4GECA

Crystal structure of e.coli menh r124a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
VPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAEAQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gecA00
4CIAA 2G63A 5EI5A 5LP1A 4WY5A 4XWGA 1DWOA 2GZSA 3RM3A 3PFCA 1IZ7A 5C8XA 4JEIA 1MJ5A 3H17A 4J0DA 1JKMA 1AC5A 1C7IA 2XMZA 5FKJA 2BUCA 2VATA 1AMNA 2J4CA 1VOTA 2Z8XA 1THTA 1JI3A 1SC9A 1EK1A 1TCBA 3R3WA 2X8BA 1F6WA 4U2DA 4WDRA 4JH0A 1A8UA 3RKSA 1WHSA 4B82A 1GKLA 4H7DA 4OSEA 4N5IX 1B6GA 1E8NA 3F97A 3DL7A 1CIJA 2V98A 4OB8A 1TQHA 4HRYA 3O95A 1GQSA 4A23A 1CUYA 1CUHA 2Y6VA 3BE8A 3WJ2A 4Y2VA 4KJXA 1ACJA 3FYTA 3KWFA 1N5RA 1XZFA 5BWCA 3STTA 5LZ8A 1ZD5A 2ORYA 2Z5GA 1TKRA 1XRMA 1G66A 1S8OA 5BOVA 3HXKA 3WZMA 3A2NA 1XRRA 1SCKA 3AUKA 5AP9A 5LLSA 3R3XA 4J0HA 4RE5A 2QZPA 5BV7A 2WILA 1CUSA 3QITA 4G4GA 3K6KA 1XZAA 5FPQA 2OAGA 3UUEA 3IUJA 3MGAA 4X93A 1DQYA 4HRXA 2IIVA 1LPNA 1WPRA 4LYDA 3R41A 4GHWA 3P2MA 1DT5A 1XROA 2RHTA 5JALA 1W76A 1DT3A 2ZYIA 4W1PA 3IBTA 1ZI9A 1YCDA 4Y2JA 2ZSHA 4X91A 5JYCA 4BBZA 1LGYA 2HDWA 4QDZA 5IVKA 2Y2UA 3STWA 3QMWA 4G4JA 2OPHA 2GBCA 1FSSA 2PSJA 1N1MA 3AILA 1GGVA 2H9YA 5JZSA 1BEZA 2WIKA 2DHCA 3PE6A 2PVSA 4YK7A 3C8HA 3D2CA 4J0CA 1LPOA 2G4LA 5JADA 3ZV7A 5HF5A 3F67A 4B81A 4FKBA 1WHTA 4LYEA 1VJ5A 3BJMA 5IKXA 2DCMA 1X2EA 4RNCA 1RWQA 1BCRA 1CUEA 4KE9A 5DYTA 3NUZA 4CG2A 1UKAA 1R3DA 5AKEA 3C6ZA 3HSSA 3WA7A 3K2IA 4EY4A 2VEOA 3FNBA 3CCCA 2OCGA 3WMRA 4BATA 1R4ZA 2HA6A 1FFDA 1E3QA 5K3BA 3LP5A 2BGRA 4H7IA 4V2IA 4O08A 1R9NA 4UBOA 1DX4A 4BAGA 1JJIA 4X94A 3WWOA 4W1RA 2XQIA 4RPCA 4BC0A 1EVQA 4FNGA 5EFZA 2ZJ6A 4B85A 1BN6A 4DM7A 2PUJA 1CUJA 4K6HA 3WYNA 2XLBA 2ZYSA 2FX5A 5AO9A 1GQRA 2O7RA 3FAKA 5E4JA 3FCXA 2V97A 5FUMA 1LPAB 3I2FA 3I2JA 4KAFA 4OUKX 4AB1A 1QIIA 5ALEA 1AQLA 3V1MA 3G0BA 1KU6A 4Y2UA 2CZQA 2QJRA 1F0PA 1GPKA 3WK5A 3F8SA 2XMCA 2DHDA 3DDUA 5K5EA 5KWIA 5ALUA 2DFPA 2C7BA 5ALXA 2HIHA 1GKKA 5AM5A 5ALHA 4UFPA 2JEZA 1MX9A 1QO9A 3R40A 4WFIA 3WLAA 2O2IA 1RP1A 1BEEA 3WK4A 4ARAA 1ORWA 4ZGBA 4E46A 5LYYA 1H22A 1ODCA 1MX1A 4ETWA 4DNQA 2BUBA 4FLEA 5K3FA 2XE4A 5CH8A 4DLNA 3C6YA 4FNMA 1W4LA 3WIBA 1TK3A 2Z3WA 2DR0A 5CT8A 3PDCA 3BWXA 5HQ3A 4QDTA 2RONA 3TRDA 4JNCA 4F5ZA 1EDEA 1BRTA 1EH5A 5HCUA 2DHEA 4INZA 1UK6A 2C4HA 1JMKC 4CCWA 1HL7A 1SFRA 3STYA 3S2ZA 1UZAA 2BUAA 5AOBA 2FJ0A 1ACLA 1YSCA 5T4HA 1QTIA 2HA0A 2QKYA 1NX9A 3L1HA 3ZLTA 4C89A 4UPDA 4IQ4A 4DSZA 2PPLA 2PU5A 3V9AA 1H2XA 2OCIA 4ROTA 4C6HA 3DKRA 3QH4A 1TCAA 4J0KA 3AZPA 1HBJA 3STVA 3ESDA 4BE4A 3U0VA 1XZMA 3W9BA 1YA8A 2CJPA 4S0XA 3FSGD 2EEPA 1JJFA 2W6CX 1K8QA 3R0VA 4GW3A 1XLVA 5AHXA 1E8DA 4XX1A 4QWMA 5ALTA 4BDTA 4FFWA 1LZKA 4XIIA 1H2WA 4DIUA 4PQEA 5FDFA 4G4IA 3S8YA 3BIXA 5SYMA 5AKIA 4Y9SA 4WCVA 4UHDA 2DQYA 3FLBA 4CCYB 1WB5A 1MNAA 3A2MA 4AMYA 2OQIA 4BCCA 2ZYHA 3PUHA 1XZGA 3X3HA 3FWHA 5CRIA 4PO3X 3W2TA 2FUKA 1Z68A 3BL8A 2WIGA 2O2GA 3I2HA 5AM0A 5A6VA 3HRHA 1G4HA 1DTEA 3D59A 3UUFA 2J4FA 4L3WA 4PSDA 4G5XA 5EIEA 1VA4A 1VXOA 1HDEA 3K9BA 2GBFA 4FBMA 4B7ZA 2K2QB 4OPMA 4UBJA 1FFCA 4WJLA 1LZLA 3IUNA 4HZGA 5DNUA 4UHEA 1CUAA 3QBJA 1H2ZA 1UOPA 3M82A 1T4MA 1JU4A 4CG3A 3ZI7A 3M83A 2WJ6A 4BP9A 1GPLA 3WKAA 4E11A 4K6GA 3FBWA 2C5GA 3MUOA 3CXUA 1BN7A 3EQ7A 1YS1X 3MUNA 4MEAA 1K63A 4CIBA 1MX5A 3D4LA 1BCSA 1DINA 4KACA 4PV7A 4IO0A 4U2BA 4OYLA 4M0EA 3V1LA 1MT3A 3ZWQA 1XZBA 3G9ZA 2RI6A 5CT4A 2GYWA 3G9UA 1X70A 4X3CA 2XMGA 4G8DA 1R9MA 1E66A 2I78A 5DTJA 5JATA 1VA5A 4KE6A 4TPKA 3DOIA 2ZJFA 4QA9A 2QS9A 4MYDA 5AOCA 2XUQA 1IUNA 2JIDA 5T4BA 5K3EA 4HXGA 2WTMA 4Q1VA 4EZIA 5ALWA 4MJ3A 1QONA 1KEZA 1U65A 3B5EA 1C4XA 1J2EA 2OCLA 1WOMA 1W52X 3GA7A 5K3CA 5CTAA 2PU7A 4BE9A 4DMKA 1QJ4A 3I28A 1WCYA 3W06A 1GPNA 3H2GA 1F0NA 2XT0A 2V9ZA 5LKRA 4JYPA 5CT6A 5KWJA 5FLKA 2H7YA 4AN0A 2WUEA 3JWEA 4X00A 3QM1A 4QE3A 3T4UA 4C4ZA 3OPMA 3TGLA 1G5FA 4Q82A 4BDSA 4AO6A 2WHQA 3WWDA 3FYUA 5LZ4A 2WUDA 3HJUA 4HVTA 5HFAA 3W05A 4J03A 1QIMA 3HYSA 2XUJA 3GUUA 2WU3A 2WHPB 4UHBA 1H2YA 1L7AA 3UMJA 3QPCA 5A7GA 4N8EA 2HRRA 4F60A 1OXMA 3DQZA 4P9NA 4BZWA 5JD4A 1YB6A 3WL7A 5C8VA 2PSDA 4J3JA 4H7JA 1CUGA 2BGNA 2WU4A 3HI4A 3IB3A 1YASA 4DNPA 1N5MA 4ZWNA 2WQZA 1JFRA 3F98A 4W1QA 4D9JA 5J3JA 3KWJA 1QIHA 3C5WP 5I9IA 5JAPA 2WG2A 1LBTA 5HKBA 1K5PA 1EHYA 5CW2A 4BYMA 2C5FA 1AZWA 1AURA 1ISPA 1P0IA 1GZ7A 1QLWA 4J0GA 1CPYA 4AX4A 3E4DA 3E3AA 2VJBA 3FLEA 2HRQA 2HA3A 3EF3A 3ZPXA 1LBSA 1FFEA 5ALIA 5DNVA 3OTQA 5I8PA 4H35A 2D5LA 4EHBA 3H2JA 4BB0A 1XQWA 3H1BA 4DMCA 4QDOA 2JGKA 1BROA 2QM0A 5C7YA 5AK6A 1WM1A 5JIBA 3KSRA 5AOAA 1J1IA 3ILSA 5LZ5A 1XZJA 3ESCA 4XJVA 1G42A 5DTIA 3B12A 5E2IA 3RLIA 1Y7HA 1A8SA 4P92A 5AKZA 4LXGA 1Q0RA 3HEAA 1VZ2A 3DS8A 2V96A 2OQVA 5AICA 5AM2A 2YYSA 5HFNA 3O4IA 3H04A 1CUIA 1LPMA 1NU6A 3D7RA 1CUUA 4AMZA 1JMYA 2XQKA 2RGUA 3M81A 2JGJA 4UBKA 3CCBA 2HA5A 4ITVA 4C4XA 4WY8A 3QYJA 3VISA 5JANA 4IH1A 3FCYA 2J3QA 5DLPA 3LS2A 3HLKA 4Q3OA 1CLEA 4FLFA 2QOEA 3C45A 1DU4A 4NVRA 2D0DA 5ALLA 4RGYA 3OURA 1I6WA 1UK8A 2RAUA 3F9CA 1P0QA 4BCBA 3C70A 2H7CA 4ZXFA 1CQZA 1QE3A 1YAJA 2WLSA 4B0PA 4DMHA 3WK6A 2CB9A 4A16A 1K4YA 4FFVA 3PFBA 6YASA 3IDAA 5ALZA 2WUGA 5AIBA 5JD6A 5CBKA 2DQZA 4YASA 5D7BA 3ZLVA 4I4CA 2OAEA 1XRLA 4DNOA 1QGED 1Q0ZA 3WKDA 1WPXA 5ESRA 1N8SA 5CXXA 2OCKA 3VJKA 1F8UA 1E5TA 1USWA 3DYIA 3HACA 3BXPA 4FLMA 4B80A 1W75A 3VJMA 4KAAA 4QLOA 2WG1A 1SOMA 3G9TA 4E14A 3AIMA 4QEKA 1AUOA 1XZIA 2LIPA 5CT5A 2VJCA 1LLFA 3BDVA 1CVLA 1XQXA 2XMDA 1ZIYA 5EIHA 3LCRA 5AM1A 5AKJA 5ALNA 2AXEA 2VJAA 1ZD2P 5LIPA 5I7UA 1UFOA 1GXSA 1L7QA 4WFJA 4EB0A 2OGTA 2XUFA 3OM8A 4BAZA 1MNQA 2PSEA 3G02A 4AO7A 5CURA 4Q34A 2Z8ZA 2VJDA 3HABA 1EXWA 2WFLA 1EDBA 3IULA 3AINA 1CUZA 4KE7A 4NS4A 5IVHA 1Q83A 1TCCA 2NW6A 3I2KA 3ANSA 2E3JA 1AX9A 5AKHA 5EHNA 3WA6A 4CG1A 2WIDA 5CH5A 3O4HA 3GROA 2XUHA 5DWDA 1UXOA 3YASA 4BZZA 2HADA 2XI4A 4QWWA 1QIFA 4X95A 5DJ5A 4U2FA 1UOQA 1TAHA 3KOOA 5AKGA 5A7HA 4LXHA 5AK4A 4B0OA 4X6XA 1H23A 3RK4A 4X85A 1ZICA 3PF8A 1J06A 5K3FB 1B41A 3I2IA 1E8MA 4WDQA 5T4FA 1ORVA 3WJ1A 3WYDA 2HL6A 4ZRDA 1XZCA 4H7HA 5FV4A 5BWBA 4DMFA 5EHXA 3R3UA 2BKLA 4B6GA 2ECFA 3TEJA 1IMJA 2AJDA 1XRPA 2JGFA 2JGEA 4GI1A 1EDDA 4Y2SA 5HQ3B 4X6UA 3OC0A 1O6GA 2VT6A 4H7EA 1UWCA 1YS2X 3GFFA 5AM4A 5DYWA 3G0IA 4A5SA 1CUXA 4UFNA 4Q05A 1JJBA 4OB7A 1CUWA 1YAHA 4ZV9A 1EK2A 1P0MA 2ES4A 4I3FA 4J0JA 2GZRA 2WFMA 3IUMA 1E89A 3PICA 3VKFA 2ZSIA 1VXRA 3W04A 1PV1A 3BIWA 2YXPX 3I1YA 4AQDA 1P0PA 3EQ9A 1GT6A 1FFBA 3WWPA 2HU5A 1ZIXA 4MQLA 1CUFA 4DTCA 3PUIA 4BVJA 4UBLA 3W9UA 4Q3KA 1HQDA 5AKLA 1XZLA 3QZUA 2XUOA 3ESAA 5HKAA 3WWCA 2HHAA 1QIJA 4H0CA 2PSHA 4KAJA 1Y37A 4U2GA 3IVMA 3ANTA 2OLEA 5C8ZA 1JU3A 2WG0A 3JYHA 4OD0A 4B9EA 1VKHA 4C87A 1IVYA 2GYVA 1ODTC 3SX4A 5H3HA 1YB7A 3VVMA 4Y2YA 2WIJA 1W6RA 2JGMA 5FPPA 4K6KA 2R11A 4QDUA 1ZOIA 3WK7A 2QMQA 4M0MA 2XUDA 2OGZA 4NMWA 4M0FA 5DYYA 5K3DA 4CI9A 3IURA 3VVLA 2Q0XA 3WKCA 1U8EA 4Y2TA 5AI8A 3NWOA 3O9MA 2EDAA 1R88A 4FWBA 2H1IA 2Y2VA 4X92A 2VTVA 4PW0A 1YA4A 5AK3A 1BU8A 5HF6A 5KREA 4TVKA 2ACEA 5ALGA 4JUIA 1A8QA 5JARA 2DSNA 2XB6A 3FVTA 5F4ZA 4B84A 5A62A 3H1AA 4UFOA 3LLCA 1T2NA 4GBGA 2W22A 2FJPA 4GECA 4RE6A 3O0DA 5AIAA 3AFIA 4FTWA 2VQ6A 2QXTA 4H18A 1LPPA 4AN1A 5EHZA 4ZV7A 3WKBA 1DWQA 3SWWA 3PF9A 3F96A 3QPDA 5HK8A 4Y2QA 3QVMA 5AK5A 1MAAA 2G5PA 3U1TA 2CMFA 2AJ8A 3O4GA 3DJYA 2VF2A 3OOSA 4HTAA 4C01A 4QNNA 4YPVA 1LNSA 3GBSA 5LZ7A 5ALOA 1WB6A 5CT9A 5IVDA 3D2AA 4X90A 3QPAA 5AI5A 5JASA 3WK8A 2XQJA 2WFZA 2HA2A 2ONCA 4KR0A 4BTVA 3G8YA 1TIBA 5A71A 5IVIA 5A2GA 2G5TA 3AZQA 2WUFA 1HKHA 2JGLA 4Q3LA 2AJBA 4K5QA 4FMPA 4AXBA 1A88A 4G1FA 1C7JA 2B4KA 4BVKA 3DLTA 4Y2RA 1X2BA 1JT2A 2EDCA 5CXUA 1R50A 2BFNA 3I1IA 4H7KA 2GBIA 3G0CA 4OU4A 1EINA 1CUBA 3LIPA 1WB4A 4BAUA 1MTZA 2Y6UA 4E15A 2VAVA 4DNFA 2CBGA 3G0DA 1PJAA 2BCEA 3WK9A 3FYUC 2QXUA 1XZDA 4MXDA 4ARBA 3H19A 3FYUB 3STXA 3DCNA 4BRZA 3Q0TA 2XUPA 3I6YA 4IH4A 3KD2A 2CEKA 2HA4A 2XMQA 1U2EA 4KRXA 3H2KA 2PKYX 4C4YA 5C81A 1EX9A 3AZOA 2ZJ7A 2QJWA 1QIGA 3L1JA 1ZD3A 5JZBA 1FFAA 3I6ZA 4UBMA 5ALKA 1XKTA 3ESBA 4UHHA 1ZGBA 4YX9A 1AGYA 2XUGA 4F0JA 5AJHA 2B61A 1CR6A 1MN6A 4EUSA 4G8BA 5AI9A 4JYMA 5ALYA 4DSAA 3AJAA 4WFKA 4ZREA 1EVEA 3A2LA 1ZJ4A 5EIAA 1RYYA 7YASA 2X5XA 1THGA 3A70A 2JBWA 3WQHA 1VZ3A 5EGNA 4HS9A 2CKMA 3WKEA 5AKXA 3R3YA 4UUQA 5ALFA 3ZLUA 2Z3ZA 2ROQA 1XZEA 5AM3A 4MEBA 1XQVA 5AKYA 3DYVA 4AO8A 3PI6A 2OXEA 1MAHA 4FHZA 5ALDA 4GLBA 1IUOA 4UBIA 4MYSA 4OU5A 5E4TA 3WWEA 1Q84A 2XUKA 4NZZA 2VT7A 3H18A 3HZOA 3EIOA 4X6YA 5JZ9A 2AJLI 4MWSA 3C6BA 4P93A 2JGIA 2HU8A 3SC2A 1SCQA 2QVBA 2PM8A 4J7AA 4EY6A 3B3QA 3WI7A 4BVLA 1LPSA 1PFQA 1XFDA 5ALSA 2WKWA 2Y1KA 4MWTA 4U2EA 3MVEA 1BS9A 4BTLA 4OCZA 5LKAA 3V1KA 5E4YA 3GZJA 5AI6A 3V1NA 2R8BA 4J0IA 5SYNA 4KE8A 4K2AA 2OG1A 5AI0A 1M33A 4FOLA 4LXIA 3D2BA 4BRSA 4LHEA 2WHRA 2X76A 1UKBA 5A7FA 1ODSA 3AIOA 3BDIA 4Y7DA 2PBLA 3CN7A 4PF1A 1U4NA 1XQYA 3C6XA 1DQZA 4Y2XA 3A6ZA 3C5VA 4UBNA 5AH0A 2BAGA 1HLGA 2ACKA 2YASA 3WL6A 2XLCA 1UOOA 4BC1A 1UK7A 1CEXA 2O7VA 4XVCA 1QO7A 3QMMA 2QUBA 4X71A 1W1IA 4EY5A 4C88A 3N2ZB 3OG9A 3WZLA 1QZ3A 5EHQA 5FRDA 1ZI8A 4L72A 3GELA 4GWLA 5YASA 4FDMA 2QT9A 2I3ZA 5ALQA 5FXMA 1XLWA 3FVRA 4W9RA 4HAIA 3EBLA 4KRYA 1QFMA 4BP8A 4G9GA 2XQFA 4P08A 4B9AA 1XZHA 4LKOA 1FJ2A 3BF8A 1QIEA 5JAUA 1XRNA 2XDWA 4FBLA 4X97A 4TGLA 3H2IA 2IITA 3D5EA 2JEYA 3H0CA 3KXPA 1VLQA 3HC7A 3STUA 1CRLA 3ICWA 3N0TA 2HFKA 2HFJA 2WSLA 2ZVDA 2GBGA 3NGMA 1A7UA 2P8SA 1UKCA 5K3AA 5JD5A 2XMBA 4QZVA 3IIIA 1ZJ5A 4X7BA 2QUAA 2VAXA 2YH2A 3R3ZA 3QMVA 3O4JA 2PSFA 1BE0A 3I6MA 1OILA 1QIDA 3TJMA 3V48A 1DWPA 1O6FA 4N5HX 3VXKA 3DNMA 2J3DA 1QIKA 1UT6A 2O2HA 1TRHA 2WFLB 4I19A 1Y7IA 4N8DA 1DX6A 4B83A 3IUQA 5LZ2A 4HXEB 3AIKA 5ISMA 4GDMA 5KBYA 2WJ4A 3T52A 2RHWA 1QOZA 4ZI5A 3VDXA 2XMRA 2HM7A 3FOBA 5HZGA 3DL4A 4CCYA 3M3DA 1CUVA 1HPLA 1MO2A 3KDAA 4BCDA 4Y2PA 4UHFA 2ZYRA 1ZGCA 5D3ZA 5HF9A 3Q8WA 3C43A 1ZI6A 3G0GA 3WIOA 4DGQA 2B9VA 1XKLA 1D07A 2IX9A 1CV2A 1XLUA 1MU0A 2WM2A 5JAHA 1KU0A 4F21A 3I2GA 4OYYA 2XUIA 2WIFA 4W1SA 3BF7A 4HXFB 1VE6A 1K6EA 1IUPA 5D3KA 2PUHA 2JF0A 2OGSA 1QTRA 4EBBA 5HK9A 1CUDA 1EI9A 3CN9A 5AKKA 1XRQA 2WTNA 4H7FA 3C8DA 1CQWA 4G9EA 2HU7A 4GEGA 2PX6A 2QR5A 3E0XA 2QTBA 2VSQA 2C58A 3R3VA 3JW8A 4PSUA 5T4EA 2HA7A 2XUAA 2GYUA 2I3DA 5HF8A 5ALMA 3EQ8A 4Z49A 3LIIA 3DD5A 4EY7A 2BJHA 2C0QA 4H77A 3NOXA 1NU8A 3ED1A 3FLAA 3DOHA 3RARA 2QRUA 3H2HA 4QDXA 3G7NA 1R1DA 2CUTA 1L7RA 4L0CA 4UHCA 5AI4A 3L1IA 1SCIA 3ICVA 1LPBB 3O9VA 5CH3A 4KEAA 4U2CA 1ZD4A 4LIPD 3BJRA 5JAOA 1J07A 2WJ3A 1YR2A 4G8CA 1EB9A 1AKNA 4W63A 4EY8A 1EA5A 3WL8A 3DKKA 1ETHA 1EB8A 1CUCA 4KYVA 4AZ0A 5ALJA 4L9AA 4AZ3A 5FOQA 4OB6A 4PSCA 3D3NA 2PL5A 1UK9A 2C0PA 5IH7A 5FP0A 1IZ8A 5D6OA 4N8SA 5ALRA 2I03A 2B20A 5DNWA 4EA6A 1CFJA 1MPXA 2XQGA 3C87A 2H7XA 3E1GA 4IHAA 3WL5A 3G9XA 2RIPA 5CMLA 4DYHA 1QFSA 3IA2A 4MQMA 2XMSA 4CFSA 2UZ0A 4PNZA 3FSGA 5ALPA 4IH9A 2AJCA 5ALVA 3D0KA 3DEAA 1OCEA 5LZ9A 4QLAA 2WHPA 3SK0A 1XZKA 3VJLA 2VA9A 1VE7A 4GXNA
chains in the Genus database with same CATH superfamily
3W5IA 2FN3A 2G63A 2X8LA 3FX2A 2IOFA 1NQ5A 2GLUA 3PL5A 3AEZA 1GUBA 4PNPA 4D4KA 2QTZA 3K0BA 4AJOA 5A5VA 1YQEA 1PYGA 3CVXA 4C4PA 4ZJPA 4I4LA 1DWOA 1Y8CA 2GZSA 2PT5A 4Y1RB 1SEVA 3EDRA 4TTVA 1SVSA 3N76A 5JMWA 3SQOA 4BL5A 2FZVA 4ZARA 3KUCA 5C8XA 3F47A 5CD1A 3JALB 2ZR0A 5BSFA 1OFTA 4MR9A 3OP1A 1MTOA 3T0GA 2MHCA 4G07A 2A0KA 3DOEA 1U9ZA 1WZIA 1W46A 5CHEA 4Q6BA 4D9MA 1C7IA 4N12A 5CFOA 1Q0QA 5DBOA 1IATA 8AT1A 2KWIA 3M1AA 1WMEA 4A2QA 3EHEA 1N0HA 1VOTA 2Z8XA 5KTSA 4ARIA 3AVVA 4BRUA 1QGZA 3UV7A 5ELXA 1IB0A 2NYAA 2VEDA 2C59A 3FNGA 3GK3A 5FBKA 1SC9A 4B32A 4A0SA 3NMUF 1JLHA 3FVVA 4ME6A 1UDRA 2A9KA 2ZUWA 3P9SA 4IIFA 3AUAA 4R3UC 4TTPA 5FADA 2EARA 4U2DA 3PEYA 1DGQA 4MYRA 2V9PA 3A31A 1YI1A 4P35A 4H7DA 3RJTA 3RYIB 1TT7A 4OSEA 4JI3B 4AKIA 1EE2A 1LTKA 1SU8A 1B6GA 621PA 3DL7A 1CIJA 2ZITA 1S5PA 3VR5D 4CQNA 1IZZA 4CT0A 1TD1A 3OI7A 2XZPA 3S70A 1DC6A 1H6DA 4X1OA 1CQJB 5AJWA 1GQSA 2O8VA 4K6MA 3TI7A 3HY4A 4DNXA 1KEVA 4NU5A 3RTAA 1GPBA 4D8TA 2P6OA 1KKLA 1SM4A 2XA1A 4G0QA 4H0FA 4Z7OB 1C8BA 1Z0DA 4PYQA 3USCS 3U80A 2JFYA 4WPGA 4KJXA 5J2UA 2OUIA 2E0IA 1EFPA 1JIJA 1X7DA 2R9VA 2REXB 3KWFA 4G4SO 4KW7A 4DDKA 4Z7JA 5K0JA 1F5SA 4RTNA 3FI9A 2PUFA 5J4VA 2PEZA 1SZPA 2XCUA 2ZRDA 3ISVA 3BTSA 3B7WA 3STTA 5LZ8A 4M76B 4TMWA 2Z58A 4E22A 2Z5GA 4K8RB 2JLUA 1SZCA 4HDAA 2J8ZA 4MI3A 4E2ZA 3U13A 3HUEA 2GCGA 2PKCA 4ZODA 2IXTA 1TKRA 2WICA 3RTGA 3THSA 3G2OA 5T67A 3NCTA 4IDCA 2CJXA 3JAKB 1W9MA 3QPUA 1NIJA 4QOEA 1OX4A 3W79A 1KAQA 4A6DA 1BD3A 4D9FA 1GPUA 3I92A 4I6EA 4JC5A 4IZ6A 4U0KA 4KOEC 2BHRA 2GPJA 3K4QA 2PL3A 2GHTA 3K1TA 5BOVA 3HXKA 2XGOA 3G5MA 4DQLA 2J6CA 1OTYA 3INNA 2Y99A 1XRRA 3L2OB 4KR2A 1DCTA 1K08A 1ZAYA 3DE4X 2VUTA 3E0QA 5FBLB 5LLSA 4TWBA 5FAXA 1WZUA 3VNRA 3VC1A 4J0HA 4WVFA 4PC1A 2OZLA 4K0KB 5BV7A 2WILA 5G41A 3ZZ1A 1CUSA 3UKJA 3UWMA 2ZUUA 2W9XA 1CF2O 2N0SA 3MT7A 2ZT7A 1YQXA 1H2RS 3DW1X 4C43A 4JLMA 4X62B 3LUCA 4FGLA 4PE5B 3F6RA 2RB5A 1DDGA 2XHEA 3HRKA 1FXWF 3IUJA 3MFQA 2P9ZA 3UHAA 3WXBA 3VR2A 3KQPA 2O3JA 3LPCA 1A04A 1SC6A 2RGCA 3H4IA 4IDOA 5B6IA 5DPMA 5FL7A 3Q1KA 1T1IA 4IHJB 3KLPX 1LPNA 3LFHA 4YMWA 1SU6A 1WPRA 4LYDA 1U2TA 4HRVA 5HJ7A 1A5SB 3TGPA 3LSYA 3MQ2A 3DKPA 1G2IA 3P2MA 2E4WA 4GRAA 3OOHA 4KL8S 4ZCSA 2X0DA 3GNLA 4OI4A 4L0QA 4R71A 3HR4A 1U04A 3BX1A 4ZP1A 1NBME 2HYIC 2B5WA 2Q0SA 2RAFA 2RGXA 3U44B 4U39A 5JCJA 3Q9NA 2DQ4A 2W0SA 4B3HA 4MULA 2PZAA 4MRVA 2WWIA 4D8WA 1URPA 5AUOB 2M98A 1F2UB 1R9GA 4Y2JA 2EKZA 2ZSHA 4X91A 4BBZA 1W5FA 1AKRA 2RMKA 3D0QA 3H99A 4DYDA 5JXHA 5KNCD 3W3AH 3GEHA 3E7FA 2P62A 3LQFA 5DOZA 5IVKA 4HCJA 3B6ZA 3S2FA 1L7BA 4TKUA 5K3SA 3STWA 4M7WA 1LV8A 4B3IA 3PQ3A 3QMWA 4BO4A 4BWVA 3C7DB 5K99A 1LBEA 4PLCA 1GYRA 4GE3A 2GBCA 4HOYA 2OPHA 3LRTA 1Q22A 4A27A 1SPXA 1YJQA 5DTEA 3NYIA 1B26A 2LDXA 3Q3VA 2EP7A 1L6IA 4M60A 4IXWA 4ZAYA 3AUTA 5T57A 4QQRA 4AJNA 5ARBA 3H8VA 4LC1A 2C7OA 6REQA 4EJFA 4RPGA 5IW8A 4UPEA 1BEZA 4RPIA 2DHCA 2F7SA 4MMYB 4BKUA 3O4RA 5CM9C 5I3CA 2B3TA 3ET4A 5AXBA 1PQYA 3D2CA 4Z2AA 5IBPA 3G1UA 2GAJA 2ZCVA 5D8DA 3RHTA 1ZJWA 4YAGA 1LA2A 1LPOA 2PGIA 4CJXA 4Z4QA 2J7PA 1AQIA 2IFTA 3F67A 2F1KA 5EKUA 1RABA 3A7DA 1AS0A 1Q1QA 3QBDA 4FOPA 4NK4A 4AKTA 2CVPA 3VR4A 4ZGGA 1T8WA 5BN4B 5BN1A 1CZOA 1ZU4A 3WNZA 1XZPA 2DCMA 2YZ2A 3EA5A 1MQSA 1X2EA 3ORYA 4DOMA 5LL6P 1M2JA 4LF5B 3LHKA 4CRWB 3GT0A 2FLVA 4JR1A 5AW4A 4CKCA 2MCFA 1DXYA 3NUZA 4I2VA 2VF8A 1H2AS 1ULBA 2OCDA 1SRQA 1JKFA 4HAZA 2A1TR 1BTOA 1QYVA 4NZ9A 1FJHA 5AVVA 5D00A 4UUMA 3G2PA 3WA7A 1TTTA 4EY4A 5JVDF 5LJLA 1P2BA 2FB9A 4PZ9A 4BLWA 1JSZA 2NYVA 5LNK1 1JYEA 2I7DA 4L8GA 2XVAA 1NW5A 1P3JA 3ZH9B 4R8MA 4IWNA 1O97C 1XDSA 2JHGA 4JOSA 2A14A 1C7RA 2HA6A 3Q1LA 4DSOA 3M9LA 2FYTA 3GDHA 5KWEA 2ZRGA 5K3BA 2VDKB 3LP5A 1KOJA 1JF8A 3LXRA 1NXSA 4I2NA 1X19A 4F8JA 3HTXA 1QORA 1E3DA 1IB6A 3P97A 1R9NA 5K0NA 3OPQA 4G63A 3S1AB 2JFNA 2VH1A 1NL3A 2D74A 3CMCO 3NBMA 5TPZD 1VBNA 2FFJA 4OP3A 4QQKA 4ZAGA 4OSPA 4YMVA 2PZKA 1LJ8A 1QGDA 3KTAB 3FFTA 4IVRA 1Q3TA 2HU2A 3L6CA 3MWFA 3ZQJA 3V8RA 4D8XA 1VSVA 4UVGA 2I2FA 1EVQA 2VAMA 4J1SA 3X0DA 4KLRA 4BO7A 2AR7A 1GZSA 4DE5A 1I2BA 3WB0A 3MOSA 3JD1A 3VNQA 3N39C 1YRAA 3UGKA 4GBED 3OZWA 2LUOA 5T8KC 4WI1A 2IGBA 1CY2A 1P4GA 1BN6A 1CRQA 3ZY3A 4X84A 2PUJA 4JQSA 2PKXA 1CUJA 2YMLA 3EUFA 4I14A 3SICE 3W6ZA 3PXAA 3WYNA 1ZHHA 3PJDA 1C9EA 1R4AA 2AMJA 2DTEA 3LT2A 2QPTA 4JOQA 3X1KA 3RS9A 3SC2B 2XZOA 1RC8A 2OHOA 2J07A 3GJ7A 1K8YB 2FX5A 4RV4A 5CA1B 1DEXA 5AO9A 1P9RA 3WQBA 1H6CA 2O7RA 5DH9A 4FVTA 5E4JA 4YI5A 4IHKA 4WNAB 2Q3FA 5EJ6A 1T36A 1Y8QA 2FRVA 2WYUA 4TWZA 1XI2A 2ZBUA 3I2FA 3LX6A 2BN4A 4PCVA 4KAFA 3G13A 4UTRA 3UAVA 2CBZA 5CB6A 1L4NA 1V4BA 5ALEA 3BEOA 3B3GA 2GNAA 2ZJ2A 3G0BA 1KU6A 3DOJA 2CZQA 1PEDA 2IIQA 4NPAA 1DKMA 1GARA 4Y2UA 2ZU6A 2OP0A 4JX8A 4MVJP 3PHCA 3WK5A 4XJXA 2XMCA 2LKCA 2XHZA 3AF0A 4YCDA 4KVFA 3AB7A 1L1EA 2Z4SA 4RORA 1PWHA 4C0LA 1DQPA 1XMPA 4LYGA 4PO1A 5AM5A 5FA6A 1TIPA 1CVIA 3MB8A 3TJRA 5ALHA 1FTSA 3TNJA 1MRZA 2HN9A 1E6EA 2G9NA 2NZUG 4GNRA 4W6ZA 4XSGA 5AVWA 1B8OA 4UFPA 1WUIS 2BBSA 2QY9A 3NHSA 3R23A 2CJFA 2QLTA 5JSZA 5G1OA 1U0EA 1YVPA 1T0JB 4K9LA 3RREA 3VM6A 1JDJA 5KTTA 3CCFA 2HWKA 3GCZA 3NC4A 5LQRA 5AJVB 1VPWA 3LFUA 4Q21A 2WWTA 5FHRA 3BMXA 1BEEA 1KNXA 3HJAA 3UK6A 1O03A 4BNMA 3KALA 4GO1A 1YKFA 4UC0A 4ARAA 4ND5A 3PQ2A 5HZHA 2P2NA 1SZJG 3PIIA 3HKDB 4LE1A 4KQXA 1OLSB 1WCIB 1WPGA 1DG1G 1U0FA 3NHUA 3PB3A 4R01A 4EG6A 2BSAA 5DX8A 4DV7B 2CLIB 1GCAA 3DZHA 5LYYA 1ODCA 5HJEA 4BEVA 1GQFA 4C20A 1NOIA 1LRLA 5L3QA 3NOQA 2TMYA 1XDUA 2QMZA 4B6PA 2C97A 1MLDA 3L8FA 2HCTA 3G17A 2Q7OE 4C0HA 3V4SA 4ABTA 1DTSA 2V6MA 3AOEC 4GPIB 1W2GA 2HCBA 4TMXA 5CH8A 4F92B 4DA4A 3GXBA 1J5EB 2JA2A 2PX0A 1D2AA 4KZKA 4LDQA 3GWGA 4Y6RA 1W4LA 2NYRA 4MRSA 3EPHA 4C06A 1RYFA 4ECAA 3WIBA 5IM5A 2ODEA 1V35A 3UJ6A 3ER6A 3KPWA 3H9BA 3UAXA 4L6AA 2Q1UA 4YRMA 3HB1A 5I9SA 4LWQA 3C4JA 3V1UA 1HRKA 1O1YA 2C4TA 2IUFA 2VP3A 1OH6A 2C8JA 2YIDA 3ESQA 4L7QA 4QDTA 4WZBA 5CP8A 1FW8A 4DDHA 4YXWD 2EGUA 2F8MA 1NN1A 2QP9X 3TRDA 3SVTA 4F5ZA 1EDEA 4O29A 121PA 1EH5A 2QX7A 3W3AD 3S5JA 5AW3A 2Y71A 2GSWA 4LV5B 4I5GA 5H68A 5DTQA 1JMKC 4DA7A 2J6HA 1HL7A 2WT9A 2PYZA 2B8NA 3NI2A 4NQZA 2OFOA 1LVUA 2BMFA 2ZYUX 5KNBA 3T9DA 2UVDA 1K7XB 2LR0A 5DULA 3RV3A 3FNQA 3UY4A 2D2EA 4ZYZA 1HE1C 2FJ0A 3MMZA 5ITZB 3V7FA 3ZIAA 4RFSA 5ERXA 1NVBA 2J0SA 5D01A 2UYOA 1C9KA 1E3TA 3AU8A 3VPSA 1V16A 5DW0A 3AL2A 4G89A 1UADA 3ZLTA 3VUEA 4A0GA 3A05A 4PYMA 1D1TA 4CT4B 3H1GA 1A72A 3TTVA 4N76A 4FD3A 1YD7A 2F8SA 4MKFA 5JOQA 4M88A 1LH0A 2F90A 2XYHA 2H2GA 4ZEVA 4P58A 3H83A 3V9AA 1H2XA 1DRVA 1REQB 1C1XB 4AULA 5JXJA 1S6YA 4P2GA 1RM4A 2PJZA 4MHSA 2X40A 4TV8F 1SXJD 2R8PA 3U49A 1HBJA 1C3XA 3H65A 3N7UA 1TM7E 3KRTA 4EHDA 3STVA 1VRCA 1PDOA 4IBOA 3PHIA 4FYWA 4YJ2F 2OFFA 1KYVA 3ESDA 3ZV3A 3ODPA 1V5IA 1GNVA 5CAEA 4P53A 3RI3A 1SKYE 1MVOA 2V3VA 4IRMA 3CU5A 4B5LA 4K9DA 3VU9A 2AUMA 3L8HA 3KWMA 1QYDA 1SCUA 1COWA 1XZMA 1QQBA 1A2BA 3IEIA 4NOLA 4L95C 5K4GA 2JKVA 2O4UX 2EJBA 2B2XA 3FSGD 3NHYA 4I8XA 4N7MA 2ID8A 1F9AA 1RI2A 4ZRMA 3U1VA 5BVHA 3QFRA 2QNBA 1ZM7A 3NKFA 3QNUA 2V8OA 1QK3A 1V96A 5LDDC 4I46A 4ZOBA 3GFSA 3ANXA 5KINB 4EMTA 3UHPA 3TVYA 1LI4A 1L4HA 3FW1A 2I65A 2IU4A 3OPVA 3E7PA 3PYXA 3FPCA 3AUFA 3AU9A 2XXJA 4IIXA 3L40A 2ETXA 1AHIA 2OCYC 2R8XA 3QVWA 1XMXA 3GZ4A 4IXDA 4BNWA 5ES4B 5JWRA 3L01A 1LZKA 1PZXA 4HAOA 5DI9A 1KTVA 3UHJA 3BMOA 4EI7A 5LMCA 4P3KA 4LF9B 5CW1A 1KDRA 1HGXA 5F7JA 4DIUA 1NI5A 4PQEA 5FDFA 3LP6A 5ERGB 1EQUA 1OD6A 2IDMA 4G4IA 3S8YA 5IPFA 1B6TA 1M6WA 1H1LA 2P3LA 3FSJX 5SYMA 1G8PA 4K05A 1VJDA 2GD6A 3UFXB 5AKIA 2IHBA 1Z9BA 3GFQA 2Q07A 4P86A 5E6UB 2NN3C 3NHRA 5FF9A 2OK8A 3LVRE 5I7HA 5CJJA 2Z8YM 1L6RA 1U0SY 1MNAA 4H6PA 1IHOA 1NLFA 2R1UA 3R1IA 4PC6A 4EGCB 4J16A 3HPQA 4IW3B 3ST7A 4F38A 3CUVA 4WZAB 4CMHA 1I7SB 4DCCA 1LK7A 1R16A 1HTBA 3RPEA 1M34B 3BXHA 4JT4A 4ZOLB 1J8VA 3SN6A 1J2JA 2BCGY 3ZWNA 5LU8A 1KTIA 3U81A 1Y3AA 4UNSA 3KCQA 1SXJE 4M87A 1PJZA 2GWRA 2Y27A 3FWHA 4PO3X 5CRIA 2FUKA 2WSMA 3X3HA 1C4KA 4YEDA 4LVCA 1JQ3A 2ARKA 1T4DA 2IHKA 5I01A 2X7JA 2XR1A 5EP4A 2RCYA 4REQA 1NRXA 1S7GA 3HRHA 4LYYA 4MDEA 3EVTA 4I6GA 4GOKA 4F4JA 1H2BA 4FMCF 1O95C 4L3WA 4PSDA 3PHGA 2XE7A 4BFTA 3QU5A 3ZY5A 2XA2A 1FS5A 1GUFA 5HNKA 1V25A 1VXOA 1ORRA 3K9BA 3E8MA 1G6HA 4FGWA 2C5AA 1IHXA 5A1TA 4B7ZA 1KI9A 1OPRA 2QV0A 4M6WB 4O4LA 3IT2A 4QBHA 1ABBA 4EABA 4HG2A 3AP2A 3OJOA 2I7CA 4GGMX 4WJLA 2AIRA 3DYBA 3AEKA 1XPUA 2C82A 2IYUA 4KO8A 2B5OA 4QVKA 1LZLA 3IUNA 4BNXA 4GWGA 1XQ1A 1UMCB 4HZGA 4KUEA 4GOMD 3C3DA 1JHZA 2O59A 1YQTA 2FMHA 4MOWA 1YR6A 2GN4A 2R2GA 5AWFC 1CUAA 4CUJA 1Z8FA 5DBFA 5KX5A 2Z56A 4X1IB 3BSFA 2GOYA 1ESEA 5EJ5A 4CV1A 1G21E 3KKLA 4RMHA 1T5LA 1GEGA 1P5HA 1IHDA 2ZXFA 2XGSA 1G3RA 3B2QA 4M49A 4BP9A 4AI6A 2VQDA 2ZLBA 3ZWWA 5JSQA 1CB7A 4RS4A 1Q7RA 3F3SA 4Q3BA 2P9JA 2PYDA 3V8PA 4EUFA 5KOYA 3IOYA 1KH2A 3DH0A 4ZQIA 5E2AA 1TU3A 2IWRA 3NDBB 2AN5A 4FGJA 1CRPA 1ZGJA 1SQ5A 3EBOA 1J2RA 4PS0A 4QTZA 4XWOA 2O8BB 4EOGA 1JDTA 4MEAA 4PX9A 1QFYA 2Q5IA 4K7JA 5JDCC 2FZEA 4DM3A 2QRLA 3BXFA 3UK7A 4U2BA 5E38A 1Z4JA 4BV3A 4IIJF 3KQLA 4M0EA 4WINA 2PUDA 3O2JA 4JP1A 2E5LB 2FPMA 1MT3A 3ZWQA 1YZ3A 3AP1A 3QIAA 3VH2A 3KVNA 3R0ZA 4BMYA 4EYGA 1DDIA 5J5CA 3O2NA 3BGWA 1GQYA 1YBMA 1JPVA 3LKZA 5E9WA 1K4KA 3G9UA 4HNRA 4P4SB 4YO8A 3WIUA 1N5IA 2Y1LA 3HCOA 1TECE 3EMVA 1DQRA 3W8NA 3E9DA 1JECA 1X7ZB 4I4IA 4IP0A 4MVJG 4Q3AA 4OO3A 1PGOA 4A8PA 3UA4A 4Z4CA 1EZ1A 3I05A 4LEIA 2J9XB 4OQPA 2YN2A 3EC2A 3O94A 5FFFA 4COOA 2CSUA 1EP3B 1V9SA 4TUYA 4C2AA 4OA5A 4ZJZA 1PGNA 4BLUA 1OWOA 5IXYA 3N75A 3EGXA 3E61A 2ZBPA 5FOUA 2QG6A 3EQZA 4RV9A 4QA9A 4DC1A 4TRRA 1YF3A 4ZOEA 1B4DA 4YRSA 1MG5A 1QANA 5D87A 1N0VC 1PL7A 5CDSA 4CMBA 1I5OA 4RENA 5HCNA 1MF7A 2QK4A 1IUNA 1IH8A 2BE9A 2JIDA 4OM7A 3NZEA 5K3EA 2RBEA 2ZULA 5EWMA 2A86A 3OZIA 3TFQA 2IZOA 4R69A 1A98A 4AZTA 1NC3A 4C1BA 4UD2A 3QLUC 3IILA 3E81A 4M7OA 4MJ3A 1NFFA 3NKVA 1HWYA 3U40A 5EAIA 2DWPA 3ZEIA 4M55A 4YI3A 3T1TA 2HBZA 1PG0A 4BFSA 3BGIA 1OV4A 2X7HA 3X1MA 3LKBA 3EMKA 4S1PA 5F5NA 3ETGA 3GA7A 3MAGA 3P94A 5K3CA 2HCRA 5FT9A 4P7FA 2B2CA 3TQFA 3IMKA 1T2VA 4NP6A 3N0VA 4ZCTA 3FHTA 2G4VA 3M4NA 4INAA 3PG5A 4BQPA 2QUHA 1W94A 4DMKA 1OV6A 3M8KA 5I6DA 1ZRNA 2UXDB 3O8OA 2FEMA 4G0PA 3ZXYA 1DCKA 3I28A 2XB9A 3ACBA 4WNCA 5AW7A 2NSLA 4HQLA 1ZSNA 4C14A 3KHTA 3FFAA 4E2WA 3BBPA 3H2GA 1JR2A 1R37A 2Q7XA 1IMOA 1E6LA 4MUFA 4ZAFA 2RJ3A 1F0NA 4B5KA 4JCCA 4HJXA 4O4IF 5JMOA 1E2NA 1R0LA 2V5UA 3IKTA 3E1KA 4TTSA 4MWEA 4EENA 5DGCA 4ZKEA 1UM9A 4H6WA 2YXDA 4PYRA 3IDOA 4CKXA 4JQZA 3SZMA 5EIXA 2WAMA 5FL3A 4W5OA 1VTKA 1G3QA 2D4AA 3C6MA 1HL3A 4N6NA 4BNDA 2M6KA 1SD5A 2BVNA 2ZRJA 3UENA 3QM1A 1DUVG 2HF2A 2MYUA 2QTGA 3ABIA 1FMCA 2C99A 4O33A 4PTLA 2BFFA 3EFEA 1SXPA 1N6OA 1FPMA 2JJ1D 4AO6A 1KFKB 4YC7A 1W47A 3ED5A 3WBBA 2QE7A 5JZVA 1QRUA 1L8XA 5LZ4A 4IV0A 4EMSA 3PEWA 3DLIA 2CXHA 3DVSX 3RT7A 4CN8A 3WDSA 5KC9A 4ZC8A 3MG9A 3GDOA 1YDGA 4FSDA 2EERA 3G2MA 4GGPA 2O06A 4QOGA 1Q21A 3NTOA 5JYBA 5T3YA 1IPFA 2JHCA 3HYSA 2RGRA 2XH8A 3K4PA 3SQNA 4KQEA 2ZI6A 1N4DA 4UHBA 3FVWA 1KMNA 2FNAA 2ZIXA 2FCAA 3DR3A 3O26A 1NURA 3ACCA 4PQYA 4RSMA 2DMRA 3C5CA 1WTAA 1P1JA 3EYAA 1F0YA 5GJVC 4GD3Q 1AQNA 2X9LA 3LQKA 3PPXA 1PWXA 3GJRA 1K9VF 3U7GA 4RY2A 1GYQA 3ANLA 4RBNA 2XZLA 1FFGA 4ENTA 1GSOA 4XXHA 3P2OA 4F60A 1RCFA 3R44A 2Q2QA 1OXMA 1G2QA 2BR3A 4B3CA 5AUPB 1P8AA 2TMGA 3HNPA 4BNGA 3E05A 3HY3A 1T3SA 1YB6A 4RD6A 2JDIA 1AGNA 2HF8A 3DE3X 5C8VA 2YMMA 2PSDA 1EK0A 2WU4A 1L9KA 1WBJB 1YHNA 2R87A 4MR9B 4OAOA 4ZVNA 3HI4A 1UANA 3PLNA 4S3MA 1Z38A 3T7CA 2YMQA 1MH1A 1YASA 3IB3A 3NXSA 3T38A 3VR3D 1DKOA 1E1KA 3ZHUA 4LPSA 1KWGA 1LS1A 3TTWA 4YT8A 4MVJA 4JVOA 1C5KA 4IILA 1S9DA 2HI0A 1BEUB 1LFAA 2DYKA 2I0FA 3NS7A 4JODA 4TWRA 1NNSA 5FJJA 3WC4A 3GLTA 3K2EA 2AN4A 2QM7A 2ZAOA 3IP9A 2WK1A 3KSDO 3QYFA 4MKGA 4ND6A 4LDJA 3QE4A 4BIMA 4GSYA 3D0OA 1RBQA 2ANBA 4G67A 4RDCA 5DWVA 2AT1A 4MKXA 3WFJA 4GLJA 5EVJA 3I39X 5JTUA 4ESVA 4Y9TA 2QW8A 1KIAA 4QXMA 5JXWA 1F8GA 1KIMA 4H1HA 3TG8A 4OK6A 1C1DA 1KQ3A 4PNEA 3ZU6A 2VIIA 1BHJA 1PTJA 1GWNA 1ZRMA 2DWOA 3C98A 1AN9A 3GPCA 1C41A 4B17A 2FV8A 1YL5A 4F04A 4J0GA 1W44A 1VYHA 2VVTA 5JAHA 5HOEA 1N34B 2G83A 1QV7A 1T2CA 3VSBA 3S5UA 1IIBA 3MSXA 3E3AA 5B1EA 4LN1A 4OP1A 5L7TA 5MGBA 1DV2A 4F4CA 3GJ6A 1FB5A 3AB3A 4ZQCB 1EX1A 4QKQA 4D3SA 5I8PA 3N2IA 2HV8A 1UUFA 5J2UB 2EHDA 1EFPB 2B4YA 2D5LA 4M0DA 1PK9A 1Q7CA 3U7RA 4FYHA 2XCRB 2QA5A 2W93A 3P0FA 2RJNA 2Z83A 5D2CA 1E2DA 4Y6PA 3QLEA 1J9EA 3BXOA 3WNQA 5IDVA 3TRKA 1BROA 3PA8A 2VP5A 1JKIA 3NOVA 5H80A 2J3EA 1Z37A 1SUBA 1OX4B 4EYSA 1P1KA 2N42A 5AK6A 3D6UA 3INGA 4Z6KA 1U2SA 3QUCA 2VYND 2MYNA 2ZRMA 2DEUA 4MUKA 1X9IA 4J07A 1KQGA 3DEKA 3EYWA 3H5LA 4M7RA 4PLZA 4R9NA 1SCNE 1UQUA 1IWOA 3B1KA 3AR9A 3MTAA 3VR1A 4K9PA 4U7FA 4F46A 2OZLB 3AUUA 1DBWA 3RLIA 4P92A 1WBDA 4ETIA 1HTWA 1RKUA 2G5CA 3KKEA 3D3JA 3HEAA 2V96A 2JLQA 3WX0A 2MSCB 2AN1A 3CUUA 1EXNA 2ETVA 2WLTA 4E5MA 1Z0KA 4Y3UA 3LKDA 2OQVA 1P0FA 5BUSA 3HWWA 5DCLA 5J58A 2HMVA 5AICA 4OL0A 1X9HA 3UGJA 2XTMA 2A5DA 2GS9A 2Q50A 3ABRB 3M6WA 3V8BA 4C2TA 2GEKA 3FB1A 4FYVA 1O6BA 3CNLA 5CX1B 1YU6A 3H04A 1AKTA 1WUTA 5CHYA 1XEFA 3EC1A 4DN6A 3O93A 1CUIA 2ZZKA 4B2YA 5F7ZA 1N2GA 1LPMA 1TM4E 1NU6A 1V8DA 1X15A 3K30A 2C9CA 4GPAA 3GLFA 3B82A 1JBKA 1NBAA 1DQSA 5AHWA 1JMYA 3HCEA 4Z8YA 5EKTA 4WW0A 1AMOA 4EG3A 1X8KA 3DLPX 3NALA 2JGJA 1LD3A 4C2BA 4Q66C 1JB9A 3PV0A 3NVKI 4WX2B 3SX0A 3TJZA 2FZLA 2P0AA 3RBXA 4C4XA 3P2YA 3QOFA 5IMBA 1VG9B 3FM9A 1VLHA 3VISA 4FYXA 1RPZA 4TKUB 3DWGA 5GZ6A 3NORA 5DLPA 2OG2A 1CW2B 2WJWA 3G8BA 3LS2A 1TE2A 2V74B 3ETCA 3MCUA 1C7QA 4Q01A 3C8UA 1OY1A 1I6KA 4JYCA 1JILA 3MUEA 1ADCA 3ZV4A 5LQKA 3CVUA 1SJ9A 3E9MA 4WL0A 5F3RA 3CNEA 2YQ5A 4AS2A 4FLFA 2VQEB 2KB0A 1JLLA 4RGVA 4RH0A 4LZLA 2X2EA 1DU4A 4NVRA 4V03A 2VF7A 2YN0A 3SBEA 5ALLA 2IYAA 2OBFA 2PT9A 2XOKA 3OURA 3HE3A 5AJZA 4V39A 3BMQA 1HQYE 2XF8A 4C9BA 1RAFA 4RJKA 1SULA 2O7QA 1SBHA 3ZLJA 1CY0A 2O1EA 1XDBA 3PUXA 2AKAB 2XJ9A 1LRKA 4WEQA 2QG4A 2QVYX 3ND5A 2GVNA 5F52A 1PSWA 2I3BA 4BKRA 2IS1A 1QV9A 3UV3A 3GJZA 4RXMA 2B37A 1QM5A 1W1UA 4R2MA 3OEED 2OYCA 4B0PA 4DDMA 4DMHA 4BQNA 2A33A 3KB2A 4KGXA 4CKCB 4HQ0A 4CM1A 4DJTA 3P9NA 3KLBA 2AGVA 4R0MA 4E12A 1N6PA 2DJ5A 2NQ8A 1NBEA 1M1NA 3UV6A 1K75A 1T5IA 2HLDD 4DLWA 5CB8A 5KC8A 1ORDA 2W6NA 4NLLA 3DKIA 1E64A 2FWRA 2WUGA 3E3MA 4PIMA 3U7EB 1LDGA 1M1XB 2C3OA 3QIVA 1PE0A 3IBSA 4X8MA 5DCUA 1JP7A 5D7BA 5BSMA 3LWBA 3N2NA 3JQ9A 4JI5B 3VV3A 4B1FA 1QK5A 3TOSA 4ALIA 4D98A 3ZCXA 1QGED 4DNOA 2C92A 1NAHA 3B2EA 4RESA 1PN3A 1DRWA 1KOLA 2XKBA 1AB6A 3Q9SA 1F8UA 2O3UA 2VQSA 4MGZR 4NZYA 1U2RA 3VJKA 2ID7A 4NDNE 1P7PA 1L5YA 4JELA 1GPWB 1OFHA 4DPKA 2X41A 1FP1D 2EKBA 2O0MA 3WLMA 1WW2A 3P4UA 1I3KA 4QLOA 2WG1A 1SOMA 4TTJA 4W82A 3SS8A 3A4NA 4O2AA 2JFQA 1E2KA 3HGQA 4ZVRA 3ZBQA 4UTXA 4E14A 2PLFA 3AIMA 1BHSA 1W36C 4O1MA 2BFBA 3VO9A 1P3DA 4XGKA 2HNKA 2QD2A 2JAUA 1ISFA 4OHKA 3FMGA 2QUIA 2AX4A 2GJKA 4I08A 1AUOA 3EVZA 2CJWA 3CTPA 3CT6A 3WBFA 4E7PA 1W36B 1I51A 2DPHA 5CT5A 4DSTA 1A2OA 2C5LA 4INPA 5LC1A 3BDVA 1LSUA 2E4UA 1EVLA 2H85A 2QX4A 4JP2A 3K53A 2AMFA 2ALJA 3KFXA 4Q1EA 4XWTA 3ZHSA 1FIUA 1IY1A 4JL6A 3LCRA 3TW0A 3R7WA 3BRSA 4L8VA 2VDQB 4NZMA 5FI3A 3EPLA 3AESA 3L0ZA 4J0QA 1L5WA 3GFGA 4TYNA 3CSDA 5EJ2A 3QTBA 5JZ9A 1EUYA 3MTIA 4KNYA 3JYQA 2R1ZA 2P6MA 1ZD2P 2ZYGA 4UAVA 5IF9A 1T5SA 3OTGA 1T36B 1Y8QB 2QZ9A 5I7UA 1ONSA 2DTDA 3SS7X 3U3RA 1RXVA 3TVTA 1L5SA 4L28A 3OQMA 2PH5A 4TLLB 2PL9A 1P4HA 2BP7A 1PR3A 3ET5A 1T9BA 2G8NA 2GA8A 4A2WA 1Z6ZA 3GFVA 3G02A 2QNIA 4RAOA 3VO8A 1RPJA 4YUVA 5HKKD 3TTXA 1BVUA 3NHPA 3HBNA 2VJDA 4EPTA 1BX0A 2WWWA 1LJUA 3E23A 1KJWA 1VL5A 2ZZMA 1CUZA 1AO3A 4ZI7F 4JJKA 1TCCA 4Y6GB 3G59A 4DC9A 2WYVA 4QJ4A 4TRMA 3D5TA 3I2KA 1GTZA 1ZYUA 3ANSA 1Z4OA 4HAYA 3CLSD 4HZIA 1GSIA 4X44A 4N47A 5HTKA 3UJBA 4LZWA 1NLYA 3WNBA 4CG1A 4EO9A 3BSSA 1N1GA 2XXAA 5LMZA 4LAFA 4YRZA 3OX4A 4J0FA 2H1WA 1PR5A 1UZUA 2CK3D 2FVXA 2ZATA 3O4HA 1U3DA 2APJA 4UREA 2NXJA 5DWDA 3YASA 1XTPA 3CRZA 4QWWA 3NTLA 4KPFC 5IYZA 4LDRA 3CX6A 3UQZA 2G6TA 2D4HA 2WAAA 2ZWVA 3JYPA 4U2FA 3WO0A 1TAHA 1L4KA 1ORIA 1VIVA 4QJ5A 4PZYA 1Q57A 4Z3KA 5A7HA 1SXQA 4LXHA 4EPRA 1CE8B 4JI4B 3T95A 5KQMA 2YZGA 3VYSB 4HPXB 3BUSA 3ETHA 3IMGA 4PCLA 1TPYA 4B0OA 4Q4CA 2UKDA 5MHTA 3VKHA 3GJ5A 3H6GA 2Q49A 3QV1A 4X6XA 1H23A 3IQZA 4E7OA 5JCZA 2YBDA 5EIWA 3GUYA 4UMFA 4NDAA 1N8NA 1UP7A 4PAWA 4D3FA 3OAAA 1XSEA 1YRLA 1II8B 3VAYA 5L3QB 2NLOA 4CW7A 2I91A 3SBDA 2OENG 1B41A 2M9MA 3KOYA 1EBUA 3KOZA 4V3CA 4CNBA 2VSOA 2PJUA 3I2IA 3MMXA 4LWZA 4CL3A 3SYRA 3BGDA 3PR3A 2AOUA 4R9RA 3TAXA 2GJ8A 4OL9A 5DI3A 5HEKA 1XZCA 2F00A 1F4PA 2FKNA 3WLHA 2QX8A 5FV4A 4DMFA 4R84A 4AY2A 2HQ1A 3R3UA 1PUJA 4KZPA 5D1HA 1YBFA 3TEJA 4D26A 2QRNA 1P9LA 3D4BA 3KHKA 1Z62A 2M32A 1K66A 4PO9A 2CL0X 3UB2A 4JI8B 2XBLA 2JGFA 2H2FA 2JGEA 1Y1KE 1EDDA 2H4JA 4HWKA 3IXMA 2QTVA 1RHRA 2BBTA 4MB2A 4WZBB 2WSIA 1TJ3A 3OC0A 4TLBA 1O6GA 3MS2A 3N8GA 4JC0A 1T6XA 4MCHA 4UHJA 2VT6A 3NWBA 2UZAA 4YPFA 5JW6A 5AM4A 3GFFA 3K9HA 5DSXA 3PRHA 3GX1A 4ALNA 1GKYA 2PO7A 3VC2A 2VZLA 4FK8A 2LD4A 4FW8A 4A5SA 5KNDA 2XX3A 2VPPA 1UPFA 2TS1A 4HFNA 2IBTA 5B2ZA 4LX0A 1JXOA 2X22A 3CG0A 1LV7A 3VHXA 3Q8XB 4CPDA 1Z4LA 3T3DA 1ZSYA 5C52B 1CUWA 4ZV9A 3N9IA 4RFSB 1JQ5A 2LXNA 4A10A 4ABYA 1TMYA 5LNK6 3ZWKA 1EESA 1V16B 1T5TA 1ZX1A 1VSUA 1ZY2A 3GLRA 4QFMA 3SU8A 3UXEA 4BLSA 3KG2A 1FDRA 2DR3A 1Z15A 4GU5A 4DCVA 5MN6A 2HSWA 2PX8A 3EVGA 1YRYE 1X13A 1JLRA 2ZSIA 5LBUA 2YOHA 4L4ZA 3PT5A 4D4HA 1UFQA 4IIUA 2XTNA 1CS0A 2YXPX 2AWOA 4Y6QA 1YRWA 4M0KA 2CW5A 4Q9HA 1NVUQ 1MV5A 3L18A 2WABA 4CM3A 1GLGA 3INYA 1RPAA 3WWPA 1YR1A 3K4HA 4II7A 3PS9A 4MQLA 4R1UA 4EYEA 2VUUA 3WBKA 3QRWA 4ZYYA 3RAFC 4BUJA 4XDYA 2MSNA 4F5WA 1R18A 2FMUA 3W9UA 2TMKA 1Q15A 1TVMA 2J3LA 3A06A 5CAEB 5I4BA 3GQBA 3KE9A 2FEKA 5AVTA 2H3EA 3VU9B 4AICA 4DLSA 1TZBA 3FJ1A 1SCUB 3K5PA 1G16A 1O4VA 2ZSKA 1YKGA 4WBXC 4DT1B 1XZLA 4H0NA 3HUUA 2WF5A 3HDJA 4UM9B 3ESAA 2HB6A 3TMKA 1RBZA 5BVHB 1M6YA 4HDOB 5C5EA 4TZTA 5TDHA 1JHQA 3LGXA 1GTL1 4BXOA 5IJ0A 4QHSA 4IJWA 2YWDA 1HUQA 1U6IA 4M46A 1RTTA 4XR4A 4IOKA 3T7DA 2GNPA 2WG0A 2YHAA 4OD0A 2PKQP 4WK2B 4B9EA 1I2CA 2YMPA 2ZRPA 1ZIDA 3BREA 3QLVA 4RIGA 5KSZA 4YAJA 1ODTC 5A3SA 1T3TA 4UNPA 5IVPA 3V8NA 5CPBA 1ZOOA 3SX4A 2FSSA 3BMOB 3E53A 3ZGNA 3GH3A 3ZDDA 3E3LA 1KI3A 2JAHA 4NPHA 4X8HA 5EZ6B 2MT9A 2WIJA 3M1LA 1Y6JA 4EW1A 5FPPA 4K6KA 5DF1A 1OAAA 1E3WA 4C5AA 4G4SP 4IG4A 4YT4A 3P4YA 1EP9A 5I45A 1NVMB 2QTAA 1YRQA 3FPBA 4J16C 3QPBA 3PE4A 5KS2A 1FJXA 2GTIA 1RYEA 1XJ5A 1YFZA 3AJDA 4HR7A 4CTKA 2BT4A 2FH5B 2PZJA 4YDRA 2WAYA 4KPUA 4X61A 4NMWA 1UQTA 3ZDZB 2G1JA 2CNLA 3D3KA 4IDGA 3KKQA 1T4BA 1ZISA 4OBEA 3I5XA 2P90A 5FWYA 4RZ3A 2NTYC 4JC4A 5EE9A 3VVLA 2A1IA 4JGGA 3Q88A 4R1QA 4YAWA 1AKWA 1U63A 1V8OA 4K9RA 2BR4A 3OJWA 2D1QA 4QEDA 4GXTA 4MLCA 1NMYA 2O1XA 1KFCB 1M2OA 1XDDA 1O94D 4REQB 2CXNA 3FPAA 4X92A 4BU0A 1BC5A 4YONB 1WMAA 2GCNA 2WYOA 3GDFA 5C7IO 3BGVA 4AKEA 3AHDA 1QVVA 1N5OX 1R0WA 4N65A 1YA4A 3KT6A 3AUJB 5EL0A 1NKSA 3GGDA 4RS3A 3SEZA 3SBXA 3WLLA 4L6CA 1DIHA 4P7BA 5AK3A 1QU2A 5HS6A 3PD7A 4C7OA 1G64A 1Z6YA 2BF7A 2NX2A 4BGUA 4O4LB 5ALGA 4JUIA 1E6MA 3U3OA 4JI6B 5EWLA 1A8QA 1DIGA 1MAWA 1N2OA 1TQ2A 3BK1A 2DSNA 3ZWMA 5MF6A 2NP7A 3AEKB 2FQYA 2JLAA 3B9PA 3NH9A 4MW7A 1NT4A 2A9FA 3TQRA 5JYCA 5EIBC 2D59A 3TTSA 3GRYA 4P0PB 2IS4A 3AFNA 1Y8RA 4FEAA 4O5AA 4D7AA 1M2KA 3FMFA 5DB4A 3R8FA 1KY2A 2DM6A 1A5BB 4C4RA 1I6MA 1RMTA 1RU3A 3ITKA 4PGHA 4ZCRA 2DF8A 3VOAA 3LTNC 5KVQA 4AQ7A 1I7LA 5KU1A 3VU8A 5ERYA 2MIIA 1J1UA 1Z5NA 4G97A 2VNSA 3TIFA 1B2RA 1QF7A 1EE1A 3R6GA 4IDNA 4I4TF 4MIKA 4YCAA 1NQVA 4RWZA 3IUEA 3WVNA 3NKLA 4A91A 3CGGA 5H3CA 4CGYA 3HFJA 1CHDA 1J0DA 2BISA 5B58C 4PQGA 2O3RA 1YFKA 1U0LA 3EAGA 2QP4A 3M6FA 4NBTA 3RJ9A 4CM9A 2JASA 3HFGA 1W34A 3KTDA 3N5KA 4BEBA 3SWWA 1QVZA 3EF1A 1CWUA 2JVIA 2W6MA 5FBHA 3QPDA 2E5WA 4FYYA 3T1QA 2ZETA 3TD9A 1TAQA 2IW3A 3QVMA 3SXUB 1XMIA 1J1ZA 3PQ6A 5P8WA 1LBIA 3U1TA 1NBOA 1FTQA 3N2GA 5DXFA 4B3RB 3P4XA 3CNBA 1T0BA 2BJWA 4AZ0B 4K87A 1YB2A 1E9EA 2FN9A 1EE9A 4MI1A 4BMXA 1EDOA 2CZGA 4BNKA 5JC8A 1QP7A 3RS2A 2XDYA 4KKXB 4DMUB 4KMRA 3K6SA 3K9CA 5DLYA 5TPWA 3Q7TA 1KH3A 4D56A 1HEIA 1R0XA 4Z8XA 4EGQA 5DBIA 4BN0A 4Q4JB 4YPVA 2GKOA 2W4MA 4OLHA 1M74A 3VJLA 5EPUA 1IJEA 3GAFA 3OQIA 1U8TA 1K0FA 1T1SA 5JQGA 4M83A 3D6HA 4L1KA 1WB6A 5ALOA 2W2NA 5IVDA 3J81A 4QBKA 2HH9A 1UDBA 4OHXA 1FC0A 3A6DA 2AG5A 3VPHA 3VZDA 1M73E 1A9PA 3QK7A 4TUYB 3ZE6A 2WFZA 4I4NA 1WKCA 5SZIA 3ZVKA 4QM6A 4EG5A 5J1SB 3EEOA 3AP3A 4W99A 1PQ4A 1M1YE 5EGSA 2V7XA 1Y3CE 3G8YA 3SZOA 1EFKA 2PMKA 4JLVA 2I80A 3IPXA 1KKMA 1TIBA 3P96A 1XU7A 3EGXB 3GVXA 2C20A 1L1QA 3C24A 2ZJ4A 4ZAXA 1SU4A 1U3GA 2ZBRA 3OCCA 1GA1A 4I1SA 1E3LA 4O3FA 2QYTA 3PEUA 4P2BA 4XYGA 5AXCA 4DY6A 3V2IA 3K71B 2Z3VA 5CVUA 1AQYA 1M7GA 3DEFA 4V0LA 5EWMB 3NT5A 4IHJF 3MBOA 4TT3D 1YMUA 2BJVA 3T94A 2AJBA 1G1MA 2VHQA 2ZB3A 1EWTA 3EIXA 3L7KA 1S3GA 3F8WA 5HIMA 3TW6A 3BSWA 4US0R 4GM4A 4YFVA 2D13A 5EZYF 3KTFA 4JJIA 3P9KA 3T5BA 4C29A 3LT0A 4P54A 2ZAMA 3HB5X 4CE6A 4D46A 5B12A 1S2DA 2B4KA 4BVKA 2H29A 4R8KA 2VP2A 2H1VA 2PLNA 1HG1A 1V8FA 1TVEA 4G5YA 4NEQA 4B6SA 3P9ZA 4GT1A 1XCLA 4NXMB 1RWKA 3BMCA 4G3XA 5EHGA 2DQSA 1X1QA 4D57A 3KJFA 5DE3A 4UM8B 2E55A 4C0JA 4U6NA 4MQEA 3ZLBA 4OKNA 3I1IA 4GFDA 3E2IA 4M1ZA 3VZPA 1E7MA 2VDJA 3KZ1E 4KQFA 5FBRB 3WB1A 4FKMA 5FHQA 5BUQA 3PXCX 4RX1A 2WIAA 1IXRC 3CX7A 4ZZ1A 2V5AA 3N28A 2WSYB 4NU8X 1SIOA 1PYOA 1SKMA 3WAKA 4IJ5A 3P9YA 2J9FB 1UM9B 4HTFB 4U4AA 4YB8A 3LIPA 1WB4A 3FKJA 2A57A 1MTZA 5GY7A 2JI8A 3MMNA 2L82A 3HH8A 4O2BF 1ZHFA 1T6BY 1NPTO 4E15A 1HDGO 5IMSA 1XK6A 5C4GB 3A1UA 5JEEA 3G0DA 1PJ8A 4XWKA 1VKZA 2BCEA 2OXIA 2W6JA 3DTVD 4MGHA 1QNLA 4GG1A 2V6JA 2BFFB 1GILA 1U0GA 4FYPA 5JR3A 2HR1A 1NUAA 3C7KA 1W2WB 1XZDA 2E2WA 1GFIA 3IVGA 4JLJA 1XWFA 2CF6A 1NN0A 1W5BA 4QT0A 4QARA 4EW3A 4GM1A 3H19A 4YNBA 1KVUA 1NR5A 2AFHA 1FYFA 3W8FA 1DEAA 1RWXA 3Q0TA 1NJ1A 2CXPA 3I6YA 2HPHA 2OTCA 1W5EA 3ODGA 2WF9A 4L5YA 4OH1A 4PZDA 5KTMA 1EHCA 1FDIA 1RMQA 1DFHA 1UBLS 2ZIXB 1TF5A 1QGAA 1YNOA 3DFKA 1SVMA 3PQ4A 3K5WA 3QBEA 4JHLA 4MH0R 5DU2A 4ZVPA 3M9XA 5BWOA 2JHAA 1TMGE 1CEEA 2XVXA 1Q7EA 4CLXA 2PKYX 4M9XA 3WMXA 1RI1A 1M1ZA 2QGNA 1XRSB 2UYGA 4JJFA 5EPOA 4Y6SA 721PA 3QF4A 4YDHB 3H4MA 2ZJ7A 2GPSA 1USUA 4V0ME 3JVVA 1ZOSA 1RJ9A 3NP7A 3VC7A 2FWIA 4X1YB 5H16A 4B3BA 1BXKA 3T4EA 3BRWA 5H70A 4AY3A 5JZBA 5CFLA 1I1NA 5L53A 1FFAA 3TXYA 4DMGA 4PSKA 3OOEA 4ZANA 2IP4A 1KEUA 1GA6A 3HHEA 1O96A 4UBMA 1YVRA 5KYYB 1CQPA 1DOZA 2FMKA 2LNDA 1XKTA 5J5AA 4UHHA 5ITWA 2PX4A 3N0RA 2HKIA 3KT8A 3L0IB 1UPBA 3IMCA 3PPIA 4MA5A 3RSGA 3FYDA 5GAJA 4AC9A 1J7KA 2XUGA 4F0JA 4II2A 1EJ6A 1UIRA 3IQEA 3QKWA 3SPXA 1E0KA 3TZEA 1GAJA 1UWKA 1CR6A 4FILA 5BV1A 2C9MA 2ICAA 2O8CA 3K9WA 3Q7QA 1NQOA 4UVHA 2WQ7A 1J0BA 3A2LA 1D9ZA 1H9BA 5EIAA 1SRRA 1KEKA 3WSTA 2FWJA 1S2NA 1PTJC 3S2UA 4G1BA 3A70A 4XFKA 1J49A 4KBGA 1P4AA 1VZ3A 1C1DB 3GEPA 3OEHA 2G1AA 3LPDA 4U7HA 2AOXA 5AVUA 4BNLA 2KS6A 1H1TA 2C2WA 4UUQA 1JSRA 5CVVA 3RFUA 1JSLA 3FR7A 1VL8A 2PRYA 5SICE 4UU8A 3PNSA 3W7BA 1O8BA 4AROA 5AM3A 2HQSA 1SD1A 2P9HA 2F43A 1KS9A 4JP5A 1UFRA 3WGVA 1Z0UA 5B7GA 1Y81A 5JS7A 4AO8A 1HE2A 1MOZA 1SR8A 2CLOB 1FQKA 2P1ZA 3TFOA 4XDGA 5FOTA 3T5PA 2PWBA 1N33B 2WI8A 1FUYB 2GDZA 2DBYA 2WKQA 1A7KA 1U9YA 4GLBA 4I7EA 5PNTA 1PEYA 5JFOA 5MN4A 5JLAA 1QKKA 4IXNA 5CB0A 5FWAA 4LHWA 4Q3CA 4OQMA 1U31A 1B3BA 1RCUA 2VO1A 2W2QA 4YLEA 4OU5A 3EG5A 1BH6A 4GPTA 1E2PA 2EFEB 3R0QA 2CMHA 4FB5A 2F1HA 1HYBA 2XGMA 2ZJ0A 1KORA 1Z83A 1C4OA 2ZQ5A 2OHJA 1UBGA 3G5LA 2FMFA 3Q0IA 5FFNA 1V8PA 1XGKA 1JEAA 1XTRA 4AAYA 2Y1OA 1PEKE 1JFTA 2IHTA 1LEHA 3EIOA 3OTIA 3K9FC 4ZJYA 3OY7A 2IY8A 1EFUA 3LQRA 4HD8A 4YFYA 5LQAA 2NQ2C 1ZA1A 2F62A 1IVNA 3B85A 2Q46A 4X24A 2YWCA 4X6YA 5DHAA 4D41A 1W5SA 2ZYWX 2QW1A 4QG3A 5KVSA 5IT9A 4P93A 3LGAA 2UUCB 1BQ4A 4PONA 1JI0A 1ST2A 1YCGA 4MW5A 2HO5A 4YIKA 3RH0A 3ZC3A 3COZA 1J23A 1G3IA 1SCQA 2PM8A 2QVBA 4J7AA 5IC6A 4DSNA 1XAHA 1JL3A 3CEPB 3H9JA 1P5RA 3NCHA 3HLYA 3HU3A 1M10A 2V6IA 3U26A 5JNSA 3KXDA 3R5JA 4DWJA 2C78A 2FOLA 1XFDA 3JQGA 4DLLA 1W85A 1XD8A 3BFXA 3CHYA 5CDTA 4GGOA 2Q9CA 2X0NA 1QP8A 1UZLA 4ZIRA 5DP1A 4L6IA 4G24A 4OXIA 4KFSA 1A97A 3DMTA 2X8WA 5LKAA 2DXIA 3V1KA 5E4YA 3WZ2A 2PXHA 1Z8HA 5L4SA 1ZH0A 1E9BA 3C6QA 5G4KA 3EA4A 1O6CA 5CLFA 4PFJA 16PKA 4KQ9A 1QQ5A 1H5NA 4FMBB 4WADA 5GGXA 3GLFB 1S3FA 1I1HA 2V7TA 4QX6A 3WRYA 2M6SA 1GG5A 2ZBDA 5CVTA 4R40A 1OZ0A 4LKRA 2VHWA 3T7AA 4BU1A 4LHEA 1WY5A 4FI3C 1RWWA 4KPYA 1TT5A 1CR0A 4LOIA 2C5BA 5HFJA 1T5HX 1YJ8A 5TB5A 4XM1A 3RYFA 1MW9X 4KO4S 4ZYWA 4P7GA 5GONA 3QI7A 2GHQA 1U4SA 3VR5A 1JZSA 4EKYA 5LVAA 2IDKA 1KBOA 1O77A 3AIOA 3ELDA 3K72B 4FCCA 2BMDA 4OJMX 3TLMA 4HRAA 4PLWA 5AJYA 3VOBA 1RZRD 3CN7A 2C1ZA 4PF1A 1JG1A 3E9EA 5DDIP 1FTNA 2FFHA 1I4WA 3ADKA 5BV2P 5KEIA 5IXSA 4DV5B 1DQZA 1JLLB 4ISCA 2GK3A 3DMRA 4Y2XA 4FSHA 3AMVA 5EJEA 1YJCA 1GDTA 1O87A 2QP3A 4EW6A 1UDXA 1HLGA 2H63A 2YASA 3GRPA 5KOIA 3T5AA 2MSDB 3E5MA 3BMQB 3I3OA 4J9VA 1B74A 1UOOA 3IR7A 3BIJA 1E4YA 1UK7A 1JLMA 1FSGA 4K6OA 4BC1A 3GN2A 4RH3A 4MGKR 1OBFO 4KV7A 5B1YA 3LHIA 3PFKA 1Z5UA 5FNVA 4D4LA 2AZXA 2XT6A 4ARVA 1NRIA 4MWZA 4XVQA 4BGEA 4D9KA 5LA6A 1X1SA 1WRBA 4NRDA 5DMXA 2FSIA 2BMWA 3EA0A 4BPRA 2I6XA 3A28A 4L51A 3UZUA 2ST1A 3GCGA 2KM1A 3N2ZB 4PYLA 5JCPA 1YVEI 3VTKA 2QMUA 2PZ8A 4XQCA 2OFWA 2C03A 1MAUA 2VT3A 5EMMA 1CY6A 2NYUA 4TYYA 1M1NB 1OLXA 2BFWA 3KFVA 3RV4A 4L72A 1VJGA 4YPOA 3KEFA 2VPXA 3GELA 5CVEA 5D3QA 1KJ9A 4GWLA 4GX5A 4ENSA 4HGOA 2QT9A 1CF9A 1D8TA 4P0TA 1I36A 4X3OA 2RHRA 5FI5A 2I3ZA 4X60A 4PHCA 1VPTA 1KY3A 1R64A 3PL1A 1YK1A 4UE3S 5CEJA 3LUDA 5KHOC 3CXRA 4MW2A 4WZAE 5F2EA 1NC1A 2Q28A 4F93B 3ZHBA 1M34E 3E7XA 1ZUHA 2D62A 3H8SA 2EFCB 4MVJI 1N7GA 4G9GA 4QO8A 1C0LA 3VSCA 2FSFA 3H75A 4B9AA 1VI6A 3DOCA 1NF3A 5TS2A 1RVV1 4ZCIA 1M6HA 3AY6A 3JARA 3KS9A 4Q4LA 2DX7A 3DVAA 5L4LA 1UPAA 3IEKA 5IF3A 5JAUA 1PSDA 1E5VA 2HQOA 3PWTA 4FBLA 4O2AB 3FHJA 3LDHA 1N78A 3D5EA 4L5AA 1XTVA 2X3YA 4WOCA 2BFBB 2ZW9A 1FRFS 1UQRA 2JEYA 4O4HF 4YCJA 5TV2A 3V4FA 2P35A 3ZQ4A 4DG9A 5KYTA 3OM0A 2NIPA 3NHMA 3N0TA 1FL9A 4HQNA 2CJWB 3D6TB 1BVHA 3FF4A 2ZPAA 4J1QA 2HFKA 1CB0A 4P33A 4YRRA 5EC8A 1UBKS 4RLSA 3ZTYA 5KNCA 1YFJA 4JENA 3OOWA 2VS1A 5HKLA 4B3FX 1U5CA 2OXFA 1A5TA 3DEIA 2ZR7A 1A7UA 4MUNA 4D9IA 1N7IA 5DHQA 1RHMA 2VNJA 3O38A 3ZHTA 1Z73A 4G5QA 2ZIAA 3IMFA 4MGYR 3T1OA 2XMBA 1VE5A 3ENKA 1BGWA 2WINI 5BSVA 3R7WB 3FYCA 3L04A 4RLHA 4LF7B 3AESB 1SUDA 4IQ8A 4P3PA 5DGHA 2YNMD 2BBWA 2FQ1A 2QUAA 2VAXA 1NSFA 2ZRBA 5MDHA 2ZPUA 3QMVA 4HH3C 2DPLA 3G79A 3O4JA 4UD6A 3UMRA 3GMSA 2NO4A 4LWOA 2A9RA 1IN5A 4L73A 4N9WA 1T26A 5HZKA 3AT1A 4LI3X 4PZEA 1OILA 2YL2A 3WWYA 1ZCBA 2DBZA 1MKYA 4QBIA 5DHUA 1PR9A 4I5IA 2W70A 2IPAB 3MTEA 4UM5A 4YCSA 2YV3A 3CLRD 2O7NA 1WAMA 2OV2A 2BP7B 3FNIA 2NV0A 3GVHA 4ZOLF 7GPBA 2QN1A 4FYMA 4R2WA 1TJ5A 1MOQA 3OCJA 3JY6A 2ZJOA 3HCWA 3O91A 1TEXA 3QFHA 1DZIA 3FBGA 3U3ZA 4C6TA 4I5FA 4E5NA 5KWVA 4XA8A 1E62A 2Z30A 4IPTA 5SZHB 2O2YA 4I9HA 3WS7A 1GD1O 3H5OA 3I6BA 4EX6A 2Z57A 2PQ6A 4PLHA 4V38A 2PIDA 3I1FA 5BR1A 1U94A 5CNMA 3BG5A 4AMUA 1XYVA 4HB4A 3JQQA 2Q8PA 2XXAB 2VNAA 5I9MA 4FW9A 1F4VA 3GRCA 3OCXA 3CIFA 3R5SA 3TL3A 1EFRD 5DFAA 2ZI7A 2EQBA 4FNAA 1LSJA 3T52A 4J2HA 3RS7A 1P8JA 3KQWA 4W6QA 4D6XA 5IYZB 5LJIA 2HWWA 4ML3A 2QMYA 4QBGB 2HM7A 2FWBA 3IJEB 2Q2NA 5C31A 2NUTA 3UC9A 1DKLA 1Q14A 4QDKA 5LUAA 4CCYA 3S2GA 1PT8A 1FRZA 1GRCA 1PSZA 3SHWA 4BQOA 5I7SA 1Q0TA 5TPZA 1R0RE 2XV1A 5HDBB 1HPLA 3KDAA 1HF3A 4BCDA 3DM9B 1P4SA 4UHFA 1DAFA 3GJ8A 1NA5A 4YV0A 3NEJA 2WD7A 1ZO8A 2ZOSA 1Y6FA 1PHPA 2C9YA 3BT7A 1RWBA 1F20A 1BIFA 1M76A 1H42A 2BLNA 2RI1A 4FB4A 3GD5A 2V6GA 1UJBA 5HS4A 4L22A 1XKLA 3Q3EA 4UOZA 2VHJA 1Z3IX 5D5PA 2GJ4A 1PV4A 1CV2A 2K4MA 3NT2A 4XWYA 4BV9A 3IVRA 3IP5A 5BUCA 2AOUB 1G8KA 1G6OA 5DI3B 4AYXA 3BPSA 4JMLA 2V7WA 1U2DA 1SBTA 3IP3A 1OXBB 3JWHA 4FGSA 4GZ5A 4HLDA 3I2GA 2CDRA 4F21A 1NVAA 4Y98A 3DQPA 2XUIA 4L5IA 1NVVR 4TS9A 1RRPA 5TQVA 4AZWA 5BN3B 5B1SA 2C2MA 2VJKA 1L4GA 5BQXA 2IK8A 4HXFB 3SDSA 1VE6A 1K6EA 4UTNA 3C7TA 3QUQA 1G59A 1IUPA 5C37A 2A9VA 2QTVB 4ZVOA 3T7EA 1D4FA 2GM4A 1J39A 5TEWA 1XNHA 2JF0A 2PUHA 1A0OA 3NHKA 4NMMA 3HNOA 3DKVA 1U9IA 3HNRA 2X14A 1RYHA 1ZD9A 3EGOA 3MJHA 4Z5XA 2W48A 1YU9A 1SIWA 4Z9XA 1MHPA 4FP9A 4W5QA 4J43A 1WDLA 2G08A 2J5RA 1XRQA 2WTNA 1JHDA 4LJ7A 1GDDA 2RHJA 3ZY2A 1ISMA 2B1RA 1VIAA 4DLRA 3VHXB 4QHYA 1DC4A 1ORTA 3HBAA 4G0XA 1E92A 1VL1A 1Y5MA 2DT5A 3FMPB 4HAXA 4OY3A 3ZGVA 1AXEA 2AQ8A 2VDNB 4XB1A 3Q40A 5B2FA 2J3JA 3NRCA 5L40A 1T4CA 4IIDA 3R7LA 3L4KA 2FPGA 1RLJA 1ILWA 4R2HA 5HZMA 1NYLA 1JMVA 1Q6ZA 2PZLA 1GFSA 4NI5A 1NW6A 4RKFA 4HVLA 1K5HA 1MQ9A 2QLBA 3HG7A 4FEGA 2FPPA 5DGIA 1G8HA 1Z25A 4GPBA 4NYJR 4GLOA 2FEOA 2PTHA 2ZK7A 5A0TA 3U4HA 1CS0B 2E4ZA 2Q6IA 3K70C 2IEZA 5HF8A 1H2EA 4WKOA 1UJ4A 4ZJUA 3Q3JB 1QRSA 3OCUA 2H1HA 4Z49A 5JXIA 5DYNA 8ABPA 4YMUA 5C4MA 1RC1A 3K70B 2ZSUA 4EY7A 3Q85A 4FWTA 1IJBA 5FO1A 4XFDA 2C0QA 2Q3JA 3LG2A 4CIDA 2ZE5A 2AK2A 1AY0A 2JH9A 2QD3A 3A1NA 1MAVA 3ICPA 2GZHA 3ZX4A 2PS0A 3NOXA 3OF5A 5EXEA 3GJTA 4BJHB 1P2DA 2QRUA 4HWPA 4U8HA 3H2HA 1I0LA 4QDXA 3G7NA 2ODPA 5CFNA 1I3MA 1X9GA 3IH5A 2IEYA 3MCTA 2WA1A 1V43A 1PR6A 2VOJA 4RLQA 2VOEA 2YJ3A 3LWZA 3DMPA 4UHCA 5AVRA 2A35A 1PS0A 2OHXA 1RXSA 2ZP1A 3VYWA 1LTQA 4UU1A 1KI1A 2O07A 1WMBA 2QLJA 3A0RB 4FINA 3BXXA 4W7IA 9ATCA 2FY8A 2IV7A 4BXOB 3GT4A 3ICVA 2FMIA 3G2QA 1LPBB 5FPTA 1RSZA 2QV7A 4QO7A 3L7DA 2Q29A 2A4MA 2EX4A 2KQUA 3QLVC 4RCYA 5CH3A 3ZOZA 1ZJ6A 1ZINA 2PJDA 1O0SA 3I9JA 4RM3A 4LGMA 3ZW7A 3ENNA 1ZD4A 1VFPA 5CYPA 2O52A 4G56A 5EWJA 3HZZA 4QG7A 5KDOA 2O8EA 3OCWA 5K0GA 2BKAA 2DFLA 4R4JA 1W581 4M7PA 5BSKA 4LIPD 1DQNA 3BJRA 3OE7D 4RO0A 1WZCA 5CYOA 5JAOA 3LVFO 5EUMA 1E3IA 4HZUB 1NUHA 3AGQA 4Q4AA 1TC2A 2EBWA 1G1AA 4ZVUA 4EARA 2FGJA 1I4DD 2I3AA 4YXWA 4EUEA 4DUGD 3V8QA 2BDEA 3FUXA 4C3VA 1E3WB 4L3VA 4JR0A 5EJ7A 5TMPA 3W3AA 4PAOA 4GAEA 3DKKA 5JWOA 4U5XA 3T9EA 3UHFA 2HYDA 4YQZA 3C5EA 3EJWA 4EB6A 1V7CA 4LY0A 2G0TA 4H9GA 5BSTA 4FHFA 5SV2A 5ALJA 1ZR4A 1KVRA 1XL1A 1ZK0A 3NBUA 2KBEA 5FOQA 2EZ4A 2H9IA 4I6JA 2JH3A 2OSVA 3K73O 2IPMA 4FFDA 4OB6A 4OMCA 4OA8A 2JZNA 1OBHA 2CLEB 1P44A 2NPOA 2BTQA 3M33A