5PGMA

Saccharomyces cerevisiae phosphoglycerate mutase
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE MUTASE 1
publication title Sulphate ions observed in the 2.12 A structure of a new crystal form of S. cerevisiae phosphoglycerate mutase provide insights into understanding the catalytic mechanism.
pubmed doi rcsb
molecule tags Isomerase
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1998-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5pgmA00
1QHFA 2P6OA 5AJYA 3NTLA 4JOCA 3DCYA 3QPVA 2P9YA 1V37A 3KKKA 2P78A 4D4MA 2HPAA 2AXNA 4PGMA 2F90A 3IT1A 3K4QA 3LNTA 2BIFA 4IJ5A 2EOAA 1EBBA 5PGMA 1C80A 2P2ZA 4EMBA 1ND5A 1RPAA 2IKQA 2QNIA 3D4IA 3EZNA 2P30A 1BQ4A 1RPTA 4PZ9A 4JODA 1QFXA 5CDHA 4TSRA 3IT0A 1C7ZA 1C81A 1XQ9A 3DB1A 1YFKA 4ODIA 1H2EA 4GPIB 3NFYA 5AJXA 3QPWA 2WU0A 1SKBA 3ZHCA 2WNIA 1SKAA 4ARUA 1BQ3A 1V7QA 2DWOA 2HIAA 2A9JA 3E9DA 4JOBA 1BIFA 1IHPA 3GW8A 4EO9A 1NT4A 2EKZA 3IT2A 3MXOA 1K6MA 3EOZA 2ENWA 1UJBA 5CX4A 4AROA 4ARSA 1YJXA 2H4ZA 2DWPA 2P77A 2P75A 1SK9A 2P9FA 1DKLA 1DKOA 3BIFA 4PZAA 4FDUA 1UJCA 2P2YA 3E9CA 1ND6A 2H4XA 5AK0A 2EKBA 4MA4A 4IJ6A 1SK8A 4QIHA 5CU7A 3F2IA 5AJZA 1DKMA 1FBTA 3FDZA 3HJGA 2P6MA 1DKNA 4D4JA 1H2FA 3PGMA 3OI7A 1DKPA 2H0QA 5HR5A 4ARVA 3D8HA 3FDZB 1RIIA 1E58A 3LL4A 3LG2A 2OWEA 5HTKA 3C7TA 1E59A 2ENUA 1DKQA 3F3KA 3E9EA 1CVIA 3GP5A 3QPUA 2H52A 2OWDA 2A6PA 2PA0A 3O0TA 3GP3A 4FDTA 3D6AA 4HBZA 2HHJA 3FJYA 3K4PA 2I1VB 2RFLA 1QWOA 5AJVB 5AJWA 4D4LA 2P9ZA 1T8PA 1TIPA 2P79A 4GPZA 3R7AA 2GFIA 3MBKA 4D4KA 2YN2A 1FZTA 2WNHA 2YN0A 3IT3A 4E3WA
chains in the Genus database with same CATH superfamily
1HTBA 5AJYA 1ZISA 3SQXA 4D74A 1JHPA 1Q3TA 3AEKA 5HIMA 2XGOA 2B35A 3G5TA 3LW7A 4HAOA 4CDMA 2PJRA 2FZKA 2VJQA 2H7XA 4FHFA 4IOJA 5HRAA 1C4OA 2H8GA 2W93A 5FADA 821PA 4J2HA 3RIHA 2NQTA 2G5CA 2WW8A 1DEKA 4BNVA 2V5AA 1L6RA 4JA2A 4W1PA 4JNCA 4YUXA 5TXGA 5F2NA 2OA0A 4K3UA 1S4MA 3ZWDA 3NUGA 1LVUA 3RODA 5AIAA 4CN8A 1PR2A 1XZKA 4R2IA 4ND7A 1XQXA 3AI3A 1UDXA 4MJ7A 4N54A 5DNWA 4ZCIA 3ICCA 5H0IA 4LRSB 2LKDA 2X5KO 1TNDA 2I2FA 5JS7A 5JO9A 3WTBA 3N2ZB 2FU5C 2WU0A 4JQCA 3AV3A 4OX9B 2DLDA 2WSSD 1K2VN 3H13A 1KETA 3VOBA 2D1SA 3U7FB 3W3AA 1S96A 4B09A 1RKXA 5J5VA 1VTKA 5F78A 2A1UB 2ZB8A 3B1VA 3OIDA 2CZGA 4PNPA 4XZ3A 1D4OA 4LYJA 3F7MA 4ZVRA 3G02A 4WINA 4B75A 5J5AA 1R6VA 3IP9A 2C2MA 4JUDX 3V1NA 1HQDA 2GGSA 3CJRA 5ALPA 5LVAA 2IP4A 2PH3A 4JN6B 4FGZA 4G1UC 4QL3A 2EG9A 4GI3A 2YIDA 1RZUA 2CGEA 1JMYA 1W0JA 2XUGA 3HNOA 2KWIA 3IS3A 3JWHA 3LDUA 3PFBA 3R23A 2PRIA 4OQNA 4Y0VA 5E4TA 4DV4B 3L4EA 5KKCA 3RHTA 1IPEA 1E1LA 1KFJB 3OHMA 1J7JA 2VG8A 1H6DA 3LC7O 3BB3A 4X20B 3HCOA 4HRXA 2BOVA 3WL5A 3U4QA 2FFJA 1HG0A 3ZXXA 4GD3Q 3R75A 2EJTA 3JX9A 3UV7A 2P3OA 4XYGA 2SHKA 3HV2A 3PDUA 3RIMA 4EA9A 2DFVA 2X41A 4BMDA 5IHPA 1UOPA 3AR2A 3B2NA 4G5YA 3VU9A 1PWEA 2FNAA 3BD8A 2XRZA 8ADHA 2G17A 4JSTA 4EI7A 5LKRA 1W87A 1Z7GA 2ZUDA 3AONB 4X93A 3UJNA 4TS9A 3PGVA 4NULA 3LT2A 2OUIA 3IDOA 4RVCA 4ZVOA 4B48A 4X66B 3IX7A 1Y37A 2XOKD 4U8HA 1DZIA 4R5HA 4AG6A 4MMZB 3PIRA 4DPMA 4CHTA 5DASA 3GP5A 4QVKA 4ZCTA 3R5HA 3AM4A 1BDBA 2QRLA 4CM4A 1KQPA 2XE8A 2ET6A 2OWDA 3WQQA 2JLUA 3P2YA 4TUYA 3HY3A 2RHOA 4YMWA 4PX3A 3DDSA 1YDFA 1WXFA 2VP6A 2ASVA 3D6AA 2JJ8A 2BFDA 3ESYA 2FN9A 3AFNA 4I0WB 1FFYA 1J2EA 4X3CA 5IMSA 2R6ZA 3OJCA 1RQ7A 2ERYA 2H2HA 2NVBA 3CRW1 1J8DA 4UFOA 4WXYB 4J6EA 3DZDA 1SCUB 1ONNA 2AG8A 4Q1VA 3UMYA 2FPIA 2PIAA 1J7KA 2QYTA 1QYWA 2YV3A 4A9AA 1QB8A 2IH5A 3BOSA 1S8AA 3DKRA 1YIOA 2AJLI 4QREA 2BVNA 4Q47A 4BFUA 4Q48A 1QHFA 4KSYA 5SZIA 1E18A 1TAQA 3RIEA 4LRQA 3T3GA 3BK7A 5CBPA 2CWDA 1T6ZA 2R5WA 4GMHA 1CQIB 1NNUA 4J7XA 4Z2AA 4BZPA 1XLTA 2DSNA 1YB5A 4II3A 4BRWA 3HMKA 2ECFA 2VNKA 1WVIA 2CNDA 3LJKA 2HI0A 1BZYA 4LEIA 3DT8A 3IPRA 4L4UA 4ZANA 2P2ZA 3JATB 4FOPA 5T57A 3WNDA 1B1CA 4BC1A 4PNEA 6Q21A 3WK9A 4JQZA 1XLWA 2Q9UA 3DHNA 3K1YA 4ZODA 5EZQA 5ALUA 1U0HC 4G0ZA 4JAVC 5T3UA 1L1RA 2VLIA 5JWRA 4G85A 5KSYA 3QU7A 4EJFA 1ODCA 4LYAA 3DZKA 1B8OA 2AEJA 4ZKEA 4LTNA 3VSAA 3RU9A 1RLTA 2OTCA 3PR3A 3F5MA 3W6PA 3HY4A 2YHAA 3SR0A 1OZ0A 4IEIA 3KEMA 3PTLA 1SVSA 4LUCA 3L8EA 4NMWA 4V0MA 3KPUA 3L7OA 1S3IA 5EJAA 3A14A 2I2BA 2A35A 1I7NA 3RVLA 1D5CA 1ARZA 2GDZA 2IYXA 4WNAB 2HRQA 2Q5EA 5T6BA 3VNUA 2ILVA 3M3PA 2W8ZA 3N5CA 3N9IA 1P1IA 3FNEA 2WG0A 3OZIA 4HGNA 2NXNA 1C8KA 3NOQA 4IXWA 1WV1A 2JW5A 4RGBA 4ECAA 3R5FA 3HXPA 1M10A 2VCEA 1JVSA 2OV3A 4GLFA 2E18A 4EY3A 2W58A 4LC0A 3RSSA 4CEIA 4CVNA 3NHUA 4OHZA 3R5TA 3R3UA 1P2DA 5IC5A 3V32A 1IXSB 2GEJA 4Y2XA 4BS9A 3HSSA 1W25A 4K6FA 1KDVA 2FPMA 3SS7X 3UJBA 1LPSA 3PU6A 3FOAA 2B94A 5ER9A 2I8AA 4IR7A 2YXLA 3L7KA 3AJAA 1DAKA 4QHYA 5IVDA 2M6LA 1VMKA 3KXPA 3H0CA 3MS2A 4XDGA 4U63A 1AKMA 5AM5A 5A3JA 3QVGA 3MJVA 3ZJUA 4LDAA 1PJ3A 2OBLA 5TPZD 1EXDA 3ED5A 5T7BA 1CR2A 4AN4A 1V4VA 2VA9A 4NBLA 2IXDA 3GR6A 2P4QA 2REXB 4I1OA 2G82A 2PSHA 3LW8A 3OWOA 3TJZA 1EXVA 5B1HA 3WIDA 3EXIB 1D2CA 1MT3A 1HOTA 5JDIA 2YFKA 1E9CA 1TO6A 4HEA1 1IB0A 1AXRA 1Y1RA 4UU0A 3THSA 3UMJA 5G4LA 1QFYA 4BNGA 3LYHA 3IMGA 3BSWA 4BP9A 1GZ4A 3I6BA 1QCCA 1ZVJA 2P1DA 2AXPA 2PQ0A 2J59A 3LL4A 3T7TA 1P72A 1Y7LA 4QUHA 1XCPA 1EFLA 3NU1A 4OK3A 3CYFA 1IZ8A 2G7ZA 3GZNB 2IUEA 3PWKA 1C1XB 5JD3A 3RLFA 2Q3BA 4Z7JA 1CEYA 3IB3A 3P9XA 3KYBA 3O0TA 3DYIA 2ZPAA 2HX1A 3NM5A 4IBOA 1W8DA 3COSA 1G5QA 4Q03A 4LZLA 1XZJA 1OYOA 5K0EA 3WB2A 5MFPA 4LNUB 2B25A 5JATA 4UJ3A 5C7LO 5JANA 3FMIA 3N1UA 3L43A 5F5XA 1U9ZA 1T29A 3BE5A 4JQYA 2CV2A 3R0VA 1US8A 4X45A 1VLVA 2Q45A 4CN9A 3MJTA 4KQMA 2BFEA 2FFHA 3T0GA 3M1AA 3QBJA 2IUYA 1NBAA 1C3OA 2R0QC 4J7AA 4GXTA 2D00A 3LKZA 2HLHA 4G56A 5K0LA 4BLQA 2ODQA 3U6KA 2F3UA 3HCEA 4DRYA 4AWXA 4YCCA 2OYCA 4LMBA 2ES4A 4HAUA 4EFLA 1EB8A 4CYMA 1KXJA 4N0EA 4WRRA 4I1VA 2P7IA 2FWPA 3BORA 3L77A 1SULA 4PZ9A 1RWMA 3N2GB 4YGYA 5C37A 4AS1A 3DFMA 3QPBA 3IMCA 5F9FA 3RRNA 1OI3A 1ODKA 2QTTA 3ZY4A 1FX0A 4DIDA 4MS3A 4PCVA 1V8DA 2CNBA 4YH1A 1E6KA 3HJFA 1T8WA 2H1VA 2OC9A 5HCNA 3TLXA 3MS4A 4GE3A 3W2FA 3W8FA 2AKAB 2CWWA 3L0BA 4MIOA 3E9YA 4HS4A 1TU0A 4LNHA 4HDMB 2P9EA 2FUG6 3QFFA 2Y0DA 3C3AA 3DEHA 3CLHA 5KAPA 1I14A 1NV9A 2HZ7A 2I4NA 2Q1XA 1NBME 2HHLA 1SKQA 3P2EA 1PLLA 4GZMA 3TKYA 5D2CA 4HPWA 2C2BA 3CGGA 1OGIA 4M0EA 3M2TA 3L7MA 5CIQA 2AJTA 2ZRNA 1A8IA 3LGSA 4FLFA 1H93A 5J2TA 1GAQA 1C7JA 2A1TR 4P82A 4QGHA 1W85A 2QTNA 5IJ0B 5BWOA 1JECA 3NC0C 3U5ZB 1Q92A 4KLRA 3ZUGA 5JECA 1E6CA 3LOQA 2A5YB 3OU6A 3CX8A 4PZAA 1QHGA 1XAHA 2H1IA 2HF7A 1CR4A 3RTDA 3IERA 4DF3A 5A1JA 3JVDA 3FOEC 2P2YA 3B7PA 1EDEA 1O03A 4FFOA 3BMNA 1SU8A 3V8MA 4A5SA 2GHQA 1K92A 3DKPA 1MB2A 1ITZA 1CJUC 2E87A 2FPWA 3C6KA 3GJ4A 1VL5A 2GVNA 3EDCA 4GI2A 3TTTA 4I4NA 4IL5A 2O8EA 2C07A 4LYHA 4TLBA 3FTNA 3IR7A 4U7HA 1EXWA 4MEAA 4PE5B 4C0HA 3NVAA 5A2GA 2ZSAA 1ZJ4A 3GIDA 4UEKA 5KKAA 2OO3A 3FTQA 1QQTA 5BQ5A 2K5UA 2A59A 4FYKA 4IJKA 4LOJA 1XDZA 4BGVA 2A4MA 3JQFC 3RO7A 2FSFA 4YUZA 4KXUA 3U16A 5LMUB 3F1LA 2B1IA 5DEIA 4UCXA 4EDFA 1W59A 1GNPA 5BWBA 5FT9A 1RHRA 2H52A 3ELWA 3PL1A 3O75A 2GLXA 4MPPA 3FMPB 4R9VA 4WOCA 3B8EA 3TQOA 1YZKA 1BJRE 2JJ2A 2VPIA 1X80A 2D1FA 2FEKA 3IP7A 3MMXA 3W7BA 5B7GA 2C7PA 3LLCA 1JLLB 2DT5A 3N6RA 4GM4A 4KOAA 4A26A 1GUAA 3E7FA 1T36B 4Z9YA 1ANKA 2BGMA 1GAEO 3NP7A 4KO2S 1CW2B 5HFJA 3UUGA 4UTNA 2H4YA 2FQYA 1A5AB 1Y6JA 3E2IA 5EKXA 2WJHA 3C24A 1F4VA 2YZNA 5CEEA 1DAOA 3RYFB 3T5MA 3QBTA 4O4LA 4K6OA 1FLDA 1U81A 2QM3A 3KKKA 1VFPA 4Y9SA 2OXEA 4NCXA 2PSFA 3F49S 1ZXBA 2PUAA 3MPOA 2H4WA 2VIIA 4UM8B 2IY8A 1W29A 1YV9A 4TN5A 1O95D 1U0RA 3PKZA 1UMBB 1Z2OX 1NPYA 5IKPA 1X2BA 1I36A 1VSUA 4QOFA 1ZM7A 4MH0R 4FCTA 4MP8A 5J2UA 1U5BA 3I5XA 1JW9B 1GRVA 5A5FA 1T1EA 3CF2A 1OTXA 2HSDA 1WW8A 5J4HA 5K05A 3ZS8A 2VT2A 3CVWA 5SY9A 4AJNA 1HTTA 2ZJBA 2GAIA 4E07A 4YXWD 5LP6B 4DV2B 1CWUA 1QV9A 1C81A 4Y18A 3KKLA 1CD5A 3U1TA 5BUSA 4ZDWA 5JUWA 4CMEC 4Q7KA 3DTVB 4LX8A 4FCWA 5HKBA 3FSRA 2OZEA 1EBUA 1O4WA 1XT6A 4ID9A 4KE6A 4M88A 2BCGY 4TL7A 4EY4A 1W6RA 1CJKC 4BQEA 4ZT7A 1MDFA 4Q4AA 1N4AA 2GBFA 2H57A 1XMPA 4U1RA 2AW3A 1DAHA 1KU6A 3MT8A 3AG6A 4U6QA 3PPVA 2MSNA 3LCUA 3TW4A 5KWSA 1UBGA 1W49A 2EYQA 2WF6A 4EI2A 2FFBA 2XHZA 2Q6VA 3ZXYA 3Q11A 1K06A 4TWJA 1PT7A 1F0NA 1DBQA 1U2PA 2AG0A 3GGCA 3TJRA 2Z4RA 3OJEA 2NZUG 1VHJA 1NAHA 1AXGA 4E3ZA 3A70A 1BU5A 4TVOA 3K0SA 3KSMA 1M7GA 1L5WA 2EIHA 3A6KA 1TEVA 3VNQA 4C6RA 1FY2A 1I1HA 2OLEA 4RU1A 1J2RA 2OGWA 2R25B 1NQOA 2K4MA 2Z3ZA 1HYGA 5H3HA 1HMYA 5KTMA 5KYKA 2Y92A 1E1CA 3B89A 3KLNA 3E9CA 1RRGA 3PRYA 4G1FA 2CYBA 4MI6A 3L0DA 4DAEA 3EYWA 3EPJA 5CXSA 3DKVA 4LXGA 2WPDA 2J5KA 3LQRA 4P54A 1SAYA 4QDXA 1KTIA 1DKMA 1KBZA 1Q1EA 5LYJF 3EEOA 2JGMA 2XJ9A 3FM9A 4NMLA 1RAIA 1JFSA 1X87A 3CXUA 4MKFA 4PYLA 5BYBA 4URHA 3MRVA 4HWPA 4URXR 4V2IA 4X1KA 3GDFA 5BV7A 5EGNA 1N5KA 4U7TB 3QELB 2BKEA 3DP9A 3QLVA 4G0UA 1E2JA 1TM1E 1NONA 4JJ7A 3EPHA 4EKYA 4HB2A 2Q1TA 4A6PA 2Q6TA 2O5VA 4HQ0A 4X44A 1PO7A 2VT3A 3KV1A 3UUEA 1ZH4A 3UJPA 1Z4JA 4DW8A 1N5LA 4U2FA 1QK4A 3KOOA 4B81A 4YAOA 2ERCA 4M0UA 2GTIA 3D4BA 2AW5A 4K2AA 5FFMA 3HADA 4IIHA 4POAA 4YLGA 4FWTA 2WKQA 4AJOA 4BTEA 2DECA 2JH9A 1RQ2A 3JRXA 3K0FB 1E2UA 4RHTA 4PZLA 4FU0A 2XZTA 2ZJ2A 4MYDA 2I8CA 2HSEA 3C3CA 1V11B 3TECE 3Q10A 4V38A 4X6LA 4EKDA 4Z6KA 2AYXA 3BHMA 2WKWA 2Z43A 5DTEA 4US2R 2J46A 4FQ8A 2A3NA 4JB2A 1VRCA 3H5LA 1NQTA 5GQSA 1NNI1 2NN3C 3BBLA 2HMAA 4BECA 3HXOA 3GOQA 3L6RA 1YZVA 1IQ0A 1WCXA 3BL8A 4NJEB 1YASA 1G20E 3ME5A 2J9XB 3AB3A 3H2ZA 5BW6B 2H07A 5ALLA 1NBOA 1YTLA 2CVFA 5I4KA 5FL7A 5KAMA 1B15A 1JT9A 2TMDA 3CUKA 3QVJA 3IEIA 4P5EA 5ECGC 3OT4A 1KF0A 3RWMB 2XUDA 1SOAA 3T0FA 3A3YA 4PTYA 4U5QA 1D3AA 2RK6A 2W2XA 3Q88A 1M2OA 1YBHA 4Q4LA 4EZEA 4N8EA 1JEJA 1KEKA 5JQGF 1DAIA 1ZH2A 5F7OA 2X7XA 3UWPA 2PE5A 4W1SA 4BIIA 1C0LA 2SCUA 3EVFA 3IGFA 4HLDA 2EHDA 1EHYA 3L06A 4LV5B 4HJXA 1AVTA 3U19A 1QU3A 1FRZA 1CZLA 2WQZA 3LRPA 2I1LA 5HJ7A 3LTNC 3FFTA 1F6DA 1Y3DE 5HMMA 2XIJA 1YDGA 3AZOA 3ZDEA 5BYAA 3ZV4A 1V47A 5B7NA 4EJSC 3FLBA 3PUKA 3QY9A 4ZIRB 5HIJA 2B0JA 1CJMA 4OVKA 1XO1A 4RWZA 5KNBH 2QQ0A 3S8YA 1WPRA 1A3CA 3LDAA 4WA8A 5B1EA 4XDYA 1QP4A 4RM3A 5BMOA 1GRRA 1QX4A 2HXYA 2XQIA 3AG5A 4J16C 5I7FA 1JIIA 3F96A 4ZQGA 1NVGA 3MBIA 4DRZA 9GPBA 4E1AA 4KH1A 4RJJA 3ANNA 2BLNA 2VWPA 2O57A 1YU6A 3ZTWA 1NW6A 5ELMA 3SYTA 3U4QB 3ZQKA 5AI9A 2EP8A 3KO8A 1U0JA 1MA0A 1PKXA 1GSHA 2PLRA 4GT1A 1HF3A 3VR3A 4E5PA 4QG3A 1NMYA 5IXJA 2Z9BA 4HC4A 4QELA 1CY7A 2WE8A 2CBXA 4REMA 4Y6QA 5DYTA 3UXYA 2QV7A 2RGRA 3MT9A 4FNAA 4L2IB 2YHUA 2I7XA 4I9NA 3B9BA 2QMOA 2YMLA 3BXPA 4R1TA 2B69A 2XKJE 1H0KA 2H92A 2QRNA 1NVWQ 2BCEA 2GO7A 1WA5A 3BMQA 1IMJA 2G09A 1JPJA 3JQCA 3KHKA 2YY5A 2AEEA 4H7EA 1NLMA 5IBCA 1K68A 2FOXA 4JLSA 4YCBA 2X76A 1FDUA 1PFYA 1PR6A 4TUYB 1A69A 4Z9BA 2ZBQA 1KAHA 1NMZA 2J41A 1DDOA 2MSCB 1JIXA 4GS5A 4R4JA 3L1IA 5DU2A 5FWXA 4KAAA 2ZUEA 2I3BA 4B35A 2QGZA 4BATA 2ZSFA 1C8VB 2PYIA 4YRMA 4R41A 3WDSA 3T0IA 2YZKA 4LZWA 3E1GA 1F3OA 3HDYA 2FPIB 2BGGA 2M1ZA 4O2AA 2LTAA 2C5SA 4MQEA 2BFPA 2HMTA 1YZGA 4MKRA 1HZZA 1QOQB 4G2NA 2H63A 4DA8A 4KPGA 2XUZA 3HB0A 1WOMA 2RCYA 2XDAA 4FILA 4WXEA 5D87A 2QPAA 3MERA 3NWJA 2PD4A 1EUZA 1Z8NA 4HQRA 3HXLA 5SV2A 4RADA 3PFFA 1P1JA 1YU9A 1BS1A 4AX8A 4ZWNA 2WIKA 1KYTA 3QX8A 2D4HA 4F85A 5KTOA 2PVSA 2O59A 3WV5A 1Q22A 1XVTA 4JBLA 5IDVA 3M6VA 2HA2A 2NVUB 4AKGA 3D59A 3L18A 1PT6A 4A6XA 1NFQA 3PWSA 4Q3LA 2AR7A 4RENA 4PC1A 3SPXA 5B55A 1PNVA 1E0KA 3BRSA 1OXXK 1E1NA 4H2DA 1RLOA 4Q5IA 1BDJA 1P73A 5LYYA 1T9HA 1ECJA 8LDHA 4MQ5A 5BQPA 1L7VC 2V03A 1XDDA 1WDKA 3CRMA 3NOOA 5TGZA 2W2VA 1TJNA 2PKWA 5EUCA 1YC2A 4UM7A 5JFTA 2YDYA 4IDOA 1NTOA 1IWPB 3E1SA 4KC0A 2CNWD 5JFOA 2OHIA 2OM6A 4BX3A 3HI6A 1AGXA 1YHNA 4RTJA 4DXDA 1FUIA 4V1CB 1XG5A 1IFXA 3OIVA 3L82B 1ISIA 4JY7A 3H2BA 1SUCA 4QJ5A 4B17A 4F2HA 1TCBA 1DWOA 2R9VA 4IMJB 1ESMA 1FS5A 4D3FA 4E09A 5JSKA 4EW2A 5SYNA 1TJ4A 3C3XA 1NW9B 4DLTA 4D02A 4YPFA 4CTJA 3IAS6 1D6MA 2R7NA 2DWOA 2A9JA 3AWIA 2YRFA 1EK2A 4CPDA 1AK1A 1H0SA 1EWTA 1JDSA 4PZDA 3W5BA 1P7WA 4WSOA 4BUZA 4RLQA 3ZJ4A 4UJ5A 4W9MC 2UYHA 5F4BA 2ODEA 4EUKA 1VBMA 5FUXA 5K8UA 3THOA 4NK4A 2WWYA 4HUJA 1XJ0A 2XODA 4MUXA 4WPGA 2Z1MA 2YVLA 4LBVA 1DQPA 3VNBA 1BHO1 3H83A 4MVJD 1JHRA 3I9V1 2LE0A 5T4BA 4UZEA 1WS6A 1HORA 2OD9A 2Q1UA 5E4FA 3NYRA 4FWIB 3K8OE 1YR9A 4JEMA 1CB0A 4NBVA 3A9WA 3U13A 4BLWA 2FDXA 5BRAA 4V0SA 3KQPA 2JFNA 4CKWB 1KERA 3I4CA 4FZ5A 1R8YA 2DR2A 2EJCA 1RYFA 2C94A 4LJKA 5G1PA 5LOVF 1MH9A 1RLJA 1YL7A 3EEIA 1H3EA 1GPLA 3A6DA 3E35A 4FNMA 5ALFA 4ZZ3A 4RF2A 2JHCA 3FNFA 4DZRA 3BGIA 4ZAWA 2Z57A 3TKLA 2H9AA 3ZE2B 3QVOA 4FLEA 1XD2A 3UOWA 5LL6P 1OB2A 4I8XA 4JBHA 4IX9A 4P3XA 4IIEA 3RW9A 2HBQA 3HN7A 3L3BA 4G9EA 5CDYA 2BFAA 3KQVA 4EHAA 5CHEA 1R15A 1RIIA 4Q7MB 3H9JA 2PGNA 2WHXA 4PIVA 4QDKA 4YONB 3O1JC 4AS2A 4KNYA 1UFRA 3UICA 2BGUA 3JYNA 4D0SA 1Z39A 2JG3A 9MHTA 1TADA 2YH2A 2I4OA 3INNA 3GZJA 1JFLA 4MYRA 2FWAA 1XCLA 2FSSA 2BFEB 1QBKC 1ZN2A 4MUGA 2ZRLA 1ONSA 4X90A 1TVMA 1G2PA 2Q3JA 2EDCA 2XNDD 4H3SA 4ZYZA 1FRVA 4CMCA 3OQJA 1Q1NA 4ZYVA 1OFVA 4W5WA 3IAXA 4JI4B 1YQXA 3DC7A 2QMHA 1ISHA 3WWCA 5BQXA 2X8AA 5ANRB 1FLAA 5JYEA 4Q3AA 3RROA 3HVJA 1U28A 5KJFA 4UBOA 1GZDA 4FE3A 3D8UA 1CUZA 1R88A 1T3SA 2SKEA 5AXCA 5SYAA 4HDNB 2CMDA 4HPJB 2H85A 4LDPA 4Z9XA 4AJLA 2O1WA 4EA7A 1N2HA 3GAMA 3GFSA 3I09A 2FSUA 2PTHA 3SKYA 4N5LA 4D3DA 2OFFA 5EZYB 1JHMA 2H0AA 1P1HA 1QGAA 2QN2A 3PHBE 1HQYE 3KQMA 4HDOB 3I1IA 5A9RA 1FX0B 1BAPA 1XNHA 1RXSA 3EWNA 1TTHA 5CP8A 1UP4A 1R3DA 2J9GA 3LVBA 3Q7QA 4F72A 4JV5B 5M29A 4Y1RB 1QNLA 2VJCA 2P3LA 4WLNA 1K5GA 4QECA 4Z5XA 1NBEA 3OTOB 3AB8A 1JFFB 1Q17A 3EZ6A 3ITEA 3ZCRA 6CHYA 5FBRB 3WSVA 4L3VA 3U3DA 4A0GA 3MGBA 3GPBA 3O31A 5ITSA 2GEFA 4HWGA 1X7YA 4KWHA 1KZ4A 2W6NA 2XB4A 3NPAA 2QPOA 2OAP1 3O84A 2NXCA 1RM3A 2FW0A 2P2LA 2GAOA 2LD4A 3DDNA 1GQOA 2DTXA 4CLXA 3ILHA 2FZCA 1QPBA 3CLUC 1W85B 4Q34A 3AP1A 2PS9A 1PR9A 3I37X 3ANMA 2OLJA 3ZVLA 1CDZA 2FSHA 3HYLA 4RK7A 3IBYA 2QVYX 1OA1A 3PXAA 4YRLA 2YFYA 2IEAA 4EZBA 4C0SA 1AKNA 4HV4A 4LVNA 5G1NA 4S35A 1NC3A 3MINA 3HFSA 5KYNA 2BP7A 3BMNB 1VE9A 2TECE 1PFWA 3GEPA 4REQA 1ONPA 1SCKA 4A2PA 2RAPA 1HDRA 1CPYA 1J97A 2BCJQ 2YOHA 3BHNA 3FDFA 1U6JA 3LGAA 2IW3A 3QLJA 4J0IA 2NPFA 1IVYA 5HM8A 2G9VA 2VH5R 4MTLA 1NXSA 4DSUA 4EHJA 2AHRA 3M6MD 3M4YA 1E9DA 2I7VA 4QUBA 5GM1A 4P3OA 3ZDFA 4DMKA 4ZPJA 2MYNA 4WFQA 1CIVA 4J2OA 1ONOA 1YSCA 2VJMB 2PXXA 4X6XA 3NC1C 2PKQP 1TMKA 2YWFA 3H04A 1K5PA 2G04A 1G7RA 2Z0MA 5H59A 2CXUA 4TMYA 1XR3A 4N3GA 4XQ0A 3HUEA 3KZVA 3K35A 1QZ3A 3JQ7A 3L1KA 4URZR 5HVNA 5FBZA 3MJRA 4MRPA 4IIGA 3WDMA 4QGFA 1CJSA 2WD9A 4NH0A 1IN7A 1X80B 4B40A 4RMNA 2W6IA 4NMMA 2XKKA 3ROKA 1PS0A 2AOUA 1HE1C 2DBZA 4HLUC 2AFHE 5K6RA 1P77A 3PQ2A 4ZICA 1WR8A 1CUSA 3QKRA 4L4YA 1J00A 1FXUA 2G36A 4DEVA 5DTQA 2X0DA 4CE6A 1WZUA 4A10A 3EPKA 1PJLA 1OXTA 4RDCA 1YJBA 1KI7A 4K3VA 1DGQA 1ULHA 3CW8X 3PFHA 1D7AA 5FD8A 2IP1A 2IW1A 4RTNA 5A62A 3EVDA 2PKQO 1C1DB 1KVRA 2J0UA 4PAWA 3RC2A 4D9KA 1YUBA 1JQBA 2AEFA 2Q21A 3CCBA 4MIKA 5DX0A 3S27A 1Z5NA 3WLMA 1LS6A 2NZVG 2YN0A 3ZLJA 3P97A 3GBPA 4XJTA 4P5PA 1J6UA 1JFRA 3OZTA 2V59A 1A1SA 2H2WA 5FKJA 2Q6OA 2WDZA 4BUJA 2F8SA 4YMIA 1U5BB 3FWPA 1ZOIA 3CZPA 2IXTA 5CX1A 3CLTD 1O9BA 1JKXA 3KS9A 1N2XA 1H2WA 1HE3A 3H5WA 2H5LA 4C7MA 1ZVVA 4BOYA 3TZHA 3B8HA 4MYCA 2V5UA 5HFAA 2WWRA 3ZIAA 1V7PC 2A0KA 1UPUA 2PMBA 4I55B 2R6GA 1BKSB 1JA1A 2XI4A 4LOIA 3H5OA 4OBBA 4WBSA 4EYGA 1YS6A 2P1RA 1PZFA 3Q7TA 4JSRA 4BAUA 5BVHA 4AWBA 4EGSA 1C0EA 1H4SA 1V45E 4RSRA 3D2BA 1GY8A 2OP1A 3JAKB 4JZYA 1NBMA 1XNGA 1EX9A 2GN8A 3LIIA 4M55A 3IE0A 1J9ZA 1FFBA 1M1NA 2JFFA 4L16A 3CMCO 3NUQA 3RT1A 1U94A 3AESA 4F6LA 2F9FA 4Q7QA 1N1MA 2D8MA 3HJNA 5MN6A 4MVJG 1VJ1A 5CPFA 2HJSA 2JPDA 3FHCB 4XWTA 3J80A 1DKUA 4GWLA 4MTCA 2GZ2A 1L7PA 3GUUA 5H80A 1G8PA 5DW0A 5KZMB 1MLDA 3DQPA 1UDAA 3R44A 1SUDA 4X1IA 1NUSA 3RSOA 3PEWA 1JE1A 2ZVQX 4IFTA 4BLUA 4NECA 2Z30A 1YZQA 4NONA 3EFHA 4MRAA 1Z74A 5EMMA 2EP7A 2H2AA 3BFKA 3MTQA 4HQLA 3CC8A 1OUMA 2WSLA 4ROSA 5ECWA 1U2TA 1DBSA 3ZDXB 3LXRA 2OSBA 1XA4A 2C59A 4PS0A 5LDGA 4CDRA 3MLAA 4G5RA 4I14A 1DO0A 1GFWA 4IQFA 2C58A 5AOAA 4B3XA 5F98A 2Z98A 4MRVA 4OXKA 5E7IA 4XSGA 1HUQA 1ZC4A 3O93A 3CZ5A 2WM2A 3QIAA 4TPKA 3RJZA 4S0ZA 3R4VA 1HPLA 3TL6A 1MV8A 3NXKA 1SQ0A 2IDMA 1FFWA 1DBPA 4DMGA 1LDEA 1Y6ZA 2P8SA 1UC8A 1E9EA 3KUKA 3PYLA 4GG1A 4C7OA 4N8DA 3VU0A 3C16C 4KQJA 2QAGA 4H0NA 3HJAA 1YBMA 4NZPA 2HDNB 1BHSA 2QRHA 1WEKA 4RNCA 1MXHA 3C39A 4W6QA 4XARA 3ROMA 1L5MA 1MIOA 4LFAB 1PGQA 3ZJ5A 3NHYA 1EWYA 1RWPA 1NW3A 3JQFA 4IIVA 2OHHA 3VSDA 3FOBA 2EHJA 4YJKA 3AR7A 4HTFA 3MBOA 4CR7A 1VKHA 3H1BA 3O91A 3P4YA 2QLNA 3QJ5A 3GRFA 4MS4B 1QJ4A 2E48A 4BNZA 1TUBB 2CE7A 3QBEA 2H06A 4LZNA 4X63A 5HF5A 4WD3A 4DLWA 1KEPA 2GZDA 4EK9A 1RW4A 1GSIA 1PD1A 3GLUA 3Q2IA 2DQZA 1TECE 3A1WA 2AC7A 2XPCA 3LC2O 4HNUA 2SBTA 4WW0A 2I2XB 1HFEL 3E8MA 4M87A 2JGLA 3QU9A 3CLRC 2Y77A 2IXBA 1BWPA 3TNLA 2DPMA 1WKVA 1DXQA 2BM9A 5DHAA 3LUFA 2VAMA 4KR9A 5EP2A 3GP8A 2Y66A 2ZITA 4L51A 4M1KA 1RRCA 2Q29A 3AEUA 3CV3A 4FBLA 4KG7A 2AMVA 2CLSA 3MJHA 4FT4A 3A31A 4MX8A 1X8LA 1P4GA 4RKRA 4WEOA 4CFYA 4ZGGA 1DLJA 3V8VA 5K0SA 4LPKA 2HSGA 1D0VA 4PSDA 5KQPA 2WP0A 2LNDA 121PA 3WWOA 4JXXA 3FVWA 3KEQA 3KYCA 5AXAA 3UWKA 4PFJA 4PYQA 4XIYA 3T9BA 1U1GA 3A2NA 4I8IA 3VMMA 1I7SB 2IIVA 4CMHA 1XI2A 1KH2A 2PAFA 3GLIA 2JFWA 4DLYA 2F9MA 4RVDA 1IJBA 3P32A 1X3SA 1XCMA 3GMIA 5DNYB 3VTKA 3OJFA 4IOLA 2IQ5A 4Q9AA 2QG4A 3OKAA 1ML3A 2OYSA 3P9KA 521PA 4B3SB 3AC0A 4C0WA 2CUKA 1V3TA 4NXMB 3W5UA 1XZHA 4JUIA 4RK6A 3L8CA 1DWUA 3FOWA 4BL5A 3G79A 3P9QA 2LIVA 3JWEA 4MXDA 2B3DA 1J0DA 3EEYA 2ABWA 3PQFA 3B7GA 4HGRA 4BTLA 1DAFA 4XA8A 1FTWA 3ZHCA 2A5FA 4IUYA 2ATIA 5K0BA 3PXXA 3ZE6A 5CDUA 3O5AA 4FKBA 4CLRB 3FSGD 4YBRA 3MGAA 1W36B 1E69A 4WK2B 3RTEA 3RYTC 1X8JA 1LY1A 4UATA 3E7DA 4CQLA 4MRMB 2WWGA 3WGQA 4J4TA 2QTAA 1ISRA 2XZPA 2JI8A 3B1FA 2W2NA 4ENRA 5DW3A 4YP0A 1DV2A 4X8HA 3NM6B 1EB9A 4FFNA 1KAGA 2J9FB 3HB4X 4DOMA 4YPVA 4BAZA 2ZJAA 4L02A 2XD9A 3LLMA 1QR6A 3TUZC 5EFZA 1M6EX 1ZMXA 1TMGE 2VUHB 3GPIA 4D0GA 4TTAA 2LDXA 1OR8A 4DDHA 1UZAA 2KSQA 3L05A 3GLVA 4R84A 2GK4A 4G0NA 3SNKA 3W05A 3TSCA 1YJ5A 4ZI5A 4DMCA 4TVKA 4OXYA 3X1JA 4B83A 4FFBA 8ATCA 1UEIA 5FWXB 1KJNA 4RC9A 2G1AA 1J8YF 2UVQA 1AS3A 3OOSA 2C92A 2I3ZA 3BN3A 4NCKA 2V96A 3SS8A 2V9CA 5DRTA 3QRWA 4JI2B 1W30A 4J4HA 1TUEA 5TMDA 2A78A 2Q0HA 1E1QD 4BE7B 1MTOA 4QEDA 3LQ2A 1U5CA 2FLVA 3IUBA 5A3QA 5JCOC 1UJMA 3ICOA 3UQYS 3CS3A 4MUJA 1VHTA 4O2AB 4ZVPA 4ZDKA 4C4TA 1FZQA 2ONJA 1IY9A 5EMKA 3AW9A 4GE0A 4X7PA 3N0VA 2F3RA 3ETGA 3EHEA 1KVTA 2ZRMA 3KR2A 4IOKA 3RAGA 3BWVA 1Y82A 3FX2A 1SBQA 1QKIA 3PHHA 3BIJA 5IYZF 5C4GB 2QKYA 3I9FA 1SEPA 3QFSA 1C7IA 1TVKA 1DAEA 5AKHA 3L7JA 1U7HA 1EIWA 3HR7A 4JP2A 2XQGA 1JI0A 3CA8A 3TCKA 3GUZA 2JFGA 2AQ8A 2DPGA 3Q8MA 2VF8A 1G20A 2C4MA 5DVZA 2CUZA 3NBAA 4XR9A 1FMTA 2G7MC 2ORYA 1UBHS 1KEUA 3B13B 3D81A 2DFLA 1DIBA 2PO5A 1BCSA 2JL1A 3E2PA 4S1VA 2QE6A 4M22A 2PJUA 3E61A 5CHYA 2YWXA 3B3GA 2NOAA 2VJAA 2RHTA 4AY4A 4HG2A 1DG1G 4C22A 1B7GO 4RACA 4JI5B 5FLXA 3STWA 3I9NA 4E7PA 4EHIA 1QGED 4CL3A 4L9AA 1N7IA 1NUPA 2QLBA 2ZAGA 3TI7A 4AKTA 4Z4HA 5AM1A 2GILA 1XK6A 1SBCA 2JCSA 4ZZ2A 5ETJA 1I2CA 2F90A 4AT1A 4OBXA 1XPJA 3K31A 2YYSA 4PRLA 3EHDA 4XE5A 4UTOA 1HEYA 1MC4A 1OCEA 5IZCC 1U8FO 3MQ2A 3AHHA 1WPXA 4GGPA 3KETA 3G3EA 4RHUA 1DDIA 1E4YA 3RS8A 1N2SA 5HKOA 3DFFA 3IIJA 3EC7A 2Y4NA 2X0RA 4NBUA 4BZQA 4K2HA 1C9MA 1KYIA 2EDAA 2XB6A 4JLDA 4OHMA 1P2TA 1T6BY 2I78A 5C1PA 3SQLA 3LFTA 2GMWA 4DUYB 1ORHA 2JCGA 2M6RA 5A3SA 3M6AA 4IG4A 4O0LA 3BJZA 1Z38A 3L0PA 1W35A 3OOWA 4LWZA 4XPZA 1N5MA 1JEDA 1PX0A 3U7JA 1K9SA 1PV2A 5BYKA 4J43A 1UPBA 4KVGA 1TAGA 2C4KA 1I1NA 2ZANA 3AHGA 1YOVA 4J16A 3CNNA 4MV5A 5ESXA 3PDIA 5EZ5A 2A8YA 3R9IA 5JW6A 1DZ3A 2C98A 4L5IA 1OFTA 1HE4A 4UVEA 1KOLA 3UJ9A 1AKVA 5ADHA 4BCDA 3GJXC 3RAEC 1NUHA 1T0JB 1FL9A 4HWRA 4QBIA 3O8RA 3GRVA 4NXNB 4JJ8A 4I6JA 2RGBA 2VFAA 3D8BA 1Q1ZA 3DTYA 4AVYA 1PS8A 5CA1A 2NZ8A 5H3LA 3GCGA 4OO3A 2IYZA 2PTGA 1OVGA 4CNBA 2IIQA 4CQMA 1E4EA 3T4XA 1LX6A 2WVGA 5FEMA 4B4WA 4Q4CA 2P5SA 3JR7A 3C1TA 4DBLC 2REBA 5C8YA 3AR3A 1XD2B 1TT7A 4I4TF 1G8FA 2Q5LA 4BNXA 5JRZA 3CN9A 3IRUA 4LHWA 1NUUA 2GCOA 4UUNA 2ZP1A 5E7QA 5KTRA 4EAAA 4IDQA 4J1SA 3UB4A 2IEIA 1UWLA 2ZIAA 1TVCA 3LVQE 1R6DA 5ES3A 4AN0A 2TRSB 4OB7A 4G8JA 5AJHA 3UA4A 4FD2A 3JYLA 1U8XX 5ARDA 1ZA1A 4KXVA 2ACEA 3UUFA 4DBLE 2BDUA 3A05A 3BE8A 2J33A 4K9KA 2I33A 2J7PA 4CG2A 3NDJA 1S89A 3DAGA 1OBOA 3C7KA 1UR5A 2TMGA 3AUYA 3HZHA 3ZK9A 4BEVA 2ODWA 3F3KA 1K3UB 2A9KA 1LV7A 3KT8A 2C5HA 4YROA 4RTPA 2CF6A 3BULA 4D43A 4BWFB 1E61A 3HU3A 1DEOA 1TM4E 1BNCA 1K6JA 3GAAA 2J4DA 1SKYB 2IHYA 3G6WA 2O4CA 3FAZA 4QUDA 4RD3A 3MLBA 4G26A 4U7PB 5CIWA 1PYOA 1ZRNA 5C1BA 5IJ9B 1DBIA 2CMGA 2PZ8A 4IIJA 2J32A 1IHUA 2QQGA 4P7JA 3V7FA 1L5QA 5AP9A 4YN3A 1DV1A 3SEFA 2RBEA 1FA9A 1HK7A 4GHWA 1W0KA 5ELLA 3RVKA 4OHOA 1V5FA 3KB2A 1KJYA 1QIMA 2YINC 1T0BA 3K30A 3I72A 4I1IA 3TZ6A 5THXA 1FZTA 3AHEA 2HDHA 3ZG6A 1Q0TA 3IJRA 4FB4A 3G7SA 3G9UA 1P1FA 3WYNA 1IJFA 1YL5A 2IZOA 4MKHA 1L1EA 3WDLA 4AB1A 1XZNA 5CYOA 2H0RA 3SBDA 2VBIA 3EMDA 1T5HX 2B61A 2VHYA 4CNQA 5EHGA 1UKVY 3F8WA 3IPXA 3O03A 3A58B 2WSSA 2O0JA 4GYKA 2ZUSA 2B20A 1KORA 5EHQA 5GIPE 1MW9X 5D1HA 3T1VA 4D92A 5H7XA 1FNCA 3F2VA 3HCFA 5JYCA 4AQ7A 3QVKA 2DUNA 3MB5A 5ELXA 1AUOA 3KOUA 2W98A 3LBAA 1WUIS 2PMCA 4YCSA 4O63O 3WGNA 1U3UA 3QKTA 4GOMD 5F1PA 2J07A 3GD7A 5C0OE 2QN6A 3MGKA 3PNYA 1CETA 1Z88A 2GM3A 5D51S 5E8JA 1DXHA 2DFPA 5AW8A 2JKZA 2V6IA 4Q7JB 4UBIA 2FSVA 3K92A 5C52B 4O2BB 4ZVLA 1CDEA 2WUFA 4PAMA 3UAZA 3U7RA 4EEXA 5HDBB 1Z36A 1LU9A 4O4JB 5KINB 2O2EA 1ZLYA 2ZB2A 2J3DA 3PQDA 2XGSA 5DI9A 2QR3A 2OZLA 5NLLA 7REQA 4GPEA 1KDRA 4QYIB 4EHFA 5KBYA 1KP9A 1CQZA 4CM3A 4O4HA 2JFPA 1Q0PA 4MGHA 1SXQA 2I34A 2MINA 3FWYA 2A5JA 2BM1A 4S1TA 4URVR 4MVJE 2BM8A 4K1XA 2CDAA 4JUBA 5H16A 3BTVA 1VGVA 1V1JA 4NMXB 3G1TA 4RLSA 4RIIA 3WX0A 4KN8A 4H1TA 2IITA 4E70A 4TS3A 3DBLB 3OTQA 2I7CA 2P6PA 1NPTO 4HGZA 2ZJ1A 1MN6A 3U44A 2O23A 5CM8B 4OOEA 1LXCA 2DRIA 5JROA 5C7YA 1SXJC 3A1DA 3MAJA 4LRYA 4HX9A 3ZZUA 1EX6A 1JKMA 4AURA 4F84A 4BWGA 1AX9A 3HVRA 3MFQA 1W48A 3NORA 5DNAA 4U2DA 4BJ6A 4TTSA 2YYAA 1GNRA 1ECBA 1RC0A 2AOUB 2GO1A 2RHWA 3OC6A 4A2CA 2A1IA 5HMLA 1T6YA 2XGGA 1GCIA 1YZNA 2V6JA 2X4IA 3HFGA 4KXYA 4Y7CA 4XSHA 3RIGA 4CW7A 5K8VA 4N82A 3E8XA 2VQEB 2D7CA 4KX5A 1Z6PA 2BKLA 2HK7A 1EPUA 2DT8A 4NNJA 2ZUBA 2OO7A 4HLQB 3CPJB 4EWLA 3PQ4A 3T7AA 2DQSA 2O3SA 5DNCA 4OK5A 1T6XA 1R18A 3CIFA 4YMTA 4ETMA 3MAGA 2J0UB 6REQB 2G07A 4TSKA 2UZ4A 1QZXA 3RVDA 1UAAA 4D5GA 4ZZ0A 2PZKA 1JLSA 2C3YA 4ONEA 3BKWA 4Y9DA 4A82A 1L9KA 1WQ1R 1M6VA 2B4YA 2J3QA 4ZHQB 1VPWA 1WLSA 3OU7A 1W94A 4RFLA 2TMYA 4LF6B 1W46A 4RGVA 1WD7A 2VK4A 3S7TA 1UWVA 3HJBA 4D57A 2P79A 1N3IA 4IW3B 2RHDA 3HI4A 3H19A 4EW1A 1QFMA 2BD0A 3ID6C 1FXSA 4RNDB 1Z6YA 3FYHA 5KQGA 3MWGA 3IOMA 3HKEA 4OU5A 1NWCA 5BVHB 3QLUC 5CFOA 5H4GA 3DL4A 4RLHA 1L4LA 1XN1A 3WRYC 2FK8A 5KDOA 3UZUA 1QIFA 5LXTF 2PUDA 4MULA 1MX3A 4IX1A 3AESB 3HQ4O 3MCVA 3FPBA 4WZ6A 3WO1A 4MYTA 5JD5A 2IOYA 5MFZA 5I9TA 3LLUA 1RBMA 1RWVA 3KWMA 3R3XA 4AY3A 2CDRA 2DLCX 3KVNA 3PUJA 2V7UA 3M70A 3ENVA 3F9IA 3OCWA 3VO2A 2GASA 1X70A 1HC7A 1VCNA 2OZPA 3IA7A 1ADYA 2I4IA 1TZKA 2QHXA 4X1IB 4TSRA 2XXAA 1KMCA 1P2FA 3WBBA 3ZBPA 4XVUA 1C3LA 1GN9A 1S2LA 2XTAA 4EECA 3JARA 1PDOA 2J3EA 1OY1A 1A9OA 3T3OA 4L4ZA 3I42A 4NCBA 3TFWA 1YRAA 4BVAA 4LY6A 2HF9A 5I7EA 4Q19A 1RZ3A 3A6FA 4QWMA 3TIFA 1CHDA 5IHXA 1G3RA 3BYZA 4JMPA 3VZDA 1VIDA 1E3LA 2G70A 4U3JA 2IUFA 2WU3A 3VI4B 1IE3A 4DC9A 3DM5A 1I4TD 2VNSA 4OXRA 1AA9A 1T1GA 3QQ5A 1QGDA 4XD7D 4B4KA 1UKZA 1XLVA 4C1NA 3JZFA 4UHEA 5JAMA 2FRXA 2RSLA 1QPGA 4YQZA 3RVMA 4W5NA 5GONF 1NQ5A 3BJMA 3G68A 3GUVA 4X7BA 4OLJA 3GY0A 5TV2A 2AZ4A 3WMGA 1KARA 1Q15A 4RIGA 2GR9A 2PZEA 2UYGA 1XF1A 2NU7A 3K2EA 5AUQA 1MIOB 1VL1A 4KAJA 5HIIA 3V4VB 4OMUA 1QG0A 5ALDA 2IT1A 3PD1A 4QXOA 1LBQA 1KJ9A 2AFHA 4JXKA 4LRTB 2CN1A 1SC6A 1AKQA 3O8OA 1AKEA 1JLRA 2H8KA 4X60A 3G82C 3INGA 5HZGA 3F97A 4O02B 4OYHA 4NQRA 5JAHA 1EBFA 2EV9A 4EPWA 1KZHA 4FZJA 3LP8A 4PLHA 2DERA 5GJVC 5CJ2A 1RHKA 5IKXA 1G18A 2CNOA 2WAOA 4N0DA 3QSYA 4IJVA 2C2GA 2M6SA 1D2MA 1J20A 1J2JA 2A14A 1T43A 1I33A 2ZR0A 5CLQA 4EPTA 1U9IC 2NZWA 1J21A 5K09A 5K3OA 1SOUA 1P9WA 1AE1A 2P4EA 1ZI6A 1R8XA 3MF4A 1OV4A 4I99A 4C08A 1Y5LA 4R7ZA 4HDRA 2JIZD 1OQAA 2AN9A 2I3GA 4DA7A 4ENTA 4JD5A 3UHAA 1T26A 2CJPA 2CW5A 4MVJM 2VTKA 1V95A 3N74A 3N7UA 5EE9A 1O0CA 5ARCA 1MQSA 2KYRA 4DQVA 1I3KA 4MLPA 4KN5A 3VC2A 1O89A 3AUFA 5CDSA 3CZQA 2GCEA 4PRYA 1DC4A 3HZZA 4MINA 4WLVA 4XQGA 4Y1EA 2DVMA 5ED0A 2ZE8A 4OMDA 4EMUA 2B5WA 2R1VA 4UTVA 4ZI7F 3K4HA 4GRAA 2AXNA 2VJYA 3LHSA 2GYYA 2A7XA 3ESAA 2Q62A 4RFVA 1DTSA 4RA9B 4PANA 4EFKA 1U0OC 4PSAA 5FO0A 3T7SA 3VU1A 1T4MA 1I01A 1PJAA 2ZYGA 3K72B 4CFZA 1WLYA 4JBNA 3H2SA 4L8FA 2RDMA 3GF4A 3LDHA 2OBFA 2RCNA 3AHCA 1P91A 3U3RA 1ORDA 2H59A 3W1EA 3NHPA 3PFIA 2ORED 4HVTA 1Z34A 4RTLA 4CQLB 3T3HA 3V7UA 2OCLA 1MEEA 3UJ3X 5C7IO 4ZOLF 5C2JB 3IEKA 1WUTA 2CFTA 1VPDA 3DAYA 5JTUA 4L72A 2O2IA 3MCAA 5AVOA 3FJOA 2XYQA 2R84A 1XKQA 3SKVA 1FUEA 1IIRA 2VUUA 3PHJA 3H8WA 4HH1A 2H9IA 5LP1A 2VSQA 1D7OA 5J2UF 1B42A 3U9SA 3ASVA 4QDZA 1BYUA 1OPXA 3L93A 1SEVA 1L5ZA 4DXHA 2W2QA 4PLTA 4ER7A 2NP6A 1NBWB 1QANA 3OMLA 4LYGA 3N0TA 3SJ7A 4KN9S 1HDCA 4ZQHA 4D96A 4YHHB 3C1AA 3PWTA 3MQFA 3SQNA 3WTCA 3KQHA 4S1OA 4R9NA 1KJWA 2B4QA 2XYGA 5AK4A 4Q1AA 4PN7A 4C0QC 1V2GA 5KKNB 1QVWA 5E7JA 3I92A 2E0IA 3D1VA 3NYWA 5AT1A 3WRVA 1L4MA 2QRKA 3IURA 3C3YA 2FLKA 3KJFA 2QU7A 3RSGA 2ZCVA 2WUWE 2XYVA 2FP4A 2YJZA 1ACJA 4RKWA 4M99A 1GSOA 1Z07A 3UOAB 1K7SN 2EF1A 5G40A 4A3SA 3FLAA 3GJTA 2Q9AA 2PUGA 2VP0A 2W6OA 3KP1A 5EL0A 3SXJA 4NFYA 2OUKA 4Y9TA 4TYPA 5B58T 3KPVA 2O8FB 4QTUB 1XPRA 2NAFA 4TYYA 3M34A 1SQFA 3U39A 4Y6OA 5E1OA 1GCGA 2A33A 2ZB4A 1Z2NX 1BCSB 3K6KA 3F73A 2YS7A 4I9UA 1JNYA 5CG1A 1QV7A 2OBNA 1KHTA 1ZCAA 4H6XA 2JBHA 3AUXA 4MCIA 1SD5A 3BL6A 4Q02A 1O6CA 1J0BA 4XGQA 1B16A 3MTDA 5AWFC 3WQRA 3WA7A 4KFCA 5DXJA 5JY6A 4FOSA 3MJCA 4FR0A 4DCMA 3NNDA 3ABIA 5C51B 1GPKA 1UJ6A 4P3KA 4K86A 4Y9UA 3K8YA 3TVDA 1UWCA 1Y9JA 4DQ0A 5BVGA 4BXOA 5KX5F 3AEZA 1O95A 1JAHA 2G63A 3SX0A 3I8SA 1EMDA 5JHHB 4NBRA 2IWHA 4MDEA 5FUYA 3LHFA 4TWIA 1XEWX 4EB8A 5CYGA 3HCCA 4MICA 5T41A 3OM1A 4E4TA 2DPXA 4S3MA 8ABPA 3K9FC 5CTJA 1JEYB 1J42A 1WTCA 1N6NA 4G09A 1HT3A 2FMIA 2JI6A 1NC1A 1E96A 3I2KA 3OT1B 3DMGA 5G0WA 2BKXA 3GGSA 4IM7A 1PJTA 4NYJQ 5DLQC 2QUKA 3LPLA 2XNCA 4A5OA 1SQ5A 3P52A 4B73A 1UP7A 4BVBA 3D5TA 4XJXA 3TAXA 4L6AA 5DSXA 5KTSA 2FUG1 5E8RA 3FZGA 3PQ8A 3GYGA 4ZQIA 1Q0HA 6PFKA 2GAFA 4OK6A 4EJSB 3K15A 1LRKA 4R2MA 1Y8QA 4EP1A 2RKOA 5KI6A 3OIUA 3JXEA 1HDIA 1Y42X 4GR9A 4Y1GA 5THKA 1Z0JA 2AG6A 2GXQA 2I6XA 4C7BA 1PJQA 4RYDA 3HA5A 1YOVB 2DULA 2V3CC 4JVOA 3BXGA 1EAYA 3HKBA 4AYWA 4DV0B 1OFIA 1XYYA 3VVBA 5D01A 4C7JA 1A27A 3KOMA 3QJGA 3Q7IA 4U6NA 1H05A 1YOBA 2V65A 3JRWA 1KO1A 4HN4B 2DTDA 2EFYA 4IHJA 1U3CA 4OJYA 1Z68A 4NNOA 3URMA 2Y05A 3ZI7A 3AUTA 2GM9A 2F4NA 4M1ZA 3IV6A 2XTZA 2L42A 3TSZA 1E2IA 2HK6A 3H1PA 3SI7A 3A06A 2YBEA 5IG2A 1E4EB 3OPXA 4YRJA 5JAZA 3X1WA 4GIBA 4L75A 5ITWA 2C0QA 4RVOA 4OL0A 1L9XA 2G72A 4MP3A 2GAJA 4P3NA 5C8YB 2JF0A 2D1QA 3EZ7A 3B85A 5ERGB 3NBXX 5K0FA 3N07A 3QE4A 2F3SA 3DO8A 4S05A 1NLFA 4M8IA 4AROA 2D3TA 2GKSA 3BRWA 1AKRA 2HF8A 4RDHA 4L5AA 3TR0A 5CITA 2MSWA 4HK4A 4JJGA 4OI2A 5CXXA 4OHVA 1OZFA 5BMVF 2YIJA 3LF2A 3ZWAA 1NIPA 4W8OA 1YAJA 2QAIA 4KIJA 4D4IA 4D9CA 1D8AA 2PD6A 2W83A 3NBUA 3QFCA 5KJ1A 4KWEA 1LCIA 1Q21A 3TXXA 2PUVA 1CQPA 4N0MA 3KEFA 1FBTA 2G4CA 2ZBUA 5CA0F 4KYIB 1ENOA 1H2FA 4ZO4A 2OQVA 1ZX1A 2QRJA 2QRUA 2F59A 4J91A 5AVRA 3A4VA 3ANSA 1T9CA 4YQEA 1AGPA 4MKXA 3R0JA 4QUEA 1XB2A 5BSKA 2HCJB 5IBQA 3QH4A 3Q12A 3GV0A 1RYBA 1TQ8A 1GRNA 2WVJA 5LQCA 2IRWA 1ENPA 3V7WA 1QYRA 2I67A 3W3AH 4P9NA 4E2YA 2AJDA 2BHTA 2ZIGA 2HEGA 2YV1A 4LMPA 5EC8A 3VSEA 3UGJA 1RMQA 2BEWA 1ZAYA 2VP3A 4N7MA 5KWJA 5ECDA 3TDNA 4HBZA 1Q1AA 4K81B 4A0HA 2W2PA 3EG9B 3L49A 4M83A 4MP6A 1RCFA 1GPJA 2FZ5A 1RJ9A 1KSFX 2BAGA 1USKA 2H4FA 4IDNA 1CUDA 1Z06A 1JSZA 3I5UA 1G9TA 2N42A 2C0PA 4X97A 2XDYA 2BI7A 2RGXA 1FFHA 2X2FA 1XVUA 4QTTB 3ZUPA 3U56A 4BX2A 2F3PA 1CUAA 4HGQA 4QODA 2A0FA 1T35A 1FFXB 5DHQA 3IQEA 5J4LA 1G5FA 3MS7A 1XEXA 1C3EA 4RJ2A 2EBWA 2FWMX 3PRJA 1MOQA 2C4UA 4M7OA 4V02A 5TQJA 1IG3A 3G6KA 5HOQA 4ISCA 4WZBE 1ZLXA 1Z6TA 3OPYA 2NUTA 2IYEA 4Z2YA 3KNZA 4LXUA 3B6MA 2PX4A 2YJNA 2AC4A 4LDNA 2BUAA 2R2AA 1CVLA 5A6VA 1BQ4A 2J3JA 3FMOB 1BO6A 4LWQA 1EGMB 4AJPA 2GF0A 3H97A 4CKZA 1Y1QA 4P2GA 2GKGA 2OM2A 5IS2A 2CZCA 4CGYA 2V8BA 3GVHA 1LWNA 3FOZA 1VYHA 4IDBA 4C6HA 4TL8A 7REQB 1YUNA 2D13A 4NJMB 4FBGA 5D8DA 4O4HB 5JBNA 2VQ3A 3AL2A 3ZWWA 4PONA 4PLWA 2C31A 2JLBA 1ZGGA 3C8HA 3H2YA 3L8DA 4UTXA 5DCUA 4DMFA 5JMWA 3HJHA 2UAGA 1ABBA 1TIKA 1XDBA 1ZMTA 2XHEA 3F4BA 3DV9A 3H5NA 4GZ5A 3GCZA 1NM5A 5CFLA 1QIIA 1KRHA 1JPUA 3LUAA 4D2IA 4L8WB 4ZJPA 2JGEA 3DTTA 2XD4A 1RQLA 1U9CA 3IQFA 3TLCA 4WMLA 2PQ2A 4REOA 2WUVA 3CVJA 4TKUA 1YFJA 1RPNA 2O2DA 2J87A 3WL7A 4DIKA 8AT1A 4WGGA 4C03A 1WD5A 2Q3DA 3ZGZA 3KQWA 2QMQA 3SDBA 3L7DA 1CJCA 1ZJ6A 2VRWA 2JC3A 3UK1A 4DLSA 3HEAA 5DWQA 1SK9A 3WGOA 4L9RA 2NO0A 4RD0A 4NI5A 1F7UA 2VT7A 3D6UA 3ND9A 2N3ZA 4TTQA 4BNWA 4YRSA 4HB3A 1AG9A 3CH6A 1A9XA 3TBHA 2IEGA 1E2KA 3CE6A 2DQYA 3U26A 1N4DA 3HMQA 3D7SA 1ZKMA 3GRPA 4RHCA 4BQRA 4YJ2B 4M9UA 3RYIB 3HWWA 4L4XA 2GK6A 1UJNA 1R7RA 3WWEA 1ISFA 1UXHA 1FMCA 1W52X 3ZY2A 5LR6A 4K88A 2BH2A 1LDGA 3PFKA 5FOQA 2DY1A 4QOEA 3VPBA 2IE8A 2XDQA 1M6VB 1NP7A 1UODA 2IU0A 3BDAA 2AI1A 3QBDA 1TT5A 1ZWLA 4FUQA 2ZTSA 4OB6A 4BRZA 1SHUX 3KQOA 3MJSA 2L19A 3LUBA 3DT6A 1PG5A 1ICIA 4TWAA 2BI8A 1FP6A 4MAFA 5K3FB 2JLZA 2FKNA 2PJZA 1DHRA 1LH0A 4U7WA 4LDRA 1RJWA 4E15A 3PENA 4BFLA 3PXDA 4B4DA 1B0ZA 1DG3A 2JAOA 4HDSA 3THYA 1ZQ1A 1XHFA 2VDJA 1JYSA 2HBZA 5EXPA 2ID7A 2QUHA 2ZRKA 1BFUA 3JRNA 1Y3HA 1Z8HA 2R3SA 4UVHA 1ZN7A 1GU7A 4B76A 5AOCA 1G41A 1VRVA 3DT9A 2AOXA 3OF5A 3HXQA 1JYFA 4GQBA 4RPHA 3T9AA 4E4RA 2KLHA 2OE2A 1QQ7A 2WSYB 3S2SA 3LLSA 3QJYA 5HQTA 3L8FA 3ZV5A 1HNWB 1NXVA 2C4HA 2XVYA 1PWHA 2ZDQA 3GFOA 3KB6A 4FJ2A 1HDZA 2P9YA 5FV4A 2GBCA 5JMTA 1Y6GA 5F4ZA 5HRCA 3LS2A 2JASA 3ZCSA 1ZGBA 1RWWA 3ZU2A 4MB0A 3VV2A 3WGVA 3TF5A 2ID9A 2UZ3A 1GR0A 4RDIA 3PXBA 4DTIA 4W7HA 3USES 2ZUVA 2B2CA 1W93A 2EOAA 3CX7A 4KV7A 4NZZA 2QI9C 3K9CA 4V1CA 1MHTA 2O19A 1IEWA 1FSPA 3FR8A 1OI7A 3I01M 3H1FA 1RWBA 2F17A 2B7BA 3I05A 3JQAB 4NOMA 3ZEAA 4CLDA 1D4FA 1Q1QA 4PHTA 3VPDA 4YJDA 1YULA 4YWHA 5A4KA 1VSQA 1G6Q1 2JAHA 3BWDD 1JIJA 3PSAA 1KO5A 4F4FA 3ENNA 2HWUA 1JQAA 3RUEA 1GUDA 1XJWA 4MVJA 3SMVA 3UBMA 3NGLA 1KH3A 4Y8VA 4ZV4A 3LFHA 3WHLA 5AKZA 4KYVA 1G59A 1JXMA 1L4YA 3LWZA 1MRSA 2VHZA 4PLPA 4N6NA 4YPOA 5KU7A 3GEGA 1P7ZA 1P1CA 2CCKA 5TEWA 3EVGA 3SMQA 2GUGA 1KWKA 4CR6A 4M8SA 1JXAA 4JJKA 4ZVTA 3I04M 3TZKA 4TZ0A 2ZE6A 3KD2A 3D0QA 2W8BB 1Q1GA 4QDJA 5G0VA 3ORHA 5C46F 5EWLB 1R8JA 2FZVA 3JWPA 1MQAA 3FPFA 4OHPA 4GFDA 2EFHB 1Y5RA 1T6NA 3M33A 3RV4A 1UPFA 2AFHB 4HNVA 4BZWA 4KDCA 1X15A 1QCZA 1R6XA 2YXDA 1JR3E 1U0NA 1GNQA 1UP6A 3EA5A 2F67A 2DWUA 4QTXA 1FTQA 1USVA 3SHOA 3PKJA 3DDUA 2UZ1B 4BNFA 2H4XA 1AZSC 2H31A 3T4EA 3ZI0A 3RH0A 4DLLA 1LPAB 1Z28A 1ZD4A 1LF0A 3GN2A 5IDYA 2X0EA 1ZVKA 2HYIC 2RHLA 1M7HA 2QQ5A 2X9QA 2FEXA 3F2IA 1KQ3A 4GI7A 2PZFA 4LCEA 3EDYA 4TV9F 3TVYA 1RI1A 3B38A 4MRRA 3F8TA 1K8RA 2I6UA 3NYQA 1EHCA 1BGWA 5L7YA 4ALLA 5BN4A 5CLJA 2JJYA 4CIYA 4QUAA 1IJEA 2XNDA 2C5BA 2G1JA 1VKOA 2PR7A 1I24A 1P1RA 2ZIFA 2LCQA 1LWOA 5CEJA 1FP4B 2IHTA 4C89A 3ND5A 3DFKA 4Q9KA 5DBEX 1DMRA 5EG5A 4L27A 4JGBA 1U2DC 1U2EA 4PG4A 4BYMA 4H17A 1L5FA 3H9UA 4GSKA 3E27A 4Y0AA 4D9GA 3LG2A 5HJ5A 1BTOA 1FS6A 4P4GA 5JJ5A 1JMKC 4B3BA 1VGQA 4UHCA 1EGHA 2R8YA 2M98A 3GJQA 5CNIA 3ZOKA 3TTVA 4ZMSA 1ZRSA 3NMUF 2ERXA 4FDTA 1XZEA 2K6GA 4XVHA 4DLPA 4FIZA 4DR4B 3U17A 1MBZA 3GEDA 4TM7A 1TGYA 5JZ9A 2V9ZA 3U1BA 2R1VB 2X7JA 4BNDB 4D4LA 3COPA 1RR6A 5THQA 9ABPA 1F4LA 1H9AA 2VR1A 3BWBA 3I2JA 3WB9A 4ABTA 1A4IA 1M2NA 3O4JA 5D3ZA 2WYIA 3JW8A 4FIDA 3A6JA 3EFOA 2HWXA 3VPCA 2VSYA 3ZLUA 1M8PA 1GCOA 2YVUA 1VL6A 3EXAA 3LOPA 2Y4OA 3ZCPA 4EM6A 1PLKA 3TRHA 2FGJA 5B4TA 1GN8A 1XQVA 2QMYA 3M5WA 4MA5A 1HA3A 1DQNA 2XSZD 1Z45A 3WS7A 3MTAA 3QXHA 4JLBA 4MPTA 5HP4A 4XGNA 4OFZA 1T8UA 1RKUA 3AW8A 2YJGA 3C5EA 1SUFA 4OHBA 1JDZA 1JPNA 1YB7A 5FAKA 1SIUA 5BSEA 4LCJA 4Z8YA 3QVTA 5CFZA 3F3YA 5BSWA 3Q0TA 2VC2B 3B3JA 1F2UA 4EG6A 2H4JA 2ZBRA 2FMHA 3AI1A 3F90A 1KL7A 5LP6F 2RHGB 3EBLA 2ZT8A 4MA0A 1NQUA 4KE7A 1T8TA 1RPTA 2DFTA 3TRDA 2ODBA 3Q3CA 5AMXA 3L4BC 1C3XA 2GETA 5A3RA 5AHRA 3LWDA 2CJYA 2HA4A 3CWQA 2BSQA 5LLDA 3KD3A 3NDRA 4G89A 1IN1A 1CVRA 4FJ0A 4YT8A 1N0IA 1CDDA 2G3YA 3PR1A 3C6XA 3WIOA 4BTVA 4MDHA 1CR6A 3AVOA 3RKRA 4B0OA 1T8RA 1PGJA 2AWNA 5CPBA 1C9JA 2ZDHA 1L3BA 2ID8A 3Q6IA 1NDHA 4M38A 4QUGA 5DO9A 5FTLA 4MR7A 4JVNA 3F5FA 1Z3CA 2DR3A 2JDID 4PCAA 2RGNA 3A1EA 2A7QA 1GZ7A 2D0PB 3REQA 3WHIA 4CUJA 2NO5A 2V97A 3DTVD 3IYLW 1VJGA 4R54A 4YV2A 1KDTA 4MYUA 2E1RA 4Q9HA 5GADl 2QN3A 4P22A 1DOZA 2FP4B 3LCMA 4WWHA 1EWVA 3HWX1 1XWWA 4QXRA 3RKUA 4ARSA 4FMCF 4WLEA 5I7HA 4J1QA 2AT1A 2QNRA 3QXGA 1FRFS 2HCRA 3KUDA 4K9LA 2WTXA 2Y9PB 2D1YA 4NATA 4U0KA 3A0UA 1FFCA 2C4VA 5BNZA 5CBKA 3O0DA 4BMZA 4FTWA 2R47A 2YWCA 5D7NA 2IYOA 2TS1A 1KC3A 4WFIA 1ZVMA 5TLSA 1T4DA 3PC6A 3REOA 2HJGA 2X6QA 3G49A 2E5WA 4FBMA 1TDJA 4PSVA 3SZMA 3UNXA 1GTZA 1D9XA 1KKMA 1SU7A 1N5OX 1N5IA 1Z7EA 2B6NA 2LUOA 4W5JA 3QV1A 3S2GA 3WLNA 1QO9A 3EDQA 1DCKA 2HA5A 1M1YE 2X8JB 1SXIA 1U7DA 1W6UA 2O8NA 5DOZA 4IVPA 1E7YA 3FMVA 4BXOB 3ZHYA 1QE0A 1UPCA 2Q3MA 3Q8LA 2XZDA 2O20A 3PEYA 1FSFA 1QTIA 1NNSA 2QPLA 3MW8A 1BX3A 3OZ7A 5B30A 4XM2A 3K53A 4A8JA 1M5UA 1U9IA 3GGJA 2CLHB 4QO8A 4RSGA 3M4ZA 2FZWA 3R1IA 1BKDR 1PDWA 5JPIA 3SEAA 2A3RA 5KTTA 2YNMD 5CTAA 1JXOA 4ERNA 1FTSA 4DL9A 1TF5A 4KITB 1IOLA 1MP0A 3TW0A 1JJVA 4P7FA 1ZRMA 2B7CA 3U4CA 3V4PB 2DBYA 2VP5A 3CR7A 3LX6A 1IB6A 1J33A 1T4CA 2QDKA 4D4KA 4YCJA 2Z9DA 3HA2A 3ZX4A 4IFEA 4JC0A 3HYSA 3UV6A 1W4BA 4C88A 1I2DA 3FBTA 3GJ7A 1MRNA 3I3OA 3IELA 4KQIA 4PTZA 4XYMA 1F8XA 1ST3A 4N0QA 1Y8QB 2WKPA 4ARBA 2A57A 3CH7A 3IAFA 1RKQA 3L6CA 5E2BA 1TZCA 4ZVQA 4AK9A 1I3OA 3OOHA 4TWZA 1QH0A 5ULLA 4PGMA 3G85A 1R0XA 1Z62A 1EP9A 1QO0D 5HEKA 4YYZA 5IFLA 4C4RA 2WQ7A 1UBTS 1JHQA 3DXXA 4MYHA 4JYZA 1ZJWA 2UXDB 3AL3A 3HKBB 3G2OA 1SG9A 3E5MA 3RGGA 5LDHA 1TQ4A 2NVOA 3OM8A 4INZA 1IQUA 2NLOA 1MVOA 3IHTA 3AQ4A 3PI6A 1X6VA 3VDXA 2O8BB 2UZAA 1CNMA 4PW0A 4R1MA 4YAWA 1MEJA 4AYXA 2JVIA 1XHLA 2Z2JA 4LDQA 3DWEX 5HQ3A 4MGZR 1DTWA 2QPTA 1IN5A 5JV5A 4G67A 3AZPA 2HAEA 3HXTA 4PAQA 4PZZA 2IBTA 1MX5A 5AKLA 1YZ3A 3L8ZA 3FSEA 1ZW6A 3GGPA 4GPIB 1XZBA 2J48A 4EI9A 1EM8A 1GO2A 1YMQA 3NVKI 2C04A 5INTA 1J8VA 2QOEA 2YZ7A 3T34A 5MGBA 4K6KA 1YS2X 4XFKA 3M9WA 4BV8A 1J06A 3OKCA 4DDMA 5K2MA 4M9CA 3TXAA 3ZW7A 3UC5A 1WHSA 2DY0A 4BCBA 2I6QA 5KVAA 2G9UA 1KVSA 3F4KA 1CC1S 1C2YA 3VZRA 1TEHA 1A9RA 5E7MA 1RWOA 3LBYA 1SUWA 3NHWA 3FNBA 4TYWA 3PPYA 3LH5A 1PFGA 1JQ3A 1X0VA 3C8MA 4IDAA 3AVWA 4WCDA 4R16A 4JB3A 5I4CA 5L45A 1K7CA 5AIBA 2BBWA 4EENA 2JCYA 4RFSB 2CMHA 1QRDA 2YASA 1PJ4A 3ASZA 4C29A 3O9ZA 2DQ4A 3LKVA 3G17A 4OHRA 2ZJ3A 2FUKA 2WD7A 5CM9C 2FZEA 5ITZB 1HLFA 1F9AA 3BWYA 1DG9A 3OH8A 1CY2A 3OX2A 3IBFA 1M5RA 4DTCA 2O5RA 4IH1A 1DX9A 2CNLA 4WOKA 1OYWA 4LOAA 5F2EA 4C3UA 2PGIA 4YJGA 4YYEA 1EUQA 3ENQA 1R4NB 1DINA 2AUTA 2JGJA 3OWHA 1UEXC 5P8WA 4QM6A 1N2IA 3U7EB 2B21A 3IMEA 4JOQA 3T7RA 1CUEA 5EERA 3FLMA 4RKEA 1BS9A 2AHOA 1TLFA 4KEAA 2WSIA 5CB4A 4TMVA 4E2FA 1EXMA 5ICCA 3MYRA 4CODB 2I6FA 3PDCA 5CR9A 5EIBC 1NYQA 2HV8A 2PHZA 3KLOA 2O1XA 4U6SA 3KEGA 3EGCA 4BX8A 4QOHA 1HZJA 1HOXA 3UPDA 3ZNNA 4INJA 5LZ2A 1NN1A 1U0GA 1VSVA 1QYVA 2JLYA 5JNRA 3JD0A 2ZQZA 4PCUA 1Z29A 4AG3A 4YRIA 4ILKA 5DWVA 5BOSA 2GVZC 4JQOA 1XTSA 2QM8A 1KI2A 4QWWA 3UFBA 2CL0X 2NU8A 3KQLA 3OZVA 3HGMA 4XIFA 3OX4A 2BFBA 2YQZA 4V2UA 2LCFA 2FPPA 1XROA 4DMUB 4BGDA 4KFUA 4NYIR 4TQAA 1GWNA 2ONZA 2QYOA 2VPQA 3IUPA 5M7EA 1Q5PA 1O97D 5JD6A 3NR2A 2IV7A 1L4GA 5LA6A 4XTRA 4UD2A 1CRQA 3WRXA 2CFIA 2BELA 2ADFA 3R7DA 3H87A 1J0CA 1P0FA 3CBGA 1SCBA 2QB5A 1GPYA 3IXMA 1VPEA 1KTVA 1QX3A 3FFWA 2GYVA 1IPFA 3G5MA 4BV3A 5AUNB 2F1KA 1DIHA 2C5AA 2NSLA 2AVNA 3LT5A 3P4XA 2LGJA 2R6JA 1FDIA 1KNQA 1LLUA 5H83A 5A7GA 3VPHA 4E0BA 2CXHA 3C70A 1TD9A 5C5EA 4GDFA 1FJHA 4N5MA 1GLNA 3JZIA 1VI2A 3F8SA 1IOWA 1ENYA 1T2VA 4M89A 3IUMA 3DF9A 4DNPA 3ROZA 3GB9A 1IEQA 3H11B 3KT3A 5JFGA 1PG0A 2ZS8A 1FYFA 2PGJA 4P3YA 3TUIC 2W90A 1D2EA 4V24A 3HJCA 3G2NA 4ZT4A 3WR5A 1ECCA 1QGZA 2OFOA 3CNBA 3DNMA 1XTUA 1JL3A 1RMYA 2GEUA 3NH6A 4J1TC 1M2EA 2W7TA 4QE3A 2LW7A 4I4CA 4TKUB 1N92A 1Y8ZA 1I5RA 2WPNA 4EIWA 1IBKB 2I7TA 4WOBA 4UDOA 5CVCA 2Z2KA 4H59A 3URKA 4HH4A 1J99A 4N7JA 2CNKA 4CUZA 4R1LA 2AI2A 2ZU6A 2X5XA 3UGQA 2B82A 2W2MA 3UXHA 3K09C 1ZINA 2IDKA 5BW5A 2WQ6A 2PX6A 1CJTC 1E2GA 5BUQA 1E1QA 4D6YA 2GUWA 3I01A 3IULA 4GUAA 2ZS7A 5JSQA 4LZPA 3E15A 5CVVA 2R7AA 5ALSA 4CCWA 4RTKA 4GOJA 1UAYA 2CC2A 4R8LA 2BYTA 3O74A 3B5JA 3UPTA 3QGMA 1KIMA 2WT8A 1F7VA 5DOVA 3WL3A 1ILEA 1DAGA 4CIDA 4P7GA 2EG5A 3AEQA 3SLGA 4D8VA 4PG6A 5BPHA 4G25A 1SC1A 2O7RA 2RC5A 3RFCA 3IILA 4NCNA 2PLWA 2XDQB 4EITA 5BV2P 5G4KA 3LQYA 4EJ2A 2QTVB 3O8CA 1TT5B 5CEFA 4D4HA 3KKNA 2VTVA 1S2IA 2P6MA 3SLKA 4Q39A 1EWRA 4FHCA 3VX3A 1PWZA 3WB0A 4QYTA 3M8KA 3ZIDA 1KYYA 2FN3A 1SUSA 5HUHA 3I04A 5A04A 3PJFA 3O38A 1HYBA 3LO8A 4HDSB 1Z4MA 1A8HA 3ER9A 2GXSA 4GECA 5FWAA 5FWDA 1YMVA 1U8YA 2QAJA 2WTBA 4IZ6A 3HR4A 4O1HA 4UEQA 3GA7A 1CEEA 3C85A 3K5WA 4LE2A 1XAJA 3CFYA 3LVFO 3TL3A 3UOGA 3CB4A 2I7DA 4BEBA 1XWFA 1GPH1 5HUQA 1PG2A 4EG0A 2YS6A 4OJKA 1F38A 4J7CA 4AAYA 1Y5IA 2WAXA 2QK4A 3KOZA 5BWLA 3W2HA 4DKJA 1BRMA 3VQTA 4M1TA 2EKPA 1BU8A 4LYDA 2IC5A 5FUWA 3EULA 2BGNA 2RBKA 4XTCS 1UDBA 1UFQA 3ABZA 1KIAA 2ADMA 3OZWA 4GICA 1H1LA 2VUSA 2QJWA 4L8YA 5ALTA 2DYKA 3HBFA 2HPHA 5FUVA 1ZSNA 3I64A 3FOCA 3U3XA 3H4IA 3USCS 3ZHSA 4DFDA 2HQ1A 5LB4A 1F14A 1X8KA 3I6MA 3T7EA 1GQYA 4ZZIA 1C9KA 1XL1A 2IXGA 4X6UA 4YJFA 2BL4A 2YJ3A 3ROGA 2VJPA 4KTTE 5EQDA 2HQRA 3NTLA 4ND2A 3DCYA 2YYYA 4OP3A 3R09A 5LBTA 3SN6A 1NKSA 1J5PA 1EJ2A 1OF1A 4LXTA 1J90A 1GFZA 2ETVA 3DVAA 3NTVA 1PVOA 5IVIA 1JYEA 3IT1A 3N3AC 4HADA 2VEOA 3BMOA 1HT0A 2ZIZA 1X7ZA 4Q9JA 2VAXA 1E3IA 3IRVA 5F33A 4B8YA 1I6MA 2SNIE 3PWZA 3I73A 2Q27A 4A8TA 3EWIA 3EXEA 3ZE8A 4ZCRA 3FKJA 3HEMA 3W34A 3UGTA 3X2FA 1TM5E 4N49A 3OZRA 4YJHA 1KE2A 1DCTA 2CXNA 4I2NA 3OKPA 1YR6A 5E38A 1CQXA 2H5EA 3BM5A 5J2TF 4HNRA 3DB1A 4QLOA 1AUVA 1H5UA 1S5PA 1XZAA 2JGNA 2YY6A 4P33A 4UC0A 3ZXSA 5JCZA 4TTVA 3VNSA 4LKRA 3BILA 1F0YA 1JU9A 1S8FA 1IPHA 1RWNA 1XCBA 1OX4B 4MPDA 1NURA 3RK4A 3UAWA 4DCPA 1L7BA 4GR5A 3KJGA 1M34E 3PT9A 4NEHB 1P2BA 3DBRA 5CD9A 1Z2DA 3OZAA 3VTZA 4BKUA 5JHGB 3TEMA 5JZOA 4UTZA 5GWXA 4EG3A 2VP9A 2IVFA 1PWYE 4X8LA 4UQPA 4AY5A 5CXQA 4NJOA 1SXJB 4HLCA 3EPRA 4TMTA 3T9CA 5IEBA 4CI0B 2BJHA 4E5MA 3EC1A 2FW8A 3N87A 2XBLA 3QVSA 3K9WA 5FYQA 4WT7A 2R8RA 4MKIA 1E6LA 3FYDA 4CDNA 4YRNA 4P8RA 2Y68A 3ADCA 1IL0A 1GZ6A 4E03A 4PNZA 3LPCA 2VLBA 3QSGA 4WUTA 4Z0TA 1Y7HA 4YREA 4BO0A 1IUPA 1P60A 4HMOA 4XEHA 2GK7A 5BN4B 2HLDD 4YXFA 5IVPA 3RADC 1Q2UA 2JHGA 3FIJA 4LF8B 3W90A 2CFSA 1XVVA 2DG2A 1KY3A 2CE2X 4K9DA 3FSJX 1O9HA 1MO2A 2OQRA 1E7MA 3LFUA 2YVKA 2HQSA 2Q99A 3EZGA 2PUBA 3FVVA 4QTYA 2HNAA 4WCFC 1NUQA 3CKYA 5FJIA 2Q1SA 3J81A 2BFMA 3U61B 3QKSA 4UD6A 1DRWA 2ZRPA 1XNJA 1B1AA 1W5BA 4GQIA 4BEJA 3QP9A 2Q46A 1J0EA 2PBZA 1Z6GA 4HQNA 3RJTA 3DLCA 2ACWA 4AKSA 4YRKA 1UFKA 5DM70 2R66A 5TSDA 5A7FA 2B34A 3P9PA 4F3NA 2XA2A 3L7NA 2PCLA 5FB3A 3T3IA 4ZYXA 5LDDC 2XBMA 4G9GA 3KAKA 3S99A 3CTMA 1OI2A 5HHTA 2ZIVB 4H7DA 1OB5A 2QP3A 3A26A 1H1DA 4UU7A 5DHUA 3W04A 1TUIA 1YD7A 1AQIA 4O4LF 3IDAA 3PQEA 1I2ZA 1Y9ZA 3EVNA 2JJ2D 5JWHA 3L8HA 1XZDA 2XUIA 2IA5A 3UT6A 3IEVA 1YK0A 2KS6A 4S1NA 2UYCA 1NRIA 5TX7A 2WIFA 1JLMA 4R8KA 3SE7A 5EOVA 4E7OA 1KMIY 5IAOA 3ZVMA 4TTRA 4A6DA 1N0UA 3R77A 4Z9FA 2XCUA 1IVSA 1OXMA 3GEMA 1JEQB 1QIDA 4KLZA 3UKDA 4UU1A 1IU9A 1CY4A 1E6UA 1JHVA 2ZXFA 3EUWA 2G08A 2PXAA 3TM5A 4AZ0A 1PE0A 5K2OA 1F2UB 3WBJA 4OLBA 2ZT5A 3I4FA 2P6RA 1E3MA 3T99A 1LBSA 4IVQA 1F9EA 1XXHB 2NUAA 1GVHA 3G0DA 4TMWA 4H08A 1M2VB 2C5LA 1HI9A 4P81A 1C9YA 4J3NA 2RH8A 1L8QA 1B74A 1I6LA 1FOEB 4TVBA 2V1XA 4ER3A 1RI5A 4XB2A 1EUDA 4ZDJA 1JAIA 4ZOQI 3C7CB 1E20A 3H18A 2WU1A 3QFRA 2EZ9A 4YQYA 5DTRA 3QNMA 3QVVA 3WO0A 5KQLA 4M2LA 5HGJA 5I4IA 3KAJA 2WYHA 5BW8A 1LEHA 5IJXA 2C83A 4RZXA 1DUSA 2L2QA 4DCUA 1PNTA 1B73A 8OHMA 2XCLA 3QWIA 2QUIA 4QXMA 4OQDA 2O9JA 1TLLA 4XCQA 1W8IA 5KNCD 4AMVA 4JL6A 4G63A 3D4LA 3GVXA 4K46A 4KPUB 1EVZA 3IO5A 4BQFA 1ZY2A 1QC5A 2FG7C 5I7AA 2QBYB 1YVDA 1YQEA 1QVVA 3BSSA 1OLSB 2HIAA 2JBAA 4R1UA 2HRRA 1AZTA 4E33A 2OHOA 4P6VF 5AM3A 3T3NA 1W75A 3H0KA 2A4KA 3E6AA 4GKVA 5LZ4A 3P9RA 5U4QA 3BK2A 3QENA 1JIKA 1HLGA 2OFPA 4DT1B 2CVQA 1AUPA 3CEHA 1V7CA 3D43A 4KMMA 1RJDA 4MAAA 5TQ0B 3WA6A 3N0RA 4ZA2A 2GXAA 1OLUA 4MI9A 1P31A 1R5NA 3HDJA 3UWOA 3OBIA 1UM9A 1ZN9A 4DM7A 4DCGA 5BSHA 1X14A 3AP3A 1QUFA 1ZW1A 2OMEA 5AYVA 3JSXA 3O21A 1RACA 1KRXA 3QEMB 4GLLA 1JSLA 2XITA 3MUEA 5HIKA 4NDNE 2HCBA 4MWBA 3ONWA 3L79A 2C42A 5AK0A 3RBVA 4EYKA 1UH5A 2WPDD 4BV2A 1BXRB 1YHZA 1ZOOA 3R7FA 2WIBA 2E4XA 1PT8A 3L84A 2C88A 2CFCA 4WQMA 1GTVA 2JFOA 5H4HA 5CCXA 4B4VA 1GZSA 4DR3B 2FPSA 2VL7A 2WTMA 2F4VB 1UK8A 1D1QA 3LTEA 3SSOA 1Y6QA 4RUKA 4GBED 3HU1A 2V0CA 4KK3A 2VDWB 3ZDCA 1QUEA 3I2YX 3VDMA 1IWBB 1NXOA 1V6CA 1F06A 4M1SA 1VE1A 2IF0A 1NVDA 5DGXA 2UV8A 1T2CA 3SHQA 1JJBA 2XA1A 4CTOA 1NE2A 4RXMA 5LQMA 1MAVA 4KXLA 2OAGA 2C7RA