PEDA 2C42A 3H8VA 1MA0A 3WNBA 2LIVA 3F4LA 3JQ7B 3EMDA 3M34A 3O73A 4RH3A 4XWTA 3EA4A 3QPBA 4OI0A 4IGKA 4QATA 1WXHA 1XE3A 4MJ7A 4D46A 5EQJB 4XH9B 1IL0A 2PBRA 2GBFA 3X1ZA 1LWNA 2CWDA 4RZHA 3IL2A 1RMTA 5JASA 4QDXA 3FI9A 2VA9A 4IIEA 3O4HA 2ZB3A 4RH0A 4Q1CA 2AEJA 2K87A 2UZ3A 3KXLA 1KHHA 1M73E 2GZHA 1BVUA 2MSDB 4NK4A 3L0IB 1P39A 3NOVA 3C3DA 3GYBA 4G5FA 2FQYA 4R98A 3M6WA 5EZYB 3M6VA 3VR6H 5FEUA 3REFA 2OCIA 1P80A 3KEOA 3BMQA 4F97A 4JUCA 3ZJVA 3DDHA 3GIDA 3CY6A 3NGLA 2Q3BA 3BMQB 1MPTA 3D81A 5EJMA 1VCNA 5C5DA 3MS2A 3MD9A 4AMUA 3ZCSA 1HTTA 2V7QA 3R3VA 4RFVA 3ZXYA 1M7HA 4BB9A 5JMWA 1E4YA 1OZAA 2KB0A 4RMGA 1TZMA 1IHDA 1YJXA 1XTSA 2HA5A 1WUJS 2IE0A 2W8ZA 2WYVA 4X5OA 1NJ1A 3GN2A 3QWHA 2BW0A 3HCPA 4JLBA 4DIOA 4ZAGA 4RZIA 2OK8A 2BKXA 3ETGA 3PNMA 4CLEA 1SD1A 5BXYA 3PNBA 1YE5A 4AYXA 3B1FA 4KP7A 4YAGA 6AT1A 1YFKA 1W25A 3GAAA 3QTLA 4CLHA 2FSPA 2RH9B 2W6PA 2ZWMA 3CX6A 3LOUA 3UHOA 4LYDA 5DNVA 5C5EA 3RJ9A 1G8JA 2DJ5A 3H8JA 1AGPA 1MX9A 4DC9A 3MOIA 4XSVA 1Z08A 3RVRA 1B6TA 3AP2A 4MOWA 5AOAA 5JVDF 1QUFA 1IXKA 2EFYA 3QITA 3V3TA 1G8SA 1VL0A 1JQDA 2GEVA 2H2GA 3L93A 4ZDKA 5BYKA 2DB3A 2PMBA 2QLMA 3TQRA 4F6LA 3TNYA 1VJRA 2O1XA 2G09A 2G63A 3QENA 2JGRA 3DDCA 1NI4A 2QMHA 3E8MA 4MUAA 4JT9A 1XHLA 1ZJJA 5A4JA 1TXGA 3TQIA 1W4BA 1OBFO 1FNBA 1GUAA 2HTEA 2B1JA 2GDZA 2F9FA 4DXAA 3OTGA 1Y7TA 4M53A 5IT0A 3RSLA 4I14A 3OQOA 1QONA 3A11A 2AXPA 3VR3D 2B94A 4FEYA 2JGLA 3VYRB 4N4AA 3RYCA 1NPDA 3GAMA 2DFLA 3QVGB 1W4ZA 1KF0A 2IH4A 4AZVA 4KR6A 3WA7A 3PEYA 3RYCB 2EFCB 4NESA 4MWCA 4BFSA 2Z9CA 1QWSA 3UUWA 4EW3A 3KZVA 1CJKC 1WVGA 1GEEA 1H93A 1U0JA 4MUFA 1CUEA 5KSPA 5CDGA 2W90A 1EG7A 4ITVA 3G0DA 4BVBA 3HV2A 1OA0A 4QG3A 1R6VA 2EEPA 2I6QA 3EODA 2GD1O 2R97A 3B9BA 4KQ9A 1LK0A 4A0RA 4J1QA 1EE2A 1P2SA 2QN1A 1D8AA 1R50A 4E6EA 5KOHB 2H59A 2VK1A 1RKVA 3E82A 3ELUA 1UQUA 3QEMA 3WKEA 4DKXA 3UG7A 3RRJA 5JAOA 3QEMB 4X95A 3DSRA 5TMPA 4YV2A 1DARA 1AMOA 2IS4A 4YJFA 1BXRA 4LVUA 1QRTA 1BWPA 3PC8C 3LUFA 1BXRB 3LECA 4KWTA 2ADMA 2JGDA 3FZNA 3WYDA 4D5GA 3ETJA 3OESA 3OCJA 4FX5A 3RRMA 3ESCA 1ZJ5A 1JPVA 3HY6A 3R24A 4C7MA 2GOYA 1CUDA 1ZIDA 2J0QA 1DGQA 2Q5CA 3DLTA 5EP1A 2DY1A 1ZH0A 1OPRA 3A6LA 2V6BA 2WOJA 4HF7A 3LA6A 4UE6A 3ODPA 3OZUA 1Y8RA 2MYNA 3IR6A 3FD8A 4OQYA 4WBSA 4I4TF 5EZ5A 4DIDA 2V6JA 2ZM5A 3ZWQA 5F9FA 1Y8RB 3SS9X 1Z45A 3BF8A 2QN2A 3T7DA 4AZ0A 5B6PA 3OQJA 3T6KA 2P9EA 5A04A 1FMLA 5M34A 4AZ0B 1GT6A 1Q0QA 2C9OA 4UU8A 5DI9A 3PQCA 1PS8A 2XQVA 1R0ZA 4GZMA 1GG5A 1ZI8A 4RKWA 2NUPA 2VSXA 4HCJA 4P82A 1X9IA 5K2OA 4I9HA 5FNZA 1L5HA 3GLIE 1PYOA 2H1FA 5DGHA 5JROA 2WT9A 5JAHA 1L5HB 1RI4A 3HZRA 1P2UA 1P9RA 3H11B 4PTLA 4HMPA 4PXSA 2V7UA 1JYFA 1XZMA 3X1MA 1YB4A 4E30A 3HWX1 4MJLA 1EWQA 1PJSA 2QMEA 3ECAA 3GPCA 4O33A 4JH0A 4MPRA 1UL1X 3G13A 3MUFA 3BXXA 3GUVA 4OMUA 2PUTA 3BXHA 3UJAA 1G16A 4YJ3F 1B8VA 3ZTWA 3CE9A 4JGIA 3C43A 2FZLA 3FYHA 4U7PB 5I7RA 1M74A 2EC5A 3CIOA 4D8XA 3BPSA 3UHFA 4UE3S 4FYXA 2Q8QA 2V6IA 2UZIR 5BSTA 4GBGA 2EU8A 4GM4A 3WWCA 4PR3A 3P7MA 2EZTA 2BR5A 3LUKA 3VVMA 5HSGA 4PIMA 1V8BA 4C20A 1E0SA 1ZK1A 4K6GA 4RVHA 2C92A 3OKPA 5EHIA 1QHEA 1ADCA 3SX0A 1J24A 3WHKA 8ADHA 3UZUA 4Q47A 1CXZA 1Z8NA 4KN8A 3R4VA 4ESVA 2B1GA 4UZFA 3R3SA 4N3BA 1PUJA 3ROXA 3OHPA 4IGAA 5FBWB 1RZRA 2XWQA 3S1AA 4BE4A 1XDZA 3S1AB 1DX6A 1F2VA 3FTCA 3I4LA 4G8DA 4MGKR 3NRCA 4G37A 1M83A 2H6EA 3AZQA 4KVFA 4N3GA 5HM6A 5AM0A 3R3ZA 1GZDA 1VL6A 3RVMA 3RU2A 4RZXA 1Y6FA 1M6EX 2Q9BA 4HS9A 4AJJA 5EZYA 1WSAA 5ALFA 3D54D 2WDPA 2RHMA 2YYAA 4ENUA 4L0QA 2C07A 3TZBA 2OCLA 2YWCA 4LV6A 4RHUA 2GZDA 5C0OE 4U7DA 2OLEA 2P9ZA 4F91B 3O4JA 1XTQA 4G1EB 1UKVY 2EKBA 4U63A 1U7WA 3TNDA 2OWDA 1RM5A 1Z7WA 2QL6A 1NV9A 2R6JA 4DREA 2FSVA 5AHKA 3M8KA 3T7RA 3IBFA 3OY7A 4TTIA 4X7PA 1MJGA 2LP4Y 3FPLA 4BNKA 4LC0A 4AECA 2P0AA 1H2EA 2J30A 3HTXA 1SCJA 1ADYA 3BS4A 2NSHA 4FE3A 2LIPA 5IBQA 5DEOA 3H0CA 4F8EA 5SICE 2F3UA 3VPCA 2WPDA 4C0LA 1TL7C 4PANA 1MAWA 1RAIA 1RKQA 1IUNA 4Z4GA 2LCQA 1YZGA 5D1NA 1CULC 3KO8A 2Q1TA 1DKRA 2BR3A 1CHNA 1SC1A 4A6EA 3MJRA 4JEHA 4AG5A 5KDLA 2Q7XA 2Z8YM 4E51A 2OECA 1Y9EA 2PCLA 4WKBA 3VNAA 4GC5A 4UARA 1LLCA 2DUMA 1IBKB 3IDOA 1RPTA 3CLUC 1FQOA 4RM2A 4Y1EA 3N3AC 1QIJA 3D2BA 4GZ5A 4MRSA 4IDBA 2EKPA 4KE6A 3LG2A 1NMZA 5I8ZA 1NG9A 1AUXA 1W29A 1KEEB 4DG9A 2FUKA 2I99A 2VXCA 3AIOA 5A7GA 1H2XA 3IUSA 1H9BA 2RAFA 2ZQZA 3OEHA 1KI3A 1VE1A 2CVZA 2IYUA 3OZRA 2COEA 2WSSD 3U7QB 3PWZA 3GEDA 3Q5DA 4CQMD 5IXJA 3GROA 1U3DA 2Q3JA 4JR0A 3UXHA 3MXTA 1X15A 4PO1A 1QJ4A 1AF7A 3QE4A 5DXJA 5ECWA 1X86B 4CCYB 2QP4A 5BYBA 3LYUA 2ANCA 4TL6A 4YRSA 4CXMA 1C2TA 5JS8A 4O02B 2ZYAA 3DOHA 1P74A 4HJXA 2CJXA 3EWIA 1K2VN 4I3FA 4ZOBA 1NXPA 1U1IA 4DV3B 1FXUA 2JKVA 4XD7A 5KVSA 2ZWIA 4DV0B 1A72A 1N9GA 1C7IA 1CIJA 1L6IA 3BULA 3T5PA 3WFIA 5JTUA 2P2CA 2AMFA 1RQPA 1PWEA 2QSZA 5H3LA 2R96A 1ZEJA 3TIFA 2B99A 1WQ4A 1SQ0A 3PC2A 4UNNA 4BJHB 2ZUBA 2VQEB 1JEEA 1ZEMA 4YFYA 4R8MA 3B38A 3FVWA 1UZNA 1H4QA 1RXIA 4DTCA 1ZW1A 3MVEA 4LDZA 4OFXA 4EB0A 1J2JA 4M9SA 3FKSD 1JPNA 4K9LA 2I6GA 2F43A 2HIMA 4HWKA 3OOJA 1L8LA 2QL9A 1JUDA 2KPOA 4RGYA 5F78A 5I4IA 5BV0A 4C0SA 1A2BA 3SIWA 2HNKA 3LE8A 1U9ZA 3R1IA 5BUZA 5IBCA 3WICA 1EIWA 3OCWA 2GEUA 3BJMA 3K70D 2QKYA 3QMVA 1QTRA 2BKLA 2PWPA 1IATA 2A5DA 4K2AA 1S9HA 2VAXA 3AUAA 3FOZA 2C5LA 2GTIA 4LXXA 1W73A 1QYXA 3INYA 3S2EA 1UFVA 3K1JA 3NHYA 4F9TA 3AHHA 1NJFA 3LX5A 4CMEC 1ZOPA 1IDOA 2PMEA 3WVNA 4CODB 2KS6A 3SEAA 1NVVQ 4BZWA 2ACWA 3PUHA 3T95A 3N7TA 2HZBA 4J2HA 1U2GA 4HN4B 3PUVA 3OT4A 3L40A 4AJLA 4RPIA 3NEYA 1A7JA 2BCGY 2GI4A 3GJ5A 2NQ8A 3SJZA 4R16A 1QTNA 3MF4A 3LYHA 5I9IA 2Q2QA 3H04A 1MGOA 5KNBA 4PNHA 2M6SA 1ZISA 2AK2A 5JTTA 5WRFA 2HQBA 1I2BA 1AH2A 2ZYGA 4PTYA 1DJMA 5C81A 1OH7A 2IDKA 3CG4A 3U19A 3TRKA 3DDSA 4Z2AA 1YB2A 4NCIA 4ZWNA 3AEKA 2A1TR 4NYJR 3FUVA 2Z58A 3OUTA 1TJ5A 4MAMA 1K75A 4NQZA 5H82A 3V8VA 1OH6A 3AEKB 3I9V1 4FDLA 4JOSA 4UXJA 4FWTA 1PQYA 2C77A 1UZUA 3B2QA 2R751 1OZ0A 2I29A 4OL9A 1ZVVA 1RRPA 2YOFA 3LVFO 3OJLA 1VCMA 4X9XA 1O4WA 5JYCA 3HGQA 4V38A 2YNMC 4D45A 4CM9D 4Z51A 1VQ1A 4DR4B 5F1YA 5KWVA 4MDFA 4B3BA 3H4IA 2IEAA 5JAUA 3A27A 3CCFA 2PVCA 4JCCA 1FP7A 4O5OA 3LDGA 4JL8A 5K0TA 4OBBA 4EYEA 2NU9A 3SOPA 1AHNA 3EY4A 5DDIP 1VSBA 4ZU6X 1HLDA 4E1BA 2F6RA 2NU9B 2QRMA 2WUDA 4NEQA 1VIVA 3STVA 3GUCA 2AOUA 3LA8A 4Z9YA 4E2FA 1XLTC 1Q84A 1EM6A 2EDCA 3TZ6A 1ZM9A 3LPNA 3DE7X 3Q10A 4G07A 5DHTA 3WMXA 5CXUA 3CRQA 2YJNA 2VHZA 4FZ5A 4Y0NA 3REQA 3FRHA 3SIPA 1FU4A 3F6EX 4GE0A 3REQB 3D3EA 1PI3A 4PF1A 4MI9A 3Q88A 4P92A 3VH2A 4EMUA 5ULLA 3KKLA 3RRFA 2EWWA 1PNQA 2X4LA 2YDXA 3C6KA 4H1HA 5IJZA 2P4QA 3PB3A 5EXTA 3PNSA 1DC5A 3NKLA 1HC7A 2WAMA 2RJOA 2YZMA 3GJXC 1HE2A 2PBZA 2W48A 2PL9A 3IAS1 3OMXA 3PNOA 1Y9JA 4I9GA 2XE6A 4IH9A 3F97A 2QZ4A 1LVGA 4UATA 5JG7A 5T8KA 1SELA 2WSLA 1SC9A 1XZNA 3D3JA 1V9CA 3J7TA 4LV5B 5JXJA 2E0IA 4XUDA 2PZEA 1R88A 4S04A 3ND7A 4IGFA 3MHTA 1MRSA 1QAQA 2BDTA 4RQUA 4QFMA 2WF6A 2HEGA 1T9HA 2I71A 4JJFA 2WJYA 4BKMA 4TYPA 5HK9A 1U2ZA 3VR1A 1D0IA 1H05A 4LGYA 1SCQA 3FNHA 2Z1MA 1NRXA 1SCIA 4QUIA 2X9LA 4TUYF 2XT6A 3K9GA 5TE9A 4H7EA 3MTEA 4D4GA 5K3EA 1Q6ZA 4B33A 5FLXA 4FS8A 3B7PA 1EP1B 3IO5A 3O21A 3LUPA 3FDXA 4CFSA 5F7OA 1QVAA 1P4AA 5I51A 4Q15A 4XKJA 5C8YA 1HYGA 3JWEA 1XALA 1C8VB 5C8YB 3AVXA 1ONOA 3CZ5A 4DV2B 2IYRA 1D03A 3TL6A 1EX9A 3K7EA 2C2GA 3Q6IA 4K3VA 2IUSA 2UVDA 3FTNA 3GT0A 4LJ6A 4QUBA 3W9BA 2GBLC 4LTNA 4I6GA 5FR2A 2I54A 1FFXA 3HB5X 4OG2A 4G1VA 1GRNA 1FFXB 1P81A 2ABWA 3OFNA 3MMSA 5F2OA 3TQOA 5IULC 5TVKA 5AT1A 2HF8A 1CY1A 4QLBA 1CVLA 1ZINA 3NBMA 3QBJA 1GZ5A 4OUDA 4P4GA 4R8RA 4KXXA 2AIRA 4DMUB 2Z6UA 3E5RA 1SBYA 4NXMB 4OUDB 5EHGA 5B53A 4QYXA 1UODA 3EGXA 1NVEA 1UUFA 1W4CA 5FHQA 4YV7A 1H0HA 1T6NA 1JJBA 3K2BA 5CGZA 4EG4A 2G8LA 5IC4A 3EGXB 2Q6LA 2PT5A 4B83A 3FCEA 4C0JA 2W2QA 4PLYA 3UM9A 2H4HA 1RWWA 3ETHA 2HV8A 5CJPA 1I9GA 1ZN2A 3Q6MA 2NXCA 2A5FA 2FFBA 2X15A 3JRNA 1JU3A 2FRVA 1JNYA 3JYOA 3LRXA 4G2NA 4J1SA 2CXTA 5A9SB 3DEFA 1VIYA 1GM5A 4WASA 5J2TF 1EBFA 1Q74A 4GM0A 3QUSA 1QU2A 5TX7A 1JU4A 2CUNA 4M0EA 5JO0A 4ZO8A 3K9FC 4AU1A 4EG3A 1RI2A 1R9JA 1WY5A 5C8DA 4XWAA 4EJ0A 1GQ2A 2AA3A 1Z9BA 5KOJA 1TK3A 2W71A 2NMVA 2CXHA 3PFFA 3PRHA 5KOJB 3FBTA 1W48A 3MGKA 3QBDA 4BLWA 4S1PA 4DB2A 5G0UA 3OE7D 1AKTA 2RGRA 4DLPA 4AIIA 4KO3S 4IIJF 1UT6A 1A2KC 1ACLA 1FBTA 1LQTA 2AHOA 2HU2A 3FIUA 3QHQA 5LNK1 4FFLA 4H08A 3K4PA 3HHEA 4B74A 5IM5A 3OKCA 1BDJA 3HCNA 2ZBQA 1TEVA 3TW8B 1WXIA 2MR6A 3KHUA 2IBMA 3L9XA 4S24A 5C3UA 4EG8A 1EU1A 2HF2A 2IIVA 3ELYA 3WZLA 1DKLA 2CDAA 3KHTA 3QF7A 3R74A 2WFZA 3G68A 3WDLA 4LHVA 3G1UA 1L3CA 2HA7A 4Q48A 5T4FA 1E1MA 1J5XA 2CC2A 1XHFA 1NVTA 3NTLA 4P58A 1NXSA 2GPBA 2PH1A 1K08A 1O6FA 2PSHA 2HTFA 1JFLA 1WMBA 1US8A 2LRHA 1J0DA 2C5HA 2Y4OA 3QYAA 4K0KB 2E4AA 2Z8XA 3FWKA 1LBIA 2QTTA 1US8B 1IY2A 1WMSA 3QOFA 4WCFC 3F5SA 4XIIA 3VTZA 4G81A 4NX2A 3WZ2A 1HE4A 5EJ5A 4CEJA 4V0RA 4EOGA 1Q14A 4HEA1 4INAA 3C6QA 1GV0A 2XLCA 4KQMA 2FPMA 2K7ZA 2WF7A 5AMXA 4CMJA 1RW4A 4RK4A 1QQAA 1JSLA 4WINA 4D56A 3RFVA 1BHSA 5BVGB 1BN7A 1UKZA 4J6FA 3MELA 4WLEA 1VKNA 5CLQA 3SJAA 4KR2A 3EPKA 3WQRA 2HEIA 2YWEA 5CFOA 3OD5A 4Q1BA 1JHUA 2WFAA 3GZJA 3DV2A 1XT6A 2VSYA 1KJZA 3P32A 3IB3A 2ORED 3U3DA 1B43A 1Z6AA 4IHQA 4N5MA 4G85A 3AR5A 3WLTA 4U39A 1CR6A 4K9KA 2PUCA 2PG3A 2EATA 1E9FA 1QOPB 1VG1A 4ENTA 5K0GA 1MT0A 2O5VA 1BS9A 2VWHA 3BE5A 4H0CA 3HEMA 4JENA 4QREA 4YCLA 4HGRA 2WJHA 2J5RA 2WF9A 1W76A 1JQJC 1RPJA 2JGFA 3D3WA 3E4DA 3L6RA 1PHPA 3HYCA 1E2EA 4TT3D 4YDRA 2C7RA 4OUKX 2XKAA 1UPXA 1EZ1A 3D3WB 2FNAA 3WQBA 4EPYA 4ZICA 3L04A 3I2HA 5K8IA 1JHVA 1P6XA 4HNHA 5CFMA 2JPDA 1DINA 2HKIA 2V6GA 3DM5A 1RQGA 2W2KA 1PGOA 3KQUA 4KIGA 2NO9A 1TU3A 4IIVA 4NCNA 2W2KB 4NECA 2QN8A 3PXEA 4C03A 4HB3A 4LWQA 2X7JA 4XQ0A 2DUWA 1ODFA 1NJ8A 5KYKA 1J22A 3KTAA 3L5OA 1EMDA 1H0SA 2Q29A 1O4VA 1WPGA 2P3OA 1EQ2A 2XUZA 3KTAB 2H54A 3U7EB 2PL1A 3KSZO 2GKOA 5JSQA 3AVYA 1OAKA 3SAJA 1CUJA 5ILQA 1JQLB 4OJMX 4CL2A 3IKTA 1ZL0A 2D1RA 3M2TA 4KO2S 1ZK4A 3CN7A 4YR9A 4J7XA 1RSZA 2Z2IA 3V46A 4BQFA 2EGHA 1JP7A 2XUDA 3JY6A 4YUAA 5K4GA 1CY4A 1HQKA 1QIDA 2PKWA 4Q3NA 1YBMA 4JA2A 4X1OA 5IT9A 3AFOA 2ZFUA 3CWQA 5BORA 1NMEA 1RM4A 1YJBA 1YQWA 3JQFC 4HWOA 4I50F 2I4NA 4U7GA 1RWKA 3IQFA 4PY2A 4U3JA 2G1AA 1NW8A 2XOEA 2FSGA 4NBLA 3ZTTA 4D6PA 5B64A 3RIXA 4JL6A 5IHPA 1CZRA 4U3JB 4E94A 5CX4A 2BM9A 4UMVA 1D7OA 4BEVA 2IYEA 1IRIA 4N47A 3VYSB 3GEBA 3PXCX 1RXWA 4ZOLF 1UFQA 3ILYA 5ISMA 2C7BA 4UUOA 2IHVA 2JBWA 3PENA 4M46A 5C7OO 4ENSA 2WU3A 4Y8VA 2YASA 3AY0A 1OU0A 1ZN9A 3LUAA 1BSVA 3ENZA 4OQXA 2YY5A 5G53C 1QBKC 2EGUA 2Z98A 1HNXB 1ZD8A 2D5IA 5DX0A 2FN7A 5I4BA 5A3VA 5JWHA 1M1NA 1PR9A 3BVPA 4DZRA 5B1YA 3EGVA 3ICOA 5CT6A 1M1NB 1R66A 1VBNA 2FWJA 4OQLA 1VCHA 1MRNA 5FBRB 1Q1AA 1XAHA 3ABIA 5LMUB 4B6JA 1DRKA 3E53A 4GVPA 3GLGA 3MC1A 3LGXA 1IPHA 5K3CA 3GLGB 3GFQA 4TQGA 1Z2AA 3ET5A 4HUJA 1TPZA 3EE6A 3O94A 3QPCA 3MQ4A 2X5OA 4IIJB 4J0IA 1H42A 1ONPA 4I8DA 5TMDA 3TSOA 4CW7A 5JIBA 2JFXA 1G5HA 3BDIA 1AK9A 2GYVA 3IDFA 2V6MA 4MVYA 2J48A 5D84A 5TJHA 1DX9A 1W4AA 2B8WA 3PHIA 3RD5A 1JHXA 2G6BA 3E5NA 3TLBA 4IZIA 3PZBA 3UT0A 1PUIA 4K6OA 2CZQA 5LMZA 4GMGA 3HXOA 2MDTA 2V7WA 4WXMA 4ARZA 1R6AA 2BV3A 2XZOA 3QOYA 4IO0A 5DKFA 4QU0A 1E6WA 2XMZA 2VAPA 4ARZB 2X22A 4NG4A 1Q22A 4XX0A 5C4IA 1EVQA 3ENQA 1CY7A 5J47A 5HPYB 3A0RB 4XX0B 4YRRA 5EUMA 2QPLA 4PZEA 5B1IA 1SG6A 3LNCA 4M54A 3E0QA 1KAGA 3H5LA 4ZT3A 5IN4A 3JQ9C 1SQ5A 3FFAA 1JSRA 4HLUC 2IOHA 1B1CA 4OBWA 4CVNA 2X4DA 3IAM6 3HR4A 1X1DA 2QU7A 1L5LA 4MP3A 1PR4A 2OT3B 3M6MD 3BRWD 4N7RA 5A06A 4GXQA 2KBFA 4ZQBA 4YR7A 4P4SB 1OLUA 1Q2UA 2AG5A 1LPNA 2IYYA 3AJEA 1OLUB 4TTSA 3FUCA 4JJEA 3B20A 1SU7A 4R51A 1PDWA 1ZC4A 4CKWA 4NE2A 3RUIA 3F78A 1RHUA 1RVDA 5CVCA 3O82A 3AF1A 3MINA 3VC2A 2CHUA 3ZWCA 4CKWB 4BLOA 2WNSA 3MINB 1FYVA 5DYIA 2C4TA 3CNHA 3DL7A 3GHYA 4E32A 1RQRA 4K2HA 1KJ8A 2Q1WA 3VPFA 2UZAA 4EFNA 4QRHA 4ZODA 2PMWB 1TJYA 4UAGA 2GESA 2IP4A 4BNYA 4GFDA 4DCCA 3ITKA 1FSPA 2F3RA 4NYIQ 1GYQA 1YK1A 1E0DA 2V7PA 3IVCA 1XJ0A 3TJMA 4B34A 9LDBA 3G5TA 4IL5A 3MOSA 2AR7A 3HE3A 2P9HA 2RG1A 3WKAA 2I67A 1UFRA 1H2AS 1ODIA 9MHTA 3B3GA 3ZOKA 5I8PA 2QUIA 4DC1A 1RRVA 2ENUA 1HG1A 3K1ZA 3G0BA 1UPCA 1LK7A 4LBWA 1AQIA 1YCGA 5EPUA 1MZPA 3O4IA 2HM7A 1O58A 3RASA 1G1MA 2YL2A 1HPLA 1IEWA 1ZVQA 3TO5A 3C87A 4PZPA 1ADFA 3TBHA 1WSWA 4GPZA 4HPXB 3LOPA 3MM4A 2C31A 1L5FA 3FMIA 5FA6A 4HZGA 3UJPA 4EK9A 1DDIA 4X6YA 1PFYA 4EY4A 4EG7A 3UA4A 2RKBA 2I4LA 4DHEA 3VPAA 4Z5XA 5C1OA 1ORVA 2WUGA 4LISA 3L1UA 4HGPA 1P5RA 3IOEA 3RSQA 2QZSA 4EITA 1JG7A 4K9DA 1PQ4A 3WYNA 4ML3A 3ROEA 5JJCA 2HMVA 5JE8A 4MWDA 3LX4A 2CNKA 5FV4A 1HSZA 4KJXA 3PP8A 1NN5A 3A25A 1Y1LA 3AF4A 4RTSA 5ITWA 1RYMA 4JBGA 2H2HA 4KVGA 3U4GA 4DMRA 5TGTA 3VO8A 4TTQA 4G25A 1JDBB 1RBQA 1DTWA 3CH4B 3QU7A 4Q1AA 3X2SA 1IM8A 2J5BA 1N7JA 2GARA 2LNDA 4L08A 4JS0A 1H2YA 3ZY4A 1DTWB 3I04A 2ZP1A 4MPDA 3LX8A 3ZWBA 1JDNA 1I7LA 1Z7GA 2C29D 1KZGB 2XOKA 1WZNA 1NW6A 2D2VA 2ZXEA 3CEHA 1IK4A 2JHGA 2IUYA 3CLUD 3VNSA 1MJFA 4DQLA 2OB2A 4ENVA 2B5OA 1E5LA 1CFJA 1SCAA 9ABPA 4ZTBA 1G38A 4X41A 3DEKA 4TSFA 3UHPA 4KZPA 3O4RA 1K8ZB 2H06A 5TS2A 2P2LA 1TCVA 1FE8A 2PUVA 1SGWA 2C9BA 1EM8A 4DR1B 4XM0A 3F3MA 3T9DA 2J6IA 4LXGA 2QM8A 4BNNA 4EI9A 3SMQA 1ECLA 2GD0A 2FZGA 2PIDA 2XB9A 4F5DA 2YJ3A 4MHSA 3TNLA 1J2RA 4B3XA 4DCJA 2L2QA 4NBTA 3IKLA 3B2EA 1BWQA 3PXAA 5C7YA 3ZHSA 5AVQA 5MDHA 5ELXA 3TD9A 5COQA 2FCRA 2W2VA 4DQDA 5HGXA 3RB8A 3GGDA 4X62B 4O4HF 3QMMA 3PICA 3CLVA 5SV2A 2E37A 1E60A 1M6YA 2KJQA 1OU4A 1TQHA 1AMNA 3RRYA 1IBLB 3BWVA 3OKAA 4FC6A 5FFNA 5FQOA 2AH5A 2A30A 4RVDA 3QUQA 1C5KA 5IN5A 1FNCA 4YLEA 1SU8A 5AJHA 2KWIA 1MAHA 1XZGA 3I6IA 2H2AA 3U13A 1KI9A 1QK5A 1I94B 1AGRA 1NAIA 3AGPA 1X1SA 3L4BC 4RAQA 4UQLA 3WGGA 5IUJC 4QJ3A 4KHPB 4N54A 2C8VA 1PFWA 1E3WA 1WDWB 4WLFA 1DELA 3FSEA 3D8NA 3GGGA 2JW5A 2HFKA 5CK4A 5C8ZA 1E3WB 3HP7A 2OQVA 1L4YA 2EP7A 3EYAA 1MAAA 1YB6A 4MO2A 4I3GA 4K9RA 3NTXA 4KQFA 4G0WA 4XVCA 1VM6A 1Y0BA 1ODTC 1OXKB 2FE4A 3AF3A 1NVXQ 3QEAZ 4QOEA 1UBMS 3EIQA 3P8ZA 2B1IA 3KXDA 1VFNA 4WFJA 3SY8A 3U44B 3KYDA 4RETA 4JLSA 4FC7A 2QL5A 1WZIA 4V0LA 2EF0A 1M2JA 2VK2A 1SKBA 1XTZA 1L5QA 2JFZA 3KYDB 1IZ7A 3DA8A 2I6FA 1Q3KA 4EMTA 2FEPA 2OBNA 4OQPA 1CEXA 4HPJB 3CEJA 2ZGVA 4YDHB 4MQMA 2PR2A 1A8SA 3U62A 3VJLA 2BIFA 1X2BA 3RS7A 3GJZA 1VJ0A 3P2OA 3ZWVA 2PSSA 3LXMA 3KVRA 3K92A 3DE3X 1SA0A 2VSOA 3O3CA 3WWOA 1Z0ZA 2Q28A 3N07A 4MCHA 1G21E 3RV3A 2R8RA 3U9SA 1I2DA 5C37A 2QEQA 2IYVA 4DLUA 2O59A 3IJ5A 4NP6A 4XASA 2QM3A 1ZGBA 4NJEA 2ZYVX 3WBBA 1J0EA 3W2EA 2IPNA 2X2FA 3LRTA 4KGDA 4ZZ0A 5JDIC 2YH2A 1KEVA 1N6NA 2GFHA 4MV3A 4YMHA 1E2GA 4D9HA 1LDGA 3VJMA 4LQ4A 2Q21A 3E9CA 4XYLA 3I42A 5EMHA 1YULA 3NTVA 1R4AA 2WJIA 1J7JA 2ZB4A 3GCXA 1RRKA 5DBOA 5C1DA 4E13A 2HUNA 5FT9A 3DMTA 3R75A 3ZDCA 2JFFA 3V8NA 2RHBA 4MA5A 1RYDA 3ZE0B 1VIMA 3QVUA 5CDUA 2YNMD 2ZJ8A 1RI1A 1SBNE 1ORRA 2O2SA 2ZI7A 3AHIA 3U3KA 2IPXA 2WNIA 3OETA 1KHTA 1NXOA 1W6UA 1Z7YA 1WDMA 3HN7A 4DW8A 5C7IO 4FNGA 4HWTA 4MKXA 1USKA 1GGEA 3EGEA 4PQFA 2VDPB 4YUYA 1QP4A 1SU4A 2BMVA 2WTEA 5I7FA 3BSWA 2H92A 5HMLA 3HM9A 4QYIA 421PA 2HIHA 4MJXA 3N86A 4MLZA 3BN3A 4TZKA 4G9BA 1G0OA 3GNSA 4Y3UA 5H8WA 2DERA 4QYIB 2YYZA 4Y2TA 5I8WA 3H0EA 2OFWA 3I9MA 4IWXA 4CIBA 1O96A 1AZSC 4QQKA 5AK3A 3ZZMA 4JI1B 4NDAA 4GKBA 1O96B 1OBCA 1DO0A 1KEWA 5TLSA 5SYMA 3KB1A 4QDJA 4A6PA 4UVDA 1ODKA 1PT6A 2GKGA 4IOKA 4R3NA 4U7WA 3UPUA 1JIXA 3GLHE 4FCCA 1KIFA 1A5AB 4HDRB 4MLCA 4OY3A 4E11A 5JV5A 1QGUA 1XTBA 4B5LA 1DT3A 2BONA 2GETA 3T7CA 1J8YF 1QGUB 1XXHE 3H9EO 4YREA 4BYMA 2CL0X 5BSEA 1T0JB 3CX7A 2G08A 4HRVA 3T1NA 2QNRA 3K09C 4PLHA 3CBGA 2A35A 4RADA 4FHFA 2PVSA 2SCUA 4IIHA 1T1SA 3AY6A 1B6RA 2SCUB 2XYRA 3OX3A 1H1DA 5F77A 3MEQA 3EGWA 3PT5A 3RFXA 1GR0A 2VTVA 3S2SA 5IDWA 2KMLA 3DH0A 5HZMA 1CUYA 1U8UA 5U9CA 2XXAA 1A5SB 3U4IA 1ZGHA 1OYYA 4LZJA 3UWOA 3V3KA 2DQ4A 1TYAE 3FHJA 4MDHA 4OP3A 2XXAB 3RFCA 3IUNA 5HW0A 3H5AA 5IAKA 3JVDA 3KZNA 2B30A 1GRQA 2EP8A 2FZCA 4M0MA 3TDMA 5C1BA 1IN6A 1T4DA 1ETHA 2B78A 1HRDA 2V7VA 2FSUA 4UM7A 3A4NA 4KYTA 5JSYA 3W34A 3ZDBA 1C1DA 3TTWA 3LT2A 5FH9A 2ZTUA 3QI7A 3R23A 3EXHA 1GADO 5ERYA 3N8KA 3WWPA 1C1DB 1DKNA 2BGNA 3A6DA 3CYFA 5SZKB 5FYQA 3RIYA 4IJ6A 2IITA 2ZYUX 4H6WA 4MR8A 1F5NA 2XGMA 1QGAA 4GE3A 3RIHA 3RS5A 5K8TA 5HNKA 4QICA 1MFZA 2FA9A 4IFEA 4MR8B 3ZDYB 4TMKA 4BUCA 2X2OA 4ENWA 2CHEA 4XDGA 3HDVA 1RHQA 3UG6A 3UUGA 1V3TA 3MJDA 3E8XA 3O3NB 5A2QA 2DUNA 4Y2SA 1IWPB 3S81A 1F2UA 1WQ1R 5AVKA 2FJUA 1CQWA 3AEZA 1LSJA 3OZIA 3WLIA 3ZHTA 1F2UB 3BK2A 2XXBA 4BO2A 3UT5A 4YRZA 5GZ3A 3GFOA 1KWGA 5ED4A 3T3GA 4XGRA 3GRCA 4PCAA 3UT5B 4L72A 4Q4DA 5EP3A 5ALMA 3A6ZA 1ZMXA 1RC0A 2COKA 1Z6GA 1D5WA 3COWA 3FOCA 3IX7A 4Q3KA 3OIDA 1KMMA 2P2NA 3KR1A 2PGLA 1TIBA 3EW9A 3WV5A 3KE9A 4ZDJA 3VZSA 2RGNA 2R6FA 1QF9A 1VL1A 4Q39A 3VU1A 1CVRA 3WLRA 4EGAA 4QWMA 1G55A 4IUBS 2JD2A 4LDQA 3FDFA 2FMTA 1K06A 4BKUA 1KSJA 3UAGA 3LCMA 2P4UA 2ZVQX 2ZVJA 3A4MA 4HKTA 3ZV6A 1ZK2A 4CN8A 3GDHA 3QQPA 2V9ZA 4ABTA 2VYFA 1JALA 4J0CA 3ZBQA 4ETMA 3B1XA 1LKZA 4OK3A 4HDNA 1D1PA 2IEIA 2CHFA 2Z1DA 4KWCA 1NP7A 5AR1A 3KQNA 1N75A 1TM5E 3CZQA 4HDNB 1NFQA 1GAJA 5E9WA 1A8HA 1ZW6A 1HETA 2QNIA 1I2CA 3FRIA 3AXSA 2FAXA 1FPQA 1BHQ1 3R3HA 1Y5IA 2UDPA 4LBVA 4MQ6A 5C51B 3LBYA 3FETA 3VX3A 4QVIA 1E92A 2J6CA 2BZ1A 3W1VA 4O2AF 1J8FA 3PIIA 4B35A 1CK4A 2BDEA 4KVAA 3AYZB 5J1TB 3RC2A 4FR5A 3GEIA 3KJXA 4GEKA 2CV0A 4LMPA 3HCBA 3DONA 3NDPA 3R77A 4DIBA 5KNDD 1JW9B 3HBAA 2G5PA 3I73A 3R0VA 3PQFA 5AD1A 4HGYA 4OQNA 4GWKA 2ZWOA 5AXBA 1P7CA 4KXYA 5FTWA 3N0RA 1YFJA 3ZHCA 4F38A 1QS0A 1E3TA 1RCTE 3HMQA 1PV4A 3UAXA 3C3PA 3HNRA 3E61A 4BZPA 2C20A 3I5UA 1YZYA 3VZBA 4FS3A 3GRVA 4EY7A 4ZOAA 4ILKA 1H0KA 3LDAA 1PL7A 2XDQA 4PZ0A 4YGYA 4P5PA 4XDZA 2RGWA 5ADUS 2XDQB 3VFDA 2UYCA 3MCTA 1QPZA 5EQFA 3GC6A 3KUUA 1TLFA 1CUZA 3Q15C 1G291 4KUEA 5CNKA 1ISFA 4R8VA 2G25A 5EE3A 4BQOA 1W30A 4CLDA 3T3NA 4DR5B 2GDJA 3UH0A 3W4JA 2FJPA 1M72A 1Z15A 3H7AA 4GMFA 2X5KO 1BDIA 4ZCTA 4DWVA 1NQWA 1U9IC 1E89A 2P7IA 4Y2UA 1EA5A 1NNUA 3FI0A 1VRCA 4BX8A 1QUEA 4Z49A 1B42A 2J6HA 2NYUA 2P41A 2VEOA 4L76A 3I01M 2NUTA 2WI8A 3WJ7A 4IIUA 4CN9A 1TU4A 1H65A 2NUTB 2ZITA 3QUAA 4F2GA 1IEQA 1ZD5A 3OOSA 3PXDA 4YRCA 5GGYA 4L5YA 2Y1DA 1FVXA 1ZNYA 2B61A 3JYPA 2DCMA 3MSXA 3GARA 4LY6A 4Z99A 1QOQB 4C7KA 1BQ4A 4J0EA 1IQUA 4RZ2A 2RGXA 3U7HB 5BUCA 3FAZA 2HBQA 3OAAD 4BWFB 4BP8A 2FEXA 3IVAA 4IQ0A 3M9XA 4PSCA 2LGJA 1GQRA 1IUPA 4PZAA 5J3JA 3DEIA 1IU9A 2DFNA 1G17A 1UK7A 2AZDA 3D4BA 3OTWA 3Q0TA 4M1EA 4U7JA 1KDYA 2OCYC 3RC7A 2PUDA 1DTEA 5HEKA 1VFPA 4KZKA 3BFKA 4OSOA 1J8DA 5DE3A 3SBDA 2P68A 4JI2B 1F3OA 1GGVA 1Z88A 2JJ2A 2POQX 2Q50A 2ZT7A 4RTPA 2NU7A 2WWYA 3Q3VA 2EHJA 2XHZA 1FNNA 1X1BA 3NH9A 2NU7B 3WK7A 2G88A 5B7GA 1A5BB 3I28A 3T38A 1VBKA 2YY6A 1A96A 1D2HA 3D3KA 3N59A 4HGZA 3FPSA 4M7RA 8AT1A 4EVRA 3VO9A 1CY2A 2DECA 3SYNA 2Q6IA 3VPDA 2HHHB 4AQ7A 2J3DA 4DANA 3OCCA 3B6KA 3KQTA 2ZSKA 2QB5A 2XADA 3EDQA 3FE2A 4LHZA 4LRYA 4CKYA 5LWHA 3UGJA 4W8HA 3E15A 4AULA 1X1AA 1SPXA 5AYVA 4RE5A 3ENVA 3LHKA 3GJ4A 1KU0A 4X7MA 1OTXA 3FM9A 3BZWA 4FEAA 4Q3AA 1QH8A 1NVFA 1OV4A 3NUGA 2NG1A 3DNPA 4OP1A 1QH8B 2CFCA 2J0EA 4GQBA 2QRNA 3AM1A 1EAYA 1X7DA 3W8RA 5EOVA 5DYYA 5LZ2A 4KPFC 4GMXA 3RVNA 1ESCA 1CS4C 4B7XA 2VQ3A 4JI6B 4BJ6A 3RM3A 5AKZA 2GZ3A 5ALRA 4BNGA 1IULA 5EJEA 3HFGA 1X19A 2ZYSA 1G20E 1SAYA 4NZYA 4FMBB 4AWAA 2FF5A 3RK0A 3SQMA 3UMYA 1EH5A 1PT7A 1TOAA 5EJIA 4R1MA 1KP2A 1SWWA 1IQPA 1F38A 1JJ7A 2HBRA 3CQ9A 1GZ7A 1N6PA 4PIPA 4AKHA 1AQYA 1SXJC 5FUYA 5SZHB 4EY6A 5CHYA 3NONA 4GPD1 3RKUA 3TMAA 4UVHA 4CT5A 3WOHA 3IS3A 3CURA 1RWXA 2BUAA 2HA4A 3A6KA 3JQQA 3KKOA 3N2GA 3WRYA 3BSSA 2OV4A 1YU9A 2XMSA 3N2GB 1IIRA 2R8ZA 4O2AB 4U2CA 1DCKA 1LUAA 3AM5A 5A6SB 2G3YA 3IEXA 4DDVA 2G5GX 2OO5A 4XM2A 1C9JA 1WPRA 4X7BA 1CG6A 2X6TA 2BTEA 1B8PA 4DJEC 3WGJA 2QN9A 3F71A 3ZYCA 2QR2A 2BC9A 2VFAA 2PRJA 3K5IA 3JYLA 4ZQEA 2NO1A 3HDJA 1OKKA 5DHAA 3K0EA 1ECBA 3RADC 3IULA 4O29A 3OU6A 2YHIA 5B5SA 1LF5A 2ACEA 3A3YA 1ORDA 3DPSA 4MCJA 2YHIB 1D1QA 4TKVB 1Z28A 3ZGYA 1I1NA 4Q4HA 1NF3A 4ZQFA 3STXA 1BOOA 4JVMA 4ND7A 2YINC 3PWTA 3ESYA 1PFVA 2R84A 3CT6A 1M2FA 2VLBA 5CITA 2PS3A 3H6GA 3BCSA 2EX1A 2OPBA 1F5SA 1S2NA 4I1UA 5D86A 1RM3A 3WL5A 4HNAA 3JTEA 5BSGA 1IY1A 4RVGA 3T5DA 1CJMA 4LJ5A 3TR0A 3SFVA 3NGXA 4JSYA 1E1QA 4OOEA 4XGKA 4JJ8A 3M82A 4A8JC 1L7QA 2VN8A 1W5TA 1KARA 1JIJA 2YWBA 2P75A 1OIVA 3RI3A 1XTTA 4XQGA 4CE6A 2BZGA 3LX6A 2Z5FA 1QIIA 4K9QA 4RIFA 1RPZA 2PRZA 4LXHA 4PGFA 3UVEA 2GK3A 3VUEA 2AZ4A 1Q57A 3BL6A 2DU8A 1BC5A 3GVPA 5LP6C 3UJ6A 4TVOA 1K89A 4EH1A 1XMXA 1QZTA 2IWRA 2QLFA 4M9ZA 2PUHA 1P1BA 5JSKA 4TV8F 5FBQB 2NX2A 4N41A 1GSIA 1K4MA 4ER5A 3ERCA 2UYYA 3NP7A 3BGDA 2YFYA 2ZPUA 2VDWA 2V65A 2VYND 1OHHD 2P65A 5BOSA 1FUYB 3K20A 2VDWB 1W5BA 3ENNA 1FLAA 4JNKA 1DEXA 3QSGA 2ID7A 3RU3A 1DAIA 5BOSB 5C46F 2CL6X 4RTRA 2ETXA 2XTZA 2GHTA 4IJVA 2H7XA 4OK6A 1V9LA 2W9XA 3W9SA 4Q82A 2E85A 3SQXA 2H7VA 4BVEA 4PLCA 2QYSA 4CM7A 5JCJA 1QTIA 1XQ1A 3QVOA 3E48A 1I3OA 3K6SB 3HL0A 1PK8A 5A05A 3VSAA 1COWD 4FOLA 4F7WA 2OZPA 4S1NA 1BVYF 2EFDB 1O5TA 5F35A 1JAZA 1HM5A 4BMDA 4D96A 5C80A 3AINA 4TMFA 3EZ2A 5G0TA 1Z8FA 2NUAA 3AXTA 3CWCA 4GS5A 3DOEA 3JZMA 3NUQA 4M60A 2C2MA 2IEZA 3LKBA 4IO1A 2AS0A 4IEIA 3F9RA 2NUAB 2MMCA 3CH7A 3ZI0A 2I3AA 4OREX 4OQEA 3KSBC 2QI9F 3E8SA 3OZAA 1X9GA 2ES4A 4TV9F 2QDKA 1SWVA 3K05A 1XTJA 3HFJA 4MV4A 4EVIA 3JPYA 5AVSA 4YDQA 1AKQA 2EG5A 2H2FA 1QYCA 4LRQA 5JCOA 2GXAA 5BSHA 3ZWAA 5JRZA 2FRDC 3FY4A 4XLTA 1V39A 2OHIA 5CTAA 1FP1D 3BCHA 3HMKA 4WGGA 1ZFNA 1K5GA 1GDTA 2Q3CA 4TSKA 1MORA 2G77B 3BB1A 4FHGA 5AVXA 3G79A 2FPKA 5DULA 1U04A 3NZEA 3L4JA 3PNVA 3UBTA 4C7OA 4E46A 1R6DA 4DWOA 1E2JA 4Q4CA 1KJ9A 2IZ1A 4F9FA 3KQYA 5KNCD 4Q3DA 3ZGZA 3BTUA 1KMNA 1I4OA 2WA1A 1UWCA 5KVCA 1YD7A 1NMSA 1Z75A 2FWIA 1T9BA 3OPNA 3KWLA 3G9QA 1V2GA 3KUKA 5LYYA 4KJZA 3STHA 2QV0A 4ZYWA 3E9ZA 2NM0A 2BFDA 2XUAA 2RHWA 1G8GA 2BBWA 2BFDB 3COZA 5CLGA 2PZBA 1UAAA 2J3MA 3A1VA 4XQEA 1YFLA 1G9TA 2ST1A 3CLHA 5A03A 1SC3A 4X6UA 1O97C 1O0SA 4FGSA 3E5HA 1RQXA 3LP8A 1T9KA 1QLJA 2E48A 4G1FA 4HUQA 4QBKA 3UV3A 4DIMA 1YRLA 2FKAA 4X94A 1RWOA 1LW6E 4YIKA 3RNLA 1A98A 1UT5A 1JI0A 2DHEA 2NSDA 3V2HA 4R1TA 2FDRA 1Y3DE 3WYBA 2BE9A 1GQFA 2WTUA 1QV9A 2JFPA 2J0VA 4H60A 4IMIB 3PIRA 4CCSA 5CBKA 1KQPA 4V0ME 4HWPA 4DV4B 2VRBA 3DLBA 1UBNA 4QPZA 3ZV3A 1N2GA 1A8UA 1JPJA 1MG5A 4UAUA 1RAHA 5AW6A 2Z57A 2QQEA 2CXPA 4BV9A 1E0KA 4ARCA 3LCVB 4L7QA 5DM70 1HBJA 1DFHA 4W6QA 2XB6A 3IJPA 1NVAA 4DC0A 4RA6A 4BNMA 2CUTA 1ESEA 3NT2A 3IEPA 3RTDA 3AW8A 3D8TA 3MWGA 4RA6B 2IS6A 1JKMA 2ZQYA 2H11A 3QY9A 4EF5A 2HOQA 3ZZNA 3VC1A 4YAKA 1EVLA 1SZJG 1JR3A 4FYJA 2ARKA 6ADHA 1S2DA 2ODBA 3HUUA 3K73O 4ESEA 2JK1A 4FKZA 4OQZA 4JJKA 3WSTA 1CUSA 2O0LA 2W58A 3G2QA 4YRFA 2CZGA 2UVQA 4GLFA 1IZZA 1PW5A 3FB4A 3OOHA 4YV0A 1AN9A 4JT8A 1V9SA 1Z4KA 2PLAA 3C6XA 4NZZA 2JK0A 2QTFA 4G0ZA 1U3WA 5L3ZA 5HWSA 4UHEA 5EJAA 1YQGA 3HABA 4CTJA 2EZ9A 2G76A 3ESQA 4GX5A 2XIJA 2WVGA 4TV8B 4BTVA 1DJPA 3WNCA 1R18A 4Z54A 1X42A 1J49A 2Q3MA 4BBZA 2XMGA 1GG9A 3QPDA 1U8AA 4UXIA 4JGGA 1N8TA 1WKVA 3OPXA 3I62A 1JG1A 5CT5A 3CV3A 3NHMA 3DLPX 1KYZA 3DD1A 3G8DA 3GLHB 1EZZA 1BJKA 1GFWA 1S1MA 1V41E 3FWPA 3PYMA 1TYBE 2ZSBA 4P3OA 4RD3A 4BCDA 4G26A 1YAHA 3MUEA 2MU1A 3CRNA 5AOBA 4UREA 2DFPA 1PX2A 1LSOA 2I6SA 2W42A 4ZZ2A 1VHDA 3IAXA 3DE1X 4CF6A 1AXRA 3C3XA 4GMDA 4PAWA 4FOPA 3CXRA 2I91A 3AR8A 2XCLA 3HN2A 4O1HA 2V4UA 4LMAA 4M7PA 3K0FA 4OAPA 4BAGA 4AL4A 4CMGA 2Y1OA 3NWPA 3RJZA 1R27A 1XZCA 3K0FB 1KI8A 3GRRA 3RYFB 4HK4A 3TW6A 3ZWDA 5GTDA 1NW7A 5F3RA 2CCKA 5I4KA 2PYDA 4AJ4A 3NR2A 5F5NA 4KG7A 4IVQA 2A0UA 1PKEA 2YWDA 1XCJA 3NPAA 1QHFA 1SXIA 1ESZA 4IY1A 3B1YA 5GM1A 3U16A 1MEJA 1KY4A 3VR5D 2GEFA 3PQ8A 5KZMB 2M1XA 1NW5A 3C8MA 1JH8A 2A58A 4TX1A 4B3FX 3M4JA 4JVOA 2C9DA 3PCXA 4UZEA 5DNDA 2JAWA 4MIEA 4A73A 2FSVC 1XU9A 3GLUA 3RQSA 2V5AA 5FNVF 4DG8A 3MAJA 1QFMA 1YZVA 1JLHA 3CGWA 3GFRA 5BNFA 5DIZA 4P7BA 5HKKD 2RD2A 5KYVA 4UQOA 3IVXA 3SX4A 4E5DA 4C5AA 4F5EA 1TGYA 3PGXA 1Z4IA 5KCZA 2VKTA 4O25A 2ORVA 2FN9A 4ALKA 1S89A 3DCJA 3IXLA 3QBEA 5JNRA 4D3FA 1T4MA 3F6BX 4PAGA 2QYHA 2WJ4A 4YH1A 2QIOA 5IKMA 2DH5A 2QP9X 1KA9H 2QN7A 3ND6A 1LX6A 2BEJA 1DC4A 1P9NA 3EMKA 4PVDA 2R25B 5AHWA 4NV3A 1M6NA 3LHIA 4XVQA 4AJEA 4NEGA 3IEVA 1MVLA 3T99A 4MYUA 3A05A 1EXWA 2IPAB 5JMPA 4AKTA 1O95C 2WAOA 4CLOB 3VR3A 3W2GA 3BRSA 2VOEA 5LJLA 3PXUA 5LD2B 2HWKA 3VM6A 3W5VA 1IJBA 3MBKA 4QNNA 3B3JA 3ACBA 3QUTA 3FWZA 3CCBA 1P1KA 2C2WA 5E1OA 2O3QA 1GPAA 1DBRA 1EUZA 3OKFA 2QSJA 2O0JA 1F3LA 4EB3A 5KNLA 3ECCA 5F33A 1HNWB 1OWLA 4Y30A 3I92A 4B8ZA 1BO6A 4LTDA 2O6HA 1Z6PA 3IHTA 3QVXA 2B3TA 1MU0A 3UC9A 4NC9A 5H4GA 1AGNA 2PAFA 1E7QA 4EI8A 3RROA 3N70A 3T9BA 4EY8A 4LCEA 4L5AA 1X7WA 5GJVC 5KIAA 2G0AA 3GQBA 5TT1A 1H4SA 3X3HA