4V0KA

Crystal structure of the crarl6dn in the gdp bound form
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
151
Chain Sequence
KVNVLVVGLDNSGKTTIIERLKGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords ARF-LIKE SMALL GTPASE
total genus 44
structure length 151
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0kA00
4WVFA 2QL6A 1UPTA 1AS3A 1SKQA 2D2FA 2OILA 4NYIR 3FHTA 2G0TA 4GMXA 1KK3A 3VX4A 1Q1QA 1G8FA 2ZRJA 2V6JA 5B30A 3EA5A 3JVVA 3RS5A 2EFHB 3IPYA 2ZM5A 1IY1A 1UKZA 1TPZA 1COWA 4LC0A 1IY0A 3QKRB 1ODFA 2AK2A 3NTUA 4KFSA 2YWEA 5TV2A 1YU9A 5KHOC 4OKSA 2O8FA 2D3WA 4W7SA 1N5JA 1KO7A 4MKGA 3QVVA 3QF4A 4TT3D 1SVWA 1KI6B 1Q57A 2GKSA 2XEXA 5E4FA 4IRUB 5CDFA 4DZZA 2W00A 1F60A 2YOHA 1U0HC 1EX7A 4MGIR 4P0TA 3NWJA 3SJBA 5FTLA 1TTTA 4Q7JB 4KFRA 3CX7A 1FUUA 1X8LA 3K09C 2FF7A 2JEOA 3B60A 1CEEA 1E2NA 3SJZA 3IHLA 3A1SA 2B92A 1NN5A 3NC0C 4TTPA 5SZHB 1E9DA 1NBMA 2EFGA 2Z4RA 2ZJYA 2GBLC 4DCNA 2YKGA 4LBVA 4NYIQ 1HQYE 4ZI2A 4ZDKA 4BPBA 1YE8A 1KNQA 2P3SA 1XDBA 2Q0HA 4Q4HA 3IQWA 2YINC 4ZIRB 3AUXA 3A58B 5B64A 2Y8EA 1R8QA 2ONJA 3GEEA 1ETUA 1NN1A 4II7A 4ACAA 3SQXA 4G5GA 1SXJE 1T5LA 4F4IA 1E2EA 2CNWD 5BQ5A 1X1SA 1G9XA 2EVWX 2NO6A 4XSGA 4WXPA 3ONWA 3PCRB 2IF0A 2X8AA 3UMFA 3RC8A 4C3ZA 4IXMA 1TF5A 5EP1A 3FMFA 1YZTA 5FPSA 3TKLA 4V0KA 1E2PA 2A5GA 2ANBA 1N6NA 4QGGA 1LF5A 5FR1A 5D3MA 4B33A 5J4HA 5J40A 3HPQA 4PC7A 4W9MC 3ADDA 5K8TA 4TMZA 2CJWA 2BEJA 3MSXA 1PLKA 3OE7D 3P4XA 4JLKA 4IDPA 3V00A 4E22A 1GAJA 4G5QA 1ONBA 3C4JA 4M21A 4WOPA 5G40A 1NN0A 1UDWA 1XD8A 1T3LA 4DSTA 1JXMA 5CK4A 1OFHA 3AV0B 3CH4B 5G3ZA 5B2ZA 1OH8A 5J4LA 3TGPA 5AR1A 1FP7A 5EE3A 1E2MA 1U99A 3U3RA 4C7OA 2QP3A 3ICQB 3H1TA 4LHYA 4TL6A 2OBLA 4JLDA 2A9KA 1VPLA 1VDZA 1R10A 1ZUHA 1TUIA 3NH9A 3U3JA 4Q18A 4MA4A 2XXAB 3CNOA 3L0PA 1XD9A 1H8HA 3I4LA 2IXFA 3EZFA 4Q9LA 1KZGB 5KUTA 1OFUX 2Q9CA 2W6ID 1ZCAA 1OKKD 3CB4A 4DCTA 4HLDA 5E7IA 2QENA 2P0EA 4XIGS 3R9IA 1O87A 4W5HA 1HA3A 4JLOA 3PVSA 3Q5DA 1Z0KA 3K9HA 2RGNC 2HYIC 3PENA 4GNKA 2FH5B 2RGCA 5JEEA 1K5DA 1F2TA 3V4FA 3S1AA 3F3YA 1GDDA 1E96A 4GPTA 4C4PA 4A0RA 2V54A 3IIMA 4Q00A 4Q9HA 2ZSBA 1IAQA 4M1KA 1ZD9A 4BUJA 2QMOA 2GJKA 1YZUA 2QAGB 2WSSA 4NYJR 4RD1A 2ONKA 1EG7A 2ZIAA 3NIBA 3GP8A 4A8JC 2P6RA 1RRCA 3QOFA 3SBDA 4PSKA 2HDNB 4TTQA 4LV8B 2VP4A 1W2GA 2J3EA 3AGQA 3K53A 1F48A 2J59A 1WBBA 2Z4SA 5CM9C 4UKDA 3LBHA 1G7RA 4TN1A 2QSZA 2WWGA 1FPMA 621PA 3GMTA 1QF9A 3KQNA 2XJ9A 2C8VA 3FKSA 3W3AA 1UKVY 1TUEA 4FMCB 2YWGA 1G8PA 3K9LA 4R71A 3C16C 3NHAA 1SXJA 3UATA 2NQ2C 4NL4H 4Q21A 3WY9A 3FPAA 1QG4A 3CRRA 2IS1A 3OIUA 2RB4A 2ZI3A 2JA1A 4WZAE 4OJKA 1Z2AA 5KSZA 1XB2A 4PO9A 1D6JA 4XWKA 1ZM3A 4DWJA 2OCYC 4LJAA 2VO1A 4TMVA 4QHSA 2LCFA 3FGNA 3T34A 3DMNA 4BLSA 2CE7A 2QE7D 1L4UA 1X3SA 1N6KA 2EFDB 2XSZD 3ZH9B 2CK3D 4OI4A 1LY1A 1G16A 2JLSA 1E94E 4NYJQ 3GJ4A 3BH7A 2ZI6A 2J41A 3BRWD 1R4AA 5FPYA 1E2JA 3OESA 4C0LA 4B6FA 3QXXA 1UKEA 4EDHA 1D9XA 2ASEA 1VHLA 1TQ4A 4AWXA 5GJCA 1FUKA 2XITA 4LX0A 3MWKA 2H57A 4L16A 5FOXA 2WOOA 1FNNA 2IF2A 3VU9A 1JQLB 4DLRA 5JZVA 3DEFA 3KKNA 1MRSA 3L8ZA 3BB1A 3GJ7A 3QKSA 2DCUA 2ZI5A 1N25A 2C78A 2WWFA 3UIEA 1N2CE 1VG0B 5ELXA 1AQUA 4TL8A 4C0QC 2AXPA 2RGBA 1UAAA 5EXPA 4GOXA 1JR3D 4AKHA 5DYGA 3LO5A 1JPJA 4CW7A 2VHQA 1YZLA 2ZI4A 2A3RA 3NEJA 4GZLA 3TNFA 1YR6A 2PCJA 1G5TA 2DWQA 4A36A 1ZAKA 1J99A 3CH5A 1Z08A 3SYKA 2P2LA 1VCMA 2GCOA 4MKHA 4EPRA 5CLQA 5FOUA 3P32A 4AYWA 3FDIA 2WIBA 1KJZA 3LY5A 4IXNA 1G6HA 1QHSA 4TQUS 5JJKA 3LRPA 4MKIA 3ZIAD 5JS8A 2OV2A 2H8KA 2WPDD 2O8DA 1R0YA 2H1LA 2ZJZA 4L8GA 4PFSA 2AFIE 3BB4A 1FNMA 3VMFA 2JLXA 1EWQA 2WOJA 4LYAA 1Z6YA 4MGZR 3EWAA 4EKDA 5F9HA 4QG7A 3U3KA 3R8CA 5TMPA 4X8OA 2VF8A 1AZSC 1DO2A 3T06B 2QI9C 2ODBA 2EU8A 4L9WA 2WWYA 2JDIA 4YXWA 3W5JA 4LWZA 4D4KA 1CR1A 1QHXA 5A5GA 5EE0A 4C0AC 4E09A 2IEYA 2I1VB 5FPTA 4HEJA 3P1JA 2YYZA 4CVNA 1AIPA 1TX4B 2XNDA 2HXSA 2KSQA 3C5HA 3SJAA 1BH2A 1KO5A 4Q4JA 2PZGA 4U7DA 4PPQA 4Q01A 2HJVA 2FGJA 2VRWA 3K0CA 1NMYA 1S4QA 2AD5A 2Z43A 3R7WB 2YWHA 1JI0A 2YOFA 3OIWA 1JB1A 1WP9A 2F1RA 1IN6A 3KL4A 2NIPA 3K9GA 1DO0A 2JASA 2SHKA 4BASA 4DIEA 5BN4A 2GDJA 4KODA 2XZPA 3RS3A 3S1AB 3QKSB 4KVGA 5HE8A 1NLYA 4DSNA 2VP0A 3EXAA 1GFIA 1MR3F 1VHTA 3TAHA 3EA0A 3EIEA 4KSBA 3NKVA 2BOVA 4BFXA 3NBFA 4QBHA 4D4LA 1LS1A 1Q1EA 2GCNA 3R8FA 2B6HA 4US0R 1VG9B 2OLKA 4YMTA 1HEIA 5EJEA 1MABA 3KJGA 1E32A 1KDPA 4H1UA 4YC7A 1DAFA 1P73A 2WHXA 4XOIA 1ZC3A 4K81B 4QXAA 1S0UA 2IS6A 4LGMA 1L2TA 1TF7A 4ARZB 4P32A 2D74A 4L4UA 4U00A 2EYQA 5EE5B 4MUAA 1EFTA 2X77A 3F0TA 1S1CA 1T8TA 5CDFE 4AY2A 2V7QD 4QHYA 3M6AA 1ZNWA 3AEZA 4A0HA 4LI0A 2JJ2D 1KHTA 1A4RA 1M7HA 1AK2A 4MRVA 3TW4A 4C7OB 3THOA 2P6UA 4ZKDA 1CJTC 2A5DA 4JKYA 1N5IA 2ZVQX 3BBPA 3GEIA 5KYKA 4WZ6A 2QRZA 3LAWA 3LVRE 1DADA 2V1XA 1M7GA 3H2YA 2WSSD 4GDFA 1SVSA 2AKYA 5L3QA 2WMOB 4Q1EA 3L43A 4RZUA 1A2BA 4DDVA 2QP9X 4LY6A 1AM4D 2WTUA 2Z5FA 1W36D 4H9GA 4HSEA 1VIYA 3GPLA 1XPUA 4RFVA 3THXB 3OEEA 2V6IA 1KMHB 2GRJA 1D9ZA 2QGNA 2JLRA 2QZ4A 4NPHA 1KAGA 4RFSB 1GG2A 5J5CA 1EFRA 3BFKA 4PZLA 1Z3IX 4IVQA 3VHLB 1IOZA 5JHGB 3ZD6A 1UADA 2ZRLA 3Q8XB 4M8NE 4D0LB 4KYIB 1CJVC 4R9UC 5FUVA 1E0KA 1KNXA 3DKVA 1R2QA 3BORA 3BERA 2REBA 3LX5A 1OPXA 5JEDA 2G88A 3RABA 1SZPA 1T91A 4V03A 2D06A 4OI1A 4BLRA 1IN5A 4ZIRA 4LPKA 3FE2A 4RD0A 3CBQA 4DLVA 2QMHA 5E7MA 1ZU5A 4EFMA 4M9ZA 1J7KA 3ND8A 3U60B 2VP2A 4V02A 1JEDA 2HEIA 4LC1A 2F9MA 4Z1MA 2V8OA 2F9LA 3Q85A 4PAQA 5BWMA 1IN7A 3X1YA 2ZRDA 4A8JB 3HP1A 1FMJA 2ZUBA 4UXHA 2PCLA 2CHQA 5K8IA 3IHWA 1ZNZA 5FUXA 1Z0FA 1Z6GA 3W8RA 2J7PA 1G18A 4JLAA 4N0DA 4JLJA 4M9SA 1U8AA 4URZR 3SE0A 3EC1A 3U3OA 4UXIA 4ACBA 1IQPA 3LDAA 3PEVA 4M53A 4KV9A 3TIFA 1S3GA 4DLUA 4EPVA 4ZV4A 4HLQB 2NO0A 3HU2A 2BMFA 2C95A 5FTNA 3UG6A 4ITRC 3FHCB 3ZD7A 1E0AA 1II0A 3HR7A 2PJRA 2AKAB 4Q7KA 3ZS9A 5JBQA 3QG1A 1P2UA 2XB4A 3EARA 1E2LA 4QGHA 4AYTA 1IM2A 4B43A 3SOPA 2FPLA 3U5ZB 5JSZB 1P60A 1Z6TA 4GP6A 2IWHA 3TR0A 5FUYA 3VR2A 4EQ6A 3CF2A 1OHHD 4S35A 1JEEA 1RE0A 5A0FA 4XVRA 3PEUA 3IDQA 4A0GA 1OYWA 3KX2A 4GRAA 2MMCA 4EQ6B 3OHMA 3ZLJA 1GRNA 3EZ9A 4HZUA 2IBMA 1Q3HA 1FMLA 4BWYA 4PPGA 4HAZA 5AWFC 1W1WA 3GJ6A 5DI3A 2UKDA 4QJ3A 2PZEA 1R0XA 1SULA 1ZM2A 1NJGA 3ETLA 3CR8A 4M9XA 4Q66C 2F6RA 3AP3A 3JZMA 3QF4B 2REXB 4HAVA 1G41A 4M4SA 1ZP6A 2BKUA 2ZRAA 4ON9A 2MSDB 4I99A 3PUVA 3THYA 1NVVQ 3ZZUA 2VHCA 3N2IA 1JECA 2QPTA 4UJ5A 2TMKA 4C0KA 1PZNA 3V4RA 4DLXA 1HURA 4JS0A 4BRWA 1OIWA 2WWHA 1PUJA 2CBZA 1D2NA 2AHOA 5LD2B 1TF2A 2IYXA 1E9EA 1EK0A 1P7CA 1PJRA 2VLIA 4UNPA 3MWJA 1NIPA 5AJZA 1AS0A 2OCBA 4CT5A 1PLJA 3SFVA 2OESA 1KJYA 2YZ2A 5FL7A 2F3TA 1W0JD 1KI8A 1VKJA 1NY5A 4PO1A 3WNBA 2NPIA 4BZPA 5KDLA 1X8JA 2J7KA 3DZDA 3U6BA 4OQNA 2DBYA 4MUBA 3W6OA 4I1UA 4F91B 5KO2A 3UKDA 1M1YE 3B9PA 5D3MB 2XOKA 4UNRA 4JLBA 3VFDA 2C03A 2FEMA 1XEXB 5B58C 4KITB 2FDCA 1HE8B 1XPOA 2Q6TA 5E95A 2OAQ1 1GM5A 3OFNA 3RRYA 4DDUA 3UPUA 3CIOA 1NVVR 1ZMXA 1XBTA 5CLLA 3ZVLA 3PV0A 4FCWA 2R6FA 2HV8A 1ZM7A 3K8YA 5AUPB 3FMOB 1UM8A 2FPMA 1DELA 4JMPA 5EZ5A 5FI1B 4RKEA 5L8VA 4DLYA 3KKQA 3P27A 1DEKA 1GTVA 3W6PA 821PA 3GLHA 4NYMQ 4M9QA 2F55A 3VR1A 2ANCA 4D25A 2AR7A 2C5LA 4TSFA 4G01B 4AYXA 3NDBB 3SBEA 2FA9A 2OAP1 1SVIA 4IKEA 1DS6A 1N0WA 5DNYB 3X1XA 5FBWB 5LPNA 3W34A 4YDSA 2OFOA 4P31A 2CDNA 2QROA 5HKKD 2CMKA 2WKQA 5IK2D 1W0KD 1E69A 1T5IA 4YMWA 1UJ2A 4ZDJA 4LJ7A 3EWSA 2IWRA 4NCIA 4JL5A 1O3YA 3WNDA 3EPJA 3LX8A 1XD2B 2IYRA 3TQFA 3KTAA 3G0HA 1U9IA 3VR5A 1T9HA 2ZSAA 1US8B 4Q9KA 1JBKA 2Q9AA 2YJTD 4DCSA 3KUDA 4S2EA 4ZKEA 1JPNA 3T12A 5EP4A 4MRPA 4MRRA 4PX9A 4A2PA 1CU1A 4JSTA 3FTQA 4UNQA 1EGAA 1U0JA 4B2PA 5FH9A 1Q3TA 5AK0A 1LF0A 2ZJBA 1G3UA 1SXJB 4PR0A 3ZVNA 1NVUQ 4DSUA 3HJNA 3CNNA 4ARZA 2ODWA 1N6IA 2ZUCA 5FL3A 4ESHA 1R5NA 1UFQA 3QPWA 3IILA 1VTKA 4K46A 3CR7A 4NKRA 2J45A 1HT2E 3IO3A 3AQ4A 2CK3A 4HYYA 5C4MA 1KO1A 2XSZA 4FW9A 2EW1A 3AVOA 2VHUA 4WA7A 5CK5A 2QE7A 4Q03A 2ORWA 1M2OB 1IBRA 5JCPA 4NTZA 5G41A 5EXXA 4ZPXA 5DN6A 5H70A 1R0WA 2A5FA 2CLDX 2OFWA 2J5XA 2C9YA 2R6GA 4ZCMA 2W2TA 3DOEA 1I2MA 2PMKA 1NKSA 1R5BA 2KBEA 3WBKA 3AF3A 1E98A 2UZIR 4DUGA 2HF8A 2JJ2A 1SXJD 1DG3A 5AJWA 3NXSA 2BCJQ 1OYYA 2O8CB 4RZ3A 5BYJA 3MWYW 4URVR 1A1VA 1XMIA 2CVHA 4MRNA 2ODNA 2BCGY 5JSZA 1XTIA 3PR1A 4B71A 2ZU6A 4Q9JA 3BH0A 1VCOA 1W0KA 3T1QA 2W2XA 4PQFA 4XSHA 3EPKA 1TU4A 2G1JA 3BXZA 2H16A 4JSYA 3RC3A 4RD2A 1IHUA 4GI7A 4DT1B 2BBWA 2OLJA 1NVXQ 2JLQA 4HZUB 4B47A 3TSWA 2QPOA 1AN0A 1KMHA 4JT4A 3ADKA 4HLUC 3GEHA 2QN6A 1UEIA 1N3BA 1ZNYA 4DB4A 1RIFA 2AWNA 1Z2CA 2FGKA 1V43A 3DMDA 1YJ5A 2WKRA 4WW0A 2GESA 3F5FA 2FFQA 1W5SA 4Q47A 5KSOA 4E07A 1W36B 3MMPA 1IJFA 2GCOB 1E2HA 1FW6A 1G64A 5HCIA 1S9HA 1G3IA 4QRHA 2QAGA 2Z6VA 4O0MA 4M0LA 1XXHB 2ZRHA 1KZ7B 2ZRGA 4HZIA 4JBXA 4TMKA 5P21A 3TBKA 2XOKD 4PC3A 4IJMA 4AC9A 3K70C 3N5CA 2ZYTX 3ZYCA 1SKYB 1G3QA 2G6BA 3AKYA 3VHXA 3B7GA 2PMDA 2NOAA 5EQTA 3X1ZA 1OT3A 4GOJA 3AP1A 2B21A 3SN6A 1NKTA 521PA 3ASYA 4M1TA 5CITA 3K70B 4RCYA 2PX0A 4Q19A 4CZ2A 1ZD8A 1CLUA 1JQJC 2RGDA 5FL7D 2ZJAA 1CXZA 4BLTA 1VYTA 1VIAA 3ZVMA 1ZW6A 3VTKA 2QBYB 2FFHA 3AF1A 2VPPA 3CKLA 3L0IB 1Z28A 3B82A 1I4DD 2ZSDA 3FMIA 3TUZC 1G7CA 4LJ5A 3DPUA 3OAAA 4A6XA 2WSMA 4URXR 4C0JA 1G8GA 4R7ZA 3K09A 1CR2A 1Z6XA 1ZIPA 3OEHD 4IEIA 2WKPA 2GJSA 3KXKA 3W5IA 2HCBA 5KOYA 1YZGA 4BFWA 3BE4A 3EZ7A 1UEJA 2CCKA 4M1OA 2DFTA 2O8CA 4LHZA 4C9BA 2IYVA 4TLCA 4TWZA 3K0CC 3IO5A 1OXUA 2PX3A 1RYHA 2ZEJA 1Z47A 4UQOA 1XFAA 4RKFA 5TXGA 2BM0A 3H4MA 4OK6A 1ELOA 1XP8A 3MRSA 2V9PA 4BFVA 1MRNA 1G4AE 3CX8A 3AKEA 3OIYA 4WIAA 2C98A 2NO7A 2ZSFA 3SHFA 5L3VA 2OUKA 5JJIA 1ZC4A 1QDEA 2XXAA 4NZYA 3T1VA 3B9QA 3QPUA 5FBVB 4N1AA 4URWR 2YC2C 3AVQA 3FWYA 1BYUA 4MYTA 1G291 4IW3B 5TARA 1QRAA 2H18A 1XJCA 1II8B 2XZOA 2GEDA 1OE0A 3B6EA 4JLNA 1ZD1A 5JECA 5FR2A 3U2QA 2BMJA 1L7VC 5GVSA 3R9XA 2VF7A 4NP6A 2G77B 4Q4HB 1ZIOA 1JJVA 1OFIA 4BE7B 3ASZA 2GTPA 2VP9A 1OSNA 3AVWA 3ZZTA 2C77A 4JVSB 2OE2A 2IC5A 1J8YF 4HDQB 2OZEA 1M8PA 2PLRA 1UDXA 3KB2A 1KI4A 4MYHA 4XTCS 3CNLA 1QVRA 2GZHA 2IT1A 1H8EA 3MFYA 2J7PD 4LDJA 3SI7A 3Q3JB 1U0LA 2WJHA 2GZAA 3A36A 4A2WA 4XH9B 3LBNA 4OI2A 1JR3E 2AX4A 2W0SA 4OQXA 1Z0DA 5DIFA 2OBNA 1YR8A 2AXNA 3GLGB 1VCNA 5E7JA 3K0FB 2OBMA 4JVLA 4L9SA 1JALA 3TJZA 1SHZA 4B2LA 4LOAA 4WXRA 1RYFA 4Q1FA 2ATVA 3Q9LA 4HB3A 2XAUA 2E9SA 1KK0A 5JHHB 3QEJA 3D7MA 4IOLA 1OH7A 3CRW1 3KKPA 1KSFX 5CJPA 2VBCA 1P75A 3AF0A 3FKSD 4RZXA 3ZS8A 1DE0A 3MLEA 4HLCA 1XEWY 2ZRBA 2QT0A 4FD2A 2G3YA 4RJLA 4DCVA 4OQLA 4DIDA 4C2TA 3MD0A 3GJ5A 3I8XA 3A37A 3AVPA 3MJRA 4PANA 4D81A 3U6KA 3PEYA 1DAEA 4BLPA 3VR3A 3ZVRA 2VSXA 4BECA 2GAOA 4B3DA 3ND9A 2EFEB 1ESNA 1EFRD 4NONA 4RSGA 2ZR0A 4J0QA 1DAHA 1EXMA 5HTKA 4MQBA 1EESA 1RKBA 1MO4A 4O2LA 1IXSB 3KKOA 4DJTA 4CGZA 2ZJOA 4PZZA 4CEHA 3QNUA 1OIXA 3AKDA 2BVNA 4Y0VA 1D2EA 4Z54A 3W8NA 1EFUA 4JLVA 2FSGA 5B57C 4US1R 1KK1A 1UBEA 4JBYA 4KVAA 4NYMR 1TADA 2IYQA 4YMVA 1W2HA 2EWWA 1Z63A 2RGGA 2ZAMA 3A4LA 4P4SA 2F3RA 1KOFA 3DZ8A 2ERXA 3SEAA 4G0NA 2CHGA 1RRGA 3BS4A 1NP6A 2ZRPA 4DBLC 3H86A 1NG1A 2IHBA 4A8JA 2ZVPX 5IT5A 3GJ8A 5CM8B 5L3SA 4FMCF 1KY2A 3TRFA 3PUZA 2LKCA 2C96A 3M1IA 2QTFA 3L82B 1XTJA 1RJ9B 2IYUA 1G6OA 2ZR9A 4PPFA 4HB4A 4A4DA 4LRWA 3TMKA 4KYUA 4URYR 2O0HA 2GJ8A 3O8RA 1WDTA 4X8HA 4HUQA 2UZ3A 3OEED 4BFZA 4G5OA 2G1KA 4Q1BA 2WJVA 1QHNA 2FWRA 5FOVA 3LXXA 2FN4A 2ZUDA 4AKGA 2C2HA 1Q1BA 1AZTA 2GXUA 1TU3A 3I8SA 2WM9B 5BW8A 4DT1A 3U3MA 121PA 1H8ED 1S1MA 1FQJA 3EIHA 4Q4JB 5L3RA 4DLWA 4YMUA 2IYTA 3GLFB 1PVOA 5HPYB 5KTYA 1FQKA 2AL7A 1G7TA 3E2IA 4NE2A 3CWQA 1NMXA 4QM7A 1UBCA 4IVRA 4PZYA 4LYFA 4C0BA 3ICEA 1II9A 3THYB 1XMSA 4NCJA 5BXQC 1BMFD 1E79D 5GJWC 3EASA 2IXEA 4PHHA 4CEHB 2ERYA 1U90A 4C30A 3HYRA 3I92A 2XTZA 3SYNA 1WF3A 3NDPA 2E87A 3EPHA 2CEAA 1GIAA 3IIKA 2IUTA 1MO5A 4Q4AB 1ZJ6A 2VSFA 3MWLA 4DDWA 1NBMD 5EUQB 5IK2A 3QY0A 1TNDA 2H17A 1GL9B 1UBFA 1V5WA 1XX6A 2QM7A 1E0SA 2CL7X 1GWNA 2G0NA 3GJ3A 4Q4LA 1QHHA 2O8EA 3IKJA 4QBIA 3DOFA 4OHZA 3DM9B 1OB5A 1G20E 3FOZA 1CRPA 3R20A 4R2IA 2YOGA 2P67A 1N5KA 4IOJA 4EPYA 1YHNA 2FPKA 4LHVA 3BFXA 5EP2A 3T61A 1GP2A 4TYNA 5TY0A 4A6PA 1NJFA 3PQCA 5FFMA 4IFEA 1FOEB 2O8BB 2IYZA 2ZAOA 2LWIA 3OIVA 3WRXC 3J81k 1P9NA 4HAUA 5EE1A 4B44A 4D2IA 2QMUA 2C9OA 3HWSA 3U7HB 2QU8A 2ZROA 1G17A 4WBSA 2OHFA 5KPDA 1XRJA 1XJ0A 3OAAD 3T1OA 5AUQA 3AVXA 3WXMA 2FZ4A 3KJEA 4HLUA 1G4UR 5F2EA 2XB2A 2DY1A 2F43B 2BJVA 4XVUA 4TLEA 3IUYA 1OH6A 1AKEA 3LLMA 4LV5B 1HV8A 3SNHA 4QGAA 2JCSA 5KSYA 2IS2A 1KSGA 421PA 4ZI3A 2AK3A 1YR9A 4C0HA 5J47A 1N6RA 1XCPA 3B1WA 2GF9A 2IK8A 1E2KA 3ADCA 3QUSA 4XD7A 4EIWA 4BLOA 2GA8A 3U7GA 3ZQJA 3THWB 4IVPA 1E9FA 5EE9A 8OHMA 1C9KA 1HY3A 3RANA 2VA8A 3SU8A 4LSGA 1F2UB 1G8HA 2FFAA 2FZLA 4NDZA 4DRZA 3PFIA 1E3MA 4IHQA 3A4MA 1E9AA 1KJWA 1OXVA 4M2LA 1IONA 3QXSA 5LB2A 1DBSA 4DLTA 1UBGA 1MOZA 1ZRHA 1JAIA 4HAYA 3TUJC 4MDFA 4DEXA 5GJVC 2A7QA 2GF0A 2RGAA 1K8RA 4G1UC 4F4CA 5FUWA 2X19A 1KKMA 2JLVA 2ZXUA 1N0VC 1YRBA 1OLOA 1CIPA 4PTLA 2FU5C 4MRSA 3T35A 3D8BA 4B3GA 2V55B 4RD3A 3CRMA 3WYFA 1BS1A 3I73A 5E3HA 3B2EA 1E2QA 1RC8A 1GL6A 5CIQA 2XZLA 4LJYA 2CHVA 5GADl 3CF0A 4CEIA 3V9PA 2ZYVX 1AJEA 2EYUA 5G3YA 3SR0A 5JI3E 1KTVA 1N0UA 1SVMA 1RW4A 2B7CA 2F1IA 3RRZA 2FMXA 2G9NA 1G5RA 1ZM9A 1KI7A 1D2MA 4Q02A 3NEYA 4XTRA 1E9CA 1XTRA 1K5GA 2WJJA 3GFTA 1RJ9A 2HCJB 2KI5A 1GL7A 2Q9BA 3AUYA 1OXXK 3LV8A 2BMEA 2EWVA 1MV5A 3SZRA 2QSYA 4LYHA 1RRFA 2O0KA 1XTSA 3SDZA 1FX0B 2O0JA 2GZDA 4Q1AA 3WMEA 4OL0A 4EJSC 1G3MA 4ESVA 3QI2A 3RS0A 2FSHA 5DN6D 2AFHE 2V4ZA 2RKOA 2GXAA 3FFAA 3UANA 1R7RA 3QIAA 2DWPA 4F92B 3LD9A 1XJQA 3QF7A 2IUSA 3U61B 4B75A 2QY9A 1CTQA 3UMSA 5L3QB 2V3CC 3MG9A 1GSIA 2JATA 4MYCA 4FMDF 4AD8A 2E1RA 2CL0X 3I5YA 2ZJ5A 4QHTA 2IYLD 4AKIA 3ADBA 4FCTA 1ESMA 4M1WA 4FI3C 4PQRA 5JRJA 2NTYC 5KDDA 3MJHA 1Q44A 1JXOA 2W6IA 1VG8A 2ZRKA 2PT7A 2RMKA 1Z6AA 1DAKA 3A1VA 1NL3A 4M22A 4PHTA 4LUCA 4B35A 4IOKA 2H5EA 1Q12A 4GFDA 4OBEA 1GVNB 2C99A 2FSFA 1U9IC 4KXFB 3R9WA 4OJQA 2ZS8A 2IUUA 3GLIA 1BO6A 4OHYA 4Z51A 2FX3A 1OXTA 4F93B 1GUAA 1T4GA 3PEWA 2BBTA 2CCJA 1XTKA 3X1DA 3O47A 4Q4AA 5K8LA 2ZRNA 3THXA 3CZQA 1GNQA 4FMDB 3WHKA 3UWOA 4MGYR 3MCAA 4C0SA 4D26A 5HKKA 2YHSA 1E2IA 1TL7C 1HE1C 1P5ZB 3CW2A 2VYFA 4QBGB 4EFNA 3QG5A 5AJVB 1LW7A 1W47A 2NPFA 4TYWA 2GBLA 3KTAB 2R8RA 3P26A 5JJLA 2GXQA 3GQBA 4DLZA 4NHOA 5C18A 1VMAA 4PC2A 1AGPA 3B1XA 4NH0A 1HTWA 1DOAA 2PEZA 2REOA 1IXZA 5JWOA 3MUFA 1Z0AA 2RHMA 4PSAA 4QFMA 6Q21A 1QHHB 2O8EB 3K0AB 4LCBA 2IS4A 4O25A 3NG1A 1WXQA 3LA6A 1A82A 4A1FA 1E1RA 2N1BA 2B8WA 1NSFA 4P4TA 4F38A 5C46F 3I32A 1E2DA 4TQAA 3QENA 2A78A 3LLUA 4RVCA 1CJUC 4LJ6A 4R2HA 5LDDC 3GLFA 2IYSA 4US2R 2CJWB 3IEVA 4KI0A 1RZ3A 3LNCA 3ZJYA 1LTQA 4IDQA 2YC4C 4M1YA 1X6VA 4V0LA 5F9FA 3AB3A 3H0KA 4LBWA 3U44A 1DAMA 3Q5EA 5FOTA 4RFSA 4OHWA 5TB5A 3WYGA 3WYAA 4D4JA 4U5XA 2XNSA 2OXCA 5TVKA 4HAXA 3VNVA 3C14C 3BGWA 5FBLB 1U8YA 3CM0A 3RRMA 4JVNA 3SHWA 3QXCA 4BEJA 1GOTA 1DTSA 5FOWA 3W6NA 1C1YA 2R62A 4MITA 4TQ9A 1FZQA 3QXJA 4TMXA 1F2UA 1K6MA 3RVBA 4D82A 1GITA 1HT1E 3IPXA 3KZ1E 1KI1A 1CJMA 3KJHA 4CEJA 3I72A 1RVDA 1R6BX 4CIDA 1II8A 4OK3A 5H8WA 3QE0A 3LXRA 3MGCA 2IW3A 2WAYA 1COWD 1KDOA 3I3SR 1XMVA 1L8QA 2J9RA 4LPSA 3AKCA 1E6CA 1W4RA 4LJ8A 4TZ6A 4TMWA 2H92A 3AVYA 4QL3A 2LKDA 1A2KC 1C4OA 3PUYA 4V0MA 2J0UA 2ORIA 1SGWA 1SKYE 4Q7LA 1AKYA 2P5SA 4IDHA 3HYTA 4PPNA 3K0FA 2ZR7A 2G83A 2QG6A 3QPVA 2J87A 3C41J 4NMMA 1LFDB 1OJLA 3KKMA 1XEFA 2IYWA 3AVVA 5CYOA 1TEVA 4NBSA 4QNRA 3L0OA 4BLQA 2CL6X 1OW3B 1XWIA 1RRPA 3CWZA 4MYUA 1KGDA 1R0ZA 1NI3A 4HUQB 4AKEA 3QVUA 2JDID 4AK9A 3TW8B 4YLGA 3GJ0A 2IX3A 5CB8A 5FPHA 1XU4A 1NRJB 5SZKB 4PAMA 4EPTA 1SXJC 2Q3MA 1AA9A 2FSIA 2O52A 3NH6A 3VR6A 5FOSA 2BKEA 2X2FA 2ZS9A 1YVDA 4B34A 5JI2E 5LB4A 2GILA 4X8LA 2QM8A 4B32A 3RNLA 3A1UA 2K5UA 4Q48A 3QKTA 1Z0IA 1KDRA 1P61B 1WCV1 3Q7QA 5HZHA 5KNBA 2ZE8A 2QRNA 3T5GA 1GRRA 2JLWA 2IHYA 1XCGB 1W48A 3LQQA 4FCVA 2ZSEA 2ZI7A 1QHYA 1YQTA 3CX6A 4PSVA 2VP5A 2JIZD 3KXLA 1R5OA 4AIIA 2ZE6A 5JLJA 2WJGA 1E2GA 1PLLA 1U98A 2J0VA 2W2VA 2QGZA 3DKPA 3TR5A 2RGEA 4L15A 5J4YA 3KQUA 1CKEA 4BZQA 3CO5A 2WWWA 3W9YA 3THWA 1SQ5A 4JZKA 3T15A 4BFYA 4PXAA 2WWIA 4B73A 4HDCA 2HLDA 1CJKC 2WMNB 3LW7A 4LYJA 4QGFA 5JWRA 1S3SA 1NF3A 1US8A 2A2ZA 2WZQA 3OF5A 1XPRA 4PQYA 1Z07A 2Z83A 1GKYA 3VKWA 1W5TA 5HR5A 2R44A 2VEDA 2R6CA 2D7CA 2CXXA 2R65A 4TMTA 3GLFE 4EPXA 2QORA 4W5JA 5FBQB 2KWIA 4OHXA 3C7KA 3M4YA 2XTMA 2GNOA 2WAXA 1M7BA 2VHTA 1W46A 5DE3A 4ASUA 3LVQE 3EPLA 1JAHA 4CT4B 1NLFA 3K0EA 3QKUA 3RHFA 3DHWC 2N46A 2AWOA 1F6BA 2ZJ8A 4LJ4A 3A8TA 1FX0A 1S96A 2Q3HA 2GHIA 2IYYA 3OZXA 4HAWA 5H1YA 4EJSA 1HQCA 4RZ2A 2YWFA 1TMKA 5J4VA 4RY2A 3L8YA 4IOMA 1R8SA 3DVLA 3EZ2A 4MH0R 1Q21A 3GLGA 4IDOA 2A5JA 3I5XA 1NG9A 1BOFA 3GD7A 3WMFA 1Z22A 5JFGA 3U7EB 2O8BA 3WP1B 3DDCA 3IBGA 4KBGA 5JMTA 1YZNA 2QP4A 1ZM4A 4WAUA 1T6NA 4M1SA 2V7QA 3BK7A 2PZFA 4DCUA 1GKIA 1X1RA 4HUTA 3WMGA 2GAAA 1OV4A 3EC2A 3QKRA 2BEKA 3CZPA 1P9WA 1E9SA 3UK6A 2FG5A 1WBDA 1W4CA 1FL9A 2DHRA 3HU3A 3A1WA 5KPJA 3K0SA 3L0SA 4ZDWA 3AGPA 1ZBDA 2EQBA 1QBKC 1XEWX 1KI6A 4B3XA 3CF6R 3FYHA 1Z8FA 3GLIE 3TVDA 2ZRIA 4LZZA 1EX6A 3BB3A 4A92A 1GNRA 1WB9A 1EFCA 1Z83A 4MGKR 4V0OA 2GXSA 3KFXA 2XJ4A 1Z06A 4JL6A 4DDTA 2R9VA 2OO7A 2GETA 4BFTA 1IN8A 4ABYA 3PUWA 3C5CA 1OH5A 3U4QB 1XF9A 4OQFA 4P4UA 2FJUA 2JAQA 3GCGA 2IA5A 3BJIC 1NY6A 4B6EA 2WJIA 2W58A 2ZRMA 3GLIB 1LVGA 1KO4A 2CLSA 2ZANA 1KDTA 4TL7A 3ZDQA 1SHKA 1TQDA 1FFHA 4M1MA 3T1TA 2I1QA 2ODEA 1BYIA 3C8UA 3TVTA 1SVLA 3DO6A 5F3WB 4OK5A 4KLNA 1NMZA 2QEQA 5G53C 3VAAA 4P3YA 4F4JA 4BQSA 3K1JA 2O5VA 721PA 4XVQA 2BHRA 3MAAC 4A82A 1J70A 3UG7A 3VR4A 5A4JA 2N42A 2D4HA 1W36C 5DI9A 3OE7A 1F2TB 4TSFD 2JJ1D 4Q1CA 3VKGA 4YXWD 1E0JA 2NGRA 2KJQA 1F3OA 1T0JB 4JYBA 4GOKA 4ERNA 3U44B 1X86B 2ZYUX 3AP2A 3X1WA 1Q20A 4O2RA 2WPDA 4CDGA 2BDTA 5EXSA 4I81A 4KHZA 4TYPA 3QEOA 3KQKA 1ZVQA 1BKDR 2JJ1A 5GJBA 3BIFA 2O8FB 3QJYA 2BC9A 4JJKA 4Q7MB 4KO8A 3DL0A 3EAQA 4DEYA 2RHDA 2VHJA 3AF2A 3DM5A 3EIQA 1TQ6A 5DISB 2HUPA 1T0HB 1U8ZA 3E5HA 3CRVA 2ZRFA 1E2FA 4EUNA 4ZO4A 1KI2A 5DI3B 5FTKA 3B1VA 1W0JA 2ATXA 1JR3A 2OM2A 1P72A 4HDOB 4BZXA 2NMVA 3WBJA 1G19A 2VQSA 4JLMA 1XD2A 4UJ3A 5HCNA 5KSPA 2J1LA 2CCGA 3KJIA 4K8OA 2HXYA 3N70A 1P9RA 2PH1A 1P2TA 2BM1A 5BN3A 1GNPA 3JZAA 1KYIA 5TDHA 3P20A 4CEIB 5AUNB 2ZPTX 2IEZA 3IIJA 4P4SB 4L5BA 1NBME 4RCZA 4TT3A 4E5UA 5DHAA 2JLYA 3RDPA 3BD9A 2NO9A 4TZ0A 1P4SA 3FKQA 2DWOA 4B48A 4BEBA 3I61A 1KKLA 4ZCIA 3QBVA 3LWNA 1QHIA 4XWAA 3A1TA 4YDHB 1P2SA 3SFZA 2HYDA 3I1FA 4B74A 1VCIA 4GL2A 1UKYA 1WMSA 1W7AA 1QG2A 4I1VA 3O8DA 4FIDA 3FVQA 4DLSA 2ZREA 1IN4A 4NCNA 4TL9A 3ZGXA 3KUCA 2WJYA 1CF4A 2OCPA 2F1JA 1G1MA 2Q3FA 2ZS7A 1EFHA 4KCGA 4B2IA 3RYTC 1J8MF 1Z0JA 2OEPA 3FMPB 2VIIA 4YONB 1TQ2A 1NVWQ 1OHHA 3B78A 1A7JA 5L3SB 2PL3A 4KFTA 3WRYC 5CYPA 4EAQA 3TQCA 2DFKB 2RGXA 3HU1A 3LFUA 4QNMA 2A5YB 3RSOA 4IDNA 2WWXA 2FOLA 3AVTA 1ZNXA 2D7DA 4IFBA 2QQEA 2QUZA 1KI9A 2BIFA 2WVJA 4MKFA 3REFA 2IL1A 4PHGA 1M74A 3B1YA 2HT1A 2BWJA 4I4LA 2VL7A 4BFUA 2QPAA 2W83A 4KBFA 1E1QD 4LK2A 5JCZA 1WRBA 3CONA 2F43A 3QQ5A 1E1RD 1Y3AA 1XXHE 3GLHB 1CR4A 1E99A 4UNSA 1W4BA 1CRQA 2VH5R 1ZYUA 4G5RA 1I4TD 2WICA 4JT2A 2QAJA 4RD4A 2ZRCA 1Q22A 3QXHA 1DARA 2X1VA 4Y0AA 4ASUD 5DYIA 3K9NA 1TEXA 3LQRA 4JBWA 4DSOA 4AG5A 4CEJB 1RPZA 5IDVA 5K8UA 4G3XA 2JLUA 1WE2A 5EP3A 1X8KA 5GVRA 2HF9A 4Z1MD 1OXSC 3GLHE 3N2EA 5AUOB 1FP6A 3L2OB 3Q7PA 4QC2A 3PJRA 1S2MA 1JJ7A 2J46A 3RLFA 1XCMA 3VNUA 4CF7A 2ZI9A 4B76A 5SZIA 3UMRA 4DKXA 3O8CA 2Q21A 2EFCB 4DHEA 2NZJA 3G5UA 5D3QA 4OQMA 4X8MA 3RAPR 1BIFA 1QHGA 2C04A 2GEVA 4HI0E 4JVMA 4GZMA 1P2VA 2X2EA 4TLDA 4GP7A 5BYKA 1E4VA 2BJWA 3RS2A 4B3BA 2AN9A 4POAA 1Z29A 1YZKA 4HB2A 4D6PA 3NBZC 4OI0A 1I4LD 2JIZA 3RWOA 4FWTA 4PAOA 4C2UA 3ZZ0A 4TLBA 5FPKA 4KLZA 4G5SA 2OG2A 1TAGA 2QT1A 3CPJB 4TLAA 1E4YA 3NVAA 3REGA 3SJCA 2YV5A 4Z8XA 4UNNA 4QJ5A 5EXTA 4N3NA 4AG6A 1QZXA 4A15A 1DVRA 2VSOA 2ZYWX 2KB0A 4UXJA 2YVUA 1GKUB 3ZQ6A 3IEUA 2NG1A 3B13B 2CNWA 2P6NA 4FXPA 4OYHA 1AS2A 5LBIA 5UKDA 3QBTA 2D2EA 5C1BA 1E1QA 4LV6A 1W44A 1DPFA 3TSZA 1P6XA 3EW9A 4HATA 1SVKA 2P65A 3T5DA 3C15C 4AI6A 1L4YA 3TAUA 2R2AA 2HT6A 4GT1A 1PUIA 3B8HA 1T3SA 3B85A 5IRCD 3VQTA 2B8TA 4WZBE 1M6NA 1KMQA 1T8UA 3BH6A 1XNJA 3NBXX 2AD1A 2J0UB 3BAFA 1D5CA 4D80A 2WBLC 4I1OA 2BBSA 2ZTSA 1HYQA 2ZJ2A 4JLPA 3PXGA 3KFVA 3TSOA 1PV4A 3ECCA 4PO8A 1N6LA 5F98A 3EX7C 2V1UA 3IBYA 1OFTA 4D0NA 1U2RA 3BC1A 3NHBA 2FNAA 3P4YA 2QA5A 4ZCLA 1U81A 2GEUA 2H7VA 2ZITA 1XZPA 3F8TA 3E70C 3PIRA 2QAGC 1XXHA 1J90A 4JKIA 1OB2A 5J4KA 1DG1G 5CJ2A 1J2JA 2MMGA 4N0EA 3AM1A 3B1ZA 4AURA 3OEHA 4XWOA 5M04A 3TH5A 1ANKA 1LNZA 3M0EA 3IGFA 3WNCA 2KBFA 5HE9A 2DFLA 1KSJA 3LH5A 2DPXA 3SQWA 5DH9A 1S8FA 3CPHA 1RFLA 1KY3A 1NN3A 3QSYA 4JYCA 4W5WA 5JRZA 3KQHA 1GZSA 4R98A 4U02A 1WA5A 4Q1DA 4YMSA 2GK7A 5FI0B 2RCNA 5DSZA 1CP2A 2W6JA 2XNDD 1D8TA 2W6JD 1G7SA 2JJ8A 3FFBA 3G82C 5JS7A 5H68A 4I1SA 4GBMA 1M34E 4NCHA 3CLVA 5ANRB 2OT3B 3PG5A 3WP0A 4H1VA 2QQ0A 1HH4A 4D0GA 1ZINA 1JNYA 1T3HA 2C9CA 2GK6A 3B5JA 3EG5A 2WV9A 4DXAA 1Z5ZA 5SZJA 4DVGA 2GJAA 2QTVB 4Q9IA 5FTMA 3TUIC 3FB4A 4QBFA 1HUQA 4CYMA 2XGJA 3NBYC 1VG1A 1G5PA 2I3BA 2ZQ5A 5AJYA 1N6HA 2FEOA 4GSYA 4RD6A 3KDSE 5AJXA 2J0SA 3GLGE 2QTHA 1P62B 1CBUA 4KFUA 1JR6A 4B3CA 4XJXA 1Q1ZA 3R7WA 3UXMA 3ZIAA 3K70D 3O8BA 1Q0UA 1NSTA 2R6AA 5C4GB 1YZQA 3GJXC 2VP6A 1NIJA 3U4QA 1N5LA 1YRAA 2PLFA 4QKQA 4A0FA 4TYYA 2BBOA 2QNRA 3U7FB 2ZE5A 4QOSA 1GRQA 1GILA 1G3RA 3BOSA 4LBYA 4A2QA 2DR3A 5C2JB 4NCKA 1ZUIA 4D4MA 1F5NA 5KNDA 2R6DA 3A6PC 2FV8A 3I62A 2NO1A 4PC6A 1A5TA 2GVDC 2OFXA 4BFSA 2NZ8A 4E03A 1MT0A 4LHXA 1E9BA 4O3MA 2XX3A 5KNCA 2MSEB 1ZU4A 1FTSA 1LV7A 2GVZC 4DUGD 4MDEA 2F7SA 5DO9A 3HDTA 1BMFA 1E79A 1P3JA 2OXRA 3HR8A 2VTKA 1S9DA 4KAXA 2HJGA 4QJ4A 3NC1C 2O8DB 1LS6A 3AF4A 3CUEF 2F1HA 1VYVA 4IEEA 3RSLA 1LB1B 1W4AA 3K0AA 3BFVA 1VECA 1OIVA 4HB0A 4Z8YA 2RAPA 4BRUA 4ZDIA 3D31A 4JL8A 3KQLA 3FHOA 4JIMA 2BMDA 4CRWB 5IF9A 3H84A 1OF1A 1IXRC 3RRNA 4EPWA 4EJSB 2PEYA 5EUMA 1XEXA 4A9AA 2RH5A 2Z0MA 4DB2A 5JWHA 2GWHA 2DYKA 4FN5A 4FWIB 1KAOA 1U94A 2ECKA 4ILEA 4QM6A 3SC3A 1MO6A 1ZUNB 2OSBA 3AVUA 2D62A 3A4NA 3IQXA 5DGXA 1AQYA 1N6PA 1UF9A 2J0QA 4GMDA 2BV3A 1B0UA 5LD2C 4JJZA 5FBRB 5IHPA 4EFLA 1KI3A 5FTJA 1NNEA 2DB3A 1VYUA 1DAGA 1E9RA 1N6OA 1IJEA 5BN5A 3Q72A 4URUR 5CIWA 3CRQA 1B23P 1MH1A 2JGNA 2DFNA 2OCAA 3W3ZB 5DLQC 2L0XA 3LW8A 2XTNA 3PUXA 4TTRA 2CE2X 1CS4C 4V0NA 3RS7A 4F7WA 3VKHA 4KU4A 1G21E 2A30A 3TK1A 2YNMA 3X2SA 2GJ9A 2ZE7A 4FMBB 3EZ6A 1QVAA 1I2DA 2GCPA 2CVFA 3GFOA 3PITA 5KU1A 2FE4A 3VU9B 1XTQA 5HZKA 5CB6A 2CLCX 1G8YA 1SVOA 1WQ1R 2PJZA 1XZQA 4NU0A 3HPRA 4DC9A 3BWDD 4P33A 221PA 4LHWA 4V0ME 3SS8A 3TE6A 3UWKA 3GFPA 2RGNA 3D6TB 1FTNA 1XMJA 1YR7A 1H65A 2P5TB 3D3QA 2KE5A 4PC1A 2I4IA 1MO3A 2QBYA 1IY2A 2ORVA 1Y63A 1YKSA 1KK2A 1OKKA 2ZU0C 4LJ9A 4LBZA 4PHFA 3WHLA 3OFND 4B3FX 2PT5A 1H8HD 2W0MA 1CR0A 3LBIA 1KSHA 2QMEA 3JVUA 3RWMB 5EZ6B 3TLXA 1DAIA 2MSCB 4YQFA 5KDOA 1MKYA 2PBRA 3E1SA 3KXIA 1KIMA 2IXGA 2HLDD 4BGDA 1CULC 5DHFA 1MABB 1EWRA 4FINA 4TYQA 1W49A 1AGRA 3KB1A 4OHVA 4XD7D 3W90A 2FFBA 2WIAA 1NLZA 2UVQA 2JLZA 4Q5IA 3RS4A 4KJZA 2B7BA 1ZCBA 3VX3A 3AH8A 4KSCA 3CPEA 1KO8A 2ZETA 3SYLA
chains in the Genus database with same CATH superfamily
4X90A 2I55A 4U7TB 1RWMA 4EW6A 1T0BA 1UFKA 4DV4B 1UPTA 5C8YF 4H0CA 1GUBA 3ON5A 1M2OA 3GFBA 2D1RA 1GNVA 2PSHA 3JATB 4GMXA 4C06A 4L78A 5KNDH 4LVUA 3VX4A 1Q1QA 2MSWA 1C30B 1H2WA 2DZDA 1ZGGA 2B1GA 2ZRJA 4A73A 5D85A 4B40A 1V26A 4UMVA 4V1CI 2B4RO 5K09A 1U63A 2EFHB 1W59A 3ILXA 3OM0A 1IY1A 3DZKA 2H31A 1VJGA 4K3VA 1IHXA 4LC0A 4NU8X 1ODFA 3L7DA 4RV4A 5LA6B 3EXFA 2ZUTA 3FSJX 2AK2A 3NEPX 4JB8A 4OP3A 1L4KA 2Q4BA 4DMKA 2XWQA 2F17A 1YU9A 1ZKMA 3OJLA 4N0PA 4OREX 5SYAA 2O8FA 4KWIA 2WU1A 1KO7A 3KR0A 4G97A 3UXHA 1Y7PA 2FFRA 3DBLA 1JKXA 4QYSA 4UBNA 1EDBA 3ETJA 3RK1A 1KI6B 2QVCA 1O6CA 1WD7A 5E4FA 4BNDB 3JXEA 4DZZA 3IP1A 5TSDA 2EW2A 1PJ3A 1PD1A 2ACEA 4K9OA 4XEHA 3UPTA 4MVJA 2EZUA 1Z34A 5HF6A 2FJPA 4N39A 4JHLA 3I34X 1NVMB 1YBVA 1W85A 2VYVD 3K09C 3R75A 3B60A 1IEWA 1PTJC 2JH8A 3BMNA 4LF9B 3A1SA 1YL6A 1L1EA 1LGYA 1FFEA 2G5CA 3FLMA 3G9UA 2D5IA 4F5WA 2Z4RA 1Y6GA 2PG3A 1F9EA 1G55A 3PUJA 1XZGA 3L8GA 2PX5A 3ZNOA 1T5DX 4LBVA 3AYXB 3WLHA 3TLZA 4AWAA 3A3KA 4GMFA 1T0PA 1KNQA 1XDBA 5U1PA 4LWQA 4J16C 2Z98A 1IMJA 3VC7A 4E2WA 2V59A 1TJ5A 2YINC 4DV2B 1ZWLA 1NW4A 1R8QA 3EEBA 5ESWA 2ONJA 4TQGA 1UDBA 1SXJE 4N5NA 4KG7A 1V5IA 2WSLA 4A0SA 4F4IA 3ZI7A 2XZTA 5EHXA 5BQ5A 1X1SA 3C43A 4XSGA 1G42A 1TUGA 3W7VA 1FP1D 1MEEA 1SPXA 3C5VA 3LCRA 3G02A 4IXMA 1MQ9A 1TF5A 2WZCA 4E5MA 5JH7B 2X41A 4JGIA 3FAKA 3ZCPA 5IDQA 4YHHB 3HEAA 4KRYA 4LSZA 4C05A 1KHHA 2FLKA 5IAOA 1PBNA 1Q7EA 3SVLA 3A14A 3PXXA 3BSWA 1XMOB 4MVJH 1C0EA 4ZRDA 3DE2X 2CJXA 4RMNA 5J4HA 2OY0A 3HJAA 3HCBA 4OFXA 3ADDA 1YKFA 5EIHA 4EG1A 4ZQCB 1PLKA 2Y1GA 3V00A 5HIJA 1PU2A 4ALLA 1Q2UA 1A50B 4QUGA 2GSDA 5IJXA 1H3NA 4MJXA 4WOPA 1WF6A 1H5NA 4GPZA 4HDRB 1O6BA 2PZBA 1D8AA 1C3OA 1L9KA 1NN0A 4PFJA 1GTJ1 1O95D 5H81A 2PUVA 5A06A 4DSTA 4NFHA 5TEVA 1OFHA 4FGWA 5EE3A 1VP3A 2YRXA 3FZGA 1E2MA 3QX3A 2FPUA 5DLYA 4XB2A 1EQAA 4AX8A 3H1TA 2DTDA 2CDRA 3MWEA 3O84A 1R27A 2HSWA 3E4CA 3NVMB 3SQDA 4J6EA 4F4FA 2O8DA 4JLDA 2PSDA 2XWSA 5A6SA 1R10A 1RR6A 3THSA 3U3JA 4Q18A 2WNSA 3QVGA 2Z9CA 3L0PA 4XCQA 1GQ2A 5J2TF 2Q9CA 4U6SA 1OKKD 4ECEA 4PYRA 1K9VF 4I4TA 1AUQA 2QENA 3R9IA 3T9EA 3G3EA 2QNIA 1KQOA 3DAOA 1YB1A 3SYMA 5I4KA 1QE0A 3EB9A 3SLKA 5BWBA 2OG1A 2PWBA 3LIPA 2RGCA 1W94A 2P8SA 1M2VB 1IC6A 3LT0A 5TNXA 3S1AA 4FGUA 1ISMA 1HKUA 2EDCA 1E96A 1A5SB 3G7SA 4A0RA 3IIMA 2Y1FA 3RW9A 2R4QA 3VC3A 3VTAA 5IZCA 1N34B 1ZD9A 4B6SA 1YZUA 4N8DA 2WSSA 2I78A 2QRHA 1EJ6A 1FQOA 1EG7A 5JD4A 4AJ1A 1L8AA 4BNTA 3OSUA 1C3LA 3DLAA 3SBXA 2UUOA 2KX7A 5CM9C 5T8KC 4BV3A 4KRFA 3O31A 4UKDA 4TVSA 5ISMA 4PLVA 3V8MA 1DRWA 4TN1A 1G8MA 3EFOB 5AKYA 2W70A 3UWSA 621PA 4RSRA 1B15A 4GBGA 3M5CA 1TW3A 1X92A 3RSHA 4ER0A 1A5AB 2LV8A 1NVDA 4D9FA 4QYIA 3G2LA 2C8VA 4O2BA 2WJWA 1SZCA 1RJFA 4DE5A 1SHJA 1SXJA 3NHAA 3N2GB 5A0VA 5ECGC 3VBEA 4OBWA 2G5GX 3JZDA 3SZ3A 4G1FA 1D03A 2VUHB 4LOHA 3NVDA 4E12A 1KYQA 5FB3A 2EFYA 1Z2AA 5BMVB 1XB2A 1XMPA 2COUA 5EOVA 1TZCA 1E8MA 1ZD5A 2P9TA 3R3ZA 4DWJA 2H5LA 2VO1A 3GCXA 1J0DA 3MXOA 3ZNQA 1ZICA 1DV2A 1T36A 3FGNA 3VGPA 3DMNA 5LQUA 2ODQA 1IUPA 5JADA 2QE7D 2B9VA 1SKUA 5AW9A 3M1AA 2NZ2A 4JY7A 3RYFB 3TZKA 3IX7A 1P9LA 4L7QA 2XE8A 1G16A 1J0XO 3ZHRA 2YV3A 3EXG1 4IR7A 4N7RA 4K9QA 3BRWD 1R4AA 4IJVA 3UM9A 1E2JA 3WLQA 3C97A 2OK7A 4JOSA 4M1QA 5HRAA 1XV5A 4DRXB 3IOEA 1FUKA 4C5AA 1G60A 4FHGA 3QU2A 2LP4Y 3SM3A 5FOXA 2WOOA 4M1ZA 1AC5A 1FNNA 2POCA 2IF2A 4Z9XA 5JZVA 5IM5A 3KAKA 1NE2A 4C1BA 4W7HA 1JIUA 2WVHA 2ZI5A 1N25A 2YDXA 1SKMA 2WWFA 2Y1OA 1W34A 9ABPA 4OGGA 4R2KA 1AQUA 2AXPA 4KN5A 2ZTVA 1JR3D 5D8DA 4PG8A 2C9MA 1J6UA 2ZIZA 3DWEX 3WGJA 1Y6RA 3E4DA 4GZLA 4MCHA 4RPHA 4D5EA 2PUAA 2PCJA 2W2OA 3TTXA 1U7OA 3CH5A 3SYKA 4JJAA 3EF0A 2GCOA 5FFNA 4DGQA 1L7QA 1M1NA 3I5UA 3AR4A 1LX6A 4MGEA 4PFKA 1XAJA 1TM1E 1IL0A 1G6HA 5JJKA 1SB8A 2AXQA 3ZDRA 3HCPA 3ZIAD 1EXNA 2Q07A 4R83A 5EZYA 1R6TA 3GA0A 3EA4A 2WPDD 4EOGA 3PFCA 2YV4A 1R0YA 2ZJZA 4OXXA 5HQ3B 4QVGA 4PFSA 1ZN9A 2CNOA 1SU8A 3LT2A 4UU0A 4ZAWA 1FNMA 3K8QA 1EWQA 4MGZR 4AJEA 4EKDA 1YQXA 3GVPA 5F9HA 3ZHVA 3AJRA 4QG7A 4DNFA 3LHSA 4WNYA 2H11A 1YB7A 4MQ5A 3FBWA 1I5OA 4C7XA 6GPBA 3VPBA 5TMPA 3CXUA 1H2ZA 5CH5A 3S2UA 2VF8A 1DO2A 2ZBVA 4JYPA 3T06B 4DN6A 4ZARA 3WYEA 5K4GA 4L9WA 1QF6A 5CA0B 3ZR4B 3W5JA 5LZ8A 3JTMA 4F8YA 2NNLD 3SSMA 1LFAA 2JVJA 5DGIA 4D4KA 3P2YA 2QVLA 5JBIA 5JNSA 2C4WA 4Y9DA 1OTXA 1GVHA 3ZU3A 1YGPA 2IKSA 3LXUX 2CXNA 3E35A 2IEYA 5DMXA 5EPOA 4BB5A 2H00A 3HDQA 3IXLA 3NBKA 3EXIA 1D2AA 5F12A 4HEJA 3P1JA 2HCTA 4I08A 4L2IA 4WERA 1AIPA 4J43A 4OXQA 2HXSA 2XRFA 1HNNA 1CJSA 3C5HA 2IDZA 1ZJ4A 2ZBQA 5DTQA 2IHVA 4H08A 4YK7A 4Q4JA 1ZAYA 1Q7TA 2PZGA 3MJFA 3MMNA 4PPQA 4YRMA 1NHGA 4U7DA 2OFPA 3BF7A 4BP9A 3GG9A 1J4AA 1QFYA 2VRWA 1BMDA 3PL1A 1NMYA 4NV1A 2PNJA 4YALA 4Y7CA 2VNHA 3LC0A 2VZ9A 2AD5A 2Z43A 1JLLB 2AVDA 2XR1A 3EXFB 1JI0A 3TDNA 2YOFA 3L8CA 2Z9DA 1DBWA 2X0KA 3QVGB 1JB1A 2OGSA 3MMSA 3KL4A 5A1JA 2HMWA 1H1TA 2BTQB 4E0BA 4X1KA 2FAXA 2QJWA 1W4ZA 2GDJA 2G09A 2XZPA 1VC2A 3AHDA 4U2BA 3RS3A 1DXOA 1H2RS 2IIPA 4KVGA 4R1PA 5BP7A 4KE8A 3RVOA 1E3WA 1K2WA 1NLYA 2BW0A 2ZT6A 2BHTA 2FWAA 1X2EA 4MVXA 4ALIA 1QK5A 1Y1RA 1H05A 4HAOA 4ODIA 2HB6A 4F4HA 4YAEA 4KSBA 3HJHA 4QUAA 1YOVA 3NBFA 5AM0A 2XLBA 1T9KA 3D6JA 4RA6A 4B9EA 3NUZA 1Q1EA 4J6FA 1YF3A 2B6HA 1JFTA 3HKCA 2F4NA 1VG9B 2H3EA 4KR0A 3FR7A 3IBSA 3IKLA 4H4DA 4EKNB 3GRPA 5JD3A 1ZRMA 1MB0A 1MABA 1RAFA 3KJGA 4HT3B 5KYXA 4H1UA 4EH1A 1P73A 4RKWA 2PO5A 2CHUA 1ZC3A 1V6AA 4E3WA 3V1LA 3U4DA 6REQA 4LGMA 3RAGA 5LWHA 4P32A 3VR2D 2Q7DA 4UVDA 3QFRA 2D0PB 2X77A 2CD9A 3RH0A 1MGOA 4JVOA 4CKWA 2WHPA 4EY8A 1D6MA 2K87A 4FZRA 3L1HA 1LJ8A 3CEAA 2XDQB 3GHHA 3MCWA 3NWPA 4P7GA 3JSAA 2WHEA 3LUFA 3TIVA 4DA0A 5LLDA 3TW4A 2BLLA 1LK0A 3THOA 2VQEB 5G0SA 4C7OB 1W5EA 1IOWA 4QPNA 1O58A 2B30A 3DUWA 3GEIA 4I4IA 4N6GA 2JG3A 4MQFB 4M8SA 3SM9A 3LVRE 2W9XA 1HL3A 1M7GA 4AQDA 1E1MA 3FNGA 2WSSD 4IXTA 4GDFA 5JXWA 2C2MA 5IJ0A 4Q9DA 5IJ9B 2V97A 4Q1EA 3RSZA 2HDHA 1TJ3A 5GGXA 1VSQA 3E18A 2XD9A 2HHLA 1BHO1 3AC0A 2Z5FA 4HSEA 3ROFA 4J7UA 1T4CB 1P2FA 2HK9A 1F7UA 4EUKA 3FF4A 5AP9A 3T3EA 3GEPA 3U37A 3ZUPA 1IULA 3FAZA 3DCNA 3FNFA 4B6PA 3GGSA 1HG1A 2V6IA 2FEXA 2WHYA 4ZAXA 4KR2A 3IAUA 2XCTB 1ISRA 1W581 2JLRA 2QGNA 2FK8A 1RLJA 2QZ4A 2RGWA 4ITVA 4OP1A 3BFKA 5HK9A 5D1NA 2I6QA 1FTGA 5JHGB 1UPXA 1QKIA 3VAZA 1UADA 1P3Y1 1X7WB 2SBTA 3PT5A 2O19A 1DAPA 1J1ZA 2W2QA 2PUCA 1R2QA 1RHUA 5I5GA 5KTSA 1TJYA 3QWIA 5AVOA 4WNAA 1O97D 3BERA 4QOGA 4ZCSA 1WZUA 1JA0A 4LF6B 3B36A 1D5WA 1OPXA 1CEQA 2ZYHA 4V03A 3JD4A 1MUUA 3EODA 4L73A 4PYNA 4J0FA 4LPKA 3H7IA 4JENA 4UZFA 4TTVA 1ECFA 5ICGA 4B4KA 4JUAA 3GAAA 1K89A 4ND8B 4XASA 1Y4DE 1JA9A 2GM5A 2WA2A 5A4IS 3AJEA 4JI2B 1FXSA 4M9ZA 5A1TA 1A88A 1H42A 1DUVG 2DG2A 5ALDA 5ER9A 4V02A 2HEIA 4LC1A 5IFLA 1MP0A 4F97A 1ONSA 3HWRA 5BWMA 3X1YA 4RW0A 2ZRDA 1JSZA 4BKRA 1L1RA 3HP1A 1Z4QA 4AZ3B 4R69A 4UXHA 2CUNA 2PCLA 2CHQA 3OT1A 2G9VA 3HLYA 5HXAA 5FUXA 3STUA 1Z6GA 2V7EA 2GYWA 1G18A 5I4BA 2NU7A 4I5DA 2JBHA 1XELA 1HT0A 1U8AA 2WI8A 4HWOA 1MJGM 2CGEA 1CUCA 3SHOA 3U3OA 1ZCJA 4RH0A 3FNQA 3LDAA 4ZV4A 2DQZA 1MGPA 4DLUA 1XKTA 4EPVA 5KQSA 2H4WA 5E1MA 4M88A 2NO0A 3KSAC 4BO8A 3IPRA 1ZJZA 3EFHA 2C95A 3MTIA 1LPBB 1T2UA 3NIDB 1GKLA 3ZD7A 4QYIB 4NENB 5ALRA 4BUZA 4KLAA 2PJRA 2RI6A 3DD5A 1W4LA 4G0MA 1QLHA 4OJNA 4K6HA 3H2KA 3T0IA 2PD4A 3V2GA 3ZS9A 3ZY5A 4MS4B 3GYGA 8ADHA 3W5DA 1ZGBA 1E2LA 1E7QA 1IVYA 3ILHA 3SOPA 3UJ9A 3VAYA 4CV2A 1P60A 3SC2B 1BRMA 1EKXA 3CZ9A 3TR0A 3L6EA 3N59A 4U2KA 3WSWA 3GRFA 3WRWA 2DWUA 5K6TA 4IM7A 3FNRA 5LMNB 3G9TA 5A0FA 3NHRA 2C2BA 2EZ8A 2CDAA 2FVYA 3PNYA 3BK1A 4M83A 4FEYA 4XVRA 1L5MA 2QTGA 4BWVA 1LDYA 5ILOA 1RU3A 2GCGA 4G81A 4EQ6B 5F2NA 5CD1A 1X15A 4ATNA 3W04A 2AQHA 5FLXA 3DMTC 1AV6A 1PJQA 4O59O 3HSKA 4WH0A 3TRJA 4ZEOA 5DI3A 1EK5A 2GHRA 4QJ3A 5CG1A 1C7IA 1SULA 4TVKA 1NJGA 3TLAA 2JLWA 3JZMA 3UTDA 5EKTA 4HAVA 4GL4A 1ZP6A 2EKBA 4FSXA 4RTSA 3EXEB 3OZ7A 4ON9A 4R2MA 4ZJUA 3I6QA 5I7RA 3IL2A 4HTFB 3CY6A 1AMNA 1GZ7A 5ALGA 4BO2A 2O50A 2XRZA 3PXEA 5IXYA 2WJAA 1NVVQ 3E6AA 1RZRD 1SIBE 1D09A 1T8RA 1X7XA 4C4RA 1VHJA 1M2VA 1F8UA 1XRSB 3GDHA 3HLTA 1CWUA 4LE1A 2GJ4A 2JFHA 3EEYA 5DM1A 4ZAZA 3RJMA 5L95A 2IH5A 3BREA 4JS0A 3V8RA 3QPAA 2KPOA 1UBKS 2O05A 1JLSA 1PUJA 2CBZA 4Z2YA 3E1KA 1Z7EA 4KQJA 5K3BA 4MWDA 1D2NA 3K3PA 3SBOA 2FN7A 2Z2YA 1QVZA 5EFOA 4EG8A 2P0YA 3VSDA 4GM4A 1NIPA 2ZWAA 3OQOA 2OCBA 4RZHA 4WKOA 5KYYB 3SFVA 5KJ1A 2I2CA 1BDJA 3T5PA 3AW8A 2I9KA 1MIHA 1GZ3A 4LXTA 1VKJA 5GPBA 4TSKA 3PFGA 2A88A 3MCUA 5CVEA 3WNBA 4IH9A 5KDLA 4DLBA 1X8JA 3DZDA 3NXKA 4Y2SA 4BX9A 2ZBEA 3RSCA 1N1EA 4DBVO 4DKJA 2DBYA 3Q0EA 1LWNA 3W6OA 1BE0A 4C4YA 1JPUA 5KO2A 3K4HA 4HPXB 4REMA 3S28A 3JQ7B 1Q0RA 1UFOA 3A2MA 2BMWA 3KDAA 3O3MB 1M8JA 4P38A 4X1YB 5JUWA 5D3MB 2C7QA 4MKXA 4UNRA 4FUQA 3B1JA 2JFGA 3JX9A 3ABZA 2C03A 4JLBA 1V8BA 5B1IA 4INJA 1HE8B 1XPOA 4FIZA 3PF9A 5BR1A 1PDVA 2I87A 4HNGA 2VK8A 4IKOA 1ZMXA 1BHSA 2R6ZA 4Y1RB 3PC8A 1UM9B 2R6FA 2IZ1A 3F7OA 1IHYA 1NX6A 3FMOB 1DELA 3L8MA 2VZEA 4HL6A 4JMPA 3EJ6A 1W73A 1GSOA 4ZQFA 3P27A 4DLYA 4P82A 4B6JA 3GLHA 4NYMQ 1I3MA 1E92A 3E9RA 3VR1A 4D9IA 2JFFA 2Y93A 3WDKA 1HFWA 1M1YB 4AYXA 2XF2A 3SBEA 2ACWA 3FETA 5BNWA 5HKAA 2OAP1 1YBMA 2QRQA 5DWVA 5DNYB 4FPXA 1O95C 3FRIA 3FTDA 1Y80A 1P31A 2BFDB 3D6FA 4P31A 2CDNA 3OQ1A 4YDSA 4DQ0A 1W0KD 1ZVVA 1T5IA 6ADHA 2AMJA 1QLWA 4QDXA 4P92A 4L4YA 5FORA 1N2IA 2Q1WA 1ZK1A 4QEZA 2XIJA 3OLZA 3MA0A 3D7KA 4JL5A 1O3YA 2IPLA 4Z9YA 3WNDA 2IYRA 1SKAA 3KTAA 4P54A 1LRKA 3G0HA 1U9IA 2NTEA 3OJFA 1UWKA 2WTNA 3SYRA 2Q9AA 2YJTD 3PF8A 3TOZA 4PG7A 1VSVA 1QMGA 3CSSA 4DCSA 4HRXA 3NATA 2EJUA 8LDHA 4NRDA 4KVFA 4PX9A 4NZZA 4YP1A 4GI2A 4L5YA 4CTKA 1V5FA 1U0JA 1VFPA 4HPJB 1H4QA 2Y1DA 3OM1A 3ELWA 2H9YA 1PT6A 5EHQA 5KWEA 3DEKA 1R6UA 4NS4A 5ENVA 4GF5A 1DGQA 2OCXA 1KMNA 4CLOB 1N6IA 3L1JA 2ZUCA 2QZ9A 3CE9A 4ESHA 4IJ6A 2LTAA 1WTCA 4P5EA 3CR7A 2CEKA 4C4AA 1RAGA 1Z2DA 4NKRA 3H2JA 3D9QX 3R77A 4ER7A 2DLCX 1WQ4A 1QFMA 2CK3A 3ROPA 3WDLA 3WLFA 3HKEB 4N76A 1A5ZA 4AP6A 1RXWA 4Q03A 1IBRA 1S7GA 4N40A 4Q7EA 3IKMB 5AOCA 2C4HA 5G41A 1V25A 5IDWA 2I76A 5L4SA 5H70A 4CL8A 1R0WA 2CLDX 3IC5A 4N54A 3C7DB 5ERYA 3OTOB 1YIDA 1E9VA 2W4MA 4GXQA 3KQVA 1I2MA 1LJLA 1V7QA 4IIUA 4XGNA 1KYZA 2KBEA 3VO8A 1W96A 1FJHA 4N5LA 1LX7A 3ZHXA 1WMEA 1NRXA 1ORHA 2FEPA 4K05A 3VI3B 4CFSA 4YN3A 5LP6A 3NAQA 5IS2A 4I50F 2I2FA 1GG9A 2FVXA 3F4KA 4BMSA 2O8CB 1WCXA 4RZ3A 2QIPA 1AX9A 3IUPA 4URVR 1A1VA 1NF8A 4JI4B 2CVHA 4RY9A 4D9KA 1N92A 4QT0A 2AIRA 4LVOA 4I55A 2BYTA 2ZUSA 4ZYWA 4DV7B 1RHJA 2ZU6A 4PRZA 5E4TA 2O1XA 5A6VA 4KPYA 3LNTA 1DTWA 1W0KA 1YBHA 2GYYA 3Q9SA 4IQ4A 4PQFA 5H0IA 1AA6A 4G41A 3A6JA 4WCDA 1JWLA 4G8CA 4J1TA 2NM0A 4RD2A 1X1AA 2BBWA 2V7PA 2XODA 2AJBA 2JLQA 3COVA 3L6CA 5C8YA 4ALNA 5LQKA 1XO1A 2QPOA 1AN0A 2GM4A 3FNIA 5HF5A 1BFDA 1QKKA 1U2TA 1G6Q1 4JT4A 3D8SA 1B7GO 1WOYA 4Y9SA 2R6R1 2C2XA 1BAPA 4X97A 1N3BA 3WDMA 1WNTA 2AWNA 4QXQA 3S2IA 1Z2CA 4ZT2A 2AYZA 3DMDA 3DS8A 3HKCB 1O0SA 2GESA 4WI1A 2FFQA 1W5SA 3MPOA 4Q47A 3CU5A 3RVLA 3V7NA 4B9AA 2X4DA 4DQVA 3FPKA 2VDLB 2GCOB 3MMPA 3LF2A 3VVLA 1FW6A 4BP1A 3AXSA 4ND1A 3R0ZA 4IO1A 1ZN2A 1NG9A 3MUOA 1G3IA 2QNBA 3GJYA 2QAGA 3E15A 5LZ5A 1WVGA 2DFPA 1KZ7B 2ZRHA 5P21A 3K6SB 4AC9A 1XNQB 4D9CA 1KPIA 1CG6A 3SDSA 1NWCA 4GBED 1LTKA 4IWNA 3NWOA 2ZYTX 5A9SB 1SKYB 5ALEA 5EWMB 4DSAA 3B7GA 3MWFA 2NOAA 2I2AA 2PMBA 3DZIA 4JP1A 4TZTA 4GOJA 3AM3A 3AP1A 5BOVA 2Z95A 2PUDA 5ES3A 1NKTA 4ZYYA 4BCBA 2G9QA 521PA 1UXOA 1E5XA 3ASYA 2IIBA 3VHXB 1IZYA 4ESOA 1KEEA 3ZCRA 2E85A 2F48A 1ZD8A 3ORFA 5CAEA 2XVMA 1JHXA 1QAOA 2GWRA 3ZHUA 3KKZA 1GY8A 1SZJG 2RGYA 3QW4B 4GHWA 2I1WA 3SK0A 3VTKA 1M1UA 1VMIA 4KUHA 2BJHA 3GVHA 2M1XA 3CKLA 1U1EA 4OVKA 2QY6A 3B82A 3V7FA 5G02A 4XR9A 3JY6A 1JP7A 3OAAA 4A6XA 4MV0A 1T5HX 3F97A 4URXR 3C7TA 1P1RA 2R2GA 4AROA 2QUKA 1T9GR 3FPEA 1ZIPA 2P9ZA 3Q87B 4NDNE 2GBFA 4AM8A 3A3NA 2JD2A 2WKPA 1BHJA 1A77A 5B4TA 4BPRA 1WQ3A 4MW7A 3W5IA 2HCBA 2WLSA 1YZGA 4GUAA 4H3KB 4WK4B 5KTOA 1N8TA 3M4NA 2RJ3A 1XVIA 2M6SA 2R1UA 5D6OA 3ESDA 2IYVA 4TWZA 2JAOA 2WU8A 4ZQIA 1MC5A 2BI4A 1OXUA 4BVKA 3IMGA 1RYHA 1FRNA 2BFEA 3C3KA 3GCZA 3VU3A 4UQOA 1CW2B 4FYKA 2BM0A 1I51A 2ZJ3A 1QQ6A 1GKKA 1WKBA 4K9SA 4ZMSA 4ZZ0A 4XDHA 1SXHA 1AQLA 1LQ2A 1Y6FA 1D4FA 4YBZA 1KJ9A 3C45A 4XX0A 1K5HA 4NE7A 4CM3A 4WIAA 2YIDA 3KUXA 2DQSA 3L0DA 4QPJC 2Q8PA 5KQPA 4MQMA 1QDEA 3RJZA 3STTA 4J4HA 4DYVA 2N9UA 1E5VA 2LR0A 3QPUA 1GQFA 4UBJA 3AVQA 2YMMA 1G291 3COSA 5IBQA 5TARA 1QRAA 2CMFA 3EH1A 4GGOA 4GNRA 3FSRA 5AXAA 1E3SA 2XZOA 2J07A 5JECA 4O08A 5FR2A 2BMJA 2C3OA 4H6VA 4O2BB 3TB6A 1L9XA 4D6YA 3P9KA 4FHZA 4NP6A 2CN1A 5J2TA 2EL9A 4AY4A 5B1EA 5IF3A 3K2IA 4BE7B 2UYCA 4YFYA 1JFFA 2IY8A 3I39X 3AVWA 1RWQA 3B6KA 2HIGA 4X7PA 2OE2A 5A7HA 1P1JA 1QO7A 5JAPA 1I7SB 1J8YF 3L6UA 3LECA 4J4BA 5FNZA 3FDJA 2G5TA 3F96A 5G2OA 3LHIA 3RKUA 3GBSA 2GZHA 1OXKB 2H2WA 2WM8A 2J7PD 3B12A 3MFYA 3O73A 4LDJA 4P58A 2GZAA 1DC4A 4QLAA 2RJNA 4Y6SA 1UPAA 5I01A 3LBNA 1FRVA 2I80A 3HCOA 3BIOA 3AG6A 3UK0A 2BSXA 2W0SA 1IUOA 1T5OA 1Z0DA 2FSUA 3V42A 1JXQA 5KSWB 2AXNA 4XWGA 3W79A 1JIXA 2OBMA 4JVLA 4Y1EA 9MHTA 1JALA 4LFCB 1SHZA 4KTVE 3NOXA 1OUMA 3DDNA 4WXRA 4C3ZA 4ZEVA 1E7WA 2G80A 5LOVF 1EH5A 3U48A 1ZHOA 2YFYA 2ATVA 2TECE 2UZ1B 3Q9LA 4DY4A 5HKOA 3MRVA 2E4YA 2E9SA 3IPLA 1CY7A 4X95A 4ZYLA 2Y0PA 5JHHB 1U8TA 1DFGA 4F11A 5AKJA 2K7FA 1F20A 4P93A 4FGKA 3O8QA 5JAIA 4FYVA 2H51A 3FKSD 1MEOA 4MW4A 1KY4A 3D6UA 1K27A 2HNBA 4BBPA 1XEWY 4JGBA 2R5NA 1EGQA 3QOYA 2ZATA 4OQLA 1WNFA 4BNFA 1T2EA 4JR2A 3EPKA 5DNAA 3U6KA 1SC9A 2QRJA 5LL6P 2P68A 2BMVA 2C3PA 4GPBA 4MK4A 4HTAA 4QULA 4RJJA 3A4VA 3VR3A 1GYRA 3ZVRA 4PYLA 2VSXA 2I34A 4DJJA 1LW6E 3EY4A 4BECA 2GAOA 4DANA 1ESNA 4UAVA 3S2GA 3AQIA 3DVSX 1SUCA 4RSGA 2VYQA 1EXMA 4F6RA 5JJ5A 5K4HA 5LJIA 4MJLA 3DEZA 4MQBA 2FMKA 1KS2A 3MTQA 1KYWA 2CLMB 4EA7A 5HMMA 1DTWB 1P4RA 4BKMA 1WR8A 4JYZA 1OREA 3I04M 3QUQA 3T1YB 3UJ8A 5DYTA 2IYEA 5FJIA 2WWVD 1D2EA 3Q8LA 1MHPA 2PZAA 4JLVA 2FSGA 4JJFA 1KK1A 3EOBI 5E8JA 4IF6A 4ZVKA 1SNYA 4ZANA 3ZX4A 1TIPA 1DV1A 3IUMA 2LBPA 3AHJA 4L02A 2X8JB 5LXTF 4DMUB 4LE2A 3ONDA 1INLA 5CDSA 2D2XA 4JI7B 5DCLA 1UQRA 4P4SA 5HBRA 1KOFA 5IN4A 1YK1A 3DZ8A 5TMBA 3B70A 4OM7A 4HYEA 1L8OA 1CIJA 1NP6A 1T9BA 4DR4B 3DCJA 1C8VB 1VJTA 4GWGA 2O54A 2HK7A 1GZDA 4A8JA 5JBNA 1P0QA 4IGFA 5IT5A 4EA8A 2YFQA 2RKWA 5LYYA 3ZHTA 3NC4A 4MQ4A 1WUTA 3PWZA 5EY5B 1EB9A 3FWKA 3M1IA 3QBJA 1Q6ZA 4ZQBA 3KJFA 4UDYX 1Z7WA 3W3AH 3R5HA 2VDJA 3K0HA 3TVYA 4BLWA 1R3DA 4HB4A 5E6RA 4LRWA 3ACDA 4WLNA 5EJIA 5EJ5A 4DJFC 4RWEA 2GJ8A 2H2HA 3IPCA 3QUCA 2R84A 1WDTA 4IMPA 4U9UA 3H16A 1FCJA 4PAWA 1FRFS 3G0CA 4RIFA 2WJVA 4WGFA 4WLUA 5FOVA 1JV2B 3ACBA 2ZUDA 1H2XA 1ENZA 3LDGA 2QR2A 5AQEA 4B31A 4BTEA 1AZTA 2GXUA 1GN8A 3UEOA 4YRKA 3RVJA 1HYHA 4DT1A 4N6NA 2F62A 1FQJA 4BMVA 3QLTA 3IV7A 2J30A 3FLAA 4FYWA 3F78A 4HFMA 2HUNA 4YV2A 2C7BA 5FOQA 1OBVA 1SBCA 3U0BA 1KA9H 3CT4A 4IF4A 4JC5A 2Z58A 3KJNA 4IVRA 1U7XA 3I12A 3OSZA 4LYFA 4XX1A 2WFZA 3GAZA 3MWEB 3ICEA 5IHXA 1BEZA 4D92A 7REQB 2MSNA 3GYBA 3ME5A 4DIUA 3L92A 4NU5A 3MB8A 3EASA 2IXEA 3HO6A 2ZZKA 2ERYA 4HVLA 1E20A 1U90A 2AFIA 1LLCA 1C2YA 2BFOA 2O2HA 3GXBA 2HLPA 5CVCA 3IP9A 4JU8A 1Y9EA 1WF3A 1RXCA 5EJMA 5GONB 3VZDA 3EPHA 4IGKA 3SOZA 1NX9A 3E58A 4XIIA 4X6XA 5JQWA 2P41A 4IV8A 4Q4AB 3V1NA 2QRPA 2Q0SA 1U0SY 4COKA 3NT4A 4B7UA 1KY5A 5HMLA 2Q8QA 3QY0A 1KQ3A 4QSMA 1UBFA 2PFKA 3IQEA 4YV1A 3DFIA 1V5WA 3GRAA 3GDWA 4NARA 2WW8A 3PTAA 1NNLA 1WCYA 2VH1A 2FPSA 3OLXA 1SU7A 3V1MA 1H0KA 4ZVLA 3IKJA 4P3NA 2DVMA 1HF3A 5K3AA 4OHZA 1ZI8A 2VT3A 3DM9B 2C3MA 3OPYB 1OB5A 2CYAA 3B6MA 4EI7A 2YOGA 2P67A 3NWBA 3PXUA 4DR1B 2IIVA 3G8AA 3T61A 4CLOA 1GP2A 1J00A 1NJFA 4OUDA 4O2AF 2AEEA 3WRXA 3WGIA 4LK3A 4ETNA 4GE3A 2IYZA 3J81k 5AM4A 4WXYB 3WRXC 1P9NA 4HAUA 4DQKA 2RAUA 3QVOA 4X7BA 1EHYA 3HWSA 4PZ0A 2NT3A 4Q0MA 4WXEA 5K01A 1E7RA 2VF5X 4PYMA 4Q3NA 5EJAA 3VV2A 1PE0A 2ZJFA 4FQ7A 1JAYA 3T3PB 1TTPB 5CCDA 5F2EA 1X70A 2XB2A 3W5AA 3ILSA 1Y7TA 3WWYA 5LA6A 3TM4A 5CDYA 4NNOA 2B2NA 2FB9A 4XVUA 1XTZA 3IUYA 3LLMA 4LV5B 1RWVA 2O1EA 4OSEA 1NQVA 2AI1A 4XFKA 4YRRA 1P0MA 4HDNA 2V6FA 3IUQA 1FYVA 2P1RA 3O26A 2JJMA 1M1YA 3S8MA 3WYDA 4LRXA 1Y3FE 2VQFB 2I99A 3W05A 4EIWA 5KCZA 3ZQJA 2CLOB 5LKRA 1J9EA 3THWB 4IH1A 2ZULA 1HFEL 2NSYA 3L1VA 8OHMA 1LBEA 3TX2A 2ZB7A 4XPIB 4DA4A 3R0IA 3RANA 2VA8A 5JCXA 3SU8A 1F2UB 3ORQA 2FFAA 2FZLA 4NDZA 4DRZA 1K75A 5EWJB 3C6MA 4PV7A 1E9AA 1Y37A 1M6EX 1VLJA 5EQDA 1WSWA 4Z1OA 1PJ2A 3GL9A 3GUCA 4FDTA 4KQKA 1FB5A 2WJ4A 3R8XA 4ZHQB 3HCRA 3EMDA 1ZRHA 4HAYA 4EMUA 1DIBA 3JU3A 4WN9A 1FDRA 4MDFA 1BEEA 3GRCA 1NJ8A 1U1DA 2RGAA 3W77A 1VL6A 5AM3A 1KETA 4F6RB 2EEPA 4F4CA 2ZIXB 3PB3A 5JQGA 2ZXUA 1NFFA 3B9BA 1N0VC 2C20A 3KWLA 3Q12A 2VVTA 4TV9A 1NV9A 5F51A 4PTLA 1M2EA 2ZK7A 2PA3A 4JQCA 4R8MA 3RU2A 3B3AA 4CQMB 3CRMA 3W1VA 2H52A 3WLRA 4OLBA 3EW7A 3COPA 3WKAA 1Y8AA 2AZTA 1E2QA 2P9YA 1GL6A 3NM5A 2XZLA 1VKRA 5TF0A 5JJCA 1BE1A 3F6SA 3NHKA 4CEIA 3VYWA 1CP3A 3NYQA 2Y9MB 5DASA 3RRXA 3UH0A 3ZWKA 2XYVA 1NASA 5IASA 1KTVA 2SCUB 2HTEA 3C6KA 2B7CA 2F1IA 5BQPA 1E5QA 3BWVA 2B1QA 2VQ3A 3WAKA 4M36A 1USIA 1XGKA 4DS3A 2ZUEA 1C0IA 2EP7A 1PJ4A 2JAUA 4PONA 4D8UA 1E9CA 1XTRA 3L7KA 1K5GA 5HZMA 5KQRA 1N57A 3MEQA 2C9ZA 2WTXA 2EWVA 4W9NA 3OPNA 1SK9A 3WLEA 4QA9A 4D74A 2GZDA 16PKA 2PK3A 4OL0A 2UZ1A 4MARA 4EJSC 3RFVA 3TFWA 1JFLA 5DN6D 2AFHE 3Q4GA 2RKOA 4BNHA 5J63A 4WESB 4IDGA 1XAHA 3UJPA 2DWPA 4HEA1 5B3KA 3LD9A 4CI9A 1XJQA 3QF7A 4F92B 2V0NA 3N0TA 5BVHB 3TD2A 5L53A 4QVIA 1UT6A 1DWPA 4QICA 4JWTA 4KPUB 3U62A 1U5BA 1V96A 4LISA 5L3QB 4F86A 1Y1PA 4Z4HA 4YRDA 3MG9A 4MYCA 2E1RA 2CL0X 4EVIA 2P27A 5H16A 4FCTA 2CLFB 2XCOA 1TD1A 1WWKA 4PQRA 5L4LA 4KR7A 2HWXA 2BEUA 3TLEA 3GGCA 3JAMA 3C98A 1J49A 1OV6A 2BHNA 2XOEA 1PTKA 4DRXA 1YDHA 4CCWA 7MHTA 3UUGA 1FX1A 3C8DA 4BNKA 1ZK3A 4QRIA 3FR8A 1CUWA 1YDFA 4W9NC 4EYOA 3RVSA 1RS0A 2ID9A 4QELA 4BQNA 1Y3DE 2PX4A 2XYHA 3KYIB 3OEWA 4WUVA 5DM0A 2XUKA 2D7JA 4MWTA 1U2EA 3FYUC 4U7JA 3ZK9A 3GLIA 3TMAA 4OQQA 2GARA 1BO6A 1GZ6A 1SRQA 2X0IA 4OHYA 4CMGA 1Z0ZA 3HB0A 4IHJB 3REQA 1X7GA 1S8OA 1XTKA 2CCJA 2NN3C 2QMQA 4Q4AA 4QTUB 4FLMA 1R00A 1NW3A 2ZRNA 5K8LA 5F7ZA 1CQIB 3IRVA 3R5FA 3WHKA 3T7SA 3AI2A 1A9XA 3NHZA 4MGYR 4X66B 4NF2A