5PGMA

Saccharomyces cerevisiae phosphoglycerate mutase
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulphate ions observed in the 2.12 A structure of a new crystal form of S. cerevisiae phosphoglycerate mutase provide insights into understanding the catalytic mechanism.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords PHOSPHOGLYCERATE MUTASE 1
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1998-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5pgmA00
1SK8A 3QPUA 1RIIA 2F90A 1E59A 3R7AA 1C80A 1UJBA 2P6OA 4IJ5A 4D4KA 2OWEA 3DCYA 4QIHA 1T8PA 5CX4A 5CU7A 1BQ4A 3K4QA 2H4XA 2HPAA 3F2IA 2PA0A 2A9JA 4IJ6A 3FDZB 1E58A 1IHPA 1QWOA 1SKBA 2A6PA 1RPTA 2WU0A 3BIFA 3C7TA 5AK0A 1SK9A 3KKKA 2HHJA 2WNHA 2P2ZA 1EBBA 2P77A 5CDHA 1DKMA 4JOBA 2YN0A 1H2FA 1NT4A 3E9CA 3LL4A 3O0TA 1XQ9A 2IKQA 3D6AA 4MA4A 5HR5A 2H0QA 4GPZA 3E9DA 3LG2A 4EO9A 1FBTA 3FDZA 2P9FA 3OI7A 3ZHCA 1V7QA 1YJXA 1BQ3A 4JODA 4TSRA 5AJYA 4FDTA 1DKNA 4HBZA 3K4PA 2HIAA 2ENUA 2EKZA 2P30A 2OWDA 3F3KA 2WNIA 3EZNA 4FDUA 4AROA 1K6MA 3PGMA 3QPWA 1H2EA 1BIFA 1CVIA 5AJZA 2P2YA 2P78A 5AJWA 2H52A 4D4JA 1TIPA 1DKOA 3NFYA 3MBKA 1SKAA 3E9EA 3GP5A 2P6MA 4D4LA 1RPAA 1V37A 4ARSA 2I1VB 3GW8A 4D4MA 2EKBA 3LNTA 2RFLA 1C7ZA 3DB1A 3MXOA 3IT3A 2ENWA 1C81A 4PGMA 4ARVA 2P79A 3FJYA 4GPIB 4JOCA 4ARUA 1QFXA 3D8HA 5PGMA 1DKPA 3IT1A 1DKLA 2P9ZA 2EOAA 3NTLA 3QPVA 1YFKA 4EMBA 3IT2A 2YN2A 5AJXA 2AXNA 3GP3A 4E3WA 1QHFA 1DKQA 2DWOA 2DWPA 4ODIA 4PZ9A 2P75A 3EOZA 3IT0A 2QNIA 1ND6A 3HJGA 4PZAA 2GFIA 5HTKA 1UJCA 1FZTA 1ND5A 2P9YA 5AJVB 3D4IA 2H4ZA 2BIFA
chains in the Genus database with same CATH superfamily
3DZ8A 4R1NA 4TKUA 4JUCA 2NSHA 3HP1A 3V4RA 1JALA 5F1OA 2Q49A 3G7UA 4D6PA 1FLVA 4DXAA 3EAGA 1Y1KE 4UHDA 1AO0A 4I36A 4DXDA 1INLA 2B8TA 2W2XA 3DCYA 1NW4A 3LVQE 2J9YB 4KTVE 4E15A 1PZFA 2G5PA 4YQFA 5A0TA 2H6EA 3MRTA 5AM4A 3DMRA 2YH2A 1PQWA 1GPJA 4KQ6A 5B37A 4GVXA 3F9IA 4FR5A 4JFAA 1CP2A 4QXQA 2VJCA 5DLDA 5JFGA 2LR0A 2Q0SA 1XVAA 4M46A 3ZEAA 2XQKA 2XKAA 1ATZA 3IUMA 2XPCA 3NBAA 3PI7A 2ZFUA 4M9RA 3T41A 4K6FA 2GM5A 4MDYA 5T6BA 3VTZA 4EP1A 5ICCA 1ZW6A 3GRYA 4WCFB 1FX0A 3W8FA 4B8YA 3CVVA 2R3SA 1JVBA 3H8JA 2GILA 1U98A 4L28A 2FZVA 2JGIA 4NFHA 1BJRE 4O4JB 1Z5UA 1U0SY 3UTDA 2ZUUA 4AJLA 5MFZA 3ZS9A 4ENVA 3IURA 3GAAA 4WKNA 1IEQA 5EL0A 3JQAB 4YV2A 2REQA 3BH7A 3UAYA 4F4JA 5DBFA 4X97A 4KXWA 4QKQA 2YWEA 3E35A 4RZUA 2NXNA 2D6FA 1EHCA 2EKLA 4FOTA 4IOKA 1ZKMA 2FMIA 5AJYA 1UDBA 1RQLA 3LHKA 1YE5A 4RDXA 2P2SA 4X91A 2PKQP 2I6XA 3TMYA 2B92A 3IC5A 2BTEA 3D4NA 4JJKA 3USZA 3ZY4A 4RESA 5FWAA 3INGA 4IHQA 4GRDA 3BULA 3IPRA 5FF9A 1OIWA 3LQRA 3VHXA 3IAS1 1EGAA 1SOMA 4LZLA 4PSUA 6PFKA 2IHYA 2GJ9A 4LVUA 3QOYA 1PJ2A 1XDDA 2CCKA 1U0FA 2WJHA 3GRUA 2EV9A 4FS3A 3V7YA 3WHKA 1UJ5A 4C0QC 2UZ3A 1KC1A 3MNFA 4LDPA 1JHOA 3QOFA 1NZDA 5E1BA 1NBHA 4Q9LA 3QIVA 1IAVA 5THXA 1JG2A 2HPVA 3F71A 5H16A 3A3PA 4QVIA 2O3SA 4X90A 5KNCH 3DMTC 1OSNA 4X44A 2ZU6A 4IUBS 3IQGX 3W04A 4BNJA 4UKDA 5CYPA 2VYFA 4BB5A 5J2UF 4MIOA 2P6UA 4H7HA 5KQLA 4N49A 3KJNA 4BGUA 3VUFA 4PPFA 2Y3IA 1DG3A 5C0OE 3T54A 3P96A 4ESHA 5IF3A 5BWNA 3RU2A 2NUPB 4CUJA 2G82A 1OBFO 1H6AA 5BV2P 2DQSA 2EQ5A 2E21A 4HNGA 3AU9A 3FTCA 2ZP1A 3TLBA 4ZN6A 1JQJC 1C4KA 1NKTA 4NNOA 4YK7A 5FJIA 2ARKA 3IT2A 4LAFA 5BURA 2CVFA 1GAEO 1HQCA 1SKYB 1VPWA 5AW4A 9LDBA 1E5LA 3P9KA 3PG5A 2H9YA 4JUIA 2IWHA 3RG8A 3NBXX 1R4ZA 4LZNA 4PZ9A 4DJTA 1OGJA 3H7AA 4HGRA 4Q4LA 3LUGA 3T5AA 1KC3A 2JCVA 3TGLA 1MRZA 3OESA 2FZCA 3IRVA 4PX9A 3OIGA 3TKAA 5FAKA 5IT0A 1W52X 4FDMA 2L17A 3UUEA 3UCXA 2PZFA 3T1HB 1QRRA 3QLTA 3A6JA 1E1RA 4NBTA 3WZLA 4CMKA 3HGTA 4LY3A 1Z6AA 3EIEA 3U7RA 3CMCO 1T43A 3G8YA 3HU1A 4MI3A 1E98A 1XRQA 1PR0A 1U0GA 2AJTA 3COZA 4LXYA 1FDRA 4QBTA 4PLPA 1ECPA 2HUPA 4QODA 3T7DA 4NYIR 4EL5A 2WFMA 1HRDA 4CL3A 2I6TA 2GTHA 3HRKA 4IHJB 1E4YA 2O7VA 4CBVA 4Y9UA 5KWSA 4F56A 1Y8RB 1FS6A 1K5DA 1T8PA 2WV7A 1JDNA 2CXQA 5E9WA 2ADOA 3D7LA 2WUEA 3FYUC 1IXRC 3A8TA 3ESCA 3C48A 3THWB 4P7BA 1P60A 2AOUB 2FKAA 5J4KA 1J0XO 2LTAA 4KKXB 4HDMB 4XJXA 3O8NA 4ZZIA 1I2CA 3ANNA 3BJZA 4Y9SA 2ZRKA 4FKZA 3UG7A 2WHQA 1MAWA 4A8JA 5AVOA 1IBMB 3L93A 1JIQA 2DJ5A 2BWJA 2O2ZA 1KK1A 5KWEA 3O9VA 3OPYA 3O0TA 4OXRA 4FNAA 3X1KA 1QK5A 2JARA 1HMYA 2P7HA 3O95A 4LCEA 4M0MA 3HI6A 3I9LA 2I91A 2YIDA 1ZD9A 2Z6VA 4GQAA 5IKXA 2PPLA 2JBWA 3QVUA 5LDGA 1JG1A 3ROEA 2RJ3A 4ALJA 4OHYA 1LFAA 4HXGA 4WOKA 5E6SA 1TPYA 3ENZA 4HBGA 4QYTA 3DHVA 3VPFA 5CYGA 3TEMA 3LKVA 2CVQA 5JS2A 5IJ0B 5FT9A 3AFGA 4S1TA 4F5DA 4N9QA 5E38A 5KYVA 3LYAA 2PL1A 4Z6KA 1Y8AA 4XX1A 4OAQA 4QHYA 1JEQA 4XLZA 4G0YA 3N8DA 3C6ZA 3ASUA 2XVAA 3OU7A 3EWNA 2A5JA 2ECFA 2KLBA 1O4WA 1SQFA 4Q48A 3S40A 1LNZA 1TYEB 2FPXA 2D54A 3WS7A 4ZU6X 2RI6A 3D7SA 3GJ5A 4YWHA 2WMNB 1NHWA 2G1UA 4OA5A 4QYWA 2JIQA 5LQJA 1YQ9A 3FCEA 1JHUA 2CFOA 4KYTA 1IYZA 2BEWB 2OMEA 2WE7A 1TCCA 3PFIA 3ZWDA 3AFMA 4FM9A 4OM7A 2BTQA 3JQ7A 3ABQB 2BHLA 3WGTA 1EWRA 4IL5A 1MIHA 2JIRA 3GPCA 3AG5A 4XPZA 1QJ4A 2R85A 2V3WA 2C97A 1AN9A 1VYTA 3PFWO 2VTBA 2JFQA 5H0IA 1PJ8A 2X7JA 3NWJA 1IOZA 4PZPA 1MO5A 1VBKA 3HBFA 3PXAA 3G1UA 4B7AA 2DRIA 1CNMA 4E0BA 2XGMA 4J9UE 3W5SA 5KVSA 3FUXA 3F8SA 2HHCA 2A1UA 4HAZA 5CJPA 1M1NA 1FP2A 3AYXB 1SIWA 3EWAA 3GJZA 4BY9E 4KNYA 3WAJA 1KH1A 1Q0RA 2H0RA 2Z43A 1ZN9A 2QTGA 3PGVA 5AR1A 2NM0A 5CLQA 4CM1A 4RIFA 5IULC 5KYYB 4TMYA 3PC3A 5FPYA 5J63A 3RSQA 3VHLB 2Q5QA 3SZGA 1VM6A 4ZYLA 1BW9A 3OE7D 1FXWA 2YC2C 1NW6A 4A73A 4GBJA 3NG1A 3JQRA 3W4IA 1CR1A 2IJGX 1DC3A 4FE3A 3ECSA 3ZVKA 4RHEA 2JFVA 1L5RA 1JSXA 5CIQA 1JDSA 4FX5A 4CLDA 1CQWA 2OO5A 2FFHA 2EERA 3AGQA 2FK7A 4JXZA 2BCJQ 2AFIE 5GWXA 1CS4C 3JRNA 3WGVA 4LSMA 1XMQB 1G8JA 3SJCA 1XP5A 4GP7A 2ASEA 4I08A 4HS4A 5CBPA 4CG2A 4PZLA 3KWFA 4ARZA 4TKVA 2G07A 4TQGA 1KYZA 3NJ4A 1TJ3A 3M1AA 3HWWA 4H7DA 5IWCA 1MNAA 4H0FA 3ZV5A 5LNK6 4M1OA 3T7IA 3WA7A 3C3AA 1Z4IA 3RU9A 3JZDA 3AJ9A 6LDHA 2WD8A 2Z57A 1M73E 2YJZA 4HGQA 3JTEA 1M8PA 1Z33A 1I8TA 1E4VA 2WF8A 3B1FA 2OMKA 4Q15A 5ER9A 5L53A 1SZDA 1TQ2A 2FSVC 3D1JA 2WUVA 4DV1B 3HGQA 3L1UA 4ECAA 1X15A 3UJPA 4D46A 5C52B 1JP7A 2F43B 1G4HA 1GZDA 2O20A 4NDZA 1EXNA 5HGJA 5KX5B 3DDHA 3BIFA 2KBEA 2QX4A 4TGLA 4B35A 2HREA 1E2MA 1LVHA 1B8PA 1O9BA 3B5IA 1K3UB 1VLMA 3AETA 3GRRA 4V39A 4EO7A 5IVHA 3FMOB 4WAUA 4D4GA 4BNIA 1IN4A 4Y6OA 1FFAA 3IQIX 5HA5A 1O97D 1R5JA 1I3NA 4C0HA 1SCUA 1O5TA 4R8LA 3LC0A 5FCDA 5CCXA 3U3MA 3V5NA 3I73A 3Q9SA 5K45A 2GAOA 1IG0A 4GI1A 5CGQB 4N41A 5CURA 1EK6A 3GNSA 3ROGA 4LNUA 3RUAA 2Q07A 4WN9A 3V8MA 3KQKA 2OWDA 4B76A 1YQGA 2RGAA 4N1AA 2XTMA 4FHDA 1FW6A 1WW8A 1DC6A 1Y80A 4CEIB 5LQUA 1P18A 2QG6A 4U00A 3U44B 1X87A 3IEMA 4C3VA 4G1EB 4AO8A 3CU5A 3RO7A 2W6IA 2ESRA 5IBQA 2QTCA 1KXJA 1CZOA 3M6AA 5LFAA 3QE2A 3SLKA 4QU0A 3P2YA 2W71A 2AN5A 2FN3A 2VPYA 5KVAA 2B4RO 4CTOA 2PMCA 1NOJA 1Z8FA 1IWPB 4IEFB 2NAPA 2FY8A 4NPHA 1GARA 3W2IA 3ZS8A 5B2EA 1XMJA 1NW5A 3I5UA 2H07A 4DM4A 2PWPA 1MX1A 4J4HA 3WWPA 1Z07A 1RKXA 3HXKA 1C14A 2X9GA 4Q21A 4QYXA 4X93A 3QBJA 5DRTA 5JDIA 1WSAA 1WDTA 4YWJA 2HRRA 2P2LA 2PQ6A 5FLKA 2QROA 1RYMA 3C4JA 5LIPA 3AF3A 2QT9A 3E18A 3KHSA 4MQEB 3H9BA 5B5SA 2NO4A 1I80A 3KYJB 2PZGA 3UA4A 4A0QA 1Z2CA 1KJ9A 1LJLA 2ECPA 3KU4A 5A7HA 4PCVA 4YCJA 4CN8A 1TOAA 1JQ5A 1KI9A 4KDFA 4EQ6A 1LSJA 2DBRA 1B0PA 2A92A 1FYWA 3HNRA 4H1UA 4W1SA 5DEIA 4M83A 2NUTA 1RWPA 2TYSB 3T34A 3B53X 4LEIA 5F2EA 3ADKA 4MMYB 3IP6A 4BZPA 2AFIB 4L8GA 3TK1A 3R6GA 2IBSA 1Q0PA 3GU3A 5HTKA 4RH3A 2QRLA 2Q1YA 3SBOA 2ZDGA 4BB6A 4FDVA 2F55A 1TCAA 4EQ6B 2WT8A 4PRLA 1ZMTA 2R84A 2MCFA 4AMGA 1GIAA 2XGGA 2YV1A 3GLSA 2PQMA 3AF6A 1T0BA 2VBIA 3DBHA 3H05A 3IL2A 3WNZA 1GZ4A 5TLSA 5IBPA 3O6VA 4PTLA 1E8DA 2B0JA 2DEUA 1SXHA 3ZE2B 2QM3A 4IXMA 2YNMA 2I2AA 2PMBA 3PX7A 2REOA 2DXIA 4KUEA 4RETA 2I2DA 4AUEA 4IDCA 2CVPA 4O3MA 3MMZA 1YQTA 2DR3A 2BFPA 3GOHA 4W8HA 4DA9A 4OB6A 1Y3AA 2C7RA 3IEVA 1TQ8A 3LUAA 2C2WA 2P9BA 5ER6A 1HTTA 1QHNA 3FTDA 1IUKA 2YVQA 1MH1A 1V8FA 5AM2A 4EMTA 3Q9LA 2BGIA 2HGSA 5DNYB 1XNJA 1NG1A 5TNXA 5KJ6A 4AKIA 3C6XA 4K9NA 1GUZA 1IAQA 4XGRA 5DFAA 4WV3A 1SIOA 3QJ5A 1SBQA 2EP8A 4B2LA 1Y6RA 1T5LA 2CMDA 3BSWA 4JNCA 5ALXA 2FSHA 3F6YA 3ME5A 2WF7A 3HJHA 2X22A 1N25A 3B6MA 2C8LA 1VFPA 1RQPA 3UKDA 4HDMA 2WTMA 4C01A 1I4DD 5GJCA 2ZPAA 4FGZA 3BWXA 2ZJOA 4ENQA 3WLJA 4PYJA 4KR0A 2EEZA 1YS9A 3T61A 1P4RA 4XLLA 1V71A 4ICIA 2DTEA 1YFJA 3HCFA 4YAIA 1J0DA 4FHEA 4H60A 4NOMA 4QX6A 4YRIA 2FSSA 2IS4A 4IV0A 3WB1A 1KGSA 2QYOA 4JXKA 3AR9A 1I13A 1ECFA 2HRCA 1HY3A 3DOIA 1JBEA 4L51A 1P7ZA 4HDKB 1KAGA 1L4HA 1QK4A 1SXJC 2Q8QA 3NU1A 1R8SA 3TM5A 5AJZA 1WU7A 4KTTE 4Z7JA 9GPBA 4M2LA 4K8OA 2Q9BA 5IW8A 1GTL1 3TAHA 4UHFA 2SCUB 3DBRA 5CVDA 5FTNA 3GLHE 4EW3A 1GITA 1KMQA 3BF7A 2HFKA 1YD7A 4XD7A 2UYQA 4JNKA 4XOIA 3S8YA 3J7AC 1Z36A 3PICA 1GQOA 2BJVA 4C4SA 4DV3B 3I92A 3WSTA 2ZPUA 1TA9A 621PA 2AB0A 4JS0A 3CLTD 4WZAB 1OFGA 4V0ME 4LGVA 1JZQA 4MVJI 2JGRA 1GYRA 1E6CA 3HKDB 4MIYA 4D82A 1U8FO 4GZ3A 3VZCA 2DBZA 1OIVA 2Z2KA 3P2OA 4BQOA 3NFRA 2X6RA 5F4BA 2Q5JA 2QRVA 5JASA 4KVFA 2CL7X 4CUZA 1QB7A 1Y3HA 5IAEA 3DXFA 2QTWB 4G4SP 4KLNA 2E7ZA 1WABA 5GGYA 4Z2AA 1CJSA 3NDBB 3TN7A 4NBLA 4EMUA 4U02A 3RGWS 3WKEA 1IQ0A 3PUJA 1PGQA 1L5HA 2WJ3A 5DK6A 1F51E 3U39A 1POXA 2JH3A 5IVPA 4XUDA 1QR6A 1E3WA 1XCGB 1YZVA 4F60A 5KO2A 4DLLA 5FI0B 1FLAA 3R9XA 2PZAA 3EFHA 1E7RA 3PQCA 4DCMA 2QAGC 1R0KA 4CNQA 3DA8A 2B83A 1AUXA 5LZ8A 4N39A 3WGMA 5KYYA 5KZMB 1LWNA 4GEGA 1KVTA 3TTSA 4QSHA 3ZHQA 1XEXA 1G5FA 4KEAA 3W06A 4BGIA 4HFMA 3NW9A 3RSSA 3L7CA 4DNOA 3E81A 4GOLD 3RADC 2RGUA 2P6OA 1DX4A 4RS4A 1NVFA 1QPGA 4DBZA 2BFOA 3HCRA 4OMUA 2QWXA 4TWBA 1SO8A 4URZR 3PUWA 4O3FA 1L5SA 2G76A 3G2KA 3LT4A 4LWQA 4PC7A 4ZCSA 2HPAA 3Q3CA 4KXFB 2DFVA 2OC4A 3LIPA 2VQFB 1SXJD 4AXBA 5ADVA 2C9MA 1JMKC 2XWJI 3AILA 4MX8A 1Y7TA 1QWOA 4YNBA 3N76A 4N3GA 4Q16A 1JMYA 1V4BA 2WIBA 4R8VA 2C92A 2YXLA 1Y7LA 2W9XA 4IHAA 3SC2B 3SBEA 3X2EA 1JH9A 4V1CB 4FI3C 5ALEA 3OZRA 4QEDA 4DLNA 4G8BA 3SZOA 3H2GA 5K3DA 1V2GA 5CJJA 4F1WA 2G77B 3OJOA 5DLPA 5SZHB 3S2SA 1P1JA 3G8AA 3U4QB 1ZC3A 1UT6A 4EG0A 2XAAA 2PKQO 1UZUA 1W94A 3DMHA 3BGVA 4HJXA 1DSSG 1H85A 3GUZA 4DM7A 2I7VA 1BKDR 5IKPA 1U3TA 3OU6A 4B2YA 3R0IA 1N3BA 3X3HA 3WNVA 2A9OA 1CP3A 3ZI7A 2OCGA 4RGQA 3R3WA 1E79A 4YUVA 4M0PA 4JI3B 3QPDA 1JE0A 3PHBE 5LNK1 3CUVA 2F3TA 2BKXA 4I9NA 3SZ3A 4K6OA 2BN4A 3AOGA 1Q7CA 2A0YA 1MABA 2M1ZA 4X00A 4CIDA 4N54A 4UXHA 3VSAA 5LZ2A 1X7DA 5IXJA 1Z06A 1SR8A 3VJLA 1MUUA 3DT8A 1TA0A 2H7YA 3Q2IA 2UXBB 4Y2JA 1FMCA 3H5LA 4M9CA 3DMDA 3SSAA 3ODGA 3PUXA 3LT5A 1ACLA 3NFYA 3RUFA 3KZVA 2GF2A 2EJBA 2W6JA 4G0ZA 8ATCA 5JPIA 4OOFA 3SXUA 3H84A 3EGIA 5KYNA 4UASA 4ZHQF 3CVWA 1T0HB 4FQ5A 1CY1A 2C0QA 3X1YA 1UKAA 3KOXA 1V7ZA 2QSZA 3I0NA 3RUEA 4U4AA 2J9RA 2P79A 4C1BA 1IN6A 5LQRA 4AS2A 4J0FA 4D8XA 4M6WA 4L1KA 5AVKA 1DKPA 4O29A 5TMBA 3IUBA 4OH1A 2Y1DA 3RBZA 3T1QA 3MWEA 1E9DA 2IHVA 3FPGA 3R3SA 1J06A 4L7VA 3EXG1 4NG4A 3RVLA 4E3ZA 4FHFA 4JGGA 3ROTA 2XQJA 2PR2A 2N1MA 2ZWIA 4KL8S 4XXHA 2I4NA 3CTPA 3BJEA 1QHIA 2ZBEA 3ONDA 1KO7A 2FR1A 2Z6UA 5K4GA 1E2JA 4U1RA 1WZ2A 3LTNC 1FFYA 1KFBB 3MSCA 2WSBA 2Y92A 3GT0A 4N0MA 1M72A 3MTAA 4NJMB 1DFGA 3OQJA 1I7QB 3VSBA 2NU9B 3NHFA 4RD6A 2OLEA 4QOIA 3L6CA 4YT2A 5T4FA 1CRLA 4US1R 1T6YA 5JFTA 5JFOA 2BBTA 3GGPA 2HY7A 2QXUA 1NF2A 9ABPA 2ZEJA 1UK8A 2WUWE 3HB5X 3MELA 1IM2A 3B5JA 2LIPA 2YWBA 4HWSA 4OA8A 2DH5A 4O0MA 3AF4A 3TTUA 3RBXA 1PV4A 1TKBA 1X7YB 1XTRA 4DDTA 4JUBA 1A2KC 1HO3A 3CLVA 4D9EA 4ZFNA 1Y9EA 4LXQA 4TMZA 1RYHA 5HJ2A 1EDOA 3DEAA 1JUDA 3RV4A 3AR6A 3QTBA 3GIWA 3CCCA 4CM4B 4D43A 5TRTA 2G0NA 4BIMA 2OGZA 4JOQA 4LN1A 3P94A 3CGWA 4IP0A 1UFOA 1GNSA 1ULBA 3HHPA 3I6YA 3ICCA 4L4YA 2RCYA 5JNTA 2M2IA 3I30X 2QRNA 1P5JA 3VU0A 1ENYA 4NWIA 1XMOB 5KUTA 1NPDA 1JB1A 2ZJZA 3VZSA 1JEQB 1A2OA 3FCAA 3L7JA 3CF4G 1WW2A 3HYCA 3WNBA 1AMUA 4J2OA 3EPLA 2WUFA 3PC8C 1RRGA 4LV8B 1C9KA 2WWGA 3FPKA 3HDVA 1D6MA 3ZZNA 3SR4A 4D9MA 4L5JA 4Q3EA 3UOAB 2IYEA 4XOUA 1YF3A 2ZSAA 5E9QA 1EM8A 2OGWA 5DCYA 3UQZA 1DWOA 4JL6A 3UYKA 3NDRA 3T9BA 1UZAA 3FI0A 3UW3A 4CKBA 5EUCA 2VSYA 3ZI4A 2CD9A 3CLUD 3C2QA 1QH0A 2L18A 2EZTA 1HUQA 2E4ZA 1N3YA 5JATA 1AG9A 2P35A 3EZNA 1U02A 3SOPA 5K99A 4W5TA 3PQ5A 3EXHB 4QELA 4UUOA 4LF7B 2XCUA 1WSDA 2FEWB 5CCBA 4YX9A 1NW3A 1ORRA 2FU5C 4IV5A 2R87A 4HYYA 3OHPA 3TB4A 5C8DA 4YRCA 3EJWA 4YCCA 5BW8A 2UYGA 2B7LA 1OU4A 2C8KA 2JGAA 3BMNA 3PGJA 3QUSA 4AFNA 4HEA6 2ZTUA 1Y89A 3EXHC 4GC9A 2WD7A 3AFOA 2F3UA 3DFFA 3G5TA 3S44A 4RYLA 4BBZA 2CD7A 1G0NA 3DE2X 3EIHA 2GTIA 1JFLA 1KNXA 2BI8A 2QVLA 2YW9A 5F7ZA 4ENSA 3DT6A 4XUCA 2P7IA 3QVGB 1UP4A 3NHAA 2O1XA 1PEYA 1AGPA 2XTZA 5FIUA 3UA3A 3CJTA 3G8CA 2BSAA 2ZVJA 1Q0SA 4UNPA 3A2LA 3NOOA 3WB0A 3EASA 2VK2A 3BWYA 2X0NA 5DTJA 3VPBA 4EHKA 3AJDA 1KSHA 2WUDA 5P21A 1YFKA 3D8NA 2O2JA 1QVZA 1SMKA 1M6NA 3NHYA 3DEKA 2M9MA 2Q28A 4YJ3B 1I30A 1EVQA 1AK1A 1N2EA 2JKVA 1HI9A 2JHFA 3LPNA 5K20A 1P81A 3JQ8A 1J07A 3FLBA 3FZNA 3W5UA 4Q24A 4MWDA 1GNVA 4PICA 3N59A 4TKLA 3PR1A 2XMRA 3PJRA 5TQ0B 4JJZA 3V55A 1ACMA 4EJ0A 1FJGB 5J3JA 3EYWA 3OJ0A 4EFDA 1H69A 5IXSA 2IITA 4GGOA 4WUTA 1WNFA 5K0GA 3AM3A 5CX1B 4AZWA 3LOPA 4MO2A 4R7ZA 4S0XA 5E9JA 2ZR0A 2WOOA 2MJLA 4AF6A 5AI9A 2DR2A 3C4QA 4REOA 2LWIA 3I5XA 1MJGA 2UXCB 2HC9A 3FZYA 4BNLA 5TVGA 3EGDA 3PHIA 5KKAA 1YBHA 1F6WA 2R11A 3SIRA 1YT5A 1V4NA 1AZWA 2D62A 4LRUA 3ZOZA 2CJFA 3X2FA 2VHWA 3WMFA 5K0FA 1W4RA 1ARZA 4UHBA 1MQ8B 3DDNA 1PHPA 4AX4A 1P8JA 3X1XA 2WTEA 3V7FA 2BSQA 1F4VA 4FLEA 4A2WA 1R4NB 2Y68A 1JFSA 2EKDA 2XX3A 1X74A 3RFCA 3H18A 3QKSA 3QX8A 2GETA 3T5DA 1P9OA 5LM3A 3W5AA 1G3MA 4EG3A 1UC4B 5LD2C 3ES9A 2V03A 2R8XA 3VKWA 2V7TA 4MB0A 2ZIZA 5FPQA 4BCCA 4BUJA 5EWMB 4CF3A 4EYEA 3BRQA 1G9SA 4FJ0A 3SDBA 3C3KA 5AOBA 4EO9A 4R2HA 3ESBA 4TVSA 4GX2A 2J5QA 5TJHA 1KTIA 2NUAB 1NPTO 2GESA 3EDOA 1MJGM 1W5TA 4BFYA 3AM1A 2VR1A 3SS8A 3ZY5A 1VPEA 5JNLA 1L7NA 4BQRA 2RHBA 5K8JB 4F0JA 3KUUA 5LN1A 2VDJA 3QGMA 1Y34E 5GV7A 5CXQA 3QBDA 1GPNA 3S0JA 1RQGA 3O4IA 1O4VA 3TQIA 2B5VA 4X7RA 4HH3C 2GVDC 4NCXA 4L9RA 4MGKR 1A8HA 1PO7A 1JQBA 5DI3A 3ZCXA 2BFBB 3X1DA 3F73A 3RYFB 1XNGA 1ML4A 2IW1A 2OENG 3EXAA 1DUVG 3EWIA 5JADA 3HTXA 1N5OX 2FZLA 2MMCA 2HU8A 1RI5A 3DE6X 1LQUA 3ESXA 3A4IA 4J7AA 5KJCA 4I1OA 4M9XA 4JI4B 3QV2A 1KIFA 1F8FA 2RGRA 1KSFX 3NV9A 2JNWA 2EF1A 4DCGA 1PRYA 1K97A 1I4OA 4JGIA 1C1XA 1W19A 4B4VA 2HNKA 2B82A 2YWDA 4XSVA 1OI2A 2QGFA 2ET6A 4KXUA 5BRJA 1BHJA 4F3KA 2VUUA 1JI0A 3Q7IA 4WCVA 1WULS 2GFHA 1LS1A 1AXGA 2B9EA 3F0TA 4GOOD 4IH1A 3ER9A 2RHOA 1KO4A 1ZO8A 3PGLA 1FDOA 1QQ6A 4BKQA 3M6LA 3PNBA 1NNUA 2FAXA 2LKCA 3HLYA 3OZCA 4PC2A 3ZZ1A 2G6BA 2Z2XA 3KKLA 3AKDA 3BTSA 4F5ZA 3NJ8A 3PA6A 3AKCA 4R8KA 4WA8A 3BMQA 3RSGA 3GZNA 1VE1A 3REQB 1RBYA 2WWXA 3NEAA 4M9ZA 5YASA 1EFLA 2BHNA 3IFSA 3A0UA 2P75A 1TZKA 3M3HA 1BA3A 2OY0A 3EN0A 3ONVA 3ZD7A 4KMOA 2WSSD 4LDJA 1W4AA 3R5JA 1P0FA 3A32A 1E6LA 1H0RA 1QE5A 3EOBI 4B7UA 2I33A 1R50A 5DYIA 2D2IA 2OCDA 2WIGA 3NT5A 4PSVA 5K8UA 4RHCA 1ZD8A 2AFHA 4X1IB 2GWRA 2A4KA 4PLZA 4QTXA 4DJJA 4LW8A 4OJQA 2BM0A 3ECAA 3ZI0A 5MHTA 4CKCA 5ESDA 1L7EA 4EW6A 1B1CA 2C42A 2ZSKA 3MB5A 4HSEA 1R6BX 5ELLA 1PW5A 2PBLA 3RAGA 5KJ1A 1T91A 1E59A 4H3VA 1UJ2A 1NGSA 1PJAA 1OPXA 3V8QA 1CR4A 2YQ4A 4C6HA 1NQUA 1ZVJA 4CF7A 1L9KA 3AP2A 2ZZKA 3QUCA 3CZMA 4OHUA 2AFHB 2CJXA 1IM8A 5B6IA 2D0IA 1BOFA 1PN3A 1DWPA 2CLSA 3DUFB 3F3SA 1WV0A 2R6R1 1JFFA 4UCXA 4R4JA 3P9CA 4OF4A 3RYCA 4OUDA 3UKOA 2ADFA 4E2ZA 4IOLA 1C30A 2YV4A 3M1LA 4G4JA 1T9BA 2OHHA 4XFJA 4E03A 2JRLA 1JQKA 1Q2UA 2XNHA 5JWHA 3STUA 1CJTC 1E2EA 5JBNA 1M2KA 2Q4EA 2JIPA 5JCOA 1V2HE 3SSOA 5ICFA 3T95A 4IHJA 3N75A 5DRYA 1H93A 5JYDA 5JMOA 5H82A 3LL4A 1AO3A 4ITVA 5JI2E 1OY1A 3VZRA 3H04A 2FEXA 2QF7A 1ZRNA 3CZCA 5IPFA 1W0JD 3KUDA 1Z5WA 2V7QA 2CGEA 4V0QA 3SF8A 3VTAA 3A31A 1CLUA 2BI7A 3P32A 5BRNA 4K9PA 2H2FA 1XRNA 2IUEA 3NHPA 3PDWA 1A9RA 1W48A 4G8CA 4JEIA 3G1WA 4KODA 4Q39A 3P4YA 5H5JA 3ROPA 4D8UA 1Z63A 3ZDAA 4MYSA 4XVCA 2CHEA 3LXXA 2DTDA 3FWPA 5LXTB 1EH5A 1YFZA 1ENPA 2JEYA 5B12A 4GUDA 2WR8A 5LJIA 3UUGA 1BAPA 1MFZA 3HKEA 4QDXA 3ZWAA 4D45A 4QQNA 1VL0A 3WV5A 4BNVA 1X8KA 2Q3BA 4MVYA 3QE3A 4C6SA 3W7VA 2ORWA 3D2LA 2QTLA 3HP4A 4NATA 2F9LA 1EB9A 3NI2A 2B3DA 3QU7A 4GPTA 4TTJA 5FL7A 3W8EA 3WLOA 4BTLA 4A0SA 5A5VA 4BAUA 1B26A 1VTKA 4D4JA 1IJEA 4UEOA 2NGRA 4LDAA 1E92A 1Z0JA 4OLAA 4UM7A 2CEAA 4AT1A 2PVCA 1Z29A 4WK4B 5EPUA 2I1VB 2P90A 3CLTC 3HJTA 3DPIA 2AR7A 5JJ5A 1AHIA 1OD6A 2FCRA 4RLSA 3W5DA 2QTVA 4J3JA 1HDXA 3K8YA 4LJ7A 4Q3AA 1B23P 3AEKA 4EAQA 1P1CA 1LSUA 1N75A 2Z83A 3K5IA 3DQZA 1I51A 1X1TA 1Z18A 3QYFA 4MCIA 3U26A 5IJ9A 1QYCA 1TXGA 2GRJA 3EQZA 3R9XB 1RLUA 3G9TA 2GN8A 3FCUB 1Z6YA 2QPAA 1PK7A 3UMBA 1JAHA 1UPXA 3CBQA 1ZC4A 4KO1S 1K8ZB 2J87A 4E2YA 3COSA 2EZUA 3RHSA 3K0AA 2IHTA 1UQRA 2VAXA 2GB4A 4MYUA 4RE6A 1G1MA 4DJDC 4OXIA 1DQNA 4DJAA 4HVLA 1ORDA 3OPXA 3SJZA 1GDHA 3AF2A 5AUPB 3HWX1 3GJ4A 4UJ3A 2BFDA 4Q47A 3ELUA 2CC2A 2DP4E 2EAUA 3ROFA 1JHYA 4U3JA 3HY3A 1RRCA 5TE9A 2DTXA 3JTMA 4GQIA 2C9DA 3GJ7A 1EB8A 3I83A 3SR3A 4DC0A 1NI4B 1MV8A 2R6GA 2NU8B 4PY2A 1Y42X 2VA9A 4U6QA 2CT8A 3OH8A 1KYQA 1ORWA 5IEJA 4TS4A 8AT1A 2VJYA 2ZIUB 4L6AA 4YMIA 1WD5A 3OZIA 3QEBZ 1IOVA 3OCZA 1GPWB 2EFJA 5G3ZA 4AKHA 2HA0A 4LFCB 1SBIA 4K81B 1NQTA 4M1EA 5LCXA 4I4LA 4UOEA 1M6WA 1RLIA 1IB6A 1FNBA 1ZUNB 1RQ7A 2Z1NA 3HVJA 1IMOA 2KX7A 2RGNA 3CLSC 3DS8A 3K9BA 3KOYA 4FONA 5JRJA 1PGNA 1R0YA 4GP9A 3T9DA 2NP6A 1VJGA 4TT3D 4PNEA 3UFBA 2PA0A 4I6JA 5JW6A 1JGTA 2OORC 5T4HA 4CEJA 1KZ6A 5B4TA 1I6WA 2IPAB 2D4HA 4G25A 4MWZA 3WVNA 3VNRA 3ZU6A 4RJLA 1U2GC 1RM4A 3SJ7A 3QA3E 5A7FA 2BRUA 2NYRA 4KR6A 5I3ZA 3EXFA 3NYWA 2VWPA 1N1DA 1Z3IX 2GEKA 4E1VA 3PDIA 5D3KA 4C78A 4XCVA 4LDQA 2YZGA 1ZVKA 2I67A 4NICA 1USIA 2ZB2A 4EDHA 3SQMA 3P4XA 3K16A 5ITZB 3VPAA 2ZJAA 5CBKA 5LKAA 4D26A 1Q0ZA 2H59A 4O2AF 5TS3A 4ER0A 1KK0A 4BV2A 2PK3A 4ZHQA 2DMRA 1G21E 1H05A 1NQXA 1YS1X 1C8BA 2E49A 1YR2A 1F9AA 2W8ZA 5JH7A 5BN3A 1F7UA 1NA5A 3HXOA 1TUBA 3DTVD 3TAUA 1UBHS 3TLYA 4LRSB 3BGSA 4IAOA 1DS6A 2FYTA 4WY8A 1N5LA 2W11A 5AOCA 1B43A 3UG6A 4NV3A 3NS7A 4DJ5X 1TE2A 2Y1OA 2KJQA 4I8IA 4ZGWA 3DOEA 4LDRA 4DQUA 5CDTA 1P0QA 4NU5A 4QUEA 6REQA 3NBQA 3SNKA 4MRPA 1SFRA 2EQAA 4WN9B 3V1LA 2X0FA 1TCVA 3KETA 1FU4A 4BVFA 3NORA 4E6PA 4X7PA 5BVHA 1XG5A 2WHXA 1WB4A 5AXAA 4AMBA 1PE0A 4KJZA 1SOAA 4LX8A 3P9NA 1M8FA 4RPJA 4KR2A 3VKGA 1GUFA 3IDQA 4YI3A 4EUFA 4U2GA 2H57A 1MXHA 2HIHA 2LDBA 3OIDA 4CRWB 5EJ8A 3KR1A 4D3XA 4DOMA 4YRZA 3RIHA 1IEWA 3DO6A 2J0QA 5AO9A 2V0CA 1QQ5A 1RJGA 1A88A 1Q95A 3R5SA 1A9XB 1D5WA 3VO2A 3VR0A 5I9NA 2YN2A 2J5BA 5JJIA 3EUAA 4WBNB 1MDFA 1QHFA 1P2BA 3GY0A 5BVGB 1MJFA 2QN7A 3B13B 1L7OA 2R6FA 3PIRA 4FEGA 4PQYA 5AI5A 1D9XA 1WTCA 4D9JA 2Z1MA 4DJEC 4JOSA 3TD2A 1WUYA 1ZXXA 3EQ6A 4JENA 3OJCA 3IIEA 4O8CA 4KNWA 4NOLA 1V9LA 4IVQA 3KTAB 1JB9A 3H5OA 3R6DA 4JB8A 5HZGA 4X6XA 1JV2B 3IHTA 1KEPA 2EJUA 4IUCS 2Y6UA 3HKBA 1F20A 4Q7QA 2PO5A 4INZA 1ISHA 1C3EA 1QIIA 3ZQ6A 3WTCA 2DYKA 3C7CB 3VXKA 4G0WA 2QLNA 4O8ZA 2UZ0A 1Z34A 1LBSA 2ZI7A 4RTPA 4F5EA 4TMFA 2FQQA 2MOKA 1B0AA 1CPYA 1XD9A 2WBLC 4MQUA 3PQEA 1NRJB 2C61A 3G2IA 5GPBA 1EK2A 2EX4A 4X1OA 2CL0X 3GLUA 2B20A 2Z8ZA 2DGDA 2JH8A 2X3UA 4JC8A 3RAPR 1E8NA 1K7SN 1RP7A 4I81A 4WADA 5CFNA 4QOHA 2PRKA 4WK2B 3G2PA 2VS1A 3L9XA 3TR5A 3TZHA 4ZIRA 3DBHB 1Q3KA 4H7FA 3PJDA 1B74A 1VSTA 4G1MB 2GVZC 4DIFA 2C4MA 4EKYA 1WHSB 5TMPA 1Q14A 3IESA 4GKBA 4XGNA 2EU8A 2R00A 5EZYF 4RSHA 2CXOA 4KQ2A 3WE7A 1X1AA 1J2RA 4OQLA 4F5YA 2XUOA 3UMVA 3O92A 1H1LA 1FBNA 1XB2A 2CNWD 4WNAB 2C7QA 1VMDA 2XD9A 5FUMA 2WWRA 4KE6A 4AUMA 4KI0A 1Y1RA 3RI3A 3GPBA 5LB4A 3QU4A 1O94A 3KVNA 4U2FA 4F4FA 4LQDA 2HQ1A 2DFTA 4P0PB 3LDHA 3ZVRA 1R64A 1N2CA 4ZV9A 4DIUA 1K6XA 1N8TA 3NB0A 1O94D 1OGIA 4KV9A 5C2JB 4DV2B 1LPMA 2K2QB 2MSCB 2W2LD 3M8KA 4C4RA 5JZSA 5KNBA 2WU4A 1RRKA 2IZOA 1XCBA 3PC4A 5A4DA 4I66A 1I7SB 3U60B 4LV6A 4H2DA 5EMNA 2FW1A 1CZNA 3PD1A 1IATA 4OP2A 4BWFB 1A77A 3HCCA 1D4ZA 1ZNZA 4N82A 5DOZA 1RBQA 3U6KA 4QDTA 4XVHA 3UZUA 1K8QA 2JCSA 3CIFA 2OG1A 4U6SA 1Y1PA 1K0FA 2YHIB 2B25A 3IBGA 4QGBA 5DW3A 3ZCTA 1G63A 4BYMA 4TTIA 1I6KA 1N2CB 3LHFA 3W1VA 5A5GA 2PMKA 3SCZA 5U1PA 2FQ1A 2JS7A 4QGGA 3GMIA 1S2MA 2OCLA 2YIMA 3KZNA 3PRYA 9MHTA 1IJKA 1WZEA 2JLCA 4L0CA 1J5PA 1X80A 1P9LA 1XEFA 3WGHA 4I5DA 1SURA 1SH7A 3AGPA 3AVUA 4JT2A 4UEQA 1L2TA 2YFKA 3Q3IA 4LBVA 5JXWA 2VDNB 4Y9TA 5EQTA 2ATEA 4V3BA 1ZDMA 2C84A 4S1PA 3E9NA 4KRFA 4AAYA 4IRUB 2Z5FA 5I48A 2Z58A 1KO1A 2X14A 1JF8A 4FHZA 4GE3A 4RD3A 3WIBA 1OAOA 4J0QA 4N4AA 3WRXC 2JGDB 3CPSA 1OF1A 1QFZA 2CSXA 2FF5A 3FNRA 3VPGA 4BU0A 4W6QA 2WKSA 2BGWA 2F00A 2BMWA 2Z8YA 3EZXA 3N2KA 2GKSA 2EF0A 4FFBA 2PXHA 3RYTC 3TZ6A 4EBBA 1XTJA 3RC8A 2V7WA 3OSZA 1Q1ZA 2J46A 2ZR8A 4RPLA 3WL5A 1YR3A 1DG1G 3AI2A 3GH1A 3IB6A 4YTEA 1NE2A 4V38A 5EJEA 1OH6A 1HT0A 2DQZA 3ZCPA 3C8UA 1Y4SA 2RHTA 1J8QA 1JNXX 1R9NA 1TMYA 3I01M 2C82A 2A9QA 2NZUG 1QO0A 1Q3HA 2Z56A 3CINA 3EEFA 3O9MA 4GHWA 4LI3X 1RDFA 2JLYA 1EJ2A 4JR2A 2HXSA 5I7HA 4W7HA 3JQ6A 3D5EA 4Z9YA 4RXTA 4WOJA 4CMEC 2ZRMA 4DVGA 3B3QA 2RK3A 4LZAA 2GN9A 3T7SA 3JD1A 1CKEA 3WIDA 2CLDX 2ZE8A 4E31A 1F0NA 2G8NA 3QYAA 1T0PA 3WYEA 2NADA 3M34A 1S0UA 4CETA 1IONA 2HWXA 1M0EA 1OXXK 3IKTA 1U28C 2DLNA 1PG2A 1DARA 3IAEA 5L3SB 2O6HA 2CHVA 2FWIA 4JLWA 5H02A 1VG8A 5TY0A 1ULAA 1SBYA 3IEKA 1XROA 1ZVMA 3CV3A 4FZVA 4EA9A 1E4EB 2P0AA 2JLQA 4MWOA 1T1EA 4OVKA 5CA0A 4ZT6A 1H3EA 4PSDA 4TXLA 3UPTA 3MA0A 3EBLA 4ZAZA 1L4NA 4LOKA 2X2OA 4Q66C 3V97A 1JR4A 4BDSA 3LV8A 5CW2A 3HUTA 2EDCA 5J23A 3EDRA 1F4PA 3DHEA 2R7LA 1BN7A 1RIFA 2P9QA 3FDZA 4FVTA 3TBFA 3W77A 5IANA 3ZIUA 4ALKA 1HBJA 4DIDA 1T36B 5JY6A 2YV3A 1N0UA 2XCIA 1GG2A 3CY6A 3EFEA 4ZARA 5BNWA 3DDZX 3WTBA 1GTVA 4G0NA 4CMIA 3I2GA 4LTNA 2I4TA 2ZBUA 1LRLA 4NCHA 2MT9A 3WLEA 1Z0IA 1V8PA 4QARA 1QP7A 4JUAA 3M5WA 1V41E 3B1ZA 3BIXA 3G68A 4OHFA 1BMQA 1NKSA 1SAYA 5IM4A 4DM3A 3MJSA 5EIOA 4EX6A 4RA6B 4AMUA 4QBHA 5BN1A 5L3QB 4D74A 3V1UA 3IELA 2AMYA 5ETJA 5KCMA 5JTUA 1J8MF 5JH7B 2ST1A 1ODFA 3EA0A 1MC1A 4GSKA 3QIAA 4O4HF 5BN3B 5MN4A 2AOTB 2KSQA 3SD7A 2HN9A 4UUBA 1N2ZA 3L0IB 2RC5A 3D3QA 3OZVA 3UUWA 4W5QA 3RS0A 1SWWA 2GPSA 1E3EA 1L7BA 1OWLA 1TPZA 4OP3A 5CDFA 3QMVA 1AH2A 1RKUA 1A82A 2FFAA 1TKCA 3HVUA 3DFIA 3UCEA 3IX7A 1J0BA 2ZB7A 4Q3LA 1LI7A 1Z8NA 4KLRA 3WQQA 3G5AA 1DX9A 3IT1A 5CFOA 4NV0A 1XNRB 3USES 2Z0MA 3IVRA 1GFSA 2Y93A 4FOSA 3GGGA 3MHTA 4MZXA 1JBKA 2EIXA 4KMSA 1C7RA 1T5TA 1JLKA 3JASB 3RW9A 1SKUA 4LA4A 1GEEA 4IX1A 3SOZA 3TRHA 1AQYA 1KBQA 3H2JA 4GG1A 3G9UA 4BVLA 2VSNA 5EIEA 4I46A 2NSJA 3N07A 1QNLA 4DWJA 4QUKA 2E4XA 2N42A 2Z5LA 4UM9B 4M76B 4IF6A 3MUFA 3RS4A 4DA0A 1P7VA 1SBCA 4FSXA 4M55A 3O21A 1L4LA 3CMMA 3EZFA 5EWLB 4BO8A 2PJRA 3RD5A 3KR0A 3T6KA 1Z5NA 5BYBA 2ZE5A 2QVCA 3DBIA 3GUCA 4LE2A 2ETVA 2E0IA 1EBUA 4IBOA 2ZIXA 1KI6B 4HLCA 3QPUA 1FNCA 4HH1A 1V0JA 3R77A 1DE0A 1RMYA 1I7PA 1Z2EA 3OCYA 4YRTA 5A3VA 4FUTA 4E5VA 3DOHA 3LC7O 4N18A 4OQXA 4ZAYA 1XEWX 5J4YA 3PRKE 3KJGA 1FSZA 1ZISA 3FCOA 4PYQA 3VGJA 5AVQA 5K0SA 3R0VA 2HR1A 1VGQA 1M2NA 3MLAA 4TLEA 1YZKA 4PO1A 2YWXA 3AHJA 4BS9A 3WJ2A 2VC2B 4UUQA 1CQIB 3NHSA 4N5LA 4QXOA 5EHNA 3A2KA 3PR2B 2WVJA 2LVBA 1G19A 4B3CA 1ONOA 1F8GA 3FHLA 4AP6A 2FVXA 2VT6A 3NTOA 2WAXA 4L0MA 3MAGA 2Q1SA 3T3NA 1UAAA 1AB6A 5IAGA 3CEMA 4N6GA 2IEIA 4F3RA 3DVRX 4DIMA 3VNVA 1LSSA 1EBBA 2WNHA 5DP1A 3TIXB 4OXKA 2IS1A 1RJ9A 4O6VA 3HO8A 2CWWA 4PC3A 3ZW8A 4V03A 3MJDA 3RC2A 2OCXA 1NJFA 2CFRA 4ZZ0A 1L4KA 3R9IA 1XT6A 1RI2A 4HDRA 4QTTB 1F2TA 1NVBA 2WU3A 1T9HA 3IQDB 5DM60 2H48A 3PZRA 1NUHA 1GM5A 5G0TA 3DBVO 4GZ5A 2OGUA 3FRIA 5DP2A 3LZ6A 1W5SA 2XI4A 3CRZA 1N5KA 1FFEA 1I33A 2ZBQA 3FTQA 3GDFA 5EE0A 4DG5A 2BT4A 3BM5A 3D6UA 4DTIA 1RYNA 3G2MA 4GYWA 4QEZA 1G8PA 4X61A 5JCXA 4QPDA 3NV7A 3VZBA 4LJ5A 1K6MA 4J1TC 4XARA 3ZQUA 2NVUA 5DGTA 5BSWA 2ZCUA 4C7XA 3QW4B 4Z4IA 3H3XA 5BUZA 1FU7A 1ODTC 2XTNA 3IUQA 4WY2A 2PT6A 4IIJA 2QG9A 4Y2SA 3V1TC 1DFHA 2WWTA 3PRJA 4IDGA 5K4AA 3KRTA 3MMNA 3WKDA 1ZA2A 5JG7A 1DKOA 1MVLA 2QX8A 1JVSA 1KE2A 4C0XA 3Q85A 3OHMA 4U0JA 2L2QA 1G3RA 3FSRA 1TJ4A 2GEJA 3CURA 3QUAA 2FXVA 3UHJA 1ZIXA 4D5GA 1XD2B 4H0CA 3A58B 4RKQA 4FKBA 3HNPA 4C5BA 3BHNA 5ALYA 3BUSA 3CONA 3EIUA 5CB6A 1QU2A 4C6TB 1SQ6A 2IYLD 3OWXA 1JIUA 1O7JA 4WXYB 4WI1A 4CTMA 4F2GA 2RB4A 1SQSA 1IN8A 1D6NA 2ZS8A 3I28A 3TGPA 1H2BA 5G53C 5D85A 3CE9A 2IVZA 5L7WA 2HJRA 3BBLA 4JYBA 3I2FA 3K0HA 1KVSA 3PNMA 2P4UA 2YBEA 3VHQA 4QTYA 1MX5A 3KELA 4P84A 3SR0A 4MUBA 1XZEA 4ARZB 4HFRA 3VMMA 1X80B 3A06A 3J81k 5IKOA 1DAHA 5CTJA 5I8PA 1UINA 3FDJA 1XQWA 2H1FA 1FE8A 4IZHA 1UCFA 2OB1A 4I1SA 1GUYA 3DP9A 2OM2A 5CLHA 2O7SA 3ZUGA 4YUXA 1H42A 4GOKA 5CVTA 4GX0A 3RRYA 2IGBA 1YB2A 1DC5A 3G5LA 3I9V1 4INAA 4RMNA 3U5TA 2HX1A 5IMBA 1EX9A 3TW0A 1Y8QB 1YI1A 1ZMOA 5IEBA 3ZV3A 4F4DA 2XWQA 1FB5A 2OQVA 5ALMA 4ZRDA 4ZDKA 2BMVA 1T26A 3GZTB 1BO6A 4ND2A 4R5HA 4XM2A 1I0ZA 4NENB 3T35A 5BMVA 1JHRA 1YMUA 3DKPA 3QY9A 3BH6A 4TM7A 4RQBA 1QH8B 1S5PA 1NP7A 1G98A 3OFJA 2GZSA 3R6WA 1QF9A 1QYWA 3JYQA 4IVRA 2IIVA 2JVIA 4N5DA 5FOXA 3BXHA 4EO4A 1EKXA 5TQ0A 2I4RA 3VDXA 1GSHA 2OCAA 1XTSA 1SUIA 1LPOA 3JVDA 3AHGA 4DMFA 1P3JA 1P0IA 1BE8A 4UEKA 4D0NA 1G3UA 3OZGA 3FTFA 1ZRHA 2C78A 1PDVA 3BHIA 2CF6A 3CX7A 1RHKA 4KWCA 4UVGA 4WIAA 1CW2B 2SKCA 4Q7KA 4TMXA 1FVOA 3EMKA 2PD3A 4FFOA 3AK4A 5L4SA 3ZHXA 4ETNA 1E1QA 5E8JA 3EF1A 3AR7A 3O3OB 2ODBA 1ZIYA 1AA9A 2IYTA 4P31A 4TXJA 5D3MB 5T4BA 2JJYA 3KKKA 4QNMA 3CB4A 1AV7A 3MSXA 4M36A 3ZCVA 2EWWA 2O7QA 3QPCA 5K09A 3KQLA 5ITWA 4UBOA 2O2EA 2J59A 1H23A 2QJWA 1QV9A 1U7UA 4F6CA 3FUVA 4LUCA 1Q7GA 4R3NA 3IHWA 1YAJA 4F84A 2ZT6A 4MROA 3T1NA 3CEPB 1GG8A 1QQ7A 3AVPA 1SOWA 1HM5A 2QTNA 1GNLA 5HM8A 2FW9A 1PJCA 2HU5A 2I6UA 3BD9A 3JYNA 1WXXA 4YC7A 4AW9A 4BFTA 3AL3A 3OT4A 3ZXIA 3IMGA 4W7SA 5ICEA 5K0EA 1ULUA 4MTLA 3RVSA 1JLHA 4ND7A 3W2HA 4DSNA 5B55A 5C3MA 1N2IA 2PR7A 3D0QA 4R51A 3SYKA 1AVTA 1UDRA 3JATA 4MRRA 4GZ6A 3T06B 2GZAA 4EFLA 4FT4A 1Y5NA 4AWAA 1T9GR 1EBFA 4YP0A 3PEVA 1UJNA 3TL3A 1XALA 4A27A 5TXGA 5B7QA 5JXHA 2JFBA 4W6ZA 4BDTA 1JJVA 2BKEA 4OREX 1OASA 2H65A 1RVDA 3LLMA 2O52A 3EPPA 2KW5A 2WG1A 3RIEA 2JJ8A 1CUWA 3AG6A 4RVFA 2Q5FA 4TWIA 3P26A 1G5IA 2UUPA 4NBUA 1CRZA 1G8HA 4B74A 2X7XA 5AK4A 1FYVA 4KX5A 1J5XA 1AS0A 1KDVA 1SKMA 1U94A 3QMPA 4WLFA 121PA 2P67A 4LTMA 3ZHBA 1GZ5A 3C5HA 4W1PA 3ITNA 1LSOA 4LE0A 4HLNA 1I4LD 3RVMA 4LPSA 5CJ2A 1BS9A 4OKNA 3GNTA 2O8NA 5I7VA 1Y81A 2EJTA 1Z22A 4UU8A 3W6PA 2H1WA 1NF3A 2HWWA 4JEMA 4M0DA 5SICE 4X3PA 1TMKA 3LPLA 5CFLA 1G9TA 4S0ZA 2R2GA 5DWVA 4DV0B 4UATA 3UANA 5GJWC 3EOZA 4IMJB 4G0OA 4YUZA 1JG3A 1C1YA 1XHLA 2LXNA 2XDQB 3AC0A 4HZUA 4Q7EA 3TZEA 3ZQ4A 3HP7A 3NTRA 3H9JA 4E07A 1W76A 4TTVA 4YJFA 2VHTA 1TNDA 2UYHA 2YHSA 1Y6FA 3DDSA 2VCYA 4K6KA 1PT9A 1KDOA 2C5EA 3LK7A 3SEAA 2X9LA 1NBEA 3R0ZA 5DYWA 2QM7A 3GAFA 4OSPA 2NSYA 2NVOA 5JVDA 4FYVA 5G4KA 2FMTA 4II7A 3CEJA 4CIXA 4II2A 5GM1A 5GONB 2M6KA 3H19A 3A1WA 2VTDA 1PZHA 1KVQA 1C50A 1WMEA 2FOXA 3MT8A 1Q11A 5JQWA 3BFXA 1M67A 3BWVA 1M7BA 2ZYHA 4ZOLF 4BFVA 4RTRA 4EGSA 1B3RA 3TSAA 3E2IA 1F6BA 1UK9A 2P40A 3AB7A 3AMVA 4HDSB 4IO0A 4M0EA 3Q3HA 1RNLA 1QIMA 3UIEA 3CG4A 3ZD9A 2ZE6A 1CUVA 4TUYF 1PVVA 3VI3B 3EG9B 4DAOA 1SUBA 1VL6A 2RAUA 2VXYA 4J7UA 5A71A 2XUIA 1M6YA 1KI6A 5NLLA 4BJ3A 5IYZA 1J42A 1DQYA 3DWIA 1R8QA 4CG1A 2OKCA 3R3JA 1EFUA 1O03A 1XWIA 2B7BA 2ANBA 2WU0A 1IM5A 2WJVA 4WMLA 4BEBA 3K92A 4P34A 3G6WA 4JITA 5JAQA 1IXZA 2V5UA 3PCRB 3RODA 2V6BA 4BFLA 1TA4A 1GSIA 1CB0A 1VZ2A 1Z17A 4KO4S 3ZZTA 4ZZ1A 5B1EA 3VDMA 4BP8A 2C57A 3VR3A 3OFNA 4G9EA 1Q0QA 2XUDA 3K0KA 2FFBA 2R7MA 4BIIA 4M0UA 5CB4A 5IVIA 4D96A 2J31A 4EK9A 3PNOA 4CIWA 1GTJ1 2A9PA 3QLUC 2XJ4A 1TAGA 2QAJA 5EP3A 3LF2A 2AUMA 3FTPA 1TVMA 3AH8A 2V1UA 3IMEA 3E3NA 4XX0A 3OPYB 1AU9A 2OVBA 4UU0A 4ZI7F 1NM5A 4FB5A 1G4UR 3IQEA 4HWRA 2BELA 2GNPA 4YJ2B 2H8GA 2I66A 1OA0A 3CF6R 3GWZA 2WKQA 2EFEB 4QHSA 4CCYA 3SIPA 4WZAA 2X5OA 3VU3A 1YL6A 3RJMA 5L6LB 3HYNA 4RORA 4Q4DA 2A9VA 4YXWA 5KYWB 2GPBA 4LXIA 4HWOA 2JAUA 4EB8A 2E55A 3COVA 4I1IA 4EW2A 5I6DA 2CVHA 2IS6A 3ZXYA 2J5KA 4RE5A 2EX1A 3FB4A 5DLYA 1A4RA 3R7FA 4MCAA 1I5RA 2FPGA 4Y2GA 1Y9AA 2FXIA 5F9MA 2YOHA 2YYAA 4S24A 4Y6LA 1FMJA 2W00A 1ZNYA 4TL7A 4LYFA 2O8CB 2BDUA 4OSOA 2ORVA 1GFWA 2HCTA 4J7XA 2WFLB 3WYFA 2YVKA 2NU7A 2PUTA 3KPYA 2IPXA 3PPWA 4JSRA 4OGLA 2B4QA 3L7YA 4V0OA 3S70A 3SX4A 1XV5A 4GZLA 2ZUFA 3VNSA 1R37A 3VSDA 3A1DA 1PL6A 2PX3A 3P2MA 1CEEA 4A2QA 1WHTA 3HCDA 3I4FA 5CFMA 1E9BA 4F85A 3DPSA 4UAGA 5E0OA 1FZQA 3AQ4A 4QREA 4R31A 5F1KA 3EZ9A 1QPZA 1RYZA 1JKFA 2CBXA 2ECKA 2AF3C 4TXMA 3DTVB 1THZA 1BOOA 3JXEA 1RFGE 4WSOA 1NVEA 2POQX 1EFPA 1FUKA 2W2NA 3WK9A 3KE8A 2IS2A 2GYWA 2IPLA 3LIIA 3GA5A 4NEHB 4A8HA 1XDUA 1XZGA 5KTKA 1SG6A 2X0RA 2VQDA 3F5QA 2BRUC 2BZ1A 5EP1A 5JNWA 5A5EA 2IH5A 2IZZA 3QUTA 1YVUA 3PCXA 3PXXA 3TIVA 4GL2A 2YNMC 1GQYA 3C3PA 2XOEA 3C4VA 3MC1A 1KVUA 2CXSA 2VAPA 3ORYA 1SD1A 3OWHA 5L3VA 3EIQA 2J7PD 1WF3A 4I50A 4X41A 3PQ3A 1J8FA 4EMSA 2GUGA 5AHWA 1A5TA 4PZUA 3ED5A 1YRLA 3AOEC 3HYSA 1U8TA 1VJ0A 3V1MA 1L8QA 5I45A 4TTPA 3N5CA 3TQRA 4F8JA 1NVXQ 1AQNA 1TYDE 4BASA 1NI4A 1GPLA 3G2LA 2NPFA 2AE1A 4UTNA 2VQEB 2GM4A 4EA8A 1UBLS 3QWBA 3A6EA 1MA0A 3JR7A 4LVOA 5HCUA 3VH3A 4HGNA 1KDPA 1NHGA 3VR5A 2CJWA 2OE2A 2O2YA 2ZI3A 3PDHA 2X13A 4F4UA 5JARA 4IJQA 5B36A 1NV9A 1WBJB 3JD2A 5DBGA 3UN1A 4A3SA 4DLKA 3G0OA 1DUSA 1ONSA 2E18A 3HFRA 4D4HA 2RB5A 1EI9A 5A6SA 5IT5A 2XVYA 2O0LA 4PZYA 3VR5H 1EG2A 3GBPA 4HD8A 2IYUA 2W58A 4OFZA 4BMCA 2G70A 5JXJA 3VVBA 1M2GA 2IP1A 1NDHA 1DAOA 2NTEA 3DJFA 3KKMA 4JODA 4M9SA 3K6RA 5LOVA 2OTCA 3H2ZA 1AB5A 3ST7A 4BV8A 4H7KA 3WLAA 1LI4A 3WDSA 1PNQA 2QQEA 4M1KA 3OLZA 3S8MA 5KDDA 3UAXA 3WKAA 1YRWA 5I8ZA 3ENWA 1YR6A 4B1FA 3NC1C 2QJFA 5EOVA 1CF4A 3HYTA 4H6WA 3EVAA 4IQGA 4UM8B 3VV3A 3QHQA 4MEJA 3FPSA 1P2FA 4NMLA 4CIAA 4M1YA 3PL5A 4DLBA 2H52A 4F9TA 1WXQA 3CUUA 4EHNA 3Q7PA 4DR5B 4XM0A 3SVZA 5AW2A 5FUWA 3E9EA 2WWFA 3LCUA 4DZRA 5KOHA 3BGIA 4XW2A 4N8EA 4FQ8A 2FZWA 3E23A 4DQXA 4DW8A 1NT2A 2N0SA 3NH9A 1KSGA 4YRAA 1K98A 3AEZA 4R0VA 5B64A 2G09A 1UZNA 3O3NB 4HAVA 4ZDWA 3VKFA 4DE5A 2AA3A 3NDIA 1NVUQ 1X6VA 4GUAA 5J4VA 5KSOA 1O57A 2INGX 2UYCA 3K9CA 4D9CA 1UC8A 5PGMA 3ZWWA 4ESOA 2FPOA 2ACWA 1EAYA 2EDAA 2UZ1B 1D1QA 1XTZA 3NALA 2ETXA 4LY6A 2QI9F 4LXXA 4H15A 4MB2A 4UTOA 2C9CA 2RARA 4OBEA 1ZOIA 3IXMA 2VT2A 3FW1A 4IUDS 1ZGZA 1AHHA 1NN0A 4KAXA 4OO3A 2NTYC 2WJ6A 3LFTA 1JLRA 4CN9A 2I6QA 1MFPA 4QOEA 1RZ3A 3U3DA 4ZI2A 2HWUA 2IYFA 2F8MA 2R6JA 3LLCA 3OU2A 4RK5A 4HDCA 4AJHA 5LP6A 5L4NA 4PXSA 4EJFA 3DF7A 4ZT7A 4NJEB 4DEYA 4QBKA 1HYGA 1NZFA 2FZKA 1QAMA 5K6AA 2FFRA 3N0VA 3T3HA 1EDZA 1YASA 2R2AA 3GEBA 4IF4A 1BH2A 5AMXA 3ZKWB 2HSDA 2JLAA 2XHEA 4OYYA 4PHFA 5EIWA 3I3SR 1OC2A 3LFUA 5T67A 2Q62A 2I87A 1W36C 3H1BA 5KU1A 1UUFA 3KQUA 1TK9A 3I4LA 4CF6A 1AIPA 1GLGA 2A30A 5J40A 2IWRA 3SE7A 4COOA 2Q3EA 3KKNA 5JWOA 2VNJA 2M6RA 4ISCA 4PSCA 1XTKA 5NULA 1D0SA 3A9WA 1HNXB 5EIAA 4E2XA 3TWOA 4NVRA 3HDJA 4LJKA 1XZHA 2PGJA 1TRKA 5FOVA 4JKYA 1NC1A 3N9IA 3PNKA 3PXGA 1Y7IA 2DX7A 5CFRA 5AM0A 4G65A 3J81A 1AD2A 1YJQA 2FRXA 4R40A 3FPHA 3R2JA 4H17A 4TS1A 4Y6QA 5KVQA 3ZJ4A 4C07A 2WDPA 2FWAA 1ZRSA 3ESAA 4LI0A 1C1HA 1T9DA 1XLTC 2KMLA 3MINA 5AIAA 2FW6A 5ARCA 2I55A 4J1SA 3CKMA 5C81A 1T2FA 1Q7BA 4Q12A 1SQGA 4DMKA 1QG6A 3OPVA 1N0HA 3DEFA 1UM9A 3JCZA 4YAOA 1RC1A 4J8PA 1C7QA 4HGPA 1SUEA 2CLMB 4XJSA 5IYZB 2R5NA 3DZJA 3ZD6A 3L7BA 3GVPA 3DTTA 1Z0ZA 5HUHA 3DR3A 3DTNA 3ZDCA 1BMFA 4HNSA 2IU3A 2QSJA 4RJIA 3UF0A 1XJCA 4B31A 3DYIA 4FS8A 1E2HA 1P7YA 4G41A 4AJEA 4NKRA 5AWFC 5JY1A 4X54A 3IAXA 4UREA 5HUJA 4B81A 2C58A 2I0FA 5ESRA 1P3DA 3L07A 1R9JA 1JMVA 4I4TF 2XA9A 1X7XB 3EFBA 2Z2ZA 5LMCA 1OTXA 4NYMQ 1UXGA 3KIPA 4BATA 1ZD1A 2H5EA 1ZD2P 1T9ZA 4ZEVA 5M7EA 1I7DA 5JALA 1Z5PA 4QPCA 4B3GA 2BMEA 1RLJA 4Z4CA 2ZG6A 4YCNA 4K46A 4FYIA 2YVUA 2CN1A 4P4SB 2IYPA 4RVCA 2R7KA 1P0MA 3R74A 2PX2A 4JJ8A 4K7JA 4XSGA 2AJLI 3P20A 1SU4A 3OUTA 4OBBA 4PBTA 5E1OA 2R65A 3RFVA 3U1VA 4LHXA 2NO6A 1MPXA 4KMRA 2OD2A 4YJ2A 3IEIA 1XMIA 2AV6A 2PT5A 1ESZA 1KKUA 2ZSUA 5DBOA 4CFSA 2LKDA 3JQ8B 1DI0A 2FGKA 4ZU3A 3FPFA 4Y0VA 4ERNA 4G5GA 4CMEA 1T4CB 1QVWA 1SU7A 1NSFA 1PTJA 1Z2PX 4RTJA 3QELB 3ZE0B 3ZZ0A 1DRJA 4KR3A 2CHQA 5UKDA 1A7JA 1KMIY 1D7OA 4EFNA 2CLFB 2HDHA 3LZCA 2IUTA 2P2DA 4KFRA 1OWOA 4GW3A 5TEWA 3EK2A 1X42A 4QYSA 1D5CA 1NL3A 5KTPA 2ZRQA 3HPQA 1X77A 2HK6A 1SG9A 3IOCA 4XDHA 3SYNA 4O2AB 3ZTWA 4BV3A 3ZHSA 4I6EA 1G18A 3B6IA 1XSEA 1IOLA 2IY7A 3H86A 4GM4A 5A3QA 4FGSA 4BZWA 3BK1A 3U3JA 1A71A 1BWSA 1UQUA 4IZ6A 2H4ZA 2XRFA 1QGOA 2DT5A 5EXPA 3CCFA 2OHFA 1T1JA 3SMQA 1RIIA 2IOYA 2KB0A 3N6XA 3R7AA 1IN1A 1GHTA 4WESB 4TPKA 1XXHE 3FPAA 1LBHA 2WA2A 4MCJA 4YDHB 5AFSA 1JJFA 4CQLB 1U3UA 4FQ7A 3BZUA 3D3KA 3F6RA 3D6HA 4JHLA 1Y8ZA 2AG0A 1EQ2A 3OA0A 1NNSA 2QUBA 1WL8A 3OJXA 4YQYA 5JMTA 3KG2A 3T15A 2MSNA 4GOJA 1FOEB 3R09A 2PSSA 4YRRA 5KTOA 2DKNA 4B84A 4WN3A 4GX1A 3L92A 3RLIA 4XFDA 3GVXA 1X9IA 2LV8A 1QM5A 3VNUA 1O95C 3U17A 1NT4A 2ZYGA 4IKEA 4ZOAA 1YBVA 3IPAA 3U62A 3KR2A 1H1TA 4DXHA 3E3OA 4N5HX 5C7OO 3VM6A 3SMVA 4TUYB 821PA 4X64B 3T7CA 4LMRA 2B6NA 2HLDD 4OD0A 1O94C 1TU4A 4LYJA 3ZVLA 1ZI9A 1XKTA 2XXBA 2YN4A 1NXOA 5JAPA 1DXYA 3K4PA 2J3EA 3QFSA 3IKVA 3QFCA 4UU7A 5EZYB 4CQMD 1JG4A 4NNJA 3JVVA 4BRZA 2H3EA 2C04A 3F3KA 3F3YA 3G0IA 4AZ3A 1NP6A 1MTZA 2CCGA 1DCMA 1ZK0A 3BDVA 3X0DA 3B6ZA 4TYWA 3CRQA 3WL8A 5K3EA 2A94A 5I01A 1ABBA 3VPDA 3V1NA 4DG9A 5HNKA 1FEZA 4IWNA 1TJNA 2VI5A 3AV0B 1K4YA 1M3SA 1CUCA 4NBSA 4NHEA 1MENA 4OXNA 3N8GA 4YHBA 1A5SB 5K1ZA 4OBXA 5C4IA 5GTDA 3Q9UA 4G1BA 1M2EA 2AG5A 3KJIA 4PZEA 1AGRA 4ZTUB 3D6MA 3VBCA 1GZUA 2ZUSA 3HKCB 4H4EA 4AZ0A 2X5JO 4D8VA 1N2XA 1DPGA 2G7ZA 2HMSA 3BWMA 1HDEA 3B52X 3ZWNA 3KJHA 4BMSA 3EYAA 4BJ6A 2XMDA 4HZIA 1QFXA 2Q45A 4N8SA 3U4GA 5JAHA 4PONA 2BC9A 5F78A 4F3CA 4K2HA 3LY7A 5JSZA 1QKJA 1TUIA 2O2SA 4AU1A 4EHIA 5JD5A 1L1RA 2R9VA 1H1DA 3P27A 3ZDXB 3LE8A 4AURA 5KOHB 4FYKA 2EBUA 1XCOA 3ZD8A 1P45A 2HEGA 2AQ8A 1A5AB 2ZQ5A 4M98A 4OI1A 1J21A 2IE8A 1VHTA 1I14A 4ZYTA 3H5TA 3G0HA 1GCOA 1I2BA 3F9RA 4HUQA 2J9XB 4QU5A 3AKYA 4A6DA 2C83A 3UK7A 4B3FX 4XIFA 5K0NA 1E89A 3VOAA 2APJA 5LQKA 4JSTA 4QFBA 2ZVQX 4ZO8A 4BNFA 2GPWA 1V11B 5EIBD 3PIIA 4AY4A 1XA4A 3G8BA 3QXSA 2QRMA 4B6GA 3H9EO 2JCGA 4D98A 5JC8A 3KWMA 2WYWA 4D9NA 2ZVPX 1BE1A 3B1KA 5JROA 4ND5A 3RT9A 2NZ8A 4FBMA 4GP6A 4ZAXA 3KPVA 4WZ6A 1RQRA 1AUPA 2PRZA 4RLQA 3UWDA 4Q19A 5C1DA 1RXYA 1KI3A 5FFNA 2OILA 5SY9A 5F98A 1Q91A 4NBRA 2P6RA 3AR2A 4ZT2A 3T7EA 2ZSEA 1IQPA 1DRVA 1TT5B 2NU9A 5BQOA 2JIBA 1W88B 1UBMS 4AF8A 4D9FA 1FDTA 4IDNA 1J0EA 4XIYA 3O94A 5ERYA 3AO0B 4QU9A 2WJJA 4YH1A 1RE0A 4NZMA 4BMVA 4KYVA 3ADBA 1FP4A 2QZ4A 3GFSA 3I3OA 1C2YA 4Q34A 3RIMA 1Z82A 3KHTA 4NXMB 2Y8EA 1XZ8A 4X7BA 5DW0A 1QOPB 3LWDA 1BMDA 4MQ5A 2YHAA 1T6BY 2WMOB 4FMPA 3Q72A 3QLVC 5IFKA 1CR2A 2GRUA 2Q8NA 1Q1GA 2BGMA 3H0EA 3K0SA 1W88A 5DHPA 1OFUX 7REQB 2V6IA 5EJ9A 3RS7A 3I62A 1Z6PA 4WQMA 2CK3D 2GK3A 4IHKA 3HXQA 1I2ZA 1J1UA 1CEQA 2AS0A 4M0FA 4HGZA 4OLHA 4PX3A 3UYLA 1PQYA 3WZ2A 1JR2A 3CZRA 2Q2QA 4CR8A 3GQBA 4ITRC 4TQ9A 1QOZA 3X1WA 1FA9A 2DLDA 2FPKA 3A9VA 2BBSA 4WJLA 2O05A 1L7MA 1UBCA 2CHGA 3I39X 4W63A 1LF0A 4HNAB 1J56A 1I9CA 2QAGA 3E4CA 7REQA 1PBNA 2QUAA 4LBWA 1VDMA 1CG6A 2GA9A 4NL4H 2OA0A 4NMMA 4C0SA 4EG1A 4J0IA 3KQHA 1YZYA 3CT4A 4YJ2F 1OXTA 5E3IA 3QRWA 4UZEA 1A8UA 1O3YA 4BVGA 2JFXA 1Y5IA 1IY0A 1ODSA 3UK2A 3COWA 2VLBA 4UBKA 4MINA 1QIDA 1WHTB 3FBWA 3K3PA 4Y1GA 1FTYA 1Z2DA 2Z4SA 4CT4B 1T24A 5FH9A 3V3TA 2X15A 1GT91 1ZWLA 5EGNA 3FLMA 3U81A 3MGAA 2G04A 2V8BA 3WY9A 1D04A 3JQGA 4H3KB 5H68A 4ENWA 1CHNA 1O58A 3IRUA 3DKKA 4LIPD 1T9GS 4CDNA 1DHRA 1S4MA 4EFMA 2HT1A 1BCRA 2DUJA 3TZCA 1JQEA 4NU6A 3WV4A 1K7FB 1TZJA 4OJKA 4RTKA 3T9EA 3HYRA 1PZGA 1TAHA 2SKEA 2WAOA 3SF0A 3ADOA 5DT9A 4DCTA 4EZBA 4RY0A 1EK5A 3IP3A 3SHQA 4GF5A 3LRXA 4MA5A 1UJ6A 1JAXA 4U3JB 3JAMA 4I2VA 3U9LA 4EB6B 4ZICA 2H31A 3AJRA 4QGFA 1IUOA 5EKUA 4MKXA 5FI1B 5HQJA 2NU8A 2DWPA 3ZLUA 4ODIA 1LK5A 1TKRA 3UY4A 3T5TA 3BZWA 1Z7YA 5LMUB 3Q8LA 4AO6A 4A92A 3NAGA 4RPIA 1L3CA 1SCBA 4JLJA 2PSEA 4CT0A 3A2MA 3Q4GA 3I8OA 4LZPA 1JEAA 2GFIA 1ESCA 2X5XA 1ZIPA 4DRXA 4BLWA 2Z95A 2HMUA 2WTUA 5EMJA 1JIJA 5FPKA 2ZYRA 3GGCA 1CHDA 4BX2A 1XJQA 3ROKA 4DUPA 2F43A 4IIGA 1GKYA 5DXJA 1L5FA 5AW3A 2PUJA 4IM7A 3AUFA 3LDUA 5KX5A 3LY8A 3ZBUA 3TF5A 1Z4LA 1JDTA 2RGXA 3PDJA 4YR9A 2F4VB 3WX0A 2AYYA 5C8YA 5KTSA 3RFUA 2IYZA 4CEIA 4KQCA 5IZ4A 8ABPA 1CEXA 2W0MA 1Y3DE 2V5AA 2Q2VA 4RPCA 4ZO4A 1FUYB 5C51B 3F6PA 5EG5A 5JAZA 3D8SA 3IDAA 4NP6A 1W30A 3QZUA 3O1LA 2PWAA 4QDKA 5AKHA 4ZV7A 1A76A 2H9IA 3F6SA 5BNZA 1JHAA 1Q0LA 1R0BA 4O33A 5KTMA 2VUSA 4NCAA 4IKPA 2C3YA 4TQAA 2ATCA 1UMKA 1ISIA 2P77A 3B36A 3H42B 2DPHA 1XVUA 1Z6TA 1RWOA 2CL6X 3PHGA 3RRFA 1SCAA 4Z49A 1OZHA 1A8IA 2XGJA 3GN2A 3C45A 3TAXA 4B8WA 5LLSA 1WCXA 1R4AA 3ENKA 3LCCA 4MVJM 4W99A 2OSVA 1Z2OX 1FNNA 1QLWA 1KZ9A 2QPOA 4R1PA 1LPSA 3U37A 4DIEA 2J85A 2QJRA 1O5IA 3LVBA 4TYNA 3ONEA 3RKSA 1CIPA 1EZ4A 1GDDA 2C29D 1DXHA 3Q8KA 4V02A 4DA8A 2OZLB 1LW7A 1SHTX 2G36A 1TECE 3GNLA 1TK2A 1L5OA 4RV4A 3ZYZA 4K1LA 3HCPA 1BVUA 2I3GA 1KJWA 3AHEA 3MWJA 3DAHA 4I99A 2B8NA 4BLSA 4C5CA 3SFTA 1CD5A 4RVGA 4J07A 2E1PA 1Q6ZA 2QTBA 4PC1A 5BOSA 2Q8PA 3DLIA 3OQPA 1N1MA 4B73A 5A3JA 5FBVB 3BN3A 4L8WB 4LMBA 1XZKA 2BYTA 3ZDBA 2WTAA 5H8WA 3SYRA 3DBRB 4P93A 5JO9A 1W581 2CNWA 1R6TA 5HIJA 4ER6A 4GKKB 4V2IA 3LQFA 4Y2YA 3GDWA 4DLSA 1YA6A 3I1JA 3BB4A 3BIJA 2FMXA 5DNVA 5CAEA 4LSZA 2CDNA 2OBMA 2EW2A 3OZUA 5EE1A 4EGFA 5BYAA 1W6RA 4XQEA 1GGKA 5HBGA 3OKCA 1QO9A 2P4QA 3NOXA 4MUMA 4QSMA 4KGXA 1BMTA 2CBGA 1S4QA 1PZNA 3RK0A 2FWMX 4BNGA 3MIIA 2PFSA 5HK8A 5I8WA 1HYHA 4RNDB 4I4IA 3CZQA 3JW8A 4LMPA 3VZPA 1ONPA 1T8WA 2G83A 4TXNA 1J09A 2DCUA 2Q6TA 1CUIA 2VN8A 4AWBA 4KWEA 2BJHA 2OV1A 1C1XB 4I1UA 4EMBA 4UXIA 1Z28A 1U5BB 4D99A 2NW6A 3Q5DA 5TB5A 2ODQA 1PR6A 5ISMA 3R7SA 1U1EA 1KAOA 2PKCA 3EGWA 5KNLA 2PE5A 2FRDA 3KTDA 4JR0A 3C6KA 1ZVQA 1PGPA 4B2IA 4EEKA 4EZIA 2B3TA 4JSYA 2ZYSA 2RCNA 3BGOS 4MLPA 4QYMA 1FYFA 2QUJA 4EPVA 2HWYA 5IC4A 3HHEA 1NFRA 5IK2A 2HU7A 4WJKB 3UM9A 3WGKA 1NAIA 4C0WA 4D6YA 2QZSA 3NPMA 2QTAA 3G3EA 2GPYA 4PVDA 1ISRA 3K05A 3L43A 1SVOA 2YZ7A 2MYTA 2R1VB 1HSOA 3H17A 3MFYA 1MKYA 1ZCBA 4TLLB 4D3YA 3KDAA 2VVTA 1M74A 3DE4X 5FUBA 1ZINA 2PD4A 2EX0A 3G88A 5J2UB 4HUJA 4HZUB 3STHA 3FHJA 2RHHA 3X1JA 3K6SB 4QPNA 4CTKA 1T1IA 5D51S 1W9HA 2VPQA 2XUPA 3G85A 3W6OA 1U4SA 2SNIE 1VJ1A 3CVJA 1V47A 3K0CA 5A06A 1GAXA 1Z4OA 3GJ8A 2GPNA 1HSZA 4JXJA 1BGVA 3GRFA 1KJYA 3K9FC 2C5GA 2LIVA 4UNQA 2H54A 1M0SA 4R2WA 4PNZA 2ZUEA 1U9ZA 1KI8A 4WH0A 3THYB 3DC2A 3WGUA 4V1CA 1XZLA 3LC1O 3DMNA 4UFNA 6NULA 1M8GA 3NP7A 4LY0A 1D3AA 4MK4A 4CU2A 4IS3A 2HJHA 1YI0A 1YRBA 2I3DA 3MWLA 5B1HA 1W59A 5JZBA 3P0FA 1NF8A 1X1SA 3D3WA 4IG4A 4L8LA 5JVDF 3C3WA 5MGBA 2Z2YA 1G6OA 4D56A 4F3NA 5IUNC 3DUFA 4TRNA 4YRNA 1HE2A 3FWZA 4CV2A 1V5GA 3FVQA 3I5AA 3WWZA 2PBZA 2XR1A 5K3OA 3K1YA 2HF7A 2BFEB 1WE2A 2PLWA 2SHKA 3UXEA 1A4IA 1E2QA 1GR0A 1GEGA 3FCCA 3HRHA 3EGEA 3T7RA 1TLTA 2PCLA 4HNUA 3NOVA 5DNDA 3ASVA 4MDEA 3NUZA 2K7ZA 5AXCA 5L7TA 4LJRA 1BX1A 3DL7A 3T3IA 5B3AA 2F1JA 1Q1AA 1K8RA 2GX6A 3E1KA 1PQUA 1QYDA 3CT6A 1N9GA 1ONBA 1YA8A 4PNPA 4YXWD 1YIAA 1BXKA 1K86A 4KI7A 3GLQA 5EA2A 2GGSA 2AOTA 4XQGA 1U9IC 1VBNA 2O48X 2ZRAA 4DBLC 4JI1B 1B2LA 1IU9A 3IHKA 2OAEA 2Z3WA 4YP6A 5GY7A 3WMRA 4QOJA 5D00A 1E5QA 3ZHUA 1YZFA 3Q6IA 3M6WA 3KU1A 3QA9A 4TOIA 1N7JA 2AOXA 5CNJA 3CFYA 4XDYA 4FILA 3N2ZB 4HK4A 2G4LA 1DEOA 3A0RB 4FW9A 2GEUA 4HNAA 4K9DA 4U7FA 3QLJA 5AK3A 2GF9A 1H0SA 4IMRA 3IA7A 3WWEA 1V95A 5HQ3A 2PFGA 5CT6A 3Q15C 2VHVA 3TTWA 1P74A 3I1IA 1F5NA 3IPYA 2QT0A 4OG2A 3ZWMA 4BTEA 3QMMA 4Q9JA 3UVEA 2OGSA 1GFZA 3JX9A 4B3MB 4RF2A 1AQUA 2P9TA 1DDOA 2H8KA 5B6PA 5TT0A 1H5NA 2P9ZA 5K3CA 2XW6A 3TX6A 1V9CA 1Z45A 3FPEA 3HUFA 4PC6A 3SHFA 3PC2A 1JQAA 4IDOA 1K1EA 1TJYA 3O3CA 2ES4A 2ERXA 4L4RA 3OE5A 3LECA 1ZH6A 5T3UA 1HG1A 4FIDA 1A4UA 1LQ2A 3ISJA 1B16A 1WCWA 4PG5A 4D0SA 2VCEA 5DHFA 5EJIA 4ZYWA 2IUFA 3TFWA 2VF7A 4D2IA 3A6LA 3IIIA 3PGA1 2H85A 2RKBA 2VWGA 4JIMA 1WTAA 1ODKA 4S2UA 4ZYUA 3FHOA 4P35A 4AP5A 2AI1A 4TTSA 5GOTA 1LH0A 1K08A 4RSGA 2BGRA 1E2NA 2YX1A 3H83A 2NU6B 2VP2A 2WC1A 3L9WA 1KP9A 4QYIA 3U40A 4F4IA 2VDMB 2QZJA 3AYZB 3DZIA 4AJ1A 4CM9A 5CEEA 2WJ4A 5BSTA 1YDEA 2YWJA 4MAMA 1TM5E 3TQFA 2HHLA 3F5MA 1O0BA 1U7TA 4AUNA 4N65A 2AMLA 4G26A 5DVZA 3W5HA 1GNRA 2J48A 4INPA 3N2NA 5LQAA 1QXSA 3SHVA 3VDRA 2BEVB 2ONCA 4OHOA 1SHUX 1LWOA 1WLSA 2VXOA 4B6PA 3ZGYA 1COZA 4CGYA 3MGGA 2PKYX 4Y30A 4B3IA 5CB8A 3VZQA 2GN0A 3T38A 3PNVA 4RIHA 1XPUA 3VYTB 2HMYB 4YASA 4YV1A 2FPUA 1AS2A 1TLFA 4UAJA 4Y2TA 3RDPA 1M1UA 4W7IA 3V33A 4KITB 5KQGA 4L4UA 4F46A 2CMFA 5JCZA 4B17A 3F7NA 5ALSA 2WB2A 1VCNA 2H1SA 3A3KA 1S89A 4WBSA 1BH6A 4FW8A 1NMEA 1XL1A 3ORQA 2OZVA 4CL0A 2C00A 1A97A 4PHGA 5EIFA 1SC3A 2OZEA 3PGXA 4LISA 1YB5A 2B1JA 2UUAB 1E99A 4KIJA 1JECA 3EIFA 3BSYA 3PF9A 1WPXA 3OM9A 2VDPB 5DHRA 1M0WA 5CYOA 3SDZA 1KHTA 1C9MA 5AW0A 2JL1A 4BFSA 1B8NA 2P9FA 4EGCB 4CEHA 4PRYA 4YV0A 1R0XA 1BDHA 2AEMA 2QUIA 3TMKA 2RHLA 1PCXA 1V5IA 1WDWB 2NZXA 2Z8XA 2FZGA 4XD7D 2VAMA 4IQ0A 1EIZA 1E63A 2J8ZA 4RZSA 2PMEA 2GZ1A 3HKCA 3LPAA 1SXJA 4KXMA 3BL6A 3D6VA 4Z4HA 4MMZB 5BXYA 3LU1A 4ML3A 2XKKA 2O8DA 4AY2A 4FGLA 4J0KA 1HLDA 2HRZA 1W8IA 4REQB 3EULA 1JR3D 2ZROA 3GH3A 4TWZA 3SC4A 2WQ6A 5FD8A 2J0VA 1J9GA 2WY2D 1B8OA 5IH7A 3LL7A 2O3QA 4Q4HA 4X60A 3ZDZB 2W43A 5IFLA 2GDZA 2ZU0C 2PDAA 4O5OA 1FQWA 1Z47A 4DLAA 2OFOA 1R9GA 3KKQA 4YCLA 1G7TA 1J2JA 3E6AA 3MK31 4A26A 5C4GB 1HZJA 2YDYA 3IAUA 4BO7A 5BOSB 5K6AC 4TYYA 4NULA 2O59A 4M4SA 1P4AA 1UODA 4XFKA 4RVHA 3COYA 3L0YA