5PGMA

Saccharomyces cerevisiae phosphoglycerate mutase
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOGLYCERATE MUTASE 1
publication title Sulphate ions observed in the 2.12 A structure of a new crystal form of S. cerevisiae phosphoglycerate mutase provide insights into understanding the catalytic mechanism.
pubmed doi rcsb
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 1998-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5pgmA00
1TIPA 3NFYA 1UJBA 3QPWA 1NT4A 1C80A 2P6MA 3C7TA 4ARSA 2AXNA 5AJXA 5CX4A 2P9YA 3IT0A 3GP3A 3QPUA 2P30A 1FBTA 3E9CA 2EKBA 4MA4A 1DKQA 4PZ9A 4EMBA 3D4IA 3IT1A 4ARUA 5CDHA 5AJYA 3D6AA 4D4JA 2DWPA 2ENWA 2P77A 1QFXA 1QHFA 3DB1A 1RPAA 3F3KA 2PA0A 1DKNA 1T8PA 2A6PA 1V7QA 2P79A 4ARVA 2H4XA 3IT2A 4JOCA 1H2FA 4E3WA 3LL4A 4JOBA 1CVIA 1SK9A 3F2IA 3GP5A 1RPTA 3EOZA 1YJXA 2P75A 2WNHA 2P2ZA 4TSRA 2P2YA 2GFIA 2HIAA 4QIHA 2P9ZA 3HJGA 2F90A 1QWOA 2HPAA 2H0QA 3PGMA 1FZTA 1DKPA 4FDTA 4AROA 3K4QA 3FDZB 2H52A 1E58A 1ND6A 1DKOA 3K4PA 4EO9A 1UJCA 3MBKA 4JODA 4PZAA 3FDZA 4D4MA 4FDUA 3NTLA 2DWOA 3GW8A 1DKLA 3FJYA 5CU7A 3BIFA 4D4LA 3E9EA 3EZNA 2OWDA 1K6MA 2P6OA 1RIIA 1XQ9A 2QNIA 3D8HA 4D4KA 1SK8A 3LNTA 4GPIB 2A9JA 3MXOA 2P78A 1EBBA 3E9DA 4HBZA 1H2EA 1V37A 5PGMA 3QPVA 1SKAA 1YFKA 4IJ5A 2OWEA 5AK0A 2YN2A 2ENUA 1C7ZA 3KKKA 1BQ4A 2BIFA 5HTKA 2WU0A 1C81A 3LG2A 5AJWA 1IHPA 2IKQA 2HHJA 2RFLA 1BQ3A 2EKZA 1SKBA 2I1VB 4IJ6A 4PGMA 5HR5A 3IT3A 3OI7A 4GPZA 2WNIA 4ODIA 3ZHCA 5AJVB 1DKMA 2EOAA 3DCYA 5AJZA 2H4ZA 1E59A 2P9FA 1BIFA 3O0TA 2YN0A 3R7AA 1ND5A
chains in the Genus database with same CATH superfamily
1QR2A 3EXEA 2BHLA 2ZAYA 5B5SA 3OZWA 5CNKA 1FP1D 1QANA 1V1RA 2ZAGA 2GD0A 1HL7A 2GJSA 4ZVUA 2O1EA 2Q2NA 4A73A 2SCUB 2GJ9A 2PJDA 1YONA 5K4HA 3FOAA 2D74A 4U7PB 3MWFA 1CQJA 4MGZR 2NNLD 2H06A 3DE0X 1MC1A 4XIFA 3RVDA 4D26A 2HUPA 2W11A 4JEMA 2HNKA 4IIYA 10MHA 1S7CA 4HQKA 2C1ZA 4PG7A 5ECGC 2VDNB 1KERA 4AQYB 1VL1A 3H5OA 5I47A 3KPVA 1MAWA 4B32A 1CHNA 3EA0A 1BCRB 5CW2A 2PCLA 1XHEA 4L5CA 4F8EA 1SZDA 2I4MA 2WV7A 3LHSA 3MTBA 1JTEA 5JSZB 3L7JA 3UHAA 4ITVA 3TB6A 1R5JA 4IFIA 4PHHA 3ET4A 3SKVA 1GAQA 4FZVA 2AHOA 4WBNF 4UOQA 3T9BA 2AE1A 4CKWB 4QLBA 5BUSA 4P53A 3B3JA 3OQNA 4G5SA 4LRUA 5DSTA 4RK4A 2VWQA 2VXYA 4M1ZA 4R1NA 3UFXB 4C21A 3V8MA 1Z8DA 2NO1A 1ZL0A 3UHPA 1CUXA 1SOWA 3D8NA 2ZB8A 1GR0A 1AUXA 2BM8A 4QPPA 5FWDA 1WDKA 4B4WA 1BVRA 1OYOA 4GXTA 5E6RB 4FQ5A 1RYDA 1ZL2A 1XEWX 1ZBQA 4P2GA 3SYNA 3SY8A 3T3HA 3ZWPA 5JS6A 5EMKA 5KQPA 1JX6A 2PX5A 5A05A 4B71A 2N75A 4LOKA 5JD5A 1E7RA 3GLIB 4CTJA 3AR4A 4S04A 1NW7A 4DPKA 1KAQA 2QJTA 3IAS1 1KI6A 3SE0A 4XX1A 4HGPA 4N5DA 1RHUA 4TMVA 1SUCA 4R9RA 4IIFA 1ZVKA 3CPHA 4J7UA 4P4LA 4RSRA 4BMZA 2IY7A 4CKEB 1RYBA 4O5OA 3GRVA 1NJ6A 2AWNA 4IIXA 2GEKA 4JLNA 2EDAA 1I5EA 3D6FA 3D7SA 3NHKA 3I42A 4LC0A 5A06A 2XUHA 3BSWA 2IPXA 3W5DA 1EFLA 5EIHA 4X1OA 1F3OA 1V45E 4X1YA 2RJOA 1C1DA 2G5PA 2Z2KA 2XQGA 3H1TA 3L92A 3ZXSA 3I9FA 4EAAA 4IZ6A 1XZGA 2DCUA 2QRVB 3NTQA 5BR4A 4A27A 4UBOA 3K9GA 1TQHA 5HBRA 5CEJA 2VYQA 3K70C 2C82A 5K4GA 2JHFA 4R7GA 1RBMA 4IV8A 5EMJA 4CM1A 1IUNA 3L9XA 4HQ6A 2ONKA 3FE2A 3PVZA 4IHKA 2ZJ0A 1UDRA 3IILA 4IDOA 3V2GA 5LYJB 4BKOA 1YO6A 3QZUA 1JVNA 3GLRA 3HKDB 2O7QA 4GNRA 3TR0A 4B3CA 4QASA 2YC4C 4Q37A 1DWQA 1NFQA 2ZB2A 5BV0A 1RPZA 1IWOA 2RBGA 4JBIA 4XWKA 2FJ0A 2J9FA 1ECJA 3CPJB 4M8SA 3WO0A 5A2GA 1L4KA 2HMSA 4BUCA 3GHYA 2XTZA 3OU7A 1HL3A 4F85A 1PGOA 2ZTHA 3Q7TA 1F2TB 3K8ZA 4FFBA 4HY3A 5SZKB 3TMAA 4CKYA 3M83A 3RTCA 4YRAA 4AULA 3PE3A 1RYHA 3RVJA 1E94E 1FZQA 2C00A 3JW8A 4MI3A 2DETA 5IJ9A 2GGSA 3L6EA 2A58A 4M1EA 2HYIC 2Q46A 3Q1KA 4I50F 1JJVA 4KFSA 4RIHA 3B36A 3FF4A 1JECA 4MZXA 5J4KA 1O95C 1R3DA 3P2OA 1KPHA 5C1BA 1D6MA 4EGAA 3I5MA 4ARSA 2CNDA 1UXJA 1ZFNA 3E7DA 3EWAA 2PMFA 2I3ZA 4JKYA 1K66A 2CSXA 3OZFA 2V7TA 1ISHA 4Y2PA 4YX9A 1AK2A 1NUUA 4QARA 4FZ5A 1QG4A 4PVCA 1TJNA 3K09C 1K4MA 4EA8A 2AN4A 4X62B 2JH9A 4NOMA 1P33A 3A6ZA 3PQ8A 1VPDA 1GZHB 2VHJA 1BYIA 1U28C 2E6UX 2QMEA 3AP3A 1LF5A 2PA0A 3JWPA 1VPTA 2FVXA 2O4CA 1EFVA 4R7TA 3T38A 2JEZA 5G1NA 2ZKIA 2OPBA 1FP6A 3EDQA 3P45A 1PSDA 4JH0A 1F06A 1WY7A 1DKNA 3F6BX 3WQBA 3D8SA 5KYXA 2P3OA 2Y0BA 1YT5A 4CBVA 2VLIA 1YAHA 1CULC 1ZKDA 2OP0A 3PNVA 3TEJA 1Y7PA 4BO2A 2GPNA 4MRAA 3ERCA 2NTVA 5JYCA 2AG1A 1OLSA 3G9TA 3ELBA 4EHNA 1ZI6A 4BB6A 2FEKA 4BEBA 2PX8A 1G38A 4KVFA 1ZD4A 4IH4A 3U7IA 2MMGA 3A2NA 4MARA 5TDHA 3WOVA 3K96A 3QKRB 4IJQA 3ZOKA 4P83A 4F86A 4AVYA 3D4OA 2QD4A 4BLUA 5K8TA 3HO1A 1H85A 5LLTA 1S96A 4EJMA 2XLCA 5DYYA 2W6JA 5GIOE 3IBSA 4KQ6A 2PUFA 3CZ9A 5T4HA 2BTQA 5TQJA 1EGVB 1MGPA 3H83A 1RXIA 2CZGA 1FSZA 4JYZA 2VC2B 2ID4A 3QNWA 4ZV4A 4RESA 3SHTA 4DY4A 4DA6A 1QIEA 4B81A 4UNPA 4FMDF 5FJIA 4HLUC 4X8LA 1XFAA 3MNFA 5FUXA 1KOFA 1VP9A 3C8UA 4RHUA 4WXRA 3O4RA 1SBTA 1K08A 4O2LA 3EUFA 2BBSA 1JG3A 3Q2KA 5BRJA 1K6MA 1UC5B 1EVIA 3PC3A 5JVDA 1J8VA 3G2MA 4MAFA 2DF8A 2L17A 4MUIA 4XFJA 2C5HA 1SXIA 4TWBA 4YGYA 1GLGA 4RNDB 5G1OA 3D1VA 3ZU5A 1WXXA 1DC5A 2ZZKA 1LJ8A 1PS0A 5AK4A 1R5NA 2DTXA 2B9VA 4EMSA 3GRCA 2VPPA 1ECGA 1YZYA 2W2TA 4Q21A 1MW9X 4XFKA 4PNEA 1GYRA 1REQB 5H4HA 4C3OB 2LXNA 1IBMB 2VJOA 3H1PA 2QPTA 3AGPA 1QDLB 4BE4A 3K0HA 1P2BA 1CEYA 1VG8A 3VKFA 2IEDA 3EBLA 1GT6A 3CSSA 3QLJA 3ZDCA 121PA 1P5FA 1O5OA 4CIVA 2R87A 4EHLA 1KK1A 3N87A 4DYDA 2IITA 2PZGA 3WLOA 4PG6A 3QTLA 4PRLA 1W4AA 2XRZA 3DBRB 4MPTA 4Q02A 3EHEA 5I7SA 5REQB 2UUPA 3NUZA 1H2BA 4ED9A 2C2MA 4QBTA 5IBCA 3MTGA 4QU8A 1B8UA 1DJNA 3REOA 1AVTA 2BEUA 3DXXA 4TX1A 4BMDA 4F06A 1YZQA 5FTKA 5HS4A 4M8IA 2OHXA 5IC4A 1VHDA 3RR2A 3HCRA 1T6NA 3AZQA 2AXNA 2A86A 3AFIA 3HL4A 1D7OA 2QL6A 2DAPA 1GPAA 1Q91A 5AK6A 5ENDA 3ZK7A 1TZBA 1IOZA 3FAKA 3SXPA 4RTNA 4GRAA 3K31A 2V3CC 3RT1A 1WHTA 4EFLA 3L8MA 3S2ZA 3TW0A 1A1VA 4HKTA 1MEJA 3BDIA 4NS1A 4AP6A 4LGVA 4R69A 5IC5A 3OCXA 4IV0A 4RHCA 2GEVA 3E4CA 5FLKA 1UC8A 1H9BA 3D1JA 4YHBA 1N0WA 2LPMA 1X87A 4I50B 2D1FA 4KQGA 1TLFA 2CL7X 4TWZA 4YQYA 1PVOA 3DVRX 1E1LA 1PFYA 4R9SA 3VR4H 5LA6F 1S0UA 3RUAA 3HU1A 2O1XA 4JBWA 3CJRA 4QDZA 4DG9A 3ISTA 1Q16A 1BTOA 3HEBA 3N2NA 2IELA 4K6GA 4NG5A 3OUUA 4RS3A 4I4TF 1KOLA 2H4XA 2Z95A 2B5WA 1GA4A 5E8JA 1AA9A 2I87A 2QTFA 5JC1A 1BXKA 2V0NA 2TMDA 3DVAB 1FFAA 1SQ6A 3LQKA 3LFHA 4INOA 2VDUE 4WJZA 1CQWA 4B4VA 4EX7A 4M8LA 3P32A 1EQAA 2PRIA 4XM0A 5ENZA 4CLDA 1JPJA 5EHIA 1VIAA 5EINA 1EG7A 1NDUA 2AIRA 4B43A 1FZTA 3MWYW 4DVGA 1QR6A 5F9FA 4HZIA 3K4QA 1MAAA 1X94A 3MEQA 4D92A 3KYCA 1BN7A 3IMFA 4HZGA 1XDUA 1HM5A 1N6PA 4HXEB 4XOIA 5E1MA 1KEEA 4EY8A 1I7DA 3RRFA 2HZBA 2JD0A 2OCGA 4X3CA 4NDZA 2GHIA 2FE4A 3R5XA 4RMIA 1JR4A 5EXSA 3H4MA 4Q15A 4GUDA 3T52A 5GTDA 4N3CA 3VHRA 2OKGA 1Z06A 1FRVA 3CLKA 2QYHA 3O91A 4FOTA 4PCAA 4LOAA 1W5TA 2JHAA 3TI9A 4Z2AA 1UAGA 1KYIA 2CV2A 1R0YA 1OLUB 2VL7A 4EA7A 1K5HA 4IQFA 4EYOA 1CD5A 2AN3A 2QLBA 2UYGA 3I1JA 4L4SA 1PJLA 4L28A 3UNXA 2ATCA 2IU6A 3K5PA 1XF1A 1ZR2A 4HWPA 1LQ2A 4RFVA 3PCXA 3HK2A 2UZIR 2I5PO 5J43A 4HTAA 2OUKA 1NJ2A 5IH3A 5KHLB 1JIIA 3I9NA 1RHKA 4MUHA 1YTLA 5A5DA 2QAGA 3KYIB 3P0IA 1EUYA 5CT8A 4W63A 2ZK7A 2OBYA 2GK4A 1XX6A 5E3JA 3E8XA 3RF7A 2AR0A 3U13A 3VYTB 5AVJA 2VSFA 5TGDA 4GZMA 4I99A 1TJ3A 1JEJA 1ZUD1 1LZKA 4DDVA 4LBWA 4FNMA 3TLYA 3ESAA 3EPKA 4F56A 5T4BA 3ZTYA 4OREX 3V46A 1BWSA 1L7DA 4NE2A 2HBRA 1AURA 1CLEA 4Q4DA 1K4YA 2YW9A 2GBPA 2FOIA 2H4ZA 4X41A 2I9PA 1YDHA 1XL0A 3JQ8A 3OLXA 1Z3IX 2BONA 3CF4G 3FX2A 1I6WA 1TVKA 2G5TA 2WE7A 1NT4A 1S8NA 2OBXA 4H1WA 5L3ZA 2G63A 2OZLB 1NW5A 3HU3A 13PKA 1T29A 1I3CA 2VN8A 3GMSA 4DSTA 1CZHA 3O3CA 1AKUA 1DEOA 3R7NA 2XECA 4D5GA 2NUTB 2OG1A 1L3BA 2G1JA 4EKYA 4OFXA 4RWEA 2V7PA 1K88A 4BB5A 4QYWA 2XB8A 4YMWA 4YJHA 3L2OB 3DMDA 5HBGA 2AG0A 1OLOA 5FR1A 3EZ7A 5U4XA 1CUGA 2ORWA 3OLCX 2EERA 3W6UA 4UUBA 1TJPB 4PXAA 4J3JA 5B53A 1VE5A 5TC4A 1E99A 4UCXA 4FGLA 1P0MA 3SN6A 1KO4A 1SBQA 5FPYA 4ND6A 3G2NA 1YVRA 4NAUA 2HQSA 2LVBA 4MWCA 1ZRHA 2EL7A 3JVVA 5GGYA 4U9UA 2GDJA 2Q8QA 3HVJA 3RHTA 3G6WA 3O03A 4HUQB 3F5MA 4MW4A 4DQ0A 3TMKA 2CCGA 2WTBA 1KI8A 1H2FA 3W5IA 4YY3B 1NLFA 1C3OA 5J47A 2XD4A 4RK6A 3R8XA 3RIYA 1DAHA 3ANXA 3KOWA 3UATA 4BDSA 3GGCA 1II8B 3WGJA 2I62A 4ZHSA 2V58A 2VQFB 4DABA 2GPTA 1E7MA 1GPUA 2C2KA 3IP8A 4LG1A 5LA6B 3SF8B 5IYZF 3PJRA 1BS2A 3AUKA 1GYQA 5EIOA 1UDBA 3Q6IA 2GD2A 4ND1A 5C1OA 1YH3A 2NXCA 4RPHA 2VJQA 4I4TB 4JQCA 4MVJI 1U2ZA 5IULC 4PBSA 3KKEA 1V1JA 1UANA 4PZLA 4Y2JA 2J5BA 2ZRDA 3Q1LA 5AYVA 2WT8A 3WLEA 3WA7A 2ZXUA 4EJSB 1KJQA 2BGMA 1JG7A 4YRKA 1ISSA 1JQJC 1MA0A 2ECOA 2IKSA 3EIFA 3K6KA 4FEAA 4AJLA 1MIOA 3JALB 3QNMA 4GLLA 4IJMA 5CFMA 1P6UA 1E9DA 1X1EA 2ZUWA 3NBQA 3GJZA 1DFIA 4M0LA 4YRCA 3GDOA 4JSYA 3JCZA 4BMOB 4WUTA 1GO2A 1C4KA 3P2YA 1QIMA 3USZA 2ZI7A 2V98A 1RVDA 1X39A 3HYNA 1CYDA 4YAIA 3HYLA 5ALVA 1PKXA 3OM1A 2FLWA 2BMFA 4PLYA 1UMCB 3RARA 3P9KA 1N5JA 3FTPA 2GILA 3C3WA 4JQSA 4M53A 4X24A 1Q6ZA 1SBZA 2AF3C 2P4EA 2ATVA 1ULUA 5BN5B 5CXQA 3JARA 3R20A 4EUNA 1IB0A 2ZXEA 3P5SA 2Y6VA 3FDFA 1UM8A 2I76A 3GUCA 4RVDA 3ANSA 3HKEA 3KKPA 1X74A 5A4KA 4KXFB 3EXIA 5CP8A 2Z6UA 5I6DA 1M1XB 4XR9A 4ZZ3A 4RK0A 4B1FA 3RVMA 3LLVA 4WTOA 4L76A 3IB3A 2Q0HA 5FOUA 2JLCA 3BFVA 3EJWA 4UCWA 4C0JA 3PDIA 1FDUA 1M8GA 2A35A 3WK8A 2P5YA 2R7MA 4AO6A 3HYSA 3ME5A 4G41A 3FH0A 4MS3B 1K2VN 1OKKD 3GYGA 3GUHA 1C2YA 4LV5B 4D8YA 3ZTTA 1EUQA 2Q5FA 1E66A 1QRTA 3BMCA 5FAKA 1NXQA 1UJBA 1Y6GA 3AI3A 1J1ZA 2CLCX 1DV2A 2CYAA 4F8JA 1ABBA 1VSVA 4GFDA 5DI9A 1U0NA 4QDJA 4DMMA 1G291 1XYVA 4XA8A 4QDKA 3D4NA 1SBCA 4D82A 3I9LA 4BX0A 1BDHA 2P62A 2XNSA 4AN1A 4CCYB 4XH9B 4MMZB 4QYXA 4KREA 2O8FA 5NULA 4JC5A 3TRHA 5IT5A 4GXQA 3WGLA 4H77A 1ZIPA 4BAGA 1BE0A 4BU0A 1RKXA 2HB6A 4H0FA 3RS5A 4P3KA 3ZWCA 1OJ7A 1DIHA 2PSDA 1KRHA 1GUZA 2XYVA 4I4CA 1KO7A 1DQPA 2VUSA 4J9VA 2I99A 4LK2A 5KX5A 3LCCA 4G07A 2GUGA 2Y3IA 2ZW9A 4GWGA 2W2QA 5K6AA 2XZOA 2BR4A 1SC9A 2H1RA 4FD2A 4POOA 4JL6A 5ELXA 3O38A 3WGZA 4PHCA 4EEKA 5DEOA 1IQUA 4Q1VA 2X40A 2C4WA 4B6SA 3KEFA 1O0CA 3F4KA 4MDFA 2XMBA 2JIZA 1B73A 1GKYA 2D8MA 2V5AA 3C39A 4CFZA 1MC8A 1NLYA 1Z13A 2PLNA 5HP4A 2OBBA 2DLCX 1AY0A 2FHSA 1EM8B 4NBWA 1WPGA 1SD1A 5E9JA 2IXAA 1IN8A 5IDXA 1X7YA 4X3PA 5BMVB 3GQBB 4BZWA 2NO0A 3G68A 1LKZA 3SZUA 4JOSA 1KFEB 3NTXA 2DM6A 1CZRA 1QTIA 5BURA 1EGQA 1J2TA 5KQSA 1I32A 2OXRA 4U8GA 3GUVA 1V4VA 1RXSA 3MGKA 3DO5A 4GOKA 3BQMB 5BN4B 1QP7A 1WTCA 2R4TA 3Q2IA 1ESNA 4BNWA 4EYSA 1ND6A 1X1CA 4OFZA 5K0ZA 1T4GA 1I1NA 3CY6A 3GEMA 4MHOA 3O8RA 4FC7A 1Q44A 1I7SB 1WBJB 2YJ4A 4DUYB 1F5NA 1PKEA 3FNIA 4FBLA 1YCDA 4NLLA 3I2KA 1QE0A 1PNRA 4DZZA 1BJKA 5IYZB 2WG1A 1V16B 4LYJA 4R8RA 1E5XA 4FTWA 4JJ7A 1MQ8B 2GN0A 4B3SB 5C80A 2H0AA 1U3VA 2HF7A 4RMJA 3DDWA 1RCFA 5EXPA 3RQIA 4OOFA 1DWPA 2KX7A 2Q4EA 2XMCA 4PYNA 2KWIA 2Q07A 3OTHA 1MX3A 3GLSA 1JSXA 1O8BA 4FX2A 4L2IA 1BMFD 2BW0A 4M36A 1GKUB 2WHPA 1WVIA 1GCOA 1ZOLA 3PEFA 3VOAA 2YTZA 1W0CA 5B37A 2X0EA 3DVLA 3SR3A 3W8EA 4DJDC 1Q19A 4YCNA 4J2OA 3IUBA 3HVRA 3A3OA 3HFJA 2V7XA 2R84A 4FUTA 1ZITA 3BTSA 1M2NA 3WWDA 4MRMA 3BJZA 3KQMA 2QP9X 1QAOA 2GZHA 4PFKA 3E2IA 3PDJA 2F4NA 5LU9A 1O6FA 1EAMA 3I34X 2QSJA 2PYZA 1HE1C 2NUAB 3TGLA 2AEJA 3WJ2A 2ERXA 4K0KB 1R6UA 2V6IA 2ZRLA 1ZRNA 2GMWA 1HQDA 2EW8A 3RVPA 2PUAA 4Q66C 5G0SA 2JCSA 4AZSA 3G9XA 4MHTA 4MQ6A 4MMYB 2Z09A 1U98A 3ZGLA 4PC2A 2HTEA 3AFHA 2ZBEA 4ZEOA 3ETDA 3V2UA 1X86B 1AKWA 2MMCA 4FDVA 1C0KA 2IYFA 4IIVA 4R7ZA 3BBPA 3IOYA 4U0KA 5GINE 1XTQA 6AT1A 3PX7A 3LCRA 2EDCA 2C4MA 4LDAA 3LUCA 4RY2A 3KQTA 1DBRA 2ISCA 4QRDA 5DXFA 5EE1A 5LUBA 1L4YA 4HXYA 4HEHA 1VB3A 4AMUA 3MAAC 4DPMA 4AXXA 2YWJA 2O8EA 1NQOA 2C5FA 2P0EA 4ZO9A 1RRVA 2X3UA 4NWIA 3CZMA 1L5YA 1KNQA 2V7GA 3FNHA 4QDUA 1U65A 3DFIA 4BVBA 3J7AC 1P9WA 1BCSB 4OD0A 4PZUA 1PJQA 1IM2A 1RAIA 2QXTA 3QFTA 5TGZA 1E77A 3IFSA 2DBRA 4DNFA 1XV5A 2BRUC 4CM9A 4BP1A 4DRZA 5FLXA 1RQGA 2JFVA 1I7LA 1Z5NA 2L69A 3JATA 4EWLA 5T67A 2N9UA 4B2YA 4CFSA 4DM7A 4S12A 2DX7A 4ZDWA 4BB9A 3F78A 4HXFB 5KNBH 3MUEA 2R79A 1DVRA 4AJ4A 1ZXLA 2IHJA 3GZNA 4W6QA 4FFVA 2R00C 2ZIUB 2QZ9A 5IN4A 5JT1A 1VFNA 3N6XA 3QMWA 5B2FA 5K7SA 2QD3A 4KHPB 2GPJA 5EIBD 2YFHA 2I91A 1DQRA 2I2AA 2IPLA 3MWEA 4YUZA 4OG2A 4KFCA 2YWFA 1XP8A 5AVZA 1T34A 5A1TA 5ERYA 2Q5IA 4IVQA 4JAVC 1W76A 2WM9B 3IBCA 1RADA 5TY0A 3TVTA 3IE1A 2G5GX 1ZJ6A 3K5IA 2EIXA 5B58C 3I61A 2O52A 3W9SA 2NYUA 4FR5A 1PL0A 1VSTA 3KZ1E 4WD3A 1LLFA 3FPSA 4K9QA 1XU4A 2BFEB 4ZT7A 3B3AA 2YV5A 3HGTA 4JYMA 1WD7A 4Y6RA 3I8SA 2RDMA 3D9QX 5L53A 1LPBB 4W99A 1GNVA 3U17A 4IFEA 5K0TA 4GMFA 2R5FA 5CAEB 4UHJA 2IUTA 3WV4A 4LJ6A 3H5RA 5SYMA 2QTVB 2P2CA 1T4CA 1EAYA 3FMGA 4WXYB 4F2DA 5KOYA 2CBGA 1MDFA 2DQKA 3T06B 4PQEA 2AKEA 1HY3A 4RVGA 1UBMS 4K88A 2Q9AA 3IQEA 6PFKA 4NVRA 3PIDA 2I3GA 4PR0A 3WJ1A 4CL8A 1C1XB 1VCHA 5LBUA 2H4YA 5GV7A 4J0IA 3P0FA 5AW6A 1NVUQ 1OVGA 4QO7A 3ZW7A 1N2CA 3BERA 1HRDA 5CRIA 1JDVA 1J8QA 1KVQA 2ZJAA 3NC1C 1JWBB 2PGIA 4BXOA 3BMNB 1Q57A 3T1VA 3M4XA 1QJ4A 2AHRA 3L6UA 3ONEA 1A9OA 1MJGA 1UBLS 3DEHA 2QW0X 1XJ5A 4DLUA 3UYLA 2GHRA 3LDGA 4YJFA 1ST3A 2HNBA 3ADOA 3CUYA 5CA0F 4JJ8A 3KC2A 2B2NA 3HB1A 3ABQB 2VO1A 4HNGA 3VHXB 1ULBA 3I37X 4W7HA 5EZ6B 3T3GA 2XSZD 3QKIA 4J6EA 3W06A 1IRIA 4P34A 4YA6A 3LT2A 3T7IA 1PSZA 1AS3A 1C4OA 3VPCA 3DJFA 2W6QA 1CJMA 1BVUA 4E2ZA 3ILHA 3FCSB 1RC8A 1KY5A 2FWBA 3F3MA 3LOPA 3N2KA 4FJ1A 4LZOA 3QI2A 1CR0A 2N42A 3M6VA 1QCCA 2A0FA 1LA2A 2QXYA 4QVGA 3H8JA 2WR8A 4K9DA 3K0CA 2XUIA 4N82A 2PO5A 1OPXA 5HM8A 2I65A 4YT2A 1G21B 2PX3A 3VTKA 5DB4A 2ID9A 4R2LA 2QMYA 3LYAA 4PO3X 2ZG6A 2GO1A 1KL7A 3MQ2A 3HXLA 4YJ2A 2HA5A 4OXQA 4PANA 2OA0A 3D4IA 1NMQA 1Y1RA 3TW6A 1VLQA 1JYEA 1U0RA 4ITRC 5F7XA 4N6NA 2QTLA 4IIUA 4TYPA 4K26A 5F2EA 2QDKA 2V03A 7GPBA 1A7UA 1KC3A 2J0EA 3CIOA 2B6HA 3GGPA 4OJTA 3GJ4A 1KDVA 2XWBF 2XD9A 3HLYA 3VISA 1VIMA 1SVOA 3X1JA 1U0OC 3GD7A 1PFUA 5DGXA 2V6BA 4NR0A 3ZE2B 1M7BA 1RACA 1TM3E 1I3OA 2A33A 5MN5A 1YJ8A 4MVJG 3E5MA 5DTMA 3FCAA 1J5EB 4AY6A 3ZW8A 2FRXA 3NO4A 4C5CA 3U7RA 4JLKA 3VPBA 4NX2A 1U9YA 3MC1A 2GESA 1YKGA 4IPTA 1VJGA 4ZARA 4H4DA 4OA8A 1AB6A 1U9IA 3RH0A 2F3QA 1G4AE 4IWXA 1DDGA 2NX2A 3TE7A 1NLMA 1YASA 5IT9A 9LDTA 3A3NA 4ZXPA 3HPRA 2ID8A 4C0XA 1AK9A 3GLHE 1M2OA 2ZOSA 3EVEA 2UVPA 3R3SA 4JODA 4FGJA 3THYB 2DH6A 1WABA 2G28A 4XVRA 1D5WA 4ZTUB 2PJUA 3G2LA 1OFTA 3QEAZ 1NC3A 4ME6A 4D9BA 2WHYA 1KJWA 3NKFA 4FFSA 1L6RA 1SG6A 3RGWS 5ADWA 2C7VA 4DR5B 5E3HA 1YQQA 1R27A 4HXGA 2XGGA 1RXYA 3OH8A 5BT9A 2OXIA 3I64A 4EF6A 3TIVA 2G09A 4LXYA 2ZYTX 3LCVB 3WRVA 2B0JA 5GVSA 4I1UA 5LZ4A 1H9CA 1NNI1 1UC9A 5C31A 2BF4A 4MQLA 1BQEA 4LCJA 1B41A 3HBAA 1JE0A 1SXJC 5DCLA 3USCS 4A26A 1X1BA 3HXOA 5H8WA 2W6ID 3RQSA 1U5BA 2P78A 1ZK0A 2PSJA 1KMQA 5FPHA 2I0FA 2C07A 4JR2A 5ANRB 3DOCA 4E2WA 1G9TA 1T3ZA 5TEVA 5KKAA 3ZWOA 2V9CA 5CH3A 3OPXA 1OXXK 5F7JA 5IJXA 1NFFA 2H18A 1WX1A 4IDHA 1L5NA 5JS1A 2YWHA 1GD1O 5AJWA 5KYYA 5I5GA 2EW2A 5DISB 4Q1FA 4ZGWA 1C9KA 1ODTC 3H0EA 1Y5MA 1FMLA 1J24A 1I36A 4XDGA 2AQKA 1IVNA 4KKXB 3MPOA 1MB9A 3O4VA 2X4IA 3VO8A 3JVUA 1QYDA 1WWKA 1LDYA 4X00A 3DEFA 3L8CA 2P8SA 4NU0A 1Z3CA 4N3AA 5CLIA 5LDGA 3RV3A 1H2AS 1JH9A 1E7QA 4DS3A 3H65A 4FB4A 2PUWA 3U4QA 3T15A 5HS6A 1G5HA 1T6BY 3VNAA 4JD5A 1TGYA 4ZQHA 1JNYA 2QT1A 1G2QA 4MR9A 5ALLA 3WSTA 4PGAA 3DOOA 3CGGA 5AIBA 1L6IA 3CWCA 3JQAA 1YXMA 3DO6A 4P7FA 3HBFA 4AX8A 4AF8A 3TVDA 5FB3A 5HDBB 4EFMA 2PRKA 3EIEA 4KXLA 3EVBA 2VPWA 1T0BA 2W98A 3EVAA 2CK3A 3LPCA 1U94A 4L50A 1J0EA 2HHCA 3EEIA 4G26A 2OCDA 1NMEA 3CSDA 4OAQA 4RJ2A 1Z6QA 3W0LB 1GFSA 5FWAA 1JGTA 1KJ8A 4ER0A 2BUBA 3K1JA 1JHOA 2GCOB 3V32A 3DSRA 3GYBA 1FFEA 2WLSA 4CG2A 2X22A 3OETA 4QG3A 4OUKX 3E27A 4FZRA 2OHGA 5K2MA 3TNDA 1WF6A 1Z28A 3IDQA 1KK3A 3JQAD 4IZHA 1X3SA 3WX0A 4DIBA 2AFHB 4FMCF 4RM2A 2C7QA 1R8SA 4EKNB 4B17A 4CI9A 4R0VA 3ADDA 1OXVA 2YJ5A 1Y8QB 1O1YA 2B1GA 1AB5A 1GZ7A 3CTMA 4O8CA 1WU7A 2VA9A 3NHLA 3PCRB 4JSRA 1M75A 1KMHA 4ZAGA 3GLFB 1YZNA 3L79A 3R6GA 4AJHA 5DBGA 5J5AA 3ZHVA 2QP4A 4DLZA 4IIHA 4L5BA 1GTRA 1VA4A 1K4KA 1Y7HA 4GPAA 4LDJA 1QVRA 2B4KA 2ONJA 5CBPB 1QHGA 3O2NA 4M37A 1D4ZA 4Z1MA 4F3NA 1FYWA 2ET6A 2GM9A 2C31A 1W4LA 1UKEA 2H52A 1PFGA 3AR7A 3DQZA 4PXSA 4TTIA 4UCQA 3TH5A 2O0KA 4O0MA 3HWWA 4HYYA 1DJLA 4GOMD 4U02A 3EULA 3U7QA 1QP0A 1E6KA 3R7WB 2DSNA 3CPSA 4HWRA 4NENB 5JS8A 1PE0A 1LLCA 4AU1A 5C53B 3K20A 4IDQA 4L4XA 5H0IA 2C9CA 4G0OA 4GUAA 2PGAA 1WR8A 1M1NA 4ID3A 1UBRS 3ZS9A 1AMUA 2OVFA 2LCIA 3W7VA 5HZGA 1QO0A 3MWGA 2O8DA 3KR9A 2FW0A 2XDYA 5JSUA 3VPAA 4CUKA 1SKMA 1J1UA 1NBMA 4X45A 1NVDA 2D7JA 2IUEA 1MAHA 5A71A 3R77A 4LF6B 3K0BA 3QPVA 1E4EB 4I66A 4PYLA 1YFKA 2VJYA 3V8NA 2BI7A 1Y8RB 1NSTA 3PGJA 2WQ6A 1ZW1A 3IAUA 4G5OA 5WRFA 2LR0A 1CS0B 4LX8A 4YWJA 1KH3A 2O2GA 4IJUA 3HDHA 3OZEA 3P5BA 1QO0D 4NZ9A 3T3EA 4BVKA 2VDLB 1SXPA 1ZOSA 3W9YA 1SC3A 2C83A 1W47A 1NBMD 3HB7A 1P19A 3O1JC 2VATA 1GSAA 1LF0A 4J0QA 4TKLA 4YK7A 3ZH2A 4JP1A 5ETJA 2ZGVA 1J0CA 2XEXA 3MQFA 2XXBA 2DFDA 4XCQA 3TLEA 1V47A 4CV0A 3CRMA 3MUNA 3ZR4B 2GK3A 2NZWA 2V8BA 4F4HA 5EHQA 1FFSA 2HSJA 2JCXA 3CB2A 3DULA 2CHVA 3I3OA 4OMFG 1ADYA 1TO6A 4P32A 1P7VA 3T0IA 1USIA 2XZPA 3TW4A 2JATA 1OYWA 3LX4A 3NM6B 2VTBB 2JARA 4KCGA 2HU2A 5IDWA 3T7DA 4GOND 3RASA 4FYYA 3PGKA 4PAGA 5KUTA 4NNPA 4NNOA 8GPBA 3T1TA 3AVVA 1TQDA 5ER6A 3THWA 1XTRA 3AZPA 1R50A 3FGZA 3IYLW 3KD2A 5D8DA 4JT4A 1HK7A 3I2HA 3A0RB 3WKDA 2JGDA 4IS3A 3ST7A 4D9NA 3LHDA 1NTRA 4Q05A 2E49A 1E9EA 1L5QA 2PSFA 4AD8A 4ZGGA 5FHQA 3KZXA 3QIAA 3EG9B 5TV2A 1EVKA 3L7LA 1SOAA 3L93A 1PJ2A 2AJ8A 2G0AA 2IQIA 2QLMA 3H5LA 4LVCA 4B0PA 2NV6A 3DLCA 4LMBA 2J3IA 5ER9A 5HVNA 2A6PA 1V6AA 2QX9A 3A26A 3AKDA 3HSSA 5SICE 1W1UA 5FA8A 3U4GA 4UUOA 5AXBA 4CMKA 2VUTA 4G4SP 5DBEX 5BO5A 4LOLA 4DJ5X 3EZ2A 4KQKA 4JOCA 3H2IA 3C3BA 3QSGA 3QVOA 4YV7A 3BUSA 4MW2A 4EY3A 4QEKA 1KHHA 4EDHA 4F1KA 2F43A 4H7DA 2PT5A 1Z6PA 5AIAA 2JDID 4X95A 1DBSA 2KMLA 1N6NA 2XWQA 2ZIAA 4JX8A 4Z8YA 2HC9A 3ORYA 3ZDYB 3HU5A 5DI3B 1EEHA 5LYJF 2ZJ4A 1Y6JA 3GH3A 3NHJA 3MRVA 3R75A 2OE2A 4M21A 4ZO6A 4KXYA 2OBFA 2CF6A 1C30B 1WP9A 4Y2QA 3B2QA 1ABFA 4YDHB 3EDYA 4IXDA 3VR5D 2XVYA 4O02B 3SZOA 1XLVA 5HIAA 2W2KA 3GP8A 2FFQA 4G8CA 2HMYB 3KSBC 3TIIA 2CLSA 4MTCA 1L3IA 3ABIA 4XXHA 4B3JA 1NVTA 2XUPA 3ZXYA 3ENVA 1IY0A 5KWJA 3NBKA 1UZMA 1CT9A 3DZCA 2YRWA 3ONVA 1A50B 3UWOA 1ODIA 2IHZA 4BNZA 2LIPA 5BSEA 5L3QA 1PP4A 4BFUA 3U1BA 1BGXT 5A4DA 4UM7A 3MCAA 3WIOA 2IZ5A 4A8HA 2OAGA 3BZUA 4KJXA 3WLMA 1SWVA 2ZCJA 3G2IA 5H7XA 2R7AA 4KTVE 4LY0A 1CF2O 4XQGA 4WLNA 1XMOB 2KYRA 2C95A 1PT8A 3E35A 4B3TB 1FUKA 4P82A 4JEIA 4WASA 1OC4A 3OJFA 2BIFA 5TPZD 5HTKA 1OH6A 1OBOA 4IM7A 5G2OA 3F97A 1FYVA 2WFLB 2WJGA 1Z16A 4U1RA 1W5SA 3DAOA 4RX1A 1NHWA 3TRKA 4QZVA 2ZBUA 4MVYA 5KTRA 3TNJA 1IMOA 2SHKA 1OXSC 1XPUA 4KI7A 3RRNA 4B3FX 2FG6C 1O94D 4QTXA 3OKAA 2Q7DA 3RJ9A 2NT3A 4K81B 3FVRA 4WN3A 1D4FA 1QVVA 2YJTD 4G4JA 1JJ7A 1NAHA 2WZBA 5CYPA 1OWOA 1BX3A 4NYMR 4TMZA 1XKTA 3KYJB 4TKVA 4CKZA 1A9XA 2QEQA 1TT5A 2ZWOA 3LKVA 5HMLA 3Q9UA 5BQFA 4MS1A 1KVRA 1H2YA 4EUFA 4UTVA 3WKCA 3HNRA 4MKGA 3N76A 3ZHYA 5L7TA 1FJ2A 1M72A 2Z9CA 2QZPA 5GZ3A 4NK4A 1SXGA 4GLBA 1GUAA 2PKEA 5ALMA 3NI2A 4BBJA 4OHXA 1MENA 3AHEA 1R6XA 3WSVA 5AVOA 1FFGA 5TXGA 2ZSKA 4GOXA 4D0SA 3OC0A 1JIKA 4OJNA 2HZ7A 3HKCB 2FX2A 4HMOA 3U44A 3BE8A 1H93A 2ACWA 3MLBA 4RLSA 1OWLA 3ES9A 5L4LA 1UPTA 3F6CA 1SFRA 3PC4A 1W1WA 4KAFA 4QO8A 2GM3A 2ECQA 1P4JA 2GJAA 1CZUA 3V7WA 2IW1A 1E5LA 1FQWA 2HK8A 2OC9A 3QF4B 4QD3A 3R23A 5DGCA 5AKZA 4G1VA 3SS7X 4E14A 4N4AA 3WIDA 4NF2A 3AEQA 2JJ8A 2ZR7A 2C88A 2QD2A 3SK0A 4XD7A 2RHBA 5ALUA 1G8KA 1L5GB 1E8MA 2QYTA 5J2UA 1X9HA 4RVUA 3OFSA 4OQQA 1R4NA 1SU6A 5EFOA 4PO8A 2PR2A 2KM1A 2Q1YA 3P4UA 2QX6A 1SCUB 2VOEA 2O50A 2VHYA 4BNNA 5H70A 3VZSA 1X92A 3VH2A 2I1LA 3ODGA 1LNQA 1PZHA 3TE6A 1Q7TA 3W6PA 3HZRA 2HGSA 4TXLA 1BHO1 1L5RA 3H05A 4HRYA 1MC4A 1CUDA 2DKNA 2HRQA 3SR4A 1Q12A 1BJRE 4XCXA 4ZTBA 5F4ZA 5A4MS 3SNHA 1IJKA 2IIBA 5SYAA 1OREA 1NYLA 1AN0A 3OM8A 2Q27A 4ARZB 3FB4A 1IN6A 3CVJA 4C05A 1CC1S 1TO1E 1FYXA 1TAHA 1BU8A 5EMHA 1FA9A 1P60A 1NVAA 2XKBA 3SJ7A 4JLOA 3OIYA 2NXJA 5AJUA 1UFQA 2ZQ5A 5ICGA 1M8KA 4HS9A 4MW0A 4E07A 4ARIA 1W0JD 5LYYA 1N2GA 1SCIA 2PTGA 3T4EA 5JH7B 5C81A 1JFFB 4TLAA 4MB0A 1VPEA 4YT8A 5TLSA 1RTTA 3FUTA 3PF9A 1VL2A 2OUIA 3NV7A 2QLJA 2FDRA 2WKQA 1EDBA 3KV3O 4JR0A 2IU3A 1SKYB 1SIWA 1O58A 3G8DA 5JALA 3HLKA 4FR0A 4KQXA 3DE1X 2AG6A 2WU0A 1C81A 4PAWA 3PV0A 1XEWY 4KBGA 4LKOA 3B5EA 3FYUB 3H19A 4XCVA 2D13A 2VJAA 2I1VB 3X1KA 2V7UA 4XDZA 3DBOB 1DTEA 5LJLA 4GBMA 2JLRA 3MD0A 3B13B 1VKRA 4MKHA 3K6SA 5JCXA 5LVAA 1SUBA 4F11A 1R5BA 1YOVA 1W19A 1RP7A 1BAPA 4X1KB 3U0BA 4F9EA 5A7FA 1RYFA 5K8LA 4K9LA 3TECE 1M1YB 1XKXA 2TMGA 3IXLA 1KPIA 1O5TA 1YWGO 4J2TA 3NFYA 5DXJA 4CEHA 1D6JA 1G8SA 1YC5A 3EMVA 3JYPA 3Q15C 2FMTA 4KBYA 6GPBA 1Z4LA 1ZI9A 2MHCA 3ZWDA 1TVCA 2VDWB 3WGYA 4UTXA 3VKGA 2WUGA 4JROA 2O6LA 4Y30A 1UEIA 3QMMA 1P17A 5A2QA 4DV1B 2P30A 3T8YA 1W4RA 1H1LB 2SNIE 4XJTA 4MIOA 4B3GA 2JIDA 1FRFS 4YRRA 2C3UA 1QF7A 1WBBA 2ZJZA 1WCIA 4JWTA 4LC9A 3QUTA 1KU0A 1SHLA 3LU1A 3IL2A 3T5PA 2X13A 3ILXA 5H81A 4D4JA 4I08A 4TKUA 4BC1A 1NUSA 5ABPA 3HGQA 3OQBA 4LHXA 5DYIA 3D0QA 5ITSA 3B3GA 5AM0A 3S8MA 3P0JA 2AMJA 2IHUA 1KYVA 2MINB 2RK3A 1Z6AA 3KXIA 3OZ7A 1VJ0A 2Y71A 1W4ZA 5BW8A 4ZCMA 2H0RA 5KYGA 2FZ4A 1X7XB 3LPNA 4JC8A 4X94A 4BP3A 1E64A 1T9GR 3IUJA 3L0DA 4XIGS 4UUMA 4EEZA 3I83A 1YS1X 5IG2A 1ZSYA 4NBRA 4PS0A 1U2PA 5LQMA 3MA0A 4U3JA 1JA0A 3IUPA 1C3XA 3RS0A 4JI4B 4HDNB 1GL3A 2OBMA 4XTRA 1AQ6A 2XHZA 4Z7JA 1N5RA 3M34A 5L3SB 3UGKA 4AFNA 1E2LA 2PH1A 4XYMA 1ZGHA 2PU5A 4EB6A 2EGHA 2ZUDA 3L8HA 3M89A 4RD3A 1EH5A 1EDZA 3GEEA 5ALSA 3TSCA 1Z07A 3AETA 3I9V6 4FYMA 1DKOA 2XYRA 4PSCA 5FF9A 5KWEA 2X6QA 1BWPA 1WUTA 1EFTA 4I1YA 4XIJA 3BMOB 5JXHA 3PJGA 4GBGA 2RJ3A 1MOSA 3ESQA 4BBAA 2Q1XA 5BXYA 3L4JA 3M5PA 3CVWA 1LBQA 1EXVA 4DCVA 3DW3X 4XX0B 2E5LB 5IXYA 3ZX5A 2VS1A 4BQNA 2MSKA 3ROKA 2PWYA 4YV0A 3TL3A 2F1OA 2J31A 5GMOA 3VR3D 4OGFA 2FUCA 4M76B 4HG2A 2CLFB 2C96A 1W4BA 2GHQA 2VT6A 3CXUA 3UW1A 4BMYA 4UOZA 3OQMA 2HA2A 1T3TA 3N2IA 3CO0S 2AN1A 4Z3OA 4FP9A 1N5DA 1NYQA 2CVHA 4WBNA 4ESVA 4EYQA 1M34B 2ECPA 2FP4A 3F5SA 2VQ3A 1IZ8A 1VOTA 4FYJA 4K2HA 4Z8XA 5G1PA 5TPWB 3RW9A 3T3DA 1TE2A 3L1KA 2VP5A 1MRNA 4KDRA 3REQB 3SIWA 4IG4A 2FLKA 3LVFO 5FPTA 5CLFA 4NZYA 5EY5B 5TF0A 3C2QA 3DEYX 4G56A 2IT1A 4JC4A 2QTZA 4KB5A 4WMLA 1Y63A 4GKVA 2QAIA 1CJTC 4DR4B 1XPJA 4LOIA 4LJKA 1ZJ4A 1MORA 3MOIA 1IZ0A 4J49A 4NBTA 3ORRA 1R16A 4BO9A 4L9WA 4MUFA 3TJMA 4Z7NB 2CJWA 5JJLA 5C5CA 3DCIA 2ZIFA 1O5IA 4FR2A 3FJ1A 2XKKA 2O8BA 3IV6A 3RK4A 3RKRA 2VAWA 4L3WA 3KKMA 5UKDA 1SCQA 1HFKA 3TX6A 1E98A 3M1LA 1XTTA 3N7TA 3QVLA 3EGDA 1N0IA 1A9YA 1V9SA 3I92A 4QFBA 3AW9A 3FTCA 1OV6A 4F2GA 2PZEA 4E6EA 2QR2A 4URZR 3ZDDA 1TJYA 2VZLA 4US0R 1WUJS 4PCVA 3GEPA 3PFCA 2QA5A 4E5DA 1OTHA 1UPFA 1LTQA 1XTKA 3ZVNA 5A3QA 3OE1A 3ZYZA 1KJIA 3ZDBA 4WSOA 4CQJA 2EGGA 4Q03A 1HKUA 3OE4A 4S0ZA 3R41A 2ZI4A 3T3IA 2G6TA 1NA5A 3V4FA 3RTGA 1QOPB 1CKEA 5KNCH 2WQ7A 4Y2GA 1FX1A 2BFWA 3C5VA 3IP7A 4C6SA 5CVEA 5E38A 2OHVA 2PBZA 1NW4A 5K45A 1E92A 2OO7A 4RD6A 3A2MA 2GBCA 1FVXA 2HLHA 1N2BA 2NACA 2RHGB 5GONB 2JA1A 5EESA 2VBCA 3GJ8A 3COVA 3OTWA 1W35A 2XTAA 3OM9A 4S1TA 3ZWNA 5HGXA 4C06A 4I5FA 3LDAA 1VYUA 2A4KA 4Z54A 2Z4RA 4J94A 1HNWB 1P61B 2B69A 4Z7OB 4C7OA 3QFSA 3TCNA 2X15A 2YIDA 3A1VA 1HE2A 3JQ9A 3L01A 3UYKA 3DD1A 2EVWX 2HH9A 2JGRA 1RXVA 2Y1LA 1CIPA 3VPHA 1ZLYA 3BN3A 1V71A 2OOSA 3UH0A 3LF2A 3VZRA 2E5WA 4KUHA 3ZLTA 1H0RA 1J21A 1WSWA 1DKPA 1EWRA 2VF4X 4Z9XA 1N1EA 3ENKA 1PT7A 1X9IA 4H08A 2PPVA 1NR1A 2X5OA 4AIRA 4BTEA 2J0VA 3LO5A 1QFSA 3ESXA 2DHDA 3FSJX 2PH5A 1QFMA 5FEMA 4LTDA 3BVPA 4Q7EA 4JI1B 2DR2A 3DHEA 4HLNA 1L8OA 4I50A 1VKJA 4RIGA 2ZYWX 4JDUA 5DE3A 1ZIXA 2J5QA 3TXXA 1X7GA 5ALWA 3EAFA 3LWBA 3EXHB 4I4LA 3GI1A 1WOMA 4FMPA 5F78A 1W0KD 2V54A 5CT5A 1JR3A 1N4DA 3OF3A 5K03A 1PL6A 3M6AA 2ST1A 2UZ0A 3QI7A 2PL5A 3MIIA 5F9MA 2JFYA 2A1TR 3G59A 3T7RA 2QNIA 1G3UA 3JAWA 1QH9A 3SM3A 3T0FA 3TNLA 4UVHA 3LNTA 3DL0A 3KWFA 3DVAA 1Z38A 3E9DA 4LWQA 2HCBA 1U4SA 4BNUA 2WWTA 3R3HA 5TB5A 1QHHA 3U3DA 1SKAA 1RI5A 2RI1A 3DEIA 3KYBA 4HC4A 4IVNA 4LY9A 3TUIC 1MW8X 3VOTA 5IK2D 4L8FA 4KMMA 5T8KC 4B8YA 1QH8A 3HPQA 1Z34A 3U1VA 2C7BA 3P0EA 3WJ7A 2BH2A 1DKRA 2HBYA 3LLUA 4I55A 1HLFA 3EMKA 4B3BA 4Z4CA 4FS8A 4Y1RA 2REQB 4OQLA 3SHWA 1MB0A 3VPGA 1I3LA 4EY6A 2VNSA 4Z7QB 2FFBA 3OEYA 4WERA 5B1YA 4BECA 1CVLA 3KZNA 4PLGA 2NVUA 3UJPA 5T57A 1OFIA 1E7WA 1PTJC 2YFQA 4YUAA 1ZD9A 2O0MA 3AI1A 1GRNA 1VM6A 4XD2A 2YJGA 5F5XA 5CFOA 2XMRA 3GRAA 3E9RA 3C70A 1LLUA 2HL6A 3PC7A 2V45A 3ID6C 5COBA 1ZJWA 4I1PA 1TMGE 2PX0A 3B6EA 2RAUA 3E82A 1LSUA 3IUNA 1W7AA 3PUYA 4L9SA 1Z83A 1L4LA 2JVJA 3GQVA 2H07A 3JQEA 3NETA 3FPAA 3IKTA 4D9EA 4RA6B 2IRWA 5A6SA 4C7XA 2PL3A 2HCFA 1CUEA 4QRIA 1P31A 1FYEA 3C7KA 3QLVA 1Z0IA 2PUDA 3UF0A 1QXSA 1C0LA 1KDTA 3AUJB 4GI2A 1T2NA 3BAFA 3PLAE 2P7IA 2NZYA 1CUCA 3KTAB 1OYYA 1CIJA 5AJYA 1Z4MA 3V4LA 4BY9E 1LBIA 4JS0A 2O0HA 1D8TA 3EY9A 5BV8A 3L6RA 3PD0A 4KP7A 2GS9A 4BPBA 2B6NA 4MPDA 1T35A 1JXMA 2VHUA 1YRHA 3K1ZA 3NC0C 4TMTA 3T3PB 1ADFA 4ER5A 1YFJA 3ZDAA 1JFRA 1V5IA 3BX1A 3CPEA 3IJPA 1PFKA 3NNNA 4ZREA 2YASA 1JZQA 1RQXA 2NZ2A 3G2PA 4IKEA 2M6KA 4YYEA 1L0BA 2CXUA 5A1JA 1H4SA 4C2TA 4TRJA 3OT1A 1XZCA 2E4YA 3U5TA 5DSXA 5JV5A 1E5DA 1YBFA 1LVGA 2C2HA 2VCEA 2AOXA 4YAEA 3AM1A 2FGKA 4M60A 1N3LA 1W85A 5CNIA 3ZHZA 2DERA 2FUG6 2P2ZA 2Q4BA 2OV3A 3AIKA 3WA6A 3WYAA 1AF7A 4BNHA 1QHXA 1PX0A 2H00A 4Z53A 3A3KA 1U8UA 1J33A 1QVAA 3AJEA 5E7MA 4F97A 6ABPA 2F90A 3ENQA 3Q0TA 3DYBA 1KZ9A 1TECE 2B35A 4MQUA 1UMBB 2VWGA 2WE8A 2BHRA 2IYUA 1XU9A 3DDZX 1EWYA 2PYIA 5F3RA 1GDTA 2XZTA 1PJ8A 5FV7A 4KDFA 5FI5A 5A3SA 1XT6A 1BU5A 4TRRA 1U02A 1U31A 2F1RA 4TL9A 3KTDA 2FPXA 2NG1A 4LJ7A 4TTVA 5B6PA 4Q3AA 4DQUA 5SZJA 3RYHB 3AERB 1QVZA 3F9CA 1NQWA 5HFAA 1RJFA 2J6HA 1NSFA 1QYXA 3EMDA 5G0TA 4AI6A 2JFPA 4ZA2A 4KN6A 4WFJA 3GFRA 4ZVSA 1RM5A 2FSHA 2MT9A 1JQLB 3GU3A 3LX8A 4HGRA 3GXBA 3C3MA 3GXOA 2II6A 1KDRA 2CY0A 1CB7A 3HY4A 4BLQA 4HUQA 3DMFA 3K35A 2WK1A 3S1LA 1GGFA 4F92B 1UQUA 4J7XA 5EJ4A 4IIJB 2OYSA 5HMMA 1AHIA 4U6QA 1IZYA 1GUFA 3F6PA 3IBYA 4FS3A 2JG3A 4PY2A 2WZDA 2NZ8A 1UBKS 4NU6A 4OKIA 5ALPA 3SSNA 1NI4B 2EJWA 3UJ6A 1CJKC 1E32A 1H4TA 2B34A 3OLQA 3OP1A 2X5XA 1SMKA 3ZZNA 1YS7A 2QPLA 2JFBA 3B2EA 3MQ4A 1V43A 3QE0A 5I48A 5K0EA 3ADBA 2WHRA 4L4UA 3HFRA 3CNHA 4PS1A 1ECLA 2CCKA 3FVTA 3EIHA 4IF6A 3OD5A 2ZYRA 1P5HA 1SBIA 2QRHA 3GMTA 5CURA 1BFKA 1YRLA 4HYTA 2PEYA 4GIBA 1O57A 4F3RA 1H2XA 3NXSA 4MRPA 1TM5E 2Y05A 1KMMA 1KAGA 2YL2A 5E6SB 1M2GA 5JYBA 3RROA 3VTAA 5ITZA 4YMGA 2N0SA 4U7DA 1ISGA 1RFGE 2ZLBA 2CC2A 3DHWC 4OM8A 3EVFA 3TLBA 1U3WA 5KJEA 4HEJA 4R68A 3STHA 1AA6A 3AWIA 1ISIA 1C2TA 3DVQX 4NV3A 2CXXA 3LIPA 5A3VA 1DWOA 3AIIA 4NJEA 3ZCQA 1AKQA 1Q7CA 4MW5A 2PJRA 1JEQA 2RAPA 4Z9AA 1T9HA 1NDQA 2BZ1A 1XOIA 2LE0A 3ETEA 3F3SA 3W1VA 5LMUB 2C3OA 3O3OB 1RQ2A 3G7SA 2YZGA 3Q3VA 1LVHA 1UXHA 1WB5A 3BICA 3CNLA 5M3BA 4DJFC 2CL5A 1PHRA 1WL8A 1P2SA 1T8SA 2A8YA 5CFQA 5BN5A 3V9AA 3E9CA 1D3AA 3AB8A 3N2ZB 4DR3B 1EYZA 1B23P 4GO1A 5EIBC 3BFKA 4XAQA 5BYBA 1BO6A 3F7NA 3WK5A 3AIMA 2AK3A 1QFJA 3JVDA 1BHQ1 1XELA 3L8ZA 5EP1A 1R6VA 4FE3A 2R751 4YRZA 4UARA 1I7PA 2GYYA 3T54A 3UXEA 1P2TA 1A8UA 1MOQA 1ZH6A 2YCLA 4I5EA 5IMSA 3LS2A 2O8VA 3HCBA 2J9ZB 4UTOA 1JFTA 1Z82A 4AY4A 1K2WA 2UYQA 1N5LA 4PG8A 3E7FA 3EGXA 3I53A 4GVPA 4MS3A 5HE9A 5CCEA 2IYVA 4CE6A 1LNSA 2H7VA 4I9GA 1H69A 5C8YA 2D5IA 2ZCVA 3D2AA 3RHSA 2F8TA 4HDAA 4QELA 3RJ5A 2FN4A 2WA2A 4KO1S 1THMA 3VV2A 1KOGA 2VNKA 2GASA 1G7SA 4AXBA 1P72A 1PG2A 1MOPA 3B5IA 1OZGA 3KB8A 3MCZA 3QUAA 4FT2A 4GVLA 5D01A 5DSZA 2OORC 5C1IA 1T9AA 1HF3A 1U8TA 1A0OA 2YV2A 4W9RA 5FBRB 3FUUA 2Q0XA 4J2HA 4P3OA 1DUIA 2C0PA 3GWZA 3DTVA 3LV8A 5E4JA 3OHPA 4W5OA 3UHOA 3BKWA 3KG2A 1Z88A 4JT9A 1GUDA 4F6RB 2LWIA 3P9SA 1WDLA 3QVWA 1FUEA 1YC2A 1LD3A 3QELB 2FQWA 4CL2A 4OMUA 4LYEA 4EPRA 1V6SA 3EF1A 3GGSA 2P91A 3A31A 3QVUA 3GWGA 4MWDA 4S1PA 3WLFA 4ZDIA 3IUSA 1ZMBA 3VTZA 3U56A 3AX6A 1XQ1A 1U1EA 3KV1A 2JVIA 4C6TB 3KO8A 2H3EA 2X8LA 1T4BA 3H7AA 1H2ZA 4KQFA 2JRLA 2PMCA 3DTVD 4OOEA 5DYNA 1M6EX 1FDTA 3B5JA 3PC2A 2OB2A 3RUIA 3S99A 4O33A 2I55A 3RRMA 2X6TA 3VC1A 4KYIB 4I36A 4ZRDA 3VVLA 3ZLBA 5HEKA 3LWZA 5FTWA 4M87A 4JKOA 2D6FA 3BXEA 2B2XA 3NJ8A 3OQPA 4R9UC 3IKVA 2FPIB 4CTMA 1HFJA 1KAEA 1PWEA 2BGNA 3PNMA 3A6FA 4B4OA 3K0EA 3KQWA 4WXMA 1QC5A 2GBLA 4PC7A 5PNTA 5BVHA 3H18A 1WE2A 4IO1A 1QCYA 2IGTA 2XRFA 3TLAA 3TLMA 3FKSD 1O96A 2HF9A 4UATA 5KDOA 4URUR 1EDDA 1SZPA 1E9FA 1VIDA 1ETUA 2RKWA 3CZ5A 1XDDA 3L1UA 1F2UB 4AY3A 1JEYB 2J3MA 2DLDA 1PZXA 2VJNA 3FPBA 4P33A 4ESEA 4LWZA 1XA0A 4DLNA 2F17A 2YXPX 2BM1A 2ZYDA 4OIFA 4ZI3A 3K0SA 1V16A 4ZAFA 4HEA6 2OHIA 3NTOA 4DA9A 1UXKA 2YHIB 3F6SA 3OPYI 3VH4A 2ZDHA 3CRZA 2FOXA 3LQYA 4L3OA 3NZEA 4QJ4A 2QMZA 2VXOA 3G8BA 4JIGA 5BWLA 5C46F 1G60A 4Y6LA 4OHPA 5LZ9A 4R6XA 5LB4A 2GXUA 5AJHA 5IKOA 3RLIA 1M7GA 3AP1A 4Y9RA 3MILA 3O93A 4Y2SA 2WFMA 1CQIB 1V11A 2WMOB 3AHJA 1I4OA 5E4FA 2V4ZA 3CUSA 4AZWA 4BNIA 4AS1A 2M6SA 3UW3A 1XDZA 3NPMA 2H2WA 1P4AA 2D0OB 2R8XA 5TIIA 4ZIRA 3MG9A 3ORSA 5KYNA 4E5KA 1M6VB 1J0DA 3INTA 1V8FA 1W88B 2JIQA 2J30A 5DOVA 1OH5A 2POQX 4ZANA 1HFWA 3EXAA 1USUA 2Q4RA 1KXJA 6ADHA 3PFIA 4PYJA 4BPRA 3SQOA 3IEUA 4J43A 4I6JA 1JHDA 3FAZA 2W8BB 2GVNA 3QWFA 2YBDA 3SHFA 3ZK8A 1A69A 3TQHA 2WU4A 3KZMA 2JLQA 2JAWA 3E2MA 4JMPA 1ZSNA 4E09A 1SHZA 1LI4A 3IPAA 1FDVA 4GMHA 3LT5A 1KY4A 2GJ4A 1SM4A 3R9IA 4CJXA 1OTYA 1EFPB 2E9SA 3AHGA 3OESA 1Z5OA 2ZJ6A 4HDSB 2AA3A 2B61A 3HA7A 2WIDA 4Q47A 4UHDA 4CKXA 4DCSA 5I8WA 1DDOA 1SA0A 1OAKA 2K6GA 3H2YA 4KAJA 2XQVA 3GRFA 5LN1A 2NO9A 2PFGA 2JD1A 4GGPA 2WDZA 1BKYA 2D2XA 4Y2VA 1S2DA 4HDCA 1OPRA 1QTQA 4BKPA 2G67A 1DJOA 4A0RA 1U8ZA 2J3HA 1GU1A 3JPYA 4ETIA 5BSKA 2XCSB 4IDGA 4G1UC 4RQUA 1ITZA 2HWUA 1XTZA 3ADKA 3K71B 5AK3A 1CJCA 1QMGA 4PZEA 4DXHA 5EIAA 5KYUB 1S8FA 2VK2A 3A2KA 1LQTA 1NVWQ 3WYFA 1YB6A 3MERA 3TB4A 1YA8A 5AVTA 3ER9A 4OU5A 1T1JA 3TQCA 3V7NA 3ASUA 2G9QA 2JI4A 2BC9A 1R9GA 3PJFA 4ZVLA 2JJQA 3GA0A 3DE4X 4TT8A 1UMDA 2FW8A 2VBIA 2VJCA 3E3NA 1ZD8A 1PLJA 1RS0A 4BFZA 3ZJYA 3VPXA 1AJEA 3ICQB 4KQMA 4EYKA 5A4AA 4RF3A 2X23A 3H13A 1L4GA 3O7WA 5CGQB 4ZT6A 1XTUA 4CDGA 2AR9A 2ZAOA 4ZO7A 3A1UA 4RJJA 5AUOB 1QOQB 2GSWA 3SYMA 3TFOA 3FWYA 3I2YX 3D8RA 2CNWD 1YRAA 4TV8B 3TIXB 3GMIA 5I9IA 2POCA 2PK3A 3H6KA 5KAPA 2VT3A 3TRIA 5B2EA 3LC7O 5KKNB 5FCDA 4XWTA 4D9IA 3WQQA 2I71A 2CXOA 4H6VA 1MVLA 4YBZA 1UK6A 2O59A 2YHSA 2BFEA 4K9KA 1R66A 4ETNA 2Q1WA 2MWMA 3A14A 2VPYA 4IHJB 2Q5LA 3RSGA 4WZBA 1NE2A 2IHBA 1WZCA 3BJRA 3OLWA 5CG2A 5E4YA 3DAPA 1CUBA 3I2FA 4RTLA 2GZRA 1GLVA 1L7PA 1W93A 1TF5A 3F0TA 3GJ6A 3A05A 2CNOA 3INNA 4KO3S 4D3YA 1Y6RA 3BCUA 4JEUA 3RRBA 3UJCA 3V00A 3BILA 3IAFA 2GOYA 1S2IA 1SCNE 1AOXA 2NQ8A 3V42A 2CZCA 3FHLA 3KALA 4XARA 3Q8LA 1C1XA 5J4VA 1WUKS 2ZJOA 3DEJA 3OCWA 2WHXA 4RXMA 4ZJYA 1RSZA 2OQ2A 3NNSA 2AF4C 5TE9A 3MTAA 3EEBA 1EE9A 3LPLA 4K86A 4KWCA 1I5RA 1MVNA 3FIUA 4ZOEA 1A76A 3DVSX 1TZMA 2WHEA 1J0BA 1UBHS 4PRYA 3PA6A 4NIMA 1SUIA 3IUYA 1XZQA 1V7CA 1DXQA 2H65A 4MCJA 2FR8A 4D0NA 4UBMA 1QRDA 1KO8A 5EP4A 4DMGA 4KUGA 3IKJA 1FDOA 4QU5A 2JAHA 3OHSX 3AUFA 4KX3A 1SHUX 3NCHA 2I7DA 1KGSA 4FYWA 2XUKA 4LNHA 1MB2A 1C8KA 4ZVQA 1PG5A 1UJ5A 1VRCA 3JQRA 5KB3A 1NUPA 3DZDA 4IUBS 4QGGA 4D02A 4EHBA 5A9SA 3KSAC 3EK2A 1EWTA 1Y3DE 3PE6A 1GSOA 1WG8A 4TXJA 1NKTA 3HM2A 4Q4JA 5ILGA 1UBNA 4M0DA 3CEHA 2WWHA 3LUAA 3OUTA 3TBHA 4NU5A 3GRZA 4O4HF 3U49A 5CDSA 2BKAA 1I1QB 2QRNA 3QVGA 4QPZA 2QVZX 3L7KA 1V39A 5HFJA 5FWXA 1ONPA 2BZ0A 1T1SA 3DAGA 4UE2A 4R2HA 1VKOA 2O8CB 4MKRA 1GZVA 4XLZA 4OHRA 1S9HA 1CP3A 3SEAA 2QWXA 1K8RA 2PMWB 1I13A 4FNAA 4FU0A 3GFFA 2IYOA 3BWCA 3HABA 1VLLA 2E4AA 5ELLA 2QX4A 3ROMA 5KPJA 3LXMA 1IN5A 2X7HA 1OVMA 4TYWA 4H7KA 3PWSA 4BQEA 3I01A 1NWHA 2LDBA 3PUXA 1CY7A 3ADPA 5MF6A 1IWPB 1I6KA 5G41A 2I78A 4OXIA 1PV4A 4ASUD 3WVNA 2HJVA 4QT0A 1Z4NA 1T1GA 1MO5A 1KC1A 3C14C 4M9ZA 1NQAO 3DPIA 2QM7A 3HR7A 2ORIA 2F8MA 4U2BA 1VCIA 3COWA 1TU3A 4D79A 3KUDA 2ZI3A 3HWRA 4FLMA 2LW7A 4FXOA 4FYIA 2ZZMA 3WAKA 5BN3B 3MAJA 3GLGA 4AJ9A 1JRLA 1F0PA 3OIWA 4MTLA 3AVUA 4H4EA 2P40A 4A0FA 4XEHA 3QTTA 2R1ZA 3OPYA 1DO2A 3ZIDA 1NZDA 3SBXA 3A6DA 3PQ7A 4RH0A 4GBED 4YTEA 4UPDA 5C4GB 7AT1A 2O5CA 3OTGA 2R7KA 1FUIA 1JHAA 2XF2A 3T5MA 4XE5A 3QBDA 1GGJA 1EUDA 3VHLB 3MWKA 4GWKA 3V5NA 1JAZA 2Q5EA 4M9QA 3W2IA 2NMVA 2EF0A 1Z15A 3KX2A 3IR7A 4IGAA 4UQLA 3THYA 5CTAA 4I5GA 1PBNA 2C8VA 2FFJA 2I6QA 3MMNA 4R1OA 3R5HA 2EWMA 4HO1X 4QOEA 1EHCA 4S24A 4YO7A 4BVLA 1GSIA 1AGNA 1XSEA 4IGKA 2I3AA 4RAQA 2ZUVA 3DV9A 1ZGJA 2YIMA 1KAMA 2V8OA 4XSHA 2WIFA 2NNWB 4EB3A 1U63A 3R2JA 4B6OA 1MNAA 1W59A 3A4MA 3K6JA 1KZYC 4WBXC 3ZE9A 2GAIA 2VP4A 2BKLA 5DVZA 2AB0A 3C6KA 3LPDA 1KSJA 2G70A 1Z33A 1H0KA 3AVYA 3KFXA 3IUQA 2Q2QA 3BFXA 3FZEA 2VDVE 2ODWA 3H2GA 4HL6A 1XZNA 4EMBA 3C6BA 3A7EA 4OK3A 4CMIB 2QL7A 1EP1B 2GYVA 5DLEA 2BOVA 3TLGA 5HKKA 1MC5A 2G04A 4ZQGA 5DN9A 2QMOA 3V8VA 3A9TA 1HTTA 2OPHA 3W1WA 4WOPA 3GAZA 1M83A 1IB6A 2BEVA 4KQ2A 3ZCVA 2IS6A 5CDGA 1Z26A 1EP9A 3BL5A 1WHSA 5CX1B 4L6IA 2IY8A 3N2GB 4LY3A 2Y67A 4O4LB 3VR4D 4KQEA 4ZQFA 3IMCA 1NXXA 3UCXA 1WVGA 3ZWXA 4JGGA 4D3DA 1YCHA 5AHWA 4ZT4A 5BYJA 2G1PA 4OLFA 4XGIA 1WKCA 1U0BB 1TUBB 1MABB 2FXVA 2Q3JA 4EH1A 2WV9A 1JYFA 5FTNA 5JEDA 4GE0A 4RL6A 2BGJA 2QQGA 2VP0A 1GTJ1 5DNWA 4D3ZA 2H9YA 2CLMB 3FVVA 3PQ2A 4KO4S 2V1UA 4EKGA 4L9RA 1G8YA 3NP9A 2DUNA 2DPLA 4RJTA 3OJLA 3UV7A 5DM60 2B4YA 2NLOA 2GYUA 3STTA 4HQFA 1BXGB 3BCHA 3PWTA 4G9GA 4UU7A 4F5YA 2JI7A 1E7SA 5BQPA 2YXLA 5LQSA 1DG9A 1NQXA 3UAVA 3VPSA 4DWVA 3VUEA 2EX1A 2JAXA 3D81A 4GP9A 5FV4A 1OZFA 4O4HB 1E1QD 3NIBA 4OB6A 1YCGA 4QQRA 4QGFA 3N8DA 1DKUA 3FYUC 3ZU6A 3D3JA 4FC6A 4DC1A 3RK1A 2F1HA 1VTKA 5FQNA 5FAXA 4UM9D 4L5IA 4GR9A 1O94C 1NRWA 3B8EA 5B1SA 4WK2B 1TMKA 5TARA 3AEKB 4UPEA 5BW4A 4K6MA 3G5MA 3IOCA 3H9JA 3T1OA 5HIKA 1KK2A 5EJGA 1YHNA 5EJ9A 3U60B 3DBLB 3CEJA 2BFCA 4L1KA 4ECEA 2HQRA 1KPGA 2Y1EA 2Y8EA 3CWZA 4KH1A 4L27A 1FLVA 1YRWA 5FFNA 1RZ3A 4B7UA 4XDHA 3ANNA 3O21A 4W5TA 3F1KA 3O9MA 5JQGF 1JL3A 3I6QA 2JZNA 3UJBA 5DGIA 4R0NA 4G0QA 4KXUA 2ZYGA 3N2EA 3O4IA 5JAQA 3ZZTA 1SQ5A 3DUFB 2PX4A 2JFHA 1Y42X 1SKBA 2XA9A 2WVAA 4FHEA 4A0GA 2Q3HA 1N1DA 4HB3A 4BE9A 5HR5A 3K9FC 3THXA 4NNJA 2NU6B 4U0JA 3R7WA 5EERA 5KYWB 2XNHA 5FORA 3K0AA 3N6RA 1YHZA 2JIRA 1SAYA 3OBIA 2VK4A 4BJ5A 4KIWA 1DBPA 4Z4FA 2C5EA 3QK7A 1KH2A 4OU4A 3VSAA 5DHRA 3LGSA 2QUAA 3TGPA 1GQQA 2GN2A 3LZ6A 5FO1A 2J4FA 5ALOA 3GJ7A 2C9ZA 1SC6A 2OBNA 3U3XA 2AC7A 4PU0A 4TZ6A 3RE1A 1XDGA 2RD2A 4UHFA 3NIDB 2FPOA 1KJ9A 1SUDA 2QR3A 4BTLA 2W58A 2IDMA 2X2OA 3FN4A 4UZEA 7REQB 3WLJA 1Z6YA 4KR9A 1CWUA 1ACJA 4NATA 4EUEA 3EODA 2HJWA 1Z56C 3VAYA 3WNVA 5HKAA 3JQGB 1FU7A 3T9AA 4BGEA 2Q8PA 3LQ1A 4AQDA 1EHIA 3DC7A 3I5AA 1QAMA 1EA7A 4E32A 4P2BA 4OJKA 3TW8A 4B5LA 1PG0A 4Q1AA 4MSUA 4HV4A 5IRCD 2IIVA 4L3VA 4TZ0A 4LXHA 1I7NA 2X6RA 1TA4A 3COZA 1QH1B 3OFNA 3IQDB 1GKKA 4BV3A 3EVTA 4FE7A 2E21A 2XDQB 2R8EA 1XZ8A 1R4MA 2C4VA 2D00A 4CFYA 4QBHA 1LK7A 1VMAA 2OXCA 4FFPA 3N39C 4FOOA 2PFSA 4LV8B 4DFDA 1JG6A 1WB9A 2TYSB 2RGNA 4QJIA 4A6PA 3LOQA 2MJLA 3U9TA 3RFUA 5KYVA 3C4QA 1WBDA 2ZRKA 1I2CA 2ACVA 2JEOA 2JKYA 4CKBA 4EF5A 2JZCA 5IZCC 3MN1A 3IOEA 4KLRA 5GIPE 1I9CA 4RTPA 2IEZA 3QFRA 3C98A 5JHHB 2Q0QA 1BDIA 1KO1A 4RFSA 1A7AA 4ZQBA 5DN6A 2DQYA 5LQCA 2JLVA 1NI5A 3DEZA 3M3PA 3N8KA 2WKRA 2B5OA 4IIGA 4WKCA 3FKQA 2VA8A 3Q7PA 1I0LA 3LQQA 3L5OA 3LE8A 3O1HB 5IJ0B 5DM2A 3I8XA 3H1EA 4L8GA 3TOVA 1RR6A 5CTJA 4DUPA 3WS7A 2FX3A 1AUQA 1FTNA 4RKEA 4ZOAA 2EATA 3WFZA 3VKWA 4R41A 3E9ZA 4YI5A 3GEBA 2ZE7A 1U3DA 3BTOA 2NU8A 4K40A 5D3ZA 1ZOPA 2Z5FA 4MQBA 1NN0A 2O7RA 2HRBA 5AXCA 1HURA 3V3KA 4UM9B 3AJDA 4O1MA 2EP8A 3EZNA 1ISRA 3VUFA 1FS6A 3RC3A 3UK7A 4CV2A 3L7IA 2WM2A 2P6OA 3CUTA 1PR6A 4KSBA 2NXWA 4Z4QA 1MRSA 1VG9B 3HJTA 4EVRA 1Q3HA 1G0NA 4CF5A 4FSHA 2Z8YM 2AMVA 4TUYF 1KI4A 3UT5A 1BYUA 3BA6A 2V7EA 4ZYYA 3RREA 1DOZA 4YCMA 3AQIA 2I4RA 4MWEA 4Q7LA 2HMWA 3KKKA 4U5QA 3U1TA 2BGKA 3PF8A 3ZLVA 1RHRA 1DC3A 2XXAA 3I52A 2ESRA 1E3DA 2G6BA 3BWXA 3FPCA 1GP2A 1A9RA 4ZP1A 5AOAA 4D8WA 1TA0A 3KJNA 1IZZA 3O4HA 1K7SN 4FPXA 2M6RA 3V4SA 5DPMA 3FHCB 4QT4A 4ER3A 2J1LA 4C3VA 1K8XB 4D80A 1LBTA 3EARA 1SB9A 4M1YA 4DMKA 5JQGB 3I6YA 1JKJB 1NBHA 2X9GA 3DAYA 4P3YA 5AKIA 1C0EA 1WPXA 3B1XA 2NAPA 4V0MA 5DULA 2XZLA 4OQZA 3DNMA 5CVCA 4OB7A 1K63A 4J3FA 4FKZA 1X80B 5ALJA 5J9FA 1L7MA 4EJFA 3ITKA 4TMYA 2VWHA 4ZEMA 3K9NA 2OQIA 3IJRA 4GOOD 3K5WA 1PK9A 3WKEA 1IC6A 1YR1A 5C8ZA 1OXKB 3IEKA 1CRLA 2OGSA 1SG9A 2AOUB 1V2HE 3DKRA 2ZWPA 2QE7A 2D5AA 3LLCA 1LPPA 3Q3IA 4O3FA 2AD1A 2GJKA 3FMIA 1OY1A 3DOEA 2BM9A 4EEXA 3OE5A 4F7DA 1E2IA 2ZT7A 4Q6BA 3ZWWA 1UH5A 1T0UA 4TLDA 4MVJH 4EPVA 2RHTA 3GLHB 1FX0B 5HCUA 1SVSA 4YLEA 4E5YA 2D5LA 4RPIA 1RLJA 1CYEA 3MJSA 4HHEA 1FU4A 4MS4A 1XZJA 1FVOA 5EKXA 3RRZA 2JJYA 2LBPA 4HDMB 2H7CA 1U7XA 1U4OA 3WL7A 5AUNB 5L40A 2IBSA 3MHPA 3DC2A 4UAUA 3UGQA 3WP1B 5JXJA 1YQEA 1RD4A 2VDOB 3EXHC 3HJNA 4M7WA 2QMUA 1GPLA 3UAOA 2VSXA 5JZBA 1SIBE 2DBQA 4C6RA 2M1ZA 4E1BA 5DBOA 4DR1B 4MB6A 2GRAA 5EJEA 4WVFA 2YKGA 2AOTA 3CZRA 2RGBA 4V24A 3N5CA 1Z2EA 3VZBA 4ZK2A 2IU0A 3LQFA 3F5DA 1OFGA 1DEHA 2VK8A 4M22A 2NPIA 3X1WA 3BAZA 4NBUA 2YWGA 3HFSA 1PW5A 3C1AA 2DPHA 2WMDA 1OLXB 3HKCA 1OGYA 5I7WA 5KSYA 4URWR 3FMFA 4DNPA 1NPYA 2WJ3A 2VTDA 2VR1A 3BJEA 3FWNA 2RAFA 1V5GA 3HRKA 2P3LA 4CF7A 1MEOA 3QBEA 1LC3A 1O77A 4HQOA 4KC0A 4RC9A 4BYGA 4Y2UA 5BYAA 3N1UA 5JXIA 1KEKA 1O9GA 5JR3A 1ZHOA 2HREA 4LSWA 4S2EA 3Q0IA 1JWLA 2H7XA 4RHTA 3WWOA 2WZCA 3KVNA 3OKPA 4LJSA 4YPFA 5I01A 1J42A 4DDUA 1L7NA 5JEEA 2F8SA 3E22B 3FF1A 1OFHA 2MTBA 4MJ3A 3GV0A 1JLKA 2WU1A 4QJBA 2ONYA 2Y1OA 2Q5HA 3E1GA 4KYTA 3JZFA 4D1YA 2PUVA 2DH5A 2PLAA 1QSGA 4RLFA 1JG4A 4E0BA 1B6TA 3DMTA 1W2GA 3MT8A 4J4HA 1U2DA 3X3HA 3K7EA 3RG2A 3WC4A 2FXIA 3NBYC 2PUHA 4DQVA 1XEAA 2ZDGA 4UVGA 2P5UA 1N6RA 2AUTA 1X14A 3NONA 3IA2A 2HQ1A 1V3VA 3N05A 1H6BA 5GWXA 3EQ2A 3RAGA 2PV7A 3OECA 4TUYB 3D2LA 2FMFA 3GGDA 5D1HA 2OHJA 4K9OA 4WCDA 4WACA 4ARZA 1CUFA 4BFVA 5AI4A 1SQSA 2C99A 2Q9CA 1DAMA 1F0NA 1Z08A 4MCIA 3TZEA 621PA 1UK9A 1P7ZA 4WFQA 3P2JA 1RE0A 3TNYA 1ZMOA 3OEHA 4FYHA 2OCIA 1R18A 2XPCA 3AL3A 3AC0A 4MYDA 3REGA 4A3SA 4JI5B 3PXCX 1DX6A 3HCCA 3EAQA 3NBAA 4O2BF 4OK6A 1F5SA 4DTIA 1EA5A 2HKIA 2BAGA 2FY8A 4IDEA 4JQZA 2WUDA 1T9BA 5I7FA 3IGFA 1QIJA 3KJEA 4GRIA 3LQ4A 2CDBA 5GJWC 4KN8A 2WJ6A 1J5XA 4GWLA 1XRPA 2O5RA 4XKJA 4Q12A 5JMPA 1O9HA 3G9QA 4JXKA 4KX5A 2RH4A 3E8MA 3SBOA 5CG1A 2W83A 2QBYA 1QF6A 1D09A 2B78A 3OEHD 3RVKA 1KI3A 4BEWA 1FRZA 5D86A 4A91A 2KSQA 2QLFA 3QA3E 4ND7A 2ONCA 2JEYA 2XKAA 2PL9A 5E6UA 5TVKA 2PD6A 4BMCA 1F0KA 3ZXUB 4L85A 4RKRA 1QGUA 3IB6A 4AWAA 3WFIA 3SSAA 4Y1FA 1KNXA 2BCGY 3GCWA 4X1KA 3JXEA 5KNBD 2EXXA 3A9UA 4YXWA 1FQOA 1SGWA 3JQ9C 3V4OA 4ZEXA 4D8XA 5JSFA 2IP1A 4L95C 1SUAA 4UFNA 1GAJA 1V25A 4I8IA 1LX7A 2ZVPX 4NQRA 1VDZA 3BJIC 4RPCA 3W5HA 1EVEA 1TAQA 4Q16A 2DQ4A 4P81A 1XPRA 1MB3A 4U7GA 4G5XA 4KDCA 2VDWA 3MCUA 4J16A 4NYJQ 3V55A 3NYWA 1CFJA 3RYIA 4WI1A 2DT5A 3DV0A 5ALRA 5JZOA 4ZTZB 2PIAA 1ODCA 5I7RA 1HT0A 5THXA 1OI2A 1ML3A 2PN1A 5FBKA 1H1LA 4BFTA 1TUIA 1XTSA 1QGOA 2I8CA 3K0FB 2LDXA 3PPXA 4M86A 5MGNA 4B3MB 3BL8A 4WKPA 5AXDA 3ROGA 4P7GA 2A9OA 4NE7A 3VJLA 3UIEA 3ND8A 4H31A 1PU2A 1PFQA 3CWQA 1IEVA 1AKEA 3FPLA 5B12A 3FDZA 2PBLA 1GUYA 1I6LA 1UC4B 3L1HA 3FFXA 5EYPA 1NBOA 3K3PA 3AYXB 1ZJYA 1V1MB 4QULA 4MYRA 1DBIA 1Z4QA 3IHLA 4N5HX 5JJBA 1N6OA 3MJDA 5C7IO 1NV8A 4LVUA 2W71A 5CCDA 2G5CA 5ED4A 1T2AA 2D7DA 1J49A 2QUBA 3KLPX 3Q72A 1ADCA 4LJ9A 1AQIA 5I4CA 3FMPB 3AEUA 4IF4A 4F84A 1QJCA 4UQOA 1N5KA 3C3AA 2B25A 1X3LA 2PT9A 5FP0A 3WZ2A 3I76A 1NX9A 4HFMA 1NP3A 2JANA 4JLAA 3IAHA 2YN2A 3IKMB 5CFRA 2G9UA 1DAPA 5IJWA 3QU2A 2GNOA 3U37A 1UJ4A 3QG1A 3L05A 1CR2A 4JEHA 2HAEA 5AHOA 3SX0A 5L3SA 1VGRA 4D9JA 1KZ1A 4MR8A 3K5HA 3BH0A 2GK7A 3T99A 3E84A 4ND3A 1FSFA 2J32A 2RFLA 4MH0R 2IX9A 1KMCA 1YZGA 1G3QA 1L4BA 1WZUA 2R1TA 3EGEA 3NKLA 4PONA 2PNJA 5JSQA 3WQHA 3RBVA 3L8GA 3BMOA 4W7IA 5YASA 2X0RA 2VBGA 4MNTA 4WECA 2PBFA 2VKQA 3H5NA 1RIFA 1OXMA 3LBHA 3O8QA 3L77A 4HAZA 4F60A 5ITVA 2EGUA 4B31A 1OB5A 4EQ6A 3Q98A 3IVMA 4BE7B 3DKIA 4L02A 3VM6A 1TIPA 2CJFA 1L4HA 3G1UA 3HXKA 1T3HA 2Y68A 1S1CA 3PRHA 1L5HB 4O4IF 4GPTA 3C3PA 1RXWA 4F21A 5LSAA 5DBFA 1VJ1A 3PE4A 4CKCA 2JB9A 3NANA 2W00A 3AXSA 1TTQB 2H4FA 3CO5A 1HT3A 3E4DA 3QKUA 4WCFC 1XF9A 3UEOA 3I9MA 5FTMA 5EN4A 3WGKA 3FCOA 2BFBA 2F4VB 2I6GA 3Q7IA 3UA4A 3JQDA 5DHQA 1EVQA 3OQIB 3TOZA 3E5NA 4GGMX 2W2PA 4QUGA 3FNRA 5JCJA 3LT4A 1EXDA 3CH7A 4AJPA 4CIXA 2J3JA 1GADO 3AF1A 3L06A 3Q8XB 3REQA 3RADC 2FPGB 2AI2A 1JB9A 2Q5QA 4KXMA 1X8JA 4Q4LA 2F3UA 4UEWA 3RG8A 4KPUA 3AESB 4IWYA 3EIUA 2KQUA 4RK1A 5F7OA 5LQUA 3N8NA 4CI0B 2QS9A 3T4PA 3ZY2A 5LL6P 1TM2A 4N9WA 3MRXA 1EUCB 5L4SA 2NXEA 3LA8A 1XMIA 4ES6A 1MIHA 5CB6A 5JCJD 5KZMB 3IP3A 3VOBA 1V4BA 3AF6A 3D4BA 1E0AA 3CM0A 1SUSA 4MW6A 1RZRD 3EA5A 4QFCA 1IOVA 3L7CA 2F6RA 2W7TA 3O95A 1NVFA 3D02A 5LDDC 1FSGA 1KGDA 5JDIC 3QHQA 4CG3A 1ORWA 2Q49A 4KLNA 4TMWA 1JG1A 1USVA 3TNFA 3OHMA 3TQIA 1DTWA 4GGOA 4PIPA 3DOHA 4Q4HA 1JLRA 1U3GA 2H5JA 2DHRA 2F7SA 4FJ2A 3QSYA 4R5MA 2D5CA 4MQFB 3T1HB 1IG0A 1KFCB 2O20A 4FIZA 2VYCA 2EFDB 3PC8C 3BL6A 3QLEA 3CCCA 4KOAA 4MLZA 4RE6A 5A7HA 3JQ7B 1ZN2A 3BG5A 4CMEC 2VDPB 5JE8A 2BGRA 4QEZA 4Z9FA 4ALJA 1UKCA 2Z5GA 3JZAA 3K9QO 4HNTA 3L8EA 1QO9A 1UT6A 2OV1A 3ASVA 4P93A 4D9CA 1J99A 2ILVA 2H16A 3ZWVA 2BTOA 4URHA 4AYTA 3BPSA 3KD3A 1W30A 3GROA 2WTEA 2W2LD 1CPYA 4Y7CA 4KO2S 4GEKA 2SKCA 2K5UA 2Q3EA 3GFSA 1H8HA 4OY3A 1Y5NA 3CKYA 4ALLA 2I34A 4QOHA 2ZT6A 4RCVA 3R6LA 2DPXA 2OVBA<