4GECA

Crystal structure of e.coli menh r124a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
VPRGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAEAQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gecA00
5DYYA 1EVQA 3JW8A 3E0XA 4FFWA 4QZVA 1CEXA 4AO7A 4JH0A 1XZDA 3CCCA 2FJ0A 4UHCA 1IMJA 3PDCA 1DU4A 2DHDA 3VJKA 5IVKA 2XUFA 4M0FA 4UFOA 5ALNA 5A62A 3K9BA 3BWXA 2XMQA 2JGLA 2XT0A 3T52A 4PSDA 1HQDA 2XMRA 2QT9A 5JADA 1XROA 4FLMA 1QFSA 1CUGA 3D3NA 5BWCA 1OXMA 3VKFA 4HS9A 1CQZA 4UBIA 4X7BA 2ZYIA 2DHEA 5LP1A 4LXGA 4QA9A 4H7IA 4CCWA 1Q0RA 2RHTA 3S8YA 1CUAA 1XZFA 3Q8WA 5JZBA 5IVDA 1U2EA 2XLCA 2HADA 2WHQA 5AKGA 1VXRA 1ZJ5A 3I2GA 4Z49A 5HQ3B 3NUZA 1MT3A 3EF3A 5AIAA 4TVKA 3C45A 5CH8A 4X3CA 1YCDA 3OG9A 1JI3A 5LKRA 2PPLA 5CT6A 4KJXA 3QZUA 1EA5A 2HFKA 1C7IA 2WUGA 1QIGA 3FCYA 1YAHA 2I3ZA 5T4BA 5AI5A 2XMCA 2H9YA 1XZHA 4PF1A 2VTVA 1DT5A 5JD4A 5HF8A 2HA7A 2VJAA 1QGED 2Y1KA 3RLIA 1R9MA 2XB6A 3QMWA 2VJCA 3WJ2A 2ORYA 4Y2PA 4H7JA 1FFEA 5HK8A 2B61A 3ESBA 4Y9SA 1W75A 4FTWA 3D59A 3C8DA 6YASA 3ESAA 4EA6A 5CBKA 1MNAA 4X90A 1BCRA 5C7YA 4MEBA 1QIMA 2YASA 5D7BA 1E8MA 1ODCA 2B20A 1O6GA 4ZI5A 5C8VA 5AM4A 3V48A 5DYTA 4OB6A 4UBOA 4WCVA 4C6HA 4UHDA 4J0DA 5J3JA 1ZI6A 1GQSA 1BU8A 2BGNA 5LKAA 4NS4A 5EGNA 1E66A 4X00A 4FNMA 3VJMA 1R50A 2WHPA 3C5VA 2VQ6A 3G0DA 1UWCA 4PSUA 4L72A 4DNQA 2K2QB 4F5ZA 1YB7A 4EY4A 5JD6A 2PKYX 3F8SA 1EI9A 4UFNA 4MQLA 4LIPD 4UUQA 1XRMA 2HA3A 1R3DA 4QLAA 1GQRA 4UBMA 3HZOA 2GYUA 3LIPA 3L1JA 2XI4A 1XRQA 5CXXA 3PE6A 3SX4A 3RKSA 2C58A 4J3JA 2XMSA 3F67A 3UUFA 1QIDA 1A8SA 5KWIA 2HU5A 2W6CX 4UHFA 1BCSA 1QFMA 2PSHA 2PVSA 3IDAA 1GXSA 2OCIA 2PUJA 4UHBA 2DSNA 2XMZA 3OPMA 4M0MA 5AK3A 5JZ9A 3W9BA 1EK2A 3QITA 4BRSA 1BN7A 3R3UA 4RNCA 5DNVA 1XZIA 2JGKA 4TGLA 3ZI7A 1UT6A 1ZI9A 2WIGA 1TCCA 2C7BA 2PSDA 5AJHA 2WIFA 3WWEA 1SFRA 5EHNA 3DD5A 5AOCA 3MVEA 4FKBA 4NMWA 2QKYA 5DLPA 4GECA 4BAGA 3WKDA 2RAUA 2HM7A 2OQVA 1JJBA 3STWA 2EEPA 5FPQA 5DWDA 1THTA 3ICWA 1MTZA 5JYCA 2WLSA 5E4TA 1FFAA 3VXKA 4RPCA 4J0JA 3KOOA 3G0CA 1JU3A 3D7RA 2GBGA 4I3FA 4CG3A 1F0PA 5FPPA 4BE9A 5CH3A 4H7EA 4H7DA 5EHQA 5K3FB 3WI7A 3FSGA 5ALJA 5ALWA 1TAHA 1DQYA 1MAHA 4DMHA 2JBWA 5CT4A 4LYDA 3LP5A 5CT9A 4G9EA 3B5EA 3RARA 3NWOA 3O9VA 2XUOA 4UBJA 5CMLA 3C6BA 4OU5A 3IUNA 1YS1X 2VT6A 4HAIA 1LBTA 4AQDA 5D6OA 5LZ9A 4UPDA 3DLTA 4C4ZA 1WHTA 4NZZA 4BAUA 2QUAA 2AJBA 5HF5A 3M83A 1T2NA 5KREA 4RE6A 1YAJA 5ALVA 1UKAA 3LLCA 2XUAA 1XZGA 3WK7A 3M3DA 4I4CA 4KE7A 1CV2A 2WU3A 3P2MA 2WQZA 3R3ZA 3WL8A 4N5HX 1QO9A 2PX6A 4MWTA 2G63A 4HZGA 5JD5A 3E4DA 1R4ZA 1XZCA 5A6VA 3WKBA 2GYVA 2JGEA 4ZWNA 3R0VA 2JF0A 1XQWA 3BE8A 5LZ4A 5AO9A 5AM1A 2D5LA 2I78A 3I2FA 2ZVDA 4J0GA 1N1MA 2ACEA 4U2FA 2XUKA 3D2CA 3EBLA 3HJUA 3N2ZB 2WG2A 3AJAA 3WWOA 2G4LA 1LZLA 2JEYA 3KD2A 1IUPA 4HTAA 4MYDA 1B6GA 2HRQA 3EQ7A 3FLEA 4ZREA 3TEJA 4QE3A 2QJRA 3FYUA 1U4NA 3HSSA 2EDAA 2VA9A 2HFJA 5JANA 2VF2A 1UK7A 5AKKA 4DGQA 5HKAA 3Q0TA 3KDAA 3G9UA 4ETWA 5C8XA 1L7AA 4PNZA 1QE3A 4QWWA 1CUFA 2AJLI 4DYHA 5KWJA 1KEZA 2OAEA 1P0MA 3HRHA 5ALKA 3H2IA 1FFBA 3WK4A 1YASA 1DINA 1AGYA 3FAKA 1GZ7A 3I6MA 3GZJA 2GBIA 3H04A 3C8HA 1MX9A 1YS2X 4JYPA 1S8OA 4MQMA 1W52X 4G4JA 2C5FA 1RWQA 4BP9A 3O9MA 5ALOA 1WPRA 5DYWA 3MUNA 2Z5GA 4WJLA 1N5RA 2PU7A 1XZEA 2WSLA 5FKJA 3DCNA 2GZSA 4PO3X 5AKXA 2QXTA 5CH5A 2HA6A 4WY8A 1LPOA 1VZ3A 3AIKA 4Q34A 1ZICA 3OURA 2CZQA 1OILA 5FV4A 2HL6A 1MPXA 4DNFA 4BCCA 3A70A 4UBKA 1UOPA 1VA5A 1H22A 1XKLA 4GXNA 5CRIA 2PSFA 4Q3KA 2Y2VA 3WK9A 4A5SA 2B9VA 2XQKA 1A88A 3H18A 1RP1A 1P0PA 1C7JA 4KEAA 3HLKA 3WMRA 3BIWA 3HYSA 4ZV7A 4H7HA 1TRHA 3R3VA 3DL4A 5ESRA 2CUTA 1QIEA 3ESCA 4FDMA 1YSCA 4BZZA 4LXIA 2ZJFA 5LLSA 3I1YA 1VKHA 3K6KA 4I19A 3V9AA 2YH2A 1PV1A 2Q0XA 5ALQA 3RM3A 3HACA 2ROQA 5HZGA 4Q82A 1QIHA 4X95A 4U2BA 3WKCA 4EY6A 1WB6A 4F60A 2ZSIA 4PV7A 1JFRA 2ZYSA 3FVRA 4X6YA 3PF9A 2HHAA 1K5PA 1W4LA 3BJMA 4GHWA 4AO8A 3DKRA 2WUFA 7YASA 2WJ4A 3B3QA 1QTRA 1VJ5A 3D5EA 1USWA 3WWPA 2WJ6A 4GBGA 4D9JA 5AOBA 1N8SA 2WILA 1WCYA 4G4IA 4L9AA 1F8UA 5ALIA 1CFJA 2GYWA 3D2BA 4X92A 3ILSA 4FNGA 5AI8A 4HXFB 4A16A 2Z3ZA 3CN9A 1A8QA 1G4HA 5K3CA 2QJWA 5CURA 2VAVA 2DR0A 5AI9A 4UBLA 1ZGCA 5CW2A 1LPSA 2WHPB 3STXA 2WFMA 1XLWA 1JJFA 3H1AA 4E15A 3PUIA 2WFLB 4KR0A 4X94A 3ZLVA 2GBCA 2HA4A 1AX9A 4QLOA 1QIJA 1K63A 1AC5A 3C70A 3DOHA 4ZRDA 3YASA 4CG2A 2CJPA 1IUOA 1FFDA 3MGAA 3GFFA 1O6FA 2QTBA 1UKBA 1LPAB 4KAFA 3WQHA 4MJ3A 3PI6A 4B6GA 4RGYA 3HEAA 1ETHA 1EINA 3DS8A 4MWSA 5BWBA 1TKRA 2QM0A 1UXOA 4FLEA 4KYVA 5ALEA 3O4HA 1R9NA 3KWJA 5FRDA 4J03A 3GROA 3JYHA 4U2DA 3F96A 2PBLA 1YR2A 5SYMA 4EUSA 1YA8A 3LIIA 4UFPA 3GELA 3IULA 3BJRA 1HDEA 5ALHA 2HU8A 3F9CA 4W1SA 4MEAA 2VATA 3WL5A 4BAZA 2DHCA 3IUMA 3HABA 1QLWA 4DMCA 4EY8A 3I6ZA 3FYUC 1ZD4A 5H3HA 5K3AA 1GPLA 4N8SA 1E3QA 4OU4A 4WFJA 1DT3A 2GBFA 3ZWQA 2PSEA 4HRXA 1CUYA 4S0XA 1UOOA 4L3WA 1FJ2A 4EZIA 5AM2A 4DM7A 4HXGA 4N5IX 2OCKA 2GZRA 2FUKA 5SYNA 2Y6VA 4KE9A 3U0VA 4BCBA 1MU0A 2HA0A 3WA6A 2OGSA 2JGMA 4LYEA 3R3WA 2JGIA 1OCEA 4BC0A 4LKOA 3WIOA 5JAUA 1EK1A 3DNMA 5FXMA 4B0PA 2ZYRA 1KU6A 5I9IA 5HFAA 3A2MA 4BVLA 5AKHA 2VJDA 2WFLA 4MXDA 1TCAA 4EY7A 1K6EA 3IUJA 4BYMA 5AKJA 2B4KA 2ECFA 1A8UA 2CB9A 4K6KA 3I6YA 1IZ8A 5F4ZA 1ZGBA 3I2KA 3WKAA 1EB9A 1XQXA 4PW0A 4YPVA 4V2IA 2C0PA 5DTIA 1SOMA 3ANTA 3O4IA 3WWCA 1E8NA 2Z3WA 1FSSA 3QH4A 3C6XA 4G8BA 1CQWA 3GBSA 2WKWA 1DWQA 3R3YA 4LXHA 1ACJA 4W63A 5EI5A 5E4YA 3PICA 3G0GA 2O7VA 3FYUB 3E1GA 1NU8A 1D07A 1HPLA 2ZJ6A 4C4XA 1J07A 4U2GA 1RYYA 4B0OA 3VISA 5A7FA 1ZJ4A 2R8BA 4CG1A 1EDDA 4CCYB 3HXKA 3EQ9A 4QDOA 4Y7DA 5ALGA 1QO7A 1Q0ZA 3X3HA 2XQJA 4G9GA 4GW3A 4QDUA 2WJ3A 1XFDA 1WPXA 1LNSA 3DEAA 3G8YA 1U8EA 3BDIA 3S2ZA 2ZJ7A 2D0DA 4TPKA 3WLAA 4H0CA 4KACA 2XUGA 5EIAA 1VZ2A 3OTQA 2EDCA 4Y2SA 2VEOA 4AXBA 3WYNA 3QPAA 1JKMA 3G9ZA 4O08A 1DWPA 3JWEA 2QR5A 4W1PA 5ALFA 1LPBB 3DL7A 1XZKA 4B84A 4WFKA 4JNCA 4KRYA 5D3KA 4B83A 2O2GA 1P0QA 5DNUA 4B82A 5AM5A 3EQ8A 1UK8A 4B81A 1THGA 3C6ZA 1Y7IA 5AKIA 5T4HA 2O2HA 5ISMA 1TQHA 4GWLA 3ZLTA 3KXPA 2WHRA 4OPMA 3DYIA 2AJ8A 1ZD2P 2C4HA 1XQVA 4K6GA 1AZWA 2DQYA 4YASA 4ITVA 3H2HA 2LIPA 2PUHA 1ODTC 4H77A 1M33A 4PSCA 5JARA 2ES4A 1G5FA 4AZ0A 2ACKA 1YB6A 4C87A 4H7KA 1SCKA 5EHXA 2DQZA 2AJDA 1SCIA 1BN6A 4G8DA 2CKMA 4IHAA 3DQZA 2WIDA 3STTA 1GT6A 2WUDA 4BCDA 2JIDA 4N8EA 3WIBA 5ALLA 3L1HA 1N5MA 4P92A 2J4FA 3O4JA 5ALDA 3R40A 3W04A 3OC0A 3ZPXA 4J7AA 1XZLA 1E5TA 1MNQA 4ZGBA 1YA4A 3ANSA 2YYSA 4CCYA 2OAGA 4FFVA 4IH1A 4DNPA 2DCMA 2WU4A 3SWWA 1GPKA 4X93A 2WIKA 2OPHA 4FBLA 3ICVA 4NVRA 1CUXA 4G5XA 1BRTA 3R3XA 5FLKA 2QXUA 5DJ5A 4M0EA 4Q3LA 2WTNA 3HC7A 4Q05A 1VOTA 2JEZA 4U2EA 5AM3A 4CFSA 3H17A 3I28A 2I3DA 1NU6A 2ZSHA 5T4EA 3AINA 4XJVA 2BJHA 3BL8A 4B9AA 2X5XA 3CXUA 1TK3A 1ZOIA 3STUA 2UZ0A 1LBSA 1L7RA 1ZI8A 4QDZA 2HDWA 2E3JA 1MO2A 2XUQA 3A6ZA 1EDEA 3AIMA 1BROA 5AK4A 4Y2TA 5EIHA 2VAXA 5E4JA 1CUWA 5HCUA 4RE5A 4CIAA 3R41A 1CUDA 5D3ZA 2X76A 4XVCA 3HI4A 1CRLA 3MUOA 2V96A 2XUJA 1XZMA 5YASA 5ALPA 2XQGA 2C5GA 1EXWA 4EHBA 1EB8A 1NX9A 1H2ZA 2WTMA 3FOBA 3AZQA 3F98A 4MYSA 3AZPA 5FP0A 4Y2QA 4OUKX 5ALXA 1LGYA 3OM8A 3FSGD 4GDMA 4DMKA 1W6RA 2OGZA 1IUNA 5AM0A 3VVLA 4QWMA 4BBZA 3NOXA 4Y2VA 1UZAA 1UK6A 2IX9A 4DTCA 2FJPA 1VE6A 4GEGA 5AKZA 3FBWA 1MX5A 3LS2A 2OG1A 3ZLUA 2CMFA 1DTEA 1AKNA 3QPCA 5ALTA 3DOIA 1JMKC 1X70A 1VLQA 2WG0A 1CUIA 1UFOA 5AP9A 1ISPA 4UBNA 5AOAA 4BVKA 5AK5A 1HBJA 5AIBA 4G1FA 4C4YA 4IO0A 1DX6A 4IQ4A 3QMMA 4OSEA 2XQFA 4H18A 5E2IA 3GA7A 4AMYA 4L0CA 5EHZA 1XLUA 4E14A 5AI4A 1WB5A 3IBTA 4AB1A 5FUMA 1XRNA 4W1RA 1VE7A 3TRDA 1QTIA 2BFNA 1VA4A 2XUHA 1HL7A 1IVYA 1LPNA 4U2CA 1JT2A 3KWFA 4W9RA 1BEEA 2QRUA 1XRPA 3K2IA 3O0DA 1LLFA 3W05A 3DKKA 2H7XA 5HF9A 5DNWA 3QMVA 1GKLA 3WA7A 1J1IA 5ALUA 2BUAA 4X97A 2HRRA 3BF8A 3H0CA 3IURA 4H35A 3BF7A 5JIBA 4UHEA 1PJAA 2Y6UA 1F6WA 2WG1A 4E46A 1CUSA 5AK6A 1MAAA 1W76A 4J0IA 2CBGA 2XMGA 4K6HA 2VSQA 1QIFA 3STYA 2PL5A 4EY5A 5AKYA 2FX5A 1AURA 2HA2A 2AXEA 3C5WP 2J3DA 1H23A 1EVEA 5AH0A 2BUBA 3AFIA 4YX9A 1SCQA 2J3QA 4G8CA 2WM2A 4W1QA 4AMZA 1B41A 4G4GA 2XMDA 4CIBA 4OYYA 4J0CA 4KRXA 4ARAA 3TJMA 4B7ZA 3V1KA 2C0QA 5HFNA 4P93A 4C89A 5C8ZA 5A7HA 3FNBA 1CIJA 2QUBA 2OCLA 3FVTA 2Z8XA 2XLBA 5K3EA 1BEZA 3OOSA 4QNNA 1XQYA 2G5TA 4AZ3A 1W1IA 3G9XA 4QDXA 3UUEA 1X2EA 4Y2RA 5IKXA 1G66A 4BZWA 3H2JA 4BC1A 1XZAA 2XUDA 3AUKA 1R88A 3QVMA 3AILA 3W06A 1FFCA 3SK0A 3FLBA 5HK9A 2YXPX 2CEKA 3E3AA 5I7UA 2RI6A 2QOEA 4DNOA 4HRYA 5AKEA 2RIPA 1UKCA 2I03A 1BE0A 1U65A 1T4MA 1GGVA 4X91A 4YK7A 4OD0A 4FBMA 5AKLA 3BXPA 3M82A 3H19A 1UOQA 5LZ7A 3PF8A 1G42A 4LHEA 5ALYA 3DJYA 2OXEA 2BKLA 3PFBA 1JJIA 5IVIA 5CXUA 4BTVA 5LIPA 2DFPA 2V98A 2WFZA 3WK8A 1VXOA 1P0IA 5CT8A 2Y2UA 5LYYA 2PM8A 3O95A 3T4UA 4XWGA 3TGLA 1J06A 4FHZA 2QMQA 2NW6A 5K5EA 3L1IA 1R1DA 5HQ3A 1CLEA 2VT7A 4WDQA 1QIKA 4OB8A 4B80A 1CUVA 3GUUA 1ZD5A 4CI9A 1IZ7A 3WL6A 5JAHA 3FLAA 3WK5A 5EFZA 5JALA 2ZYHA 3CCBA 4J0KA 1Q84A 1QJ4A 3C87A 1DWOA 3ED1A 3EIOA 3QPDA 1UK9A 4JEIA 4BVJA 5A71A 5K3BA 4X6UA 1EHYA 4AN1A 3A2NA 2PSJA 3IIIA 3KSRA 5AHXA 1CUHA 2OGTA 3D4LA 1HKHA 1TIBA 4AN0A 1WHSA 3WK6A 5JAPA 1TCBA 1XRLA 5AICA 5ALSA 1E8DA 4BP8A 2BUCA 1CUUA 1LPMA 4XX1A 1K8QA 4BB0A 3F97A 3I2IA 5LZ2A 1MN6A 1MX1A 1H2XA 2V97A 4OYLA 4ROTA 1AUOA 5FDFA 2OQIA 1E89A 3G02A 1Y37A 3CN7A 2XUPA 3PUHA 5JASA 1ZIYA 3PFCA 3M81A 2HU7A 3O4GA 4OB7A 4FOLA 5ALMA 4ARBA 3C6YA 1XLVA 1Y7HA 2OLEA 3G0BA 4X85A 5JAOA 4Q1VA 4FLFA 4ZV9A 3LCRA 3WZLA 2QZPA 5HKBA 3I1IA 4BRZA 1C4XA 1WOMA 4BTLA 4KAJA 4FMPA 4EB0A 4Y2XA 3WJ1A 5ALRA 3ESDA 2HA5A 4H7FA 1CUBA 3H2KA 1GKKA 4BDSA 2BGRA 1CVLA 1LPPA 3AZOA 2O2IA 2AJCA 4GI1A 4B85A 5KBYA 1AMNA 3BIXA 1K4YA 3NGMA 5I8PA 4AX4A 4HVTA 3G9TA 4E11A 2BCEA 2XDWA 1ORVA 5LZ5A 4BE4A 3W9UA 2H1IA 3BDVA 1ACLA 1AQLA 3V1LA 1DX4A 1DQZA 5ALZA 3B12A 2XQIA 1JU4A 4IH4A 4F0JA 3N0TA 5AI6A 5IVHA 2XMBA 4X71A 4WDRA 4Q3OA 5T4FA 1CR6A 4Y2UA 1SC9A 4K2AA 4ZXFA 2PU5A 4A23A 4C88A 2P8SA 3FCXA 1LZKA 3QBJA 4F21A 4QEKA 4XIIA 1MJ5A 1WB4A 3H2GA 4K5QA 1KU0A 1XZBA 4WY5A 2QS9A 5K3FA 1HLGA 1H2YA 1ORWA 3D2AA 1EDBA 1Z68A 4HXEB 5LZ8A 5HF6A 3DDUA 4C01A 3W2TA 3VDXA 1CUEA 3SC2A 3IA2A 1QONA 1A7UA 2W22A 4X6XA 1XZJA 1QOZA 4J0HA 5DTJA 5EIEA 5C81A 1F0NA 3FWHA 4JYMA 4UHHA 1EH5A 2ONCA 2JGJA 5A7GA 5JATA 2G5PA 1ODSA 1X2BA 5CT5A 4JUIA 5JZSA 4WFIA 1CUZA 4Y2JA 3IB3A 4INZA 4P9NA 3DYVA 1WM1A 3C43A 2IITA 3QM1A 4DIUA 2RONA 1ZD3A 3VVMA 2OCGA 4GLBA 3QYJA 5IH7A 3D0KA 2V9ZA 2IIVA 3U1TA 4OCZA 3V1MA 2WIJA 3G7NA 1XKTA 2VJBA 2R11A 1GPNA 2WUEA 4BATA 5BV7A 3IUQA 1H2WA 2Z8ZA 3H1BA 2RHWA 4QDTA 3RK4A 2XE4A 3A2LA 5K3DA 3IVMA 5BOVA 1CPYA 1ZIXA 3WYDA 3WZMA 3VJLA 3ZV7A 3WL7A 3AIOA 2JGFA 1L7QA 4Y2YA 4B9EA 4DMFA 3WWDA 1XRRA 2QVBA 4KAAA 3I2HA 4N8DA 3STVA 4DSZA 4FWBA 5AI0A 3G0IA 4KE8A 2H7YA 4IH9A 1CUJA 4DLNA 1Q83A 4EBBA 3UMJA 1QZ3A 1CUCA 4P08A 3I2JA 1QIIA 3WKEA 2HIHA 4AO6A 2XUIA 1JMYA 3V1NA 2X8BA 4PQEA 2BAGA 3FYTA 2H7CA 4KE6A 1PFQA 4BDTA 5FOQA 2J4CA 1EX9A 5A2GA 1I6WA 2O7RA 2RGUA 1J2EA 5CTAA 1BS9A 4DSAA
chains in the Genus database with same CATH superfamily
1SUWA 3AY0A 4M0DA 1NAHA 1GAEO 4YT2A 4FFWA 4QZVA 4GZLA 1MDBA 3EVNA 4AO7A 4D74A 3NHPA 1C3VA 5LQRA 1O95D 3BIJA 5EMNA 2V7GA 2WLTA 4LSWA 5FIUA 1DXHA 2X7XA 2FPIA 4AG6A 3ILHA 1QS0B 2LW7A 3K8QA 2J08A 2YS7A 2E89A 2F8LA 4LNUB 4HEHA 3GBVA 5A6SA 4DR7B 1AOXA 2O3JA 2XH8A 3F4BA 5F98A 4I9UA 3B3GA 1VSTA 4MYUA 3UAYA 3AF0A 4RJKA 5KTSA 3ER9A 2HJGA 2JCSA 2B6HA 2CLFB 2XUFA 3V1TC 3TE6A 2H4XA 4R7GA 2FWAA 2HC9A 2CFSA 2VPQA 3OESA 1P44A 4RV5A 2CFOA 4R2KA 4YB8A 4UTNA 2V9PA 3CPJB 1YBVA 3U5TA 3U19A 2PMDA 2PKQP 3BWXA 3BCSA 3KYCB 2JFFA 3TQOA 1QE0A 1DKPA 2XT0A 2AHOA 4PSDA 5M04A 5JAIA 1GYQA 2FUEA 4YRSA 2CT8A 1GM5A 4Q9DA 2R7MA 1QFSA 4REMA 2OBBA 4AS1A 2EGUA 3BXGA 2KPOA 1AZSC 1CUGA 2ZSKA 1NN3A 1ZCAA 5EERA 2QVYX 1GNVA 3BWDD 3F4LA 4NU0A 4YJDA 1D5CA 1L5HB 1OXMA 2J9RA 2YS6A 1T9GS 3AG5A 1NJ8A 2QDXA 1EIZA 3MB5A 3TIFA 4D80A 1CQZA 2WWWA 1NIJA 4JU9A 4TTPA 3MT8A 2R2GA 2XMPA 3NH6A 2ZYIA 1RWPA 3UAVA 1XL1A 3R7WB 5B2EA 4XM1A 3U40A 2YFKA 2I4TA 8GPBA 1BQEA 2WJIA 5LP1A 1V9SA 1ZPDA 4LXGA 3LC0A 3N59A 2O8FB 2P9FA 1TYZA 4H7IA 3T7DA 3VR6A 2ZR7A 3LA8A 3AC0A 1ID1A 4MTLA 3TOCA 2V7XA 4OK5A 2JDIA 4WESB 4UQPA 4FDVA 1CUAA 1JRLA 2W4IA 2VK2A 3DH0A 4Q15A 5D7NA 3DLAA 2ZXUA 5IJZA 3T7EA 1U2EA 1E63A 2ECOA 2PKXA 3DKVA 3ORYA 4FSXA 4UOZA 3F6SA 5BWLA 2WHQA 2QW8A 3JASB 2CE2X 2VDUE 4F72A 4O2BB 4R8RA 1BD4A 2B99A 3I2GA 3F74A 3NUZA 1Y8RB 4KR7A 5SYAA 5G0TA 3HYNA 1JBQA 1Z3CA 5AIAA 3QPUA 2GB4A 1XRJA 2R1TA 1WABA 2FK7A 3IPYA 4GNKA 1ZNWA 3H6HA 4L4SA 2OQ2A 2CUKA 3EQ6A 4WZAA 3ZDEA 3AB8A 4F8JA 1E2BA 2NLOA 1MRNA 1Z36A 2BSXA 1RSZA 2J85A 4US1R 2FGKA 2ADMA 3RI3A 2I3AA 2HDOA 2I99A 2XJ4A 1J9ZA 1FNMA 4R01A 4X7PA 1TAGA 3NWJA 1ZVJA 1SH7A 1TUIA 1UBFA 3AUFA 3ET5A 5DGHA 5KNBH 3L6OO 5LKRA 3Q3GE 1BS2A 1ODIA 4KJXA 4Q5IA 4E22A 1OH7A 2DY1A 2XDQA 3L41A 4D9MA 4ER6A 3KKPA 1C7IA 4DOMA 2G3YA 4J94A 1K06A 1B14A 2NO4A 1EFRA 1QDEA 4Z4QA 1D2AA 2C2OA 5T4BA 4L16A 1XEWY 1UPXA 1JH8A 3ANXA 1XZHA 4MPDA 3KU1A 2R4UA 4PF1A 4BL5A 4DADA 2D1YA 1JHUA 4A10A 5T6BA 4IOKA 4FR2A 2VTVA 2ZUBA 2NVUB 3PD7A 1A50B 1JKXA 1F5NA 3T34A 3ZD6A 1EIWA 1JB1A 3GJ3A 2GEJA 3UMMA 4OHMA 4D81A 2WHXA 4M8NE 5KYWA 3LLSA 3ETJA 3T7CA 4QODA 1GL9B 4NNOA 2VJCA 3FPJA 4N5DA 1WBBA 1W2GA 1WHSB 2P3SA 2X19A 2XD4A 3WJ2A 3Q7QA 2I2BA 4CMHA 1O6BA 2VLIA 1P4GA 1QYCA 1EM8A 3IJEB 4UKDA 2Z98A 1FFEA 1WW2A 2IZ7A 2RDMA 1RWVA 3IP5A 2IH4A 4KO2S 2PT7A 2B61A 4FEGA 1KZHA 2R85A 3QVKA 2A9QA 2RGEA 4AF8A 4Y9SA 2DBVO 4OA8A 2RKOA 1NLZA 2QSYA 3GA5A 2X7JA 2RBEA 2WSBA 4Z7JA 4TYNA 1IY8A 4ZJPA 1AV6A 2PBZA 5TT1A 3V55A 3I0NA 2H4WA 2YZ2A 1X1CA 4MVCA 3BULA 1IATA 1TJ4A 5A3VA 3WLOA 1CEQA 3ZKWA 4EA6A 4DV4B 1HE3A 3DO5A 1C8LA 5DMXA 1YJBA 3G2MA 2Z6AA 3MCVA 1D3AA 1Z0IA 2GXUA 3X1KA 1BCRA 4YCMA 5C7YA 4M7OA 2RHGB 3VTKA 3K1AA 3OU6A 4QTZA 2Z5FA 5CYGA 1PYOA 1SD5A 1NXWA 2RHBA 4H6VA 3FM9A 3H5OA 4HAVA 3RJZA 1DSSG 3CS3A 3FPBA 5HM8A 1X42A 3AF4A 4IXNA 5BSFA 3ZDXB 2I5PO 4ZI5A 3UK1A 5AM4A 2CV2A 2WSIA 4FYJA 2KQUA 3KXIA 1GZ3A 3V48A 3WE7A 3FWKA 2FSHA 4F92B 2GAIA 5FPKA 2NZJA 4G4SP 3FYHA 4UBOA 1WXEA 4WCVA 4B31A 4FZ5A 4C6HA 4CKBB 4E13A 5T3UA 2VXBA 3QY0A 1SXGA 2E5WA 4TTVA 4BZXA 2ZBUA 3C3WA 4KWIA 4J0DA 4N01A 2E48A 2ORWA 3S2FA 1YV9A 2DTEA 1YDMA 1XWIA 1MB0A 1RRVA 3KUDA 4MQBA 1I1HA 4OQFA 1IVSA 2RB5A 1XJWA 2M6RA 2V7VA 3ZUGA 5CCXA 1IK4A 3GVIA 1Y9ZA 3OO0A 3VU8A 5A3SA 1KERA 1GILA 5DNDA 16PKA 5CB4F 2O8CA 4PCUA 4PR3A 5F1KA 4Y3UA 2WY2D 1T1JA 2QUHA 3DEJA 1QP4A 2VQ6A 1KF0A 3A4IA 4L72A 1X9HA 3H16A 3D3WB 2EZ9A 1GGJA 1ND6A 4LYJA 3IEUA 1YB7A 2QQ0A 2QI9F 4KH0A 5NLLA 4EY4A 5JD6A 1KI6A 2PKYX 3F8SA 4UFNA 3UH1A 4MQLA 3G5MA 1ZMBA 2OKCA 1JEEA 2IUTA 1EE2A 2HA3A 3BSYA 4P6VF 3C8UA 3H11A 4KXMA 4LF6B 3TTUA 3NVDA 4B2PA 2D7CA 4UBMA 3RBAA 3GGGA 3UJ6A 5B1HA 2PH1A 3MYRA 1ISJA 3VVBA 1DQSA 4G09A 4KXFB 1RRPA 3RKSA 3A3KA 4M38A 1INLA 3BZBA 2F55A 1NFQA 2MJLA 1N2IA 2W6CX 4UHFA 1BCSA 1QFMA 2Y4OA 2PSHA 4OK3A 3DBOB 4TYPA 3KEOA 3FNEA 4PRKA 3PLRA 4C0HA 3PNQA 2OHVA 4QPNA 2OCIA 3Q7PA 1TQ4A 4LW8A 2DSNA 2ZT8A 2XMZA 1SB9A 4FJ0A 4P7BA 2NOAA 4G5SA 3TIGA 5AK3A 4AVYA 3R8XA 2YWBA 4PHGA 1TB4A 1DBIA 1ZRHA 2GUWA 3W9BA 3K3PA 3VYVA 4XRRA 4RNCA 4BV2A 2EF0A 1XZIA 2M9MA 4NBNA 3SQOA 1TEVA 2DULA 1QNLA 1ZY2A 5DTMA 4A73A 1E4EB 1QDUA 3CUTA 2IIPA 2GHTA 4RY2A 4WNIA 1KJYA 5EXTA 2PSDA 3TGWA 2KM1A 1Z0UA 2WIFA 5G0SA 1COZA 3SR3A 2PR2A 4IICA 4DLBA 5LOVB 2F8TA 5SICE 5EZSA 3DD5A 4YC7A 1OFGA 2ID7A 2Q4EA 2XB2A 1RAHA 4DA8A 5F35A 3MVEA 4UZFA 2X3YA 3RVDA 3W8RA 4BMNA 2AD1A 1WV0A 4ZMRA 1FX0B 2RAPA 1YQGA 3N6VA 2V0NA 4BAGA 1CR0A 1XKXA 3BGOS 2Z2YA 4BB6A 1QO0A 4R83A 5JV5A 5DVZA 3H5VA 2JFHA 5E4FA 3RIEA 1JJBA 1U28C 3U3ZA 1IY2A 2EEPA 5A4IS 1YL5A 2WI8A 3ICPA 4XUCA 1VGQA 5DWDA 3IUPA 1VG8A 5I47A 3RIXA 1P4AA 3JAKB 4ZYLA 3L6DA 4EJFA 2C5EA 2QTZA 5JYCA 1TEZA 2QHXA 1CIVA 1PE0A 5E4TA 3G8AA 4JJ4A 5CDFE 1A82A 1FDIA 1FFAA 2G1JA 3I45A 4LNHA 4BNVA 3ZY3A 1HA3A 2P9JA 3KOOA 5CLLA 5IDYA 3L3BA 5BRNA 1EG2A 3CUSA 5KKCA 3E9CA 4ARIA 3CF2A 2ZR8A 3D3JA 1UADA 5CH3A 2ZUTA 4D9NA 2RHOA 2Q07A 1GQOA 1NMSA 2H52A 2P6OA 4H7EA 5AVOA 1KNXA 5K3FB 5REQA 3HZRA 3TOZA 3WI7A 4COOA 1JHPA 5ALJA 3INNA 1TAHA 4ZAWA 4MEJA 3CUUA 3ORRA 2PX8A 4Q7KA 4MGHA 1EZZA 3DCJA 3KKKA 4G1VA 7REQB 4DMHA 3QEOA 5K8LA 1ZJZA 2DSTA 1J0CA 1JTEA 1U9IC 2JBWA 4FYVA 2ICAA 5CT4A 1PFUA 3QKSA 1OTXA 4D4KA 3SC2B 5CT9A 2PD6A 4AWAA 1JIVA 2HBYA 2RJ3A 2H1SA 2KMLA 2BHRA 4D3FA 5BNTA 5DNYB 3B5EA 5I48A 3ZNNA 3I05A 5FQOA 3SQXA 3FNHA 3M1IA 1XQ9A 3O9VA 4GYJA 3VU1A 1GDDA 1JJ7A 1KSFX 3HBFA 4FGZA 2AUTA 1T2UA 4XQEA 4DIMA 1IBCA 1I9GA 4J16C 4OYRA 2ZVQX 1Z2EA 4HAIA 1LBTA 2G08A 3PIIA 3NU1A 1XUOA 5D6OA 4AQDA 3LHDA 4GG1A 4TTRA 1JBKA 2VXCA 3KYBA 3WGGA 4EYOA 2C8KA 3LBNA 4CKCA 5CLFA 3X44A 2P7HA 5JCXA 2P9GA 5G3YA 2D2XA 4ND2A 1TQ2A 1WHTA 3LLUA 3VR2A 2WE8A 4DARA 4DB2A 1JT9A 2GFQA 3IAM6 4ND8B 3TFWA 1ORHA 3JQFC 5DM0A 1SAYA 2HBZA 3NKVA 2BEJA 2OENG 5HF5A 4EVSA 5CB6A 3M83A 3ZXUB 3JSXA 3K30A 1M66A 1IHUA 2CCKA 1P74A 1P2VA 3TTSA 3CNHA 4UXIA 2G4VA 2Z6UA 3KXDA 4D56A 3DHWC 3FF4A 4LDNA 4PAWA 3WNCA 3H3XA 3S2UA 2DLNA 2YNMC 3ZD9A 2NO9A 1A95A 1WDWB 2XUAA 4QUIA 2CC2A 5JCPA 3K6SB 4UCWA 3DVLA 3GEHA 5D01A 3U13A 2BC9A 4KE7A 3P2MA 3WRXA 3A0UA 1JFTA 1RI3A 2EIXA 3R3ZA 3WL8A 2JH9A 2GCNA 1QAQA 5ICSA 3CV3A 3CVUA 3C4QA 1RWMA 1YZQA 2CW5A 2PX6A 4ABTA 1E96A 2G63A 2HWWA 3RU2A 2EW1A 4IX1A 2FTKE 3AR2A 4P4GA 5E8JA 1V4VA 3RSFA 3SQNA 3V46A 3E4DA 3WIEA 3LO8A 4TMFA 5G1OA 1QV9A 5B1DA 4BQNA 5JYDA 1FDTA 4MYTA 3ZHRA 2BBOA 4HPJB 4KAXA 4GPZA 2CVQA 3DV2A 4ZWNA 3R1IA 3WBBA 3BD7A 4BFYA 3BE8A 2P8JA 1HE4A 1NXQA 4JJ8A 3ZDZB 4PPQA 1SVWA 3J7AC 3DMPA 3KCNA 5AO9A 1NNSA 5H68A 3V8BA 5AM1A 2XYHA 4HZUB 1GGNA 2VTBB 1P7CA 1ZINA 2D5LA 3PRJA 3ZHCA 2Q6OA 4XD7A 2JI4A 1A7JA 4TRMA 3UMRA 1P7WA 5CA1B 1D6MA 4Y6LA 2ZVDA 4JR1A 3H9EO 3Q7TA 4GYYA 1GCAA 2WP8J 1L4MA 3HCDA 1P6XA 2R8RA 2X1VA 2V6MA 3NEPX 2RKBA 3EYAA 3D2CA 3EBLA 3HJUA 2P2ZA 4LA4A 1UEJA 1KP9A 4JP1A 2CNKA 3N2ZB 2B98A 4DCOA 4L5BA 2V7UA 1ULBA 3AJAA 4LRWA 2ZRDA 2R8PA 4PO8A 4N82A 3A3YA 1WL8A 1F5SA 4HTAA 4MYDA 2AS0A 3RS9A 5HR5A 2OCXA 3QNUA 2GF9A 2P1DA 2G7ZA 3EQ7A 3C16C 5HJ5A 2JVJA 3GL9A 5E38A 3I9V6 1HR0B 3BJIC 1T36B 3TEJA 5CVDA 3WGQA 2E37A 4KQKA 4Z3OA 3RS8A 4NLLA 3FYUA 3UY4A 5IFKA 1U4NA 4NFSA 3AX6A 1T3ZA 3FPKA 4N5NA 3KLPX 3VHQA 4CTKA 3PHIA 1V1RB 1C1XB 2WA2A 4IY1A 3UJ9A 4JVNA 4F4FA 5JANA 1GFIA 2OD7A 4MS4B 1KXJA 3MN1A 3IV7A 4N5LA 4DGQA 5HKAA 3DXZA 1NULA 3KDAA 4HV4A 1P0CA 4HUQB 3B53X 4ETWA 1RLJA 1YQ9A 2UZ3A 4X20A 3T12A 1WZCA 4J8PA 2P4EA 4NV0A 3C1UA 3KOWA 2V7EA 1O87A 4D02A 4KQGA 1EESA 3IVXA 5KWJA 4NBKA 2G0TA 1P0MA 2I67A 3L7KA 2AI3A 5CDUA 5MN5A 2WF9A 1FFBA 3DBRB 3H2IA 3MJ4A 1POWA 3KPUA 5E9QA 3RJ5A 4YHBA 3TSAA 1PR9A 1P7YA 2YWRA 3IJRA 1DINA 4WINA 2BJVA 1WULS 3TTTA 2WP0A 4BIIA 1GZ7A 1KZ9A 3NM5A 5KQRA 4NPAA 4HNQA 3GZJA 4H4CA 1MUUA 5FWNA 1DEHA 2J1LA 3KJEA 1MX9A 2CHEA 2XQVA 3UC5A 1DIBA 3EOZA 4JYPA 1S8OA 2IEDA 3OQPA 1T1EA 1TT7A 4S24A 1KVSA 5BN4B 2O6LA 2C5FA 1RWQA 4JLKA 3O9MA 4MA0A 5BW6B 4XUDA 1XQ6A 4IVQA 3AKZA 2NX2A 3NUQA 5BQ3A 1T3HA 4HDSA 2F67A 1GGFA 5JMOA 1MAVA 2CCGA 1N5RA 3OT1B 4I7EA 3ADCA 5FKJA 2WSLA 3CH6A 1P33A 1IPHA 3E53A 4HGYA 2DAPA 5CB0A 2F48A 3DCNA 3ILYA 1Z0SA 3M6XA 1UBRS 3OIWA 4PO3X 3WMWA 4RPHA 5BMVB 1VDZA 2QXTA 2VIIA 4XSVA 3AOEA 2Q3CA 2JCXA 4NOJA 3OSUA 4ZV4A 3NNDA 3G2LA 3OJLA 5M2QA 1N6HA 4KI0A 2GCIA 2LKDA 4LXUA 4B2YA 1XDZA 1ZICA 2XJ9A 3O8QA 4MPTA 5JDCC 3FWNA 1ZH0A 1HDYA 3SKYA 3U9TA 3VR4H 1L7NA 2JZCA 3SFVA 1VA5A 1JVBA 2A4KA 1XTPA 4DQ0A 1GD1O 5BR4A 2PN1A 5A9RA 1XKLA 1WMBA 4GXNA 4N7MA 4PAMA 2LIVA 2IYPA 1Z4KA 4Q3KA 4L15A 3NCTA 4FHEA 1PSDA 1QFJA 4NJEA 4UJ5A 3HSKA 4CM1A 1XGKA 5A03A 1EFTA 3KUKA 3AB7A 4JXKA 4LTDA 3FNQA 2HXGA 4NENB 1QMGA 4QBFA 3VZPA 2CHUA 3SHTA 1PT8A 1C2TA 2ZULA 4FYXA 1OAOC 3K72B 3TXYA 1TA9A 1JSXA 4JYBA 3F3SA 5F9FA 1NF2A 5FX2A 3FOWA 1P0PA 3UCEA 3HLKA 4JIGA 4CM8B 2FR1A 2ZDGA 2VDQB 3GLUA 3IAFA 4ZC8A 3R3VA 3KV1A 3P9PA 4UVGA 5COAA 1GTRA 3V7NA 4MGIR 3T5AA 4DN6A 1U0GA 2BZ1A 2ZI4A 4YNBA 4W7IA 4BWVA 2WAAA 1WG8A 2XUZA 4PRZA 4C0XA 3ESCA 2E5LB 4FDMA 4RZXA 3RASA 2Y76A 3SLGA 1PFYA 4D9BA 1QM5A 1C8BA 1C8KA 1RHJA 4WOKA 3VU9B 2N47A 2CNWA 1YK1A 2ZJFA 5HS6A 2G5CA 3I1YA 1EWTA 1VKHA 1NV9A 4I19A 4C5CA 1VL8A 5BSGA 5DPMA 5C34B 2ONJA 4FONA 4LJ8A 1AB5A 2PGOA 3RM3A 4O4IB 4CDGA 2I33A 3LDHA 4H7PA 1VG0B 2XXAB 5AW8A 5C1PA 5D3MB 3NHLA 5H8WA 3UC9A 3FBTA 1FDSA 5GOTA 3G79A 4BGEA 5KTNA 3RYIB 2C2GA 4QGAA 5K01A 4HNTA 1HWYA 4MRAA 3NT5A 3LXXA 2D2VA 2D8MA 2Y4NA 3TLAA 4KTVE 821PA 3BC1A 4FW8A 1BEUB 1I33A 3SE0A 3DBLB 4IDOA 4PV7A 1YJCA 4TLEA 5DNEA 2E0IA 5TEWA 2DERA 4D3DA 1DAFA 2ZYSA 2GKGA 4RFVA 2YXBA 1Z6GA 4PICA 3ZXXA 4DR3B 1VPWA 2WC1A 2H18A 3U3MA 1K5PA 1JHDA 3FJYA 3KSDO 4EKDA 2NXWA 1MC5A 4Z7QB 2JG3A 2ZB2A 3JWJA 1FFSA 3BJMA 4TWAA 5AVVA 1X39A 2XOEA 1PW7A 3H4MA 1P1FA 5DBHX 4XGQA 3DKRA 4IOMA 1C3OB 3RANA 1ABBA 1PWZA 1VYVA 3L8HA 1Z8NA 3PNSA 2RBGA 5DB4A 2FLVA 2AZ4A 4BV9A 1C0KA 4BQEA 3QEKA 3NHZA 1KK3A 5BNIA 3EB9A 3D5EA 2VPTA 1UKVY 4P4UA 3NHJA 5JJ5A 2QPTA 6CHYA 2C9CA 2ZI3A 3ASYA 4LZZA 4BNIA 1JE1A 2F64A 1E7MA 1NQAO 2CMDA 4JLPA 4TUYF 2ET6A 2QT1A 2ZS9A 1WXDA 2R97A 4DA0A 4B73A 1N8SA 1TIPA 4G4IA 3EMKA 3LL7A 3O1LA 2R5WA 5C8YA 3LXMA 1VHWA 2PV7A 4KVZA 2VR1A 4GRDA 4L95C 4MCHA 4IV0A 5F3RA 4F5EA 4V0QA 4YJ2B 2ZT7A 1P7ZA 1FZTA 2QMUA 4KO1S 1V26A 1CFJA 1M3SA 4MROA 1QF9A 2XTAA 3HLYA 3LHFA 3Q40A 2PX5A 3ILSA 3R9IA 4CJXA 1DP4A 3V00A 1NNEA 1K88A 4I3GA 2R6R1 5EKDA 3CBGA 2A2ZA 2HEGA 2QR2A 2I7XA 1PJ8A 4US2R 1ESEA 1S8NA 1F4VA 2VYFA 1EXMA 2QWXA 3BAZA 5K3CA 1B6RA 4D92A 4Z5XA 5JDIA 4EGSA 3THYA 5CURA 1L5GB 2H8GA 1XFAA 3FCUB 5J1TB 1KI2A 1FTQA 4WZZA 4A9AA 4J29A 3NVAA 3MAAC 5CGZA 1QKIA 4YGYA 2XCRB 5IJ9A 2DHQA 3ZVNA 1M2FA 2DR0A 4UDXX 4TSFA 4C22A 3EJWA 1IQUA 2NAPA 2RGAA 3M5CA 2Y0BA 3DAPA 1PJZA 5DOVA 3L92A 4URXR 4URFA 1LPSA 2XTJA 2C97A 2WHPB 4B17A 2OFPA 3IOCA 1JHVA 4M99A 5LUBA 5B1YA 4OQLA 4HK4A 1M6WA 1NVWQ 1F17A 2IP4A 4GXQA 1BXRB 3H1AA 3TZBA 2GFIA 2WFLB 1UDXA 5KEIA 2RE8A 1UT8A 1XE3A 4XEHA 3LOUA 1C30B 4QARA 3WLPA 3IHLA 4Z0PA 5CLGA 3V33A 4XJXA 5FWYA 2AMLA 2GUGA 1AX9A 3MRSA 2C82A 1WCXA 2CHFA 3DW3X 4Q3BA 4TVOA 4MIKA 3M4ZA 4RF4A 1NR1A 5CW1A 4CM4B 1Z2CA 4ZRDA 1S7GA 3YASA 4C6TB 3SHQA 3OCYA 3JALB 4N39A 3MRVA 4YUWA 1ZUHA 2R3SA 3JZMA 2GX6A 3NHMA 4JLUA 4A91A 3F2IA 3S70A 2V7QD 1H65A 1ZK2A 3I1JA 5I8ZA 1IUOA 1GRRA 1V3VA 1X3SA 2Q5FA 2FPXA 3RRYA 1DO2A 3FDJA 4JBGA 3GFFA 5CM2Z 1PZMA 1L8AA 3M6AA 2QBYA 2EJCA 3DSRA 3TQCA 5KMGB 4E2WA 4I50F 2IBTA 1IE3A 4KAFA 2GTPA 4P8RA 4HQKA 4M22A 1GXSB 3UTCA 3R44A 5FTWA 4B6GA 3RRJA 1J99A 3COSA 3HEAA 4H31A 3L2OB 4UTZA 4ZT5A 3O8OB 4RZUA 1RHUA 4XJTA 4AY6A 3NIGB 4TMWA 3KKEA 4ZC1A 2R7AA 2F1JA 3GRRA 2QGZA 3N2GA 1F4PA 2CLCX 4QU0A 2C9BA 1G21B 3O74A 1KOJA 3FR7A 3TRFA 5LMUB 2WJYA 1TKRA 2V4UA 4MUAA 1JXAA 1F51E 3I34X 1L6RA 4FYMA 1J2UA 2IYFA 4M1TA 4WECA 5TPWB 5GTDA 1CQIA 2I22A 2ZRKA 1E2GA 3KWJA 1OVMA 3PHCA 5KI6A 2E4WA 3N2NA 3ADOA 1A98A 3E15A 3ZZMA 2JAPA 3MGKA 3PPXA 5G0VA 3JYHA 3KYJB 1OX4A 4B8WA 3JQ9A 2ISQA 3F96A 1EFKA 4P3YA 4ZI7A 5E8RA 4YTEA 3VOAA 4PZEA 4EYSA 1CS0A 3ABRB 4QQRA 4D4IA 3AP1A 4IVRA 2ZJOA 5IM4F 3QXHA 1GWNA 1IAVA 1VI2A 5FORA 3NEYA 3T3MB 5EVJA 2BKXA 3CNLA 2HU8A 3ZGVA 3ZWVA 3I4LA 5CP8A 1NPYA 1BMFD 3F9CA 1WNTA 4ZYZA 4DDMA 4RF3A 3OMWA 2WTEA 1D2MA 1PS9A 2PLRA 2FJUA 1RABA 3T7SA 5BXQC 2VPXA 1KORA 4W1SA 1T24A 3LCJA 3WL5A 3CT6A 4MQ6A 1GNQA 5AHWA 1QH1B 5C3MA 1GO2A 1WY5A 3Q0EA 4W8GA 5BSEA 1XD2A 3HABA 2P4HX 4YI3A 3EF1A 2O3SA 4YP6A 1E1LA 1Z74A 5JS7A 2WZDA 3MQ4A 1BWRA 5CJJA 4BO8A 5KAPA 5GIPE 3NXKA 1X7DA 2BE7A 3IIEA 2HXSA 1TYDE 1XZQA 4GMDA 5THQA 1DAIA 4OU4A 4Z4GA 1JLLA 2JJYA 4QXAA 4L85A 4OHCA 1P6QA 5P8WA 5I9NA 4O3FA 1XXHA 3LC7O 3ZWQA 1XV5A 3LD9A 1EFCA 5BW4A 4HNSA 1HNNA 1XI2A 1A9SA 1UOOA 4F6CA 1NRJB 2TSYB 2JK0A 5CDTA 4XW2A 3PUWA 5TEVA 3OLXA 4ZODA 4Y6RA 2P9YA 3RFFA 4CM5A 3WL3A 4IYRA 3OFNA 4HXGA 2NO7A 2P30A 1D2NA 3QEBZ 1DAEA 1EFLA 3ZY4A 4DIKA 4HN2A 2AR0A 3RWMB 2ID8A 1Z0ZA 3HFRA 3GA0A 1XKQA 4R2IA 5JMPA 4BLOA 2RGCA 2GOYA 1M6YA 1W8DA 3U0VA 4BCBA 2B2XA 2QD4A 3CE9A 1ECJA 3BPSA 3GT3A 3H13A 1TM3E 3VMMA 1RFGE 4ASUA 2GEKA 2I7DA 5KPJA 4EUEA 1I51A 1RPAA 3R3WA 3KT6A 3K0HA 1ZD9A 2XIQA 1G20E 2X5JO 3IDOA 3QF4B 4YQFA 2W2KB 4MRMB 2FF7A 1NYLA 3QEMB 5H4HA 4N65A 3R20A 4QT0A 1HE8B 3DL2A 4MRSA 4WBXC 3HCNA 1RJ9B 1FUUA 4B0PA 5LXTA 2Y92A 4EPTA 1Y3FE 5FV7A 2JCVA 3E81A 2CFRA 4WGGA 3GGDA 5I9IA 3REGA 1U2QA 4BVLA 5EMLA 2P3LA 1P3DA 1TM4E 4MXDA 3KZMA 1UC9A 3ZBPA 3NORA 1KI1A 2X1LA 4UNIA 5KHAA 1QPZA 4G1UC 5TQ2A 4G84A 4D0SA 3F9IA 4C2UA 3DZGA 5ENDA 1K6EA 4O4JB 2ZXEA 4UVIA 4XSHA 5KTOA 4K9DA 3CVXA 2PX3A 4RORA 3U1VA 3IDFA 2WD7A 5EIXA 5U9CA 4F84A 1KZYC 1JHOA 2ECFA 2R44A 1TUBB 4LPSA 4B2IA 3IELA 2BHTA 4EEXA 1Y5IA 2MDTA 4YBRA 4FYIA 1KS9A 3EEBA 1HL3A 1QHSA 2BFEA 4RMNA 1UBSB 2ASEA 1L9KA 2BFOA 2G0AA 2PGNA 1U94A 3WKAA 3RFUA 1MZPA 4YPVA 1FS4A 4TOIA 1VLLA 4IWXA 3TX2A 4MH0R 1GQQA 3TMYA 5DHPA 5MGBA 3DTNA 5KOYA 1MG5A 2F43B 2TMDA 1G6Q1 1YKGA 4B3RB 3DHVA 1RZVA 3WWCA 2NUPB 1KMMA 1PWYE 2Z3WA 1FSSA 2DX7A 1YS9A 2QRMA 2Z8YA 3C6XA 2XGSA 1FLDA 1G17A 2IJGX 2ZYTX 4IDDA 3HCBA 5JMTA 3AEYA 4BJ5A 5I7AA 1P31A 3GAAA 3TW0A 1HTTA 3Q5DA 3LBAA 3VVCA 4ZHQF 1G4UR 3ROGA 5JY1A 4CM6A 3GN2A 1M1YE 3OPXA 4RHCA 1G3IA 1L1EA 4KQCA 5EI5A 5LWHA 3FTNA 3EZFA 3C97A 5JPIA 3GFQA 1N25A 2A59A 4NZ9A 3OLVA 4ANFA 4NICA 3VUEA 2FN8A 1CP3A 4IJVA 4KMRA 3PQ6A 2WTAA 2BEUA 2GD6A 2O7VA 3NJRA 1FTYA 5ERXA 1VFPA 2CL7X 1N6OA 3GO4A 2QIOA 1ZDMA 1JB9A 1R18A 3CRRA 5HG0A 1CB7A 2IYSA 3COJA 2Q6VA 3G3EA 3H97A 3HCCA 5IUJC 4C4XA 3ELBA 2JCBA 3EA0A 1UIMA 2BBTA 3IC5A 5I9MA 2FQXA 4HB0A 2OBXA 4RDCA 2QYTA 1R0XA 2H59A 5ITVA 1YR6A 2R8BA 1L4LA 4HDAA 1SUBA 4UARA 5KZMB 3GQBA 1RAGA 2AOVA 4RVFA 1M73E 1PZXA 2MYPA 3QA9A 4HJXA 1OXUA 2AOTB 1UPFA 4MARA 5AD1A 3OM9A 1Q0ZA 5ELXA 5IH3A 4G9GA 3BQNB 3EPRA 4V38A 3RU3A 2TYSB 1MQSA 5P21A 1GNPA 4CEIA 3GPIA 3CF4A 4RYLA 2BV3A 3PJEA 4ID9A 4FHDA 5COQA 3LF2A 3WLJA 1WPXA 5TMPA 1LNSA 5L3VA 4ZICA 1BRMA 4XGRA 3HVHA 2FP4B 2ZIFA 3INRA 521PA 4CUZA 2P2DA 1CHDA 3L6RA 3VYSB 1R12A 4B87A 4LHXA 2D0DA 4U2KA 4EGCB 4WA8A 4H0CA 3HFJA 1VZ2A 2Z9DA 2O2CA 1AK9A 1E69A 2Y1WA 2G8LA 2ZE7A 3TSWA 5C5CA 2D62A 2DBYA 1JEOA 2CYCA 4TS1A 3NKLA 4ZO8A 1MF7A 2F9MA 2EBHX 4MHSA 1NDHA 3GP3A 2F4NA 3G9ZA 5FO0A 5GVSA 4V39A 2EG5A 1JGTA 3L0YA 1HK7A 4K87A 1O58A 4KK3A 5KOHB 2HZBA 4AECA 1H0KA 3KAJA 3Q98A 4ZHSA 2J0UB 5KU7A 3CZMA 4KQ1A 5TXGA 3ULKA 2NO0A 4ZO9A 5ALFA 5CEFA 2D3WA 3AEUB 3ESZA 1X9IA 5KQGA 4MVXA 4JNCA 5D3KA 3I3OA 3DLCA 4JI8B 4NCIA 2OV8A 4OLFA 4ENSA 5KYGA 1P0QA 1FXSA 3EGDA 4L0QA 1V25A 1NVBA 1UAYA 2QV7A 3MQFA 4LOKA 4ZCQA 4EW1A 1V8FA 1M8FA 3EQ8A 4A8JA 2WMOB 1MDFA 3D4PA 2WFAA 3OEED 2VDRB 4ZCMA 1THGA 2GFHA 1P5ZB 3BHNA 2ZJBA 4F2HA 1DBVO 1MGOA 2H3HA 4DIDA 4LF8B 3LV8A 1T9HA 1KJWA 3QI2A 2X8LA 1DZ3A 4E51A 3MRXA 3PHJA 2O2HA 5T4HA 2E49A 1Y1PA 3KUCA 3QEAZ 4CUJA 2JD1A 3MMZA 1RU3A 4RZ3A 3ZLJA 1EPUA 4KQ2A 1JA0A 2PXXA 4YP1A 4EFKA 4RLHA 1ZN2A 3AT1A 1Z18A 2VXOA 4WEOA 1MFZA 3MEQA 4OPMA 5CXQA 2X8JB 3DYIA 1X8XA 2AJ8A 4HAWA 1ZD2P 2GN0A 1Z0JA 1YZYA 2C4HA 2G9UA 2QDKA 2KLHA 3L0DA 2FKAA 4ITVA 3T5MA 1R16A 2C59A 2LIPA 4EPWA 3RNOA 4RQUA 2G7MC 4HUTA 3Q3JB 3E9QA 3QKRB 1T1RA 1ODTC 1SQ5A 1B74A 2QAGC 3ELWA 1R9JA 4MITA 4U7FA 2C77A 3A2KA 3QBDA 1P2FA 3BH6A 3TCNA 3KX2A 4GL2A 2ES4A 4FOSA 4WK6A 4AZ0A 5I7WA 5BP7A 1OLOA 1R64A 2SCUB 4YMVA 3DBIA 2C96A 2FH5B 3LPLA 2C5SA 4CKXA 1P1KA 3OPNA 2C8VA 4G2NA 4KN5A 3ZWOA 2X3FA 3AP2A 3NATA 4EIWA 1EVLA 5A9SA 2IHJA 4FILA 4TYMA 2PX4A 1B93A 3A9UA 2C5BA 4MVJG 1GTMA 4DAOA 1EWVA 2ZJ1A 5FNVB 4JI7B 1K89A 2RI1A 1BN6A 1B7GO 3FHJA 1FUIA 5BVHB 4IHJA 3HA2A 4RTPA 1I2CA 4L6AA 3KTAA 1LDMA 4ALIA 1JIQA 3FGPA 5K0CA 3UGJA 1PNTA 2RGBA 3FLMA 4TLLB 2ASVA 5JCOA 1GG5A 1CJSA 4RTJA 1J33A 4HFRA 2O2DA 1SIBE 2JIDA 3CRVA 2C07A 3GYBA 4U5QA 4KWTA 4EA9A 3GJSA 1N5MA 2KW5A 4HH3C 4P92A 1UMCB 2JI8A 5JWHA 3ZZUA 4HQRA 1Q19A 1AN9A 3NEAA 1CDOA 5DYGA 3V4LA 3U16A 4YJHB 3O4JA 2DPXA 5IT9A 1BGWA 4MRNA 4Q66C 1EUCB 3K6RA 3T9AA 2RG1A 4JZYA 4BJ3A 2OSBA 1NYQA 4P84A 2BFCB 1XZLA 2ZCUA 2CDCA 1J0BA 1JWAB 5CG2A 4EO7A 3GLHA 3ANSA 2GKOA 3L43A 4JMPA 2YYSA 3BFKA 3IMEA 4R4JA 3LUGA 3Q88A 4CCYA 3DZIA 3U7FB 4LFBB 2WABA 2JLUA 3K7EA 5IC5A 3KRTA 2A35A 2FW0A 3W8NA 1TMYA 5LDHA 4DCMA 3UOAB 1WDMA 4JJEA 3TW6A 1T4BA 4IW3B 3HKCB 2COKA 3DP7A 1GPKA 2VZ8A 3MUEA 3EFEA 1SU7A 4X93A 2QAJA 1KQGA 2G9NA 4FBLA 4MVJH 1OI4A 4NVRA 1CUXA 1V2HE 2XYPA 4KXUA 4U5XA 2FMFA 3H9GA 4G5XA 5JSYA 2NU8B 1Y1KE 2O1XA 3HS3A 4I46A 5H3CA 3VJRA 5FLKA 4TTAA 2QUIA 2JFOA 3M3HA 1G7CA 1JG7A 2WTNA 2R4TA 4CKWA 1GSOA 4OM7A 1K0FA 4CGYA 2CV1A 5CNKA 4JENA 2GSWA 3O26A 2PLWA 1DLIA 3DNPA 3K5HA 3PFHA 4H3KB 4U2EA 4CFSA 1IZZA 1B0PA 1XF1A 3I28A 5AM3A 3RBXA 4FP9A 1VE1A 3CUYA 4EHKA 4OI2A 4A0GA 5B58C 2BD0A 2ZYAA 4Q1EA 3VR3D 1ZO8A 3BMNA 5IDWA 1LY1A 3Q11A 4YXFA 3EY9A 3WFJA 1XZNA 4NONA 4ZMSA 2XNCA 4TUYB 3HEMA 2BWJA 4ZAXA 4B9AA 1PK7A 2XF8A 2I2XB 3WGTA 1R0WA 1SVNA 3ZH2A 3OTOB 4I4IA 1GU1A 3N8GA 1LBSA 2NZ2A 2V45A 1I2ZA 1N2JA 3E03A 3EZNA 5JOQA 2X0DA 3ZY2A 1ZI8A 2IYEA 4QDZA 4JKIA 1QFXA 2B0CA 3TLGA 3SFZA 3EXEA 2H63A 1LQ2A 3EARA 2VK1A 3MHPA 4GBJA 1MO2A 4R1MA 5EZ6B 3V4SA 3FPLA 3OEHD 4PU0A 4CMCA 1ZXLA 2BGKA 2J7PA 3V5NA 1G5IA 4U7DA 3D8RA 1BROA 4LJLA 2BGLA 4HGOA 3B20A 3EZYA 3G2OA 5KAMA 4ENTA 2HDHA 5E4JA 3CM0A 1USGA 4G0YA 1T2DA 5JY6A 4RE5A 4CLXA 4Q1FA 1JQKA 4CMJA 4DCSA 4HNGA 4ME6A 3SZMA 1XZPA 5FADA 1TLFA 2OVFA 4RHTA 2X0RA 2BKAA 3AVOA 3FZYA 5KVQA 2ZATA 3SQWA 1HO3A 3OU7A 1R0CA 2H5JA 3HQ4O 4N3NA 4C1BA 3SKXA 3GRCA 4PX2A 2PUBA 4IUDS 4DCGA 5CPFA 1QGAA 1NVMB 3I73A 3HI4A 2O8EB 2NVOA 3ZZNA 1DVRA 2H4ZA 2V96A 1W46A 4B46A 1OFIA 4P0TA 1RE0A 2VPYA 2OFXA 1YQQA 2W6ID 2BGMA 3N8DA 2FW7A 4O4HF 5CNIA 4I0WB 2IPAB 3P9QA 4CEHB 3AV3A 1WUJS 4MW1A 1WXQA 2OZLB 3K9HA 4E1AA 2H2GA 1IBKB 2QROA 1P7PA 1R5JA 4WKNA 3RTCA 2IPXA 4O5AA 1OJLA 4WCDA 4R9RA 2WTMA 3DXFA 3F98A 4MYSA 4G97A 3VPAA 2C7GA 2ENUA 5B37A 1YZHA 3RHFA 5ALXA 1A9ZA 4XZ3A 2YXDA 2GJ4A 3OQ6A 3QWHA 3FSGD 3N39C 1P19A 2WWHA 5TQ0B 1ECGA 3V2GA 4ZGGA 4D5GA 1B6TA 2PWPA 4QOGA 1R0RE 1H2BA 4TL8A 1YD7A 3K16A 3LX8A 5EINA 3TMKA 2PYIA 3A3NA 4BBZA 1Z35A 2RK6A 1XBTA 4A82A 5HP4A 2P7IA 3GJ8A 1UK6A 2YN4A 3D6HA 3IUBA 3LRPA 1ISIA 4AJOA 2FU5C 1J97A 1OYYA 4B8YA 1VP9A 2YUTA 4ZT3A 1CT9A 2NZWA 4PYNA 3JVDA 3GLFB 2FJPA 4ZANA 5EJ9A 3PC7A 1XLTA 1VE6A 4DRXA 4NU6A 1GTZA 3PVZA 3HV0A 4LZAA 3W5SA 5F7XA 3OI7A 4H6WA 1CWUA 5AKZA 4IRMA 3RUFA 2PT5A 3GFRA 3LS2A 2OG1A 3ZLUA 1JG2A 3OE1A 3VX3A 1NMEA 3QLVA 4DR5B 1C29B 1QGZA 1TW3A 1CJCA 1QLHA 3NNSA 2FRVA 3IFSA 1AKNA 5ITZB 1O77A 3JD1A 2FPUA 2W2TA 3JSAA 2GO7A 2GPYA 3AHIA 4YAOA 2V4ZA 3WGVA 3LHKA 4CQLA 1HY3A 3QPCA 3IL2A 3GNLA 4YY3B 2BZ0A 2O07A 2IUSA 2FDCA 1QYDA 3F7TA 4HNUA 2D5IA 3MCWA 1IIRA 1IHDA 5H0IA 4TZ6A 5GONA 2IS1A 2MYNA 3GCZA 2PCJA 3AUJB 3LUKA 3UV3A 4UBNA 1VKZA 2QLBA 2V1UA 4LHVA 3GEBA 4OHFA 3OE4A 3U26A 3JRNA 1DQPA 4G37A 1JDSA 4D45A 3NTRA 4WLNA 1M76A 2R751 2PMWB 3OCUA 4U7WA 1QSGA 1SUIA 3R77A 3QWAA 5AIBA 3B9PA 3BB1A 3INGA 4LN1A 2ZTSA 4U0JA 5JH7F 3QKWA 4EG3A 1DX6A 1ND5A 4IQ4A 3QXXA 2BGWA 3PNBA 2XQFA 4R9VA 5E2IA 4IZIA 1U4OA 2UZIR 4LWQA 5EHZA 1CNEA 3RYCA 1XLUA 1GDHA 2FHSA 4MUIA 4B4DA 3HUEA 3UTDA 5L3SA 4CF5A 4N5MA 1SWWA 5GVRA 1YJAA 3DV0B 1WB5A 3IQFA 1AM4D 1JE0A 1NM5C 1MV8A 1Q7GA 1MOZA 1T0PA 2Q3BA 3DPUA 1W581 3PDHA 1A71A 1K6JA 4W1RA 4JL8A 1N4DA 2A84A 3LP6A 4N7JA 2GEUA 3IBCA 4NZMA 1QTIA 2WYWA 1PJLA 3PC8C 1ZXXA 4FZRA 5HOEA 4CL0A 1KZ1A 2OB2A 1ILWA 2P5TB 2AR7A 2YWGA 1AQIA 3HJBA 2D4AA 4U7GA 2X4GA 3TZCA 1KEVA 1T2EA 3OIDA 2H07A 2JJ1D 3R0XA 4LTNA 3T0GA 1HL7A 3VYTB 3ZU5A 1LPNA 3KL4A 5BWMA 2ZP1A 3Q41A 2C00A 4EFNA 4I4TA 1I4OA 3ZY6A 4DMFA 2G9ZA 3KWFA 4OBWA 4CXMA 1BEEA 3A06A 3L4KA 1J7JA 2WF7A 1L3BA 1XRPA 2VBIA 3K2IA 3S29A 1NURA 4MTCA 1REQA 3UMVA 1ZCBA 2IY7A 3CTPA 5FAXA 3ROQA 3O0DA 1JPJA 2HMSA 2JGDA 1X38A 3L7BA 3DW1X 4ZQGA 3BCHA 4GOOD 3Q8KA 1S4QA 3DKKA 5SY6A 2QQ5A 3G8BA 5KSPA 5NULA 3T3GA 3AXSA 4NU5A 1RBMA 1W2WB 1ZEMA 3GVCA 2M6KA 3TLZA 2HF7A 3HBJA 2VUUA 1PKEA 3D9QX 3TZHA 2W48A 1QQBA 5TGTA 5T67A 3KBBA 4RK5A 2IQ5A 2BDTA 2OBNA 5ALUA 1FMJA 1S4MA 3JAMA 2HRRA 1KAEA 3H0CA 5I4IA 5BNZA 4G0NA 4CMEC 2C4VA 3PRYA 4XYLA 2RD2A 1GG2A 2P78A 5DHUA 1KZGB 3AUSA 3RVRA 3AF6A 4UHEA 1ADJA 4YS6A 2JAQA 5I9TA 1T9AA 2XTNA 2L0XA 1U81A 4LZWA 5CR9A 1T2FA 4L8FA 4P22A 3FY4A 3MLAA 4AKSA 2ZSEA 4X7RA 4E46A 3RC8A 3EUEA 3HB5X 3MS4A 1QUFA 2KE5A 3TJRA 4ZJUA 3INYA 1U80A 2CNNA 5EXEA 3TR0A 4P5DA 2BKUA 3EY4A 2CBGA 1DNPA 1ZRSA 2P9QA 3NALA 4FI3F 4J0IA 2AEFA 1R4NB 2BONA 2ZI5A 1ZIDA 1QIFA 1U99A 2PL5A 3F5SA 4LHYA 3STYA 1B73A 3ZK8A 3KVRA 4EG0A 4L1KA 4Q00A 4IIGA 3QQ5A 1W0JA 1ECBA 5EKTA 3VYUB 1QRRA 2HJHA 2ZROA 1Y7LA 2BI4A 2FX5A 3HXPA 1BC5A 1XZ8A 4RZIA 3ZKAA 3KP1A 5J2TB 2G6BA 2FPOA 4P82A 2VHJA 4QHTA 4F4JA 3VNUA 1YFJA 2SICE 2TECE 4X62B 4H3HB 1SVUA 5LA6A 3PTLA 3UF0A 4XQCA 4BFCA 3NRBA 1O6ZA 1GIAA 3B9QA 3UJNA 3GJ5A 4ZZ3A 1VTKA 4YX9A 4IQFA 1V95A 4RZHA 3RSGA 1UXHA 2R66A 4OMUA 2CJWB 4GQIA 1SCQA 3DVAB 1EZ4A 3ENKA 4K2HA 3V2HA 3VHRA 4EEKA 1E3MA 2QW1A 1XJQA 4IQGA 3LW8A 1BSVA 1B41A 1GZ5A 3E1KA 4YH1A 3PUXA 4RZQA 4OXXA 1RYFA 2EV9A 1GFSA 2KYRA 1T3SA 3A6GA 2LXNA 2VUTA 2XMDA 4YO8A 2W90A 4WOPA 3U3RA 1DPFA 3O7WA 5E9JA 1P4SA 4J0CA 1IOLA 2QXYA 2QD2A 4YIHA 1C14A 1GZHB 1Y8QB 2IOQA 1ZWKA 2FETA 2ZBDA 1JSRA 3CG0A 3Q9UA 3Q9LA 1E5VA 1XC7A 1T25A 4GPBA 2DPYA 3PCXA 3V1KA 3EDRA 1FW8A 3I9JA 3K5IA 4J2OA 2FZVA 5FI1B 3AUXA 1P2GA 1FP6A 1Z6XA 2C2MA 2P9TA 3OF5A 2ABWA 2H85A 2VNIA 1L5RA 4HFJA 4HG2A 1CIJA 4PPFA 4RZSA 2O8DB 2HQBA 3WNDA 1XNQB 1DOHA 1SPBS 2XVXA 2DTXA 3BWCA 3VNQA 2GXSA 3RAFC 5JS8A 1KPIA 2P69A 2D6FA 1KEUA 3O47A 2FVYA 1SVIA 3AW8A 1Q6YA 4MUEA 4GOMD 2Z8XA 1HDZA 1ICEA 3MA0A 1MA3A 3ZGYA 3PZRA 5H59A 5EY5B 5TT0A 4CFYA 1CNMA 1UQUA 4KCGA 2H3EA 2GXQA 4GOLD 3FAZA 1GR1A 3FCEA 3NAGA 1W1IA 4Y9RA 3LVBA 3LUAA 1ZM4A 1VLMA 3HJCA 3T4XA 4E08A 5B2FA 5KQPA 4MKRA 2O2SA 3UMCA 1G8AA 4CN8A 4Y2RA 3ZHZA 4DHWA 3LDUA 4JJAA 3D8UA 1P2UA 4K1LA 3A1TA 4IWYA 1JDUA 3VOTA 4BC1A 5C2JB 2LVBA 1KBQA 2DOKA 3AILA 3QPBA 4BVGA 1YZUA 2RKWA 2MYTA 1CK4A 3C85A 3DMTA 3FA2A 5EAIA 1WSDA 3EA5A 3ZCRA 1QRUA 1E79A 3HDTA 1ESCA 1FSPA 3FLBA 4KIGA 3UT5B 2GJKA 3FDZB 2A5GA 3ASVA 1IJKA 4QQ8A 2WVAA 3KKQA 5JEDA 4CIDA 5K4AA 1R8QA 3T1TA 3ABSB 3IQGX 1R6TA 2QOEA 4HVLA 4R5MA 2CK3A 2G25A 3NFYA 3R6TA 4GMHA 2A0KA 3NO4A 1FP2A 5CHYA 5AKEA 1MA0A 1UZLA 3N3AC 3SXJA 3MD9A 2J3JA 1DUVG 1DMRA 3PE3A 4NBUA 4OKNA 5CJ2A 5E6RB 5GJCA 3D4BA 1U7WA 3L9XA 3SN6A 1GN8A 2HPAA 2FSVA 2G1KA 1CRQA 4FBMA 3DZFA 4NXNB 1GRQA 1Q20A 3BTOA 4CCSA 2AFIA 3EMVA 5LZ7A 3PF8A 1G42A 2ZRCA 2QJTA 4S0ZA 4O8CA 4TV9A 1O0CA 2BCJQ 1JR2A 2P5UA 2BKLA 4ZVTA 1S2OA 3RBZA 2QE7D 5BUZA 4JT8A 5LIPA 3AFGA 2ZCVA 5EYPA 2XR1A 2D2EA 1Z8FA 3CMCO 5HGXA 4PHTA 4Z9BA 1OB5A 1CKEA 4CT5A 4H59A 1ZUD1 3M6FA 5ADUS 2ZRMA 2PM8A 3T4UA 3K0SA 1X1TA 2FKNA 3ZS9A 4XWGA 2TS1A 4DUGA 1U0HC 2A92A 1J09A 1RHKA 1SXJA 4IO1A 4Q12A 1KS2A 1LK7A 5T57A 4ER0A 4XRGA 4R51A 4L5AA 3JQAB 5BQ5A 3DWGA 2QMQA 1SQ0A 3KJNA 1Q1GA 2VBFA 4EYGA 2NUTA 4LMBA 4C4OA 3L1IA 5HQ3A 2B83A 4IDPA 1K5DA 1MORA 4ETMA 5CIYA 3LYHA 3K0CC 1RLTA 1FXUA 2VHQA 2HNKA 1ZU4A 2VT7A 1QIKA 2ZWMA 3A6JA 4PLCA 2OKGA 4P98A 4WDQA 3GXOA 4DQDA 1M7HA 2VG8A 1O0SA 5LB4A 1V48A 2C3MA 5BXYA 1GKYA 4E70A 4TWZA 5JAHA 2W6PA 3KD3A 1E9VA 2PX2A 1HMPA 4C05A 3Q0IA 2LDXA 5EFZA 3WK5A 4KSBA 2FZ4A 1SPXA 3HKDB 5CA0A 2ZYHA 3NONA 3OTHA 1KDYA 1NATA 3RQSA 1LW6E 3UMYA 1L5YA 2GAOA 3BD9A 3KHTA 4Y1RA 3EH1A 5A0FA 2XA1A 5K0GA 1NUPA 2IZOA 3ETHA 4W7SA 1QVVA 1LBQA 1QJ4A 3E27A 1RXEA 1T5OA 4DIEA 1ADCA 4DNXA 1MVNA 3BMOA 3VPGA 2Z6QA 1H6BA 2BTQB 3QPDA 1GAJA 3VU0A 1HEUA 2G06A 5CFPA 1D7AA 1RKQA 5GV8A 1NVTA 1FVFA 1AMUA 2QLJA 5K3BA 1YDGA 1P60A 4GQBA 4ZGWA 4Q1CA 4X1OA 4UM9B 5SZHB 4XKJA 1FE8A 1XYYA 5CEEA 3RUEA 1FIUA 1QWOA 3PKIA 5JVDF 1Y6JA 1EUDB 2PZAA 4NCBA 1I3CA 4J1TC 3BMXA 3V8MA 3L4BA 1T9DA 2G1AA 2V59A 3IIIA 3KSRA 1RM5A 3Q3EA 5DMHA 5KYYA 1CUHA 1I9CA 2ZJ4A 2OGTA 3IP6A 4ZVOA 3UNXA 2VEDA 1US8A 3LOQA 3SYTA 1YB2A 4TVSA 1GCUA 1HKHA 3C3DA 1BG6A 1SHZA 4LDRA 4PLYA 1ZLYA 2QPOA 3WK6A 1TCBA 2DKNA 1HDCA 1Y42X 1WQ1R 4LWOA 1MT0A 1FVHA 5ER9A 2IU6A 4EUNA 5JYBA 3K9FC 2YMPA 4INJA 3A4MA 3TL3A 5ALSA 4AK9A 4E5MA 4M86A 3P9ZA 1ZJWA 1EGQA 2PUFA 2EOAA 2OUKA 2CD7A 2QP9X 1PJSA 2VT2A 3P27A 1IOZA 2Q3DA 2VHUA 4JWKA 5FBQB 1ULHA 1C7QA 2A1TS 5FUXA 4QQFA 1LPMA 5BN3A 2QM7A 1XHFA 4KYIB 3GEGA 3QOFA 4U6QA 3VPCA 3AU8A 1OUMA 4CDNA 2LBPA 5CB4B 2IUFA 1JFSA 5DHRA 4G67A 4Z4CA 2F3PA 2P90A 3IV9A 4Q7EA 3HHPA 3QJ5A 2IXGA 3D1JA 2GZ3A 2UXDB 2CLSA 2QN9A 4Y1FA 2IWHA 2Q9UA 5EJ8A 4WN9B 3OCJA 5H5JA 3RHTA 4S05A 2VWGA 6Q21A 4DR1B 1JDZA 3FZGA 1XCPA 3PITA 4FKZA 3EVTA 2V97A 3JZFA 4NU8X 2YVKA 4NJOA 3D6TB 1RLOA 4FMBB 1KMCA 4ROTA 4BBJA 4PYJA 3PE4A 1VECA 2DF8A 2EFHB 3DD1A 4G65A 4CTMA 2X58A 4BQQA 4QXPA 3SQMA 3VDRA 3ORQA 3TVYA 1UBJS 2Q5JA 2R9VA 1Y37A 2BFAA 1UMDB 3AR3A 5D6NA 3W2FA 2P6RA 4FFDA 3QW4B 1L9XA 4CIXA 5EPEA 4BRUA 2C2ZA 4ER3A 2E21A 1P80A 4ZVSA 3NAQA 4MI1A 2R1VB 5JG7A 2HU7A 4IXDA 1VHLA 2JA1A 4TS9A 1DC6A 4FOLA 5DK4A 5KS2A 3TXXA 1UJ4A 1IVNA 3R5XA 4RS3A 2ZSBA 3CRMA 3C6QA 1XLVA 4QUJA 1JTVA 3EVAA 1WVIA 1QE5A 4HDMA 2OLEA 4K9NA 3TW4A 3E7XA 3FGNA 2V5VA 1UINA 1VM6A 3LUJA 3ZI4A 1QTQA 4ZOLB 1Y63A 4Q1VA 4Z9FA 5EWMB 4ZV9A 4BWYA 1IDOA 3AVVA 1X3LA 1U02A 4RMIA 4MQFA 3TLCA 4EW3A 4NS1A 1PFKA 4RKRA 3GJXC 2QMYA 4A15A 3KJZA 2ILTA 3A6LA 4FQ7A 1MXFA 4BTLA 2CXNA 4UD6A 4V0RA 4ZI2A 1DKNA 1NW4A 2Z2ZA 3C3CA 2GK7A 1YUBA 3BEOA 1ZVVA 1RYDA 2AKYA 1JR3A 1VSUA 3F6BX 4HQOA 5FH9A 1W5TA 4M6WB 4YRTA 5BYJA 4AKEA 4C6SA 3SLRA 1BXKA 3VSBA 4DZZA 1VBKA 1M34A 3ITEA 2Q5HA 2QQGA 2VTEA 3A6FA 3GRPA 4AG3A 3ZWPA 4YCLA 3SHWA 5F2NA 2H9IA 2FN7A 1VBMA 3P20A 3GXBA 2O4CA 1GKKA 2AX3A 3B60A 3FN4A 4J7UA 1M8KA 2AC4A 3IP3A 1CVLA 1LPPA 1J23A 3AZOA 4RD0A 4GOXA 5K7SA 4B3MB 1TI7A 1L5NA 1SG9A 1Q77A 1UUFA 1MVLA 2VJLA 3W6OA 1AMNA 4UU8A 5CIQA 3WYCA 4Z0HO 5KDOA 2NU6A 2R00A 1NKVA 1Z6YA 2VZ9A 4B76A 4BVAA 1YFLA 5FOVA 1GEGA 3DOEA 2YJ5A 1H42A 3DTVB 1S3IA 1FFGA 3G9TA 3NTUA 5DM1A 4BUJA 4WCFA 6ADHA 2BCEA 2XDWA 3OWOA 1ZUNB 2GAJA 2QRVA 2QTWB 1MABB 4KXYA 4P4SB 4D4HA 3ZNPA 3S2EA 4R2LA 4X66B 3WLMA 3GIWA 3ZGOA 3GMSA 3H1PA 3BDVA 4UW9A 1XMSA 4CHTA 4TVBA 4PFKA 2YRWA 2WPDA 3NCHA 4OUDA 2HSGA 4UTVA 4BGDA 3AVPA 4X8LA 1OWNA 1DX4A 1LC0A 1JEDA 3SJCA 1SCAA 3P9CA 3B12A 4G36A 1JEQA 4EI9A 4DEXA 5EJ5A 3E61A 1CRWG 5T8KC 1NF8A 2W5UA 5AI6A 3KSMA 4PX3A 5IVHA 2XXJA 1ZK1A 2GTIA 1U1GA 1SUDA 4WUTA 4DLSA 2MMGA 2X0FA 1U8UA 3KLNA 3F3MA 5TGDA 5LQKA 3N2YA 1YR3A 3P9YA 1PT6A 2DFTA 3DOJA 1LLDA 4PN3A 2E1PA 5GV7A 3GWGA 4TKUB 4J0FA 1JN0A 1T4DA 2ZKIA 4TZKA 1RP7A 2DHRA 3RFTA 3EWIA 5F2OA 3T99A 4ESHA 4ZDKA 3EDOA 2P2GA 2EP8A 1P1HA 3G88A 4JGGA 2I1LA 4PO9A 2TMKA 1RZRA 2A9RA 2BHNA 4Q7MB 3VNBA 4K7JA 3ANMA 2CB0A 1GYPA 2WSMA 3CEJA 3DHNA 3N2KB 3OX1A 1LZKA 1NXVA 2F3UA 2HF9A 3FKSD 4FKMA 3NTLA 3VSDA 5KX5F 1I3MA 4K5QA 4AD8A 2EW8A 2KB0A 5I5EA 5JNVA 2R8YA 3PQDA 4HHEA 4WY5A 1W47A 2AEJA 3L7LA 5G02A 4X60A 5A2QA 3CKLA 5GZ3A 3NOVA 4MI6A 4C7XA 1A8HA 4FXPA 1NY5A 1PG5A 4K05A 1EDBA 4W9MC 5LZ8A 2FEXA 2RGNA 5F21A 2RIRA 4JU8A 1E9AA 2K2WA 1A77A 3Q6MA 4DY6A 2AMFA 2PJZA 1NPTO 2RK3A 4O2LA 4R2XA 1E6LA 3R0QA 2OXIA 3R3HA 2XV1A 3I4FA 5G4KA 1E2QA 1PDVA 2P4UA 3ZIDA 3I0ZA 5BOSA 4CF7A 1DCFA 4N03A 2GF0A 4TKLA 2GI4A 3EXG2 1H4TA 4R1TA 2VP6A 1ZMTA 2EKZA 1XXLA 4J0HA 1M6NA 1NNI1 2VNJA 3SYMA 1XNGA 5DTJA 3ZC3A 1V1MB 4GEKA 2JBAA 3FWHA 5KWEA 2W2LA 3COZA 1E9FA 4UHHA 2J3IA 1IG3A 1AK1A 1JG3A 1HETA 2VWPA 4MO9A 1ES9A 1W7AA 4UUPA 1HSZA 1GRNA 2OECA 2OMKA 1M6VA 3KPJA 5JZSA 3OIFA 2Z57A 4WOCA 1E6CA 3OWHA 1Z83A 4FFRA 1CUZA 5EWLA 3MCTA 4DZTA 1NHWA 6NULA 3K73O 1ZA2A 5HKKA 1V8BA 4QOSA 3PLAE 4HFMA 4DDVA 1SKMA 3HVUA 5IBRA 4A8TA 1QQ6A 2ODQA 4P9NA 3C2QA 4KLAA 5A05A 3UAGA 2VRCA 3FOEC 3C43A 3QM1A 3AXTA 3N8NA 1O97D 3AJDA 3HVIA 1K6IA 3TECE 4OXQA 2AK2A 3C5EA 2YOGA 4D99A 2RONA 3QIAA 1ZD3A 3L07A 4GI2A 4I8XA 4LY6A 4XIFA 2GEFA 3IP7A 4LC1A 2VQ3A 1OFVA 2VP0A 3MAGA 2UUPA 4AURA 2LPMA 3D0KA 4X6LA 4Y1EA 1OZHA 3Q6IA 2YYYA 1NBME 1ZGGA 2IIVA 2O0JA 2WJWA 3H99A 3KB6A 3KALA 4HLUC 5ARDA 3U1TA 5LN1A 3OBIA 2HOQA 4FNAA 3NV7A 4CF6A 3PR2B 1AVTA 1DEOA 2IEGA 1XKTA 3KE9A 4CLRB 4EMSA 2QQEA 2R11A 4J1QA 3RW9A 3GUYA 1GPNA 3B1XA 5AW9A 3V32A 3NWBA 4XDHA 3H1BA 1NVAA 2RHWA 2AH5A 3H8WA 4BO0A 1K1EA 2IQIA 3DFZA 3VKGA 2VNKA 2OO7A 3M9LA 2UKDA 3UB3A 4DZRA 3PUKA 1CPYA 1FYWA 2BKVA 3A4TA 2IDKA 4LMRA 4LRXA 3VJLA 1CZNA 2PRZA 2QY9A 2E2WA 4BLUA 4FMDB 3AJ8A 4MUJA 3P19A 2Q49A 2EJUA 1PK9A 1SY7A 3AYXB 3WL7A 3BIFA 4XX0B 4GP6A 4YAFA 3IOYA 1L5MA 1SGWA 4B9EA 3ABQB 3QWFA 1QZZA 1Q7CA 1EJ2A 3QEJA 2XY4A 3RB8A 3GLGB 3F8WA 1LX7A 2FA9A 3MOGA 4UDOA 2JHGA 1V5FA 4DGSA 4WXYB 5FFFA 1CZRA 4JOCA 5IYZB 1GPDG 2ZI9A 3KYDB 3NHBA 4Z7OB 3AUAA 3G0IA 3RYHA 3EVBA 3OBBA 1QAOA 4LX8A 4MQEB 5SY4A 3R9XA 4LUCA 3OJFA 2RGYA 4IDFA 2R4QA 3DC7A 4GGMX 1G8YA 4KE8A 3V7WA 4YMUA 3E82A 3LGSA 4FINA 4S1WA 2FMKA 3SQDA 3OCZA 3UOGA 3KOMA 3H2YA 3JQ6A 2ZPTX 1K8ZB 5C3UA 3RKRA 1K2WA 3UMJA 4LJRA 1ISHA 2JZNA 4PAGA 3VHLB 3IP9A 1KQ3A 1OXTA 3CZAA 3KEQA 1QIIA 2NU9A 2X6QA 4MR7A 5FPTA 2Q99A 2J9FB 1U3UA 2I2AA 4K9PA 4OQNA 3V42A 3WKEA 1ZUWA 5LP6B 1U0NA 3TOSA 2PZMA 4ERNA 1JMYA 4MHOA 2C1EA 2HUNA 4NX2A 1P1JA 1D5WA 2A9JA 1BU5A 5JSHA 4YP7A