4V0KA

Crystal structure of the crarl6dn in the gdp bound form
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
151
Chain Sequence
b'KVNVLVVGLDNSGKTTIIERLKGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 44
structure length 151
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0kA00
2WJGA 4KBGA 4PR0A 2FSFA 4MH0R 1V5WA 3DZ8A 3X1ZA 2PX0A 2PZEA 2ZI7A 4W5WA 2I1VB 2XB4A 3THOA 1D9ZA 4DVGA 1JR3D 1NY6A 3ZVRA 3RANA 2CHGA 1GSIA 1FTSA 3I8XA 3TR0A 4MRPA 4U5XA 2A30A 2WKPA 2AKAB 3GJXC 5EXPA 3RC8A 1XMJA 3IIMA 2FZ4A 5G40A 4OKSA 1NLFA 4JBYA 1W2GA 3FWYA 4AC9A 1G8FA 1QHXA 4ZIRB 3MWLA 3K0FA 2HYIC 4JLAA 5IDVA 1N0VC 3KL4A 4C7OA 3JZAA 3H2YA 4ARZA 1E9CA 4Q7LA 3EA0A 5EQTA 1DADA 1KDPA 3TKLA 2WWGA 1UJ2A 1ZIPA 3REGA 3U7HB 3QNUA 4GNKA 1W48A 3CR7A 3BOSA 5AUPB 4LWZA 4IKEA 2GK7A 2ZVQX 5FOUA 4BECA 3MCAA 1UADA 2IYRA 3QXSA 4PAQA 4IW3B 1DO0A 3GJ6A 4QGGA 3RSOA 2XJ9A 1G3UA 4MYCA 4TQ9A 4DUGD 1Z22A 1NF3A 1KI3A 3RS5A 1W36D 1CLUA 2ZJOA 2BEKA 3FMIA 4Z51A 2HLDA 2W6IA 1FMLA 5FBWB 1GOTA 1VHLA 1JECA 1GAJA 1NN0A 4LJYA 2VH5R 3UKDA 2MSDB 4PZLA 5J5CA 3VR3A 2X2EA 3HYTA 2NMVA 3D6TB 4DLSA 4NP6A 4G5GA 4I1VA 3BE4A 1JXOA 4NCJA 4MA4A 1NVXQ 1ZUNB 5A5GA 3ECCA 2V6IA 1D5CA 2ZRPA 5EP4A 1ZUIA 3IO3A 1KSJA 1R0WA 1AQUA 2UZ3A 4FMCB 4HUQB 5FBVB 2BBTA 1DTSA 2RHDA 5K8TA 2BMEA 2H1LA 2IEZA 3M6AA 1SXJD 1QG4A 3EZ9A 2QAGA 1OE0A 1Q21A 3LBIA 4LK2A 4UJ3A 2ASEA 1IBRA 4HZIA 3CPJB 2IEYA 3VKHA 1Q20A 1H8HA 1XEWY 3GJ4A 1G21E 1NLZA 4WIAA 2GBLC 2SHKA 3SYLA 3ZD7A 1ZU4A 3BH7A 2F3RA 4LBZA 1M1YE 1FOEB 1ZYUA 2G1JA 3R9IA 1XEXB 4G5QA 1I2MA 2JAQA 2V6JA 2VHJA 4XTRA 3W34A 4U7DA 3GCGA 2VO1A 3PUYA 4IJMA 3U6KA 1KK1A 2ZS9A 3R9XA 2X77A 1W44A 4IDPA 4LJ8A 4Q5IA 1R0YA 2IYSA 4B3XA 1ZM7A 2R6AA 2CK3A 4KLZA 4S2EA 4LUCA 2IL1A 5L3QA 1E2FA 5AR1A 3WXMA 4TMWA 2IXEA 4M2LA 3QSYA 5FUXA 1OPXA 1E1QD 4WAUA 4P0TA 2GILA 3RS2A 1II0A 1FUUA 2VF7A 5EP2A 3TMKA 3RRNA 4MYTA 4CVNA 2CCJA 3FTQA 3IDQA 2FDCA 4R7ZA 2P3SA 3G82C 3TSZA 5J4YA 5DIFA 2JLQA 2E1RA 2ZJAA 5ANRB 1ZINA 5CK4A 1J2JA 3IPXA 3S1AA 3EAQA 3AH8A 3L0OA 4BPBA 3HU2A 3QKUA 4W7SA 3W6NA 3DL0A 2Z6VA 2O8FB 5TVKA 3C4JA 4Q66C 4LGMA 5TXGA 2QTFA 3U3MA 3SHWA 4B43A 4BFZA 4P33A 2IYTA 2YWHA 1TAGA 4HDQB 3EIHA 3KFXA 4XOIA 2QORA 2ZE5A 1GL9B 5DN6D 4WZ6A 1GG2A 1Q57A 2A9KA 1PLLA 1UKYA 5BXQC 1OFUX 1DAMA 1GRNA 1IJFA 1Z2CA 4HAZA 3EWSA 4LBVA 1KI1A 4RVCA 3ZDQA 2F1HA 3RAPR 4E22A 3U7FB 3PEYA 4F4JA 1G3QA 1L4UA 4CEJA 3T1VA 1AKEA 4DIEA 5ELXA 2PMDA 4QM6A 1TQ4A 5F3WB 4D4KA 3RNLA 2R44A 1XTJA 2DWPA 521PA 2FFHA 5LB4A 4PSKA 2C9OA 2P6RA 2BBOA 4E07A 5FTJA 4FW9A 4B35A 1XB2A 3A36A 3SFZA 5CM9C 2AHOA 4RD0A 3B9PA 1XD8A 3RWMB 3QXCA 2ZRCA 3Q7PA 4ZV4A 5L8VA 1JAIA 3SN6A 1JPJA 2ONJA 1G8PA 2OAP1 3CO5A 1ESMA 4MGKR 1G64A 2GVDC 4EPRA 2ZE6A 2ATXA 4RZ3A 3WHKA 1EGAA 3QPVA 3W8NA 2GJ8A 4KVGA 1XCMA 4QOSA 1J8MF 3X1DA 2A5FA 2BEJA 3ZYCA 3MGCA 4IOLA 2OFOA 2NGRA 3OFND 1E6CA 4HUTA 2BV3A 2B8TA 2ZUDA 3L2OB 3HR8A 3NDBB 4Q9IA 3BWDD 1MR3F 4DLUA 2A5GA 4N1AA 5B2ZA 2B7CA 1M8PA 2Z4RA 5FFMA 3TR5A 3A4LA 2ZRJA 3FHTA 4D4MA 3ASZA 1NVVR 2VSOA 2WM9B 4JVSB 3FHCB 4BLPA 1JI0A 3EIQA 2YOFA 2O52A 3C15C 1M6NA 4OHZA 3OEED 2YWGA 2ZI5A 4Q9JA 3KXIA 1UBEA 2Z83A 3AB3A 1UDWA 2ZRNA 1UBCA 4LBYA 3FPAA 3NHBA 2NO0A 4NYIQ 3EX7C 4CEIB 1EESA 3VKGA 1UKVY 4FMBB 4NONA 1G8YA 2F9MA 2OLKA 2OM2A 4HAVA 3RRZA 3AM1A 1OFTA 3AP1A 4IEIA 4FCWA 4ZKEA 2PT5A 4LHVA 2ZPTX 4D4LA 1FUKA 3H86A 2IF2A 3THYB 4DUGA 2FGKA 4XWOA 5HKKA 2J45A 4QBHA 3ASYA 4DSOA 1KI9A 5EE3A 4GBMA 1Q1ZA 1II8B 4GOJA 1T3LA 4JBWA 1QBKC 4BLOA 5H70A 3SYNA 3BIFA 2W2VA 1F3OA 4EJSA 4YMVA 2JLUA 3MFYA 1XCGB 3QBVA 2ORIA 3KTAA 1XJCA 4URZR 1S1CA 4MGZR 2QQ0A 1TPZA 1N0UA 2LCFA 1K5DA 3MWKA 4BFWA 3U60B 3HPQA 1CKEA 3SE0A 3QENA 2AN9A 3R7WB 4JYBA 4PX9A 4BWYA 2GJ9A 4YDHB 1AZTA 4TLBA 4QJ4A 4C9BA 5L3RA 3KZ1E 1XXHA 1G291 1KZ7B 3FHOA 2OZEA 4FMDB 4AK9A 4UQOA 3QIAA 2W0SA 1G9XA 4DT1A 2IW3A 2V55B 2XZLA 4V0LA 4Q4AA 4XD7D 3QJYA 1HE1C 3B82A 4GDFA 3OE7A 1N6RA 4V0ME 4AYXA 2A5JA 3BH0A 5EXXA 3RHFA 4ERNA 2HXYA 1HQCA 1E0AA 2GRJA 1GUAA 2ZROA 1KDRA 3HWSA 1E9RA 4IOJA 1S3GA 1XTQA 1XBTA 1ZC4A 2ZS7A 2NO9A 1RW4A 3WMEA 1P2SA 3TH5A 4I1UA 2EYUA 3GFTA 3TJZA 1D2MA 3L0SA 2GBLA 4LHXA 5CLQA 5FL7D 3IQXA 3UG6A 2EWWA 1MH1A 2CDNA 3AF1A 1OYYA 4IVPA 2ODNA 1Z08A 1CBUA 2FZLA 2IT1A 1G5RA 4JT4A 3TQFA 4DLXA 2O8CA 1P75A 4CT5A 2YWFA 3AF2A 5AJWA 1HT2E 1ZC3A 1YZUA 5DYIA 3A1WA 2WWWA 3EPKA 4AI6A 3B9QA 2IHYA 3VR2A 3ZH9B 4C7OB 2C5LA 3SQWA 621PA 4ARZB 1CR0A 4PZYA 1P72A 1G7CA 1L7VC 1Q12A 4HAWA 1E2HA 4PQYA 3LXXA 4ZCMA 3BJIC 4NYJR 4AURA 3EW9A 4ZIRA 1CR4A 1W0JD 2VYFA 5CDFE 2RCNA 2IUUA 5KNCA 3LX8A 4LBWA 3ADKA 2B6HA 4FD2A 4TTRA 1A4RA 4PHFA 3LVQE 1TQ2A 4OL0A 1KI4A 2GDJA 4WXRA 2JJ2D 1U8AA 3QI2A 2W6JD 4L9SA 4RD1A 1E2DA 221PA 2QN6A 1OXTA 4XJXA 3H0KA 4EIWA 1U90A 2QTHA 3ZD6A 4XSHA 1T4GA 2FEOA 3ZIAD 2BMDA 3UATA 2BKUA 1E2QA 4DLWA 2FPMA 1OH6A 3WNDA 1WRBA 4QBIA 4R2HA 1F2UA 1AIPA 5TB5A 4JLJA 3K0AA 1IN4A 4C0SA 1DARA 1Z8FA 4JLDA 1R10A 3CNNA 3WBKA 2YWEA 4A92A 2ZE7A 4LJ5A 4N0DA 3K09C 4EUNA 3AVTA 2BKEA 3V00A 3VX3A 3UG7A 3NVAA 5D3MA 4ACAA 2FV8A 1IY0A 2QAGB 4NU0A 1PLKA 2ANBA 1NSTA 1KHTA 4LJAA 1TQDA 4C3ZA 4DC9A 3A37A 1E1RA 1K5GA 2W83A 1I2DA 1R8SA 1JALA 2D06A 3DDCA 4XSGA 1WDTA 2ZAOA 4DLZA 1KTVA 4HAUA 2X8AA 2JATA 4A0HA 2Z4SA 3B1XA 4PC3A 5C46F 2IYWA 4TYPA 5TDHA 1G3RA 3GLHB 4ESHA 2RHMA 1GKUB 2GK6A 1MT0A 4EFNA 3FVQA 2PZGA 3WY9A 1DELA 1KDOA 3LW8A 2JCSA 1MRSA 5L3QB 3U3RA 1D2EA 1JPNA 2G83A 2GZAA 3U2QA 4U00A 5FBLB 3SBDA 1JR3E 3LA6A 5GVSA 1GM5A 2KSQA 2VRWA 4Q1DA 2ZIAA 4Q00A 4B44A 3L8ZA 3THXA 2DB3A 3Q5EA 421PA 4LJ4A 2GF0A 5JJIA 2WMNB 3IIJA 3ETLA 3GP8A 2QM7A 1E9AA 4LPSA 1OT3A 3NH6A 5FPTA 1AKYA 4GRAA 1OXXK 3HR7A 2ZRLA 3QPUA 4RZXA 1NVWQ 4QG7A 2VP9A 4A82A 5LDDC 2XTNA 5HE9A 2QGNA 2WV9A 4DCTA 3TW4A 4DCSA 1TADA 2QSZA 4RKFA 2F3TA 2FFBA 2ZI4A 3PITA 2YKGA 2QP4A 2AD1A 3ZVLA 2QPOA 2O8FA 2OUKA 2QY9A 2LKDA 3V4FA 2GCOB 1ZMXA 2ZE8A 3I3SR 3OAAD 4RD4A 3O8CA 3OZXA 2DFLA 3O8DA 5FI1B 4P4SB 4PSVA 1OLOA 1T0HB 3THWA 1J7KA 2ZJ8A 1Z0DA 4JIMA 5TMPA 2WAXA 4CEJB 4M9QA 4B75A 4M9SA 2W6ID 3SNHA 3LVRE 3ND8A 3WYAA 3F3YA 4QJ3A 3CKLA 2BIFA 1OFIA 5P21A 3BB4A 1N5IA 3LXRA 3PUXA 2QGZA 1W5SA 3U44A 5KNDA 1N3BA 2KBEA 3NEYA 3RS7A 1YZTA 2C9CA 4FN5A 3EPLA 2V1XA 3CF2A 2IA5A 3B60A 1G3MA 4IRUB 4HATA 1UKEA 1QG2A 2YOGA 4H1VA 4KLNA 4NPHA 5A0FA 3TW8B 1SXJE 1ODFA 1SZPA 1YRAA 3UIEA 1WBDA 2PJZA 1UKZA 3E5HA 2H5EA 3Q5DA 2RAPA 2CLDX 2OSBA 2Q3FA 4QRHA 4EPYA 1VDZA 1XJQA 4U02A 4KITB 4C2UA 2O8BB 1N6HA 4W9MC 3BD9A 2GJKA 2G77B 3C7KA 3DPUA 2P6UA 1RKBA 2F1JA 2WOOA 4DJTA 3EXAA 4LC0A 1SKYB 1H8HD 2W0MA 2GA8A 1OIXA 1KJZA 5FL7A 4R2IA 1TX4B 4JSTA 5DGXA 3LWNA 2BJWA 4BZPA 2FWRA 3BC1A 3W5IA 2J46A 2QTVB 5TY0A 5HCIA 4DRZA 3KQNA 1E0JA 2X19A 3UANA 2J41A 4C0JA 1F6BA 4B34A 2F9LA 2BCJQ 1DG1G 1XJ0A 1G5PA 1KI7A 3UMSA 1YZLA 3QXJA 5KDLA 3CWZA 1R5BA 4GMXA 1IN5A 3WHLA 1JJVA 1N6IA 1OJLA 1F60A 5FOSA 4I4LA 1ZUHA 3AEZA 2A5DA 1KK0A 1DE0A 3A8TA 1S96A 1KSHA 4MRRA 3EASA 3QF7A 2EU8A 3ZS9A 1ELOA 3IIKA 2J0QA 4RJLA 5FTKA 1COWA 1F2TA 4IDNA 2GEUA 4OQFA 1P7CA 2XZOA 4TZ0A 3LLUA 1LF5A 1HURA 1EFCA 1VHTA 4Q18A 2ZJYA 3SOPA 1GFIA 3N70A 3PUVA 4QJ5A 5FUYA 2DHRA 2FPLA 2ZSFA 3B2EA 3WMGA 4HB4A 5EZ6B 2IYQA 3CIOA 1E9BA 4GZLA 3TGPA 4LZZA 3CRMA 5FPYA 1QDEA 4B3DA 2F43A 4G3XA 3THYA 1GKYA 3P20A 3ZIAA 3PVSA 5AJZA 1UEJA 1RC8A 3PJRA 3KTAB 3L8YA 4I99A 4KSCA 2IYXA 3PXGA 3A1SA 4LY6A 1M7BA 3DM9B 1YJ5A 3N2EA 4KHZA 2CEAA 1E2NA 1CP2A 3SJCA 4BRWA 3NG1A 4KO8A 1CJUC 2PT7A 2JDID 3K0SA 5KPDA 3UK6A 3B1YA 2OXRA 3WP1B 4EFMA 2VSXA 5FBQB 2WWIA 4XTCS 2OT3B 4DT1B 2OO7A 4PQRA 3RRMA 3ICQB 4GZMA 4Q4AB 1VECA 4BUJA 1Q0UA 2R62A 1KO7A 3K09A 2QU8A 2CNWA 3UWKA 1IQPA 1R2QA 4NCNA 2KE5A 2ANCA 1W0KD 4PHGA 4XVUA 1ZD1A 2C99A 2J9RA 3EZ7A 4Q21A 4PAOA 3R9WA 2FFQA 2QI9C 3MSXA 3CF0A 4NHOA 1QRAA 2F55A 2NTYC 3CB4A 3JVVA 4MRNA 1T0JB 2WICA 5K8UA 2AK2A 1FZQA 3VR1A 4BLRA 4XVQA 1CIPA 3MUFA 3F0TA 3B5JA 5KSPA 4GL2A 1NIJA 1OIWA 1NIPA 4L16A 2QM8A 2O8CB 4G5RA 1KMQA 1XMIA 2D2FA 1W4BA 3T61A 1KAGA 4JL6A 2D3WA 2RGAA 3BB1A 5LB2A 1DAHA 4HLDA 2PL3A 4Q9LA 1I4DD 3BB3A 5AUQA 1R5OA 1KO1A 4NTZA 4NBSA 2O0KA 2GCPA 3QF4B 3CH4B 1Z5ZA 3IBYA 1JQLB 1NJFA 4JBXA 1ONBA 3A58B 4ITRC 2GCNA 1RPZA 4IXNA 4QGFA 5AUNB 1R4AA 3ICEA 3U3KA 1E4VA 4W5JA 3BH6A 1Z6AA 4BLTA 1AS3A 1S9HA 1U9IC 1E79A 3GEEA 3OAAA 3EARA 4BEBA 1P9NA 2CHVA 2HXSA 1DAFA 3I8SA 1G8GA 2BWJA 4OHXA 2GJAA 4LPKA 1QHYA 2XTMA 2C77A 1X1SA 3G0HA 5DISB 4NZYA 1UFQA 2IF0A 4FCTA 5HKKD 3OHMA 4C0AC 4Q02A 4WOPA 5IF9A 1UBGA 1IN7A 5EP3A 3GD7A 1F2UB 3T35A 1RRCA 3K0AB 3VNUA 4D0GA 4I1SA 1RYHA 2ZSBA 4CW7A 1OW3B 1AS0A 2VP2A 3ONWA 4PAMA 3WMFA 2RGNC 3GQBA 3BS4A 4UNRA 4EPWA 5K8LA 5JRJA 2WKRA 1E69A 5FBRB 4OI0A 3QXXA 1L4YA 1R8QA 1ZD8A 5D3MB 4PANA 4C0BA 2EFDB 2BJVA 5HE8A 4URVR 2J7PA 3AKYA 3PG5A 3GLIA 1SHKA 2ZUCA 5EUQB 3BFVA 3CZQA 2P0EA 3K0CC 1G4UR 3OEHA 3J81k 1E32A 3K1JA 4C30A 2ZRIA 4HLQB 4R98A 2BDTA 1VG8A 1XX6A 2FMXA 4OBEA 5KSOA 2DWQA 1N6KA 1EFUA 1XDBA 2QL6A 2RMKA 2YINC 4OK5A 1GNQA 1KIMA 3B85A 2D74A 1KJWA 1X3SA 2ODEA 1QHSA 2ZYTX 2PJRA 1TQ6A 3AF0A 1TUIA 3OE7D 2NO1A 1RIFA 1IN6A 2J59A 3HDTA 3WYFA 1T6NA 3RS4A 1X6VA 2C78A 2QP9X 3NEJA 1V43A 2OBMA 4RKEA 2CE7A 2GWHA 1NN1A 3NXSA 1WA5A 3GLHA 2ONKA 2MMCA 1QHNA 3THXB 3ZVMA 4DSNA 4K8OA 1AN0A 4LC1A 4PFSA 3SZRA 4CEHA 1NP6A 4OQXA 4M1MA 1G6OA 4V0NA 2ZSDA 3FGNA 5L3SA 4B6FA 4NYMR 2D7DA 3LNCA 2HF9A 2WBLC 1XPUA 2DWOA 4RFVA 4AWXA 2GXUA 3Q8XB 5FTNA 5FPSA 2R9VA 2GEDA 5D3QA 1IJEA 1DO2A 1KI6B 3TSOA 1NSFA 2NIPA 5GJVC 2R2AA 1YKSA 3NKVA 2H7VA 3CNLA 2PEZA 1PZNA 5JCPA 1KO8A 4XH9B 3KUCA 3I72A 2VP0A 3PCRB 5EZ5A 3WRXC 2ORVA 2AXPA 3THWB 2B8WA 1J90A 4BQSA 5BN3A 3T5DA 2E9SA 3B13B 5CDFA 3EPJA 2GCOA 2NOAA 5DNYB 4LV6A 4RY2A 4Z8YA 3AV0B 3QY0A 1IAQA 2FSHA 1LF0A 4P4SA 5B30A 2VF8A 2GHIA 2PX3A 4MDEA 4TLEA 3AUXA 4F4CA 2GVZC 2ZRGA 2R8RA 2VP5A 3RLFA 3U44B 1ZRHA 2JDIA 2R6DA 1WCV1 5B58C 3RS3A 1KZGB 3F5FA 1FL9A 3DKPA 4LCBA 3QXHA 4WA7A 4O3MA 3T15A 3DM5A 1N2CE 4OHVA 1SULA 5CLLA 5CYOA 4D26A 4LOAA 2RGDA 2WOJA 4FINA 4B3GA 1Q1EA 1XPRA 3CRVA 1Z83A 2ZYUX 5IHPA 2REBA 1W0KA 3FMPB 2QBYB 1I4LD 4US2R 2OEPA 4D2IA 3GLFA 4AIIA 5JSZA 1WMSA 3Q85A 1EWQA 3KQHA 3WBJA 4L9WA 1N6PA 5BW8A 1E1RD 1NG1A 4P4TA 4BFUA 5GADl 2R6FA 2WIAA 1R6BX 5KTYA 1T3HA 3I5XA 2ZRBA 2O8BA 1M2OB 4OI2A 3KB1A 4F92B 2CCKA 4WZAE 2ODWA 1BOFA 1LB1B 4ILEA 4MUAA 1UF9A 3QPWA 1AK2A 1U0JA 1MKYA 4TMKA 5TV2A 2YJTD 2WZQA 4JLMA 3P4XA 4L8GA 1YQTA 4KXFB 1TEXA 2UKDA 3MD0A 2WWFA 2JLWA 2JJ1D 3KKOA 1OSNA 3B1WA 3FB4A 3W9YA 1J70A 4TL8A 4RD6A 2IYLD 3RWOA 2BC9A 2ZJZA 4YXWA 2H18A 1DVRA 2VSFA 3BGWA 5JI3E 4FWIB 1HTWA 4GMDA 3K0EA 4DZZA 5J40A 1R0ZA 1F2TB 2XTZA 1IXSB 4KBFA 1Z28A 2BMJA 4ZKDA 4GOXA 1TMKA 4PXAA 5FL3A 1XEFA 4NH0A 3GLGA 1S0UA 3AVWA 2OLJA 3HJNA 4M9ZA 4D80A 2XJ4A 4JS0A 1ZJ6A 4RCYA 3C16C 3HPRA 2R65A 2ZEJA 2F43B 2ZAMA 4O25A 1VTKA 4OQLA 5LD2C 1BYIA 4BFYA 4EDHA 5JCZA 3M1IA 1MOZA 1T5LA 2QRNA 4L4UA 1VCIA 4Q47A 1U9IA 3U6BA 2MMGA 4IDHA 1E2EA 1LS6A 4QM7A 2GXQA 4P32A 4Y0VA 4FIDA 1G1MA 1HQYE 3TRFA 5FOWA 1BH2A 5AJYA 2ZVPX 2ZU6A 1TU4A 4P3YA 5CIWA 3KFVA 3UMFA 1BMFA 2QG6A 4IFBA 3KJHA 3D31A 3VKWA 4PO1A 4TZ6A 4YLGA 5CB6A 1W4RA 2JLRA 3NH9A 4QGHA 1ZNZA 3NWJA 1FPMA 4HB2A 3A1UA 2BVNA 1GL6A 5TARA 2CL6X 4MRVA 1Z6YA 4PC2A 5JRZA 4JLKA 5AJVB 2AFIE 2QMUA 4G5SA 1ESNA 5UKDA 3AGPA 3UMRA 1FNMA 5BWMA 1TF2A 4A8JC 2LWIA 1G8HA 4US1R 4X8MA 3TE6A 5SZKB 3T1TA 3RABA 3L43A 5J4VA 4Q7JB 2TMKA 4O2LA 4M8NE 4Z1MA 4TWZA 2D7CA 5G3YA 2OG2A 4HB3A 3BFKA 1FTNA 4K81B 1IXRC 4JZKA 4QL3A 2QE7A 2VIIA 5EJEA 1IONA 4PPQA 3GFOA 5FR2A 3ND9A 3PEVA 2PCJA 2QZ4A 3CBQA 1S9DA 2H16A 4TN1A 1P3JA 4UXIA 3LD9A 1HT1E 1EFRA 4NYJQ 2ZRAA 1E4YA 1Q44A 2OV2A 3DMNA 4P31A 1JEDA 1T3SA 2IXGA 3T1OA 1NBMA 1WBBA 4V02A 4KCGA 5HTKA 4Z54A 4C0LA 1KKMA 2BOVA 4A9AA 4B74A 3QF4A 5JMTA 1P2VA 1MO5A 3DMDA 1E9EA 1WXQA 4MKIA 4V0KA 4LYJA 2GKSA 2XZPA 2WIBA 1G18A 2AWOA 2BBSA 1RFLA 2NZ8A 4ZCLA 1COWD 3KQUA 3VR5A 1G19A 4UNQA 3TK1A 4RZ2A 3GMTA 3I5YA 1RYFA 5EE0A 1GTVA 1ZAKA 1ZU5A 4P4UA 5DHAA 3MG9A 2N1BA 2Y8EA 1E2GA 1X8JA 2QQEA 2Z0MA 3IEUA 4HZUA 3BORA 5BYJA 1ZM4A 4BRUA 3MWJA 1SVIA 2ZRDA 2RH5A 2QA5A 1TF5A 1U0HC 4WW0A 3OIUA 4OI4A 3ZZ0A 3DEFA 1UEIA 2RKOA 3BAFA 2ZXUA 3GLIB 2BM0A 3TUJC 4BASA 3AP3A 1EWRA 1QHHB 1U81A 1GP2A 4A2QA 2W00A 1US8B 1U2RA 2G0TA 1H8EA 3SYKA 4AKGA 4A1FA 3QVVA 1N6NA 4Q1AA 2CHQA 1X8LA 4PC7A 3A1VA 1X1RA 2C95A 2WKQA 1CF4A 1IOZA 4RZUA 2IUSA 1XFAA 2CNWD 3RS0A 2BBWA 1GRQA 1S1MA 3X1WA 1KY3A 2ECKA 2JASA 2HV8A 4TLDA 4NDZA 2ZI3A 3LY5A 5EXSA 1G7RA 3TVTA 1XMVA 3PFIA 2Z43A 4CYMA 5JLJA 1G5TA 4KU4A 4QXAA 4D25A 3GJ5A 5FH9A 5E7JA 4HSEA 3RRYA 1E3MA 1SVMA 3IQWA 4DSUA 3B8HA 1K6MA 2IK8A 4A36A 2JJ1A 1SHZA 4CEHB 2CL7X 5C4GB 3T5GA 5HZKA 2CXXA 1FNNA 3MMPA 3IO5A 1N6LA 1UPTA 5E7IA 2MSEB 5L3SB 5BYKA 3Q7QA 4URWR 2XSZD 4G01B 1ZD9A 3I62A 3B6EA 2NO6A 4TSFA 1OB2A 2OILA 3A1TA 2F7SA 3IPYA 4MITA 3CUEF 4BEJA 2OE2A 4TTQA 4BZQA 2Q9AA 3PUWA 1E2IA 3BXZA 2GESA 4I81A 5E95A 3E1SA 2W2XA 1XNJA 4DDVA 3CWQA 3BRWD 4OK6A 4M1TA 1CTQA 1KK2A 3SU8A 1D6JA 4TT3A 4XVRA 5F9FA 5DH9A 1KI6A 2H92A 5C18A 1CR1A 2Q9BA 2RGEA 2QPTA 1OXVA 5B57C 1XPOA 4B47A 3MJHA 1E79D 5JECA 3VR4A 4D0NA 4FMCF 4A15A 2P2LA 3IHLA 4TYNA 1CEEA 4M1OA 4ZO4A 3V9PA 1RE0A 1AGRA 1YR6A 2JLYA 1HH4A 4DDWA 1QZXA 4G1UC 2QENA 4JSYA 4Q7KA 1E98A 5JEDA 5DYGA 1DBSA 3U3JA 4QHSA 3G5UA 3B1VA 2IYVA 4QNMA 1ZBDA 4LJ9A 3SR0A 1PJRA 4Q1BA 2FX3A 4DCVA 2VQSA 5CITA 3KKQA 3T12A 2A2ZA 3PENA 2IBMA 4WBSA 2NPFA 2NO7A 5JJKA 3DOFA 3B78A 1KMHB 3SHFA 1LNZA 2HT6A 1HV8A 1YR9A 1CJMA 3GLFB 5JSZB 3P4YA 4NMMA 2J7PD 3AUYA 1ZM3A 1NKSA 1Z6TA 3OIWA 4HDCA 1X86B 1XXHE 1S2MA 2WPDA 2YYZA 2ZSAA 3OEHD 4US0R 2V3CC 5IRCD 4DDTA 1KK3A 1U98A 3NTUA 2QBYA 1ZP6A 3IGFA 4UKDA 1CR2A 4II7A 2YZ2A 3I1FA 1ETUA 4QC2A 2CL0X 2IC5A 4Y0AA 4A8JA 2CE2X 1SVWA 2Q9CA 2RB4A 3TLXA 2JA1A 4TMZA 4Q1CA 3PEUA 1GNRA 4NE2A 4QFMA 4FCVA 5JI2E 2DYKA 4DKXA 2QAJA 1AS2A 5LPNA 1E2PA 3C14C 2JLSA 4DIDA 4KYUA 3LV8A 4F38A 4TTPA 3U5ZB 1PUJA 3DOEA 4IOMA 4KODA 3TIFA 3T34A 1LS1A 2ZANA 5EXTA 5KOYA 2GZHA 2WTUA 1II9A 1XWIA 1MRNA 2QT0A 3AVPA 3IUYA 4YQFA 4TYWA 4BGDA 3W8RA 2FG5A 5CJ2A 3MRSA 2ZITA 4DLTA 3GLGB 4CIDA 1J8YF 1OXUA 1OB5A 2J7KA 1JXMA 2ZJ5A 3SDZA 5JJLA 3CH5A 3NBXX 1Z0KA 2WSSD 1KYIA 2NQ2C 2CBZA 3TUZC 4EPTA 3KJIA 2Q21A 2ZI6A 4TMVA 4F7WA 1NG9A 2C98A 3P32A 1YE8A 3ZS8A 3K8YA 4PPFA 1LY1A 4BLQA 4PO8A 4LHWA 1E94E 1C9KA 2A7QA 1Z2AA 2AR7A 4NL4H 4JLVA 1SKQA 4TYYA 4TL9A 1P73A 4JLBA 4S35A 4UXHA 1SVOA 2UVQA 2QUZA 2WJHA 3AVOA 1KNXA 1Z0FA 4IDOA 3SQXA 5KU1A 1FX0B 3E2IA 1KKLA 2XEXA 4AD8A 1N6OA 4QNRA 5C2JB 5SZHB 2ZREA 1VG0B 1NMZA 2QPAA 3NBYC 4AG6A 5DO9A 5SZJA 1XEWX 3AKDA 1JQJC 1LVGA 3RYTC 3VU9A 3K70C 5J47A 3D8BA 3SJAA 1YZQA 1IY2A 1Z0JA 1E0KA 1VYUA 1PLJA 4RFSA 2DPXA 3L82B 2QEQA 2G6BA 3CPEA 5E7MA 3FE2A 2EW1A 4M22A 1CXZA 3BBPA 2HUPA 4L15A 4MGYR 2EFEB 3BK7A 3UPUA 5A4JA 1KGDA 2FA9A 1DAIA 2B7BA 3VR6A 3VHXA 4Q48A 1ZCBA 2XGJA 1M7HA 5CIQA 3ZJYA 2I3BA 4JT2A 4PSAA 3FKSD 4MQBA 4QGAA 4ZDJA 3NDPA 2A5YB 3WYGA 2IYZA 4R71A 1P2UA 2Q0HA 3GJ7A 3GJ8A 4DCNA 1GKIA 2X2FA 1JAHA 3L0PA 1S8FA 1K8RA 3ZZUA 4C0HA 3LQRA 1IHUA 1GIAA 4JVMA 4Q4JA 1CULC 4ACBA 4N3NA 4H9GA 3AVUA 2O8EB 2XSZA 3U7EB 1S3SA 1P4SA 5EUMA 2ZQ5A 4YMUA 1G7TA 4LYAA 4A2PA 2JIZA 1JBKA 1QVRA 2V9PA 1EG7A 4MRSA 2VPPA 4XWKA 4OHWA 4F4IA 1FMJA 1TL7C 3NBFA 3UWOA 4KFSA 4M9XA 2HF8A 5DSZA 1WB9A 1Z47A 1D9XA 4HLUC 4YXWD 3GEIA 2JEOA 3TBKA 5HZHA 4EQ6A 1Z63A 2P65A 1ANKA 2O8DA 1KOFA 3QEJA 2AL7A 5KSZA 2WMOB 4DSTA 1OF1A 1PUIA 3CX7A 4A6XA 1JNYA 1TU3A 4YDSA 4O2RA 2V7QA 3U4QA 4ESVA 2YC4C 3AKCA 2WWHA 3X1YA 5JFGA 2WJVA 3W90A 2VHCA 2N46A 1XU4A 4HAXA 3LQQA 3U7GA 1VYVA 2P5SA 4PQFA 4M53A 2YC2C 4FMDF 3AF3A 4UNPA 4WXPA 4CZ2A 3VHLB 1Y63A 4HZUB 4URXR 4GI7A 2C8VA 5J4HA 1JJ7A 3AVQA 2WWYA 2OBNA 5EE9A 4CDGA 1W36C 1W7AA 3Q72A 3I4LA 2RGXA 4TL6A 2IX3A 4BFXA 1HUQA 1NMYA 4MKFA 4ZDIA 2O0JA 4H1UA 4ZCIA 1AA9A 3LBNA 2ODBA 5CYPA 1R5NA 4DXAA 2G88A 1MO4A 4EJSC 1BMFD 4DEYA 1H65A 3QEOA 2QP3A 2DFKB 2HYDA 4C4PA 3PR1A 5IK2A 1E99A 1Y3AA 1ZNXA 2C2HA 1FQJA 4ASUA 3FFBA 2GTPA 2YVUA 3AKEA 1QHHA 1AGPA 2BMFA 2HDNB 4UXJA 5CM8B 1US8A 2BM1A 1E96A 4Q03A 2VEDA 3RSLA 4Q1FA 4D0LB 2EVWX 4LHYA 5LBIA 1DG3A 3FKQA 4J0QA 1SXJC 2EYQA 1EX6A 3TAHA 2H17A 1YU9A 3Q9LA 1G3IA 3L0IB 4C0KA 3QQ5A 3H1TA 4FXPA 3WP0A 2VHTA 2OCYC 4Z1MD 1WF3A 3SC3A 2XXAA 1BO6A 1G16A 2J87A 4KSBA 1YR7A 1ZNWA 2FH5B 5G53C 4I1OA 3WNBA 2HJVA 1Q3HA 4NYMQ 4E03A 4V0MA 2ZM5A 2I1QA 2PBRA 2QE7D 1TEVA 2FF7A 2YHSA 3EA5A 4LX0A 4A0FA 4JLNA 2CVHA 4PC1A 4M1SA 3DKVA 1KI8A 1P2TA 1G7SA 1XZQA 5E3HA 2DFTA 2GETA 1N5LA 4B3FX 4FWTA 1A2BA 4QHTA 1EFRD 2XNDA 1JR6A 1W46A 4G0NA 1BYUA 2EFGA 2AWNA 1XTIA 4GP6A 5DE3A 3CZPA 1HE8B 2V4ZA 4JL8A 1SGWA 4OK3A 1NBMD 1OV4A 3CW2A 2EQBA 2CJWA 5FI0B 4B3CA 4JVNA 4LYHA 2WSSA 2ZYWX 4JKIA 1TTTA 2F6RA 4R9UC 3RDPA 2IHBA 1SVSA 3PUZA 5FOXA 5FOVA 3P1JA 4GT1A 4NKRA 2DBYA 2FN4A 2AKYA 3D7MA 4A0RA 2GAAA 4QKQA 3NBZC 1OHHD 5JHGB 1ZCAA 4DCUA 3ZZTA 2A78A 1BKDR 4DLYA 1CJTC 3M4YA 5GVRA 1A5TA 4Q9KA 5LD2B 5KYKA 4B32A 4IVQA 4C2TA 2W58A 1DAGA 1WQ1R 3AVYA 4KYIB 3GJ3A 3M0EA 4DBLC 3HP1A 4PC6A 1N25A 4BFSA 3VMFA 2ZR0A 2C96A 3KKMA 4RCZA 4D6PA 3NHAA 4IEEA 2GNOA 4TQUS 2FU5C 1E2JA 2PZFA 4HI0E 1RRPA 4F93B 1T9HA 2CLCX 5FOTA 5DI9A 5J4KA 5JBQA 4GOKA 1W49A 1Q3TA 1GDDA 1G41A 1GWNA 4A4DA 5KO2A 1MABA 2FSIA 1ZM2A 1KSFX 2WWXA 2KBFA 4AKHA 4AG5A 4IHQA 4JLPA 1ZM9A 1KMHA 1FW6A 1CRQA 1XTKA 1H8ED 4YMSA 1Z29A 1CRPA 4MUBA 3FKSA 4B76A 2FOLA 4DWJA 4CF7A 4D82A 1U0LA 3CF6R 121PA 1RJ9A 1W2HA 1N0WA 1KJYA 4A8JB 1UAAA 2XOKA 2D4HA 4WZBE 3CRQA 4BFVA 5BN4A 821PA 2FFAA 1XZPA 5HR5A 4B2LA 3R8FA 1XF9A 3OIVA 4MYUA 2AX4A 1OKKA 1OFHA 1NVVQ 1W1WA 2AFHE 2OXCA 4MGIR 1UM8A 2GJSA 1DPFA 2CVFA 5FR1A 3ZLJA 4B48A 3C5HA 1EXMA 2FSGA 2REXB 3EPHA 1GNPA 1P9WA 2ZUBA 3QKSA 4ZI2A 3ADCA 3CM0A 1JB1A 1NI3A 2ZS8A 1A1VA 2IYYA 2WJIA 2GXSA 4Q4HA 2AD5A 1NL3A 2F1IA 2J5XA 1CU1A 1QVAA 1RZ3A 2GEVA 2R6CA 1FQKA 2OAQ1 5CJPA 2NG1A 1G20E 1AZSC 1EFTA 4EPXA 4EPVA 5DI3A 3K9HA 5JEEA 2PLFA 3VFDA 5F98A 5GJBA 1R7RA 4TSFD 5G41A 1JR3A 5GJWC 1EX7A 3NIBA 4KVAA 4ON9A 4LV5B 3CPHA 1YZKA 4BZXA 2H8KA 2MSCB 4M1YA 721PA 4ABYA 3KXKA 2FE4A 4HLUA 2GF9A 3A6PC 2ZR9A 1U8YA 1Z07A 4TT3D 1Q1BA 4Q01A 3TQCA 1E2MA 6Q21A 4IXMA 1UDXA 5KUTA 4B6EA 1IM2A 4M21A 3VQTA 3DVLA 1CS4C 1T91A 2XAUA 3IKJA 1M7GA 1LTQA 3F8TA 1NKTA 2B21A 2IYUA 5H1YA 1EK0A 1XRJA 2ZRMA 1W47A 5M04A 2ZETA 5CB8A 3R20A 4ZDKA 1HEIA 2FPKA 3VU9B 3EC1A 1HY3A 2B92A 5KSYA 2RGBA 4FI3C 3MJRA 5SZIA 3P26A 2ZRHA 3AVVA 4RSGA 2QT1A 4B73A 5HPYB 1FX0A 2ERYA 4RFSB 3IBGA 2C03A 2X1VA 2JLVA 1GZSA 4K46A 3H4MA 2XB2A 2L0XA 2IXFA 1ZVQA 2UZIR 3HU3A 3ZVNA 2RGNA 4NYIR 4HEJA 3T1QA 4HB0A 2VTKA 3SBEA 2HT1A 1P5ZB 1M74A 3GLIE 2F1RA 2PLRA 1N5KA 2HCJB 4D81A 1T8TA 3E70C 1KAOA 1WP9A 1P6XA 2CLSA 3K0CA 4TLAA 2WPDD 1B0UA 1OXSC 1KI2A 1QHIA 3I73A 4Z8XA 3LRPA 1NVUQ 4AKEA 2QRZA 3OIYA 2N42A 4PHHA 3QBTA 1E0SA 2K5UA 4LI0A 3U3OA 3X2SA 3FOZA 3QKTA 2P6NA 4Q4JB 4Q1EA 5J4LA 2FEMA 1BIFA 1SXJA 4V03A 5K8IA 4A6PA 3LDAA 4AYTA 4YONB 2JLZA 5BN5A 3I92A 3ADBA 2EWVA 3JZMA 1VG1A 1G4AE 2CCGA 4X8LA 1YZNA 3CR8A 5KDDA 3WNCA 3QKRA 2WVJA 1KO4A 4YMWA 2ZRFA 3GLHE 3LX5A 3NC1C 1MO3A 1XD2A 1FP6A 2YOHA 2O8EA 4LJ7A 2J0UA 2ORWA 4EQ6B 4LDJA 5AJXA 2DFNA 4DB2A 2O8DB 1Z0AA 2VL7A 4PO9A 3ZQ6A 1GITA 2G1KA 2ERXA 4MKGA 4CT4B 4LV8B 2JLXA 4PPGA 3H84A 1NRJB 3U4QB 1YHNA 3CNOA 1UBFA 1NNEA 1E1QA 1OHHA 5JS8A 3VTKA 4XIGS 2OHFA 1Q1QA 3AGQA 5H68A 2IWRA 3TVDA 2V8OA 1VMAA 1SQ5A 2J1LA 1R0XA 3QVUA 3BERA 3KQKA 1NJGA 1E2LA 1TNDA 3K0FB 3LH5A 3REFA 1VYTA 3SEAA 1FFHA 3O8BA 4C0QC 4G5OA 4TQAA 5FUVA 3KDSE 4RD2A 4BFTA 3DO6A 1YZGA 4KFUA 5JWHA 2V54A 3C8UA 1KO5A 3KX2A 4NCKA 2VLIA 1E9FA 2DY1A 1G6HA 1VCMA 4X8HA 2OCPA 5DN6A 1W5TA 2E87A 3QOFA 1KNQA 2GAOA 4B71A 3KKPA 2Q3HA 2QMEA 2WSMA 1S4QA 3EWAA 3W5JA 4DEXA 4DHEA 1OYWA 4A0GA 5FTLA 1LV7A 2Z5FA 3TSWA 4KI0A 3PQCA 3VX4A 2XNSA 4ZI3A 3K53A 5CK5A 2OBLA 3U61B 3A4NA 3K9GA 5IT5A 1MV5A 5C1BA 2YNMA 2VHQA 3LLMA 3O8RA 3AP2A 4EAQA 4GSYA 2QNRA 4KAXA 5E4FA 3GLFE 2XXAB 4MDFA 2IWHA 1IXZA 1D8TA 3X1XA 5JZVA 4Q7MB 1B23P 1YVDA 1Z6GA 1NMXA 3R8CA 1AQYA 1NN5A 1Z6XA 2AXNA 4QBFA 2PH1A 1RVDA 2D2EA 2PEYA 3OESA 3Q3JB 4DB4A 3T06B 3V4RA 1VIAA 5EE1A 1A7JA 4MYHA 4DLVA 4BLSA 3N5CA 1VG9B 3EZFA 3DHWC 1Z0IA 4HUQA 4JMPA 4NCHA 1SKYE 3CX6A 2FNAA 3K9NA 2OCAA 2IS2A 5C4MA 3TNFA 5G3ZA 1E9DA 5GJCA 4TL7A 4Q9HA 4PPNA 4ZPXA 4WVFA 2HCBA 5F9HA 1NLYA 4KV9A 3OFNA 2JIZD 3FYHA 2IS1A 1FP7A 2KJQA 5AWFC 2CJWB 4D4JA 4DDUA 2R6GA 3EZ6A 1EFHA 2IUTA 3EZ2A 5L3VA 1P9RA 3FDIA 2EFHB 4JLOA 4LJ6A 4MKHA 3GPLA 1OH7A 3SS8A 3ADDA 2REOA 2G9NA 1A82A 1XEXA 4JL5A 3W6OA 2V1UA 4YMTA 4EFLA 2OCBA 3I32A 1J99A 2C9YA 4PTLA 1C4OA 1VCNA 2HEIA 2XX3A 4TMXA 2O0HA 1XD9A 4B33A 2Q3MA 4CGZA 2V7QD 4X8OA 3GLGE 3OEEA 3B7GA 1HA3A 1GRRA 4UJ5A 1OH5A 4KFTA 4NCIA 1P60A 2ZJ2A 3S1AB 2CMKA 4QBGB 2PMKA 3B1ZA 3KQLA 5KNBA 2D62A 5AK0A 4B3BA 2WAYA 4Q4LA 4B2PA 3AQ4A 1BS1A 1DAKA 2J0VA 1QF9A 3JVUA 3W6PA 4F91B 1P61B 3CLVA 5KPJA 1MABB 2DR3A 1GVNB 4LYFA 1L8QA 1Q22A 4AY2A 4URUR 4UNSA 3K70B 2IS6A 3OF5A 1IN8A 4JVLA 2QROA 2ZYVX 5B64A 1LW7A 2LKCA 1G17A 3QUSA 1VCOA 1N5JA 1OIVA 4JJZA 2C04A 2ZU0C 3KB2A 1C1YA 1WE2A 2VHUA 1DS6A 3I61A 5H8WA 1SVKA 1RJ9B 2I4IA 4LRWA 2O5VA 3SJZA 3VAAA 2J3EA 3LAWA 3MAAC 5IK2D 1RRFA 4M0LA 4ASUD 1DOAA 1Z3IX 2HLDD 4KFRA 1ZIOA 2G0NA 4OI1A 5JWOA 3BFXA 3EG5A 1U8ZA 3DZDA 5KDOA 4V0OA 3SI7A 3O47A 3HYRA 5BQ5A 4RD3A 1XTSA 1L2TA 1LFDB 1VPLA 3TAUA 2YV5A 3AF4A 2QAGC 4IOKA 2ZRKA 3GEHA 3CRW1 4CRWB 2OFWA 5DLQC 1I4TD 2RGCA 4KJZA 1SVLA 3QKSB 4ZDWA 2WJJA 1OH8A 3K9LA 4OQNA 4XD7A 4OHYA 2RGGA 3WRYC 4E5UA 1T8UA 4BE7B 1IY1A 3ZQJA 4Q4HB 1YRBA 1PV4A 3CRRA 1F5NA 1XTRA 3A4MA 2NZJA 2EFCB 5HCNA 2ATVA 4L5BA 1NN3A 3P27A 5DI3B 3C5CA 3RC3A 3LFUA 4O0MA 4PHTA 2FGJA 1HYQA 5JHHB 1ZNYA 2BHRA 4M4SA 1XP8A 2VP4A 3D3QA 4OQMA 1F48A 3PEWA 4OJQA 2WHXA 3TUIC 1O87A 2QSYA 3FMFA 3IEVA 2HJGA 3LBHA 4OJKA 1T5IA 1U94A 1W4AA 2JGNA 2XNDD 5JS7A 5JWRA 1NBME 1U99A 2AK3A 2ZR7A 3FMOB 1AM4D 4EKDA 5AUOB 2WJYA 4M1WA 4IDQA 4IFEA 2PCLA 2OESA 3GJ0A 3KXLA 3W3AA 4POAA 4JJKA 3W3ZB 3EC2A 4HLCA 4DLRA 1KSGA 1Z06A 2H57A 1CJVC 1TF7A 3LO5A 3QE0A 4W5HA 3KKNA 4B2IA 2VP6A 5FPKA 4HAYA 3ZGXA 1E9SA 2CK3D 2G3YA 4IVRA 4AYWA 1JEEA 1NY5A 2GZDA 3CONA 3MWYW 4UNNA 5FTMA 3KJEA 4E09A 5KHOC 3VNVA 1AJEA 5FUWA 5FPHA 1YR8A 1GL7A 2A3RA 1X8KA 3AVXA 3SJBA 1W0JA 1TUEA 2KWIA 2FJUA 3KJGA 3IILA 5F2EA 1PVOA 4QHYA 2KB0A 1P62B 4XWAA 4Q19A 1VKJA 3IHWA 3SFVA 4LHZA 2KI5A 2ZSEA 1A2KC 1DEKA 1CJKC 3LW7A 3PIRA 1W36B 2JJ2A 2QMOA 1M34E 4LSGA 4CEIA 2ZJBA 2W6JA 4A2WA 3N2IA 2JJ8A 5DHFA 1MO6A 4GFDA 4YC7A 3PV0A 4EJSB 4TMTA 1D2NA 4URYR 2GXAA 4N0EA 1ZW6A 2BCGY 2P67A 2VBCA 5EP1A 1II8A 1GILA 1DAEA 2Q6TA 3K70D 3CX8A 4PZZA 1RRGA 1XMSA 1QHGA 3RVBA 2XITA 2J0SA 4HYYA 3EIEA 3UXMA 1KY2A 2QMHA 4AKIA 1SXJB 1XXHB 3FFAA 3QG5A 2XOKD 4TLCA 1KDTA 2W2TA 3GFPA 2ZTSA 2VA8A 1XCPA 1O3YA 2ZI9A 4GP7A 4JKYA 3QKRB 1VIYA 1E2KA 3R7WA 1OKKD 2OFXA 3HU1A 3QG1A 3NC0C 2DCUA 4M1KA 1XD2B 3C41J 3KUDA 2IS4A 4OYHA 8OHMA 2P5TB 5EE5B 2J0UB 4JYCA 4GPTA 4HDOB 1W4CA 2NPIA 3MLEA 4TYQA
chains in the Genus database with same CATH superfamily
2WJGA 1VJDA 3FN4A 4MH0R 5LMUB 1ADGA 4CMCA 4TV9F 1I5EA 3LRTA 4BFCA 3LJKA 1Z2EA 3E82A 3X1ZA 2BGGA 2P6OA 5BR4A 4ID9A 1S6YA 3PQEA 3IQHX 3PQ8A 2P77A 2XVAA 2I1VB 3A32A 3P0RA 4L0QA 3S99A 3JQ6A 1J0CA 3AR3A 5A0TA 2W2NA 5TJHA 1RRKA 1ZK1A 2DKFA 1J9GA 2B83A 1NJ5A 5ICGA 1JR3D 1KYZA 1XQ9A 3AY0A 3T3HA 2LV8A 1R8XA 2O2EA 5JD4A 3TR0A 1QK3A 2H54A 2XZDA 3I76A 4N0MA 1R16A 3GJXC 5SICE 2RE8A 4S1OA 4Y0NA 3IIMA 3LCCA 1VE3A 1RS0A 5KC9A 2VDMB 3PKIA 1FS6A 2C4TA 3T7SA 2W71A 1K86A 1C1DA 1QHXA 2V03A 3C3BA 2PPVA 3RIXA 3WDKA 5LQNA 1YZVA 4DCJA 3K0FA 4ZIRB 1XN1A 2VT2A 4L78A 2EAUA 1W36C 1MAAA 2IYOA 3E7FA 1V1RB 1I8TA 2OXFA 3TKLA 3BQ9A 2WWGA 1P2BA 4XVHA 1L5KA 3W2GA 5KBYA 1ZIPA 1KEZA 1PJAA 2B1QA 4LXYA 3REGA 2CDCA 3CR7A 3MTGA 4EARA 1P74A 3G6KA 3V4PB 4G5FA 2WTEA 4BVEA 4BECA 4KNWA 1PG0A 2HC9A 2IYRA 4MW6A 5ELMA 3RF6A 1E3EA 3TGLA 3EF3A 2EKBA 1DO0A 4MCIA 3E7DA 3RSOA 1CY2A 2XJ9A 5EWJA 2YY5A 4TQ9A 4A3SA 3AIKA 1Z22A 4DUGD 2D54A 2HF2A 5CVVA 2FHPA 4BU0A 2ZJOA 4MIYA 3SX0A 2WZDA 5IVPA 5AOBA 5K7SA 1K8ZB 3OTIA 1FMLA 4BNNA 2NXJA 3CQ9A 3P2JA 1GOTA 1VHLA 1UZUA 1BKYA 2I6TA 1QQTA 2VDUE 3G49A 1NN0A 3NV9A 1FFXA 3OWXA 4RVUA 2E55A 2VA9A 2Z04A 1HYHA 1BS2A 1M1ZA 5JNVA 5JROA 2C0PA 4PZLA 1P9OA 2D6FA 1UFOA 3IVRA 2X2EA 5HUHA 4LQ4A 1EQ2A 1X9GA 1XXLA 4ND4A 4NP6A 5DM4A 4FLEA 5H5JA 2P75A 2M6KA 3SQDA 3T95A 4URFA 3TOVA 1I1HA 4RZIA 1LI7A 4UHJA 3ZY4A 4BO1A 3B38A 3C7AA 5F7XA 4DXHA 1U5BB 1GA4A 4LSMA 4DM3A 5A5GA 1GZUA 1D5CA 2HA4A 3P0FA 4D0RA 1Q77A 3T9CA 1R0WA 4R68A 4F9TA 1AQUA 4ZT4A 5K0SA 1S8NA 3SBXA 1W75A 3HKCB 4EHAA 5K8TA 2BMEA 1XLTC 2H1LA 3CUVA 3ZX4A 1DNPA 1V5EA 2DWCA 2I8AA 2QAGA 3GDHA 1ESDA 1LDEA 4LMRA 4C3VA 3G0OA 3FUVA 4RVOA 3WL8A 5K6TA 3VKHA 3AERA 2NACA 1T26A 1IRIA 2GBLC 2SHKA 4GGPA 1A97A 3M5PA 4GG1A 1JQAA 4O33A 5TR9A 5SYAA 3ZKWA 2WB2A 1ZU4A 3EZGA 1P2FA 2DF8A 2F3RA 3MCVA 5EYPB 1QU3A 3D8SA 1CHNA 4ER6A 1QUEA 1OA1A 1GPLA 1W87A 2X8JB 4ZC8A 4EM6A 3OM0A 5LM3A 1I2MA 2I5PO 3I01A 2CWDA 3GCGA 3F71A 2VO1A 4Q16A 4IJMA 5TC4A 5KTSA 3U6KA 1KK1A 2D0PB 5F1YA 2WPNA 1H2EA 3GFBA 3AEKA 2HSEA 2J3MA 4NFYA 4PZDA 3H16A 1QVWA 1TK9A 2CK3A 3O83A 4KLZA 4S2EA 4I8IA 3CLKA 2C61A 3ML1A 4J0JA 5I7VA 4PCVA 5COQA 4ZOBA 1GTRA 4JI7B 1F0PA 3NR2A 4OYYA 7MHTA 1VJGA 3E1GA 4L4ZA 3OZAA 1K7XB 3TMKA 2IV2X 4EA8A 2FDCA 2CWWA 5LL6P 2E6KA 3HQ4O 3WL4A 1JDPA 1B8UA 1MC8A 2GRUA 3R5HA 2JLQA 3IQDB 3FZYA 1C0PA 4LZNA 4RMNA 2QMQA 1ZINA 4KSYA 5F76A 3FR8A 1N2BA 4YACA 3IPXA 3CLTC 2NX2A 4N41A 4IIGA 3S1AA 4PN7A 4JODA 1GNTA 3HU2A 2Z6VA 3KR2A 5TVKA 1P5FA 3P9CA 1DLJA 4LGMA 4OKIA 3O38A 1EINA 3RFFA 4B43A 2VOEA 1ORDA 5LYJA 3SHWA 4MVJH 4P33A 3U62A 4BFZA 5C35A 1V2GA 1SOVA 1ZO8A 4HDQB 2VZ8A 4H0NA 3KFXA 4XOIA 3E84A 4J7XA 3T94A 1WPXA 3V7NA 4G09A 3T7JA 2NUPB 2YV3A 3R4CA 1PS9A 3PGXA 3EZXA 1GG2A 2A9KA 1HE2A 1PZXA 2YWDA 3KYDA 4XEHA 3WADA 1UKYA 5IEBA 4B3TB 4MWOA 4HAZA 1H0HA 2R8PA 2ST1A 5H16A 5MGBA 4I8DA 3QVGA 1STOA 3WK8A 4MRMB 4W9NC 1T34A 2IH2A 3I9NA 4RVCA 2F1HA 4WK0B 4CEJA 3PPXA 1EVKA 2NU7A 1GNSA 4JXJA 1E1CA 1WVGA 3NRBA 4JEMA 2IU4A 3RNLA 2HD4A 5F3WB 1XTJA 1QK5A 4HDKB 3GUZA 3AIMA 2FFHA 2YVAA 2PU7A 3LYUA 4JD5A 2QD2A 4DC0A 2HQOA 2P6RA 2BBOA 4E07A 1WNTA 2DC1A 1XB2A 3FNHA 1AUXA 3RLIA 3SFZA 3L01A 3AUSA 4RD0A 1ULHA 3DS8A 3DTTA 3KLBA 2QXUA 1BAPA 4UD2A 1J1ZA 3B12A 3QXCA 1L7AA 3Q7PA 5CA0A 3L4KA 1SKMA 1E7RA 1JAIA 1GGNA 2H9IA 2UXDB 3HZOA 3PUHA 4M76B 4DIOA 1G8PA 1WG8A 2OAP1 5BT9A 2XF2A 3HP7A 3LPMA 3MMSA 4EG3A 3CINA 2OV6A 3PCXA 5KQMA 4G1FA 4EA6A 1ODKA 1YB7A 2ZE6A 4FX5A 3QPVA 4KVGA 1HNZB 1JU4A 1CUWA 4JYPA 1ZKDA 2DT8A 1YR3A 2O2XA 2PNFA 3X1DA 2BEJA 2GCIA 2GH1A 1TZCA 2PMWB 1QM5A 2KM1A 3T9DA 1PW5A 3KPWA 3STXA 2JPDA 3H7IA 3ZGLA 5SY9A 3HACA 3IX7A 3TE7A 4AXBA 2BFPA 5B2ZA 3SJUA 1PYGA 2Q28A 5FFMA 3PQ7A 1HDYA 2ZRJA 1RI4A 1C5KA 1YRQA 4GBED 4M86A 3C6ZA 3H8VA 3ASZA 1L8LA 3VC1A 1YB5A 1QZUA 4GDMA 1MV8A 2KPOA 4QU9A 4N8SA 4BJHB 5B3JA 4G4SP 4CTJA 3NNNA 3EIQA 4R3UC 3PNLA 2YHBA 2VZ9A 1M6NA 4MQUA 4OHZA 4HAIA 5EEHA 4JYZA 4EF6A 5K3EA 2CF6A 1SBNE 1K98A 4PLCA 3FPGA 3GGCA 3QMMA 3OEED 2YWGA 1T4MA 4JOBA 4FQ7A 5ICCA 4OJTA 4OSOA 1UBEA 4YV2A 5B12A 5HMLA 4FNGA 1JI3A 1C8VB 3AM4A 4LMPA 2M2IA 1K4YA 2ZRNA 3QX7A 1QK4A 1DDIA 1MB4A 1N36B 1EESA 4U2KA 2EHJA 5EJFA 1TCAA 3UXEA 3EVEA 5HUQA 2F9MA 2OM2A 1XTZA 3RRZA 1I7QB 2ACKA 2EF0A 2IPAB 3AM1A 3VJKA 4FCWA 2G28A 4EA7A 2ZVJA 2PT5A 2QI9F 4D4LA 2VNKA 1I01A 3GRZA 3OY7A 3THYB 3L7CA 4HN9A 3UJ6A 4DUGA 2FGKA 4LJSA 3M70A 5AMXA 2PFKA 2Z1MA 5C8YA 1WD7A 3EVFA 1F9EA 2F2TA 3BWYA 2HPZA 3CNBA 3FZGA 4GBMA 1T3LA 1SB8A 4IGKA 4PHCA 4JBWA 1FRQA 1CQZA 1N8TA 5FBKA 5KKAA 5TJ9A 4L72A 3MT8A 2FQ1A 3WSWA 4EABA 4I1PA 5A02A 1CDEA 3KUXA 5EHZA 5U1PA 4Y2YA 4EJSA 5TF4A 3MFYA 3UY4A 5JXJA 2FEXA 2ORIA 2ZT6A 1S1CA 2XUJA 2P69A 1H1LB 4FJ1A 2PMBA 1W88A 2H4ZA 1Z4QA 2CVZA 3HKBB 2ZJ0A 2LCFA 4BFWA 1K5DA 1WZEA 2OFPA 2MCFA 5JH7B 5LA6A 1QIMA 1QJCA 4BC0A 4XRGA 4JYBA 2ZTHA 1Z26A 2CXUA 2GJ9A 4H59A 4A0SA 1VL0A 1X80B 3L7BA 1SBTA 4FGKA 5L3RA 3RTCA 3UGKA 4BV8A 2VUUA 4D9NA 2YFYA 4H7FA 2OZEA 4LJLA 2VH2A 3UTDA 2AE1A 4DXDA 2IW3A 8MHTA 1OLUB 4P2GA 3C0KA 4Q4AA 4WZAB 4D5GA 3ZV7A 1XKLA 2ZWAA 4FBLA 1MW9X 5ALMA 4GDFA 4KRFA 3OE7A 1H0RA 5CMLA 1TDJA 4AYXA 2A5JA 4G0UA 3JX9A 4Z9AA 2WQ7A 5ER9A 3RHFA 1GNVA 2UAGA 4AJ9A 4AJEA 4X5OA 3V1LA 1KDRA 3ILHA 3MMZA 2VXYA 4IOJA 2ZS7A 1XBTA 1ZC4A 2A6PA 2J6CA 3BJRA 3BZWA 3DUFA 3LSTA 2PN1A 4HO1X 3IT1A 1ATZA 3GA7A 3K5PA 2BI4A 3M2TA 1WXGA 5E6RA 4ZD6A 3ZHQA 4FVTA 4I1UA 3EAFA 3L0SA 1VSTA 2A4KA 1RHKA 2YFQA 3N0WA 4D9GA 1TA9A 2Y0CA 5ISMA 4IHJA 3HCFA 2VK8A 3FYDA 1RDFA 3W9BA 2CDNA 1QLHA 3EXHA 4FT2A 1CUGA 3AF1A 2C7OA 4WLNA 4IVPA 2D59A 3TQFA 3E22B 2QZ9A 1OCEA 1PP4A 2YWFA 4I14A 4C03A 5JXGA 2DVMA 2KYRA 3H9JA 5DP1A 1RYYA 3FOEC 5AJWA 1ZC3A 2PKQP 2XKBA 3A1WA 3U49A 3WGYA 2AN1A 3HJHA 3RJZA 4B4KA 4C6RA 2ENWA 4AI6A 4GM4A 1GZDA 3QUCA 4BO7A 4K28A 621PA 4ARZB 2PTHA 1AMOA 4EY5A 1J8VA 1NZJA 3NFYA 1SCQA 3HRHA 3QHAA 3A14A 1SRRA 1E2HA 4WOCA 5KTRA 5KZMB 2J32A 3BJIC 3J7AC 4AURA 2BEVB 1T2DA 1CR4A 2D1YA 3UJCA 3VYRB 1WSDA 4ZVKA 1PGJA 2QR5A 5LNK1 2W6ZA 1UDBA 3LX8A 1IULA 3ADKA 3O4HA 4FD2A 4QFBA 1CNFA 3OPYB 4GM1A 5DU2A 2VFAA 3LVQE 4MCJA 1U2QA 1UBKS 2FPOA 2ID9A 4RV9A 1GGHA 4WXRA 3DLPX 5HBGA 1TIKA 1RABA 3ISJA 4EI8A 1ZFNA 2W6JD 4GBJA 1E2DA 221PA 4NOLA 4RFLA 3CBGA 5B53A 3IAM6 1TJYA 4BWVA 1TEZA 3MS2A 1TQ8A 1C30A 1KP9A 3C39A 3UZUA 3QPAA 5G1NA 5DTRA 4QUJA 4GOND 4AS1A 4QYXA 2FEOA 4IIHA 4CDMA 2BMDA 4NX2A 3UATA 1WW3A 2YZGA 3V2IA 5LXTB 1ADFA 1MO2A 2C7PA 1RM5A 2I55A 3PLRA 4QBIA 2YVQA 3TEJA 1F2UA 2PQ0A 5TB5A 2VXBA 4JLJA 4ZN6A 1A95A 1Z8FA 4GICA 1R10A 2XYGA 5EMNA 2YWEA 4ETIA 5T7BA 2ZE7A 4AY4A 2Q3EA 2H06A 3H87A 3K09C 4P3XA 1RXUA 3C6MA 4RDXA 3IKTA 1FDIA 3AVTA 3V00A 1WOMA 5AXCA 3E0QA 4AXXA 4COOA 2H00A 3ABRB 3VKUA 5BV7A 3VJRA 4KR3A 4ITVA 2O7VA 5HKLA 1X15A 1JE1A 1TVKA 1NJ2A 4NU0A 4P5DA 1TYZA 4DA7A 2AI1A 1U2DA 1PLKA 1BJKA 1NOKA 3HKEA 3GRYA 5AJUA 3VC7A 2GVNA 4DC9A 1I94B 1J49A 1ZONA 2VAMA 3C3DA 4JKOA 1FDSA 4GYKA 6AT1A 5LQJA 4RXTA 1JMKC 2OUIA 4UPVA 1QIIA 1VMDA 1T6BY 1XZBA 1Z82A 4X60A 2X8AA 4A0HA 3EEYA 1ZKMA 3OQBA 2NXWA 3VSBA 1DBWA 1OI2A 4TYPA 1UMDA 2QSJA 2C9ZA 2H2DA 1DKNA 2M6RA 3GLHB 3H5WA 2RHMA 3NGMA 4Y6SA 5ULLA 5IFLA 1UK7A 1WB4A 4X6YA 2OTCA 7ADHA 2PZGA 1ODCA 4WGFA 2PNJA 1DELA 4AB1A 1BU8A 1MCZA 3LW8A 1LC3A 4TV8F 5L3QB 3U3RA 4ZZIA 3IODA 5FBLB 3SBDA 5KINB 3LA6A 1U4OA 3MJEA 5GVSA 1T8RA 4NNOA 1K06A 2VRWA 2ZIAA 1QIHA 3TD9A 3ZCRA 3L8ZA 4H35A 1TC2A 4CCYB 2DB3A 5KTTA 1ODLA 3LWZA 2B4AA 5JJIA 4UMVA 5E8RA 2QYTA 4ZMBA 3IIJA 3ETLA 3FDFA 4D3SA 5EKXA 3IAFA 2OR3A 3D6AA 5EHNA 4I3FA 3RIGA 4BNVA 1ABBA 1K66A 3COPA 4MYRA 2Q99A 3JZDA 4LPSA 1LU9A 4NAHA 1E1YA 2AOXA 1GFZA 4GRAA 1TPYA 4TKVB 4CHTA 1FSPA 4QG7A 5LDDC 2VF2A 1A5ZA 1ZJ5A 2QGNA 4PLZA 4RC9A 5K0LA 1J5EB 1EWVA 1VOTA 3TW4A 4RVNA 4O29A 4X3PA 2VDOB 2A0YA 1LBQA 3CSDA 4ARIA 2QSZA 3Q6NA 1EB9A 2BN4A 1J56A 3VYWA 4ZZ1A 2F3TA 3GPIA 2RBEA 4MQEA 3T3DA 5M5BA 1AU9A 3S5UA 3A05A 1YKFA 3SXUB 3B5IA 4C4ZA 4W5RA 1JJBA 1LWOA 1PV1A 3HWRA 4I55A 4ZV9A 3ELBA 1ZMXA 3I3SR 3V4FA 4RD4A 3OZXA 3I9LA 5DYTA 3A06A 3O8DA 4RADA 1PDOA 1T0HB 2FP4A 2GHQA 2H4XA 3THWA 3SIXA 4EUEA 1IXYA 2GYWA 1J7KA 5CNIA 5B1SA 1SQ6A 3OH8A 3U4GA 3TZKA 2VPYA 3L1VA 2JFVA 3LGAA 3PRJA 1M6YA 1PQYA 2DECA 2G5CA 3CG0A 4M9QA 3RUEA 4AJ4A 4F5YA 1DIRA 4M9SA 4EJ2A 4IGEA 2G7ZA 4JR2A 1C2TA 3AG6A 3DP7A 2AYZA 3QX9A 3SOZA 1YASA 2QF7A 3DPSA 5DRTA 2F4VB 3EGOA 3EIOA 3KLMX 4EB0A 1D07A 3U44A 3LXRA 2YXDA 3WWYA 3RS7A 1NBEA 4F6CA 1LLDA 4FN5A 1JR4A 1QFZA 2NVUA 3ZEAA 2PRZA 4ED9A 1TGYA 1XF1A 2GS9A 2OL4A 2FG6C 4WX2B 2DETA 1E7SA 4MW7A 5EINA 1L6IA 5LKAA 4KE6A 1JMYA 3B60A 4ZEXA 5I7WA 3OLCX 3HGTA 5P8WA 5FXMA 2LDXA 4LKOA 1J07A 1R0CA 1WUIS 3ZWNA 4NPHA 1YJCA 2ODTX 3ADOA 2QN3A 3SEFA 1SZJG 2H5EA 1TUBA 3G9QA 4EPYA 2OSBA 4IRMA 4YB8A 2L2QA 2AMJA 1XJQA 3G79A 3ZCXA 2Y77A 3GLVA 4F4FA 4KITB 1C1XA 1WXEA 3OKAA 5DTEA 2GJKA 1BA2A 1IQRA 3MUOA 3NHRA 4UU0A 5ED0A 2W0MA 3S27A 1W2WB 2O14A 2CFOA 4ZQHA 3RBZA 2OCDA 1TX4B 4JSTA 1ZD4A 4D9HA 3IB6A 3AEUA 3QLTA 4LMAA 1M2OA 1KOLA 4DMMA 3BC1A 3GHHA 3IQZA 5JJBA 3VI3B 4RY8A 3KQNA 5K01A 1EZZA 2RHTA 2OHXA 1XROA 2GO1A 2NXCA 2FVYA 2VCYA 4ME6A 5JQGF 4C0JA 5TE9A 5LOVA 1GHTA 5LZ9A 1I1OA 2JVKA 1CFZA 3GVHA 1FDTA 2HO5A 2X0RA 4WOBA 2O07A 5DPMA 4B34A 2Z6UA 4X1OA 4K88A 1WV0A 4ICIA 3UMSA 4TWJA 1QZZA 1QTRA 2BSAA 1R5BA 4E51A 4GMXA 1IN5A 3GO4A 1FFEA 1D6MA 4OMDA 3W8FA 1OJLA 5A4KA 1J0AA 3WIBA 1D2CA 3EEQA 4YJ2B 1KK0A 2GWRA 5ARBA 4AO7A 1S96A 1JG6A 1KSHA 2A3NA 2NSLA 3EASA 3K92A 2EC5A 4NU6A 4BKPA 5L4NA 1FIUA 1ELOA 1YZHA 1DXOA 1G8AA 4RJLA 1ADJA 1R27A 1D4OA 1F2TA 4K6GA 5FTKA 3VDMA 3WFZA 2G72A 4DSZA 3RYIA 4TZ0A 3LLUA 1LF5A 4WDQA 1VHTA 4Q18A 3SOPA 2ORED 3NJ8A 4RCVA 1L0BA 1DQZA 1YRHA 2ZSFA 3JTMA 3NDRA 5FUYA 3T0IA 1EDDA 3WMGA 4B6SA 5K20A 2AKEA 2IEGA 4JOSA 2IYQA 1EWKA 5B1HA 3EXIA 3JATB 5CB0A 5CXQA 3AZQA 5FPYA 1QYIA 2F43A 1NE7A 4G3XA 4XUGB 4G0PA 3FFTA 3KJFA 2V96A 5CXXA 2WIJA 1WSAA 2PIAA 1KGSA 4KYVA 3WMWA 1RC8A 3PJRA 3QY9A 1XELA 2R6R1 3L8YA 5BSMA 4HWGA 5K3CA 3A1SA 1ZEJA 3R7FA 2V7WA 3R3WA 4CLRB 3NPAA 5EVJA 3WO1A 4LTNA 5EWMB 4BRWA 5MN5A 4TKMA 2R96A 2H65A 3WO0A 2AJLI 5LU8A 4RTKA 2F8SA 3BXHA 4M6WB 2IVFA 5LC1A 3UK6A 3B1YA 1IMJA 2EKQA 3DWFA 3WNVA 2NUTB 3UW3A 3SYRA 5CHEA 4BNDB 3OICA 3IELA 1RADA 4GZMA 4ZYYA 3Q10A 1FVHA 2FDRA 2JAWA 2K2QB 3W78A 4BUJA 2GFHA 3HM2A 6PFKA 3NJRA 3NWPA 5J2UB 2FP3A 2QU8A 2CNWA 4WZBA 3UWKA 1IQPA 3VU8A 1R2QA 4G0YA 4LSWA 3VH2A 2TMYA 3JCZA 5ESDA 3ZCQA 2XIJA 5IBQA 1W0KD 1YAHA 1AO3A 1ZD1A 3UC9A 2B2XA 4TXLA 4EJ6A 4CI9A 3GRPA 1M8JA 3ER6A 1GCGA 1QRAA 1N2GA 3MGBA 1U3TA 2MINB 3DMGA 4MRNA 4LHEA 3GAMA 2WICA 4DQDA 1WS6A 1P3DA 5AW0A 4ZMRA 4KQEA 1IHXA 1N8KA 1JLLA 2X0EA 2DPMA 3LIIA 3VR1A 4BLRA 1NIJA 3COSA 5DWQA 2QNIA 2ONZA 3ZDDA 1H4VB 3BTUA 1MJ5A 5KKCA 2O8CB 3WLIA 1Z12A 1KMQA 2X0JA 4B6QA 4EKNB 4B4DA 1W4BA 5IARA 1T4CB 2O4UX 2OK7A 1R0LA 1LRJA 5LB2A 4ES6A 1A4XA 4UPEA 1RWWA 3SXJA 5AUQA 5CAEA 1FDRA 1O97D 4NBSA 3WB1A 2QLJA 2Z2JA 1HZZC 3CA8A 2WHEA 5CPBA 1VHDA 2ECPA 1U11A 3OA0A 3IBYA 1D6SA 1E62A 1JHXA 1ONBA 3A58B 3LTEA 3MAJA 2J9YB 4ITRC 5L4SA 1SK9A 3GEBA 1VGRA 5F3DA 5BP7A 1YA8A 3IE2A 1ZX1A 2P9GA 2DQSA 1R4AA 4MVJG 4XWYA 4RH3A 2H1RA 1E4VA 2YN4A 5BSHA 1ZQ1A 4BLTA 3D2LA 1QANA 3PT9A 3GEEA 1YF3A 5JBIA 1C0IA 3EARA 4BEBA 3LHFA 1P9NA 3IEKA 4KDCA 3A1NA 1V6SA 3ZHYA 4Z5XA 3ZDCA 5DTJA 3DFMA 3DEJA 4LPKA 5A3VA 2BTQA 4H4DA 1SKBA 2CJYA 4BTLA 4D3FA 3G0HA 3D59A 4NZYA 4FCTA 2IF0A 4JN6B 3MJCA 4WE3A 3TECE 4C0AC 1T35A 1TLFA 2CMFA 1XU9A 2G5TA 4J49A 3IUJA 2CMHA 2ZJ4A 3PFKA 4KNYA 3GD7A 3F9CA 2XVZA 4WDRA 1QS0A 2XUGA 3K0AB 5FV7A 2W6CX 3OFSA 3B6MA 5SY4A 1RYHA 1U02A 1OW3B 4UHEA 4ZOAA 1X0VA 1EX1A 2IDZA 3HL4A 3ROQA 2ZULA 3AOGA 5K8LA 1EUZA 1DSSG 2NVBA 5A3JA 1AG9A 1U1EA 5HF6A 4OI0A 1EEXB 3O93A 1T15A 4C5BA 1L4YA 1RBMA 1ZD8A 2BKXA 1TW2A 2RH9B 1R9MA 4URHA 5EIXA 1VPTA 4URVR 4XPIA 3TQSA 4CM7A 1Q74A 3OY2A 1K7CA 4FEGA 3U7QA 3AKYA 2QQGA 2WK1A 2ZUCA 3BFVA 4GEGA 3CZQA 3HCAA 3C7TA 2W90A 1VRVA 3K1JA 1FFDA 3NIWA 4LXGA 1JHZA 5IXSA 4BO3A 4R98A 1EU1A 2VDWB 5MDHA 1C3JA 2XADA 3AESA 4OM7A 1E77A 1I6KA 3DCJA 4HX5A 2FETA 4ARSA 4HV4A 5FD8A 1JFFB 1ZGGA 5FB3A 3VBEA 3HI4A 3RV4A 1KIMA 2RHOA 5BVHA 3G2LA 3WRYA 1M6VB 1P5HA 1KJWA 2ZYTX 3JQGA 5IJWA 4K6MA 4AZWA 1TQ6A 1XRSB 1TUIA 1XL0A 3TPFA 4E6PA 1RIFA 4BO0A 1IN6A 1B73A 1H2WA 1OX6A 3WYFA 4AMVA 1CUEA 1K63A 2BH2A 1TIBA 1X6VA 3OT4A 3HCCA 3NEJA 1ECBA 1F38A 5JNRA 4NMLA 4J7CA 3WYNA 2CYCA 3SZMA 1CUFA 3K4PA 3A3KA 4H7PA 3ZE6A 3NVDA 4KUEA 2CXNA 1B8OA 1R12A 4R8LA 4UREA 5AJHA 3U17A 1AN0A 1M54A 3UHPA 3QVWA 2LPMA 1UDCA 3WGVA 1MOPA 2JCBA 3WLHA 3NP7A 3F90A 4R1QA 3COJA 3Q8WA 1DB3A 2PRIA 1XTVA 2JFQA 4M1MA 4V0NA 2ZSDA 1T0UA 3DBRB 4A2CA 1BG6A 3HP4A 5ALQA 4ZCQA 2WF9A 4N6OA 3T1NA 4ZYWA 3LUKA 2AQHA 4OAQA 3ITDA 1Y34E 1XKXA 2GXUA 5FTNA 5FPSA 2N47A 6CHYA 1FMCA 1DL5A 3D8NA 4S1VA 2GQ0A 5HFJA 1QV7A 3EEBA 5TQ0B 3UENA 3V8QA 1K6IA 3MWEB 4HS9A 1EVIA 3DEIA 1YKGA 2R2AA 1ULAA 3DFUA 3DE7X 3NX4A 3NKVA 4ZJPA 4BZZA 1H85A 3DFZA 3EGXA 3M9WA 4R54A 4XH9B 3E5NA 1VKOA 2IU6A 2WAOA 4DCOA 5LP6A 3QVMA 4LDNA 4PRYA 2E37A 3O7WA 2WSLA 2WM3A 2A9PA 3H1GA 4KAFA 1P4RA 4I8XA 5CGQB 1O7JA 1QGOA 2AUTA 2WT8A 3PFHA 4AZSA 5KJ6A 2G4CA 4F72A 4YV7A 1ECFA 3ELWA 4L0DA 4NH4A 4YREA 5KYNA 4PYRA 4B2YA 3EPJA 1J22A 2GCOA 3H3JA 4QOJA 2NOAA 5CVJA 5IDYA 3WTCA 4LV6A 2B4QA 1WU7A 1YQXA 1IAQA 3QY0A 5KYVA 3RB8A 2BHSA 3I9JA 2PX3A 1QH8A 3FIUA 2GVZC 1T6ZA 3RLFA 4KWCA 4DR3B 1X9HA 2C4WA 2R6DA 5KYXB 2KW5A 4FPXA 4G07A 4ENPA 1GJRA 4HDNB 2HQSA 2HA5A 3LWDA 3GRKA 3FTEA 3F5FA 3BPSA 2OO5A 2IVZA 3TKYA 4WA7A 4O3MA 3NLLA 5IKPA 1X7YA 3WNQA 4CM3A 1DFGA 1N2CE 1OLXB 1SULA 1QIGA 4B6PA 2ON6A 4U9HS 2YNMC 1JZTA 3WLEA 2O48X 3FUCA 1XZ8A 1RPJA 3NCHA 1F4LA 3NP9A 4MO2A 2ZYUX 4OHFA 5JYEA 1J6UA 2Q0SA 1W0KA 3H6KA 4XAQA 4US2R 2B94A 3BGIA 3QYFA 5D6OA 4YAIA 3GLFA 2PWAA 3RGWS 4AIIA 4G6ZA 3DE4X 4MWEA 4B79A 5C8XA 4K9MA 3QWHA 4RQUA 1E1RD 1NG1A 2HA3A 3EE6A 3K5HA 4OJMX 4P4TA 5DB4A 4BFUA 1EM8A 2WIAA 3MF4A 5GADl 2V7GA 1T3HA 3C4VA 4M60A 3DAFA 3DOOA 2BSXA 2Q5IA 3ELYA 4UEOA 1SZDA 2P9FA 3THSA 5F21A 3KSDO 1O9HA 1BOFA 4G8JA 4S12A 1I3KA 1W93A 3DF7A 3ZNQA 1W6RA 3GDOA 1HLGA 4X6LA 5LP1A 3NTVA 4EG6A 4YK7A 1N77A 1MKYA 2Q1XA 3F7TA 3Q7IA 5CRIA 2GN8A 1H3FA 4L8GA 3P4XA 1YQTA 3UAGA 3B1FA 3O3NB 1TEXA 3N86A 1FMFA 3KB6A 3MD0A 5ITWA 3VPAA 1PYOA 1I32A 3AXTA 1TC1A 4UM7A 2GTHA 2IYLD 2OCKA 2QRLA 1E4EA 4BUCA 2AR9A 2VSFA 2A1TR 3RSQA 3WGKA 3W5CA 4HWTA 4QQFA 5BQXA 3RODA 2R66A 2BHTA 2PJDA 3K0EA 3V48A 1ICIA 3J7TA 1V6AA 4DZZA 3AHHA 1WXIA 3C98A 3GFVA 1Z28A 3M4JA 4M1ZA 4IILA 1I0IA 4MA5A 4QARA 4O3FA 2G9QA 2E3JA 4MLZA 3TLCA 2C84A 1XLUA 5H3LA 1X2EA 1XYYA 4IF4A 1K89A 1QG0A 2CMDA 4M9ZA 2XJ4A 2XOEA 1CB7A 1VJRA 4RCYA 3C16C 3DE3X 4UVIA 4H7IA 1YHZA 2PGXA 1YDEA 3M1IA 4I6GA 5CBPB 3D6JA 4UM8B 1R8JA 1T5LA 1XCBA 3I6QA 1PZHA 3OE5A 1U9IA 1FTWA 1BFUA 1UFRA 1ZVJA 1D1QA 2MMGA 1YBAA 2OORC 1LS6A 4D45A 4RHYA 4KPYA 4LZLA 5JXWA 4X91A 4BNMA 2GXQA 3ENKA 3P9KA 2EARA 4ND2A 1V2HE 3T5PA 4OO3A 1RBQA 4N47A 3C5WP 3O8LA 1W1UA 2C4UA 4CLXA 1TU4A 2C5EA 4K9LA 4REQB 3VNSA 2OHVA 3T38A 3ACBA 5EMLA 2R97A 1YFKA 2QL7A 4IFBA 3HC7A 3KJHA 4L76A 4K8RB 1I0LA 4F9GA 3GCXA 4ZYVA 5MGNA 3BMNB 4KAJA 4TZ6A 1QPZA 3DNPA 2JLRA 1NQUA 2FSVA 3NWJA 3A1UA 1S8OA 2CL6X 4MROA 1M2JA 1YQGA 3AI1A 1XRNA 2UXCB 3BMCB 4Z4EA 1EHIA 3CS3A 2AFIE 2QMUA 5UKDA 4QQ8A 3RE1A 1FNMA 2XMDA 1JVSA 1TF2A 1CY6A 2XUPA 3T1TA 5THXA 3C6YA 4OQYA 1R88A 5EXEA 5TS3A 2ILVA 1HE4A 1XRQA 3OZRA 4ARUA 1G5HA 4KX3A 3D5EA 4MW4A 2CD7A 4Z1MA 5ED4A 5A9SB 2UUAB 5CA1F 3BFKA 4FFNA 2WTAA 1TZKA 1V7PC 3JQAB 1AC5A 1IUKA 2YJZA 4IIFA 3LFHA 4LXTA 1KRXA 1L5MA 3BILA 4LA4A 1B0ZA 3ZNPA 3GZTB 1V1JA 1H93A 5LR6A 1WQ4A 2VIIA 1KMMA 5JNTA 1DZ3A 1DWUA 5JSUA 3SXPA 4UHKA 5ADUS 4BMNA 3RTEA 5I4KA 4INJA 5T8KA 4ZYZA 4ZT3A 3PEVA 1RTTA 1U2ZA 2PCJA 5FA8A 2VRNA 4WBNB 2R79A 1CE8B 3JSAA 5DMXA 4R2WA 1UBJS 4HOYA 4NS1A 2JH8A 2ZRAA 2JNWA 4P31A 1V45E 1WZUA 2XUQA 1Y3DE 1T3SA 4UAJA 2IXGA 4X1YA 5JCXA 1NBMA 3P45A 1W581 3UVEA 1J2UA 5I51A 4I4IA 4V02A 1RWMA 3LQFA 4ZCPA 1JTVA 5CNJA 3WYAA 1EVZA 1VLHA 4NULA 4Z54A 2DE0X 2EGGA 4L57A 3ZV5A 4A9AA 3PQ5A 3UFXA 3SKXA 1HE5A 3BSFA 3D1LA 2OK8A 3ZIUA 5JY1A 3L7NA 2WIBA 3H1EA 2OBXA 3TLAA 4OHRA 2WYOA 2XW6A 1RFLA 3UB3A 1XYGA 5EIAA 1MAHA 3KQUA 2P2YA 3IP3A 3UGTA 1G19A 4XASA 1HNXB 5E6UA 3OJ0A 3L7IA 1FYXA 1T13A 4P58A 5FLYA 1UKBA 4L3OA 1RYFA 4KR9A 1XQYA 3S8MA 1LSSA 3PE6A 4AUMA 1O6ZA 1ZH8A 2YN2A 3MS7A 1Z5WA 3OPYI 1NBWB 2NZ2A 1HRDA 3LUFA 1E2GA 2C3UA 3ANSA 3M5WA 4B6GA 3S8YA 3IEUA 5HDQA 4HRVA 4BRUA 4IIJA 3MWJA 3SX2A 2ZRDA 3THRA 3RYHA 3DMPA 2QA5A 1U0HC 4WW0A 1LPOA 1ND5A 4PLGA 2H0QA 3ZHUA 3DEFA 3BAFA 3P52A 3AP3A 5HFAA 4MVYA 4TXHA 1QHHB 1GP2A 4A2QA 3GFQA 1U5CA 2W00A 2ZYGA 1H8EA 2XGSA 4AZ3B 3GY0A 1R9JA 4AKGA 4YAUA 1PJCA 3K4HA 1CUSA 3QVVA 3P5SA 1W96A 3FBWA 1X8LA 5AHWA 1FP1D 1P2GA 4RGQA 1OFVA 2MYPA 2WSIA 3JR7A 2Z2YA 4NJMA 1A0OA 2R00A 5IMSA 4L50A 2C95A 2G5PA 1IOZA 2RB5A 3D6UA 3RS0A 3X1WA 1GRQA 4CMEC 5EPUA 3VR6D 2ECKA 2HV8A 3P9SA 3GRAA 4QX6A 2PL9A 5JAUA 4L02A 1LQTA 1QIKA 2JGRA 4QO7A 3RRBA 5IYZA 3W5SA 1XMVA 2I6FA 3KQPA 4CYMA 4C08A 4C07A 1EXVA 4BNHA 4BTVA 2RK4A 1T2EA 4LF6B 4PYQA 1M76A 3PA6A 5E7JA 2GLUA 3ZZ1A 3FCCA 1E3MA 2C5GA 3BTVA 4A36A 1K6MA 1TCUA 1ULUA 2IK8A 4HK4A 4B4UA 1RYNA 4CEHB 3CUTA 2WY2D 5HZKA 2CXXA 3GNLA 4MPPA 1N6LA 1UPTA 4JQYA 4L75A 5EGNA 1VL1A 4DC1A 2VRCA 2HQBA 2WKSA 2G09A 3HB0A 5L3SB 16PKA 3KD3A 3Q7QA 3ZE0B 4G01B 5E3JA 3TRKA 1E61A 4R0NA 3MTQA 4BY9E 4CIAA 4DB2A 2C9BA 1ORHA 1HDZA 3P7MA 5JSHA 1NVEA 3WHPA 3SVLA 5K4GA 4P0PB 1ZRMA 4BZQA 4TTQA 2Q9AA 4BYMA 1DAOA 2POCA 1HTTA 2RG1A 3ANLA 4PAWA 2VDPB 2VRBA 4TXNA 3ZGOA 5DNAA 2UYGA 2W2XA 1XNJA 3W04A 2PZMA 4F2WA 4OK6A 3LZCA 4EJ0A 5KREA 2VYVD 4W82A 3GELA 1C81A 1UBRS 2P91A 4OP1A 3ZPXA 1PX0A 4X3OA 3E1KA 1KI6A 2H92A 1CQPA 3R6WA 1T25A 3DPIA 3FWKA 3V1YA 3RT7A 4E08A 3L7MA 3UO8B 3UK1A 1YNSA 3L0DA 2C5HA 1E79D 2WI8A 1K8XB 4V38A 2P2LA 4YRJA 2YRFA 3IQGX 4Q6WA 3PGVA 4B82A 4RYLA 3I3OA 4RANA 1HH4A 2C3PA 3CKKA 2JIRA 1SZCA 2QENA 4JSYA 3HEMA 5LZ7A 3U3JA 4XFDA 5JYCA 2OV3A 3EAGA 4YUXA 1RAHA 3B1VA 1GQFA 4KLAA 3ZTYA 3WAJA 4LJ9A 1QP4A 3AHCA 3ROTA 2ZQYA 4OSEA 2HW8A 1GPJA