4V0KA

Crystal structure of the crarl6dn in the gdp bound form
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
151
Chain Sequence
KVNVLVVGLDNSGKTTIIERLKGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 44
structure length 151
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0kA00
2TMKA 4UNRA 4Q4JA 5C1BA 3OE7A 1CF4A 2ORWA 1YZTA 5EXXA 1R8SA 3UPUA 1J8MF 3OFND 1M6NA 4OQXA 4DCSA 2JLZA 2ECKA 2FV8A 2R9VA 1W36C 3F5FA 2Z4RA 1Z0AA 3A58B 5JRZA 1XEWY 5EE1A 3JVVA 4Q66C 5K8TA 2YHSA 4JVNA 5KO2A 3I5YA 2QT1A 4I1SA 4QBGB 1W7AA 4M1YA 1E9BA 4WBSA 1I4DD 1P9WA 5FUYA 1E1RA 3AKYA 1FNMA 3VKGA 5KPJA 1DG3A 1OSNA 4H1UA 2P67A 1QG2A 3DOEA 4RCZA 1KO1A 4EKDA 3BH6A 4QXAA 1XD9A 5JWOA 2GILA 3ASYA 4BE7B 2DWPA 1IY2A 4B34A 4EQ6B 3MWYW 5EXSA 2W6JA 4DWJA 4YDSA 4PC7A 3TAHA 4D81A 3AM1A 3KFXA 2FWRA 1E2JA 2HEIA 5KYKA 2FZ4A 4G0NA 3IDQA 4V0NA 1T5IA 1U9IA 1XPUA 1SVWA 2BCJQ 2PT5A 3TMKA 1T4GA 3KUDA 1KTVA 2QP3A 3QKSB 3L0PA 1VYTA 2XOKA 3GJ3A 4JLVA 4K81B 2F9MA 5FTNA 2BCGY 3GJ5A 3KXIA 4F4JA 2C9OA 3CPHA 3E70C 4KU4A 3X1ZA 5K8LA 5H68A 2E1RA 4EJSB 2EFEB 3MJRA 1NL3A 2REBA 3F0TA 4I4LA 5AWFC 1X8KA 2IHYA 2J0VA 3K0CC 1NVXQ 2WJIA 2V4ZA 3OFNA 2O0KA 1OB5A 3A1TA 3HPQA 1E99A 5B30A 3MWLA 3THXB 3B9PA 4FCWA 1E9AA 4KHZA 3CNLA 3UG6A 5F9FA 3CPEA 1KY2A 1XMJA 1D2NA 1DO0A 1XEWX 2UKDA 4MH0R 2CHQA 3QBVA 3SFVA 4V0LA 2D7CA 5FOWA 4ZCIA 2BMJA 2OBNA 3VR6A 3SYLA 1G6OA 1NKTA 4BLPA 2N46A 1VYVA 2IYWA 4OJQA 4HAYA 3BK7A 4A2PA 3LXRA 2QM8A 2OG2A 2Q9BA 4Q5IA 4B35A 1IQPA 1Q12A 1EFUA 1OFTA 4MKHA 4QJ4A 1BOFA 1CU1A 3BB4A 3E2IA 2K5UA 2WJHA 4M1MA 2JASA 4DLVA 3W5IA 1LNZA 3M0EA 2NGRA 3ICEA 4LDJA 2QNRA 5DLQC 1COWD 4RKEA 3H0KA 3QKUA 1KI3A 2QBYA 1G5PA 5JJLA 1XEFA 1E1QA 3P32A 2JA1A 2OLJA 2FOLA 5JMTA 2KI5A 4I1VA 3OEED 1P2VA 5HZHA 1VTKA 4URWR 3EXAA 2WWWA 1QHHB 2MMCA 1BYUA 2BKEA 1ZUNB 1OHHD 3FOZA 4LX0A 4U5XA 2GCPA 2VSXA 3KQKA 4UNSA 3U7GA 4DCTA 5AUQA 2QMEA 3AP2A 2QZ4A 3TUJC 4B3BA 3RDPA 1XXHE 1ZM7A 1R5NA 2E9SA 2XNDD 3TVTA 3ZDQA 4F4IA 4M1KA 1FOEB 4TZ0A 2J46A 4GNKA 5JHHB 1OXTA 3AVTA 4TYWA 3QKRB 2R2AA 2B6HA 4JLBA 2C04A 2O8BA 5FTLA 5KHOC 2NQ2C 3PUWA 1A4RA 2ZI9A 1U99A 4US2R 1ONBA 3PEWA 2ZVPX 1Y3AA 4W7SA 5L3RA 1IJEA 4CYMA 3RS4A 1DOAA 4LBYA 4ZDIA 1XB2A 2X2FA 4TLAA 4POAA 5BYKA 4XVRA 3FHOA 4NYIR 1KJYA 3THWB 1OH7A 4HB0A 1UPTA 3DZ8A 5CJ2A 3W8RA 421PA 3ZD6A 3K0SA 2JGNA 1S3GA 2AL7A 1YR8A 1SGWA 4PQFA 3DM5A 3T1QA 4NP6A 3B9QA 4X8HA 1E0JA 4URXR 3O8CA 2GWHA 1COWA 1P9RA 2VHCA 2WSSD 3EA5A 4NZYA 1UKYA 1S1CA 2A30A 2ZI6A 3MFYA 1G7SA 2NG1A 1Z8FA 1CJKC 2OCPA 5L3SB 1Z83A 3OEEA 3HP1A 1IN6A 1ZCAA 4PPFA 1ZNWA 3W3AA 1G16A 3X2SA 5FPTA 2YYZA 3EIHA 3N70A 4EIWA 3K0FB 2H5EA 2O0JA 2WAXA 4OHVA 5DNYB 1PV4A 2XXAA 4LUCA 4HZUA 4PPNA 2YJTD 1H8HD 2B8WA 4Q1EA 4D0LB 4Z1MD 4URUR 4GOJA 4ZDJA 1I4LD 2OESA 5FBLB 4CT5A 4AY2A 2BBWA 3RRYA 2JLSA 2XNDA 4L4UA 1XTJA 4BZQA 3SJZA 2IWHA 2AN9A 4KO8A 5IK2D 4R7ZA 1RRCA 3ADKA 1YHNA 2NO7A 4RVCA 3RS5A 4A2WA 4WZAE 5B57C 1S0UA 3LA6A 1KYIA 1NI3A 2VHTA 2LCFA 1X6VA 2XZPA 3TQCA 2P3SA 4RD1A 1Q0UA 4IDHA 4PQRA 4MQBA 5G41A 3AVUA 3MG9A 4S2EA 4HAUA 4JS0A 3NEYA 5D3MB 2J87A 3CZQA 2GKSA 5DN6D 1BYIA 2PX0A 6Q21A 1E2DA 3AGPA 1RKBA 2QG6A 2IS1A 2ASEA 3W6NA 4JL6A 1GNQA 4P32A 4URZR 1XMVA 1PVOA 4DSOA 3B1YA 2WSSA 3A1WA 5L3VA 3HWSA 1P72A 3UWKA 2PZFA 1P3JA 1G3MA 4LJ9A 2NPFA 1YE8A 1F6BA 4A82A 5F3WB 4NKRA 1CR2A 1G8FA 4KJZA 5DGXA 3DMNA 1KJZA 4XTRA 3S1AA 1YR7A 3THYB 4Q1BA 2RHMA 2IW3A 3C41J 5CYPA 4DSTA 4M9XA 3TIFA 3GLGB 1HV8A 1A82A 1FMLA 4A1FA 1TTTA 1H8HA 1TEXA 2DCUA 3WMGA 3IBYA 3ZLJA 3Q5EA 5G53C 3LFUA 1YZNA 2NTYC 2WTUA 5FBWB 3C8UA 2QRNA 2LKCA 4BRUA 4IEEA 1SHZA 3B60A 3LX5A 4KYIB 1Z28A 3RAPR 1CP2A 3U3RA 2WWFA 1TUIA 2ZRDA 5IK2A 1AN0A 2CEAA 4PQYA 2FFHA 2O8EA 2QL6A 4YONB 5DIFA 1J2JA 4H9GA 2Z43A 3QEOA 1E9DA 4GSYA 2PLFA 2RB4A 2YC4C 4C0LA 1ZM3A 4F38A 1P75A 2WSMA 4TN1A 2C99A 4OKSA 2DBYA 5BN4A 1Q57A 4L9WA 1NVWQ 3JZAA 5TDHA 1XXHA 5DN6A 3W6OA 1CJTC 1RJ9B 1QF9A 1KNQA 4B71A 3R7WB 1EGAA 2VP0A 1P7CA 1GL6A 2IT1A 2ZJAA 5E7IA 4JKYA 3Q8XB 1XU4A 3LQQA 5CLLA 4CZ2A 3I73A 4IDOA 1NN0A 2DHRA 2IYSA 3L82B 5FI1B 2OBMA 1YR6A 3A36A 4L5BA 4NYMQ 4Q4AA 5G3ZA 3B78A 3DPUA 4ZPXA 2F1HA 5LPNA 2HCJB 4JL8A 4D0NA 1KI1A 3ZJYA 2OAP1 2ZEJA 4PHGA 4M9SA 1UEJA 1LS6A 3QPUA 1RPZA 2ZRGA 4Z51A 4MRRA 4PO8A 4F92B 1QHXA 1EG7A 3LH5A 2QAJA 4OHXA 4B2IA 5JEDA 1NBME 3RC8A 1E2QA 3JVUA 1DTSA 2OCAA 4AYXA 1E2KA 1Q1ZA 2ZE6A 4PPGA 1UBCA 1SQ5A 4XWKA 4S35A 1NRJB 1NF3A 3CUEF 3QEJA 2WMOB 1GKYA 4TMZA 1WRBA 1ZVQA 3SFZA 5J4LA 2P6RA 3REGA 1W44A 4Q7LA 1TQ2A 4QGFA 1SZPA 1BO6A 3FB4A 1N5JA 3RANA 2OFXA 2ZRHA 3RWOA 5HKKA 5K8UA 1KI2A 3WYAA 2BMDA 4WXPA 4IFBA 5JHGB 2DFNA 4PHTA 2QT0A 5KOYA 1YZQA 2ZUCA 3CBQA 3I8SA 5EXPA 1TF5A 3HJNA 1DAHA 1A2BA 1EXMA 4TMVA 1G8YA 3LX8A 1G8PA 1TF7A 2IYRA 2F43B 1EK0A 3KKOA 3NHAA 1G21E 5GJVC 4LYJA 4B74A 3KQHA 5C2JB 1W36D 4LJ7A 1F60A 4C0QC 1HY3A 2RGBA 3FPAA 3U3JA 1RYFA 4R71A 3BOSA 1XBTA 3VQTA 4KVGA 3CIOA 4KXFB 3QY0A 4QBFA 1JXOA 4PAOA 5J5CA 4B33A 4CRWB 2ZSFA 4K8OA 2A5GA 4E07A 1CJMA 1YZLA 3E1SA 4US0R 2J0UB 4JSYA 2FGJA 5HZKA 4A15A 1X1RA 1IN7A 2RGNA 5EZ6B 1G4UR 2FSGA 4TSFD 1KMHB 4GPTA 4A8JC 2IS4A 3SE0A 4QL3A 2CCGA 2KSQA 1XD8A 4JT2A 1W49A 3LWNA 4P3YA 4AKGA 2HF8A 4TMWA 5GJCA 2GEUA 2QQEA 1XX6A 1NJFA 1UKZA 2IYVA 4NU0A 2ODWA 3SJBA 4LV6A 1OFUX 4LCBA 4PXAA 1JPNA 3GLFB 3NC1C 2BMFA 2VRWA 3PIRA 4HDCA 4MA4A 5KU1A 2VYFA 1SVIA 121PA 2AK2A 1GRNA 1YJ5A 621PA 2ZJ5A 2Z5FA 2ZRLA 4EQ6A 1WB9A 3PENA 2QPOA 1U2RA 2ZVQX 4JLOA 1L7VC 2AWNA 4JLAA 1E9SA 1QG4A 4Q9JA 1ZAKA 2ONKA 1AZSC 3CB4A 1ZNXA 2AFIE 1GOTA 1AS0A 4KI0A 1PZNA 1V5WA 2GJ8A 3TJZA 3VKWA 4A92A 4HLQB 4D0GA 1W5SA 2ZSBA 4IVQA 2O8CA 1E32A 1W2HA 4PFSA 4KBGA 3U3MA 4BWYA 3EZ9A 1KO5A 5D3QA 3T61A 8OHMA 3ONWA 2IYQA 3QKSA 2SHKA 5FFMA 3TUIC 5JSZB 4JVSB 3KQNA 1XNJA 3TSWA 5DI9A 1U0LA 2O52A 4RSGA 3SYKA 4DBLC 3QF4B 2NOAA 2ERXA 3DMDA 3SI7A 3UG7A 1OXSC 4DUGD 4M1TA 5GJBA 2DFLA 4BRWA 2RCNA 5EP3A 3BB1A 1W2GA 4MKFA 4BLQA 4TSFA 2H18A 1WBDA 4IDQA 3TW4A 2FNAA 3THXA 4C3ZA 2O8DA 1Z0KA 3IGFA 2ZRKA 5IHPA 3ETLA 2GCNA 3P20A 3PR1A 4G1UC 2F7SA 5L8VA 1QZXA 3V4FA 1CIPA 3AVWA 1N25A 1KK3A 3R20A 2WWXA 4QBIA 2WOOA 3SU8A 1LS1A 4H1VA 3UMRA 1D5CA 2CXXA 4FMBB 2WZQA 4DCNA 4CEIB 5F9HA 3IPXA 3D8BA 1UF9A 1IY1A 1W0KD 2FG5A 3K9NA 5ANRB 1XTKA 5JWHA 3O8RA 4WAUA 4DB2A 2OZEA 2BMEA 4BFWA 4JKIA 4HAXA 1G3QA 1E9CA 2GXAA 1YQTA 2A5DA 1SVLA 2JLRA 2YWEA 1E96A 5FBVB 2ZXUA 4B43A 3RHFA 3K0CA 1ZC3A 5J4HA 2YWGA 1XCMA 1E2MA 4DDVA 5KNDA 3ZD7A 1IY0A 2AXNA 3C5CA 4HZIA 4I1OA 4OL0A 4IOJA 2JAQA 3K0EA 4QFMA 3QXCA 4PHHA 4MUAA 1NG1A 1QHHA 2C2HA 2QGNA 4P4UA 3SOPA 4E09A 4XWOA 3Q7PA 2XX3A 4JT4A 2RMKA 4KFRA 2XJ4A 4DUGA 2HYDA 4JYBA 3DL0A 4OK5A 4HAWA 2VP5A 3P4XA 2ZR0A 4LI0A 4TYNA 2REOA 5SZHB 1ZUHA 4GOKA 2QTFA 3ZGXA 3T06B 1Z0IA 1IJFA 1HEIA 3W6PA 4D25A 2FEOA 3PXGA 1CLUA 3A37A 2KJQA 4HDQB 4BZPA 2HCBA 5DISB 521PA 4ZIRB 1XCGB 2GESA 5FPSA 2IXEA 1M8PA 3PITA 3QKRA 3KKMA 4HSEA 4TL8A 5BQ5A 1A5TA 4BASA 1ZP6A 1XMSA 1L2TA 5CLQA 1FMJA 2JLVA 1NY6A 3NVAA 4V0OA 1AGPA 3OIYA 3EIEA 1TQDA 3RS7A 5E3HA 3HU2A 3ZZUA 1IN5A 4OQLA 4IKEA 5TMPA 5GADl 2HF9A 4P0TA 3DEFA 3NH6A 4NYJQ 3THWA 4MDFA 2CJWB 1W0KA 3K53A 1Z6YA 2QY9A 2RGGA 3QSYA 3ZQJA 3BD9A 2IYUA 1KDTA 3VU9A 2VO1A 3M1IA 4TLEA 2Q6TA 4MKGA 4BFSA 1E9EA 1QHIA 4HYYA 1Z2CA 4XOIA 2DPXA 4Z8XA 1P9NA 3IHWA 4CEHB 2V6IA 3NKVA 3ZH9B 5L3SA 3LLUA 4D82A 2A5YB 2JLQA 2GCOA 2C5LA 3V9PA 1LY1A 1E1RD 3C15C 1L8QA 3ECCA 1R10A 1ZIPA 4E03A 1VCNA 3WHLA 1G291 4V02A 2CE2X 4XIGS 4G01B 4O0MA 4RJLA 1AJEA 4RZUA 3GMTA 2ZRCA 1XEXB 2KWIA 2ZTSA 4C9BA 1OFIA 3L0SA 3RABA 4FD2A 1P61B 2OM2A 4B3GA 3ZVMA 1CRQA 4TWZA 5TV2A 4V0MA 1DADA 5CYOA 1CR0A 3BWDD 3VFDA 1J8YF 4W5WA 2VSOA 1TAGA 1FTSA 2FU5C 2GJAA 2ZRPA 4G5GA 5KTYA 1E0SA 3MSXA 1ZC4A 2AD1A 1XD2B 3EARA 2JLYA 3VNVA 2QN6A 2YV5A 2VA8A 1JR3E 1XP8A 1EFHA 1IN4A 2CE7A 2WKQA 3CKLA 2KB0A 3ZS9A 2GZDA 4P33A 3NTUA 3CRW1 4C7OB 4LYFA 3W90A 1T5LA 3IPYA 1S96A 2CBZA 4ARZA 4C2TA 4BFUA 2GXUA 4OHYA 1T3HA 4JJZA 1MKYA 4PC6A 5D3MA 1II8B 3JZMA 3R8CA 821PA 1QHNA 2IF0A 2AHOA 2D06A 2IYZA 3H84A 3PEUA 5CJPA 4QNRA 3TH5A 2ZRFA 2BJWA 3FHCB 3U61B 3QBTA 4GI7A 4JBYA 3RLFA 3Q7QA 3QKTA 4CVNA 3LLMA 4GP7A 3T12A 1W4BA 2IUUA 2IHBA 4Q03A 4EJSC 3GFOA 3R9XA 2FH5B 3CRQA 4PSVA 3GLFE 4HAZA 1WBBA 1JECA 1KJWA 4G5OA 4NTZA 1KO7A 3GCGA 3THYA 4AYWA 4PSAA 1SVSA 4YMTA 1C4OA 3B8HA 3GLGA 1GITA 1UDWA 1X86B 2PZEA 1QVRA 3CH5A 3QG5A 2IX3A 1L4YA 5B58C 2FDCA 4N3NA 3QIAA 3DZDA 1P2TA 3CONA 1XPOA 2PJRA 4NMMA 2ATVA 1HE8B 4C30A 3OIWA 4Q00A 2UZIR 2AKYA 1CRPA 3U60B 2B7CA 1WA5A 2EWWA 4D4JA 2NZ8A 4DT1A 3CW2A 3KL4A 5FOSA 3OESA 2QROA 5AK0A 1E1QD 1BMFA 3QPWA 3A1VA 1N6RA 2OCBA 4CEJB 3IKJA 1FW6A 1YRAA 2BJVA 3B5JA 4LHWA 2IWRA 4BZXA 1M7GA 4Q01A 5FTKA 1S8FA 3IBGA 3REFA 2XGJA 1NN1A 2XB4A 4DIDA 4BUJA 1KSGA 1LB1B 1A2KC 3EWSA 4Q1FA 2FZLA 3IHLA 3RRMA 2OBLA 3ADDA 3NHBA 3HR7A 4LV8B 2FFAA 1RJ9A 2YZ2A 4PZLA 4DZZA 1W1WA 2IUSA 1KGDA 3U6KA 3R7WA 3IEVA 3LD9A 2IL1A 2OXCA 4WOPA 4B3XA 4DC9A 4XVUA 4C4PA 2WIAA 1JR3D 4P4SA 1AA9A 5FPYA 1W47A 2WWHA 5EE0A 3CR8A 4CIDA 1UBEA 1GRRA 4D2IA 4ZKDA 1M2OB 4ZDWA 3MMPA 2B21A 4R98A 3TNFA 4BECA 3O47A 1KK2A 3VHLB 1T8UA 1FUUA 1XRJA 2PL3A 1X8LA 2PCJA 3GQBA 2H57A 5G3YA 4LRWA 1SKYB 2WMNB 2ZSAA 4DEXA 1E2NA 4DLSA 1C1YA 1UDXA 4K46A 1UFQA 4XTCS 1IN8A 1ZYUA 3BRWD 4B73A 4IW3B 2BOVA 2EWVA 4B6EA 2PMKA 4TTQA 2WJJA 2VP2A 4M53A 1G8GA 1M7BA 1KZGB 5TB5A 3W9YA 4U00A 5F98A 3CRVA 2R62A 2R6CA 1R5OA 1ZJ6A 5HCIA 3WNDA 4N0DA 2G0TA 1GP2A 1Q22A 2H8KA 4LYHA 3WYFA 4ZO4A 3B1XA 1S9DA 1N0WA 3PVSA 4NL4H 3BIFA 2ZJYA 5KSYA 2FSIA 1MO5A 3VNUA 2F43A 2P65A 3Q3JB 1NMXA 2AKAB 1OLOA 1EWQA 2P5TB 4IXNA 3T1TA 2OLKA 1E69A 2V1UA 2VPPA 3DHWC 1AS2A 3ZQ6A 1JR3A 3NEJA 1ESMA 4URYR 5C4GB 2C9YA 5KSPA 2G0NA 4UJ3A 3SHWA 3SR0A 3K09C 1KSHA 1W4CA 3B2EA 4DXAA 1ETUA 3GJ8A 1GWNA 3TVDA 2X77A 1FP6A 2J0UA 3B1WA 1SVOA 3E5HA 4A36A 1EESA 1JALA 1MOZA 1U90A 2XNSA 1HURA 2FF7A 4AURA 2J7KA 3DDCA 2VIIA 1QDEA 3DVLA 4TL9A 2FMXA 2ZRIA 5BYJA 1GSIA 1AK2A 5JFGA 5LB4A 2VEDA 1WDTA 4JLDA 4Q02A 5JI3E 3GEIA 2NMVA 1E79A 2ZJ8A 1GILA 3LXXA 4BFXA 3GLHB 1SKQA 2ZAOA 3AF1A 5DH9A 2QRZA 3EZ7A 3MGCA 1G19A 221PA 1P5ZB 3K9HA 4DCVA 3UMSA 4B3DA 1UBFA 3GLFA 4KYUA 1TQ4A 1NJGA 4KAXA 1QRAA 1U94A 5JLJA 4EPTA 2VP4A 4LBWA 4PHFA 2OFWA 1G3UA 2CHVA 1H65A 3UMFA 4BFTA 4W5HA 4GL2A 4QKQA 1FNNA 1P2UA 2BBSA 2GHIA 2J45A 5F2EA 3WNBA 5LDDC 2FA9A 3VR1A 3PUYA 1ZD1A 4HAVA 4L16A 4DVGA 4OQNA 2HJVA 2ZE8A 4NCNA 2AK3A 3ZZTA 2G3YA 2CVHA 4QNMA 3TSZA 2XAUA 4A8JA 4EPVA 3B7GA 4R2IA 4DDUA 5JSZA 3L43A 4B2PA 3RSOA 3T5GA 1W48A 3CM0A 4G5RA 4KFSA 4XSHA 4ACBA 4BEBA 2QSYA 4Q1CA 3KB2A 1G20E 5G40A 1ZM2A 1J7KA 3B1VA 4LYAA 2JLUA 3T35A 1D6JA 2YWHA 3IQXA 2ZJBA 3KKNA 1OKKA 3H4MA 3T1VA 2WWGA 1XMIA 4Q18A 2ZETA 2Z0MA 4Q9LA 4QHTA 5H70A 4LJ6A 3WBKA 2IS6A 5FOVA 4M9ZA 1P62B 2PCLA 1MV5A 2EVWX 3M4YA 3U4QB 3SDZA 3VR3A 4OQMA 2V7QD 4UJ5A 3P26A 4BFYA 2XJ9A 1Q3HA 3RS3A 2WKPA 2ORIA 3GP8A 4GRAA 5BN3A 2QAGB 1OYWA 2ZS9A 4LPKA 5EXTA 2R65A 1A7JA 4GOXA 4KCGA 3Q72A 4AKHA 5FOTA 1XJQA 4CEIA 2WWYA 4LJ5A 1A1VA 1SXJC 1GDDA 4X8LA 3H2YA 4KSBA 2CNWD 3WRYC 2VP9A 4FI3C 2QI9C 5H8WA 1OJLA 5EP2A 2GDJA 2RAPA 3LBHA 1DVRA 4HLUC 4BLTA 3EG5A 5J47A 2JDID 1RC8A 2O8FB 2YOHA 4UNPA 1MO3A 1HA3A 4FINA 1GKIA 3EPHA 4NCKA 3CRRA 3OF5A 2GBLA 2V1XA 3I92A 4NCHA 1C9KA 3C14C 3IUYA 4YLGA 4QOSA 2JJ1D 4IVPA 3LDAA 4QJ3A 1JJ7A 3BC1A 1IXSB 1F2TB 3K9LA 4Q9KA 1YU9A 1R4AA 3CPJB 1VPLA 4LJ8A 3I32A 1BS1A 1WP9A 5J4KA 4II7A 4BFZA 2PEYA 3HU1A 1KI9A 3X1YA 3WMFA 2D3WA 1G6HA 2FEMA 1MABA 721PA 5HKKD 2ODNA 3CWZA 2C77A 5CK5A 4NYMR 3UK6A 4ABYA 1UJ2A 1IOZA 5J4YA 1VIYA 5E4FA 1VYUA 1SXJB 1DBSA 2BVNA 3V4RA 4ZIRA 4PR0A 4TL6A 3SBEA 2O5VA 2V7QA 4YMUA 1U98A 2ZU0C 1AKYA 3IIKA 1R0WA 1XPRA 1JQJC 2RH5A 3AEZA 1FX0B 2BM0A 2RGDA 3VR4A 2Q3MA 1DAEA 1E2FA 3VX3A 5AR1A 3QXSA 5FUXA 4B44A 4PC1A 3A1UA 4FMCF 3M6AA 5DO9A 2IYYA 3I62A 1YZUA 1PLLA 5TY0A 1AKEA 1FTNA 1OIWA 3RVBA 1B23P 1Z07A 3K70C 2W58A 2CNWA 2YOGA 4HLCA 2CJWA 5JECA 5IRCD 1NNEA 1CJUC 2B7BA 1ZINA 2JDIA 3T15A 4TTPA 1TQ6A 1KK1A 4MRVA 1D9XA 3VR5A 1Z63A 2MMGA 5DHFA 2ZI5A 5FUVA 3U7FB 2UVQA 1SKYE 3ZVNA 4MGYR 1GFIA 1Z29A 5KDDA 5AJYA 2Z6VA 4FCVA 3AUXA 5FI0B 5TXGA 4DDWA 4NDZA 4DB4A 4PO1A 2JJ1A 1VHLA 2PJZA 4LOAA 2J9RA 2QA5A 2A7QA 2FPMA 1QHYA 3X1XA 1ZNZA 1KMQA 5HTKA 2BWJA 1NVVR 3CX8A 5IDVA 3GJ7A 1TF2A 1KDOA 2GXSA 4W5JA 4MRNA 2ZANA 1N5KA 1RFLA 2I3BA 3P4YA 2W2VA 4B47A 5CK4A 2CVFA 4Q9HA 4XSGA 4EUNA 1HTWA 4OI1A 4PO9A 4AK9A 3K70B 1P4SA 1FFHA 1XTSA 3U7EB 4IJMA 4PZYA 2JCSA 4FW9A 1XD2A 1CS4C 1NVVQ 3T34A 1OH8A 2W00A 1J70A 2VTKA 5EP1A 3ADCA 1SVMA 4ERNA 2J41A 4L8GA 5EE5B 4C7OA 4G5SA 2DY1A 5LBIA 3BS4A 1EFTA 2AWOA 3G0HA 4A9AA 2A5FA 4ZKEA 3FDIA 4Q21A 5CITA 1OXXK 3GFPA 3TR5A 4JBXA 1QHGA 1TMKA 1UM8A 3FTQA 4RZXA 1FL9A 3CF6R 3QI2A 2G9NA 1D2MA 2ZITA 3EW9A 1Z47A 4L9SA 1TADA 2ZUBA 2ZRAA 3ADBA 3PEVA 2XEXA 3UWOA 3AGQA 4BLSA 1Q3TA 3IIJA 3G5UA 4ON9A 3WMEA 4EPYA 5FOXA 1H8ED 1E2GA 3ND8A 2QPAA 4M22A 1KO8A 2GZAA 1PLKA 1Q1BA 2CLCX 1UKVY 2OAQ1 3HYTA 2J0QA 3AQ4A 2KBEA 1JJVA 3MLEA 1GIAA 1E2EA 2ZIAA 2ZYTX 4HEJA 4CF7A 2O8BB 1EFRD 4Q4HB 5AJVB 1Q44A 1JEDA 1G7RA 5LD2C 1SVKA 1M74A 1HQYE 2H17A 2OEPA 1F48A 1XZPA 2CLDX 4Q7KA 1Q20A 1QBKC 1XWIA 4C0SA 1CXZA 1NY5A 3EZFA 3U44B 4OHWA 1P6XA 4TYPA 3R9WA 1DEKA 4JZKA 4CGZA 2PMDA 4JMPA 1ANKA 2J5XA 5JJKA 5C18A 3FHTA 3A8TA 4UQOA 4M21A 2J7PD 4V0ME 2X8AA 2DFTA 1R0ZA 1Z5ZA 4CEJA 1IXRC 2ZR7A 1PUJA 1ZCBA 4PZZA 1RVDA 1OB2A 4P4TA 5EJEA 4M4SA 1VG1A 3HR8A 2I4IA 3BH7A 3HU3A 3SYNA 4P31A 4WVFA 2V6JA 4LHVA 3SZRA 3FGNA 4OI4A 4EJSA 4QM6A 3CNNA 2G88A 2XXAB 2WJVA 2GBLC 4MYTA 4GZMA 4PSKA 5BN5A 3K1JA 2Q9CA 4LK2A 5LD2B 2ORVA 3B85A 1MT0A 4KBFA 2QTHA 2XB2A 1PUIA 1H8EA 1GM5A 2IS2A 1DELA 5H1YA 5C46F 4RD0A 4KFTA 5FBQB 4Q7MB 2VF7A 2YOFA 2ZM5A 5L3QB 1X8JA 5AUPB 5FTJA 4WIAA 1R7RA 1N6OA 1EFRA 4QHYA 2R6DA 5EQTA 2QSZA 4TQUS 3U2QA 1RZ3A 3K0AB 3LV8A 1Z6TA 3W5JA 5JEEA 3SNHA 2VL7A 4JLKA 2EYUA 1US8B 1AQUA 4RD3A 1KKMA 4O3MA 4JLMA 1KZ7B 4EPRA 1GZSA 2BV3A 3WNCA 4AI6A 1DARA 1SULA 2WJGA 1IONA 3GLGE 4DSNA 1VCMA 2CL7X 1E0AA 4C0HA 4JSTA 1KSFX 5K8IA 4TLBA 3N2EA 3ZS8A 1JI0A 2ATXA 2ANBA 3RRZA 1ESNA 2NO0A 4DLYA 2J7PA 1DAIA 1KKLA 2R6FA 2NO1A 2VBCA 2V3CC 4HATA 2EFHB 1JAIA 4HB2A 2WOJA 1OH5A 1T0HB 3SQXA 2LWIA 4MKIA 4PC2A 1P60A 1YRBA 4G5QA 4RFVA 1IHUA 1VG8A 4JIMA 4TMTA 2F1IA 3BFVA 2W0SA 4QM7A 3PV0A 3VMFA 3UIEA 3RS2A 2B8TA 3LRPA 4AYTA 1Z06A 4GFDA 3W3ZB 5FPKA 1N2CE 4ACAA 2PLRA 3U7HB 1SXJE 1OF1A 2PEZA 1KSJA 1T3SA 4HB3A 2OSBA 1GUAA 2Z4SA 4NYJR 1KI7A 2ZRMA 5C4MA 1QVAA 1R0YA 3D7MA 3RNLA 4DEYA 4XVQA 4FMCB 1NLFA 2E87A 5EP4A 2QPTA 3F3YA 4PPQA 3TE6A 2V9PA 4LJYA 1II9A 4NONA 1I2MA 1LVGA 3KKPA 4RCYA 4TLCA 3EPKA 1N5LA 3T5DA 2QQ0A 3BXZA 1T6NA 2OV2A 4TQAA 4V03A 3VTKA 5AJZA 3MRSA 1KI6B 4B32A 4M1OA 3NXSA 4GBMA 4MGZR 3LY5A 3ND9A 1U8ZA 1CR1A 4C0AC 3CLVA 1XXHB 3NC0C 4Q19A 2KBFA 1RE0A 2JIZD 2IA5A 4A6PA 4AD8A 4Q4LA 1RW4A 4Y0VA 1GTVA 2CCKA 3GEHA 3IILA 2ODEA 1JQLB 4A4DA 5JI2E 2VHUA 3DO6A 2AXPA 2IEZA 4JL5A 2IF2A 1WCV1 3LQRA 3LVQE 1HUQA 2G77B 3N2IA 4QBHA 5FPHA 4GZLA 1OXUA 1F3OA 3C5HA 1BKDR 4LC0A 5JS7A 4HI0E 3DOFA 2DWOA 2HUPA 2AX4A 4OHZA 1II0A 2IC5A 2Q21A 3K09A 3K0FA 4MRSA 5FL3A 5KDOA 2HT1A 3IO3A 4KITB 3ZYCA 1X3SA 1U8YA 4BFVA 1LV7A 5HPYB 1Q1EA 3WBJA 1AM4D 4TL7A 4F7WA 2GXQA 1LW7A 4RZ3A 3SHFA 2J59A 3CX7A 3WRXC 2JLWA 2FSHA 1G3IA 2F3RA 4AWXA 4IHQA 4NH0A 1N5IA 5A5GA 3GEEA 1HQCA 4ZCMA 1Z0FA 4LV5B 1FP7A 2QM7A 2D74A 3I3SR 3SBDA 3N5CA 4YXWD 4HUQB 2ZE7A 2C95A 3WP0A 5FBRB 4F4CA 1KIMA 2ZAMA 3RWMB 1GL9B 3GFTA 1XTQA 4ESHA 4N0EA 4EFLA 1BMFD 1VDZA 2QGZA 3NBYC 3QNUA 4JVMA 1NMYA 1ZNYA 2IYLD 4TLDA 2W2TA 5JWRA 4AKEA 4TMXA 1AZTA 2Y8EA 4KSCA 3U4QA 1Z3IX 1SXJD 4MDEA 1GKUB 1JR6A 5SZKB 3TQFA 1NN5A 2JIZA 4OI2A 4OJKA 1B0UA 1E94E 2CL6X 2ZROA 4O2RA 4A0GA 4MYUA 2EFDB 4PTLA 3NDBB 5CM8B 4JLNA 3B6EA 4B6FA 4DSUA 2GAAA 2YINC 2DWQA 1CJVC 5DI3B 4QRHA 5SZIA 2A5JA 3OAAD 3H86A 2O8FA 4JLJA 1Z0JA 2OE2A 3LBNA 2ZRJA 2A3RA 3P1JA 4BLRA 1YZGA 3GLIB 4B48A 1XCPA 4FCTA 1D8TA 1T9HA 5EUQB 3FKSA 2P0EA 3QOFA 2GF0A 1TEVA 2GZHA 3LW7A 2ZSEA 1KDPA 4LY6A 1U0JA 4QHSA 1G3RA 1WXQA 4R2HA 1XDBA 3CH4B 4EFNA 4CW7A 1AGRA 3KQLA 4KLNA 2ZSDA 4YXWA 1F2TA 1OV4A 1ZMXA 1CEEA 3MWJA 2FPLA 2R6GA 1CTQA 2VLIA 3HPRA 4QGAA 1JPJA 5AUOB 5IT5A 2PBRA 2GJKA 4UXHA 4JVLA 2G6BA 4A6XA 3EPJA 4DLXA 1P73A 1V43A 1CR4A 1SXJA 5EE3A 3K70D 2PX3A 3LVRE 4XD7D 2BBTA 1K5DA 1OIXA 4A0FA 3VR2A 2ZUDA 1RRFA 4HLUA 4NE2A 5IF9A 2FFQA 1FX0A 4QC2A 4FIDA 2ZQ5A 3AF4A 1W4AA 2REXB 3RRNA 2GTPA 1DO2A 2FX3A 2O8CB 2CHGA 2GK6A 2QMUA 1XTRA 2D2FA 2ANCA 3AV0B 4Y0AA 2XSZD 4A0RA 1W36B 1PJRA 3EWAA 1OXVA 5CIWA 4FN5A 5CB6A 3VX4A 5JRJA 2H16A 5JS8A 4BGDA 5DYGA 1F2UB 2BM1A 1NKSA 3EZ6A 4DLZA 5HE9A 3L0OA 2XITA 2X2EA 4MUBA 4M0LA 3OAAA 3PUVA 4N1AA 2IEYA 3EZ2A 3AP3A 2ZI4A 4YMVA 1LF0A 3BJIC 4HUTA 2OILA 5KSOA 1ZU5A 1G1MA 3X1DA 2HV8A 5JCZA 1RRPA 1G64A 3MUFA 2FPKA 1E79D 4X8MA 3BH0A 4U7DA 2O8DB 2V8OA 1N6LA 5CDFA 3PJRA 4IXMA 1YZKA 5KNCA 1VECA 1O3YA 4M9QA 4QGHA 3NBFA 3LO5A 4US1R 1T91A 2F6RA 3LBIA 1YVDA 1FQJA 2BEJA 4Q7JB 4OQFA 2F1RA 1UAAA 2WM9B 1G7TA 2A78A 2EYQA 4NBSA 3CR7A 2C78A 2WPDD 3QENA 3U5ZB 2YNMA 4MGKR 4IVRA 3ZZ0A 3CNOA 3V00A 1E4YA 1FZQA 1ZU4A 1KY3A 2HXYA 1EX7A 1Z6AA 2OXRA 4XD7A 2GK7A 4MYHA 5E95A 4BPBA 3L8YA 3PEYA 1JNYA 2VQSA 4QG7A 4AG5A 1R6BX 1KI4A 1S1MA 3PUXA 4TYYA 5DE3A 2ZR9A 2GNOA 4PAQA 3UXMA 1U0HC 3NG1A 4PANA 2XSZA 4LHZA 5JCPA 4IOLA 1CKEA 2F3TA 4C0KA 3R8FA 1HH4A 1MH1A 2WIBA 4KLZA 1M34E 2NO6A 3B1ZA 3IO5A 2PT7A 1NVUQ 3VAAA 1JBKA 2HDNB 4WZBE 3TLXA 5CB8A 3HDTA 2QMHA 3MWKA 2GEVA 3KXLA 1JAHA 4DLUA 1OKKD 4NHOA 3TW8B 3TKLA 2X19A 1XZQA 2RGEA 3FKQA 1G5RA 2VP6A 1KMHA 1G7CA 4R9UC 2GF9A 2XTMA 4RY2A 4UXJA 2ZYVX 1NLYA 3TUZC 1W0JD 3A4NA 1MO6A 5EUMA 3AVVA 3BE4A 4MYCA 2WKRA 3FYHA 4DCUA 2J1LA 1RIFA 3KXKA 5FL7D 4GDFA 1O87A 2I1QA 5FR2A 4Q4HA 2V54A 2DFKB 2WVJA 1DE0A 4LBVA 4FMDF 3VHXA 2FFBA 3MD0A 4LJAA 1VG0B 3NDPA 3WYGA 2IK8A 3U44A 4Q48A 4OI0A 3NWJA 1TUEA 2BIFA 2WPDA 4L15A 1UADA 1UKEA 1ZBDA 3EASA 4O2LA 3I8XA 3X1WA 4D4LA 4W9MC 2QAGC 2HT6A 1HT2E 3VU9B 3KKQA 4LSGA 3SEAA 1MO4A 1S9HA 4D26A 5B2ZA 5DHAA 2OT3B 1EWRA 2R8RA 1R0XA 1XF9A 4M2LA 2R44A 2XZLA 4F91B 1E2LA 4XH9B 4JYCA 2XZOA 1K8RA 1FQKA 1Z2AA 2FSFA 2GCOB 2WWIA 4LHYA 1AQYA 2EU8A 3QF4A 4NYIQ 2RGAA 3EA0A 1ZRHA 1GAJA 1ZM4A 1E2HA 1N0UA 1VCOA 2CL0X 1ZM9A 2D62A 2PH1A 1NMZA 2HJGA 1OHHA 1JEEA 5SZJA 2B92A 3EAQA 4RFSB 3KTAB 1G17A 4Q9IA 1OH6A 3FMOB 2Z83A 3K9GA 3O8DA 1W0JA 2KE5A 4JLPA 4Q47A 4RD6A 4Z8YA 4B3CA 3GJ4A 2BBOA 2VHQA 1NG9A 3IQWA 5FL7A 4ZI3A 2OCYC 5L3QA 4GMDA 2AD5A 2ZYUX 4LZZA 3AKDA 2P6UA 1E3MA 2ZS7A 3OHMA 3K0AA 2WHXA 2JJ8A 2CLSA 4DJTA 4B75A 1LFDB 3GJ6A 5KPDA 1US8A 2OFOA 4D4KA 1WF3A 3RYTC 2ERYA 2OHFA 2G83A 1EFCA 4HB4A 4G3XA 4M8NE 4ARZB 3RC3A 3GLIE 2NZJA 3K8YA 1PLJA 3BB3A 3KZ1E 4Q4JB 5FR1A 5HR5A 2O0HA 1U9IC 2ZYWX 1VHTA 4WXRA 3QE0A 3G82C 3AKEA 4UNQA 1E9FA 2VSFA 2EW1A 4QGGA 1Y63A 5DSZA 5AJWA 3A6PC 1N3BA 4RD4A 1N0VC 4KVAA 3PUZA 2P2LA 3QQ5A 5KUTA 3KQUA 2BDTA 4UKDA 3TSOA 4Q1AA 3L0IB 5HE8A 5TARA 2D7DA 3Q85A 3QVUA 4WZ6A 5KDLA 2F1JA 3LNCA 3GJ0A 5GVRA 3QUSA 5UKDA 5J40A 1D9ZA 1KK0A 2EFCB 2OO7A 3AF2A 2WV9A 2QE7D 2QMOA 3QF7A 4Z1MA 1OT3A 1P2SA 1ZW6A 4EFMA 2JATA 2IYXA 2D2EA 2PZGA 1G41A 3NH9A 4DLTA 4D4MA 1DAKA 3BORA 4PX9A 1Z6GA 3BAFA 5BWMA 4DDTA 3SC3A 3QVVA 2IXFA 1G8HA 3PFIA 3AVPA 2RKOA 4DT1B 1TNDA 1DG1G 2OUKA 3PCRB 4MITA 2WBLC 1N6IA 1SHKA 2JLXA 1NLZA 4A2QA 1DPFA 2DR3A 3RSLA 5BXQC 5GVSA 1KI6A 3BBPA 2HXSA 3AH8A 1OIVA 4EDHA 3CX6A 4OK3A 3FFAA 4LPSA 3FMFA 4DKXA 2ZRNA 4RKFA 3NBXX 3QPVA 5JJIA 2H1LA 4FWIB 4JBWA 4DLRA 2ZE5A 1KAGA 3A1SA 5FOUA 3TR0A 3SJAA 3KUCA 3QXHA 3AB3A 4LBZA 2YWFA 3AVYA 2ZJZA 3WY9A 4CEHA 2C96A 5AUNB 1MRNA 3MCAA 3AF0A 2C8VA 4P4SB 5LB2A 2MSCB 2GJSA 4M1WA 1E9RA 1OPXA 3A4MA 3KJHA 3I1FA 1CBUA 4ASUD 1FUKA 1VMAA 2FE4A 4LJ4A 4CDGA 2NO9A 1T3LA 4O25A 3AVOA 3BERA 3EC2A 4QJ5A 5JZVA 1XJ0A 2ZS8A 1XEXA 2QE7A 1M7HA 2FJUA 2EFGA 2UZ3A 3IIMA 3SJCA 1TU3A 4AIIA 1Z08A 2BHRA 1VCIA 5BW8A 2DB3A 3FVQA 4FXPA 1I4TD 3MJHA 3SN6A 2GJ9A 2J0SA 3BFKA 3ZVLA 5FTMA 5DYIA 4HUQA 2ZREA 4YMSA 3T1OA 3C4JA 2QENA 2QBYB 1DAGA 3KX2A 5B64A 1Z22A 2A2ZA 3TBKA 2AFHE 1W5TA 5FH9A 1E2PA 2BC9A 1KOFA 2ZU6A 4GMXA 3W34A 5KNBA 3SS8A 2I1VB 1II8A 1IM2A 3R9IA 4ZCLA 2QTVB 3OIUA 4E22A 2Q9AA 2P5SA 3UKDA 2DYKA 3I5XA 2W6ID 2IUTA 2XTZA 3ZVRA 1GG2A 2F55A 3D3QA 3THOA 4DIEA 4I81A 3GJXC 1UEIA 2Q3HA 4ITRC 3I4LA 1IBRA 3QG1A 3GLHE 1NP6A 3F8TA 4TTRA 2XTNA 1WQ1R 4FMDB 4I99A 1HT1E 2NPIA 1NSFA 3CZPA 4JJKA 5DI3A 3WXMA 4OYHA 3QXJA 4ASUA 4EPXA 3KJEA 3GLIA 1JB1A 1AS3A 2ODBA 4E5UA 1D2EA 4D80A 3QXXA 3RS0A 4LC1A 4IFEA 4U02A 1GRQA 1ZD9A 5A0FA 5J4VA 2ZPTX 1KDRA 4C2UA 3DM9B 1KO4A 3L2OB 4BEJA 1DS6A 2C98A 1ELOA 1OFHA 4TT3D 4ESVA 1QHSA 4RZ2A 5CM9C 1S2MA 2F9LA 5GJWC 4TQ9A 2CCJA 1ZUIA 3UANA 4AG6A 3I61A 3CO5A 3FMPB 2GAOA 3FFBA 2Q3FA 3VKHA 3KFVA 4YDHB 1N6KA 4HLDA 2WAYA 1NBMD 1J99A 1IXZA 4XWAA 1XJCA 2G1KA 2JEOA 4IEIA 4OK6A 2GA8A 2W6IA 3FE2A 4HZUB 2W0MA 3OEHD 2YC2C 1S3SA 1FPMA 2WJYA 3NBZC 4ZI2A 4MGIR 4ILEA 4A0HA 1M1YE 4WA7A 2H92A 1S4QA 5E7MA 4EPWA 5ELXA 1OE0A 4GT1A 4A8JB 2IBMA 1JXMA 3AVXA 2GVZC 2C03A 1F2UA 1U8AA 2CDNA 2QEQA 5JBQA 3EC1A 1BIFA 2CMKA 2JJ2D 3WHKA 2WICA 5KSZA 1N6NA 3C7KA 2H7VA 4C0JA 1E0KA 1I2DA 3L8ZA 1K6MA 1KNXA 4AC9A 1MRSA 4DLWA 4NPHA 2HLDD 3KDSE 3IEUA 5AJXA 4KV9A 4NCIA 2IYTA 2VH5R 1F5NA 3ZIAD 1W4RA 3NIBA 3PG5A 1IAQA 3AF3A 1LF5A 1R2QA 1KI8A 2MSEB 2N42A 3FMIA 4PAMA 4TT3A 3W8NA 1GL7A 1Q1QA 3I72A 5A4JA 1BH2A 3C16C 3TK1A 3CRMA 3Q5DA 3GPLA 1VG9B 3A4LA 2V55B 3P27A 3OIVA 2RGCA 4X8OA 4IOKA 2N1BA 1E6CA 1TU4A 2ZRBA 2D4HA 1OW3B 4V0KA 1OYYA 2W2XA 1HE1C 4LHXA 3CF0A 3TRFA 2X1VA 3OZXA 3S1AB 1RYHA 4TYQA 1NBMA 3AP1A 4BQSA 4C0BA 2HYIC 3TAUA 2IXGA 4YQFA 3OEHA 1HYQA 1TPZA 5FUWA 2RGXA 5TVKA 3UATA 4F93B 3U3OA 3EPLA 1J90A 3Q9LA 2BEKA 4XJXA 1NIJA 3CWQA 3DKPA 4URVR 4YMWA 2NIPA 4TZ6A 1U81A 4TMKA 1CULC 4IRUB 3U6BA 1WE2A 5P21A 2FN4A 3CF2A 1RRGA 2JJ2A 3HYRA 2O8EB 1YR9A 2GEDA 4AKIA 3AKCA 4Q1DA 3B82A 4FWTA 3SQWA 2HLDA 4I1UA 4WW0A 2QP4A 4D6PA 1MABB 1N6HA 1EX6A 3ZIAA 3KJIA 5EZ5A 1N6PA 1WMSA 1T8TA 1G9XA 1K5GA 3ICQB 4ZV4A 3BGWA 3LAWA 1DAFA 2GVDC 3GLHA 2FGKA 2QORA 3ASZA 1E98A 2CK3D 3B13B 1T0JB 3EIQA 2G1JA 1G4AE 2MSDB 1ODFA 3GD7A 3KJGA 4PC3A 2BKUA 1X1SA 4HDOB 4UNNA 2ZJOA 1MR3F 1KHTA 2QP9X 4BLOA 5CDFE 5HCNA 1XFAA 2QUZA 1NSTA 4M1SA 2QU8A 3LW8A 1YKSA 5M04A 1KAOA 1LTQA 4DHEA 1L4UA 4Z54A 2C9CA 4NCJA 2ZJ2A 2EQBA 4Q4AB 4MRPA 3OE7D 3QJYA 3KB1A 1E2IA 1G18A 3TGPA 4B76A 2A9KA 3AUYA 2ZI3A 1Z0DA 3AVQA 3FKSD 1Q21A 1UBGA 1TL7C 1GNPA 3U3KA 4J0QA 1R5BA 1NIPA 2AR7A 4RD2A 2P6NA 4IDNA 1NN3A 2GETA 4B2LA 3MAAC 3FWYA 1XTIA 2GRJA 4KODA 4EAQA 1E4VA 2YKGA 5EE9A 2YVUA 3BFXA 3O8BA 1W46A 2W83A 2ZI7A 2R6AA 2VHJA 2RGNC 3WP1B 1GVNB 2L0XA 5CIQA 1DAMA 4RFSA 3KTAA 4KFUA 3D6TB 3D31A 3PQCA 2RHDA 1R8QA 4LGMA 4IOMA 2W6JD 1ZIOA 2LKDA 4UXIA 4CT4B 4OBEA 2CK3A 4B3FX 4GP6A 2J3EA 2ONJA 2QAGA 4DRZA 4LWZA 4ZDKA 3J81k 1VKJA 5E7JA 1TX4B 3DKVA 4IDPA 4YC7A 1VIAA 1GNRA 1Z6XA 2VF8A 1ZD8A 3H1TA 3EX7C 1AIPA 1G5TA 2XOKD 2Q0HA
chains in the Genus database with same CATH superfamily
1R0BA 3M9WA 1DKRA 4G8DA 2ORWA 1YZTA 3H8WA 4RPGA 4M0CA 3EH1A 4R8SA 4S2UA 5I8WA 5A5DA 4DJFC 2BONA 3FOFC 4DCSA 4MHSA 3E0QA 1ZGCA 2HK7A 1Z0AA 4YT5A 2QN1A 1QZTA 3GNLA 4REMA 2EIHA 3JVVA 3R3ZA 1MBZA 4Q66C 4J1QA 4PXSA 1ZI6A 3UW3A 4I1SA 4JJGA 3RYHB 2UU9B 4PE5B 2ZBGA 4NFSA 5AH0A 4CCWA 1W7AA 1BN6A 1O89A 5D8DA 1R1DA 2GN4A 3U1VA 3OY7A 2XCTB 2LV8A 1BE6A 1FNMA 1RVV1 2FPIB 2VXCA 2Y68A 3AEXA 3FF4A 4QDTA 5DTIA 3RC7A 5JC1A 5KPJA 4DV6B 4D9HA 2ORED 1OFUA 4MR7B 2OM6A 1QG2A 1U7OA 1BOOA 5CNMA 1CIVA 1RQPA 4HNUA 1IUPA 2VPQA 1NXVA 2ZIXA 1KO1A 4RCZA 4XFDA 3K6JA 5FPPA 3SD7A 4C89A 4G81A 3OA0A 3PUHA 4RYDA 3E7PA 4BE7B 1OILA 2DWPA 2HMYB 4EQ6B 1CY0A 3H1BA 4XR4A 4EL5A 2XBLA 2JGDA 3E8MA 4GIBA 3AM1A 3CLUC 1M2WA 2PWBA 1HLPA 3KFXA 2H5JA 4U0KA 1HI9A 2B8EA 1EFVB 4G0NA 3I0ZA 1G5IA 2BCJQ 1W34A 2PT5A 1PYOA 2YY5A 2JFYA 3KWJA 2GF2A 1T4GA 3AY7A 4ZEWA 1E1CA 1N4DA 2G40A 4UUBA 5E2AA 3TL3A 2XOKA 1SCKA 2Q4BA 3SK0A 3QFRA 1CDZA 4K81B 5BSUA 3SKYA 1CNFA 2AN5A 1JKFA 3BSYA 3OTOB 1EK2A 2XYRA 1UOEA 3GRPA 3NDIA 1G8AA 1E6UA 1PVDA 1LVHA 3A31A 3CPHA 3OQ6A 4KU4A 1WLSA 4OXKA 3ZDCA 3GGDA 1CS0A 1Y37A 3N76A 1NL3A 4I4LA 5DW3A 5AWFC 3W04A 1DG9A 1X8KA 2A0FA 2YYYA 4L51A 5EEHA 2V4ZA 3WADA 1PNVA 1T36A 1W2WB 2O0KA 4WERA 4OHPA 4RTMA 3HPQA 3EQZA 5B30A 3MWLA 3HJTA 4L4YA 3S2FA 4Z1OA 3THXB 1Q5PA 4ISBA 4BNYA 1KFBB 4YMIA 4CDMA 3CNLA 1JG3A 1TKAA 4OMCA 1DL5A 2Q49A 2JI7A 1DO0A 5IC5A 4MH0R 3ESAA 3OX4A 3VYRB 5DBEX 3SFVA 4V0LA 5FOWA 3H5IA 2BMJA 3PRKE 2DLCX 1JEAA 1GCUA 3ZDXB 3SYLA 1G6OA 1NKTA 2WJ4A 3A9RA 2XRFA 1IQRA 3TGLA 1H6AA 1DI0A 4UBMA 3U7IA 3SIPA 1ZCJA 1UPXA 4Q5IA 3IXMA 5TPZD 4RJTA 4G1BA 5EI5A 1EFUA 4EH1A 4QJ4A 2C57A 2J33A 3DVQX 4UTRA 3NW9A 3D5EA 4M1MA 2JASA 2Y05A 4DLVA 1U7UA 3KHKA 4ZTBA 1NW8A 2JH3A 2BFWA 1P7WA 3PFWO 4YRDA 1YA4A 3EGDA 3NDRA 3WL6A 1Z16A 3ICEA 1QDUA 1SBCA 5DLQC 1P5RA 4RKEA 2GDZA 2PQ6A 3H0KA 1KI3A 5L40A 1G5PA 4LCJA 2P2DA 1E1QA 5L4NA 4BC0A 1V6CA 1PFVA 2OLJA 2FOLA 4I9UA 1W52X 1EBUA 4P4LA 4YAJA 3OEED 3RAFC 2DPMA 4URWR 4RNDB 4C4YA 3EXAA 3DCYA 1Z6QA 1DV2A 1QHHB 1T8PA 4BMPB 1X1EA 3LSYA 1XVUA 1RWOA 5ICSA 4N6OA 3CKKA 3E9NA 4OH7A 3ZCXA 1KXJA 3OVMA 3ZK7A 4E14A 4DCTA 2PBZA 5HKOA 1IE3A 5J23A 3ZJUA 1LBTA 3CR3C 5CA0A 3TUJC 4PU0A 2B35A 3E9CA 1M2VA 1VJ5A 2WDPA 3HACA 3D7LA 3TVTA 1BS9A 2Q5EA 3ZDQA 1K8QA 4YRAA 2OUIA 1GDTA 3GXBA 1RLUA 4BX2A 4TZ0A 2IJGX 1HNWB 4GNKA 3EXEB 1OXTA 4OSEA 5ALTA 3QKRB 4I50F 2B6HA 4JLBA 4PG5A 3U9LA 1H2EA 2OYSA 2QTWB 1SOMA 4HY3A 4MI9A 5GM2A 2O8BA 1FFYA 3N0WA 3A4YA 2BFCA 4MVJH 4U2EA 2TMDA 2ZI9A 3RT9A 3JQEA 1HYEA 4W7SA 4CYMA 5BYAA 4ZDIA 1KR2A 4X00A 3K5PA 1NI4B 1TM2A 3HA3A 3X1XA 3THWB 1G6Q1 2FPXA 3DZ8A 3W8RA 421PA 3JRNA 1K2WA 1NBWB 1NVTA 2DBQA 4F3CA 1YR8A 2F8SA 4XVCA 1KMNA 2WF5A 3UHOA 2R79A 3QOWA 1UP7A 1WD5A 2YHIA 4NESA 4NP6A 4HN4B 1JMYA 1TYCA 2E4YA 4QYIB 2Z2JA 4KR9A 4JLUA 4URXR 4I6GA 4B3JA 1COWA 4RSHA 4C3UA 1ISJA 1K92A 1GKKA 4DXDA 2ZI6A 3MFYA 3HRIA 5BMVA 1Z8FA 2OCPA 3MCUA 3VOAA 3OZSA 2Z8ZA 3PI6A 1Z83A 2ZB2A 4YAEA 1LLQA 2CN1A 1OASA 2PLNA 4GI3A 3Q3GE 4O1MA 2I5PO 4PPFA 1RWXA 4FYYA 5A4FS 3M6MD 4X66B 1MHPA 1ZK3A 3KQSA 2YYZA 1DINA 2ACEA 1IU9A 2CDBA 3AJ8A 3ANYB 3DBRA 3HA7A 3N70A 3O8LA 4JCOA 4NEQA 1PV4A 3K32A 1IEWA 4LUCA 4C4ZA 4HZUA 3WOHA 3HLYA 2C59A 2P75A 4D3DA 5JNSA 4URUR 1NXTA 1I4LD 5DHTA 1A3CA 3EZLA 4INJA 5FBLB 1TZMA 3WNZA 2BBWA 3W1WA 2YCBA 4CV2A 4Z5XA 1AQNA 3T52A 1YB1A 4L4UA 4K9QA 4MLZA 1XTJA 3N8KA 4G07A 3AMVA 4BZQA 1JDSA 2UAGA 3CTPA 4HV4A 1JXQA 3D5QA 6GPBA 5BOSB 4YLEA 4PNZA 1J8QA 1QVVA 1Y98A 4MW0A 3HB5X 4RVCA 2ZUSA 4L6CA 1H93A 4KGZA 5EIBC 4WZAE 3KAJA 5B57C 4LXGA 1YCGA 2WZCA 1H66A 4JR1A 2VHTA 4N54A 1FP2A 1U0RA 2PGNA 3HP4A 3UUWA 1THGA 3QRWA 4E5SA 5F7OA 3QEMA 5FWNA 4RD1A 4ZVQA 1L5YA 1Q0UA 5G41A 3W2FA 3BICA 4IZ6A 2SKEA 1L8XA 2Q3LA 1LPPA 3MG9A 4NBWA 3AVUA 1VXOA 1GCOA 2IDMA 2PD3A 5A4MS 1PW7A 3GT3A 4NXNB 4FOLA 1X15A 3QJGA 5DN6D 2JCVA 5DM70 1PX2A 4U3JA 6Q21A 4HD8A 2X3YA 3HB9A 4XW2A 3TMYA 3OEYA 3W6NA 3BWCA 3ZGNA 4RANA 1O94D 3LVBA 9ATCA 1GNQA 3T3MB 4URZR 1XMVA 3OT4A 1PVOA 3SVTA 4ZYWA 1L4LA 2WSSA 5L3VA 4LXXA 4XGKA 4GBGA 3HWSA 1DRWA 1W9HA 1VE9A 5A62A 1NVDA 2H1SA 2BGTA 2OV1A 3FNIA 4DQXA 3O2JA 2HMAA 1F6BA 4CQLB 1T29A 2EP8A 3ECAA 4OFBA 4NKRA 4UHCA 5LQDA 1G8FA 5DGXA 1BGVA 2NAFA 4XTRA 3UQZA 4DF3A 3RYCB 1BQ3A 1XKQA 2CKDA 3IR5A 5LMUB 4QQ8A 1BWRA 1PR2A 2W6ZA 1L5SA 2XYHA 3FLAA 4TGLA 5CYPA 1K7SN 2JGJA 4M9XA 1C8KA 1TTTA 1GRVA 4RVUA 1WD7A 1E1NA 3Q5GA 4AUEA 3SSNA 4KPGA 2JH8A 3D6VA 5JZ9A 4S1TA 3T1NA 3C8UA 3U49A 2LKCA 3DOUA 2OQVA 2H2AA 2EZTA 2QVCA 3ISTA 1W5AA 5EZYF 1E1KA 3WK7A 1PJAA 2OD7A 4M0PA 4PO3X 4EVSA 1V47A 3GO4A 1Q0LA 4RC9A 2CEAA 2C8LA 1RQLA 3CCFA 2QL6A 1E1YA 2PX4A 3KLOA 1J4AA 2O4UX 4H9GA 4QRIA 5PGMA 4IEFB 3EF3A 4C0LA 3FOBA 3U62A 5BT9A 1H85A 4FQ8A 3CFYA 3DOIA 2MR5A 1XCOA 5CH3A 2C99A 1JSZA 2PPVA 5BN4A 1SHJA 3PD1A 1NUSA 1Z45A 3JZAA 5ALSA 1I7SB 1EXDA 1XXHA 1W8DA 3X0DA 1X7YA 3M4JA 4RACA 3W6OA 4H7HA 4ZOQI 5IKXA 1D2GA 3WB9A 2EC5A 1KMIY 3I9NA 2D5LA 4DC0A 5FA6A 2QPLA 4QQNA 4HWKA 1GL6A 2IT1A 4IR7A 1ZMOA 1PTJC 5HRCA 4YBRA 4EJ6A 5B4UA 2AOTA 3BIOA 1XU4A 3LQQA 3SQNA 4CZ2A 2AYYA 1NN0A 3SC2A 1RYBA 2IYSA 1KFCB 1R37A 1RJGA 3A36A 1XZ8A 3BMXA 4KZPA 3D6UA 2EF0A 4N76A 2OPHA 4D9KA 1XK6A 2FSVC 2F1HA 3DPUA 4JL8A 4ZPXA 4JOCA 2PKCA 5T67A 4C7KA 4TZKA 5ITVA 4Y1RB 1CQIA 3QPUA 2PKEA 1RPZA 2XNHA 1Z2NX 3SP1A 2CXOA 2WUDA 2V4UA 2NU8A 4HQNA 4D9NA 4F5WA 5IBPA 1YNSA 3QTBA 1VL5A 4F92B 1CQZA 1VRCA 3QWIA 3WK4A 3OU2A 4OHXA 3FF1A 5JEDA 5D1HA 5H16A 1E2QA 3FNEA 4AJ1A 4IHJB 4QOHA 5LP6B 2DUJA 3AOEC 1LBEA 4E1VA 4ML3A 4Y0NA 2ZE6A 2YXNA 3C7AA 4QTTB 4IZOA 1NRJB 4S35A 4ZANA 3WYNA 4PG8A 5SY9A 1ZXBA 3CUEF 5G0VA 4D8VA 4LF8B 3NIGB 1GKYA 4HH4A 4B4DA 5EPEA 1Q0QA 3WGMA 5B4TA 4NOJA 2Q6LA 2XYVA 1AUPA 1BO6A 2GFHA 1N5JA 1EDZA 1EQ2A 3RANA 3ZHYA 1CNMA 1EVLA 1PR6A 1R15A 2V7XA 2ZRHA 1Y0BA 3CW8X 5GGXA 5K8UA 3EDOA 3KU4A 1A97A 2HRQA 3VR6H 3PR2B 3WYAA 1AUXA 2DFNA 4BASA 4EHIA 3H0CA 3TKYA 3I6YA 1MHTA 1F8FA 1VXRA 2ORYA 2OVFA 3I8SA 4MZXA 3Q8LA 1B16A 2JCXA 3HJNA 1DAHA 1A2BA 2A5LA 1QCDA 1V4NA 4TMVA 5DK4A 1O9GA 1IZ0A 1JDJA 5JUWA 1G8PA 1KS9A 2YY7A 1R18A 2IBTA 2F43B 5CCXA 3KKOA 3NHAA 1G21E 4MV3A 4HDSB 4CKCA 4OAQA 3KQHA 5C2JB 1BC5A 1W36D 1U3TA 2JK0A 4O63O 3KYCA 3DYIA 3PGVA 4PIVA 3WLQA 4JB3A 4FIZA 4C0QC 4X44A 2H51A 4R71A 3BOSA 3OJEA 3VQTA 2E6UX 2H08A 2PX2A 4WLUA 1MU0A 1Q1AA 3W6ZA 1K7YA 3AILA 4AUNA 5C80A 4N40A 5H9WA 5JSUA 4CRWB 3TOVA 2XGOA 4JU8A 2ID8A 2A5GA 2P8JA 4OHRA 2GN2A 2J0UB 3DDNA 2FGJA 3AEUA 2FQ1A 3IVGA 4G5HA 4GD3Q 1I7DA 1HYBA 3CE9A 4O4JA 4V3BA 4D57A 1Z0UA 3FOEC 4GPTA 4JGGA 4J2HA 5CVDA 3BQNB 4QL3A 2CCGA 3H5NA 3SBOA 3LWNA 3K1YA 5JSYA 2HK6A 4TMWA 5EJIA 2VK8A 6NULA 3O3CA 2IYVA 3SHOA 1NOJA 2XMCA 2ODWA 3DT6A 4NU0A 4OOFA 1FFDA 2D5IA 1ECGA 3LECA 1L7NA 3CSDA 1R00A 1UFOA 2TS1A 4LCBA 4PXAA 1YDFA 3HRKA 3ZXSA 2QG9A 4W8GA 3SYMA 3H6GA 3GLFB 1DJMA 5EGNA 1Z25A 5KU1A 2VYFA 1SVIA 1PAUA 4GVXA 3FVWA 3HKCA 2VZ9A 4DIBA 1KP2A 4OUDB 5DXJA 621PA 2VOJA 4L5CA 1YQGA 2JKZA 4GLJA 1U2GA 1USVA 1RT9A 2QPOA 2Y2VA 1NW5A 2ZVQX 3C7CB 4DLKA 3H17A 1PL6A 4JLAA 1K98A 2DBZA 1YNOA 4JBGA 4LDRA 2RGRA 3EQ9A 1LDMA 1ZI9A 2PFGA 2V8BA 1ZNXA 1B1AA 1U7PA 1PJSA 3ENVA 1GOTA 2PMFA 4HRXA 3OQPA 5DLPA 3JS5A 1PZNA 2GJ8A 3R7AA 3VH2A 2CXNA 3VPXA 4D0GA 1NUPA 3WAJA 5LJLA 1W5SA 3TLJA 1MDBA 4Y6PA 1C7QA 2XA1A 3EZ9A 3F7MA 5D3QA 3T61A 2IYQA 2NUTB 5BSGA 1W35A 4P34A 4JVSB 1R9JA 5DI9A 1U0LA 3UAYA 1XCLA 1YK1A 3QF4B 2IEAA 1DAOA 2AZTA 3LX4A 3LHDA 3EY9A 3SNKA 3UN1A 4DUGD 2POQX 1F0NA 1WW2A 4DM7A 1FFGA 1C9YA 2Z3VA 2DFLA 2A9RA 2J8ZA 1HO3A 2RCNA 3N6XA 2IV3A 5BRNA 1G98A 1W59A 3U5TA 1W2GA 4BMDA 5HM6A 4KXUA 2OLEA 4HWTA 4BLQA 5IUKC 4TSFA 1QE5A 5DCYA 3GRFA 1U6KA 2YXBA 2P6MA 3ETLA 3KXDA 1YS9A 4KQ9A 4XM0A 5L8VA 3VHRA 2QVLA 3H2KA 4QUIA 4KR3A 1XNGA 3AVWA 3TKAA 2ZYSA 3R20A 1N7HA 2O2SA 2EWMA 4K26A 2JG3A 4BFLA 1NMQA 2C07A 1D5CA 1ODKA 5D87A 3HNRA 1OXKB 4B9AA 4FDTA 6CHYA 4K3VA 3QBJA 3RB8A 4DCNA 5ICCA 5F9HA 4ENPA 4EMTA 1S8AA 4G0UA 2NXCA 3RFXA 1IY1A 2JW5A 5JWHA 5EVCA 4ZVNA 3CUVA 3MCVA 2L82A 2R8YA 5E6RA 4HNGA 3KZVA 5F1PA 4F1KA 2ZIZA 5K0SA 2DOKA 3BM5A 3EVCA 3HLKA 1M54A 2I66A 5C5EA 5KWVA 4H3HB 3THSA 2E5LB 3QX3A 2NP6A 1QUFA 2ZXUA 2A5DA 1SVLA 2YWEA 1E96A 4RK6A 3RRBA 1EVQA 2BUCA 4FZ5A 3T9EA 3VZDA 1XCMA 1E2MA 4EGSA 4DDVA 2OA0A 3SQMA 3IAXA 3ZD7A 2AXNA 2FTKE 3U4CA 4HZIA 4P1ZA 4DV0B 4IOJA 3LZ6A 4Y2XA 5CD1A 3I6ZA 1VB3A 4QFMA 2HHAA 2WABA 2ZBVA 1JN0A 3CC8A 1V5GA 3TE7A 1L6RA 1ZUNA 2DBRA 2FUNB 2XX3A 3B5EA 1NQTA 3MTJA 3Q7PA 4UFOA 4KFRA 3L4EA 4MQEA 5G1NA 3WXBA 5K0FA 2VRNA 4IAOA 3DL0A 3W6UA 3ZC3A 3IJEB 4J07A 2QOEA 1FFSA 3VNQA 1PT5A 3D9QX 3FYUA 2DH6A 5ALWA 4O1HA 3ZGXA 1GYQA 5JNVA 3BZUA 2G71A 3THRA 1XTVA 1XA0A 1OWNA 3ZY4A 1XZMA 3M8KA 1CLUA 5DISB 3GFRA 3IP3A 1FTQA 1QHEA 2CNBA 4AO8A 1VA4A 3QEBZ 2EKLA 2ZAIA 3G6KA 3GVXA 3PITA 3KKMA 1WUHS 2XQGA 4HSEA 2HJRA 4XEHA 5FBKA 5B3JA 5BQ5A 1OTYA 1L2TA 5A3JA 1XNQB 1V45E 2ZWAA 3RKSA 2RAVA 3A6FA 4OYLA 1UK9A 3PWSA 4V0OA 5A6SA 3SFTA 4YALA 2H0QA 3BBLA 3EIEA 4D97A 3I9JA 3W78A 2XD9A 5CAEA 5JCOA 2O8FB 5GADl 1AUVA 3K30A 1DLIA 3GYBA 4P0TA 1T1RA 3WB0A 3GGCA 4EVIA 3CLKA 3OLQA 5E1DA 4N5NA 4Z4CA 1Z6YA 2RGGA 4YACA 4N0PA 3SS9X 3KSAC 3QSYA 4F3KA 2OECA 4EI2A 3IOEA 1KDTA 4L6AA 3VU9A 5A0VA 3LOQA 2AKEA 1LX7A 4F8EA 2Q6TA 4MKGA 4BFSA 1IHPA 1UDRA 2XY4A 4HYYA 1G59A 1C1XA 3GF4A 2QNBA 4Y9DA 2NYVA 1K3TA 4ZODA 5L45A 2XHEA 3JQQA 4OU5A 4CTKA 3T5PA 1HSZA 1OJ7A 1AB6A 3DBLB 2QSUA 4Z4HA 4MW5A 3ZH9B 5L3SA 1PHPA 4D82A 2A5YB 2GCOA 3KNZA 1A9PA 3T7KA 5BXYA 3C15C 5DM4A 3ECCA 3CG0A 1R10A 1OZ0A 1H0RA 1ENYA 2JD1A 3USZA 1DNPA 4D8XA 1V16B 1EQUA 1NXWA 1G291 2QXTA 2X5NA 3DTYA 4OJNA 3AETB 1ECJA 4XIGS 4G01B 4O0MA 1SXHA 1WEKA 3BL6A 4RZUA 1GQSA 2RJ3A 3OZIA 4XDYA 2X7JA 4IDAA 3SG0A 3G2NA 2F3SA 2Q4RA 4C7XA 2ZTSA 1T4BA 3R7SA 4C9BA 2XMBA 3L0SA 4L0MA 4QGBA 5B7NA 1KVSA 3FNFA 3ICPA 2R66A 4EB3A 3UJHA 4E7OA 1QSGA 2GM9A 5TV2A 2LVBA 4MRMB 1I3KA 4CJXA 3ASUA 4DFDA 3BWDD 1E3DA 4LRTB 1H4QA 4W5WA 2YWDA 1EBBA 3LCMA 4C4XA 2M98A 1TJNA 1SFRA 2GJAA 2ZRPA 3RBVA 2JGFA 4R8KA 2R47A 1BW9A 2QN6A 1RXVA 2YV5A 4RMHA 2VA8A 4FYJA 4LOKA 3CISA 3ORRA 5JS1A 3L0BA 1C9EA 3CXUA 5TQ0A 4P33A 1HDRA 2AJTA 4KLCA 1G42A 1DUIA 1O54A 2BR3A 1QH1B 4L4RA 3FVTA 4LYFA 4DYDA 1CLEA 1T5LA 1WUJS 3W90A 1S96A 2CMGA 3O8QA 4XPZA 2GXUA 4D92A 2XZTA 1JDVA 4L7VA 1T3HA 1MKYA 2X0IA 2VVTA 1II8B 2D13A 1ORTA 1X1AA 3JZMA 4LN1A 3TZBA 1RWVA 2WU1A 5F5LA 5DNEA 1PWHA 2HQ1A 3MCZA 2AHOA 5DKFA 3O0TA 1OLUB 2FSPA 1IHYA 4NNJA 3RSQA 1SBIA 1UMCB 3DB2A 4DGSA 4W1PA 1QOPB 3EUAA 4H31A 1T0IA 1V1MB 1YJ8A 4TTIA 4F7WA 4QT4A 4RTSA 3I37X 3EGXB 3QKTA 5JJ5A 2FXVA 4ROTA 1KVUA 3DGEC 4EJSC 1I1OA 2JD0A 1IBSA 2QQGA 3EEBA 1M8JA 4G56A 3LK6A 2AG8A 4G1CA 4MSUA 3ZDZB 4HAZA 5BUZA 3NRJA 4OLHA 4MX8A 3EIUA 4P5PA 1YB4A 4Y2UA 1AUOA 3C74A 1I01A 3L1JA 4MCHA 1SVSA 4AYWA 4YMTA 5L9AA 4WZZA 4BFCA 1TO6A 1JEYB 2VDLB 2IIVA 3SX4A 4WKGA 1B8OA 3R4VA 2D8MA 2O59A 4LF9B 1JU3A 1WM1A 5B58C 2VJLA 2FDCA 2I1WA 2ISCA 3H9QA 2EL7A 3K96A 1NJ8A 2PH7A 3CNEA 2WHPA 3ADOA 3H1GA 3ZI0A 3GDWA 2WHQA 4P3NA 4ZVLA 1DMSA 4AQ7A 1R27A 1ZQ1A 3ABIA 5K0LA 2FFJA 1Y6RA 3OIFA 4DT1A 1U2PA 3CW2A 3H9JA 3KL4A 1N3IA 1AMNA 5FOSA 5CVTA 4FSHA 3TAXA 2W4QA 3KR0A 3VVCA 2HPHA 3F5SA 1BMFA 2VFAA 3A1VA 3R77A 4N3AA 5FLYA 4Z7OB 4XWGA 4CEJB 1JHPA 4AJPA 2IWRA 4Q3KA 5FTKA 3DL4A 3IBGA 3REFA 2CB9A 2XB4A 1N2CA 5T4EA 4BUJA 4IVNA 1LB1B 1XTTA 3EWSA 3DMTC 1YH3A 4M1ZA 4YTEA 2H8GA 1VIMA 4FILA 1CFZA 4LV8B 2J3JA 2QJFA 1L5LA 2FFAA 5KYWB 4IV5A 4KIWA 5HRAA 4PZLA 1QC5B 3TPZA 5C35A 3JYHA 3TLZA 5K6RA 1SOUA 3LT5A 5C0OE 1QLWA 3ZU5A 3U6KA 3JYQA 3ZLVA 2OXCA 4RVOA 1PI3A 2QJOA 3V1MA 1R8YA 4BC1A 4P4SA 4NJMB 3NGXA 1W47A 1Z7GA 3LSTA 4U2GA 1B00A 1YBVA 1V8OA 2WIKA 3HDVA 1UBEA 1GRRA 4D2IA 5C31A 3RJTA 4QEDA 2QU7A 3BILA 3BMNB 2OP0A 3KJQA 3UAXA 5BRAA 2VQFB 3HL4A 3W4JA 4WE3A 4D9IA 1XNHA 1ES9A 3O47A 1JG4A 2PYIA 3N2ZB 3VHLB 3AIIA 3F1KA 3QYFA 5HIKA 1T8UA 1JFFB 5HJ7A 1XRJA 4NHEA 2ICAA 3WLOA 1X8LA 4G97A 4XUDA 2H57A 1N4AA 4CLEA 3NHUA 3MWDB 3IUNA 2WMNB 3SYTA 3RFFA 2HCTA 4DEXA 1FSGA 1E2NA 1RR6A 4BNTA 4XGRA 3IKTA 4IM7A 1C1YA 3CLTC 2W5UA 1UFQA 1XDSA 4O2AB 4XTCS 1YBMA 5CB4B 2G72A 3OWHA 4B73A 1ZYUA 3BRWD 2UUBB 2BOVA 4B6EA 2Z8YM 4LVCA 4UHFA 1IOVA 1KFEB 2DHCA 4O08A 1XLUA 1OYOA 4DVJA 2EX0A 4PYJA 3FZYA 1G8GA 1LQUA 3EF1A 5TB5A 2JL1A 4U00A 3T9BA 3IMCA 5AW5A 4I4IA 3TL6A 5LZ4A 5DTJA 5H3HA 5F73A 5F51A 1TQHA 4B83A 1ZJ6A 1PTJA 1BX0A 2PIAA 1R6UA 2Q8QA 1WDLA 3FCEA 3Q3EA 3LE8A 3V3KA 4ARVA 1JQ3A 1GP2A 5DRTA 4F06A 1WY5A 4LY0A 1Y3FE 1Q22A 2EZ8A 2AZMA 2B3TA 3CEHA 4CM8B 7YASA 5LZ2A 1NUTA 3B1XA 3Q2KA 1H9CA 1BDJA 1S9DA 1QBGA 1E7WA 2FSVA 3E82A 3NR2A 4NL4H 2J3IA 5E0KB 2Z4TA 5DVZA 4PLYA 4HN2A 1NMXA 4I50A 1N2SA 2CVOA 1EWQA 2P5TB 3T4UA 3ILYA 1ZLYA 4WDRA 3TECE 3HUFA 4RVSA 1AS2A 3LUJA 3ZQ6A 2A0XA 3WFIA 4D99A 1ESMA 1RQ2A 2YYSA 3GROA 5C4GB 3MUNA 2FUEA 3URKA 5KSPA 4Z9AA 1E1DA 1RMYA 2G0AA 3M6IA 1LLCA 1DCMA 4TXHA 1SBZA 2J9XB 2XW6A 4RELA 3VPGA 3AOEA 2JAXA 5CDHA 1T15A 3ICCA 3RQSA 1VGQA 3ZXUB 2J07A 8LDHA 1MOZA 2XNSA 3H05A 4X60A 4E70A 3VC1A 4N8DA 3JQ7B 3DDCA 2VIIA 3DT8A 2PN1A 1A8QA 3DVLA 3STUA 3VAZA 1VSQA 1ZUD1 4YVFA 1WDTA 1MEEA 3E61A 1A04A 4JLDA 4B6JA 1YI0A 5HUHA 2CJXA 3GEIA 4CF3A 2ZJ8A 5BSKA 7MHTA 5F2OA 1HNZB 2YXEA 4UVEA 3IP9A 1PD1A 1MAVA 4UM5A 3A3NA 3HYLA 3ZQ4A 1BXGA 2ZAOA 3AF1A 3C6MA 2QRZA 3EZ7A 4DCVA 1G19A 4UOEA 1P5ZB 1UBFA 3GR6A 2IU3A 4LOIA 3UK7A 1NBEA 4KAXA 1CUCA 1LCIA 1MV8A 2IYOA 3N28A 5SYNA 1AF4A 2VP4A 2IQ5A 1F4LA 3RI3A 1R4MA 2IHZA 2OFWA 1RHUA 1A95A 2IIQA 4W5HA 1F7VA 2G5TA 1EBFA 3C70A 4QKQA 1SQ6A 2GHIA 2J45A 4N4AA 2XWQA 4HEHA 3TZ6A 4P92A 4R3UC 4O2BB 1ISGA 4IRXA 5DM60 4BY9E 2PD6A 2XDAA 4XR9A 5ELLA 4OQNA 3ONNA 5BSFA 4IDBA 5CA1F 2ZE8A 2C2OA 4WGGA 1QXSA 2FWNA 2JKYA 4GM4A 3TDMA 2ZIVB 4Y9UA 3O4FA 2H07A 4EPVA 5HF6A 1PEKE 2IH4A 1WS6A 2OAEA 3L43A 1KWKA 4QDJA 4O8CA 3T5GA 5IXJA 4G5RA 4IJUA 2XAAA 4QG3A 2AOUB 1Y6ZA 3TQSA 2WNHA 5EUBA 4Q12A 4LYAA 1F0YA 5DTQA 5THXA 2FPRA 3JWJA 1D6JA 1Y9AA 3PEEA 3PX2A 2ZJBA 1EE1A 3IVAA 4B7CA 4KHPB 1XMIA 1VLHA 1U04A 4RVGA 4DILA 5BR4A 3VO8A 4LJ6A 3SEZA 1T9DA 3BX1A 1P62B 3U4QB 2WP8J 3GL9A 3VR3A 3JYOA 2DLNA 4RTPA 2WQ7A 2YASA 1SY7A 1JKJA 5EQFA 3P26A 4OB8A 1M1YB 5ITSA 1MAAA 3B1JA 1IJKA 3OT5A 5BN3A 2C4NA 2B4YA 4ND8A 3VR4D 3HXPA 1TCUA 2HBYA 1VMEA 2QTMA 4LPKA 1AE1A 4NVRA 3TQOA 1A7JA 4GOXA 3OJCA 1O6FA 3OZEA 1BXRB 3Q72A 3MRVA 4Q3BA 1XJQA 5FOTA 4JIGA 1XFDA 5KEIA 3JV7A 3AIKA 1A1VA 2P69A 3LT2A 2IEBA 4X8LA 1XR3A 2C5SA 1W25A 2FPPA 4GECA 1NFRA 5H8WA 2QI9C 2CF5A 1RKUA 1EWKA 1C3OB 1NWHA 5HBRA 2C4VA 2I80A 3EG5A 5JNUA 1SU4A 2KLHA 4CUKA 3TN7A 2Y9MB 1P29A 1MO3A 2EX1A 3EVBA 4M1EA 3GPIA 4FINA 5EZYA 4LTNA 3EPHA 3M3DA 4EHJA 2AUTA 1SIOA 4OTZA 4CFYA 3VV2A 3ZU6A 2PVPA 5JLAA 1OVGA 4MOWA 1UMBB 2VK2A 4L75A 3ER8A 4QDKA 1XZHA 4ZEOA 1D4AA 1LC3A 3A2MA 2YIDA 2GBLA 3NXKA 4Q93A 5EJ7A 5BORA 1BE0A 1MAHA 2P7HA 2IHJA 4L27A 3W2TA 4F9EA 5H7XA 4QOSA 4QJ3A 5JY1A 3EVFA 2JZOA 3VTAA 3BC1A 2XWJI 1F2TB 4PYNA 2EGGA 5F76A 2BMWA 1R4AA 5HA5A 4JQOA 5ICFA 1AKMA 3WNVA 4EG6A 4YRTA 1R0SA 1X74A 4GZ6A 2D0IA 5JO9A 4A03A 5J4KA 4BFZA 3U80A 2GPTA 1DX4A 1Q0HA 2EJWA 2PEYA 2G4LA 4RIIA 1NRIA 3ISVA 3V34A 5ES3A 1G6HA 2FEMA 4EUFA 5BNWA 1DKPA 2FOXA 2O07A 3I45A 5E6UB 3TEMA 3UK6A 1H5QA 2AV6A 1JG1A 3Q3VA 4WTOA 4ZK6A 1SXJB 4UTOA 3RSFA 2BVNA 3HDGA 3M6XA 1W88B 3C1TA 4FDMA 3RV4A 2GKGA 2O5VA 4ZIRA 2ZU0C 4MW1A 1AKYA 3IIKA 1GV0A 4R2JA 4EY7A 3CSUA 1R0WA 5FO1A 5HDQA 5JAOA 3DV0A 2RH5A 5ECWA 2BM0A 4WCVA 3U7JA 2Q3MA 1E2FA 4BHTA 5BUSA 5LMCA 1AHHA 3T5TA 3R6WA 4PC1A 5AXAA 3A1UA 2O05A 4YP7A 1BVUA 2A3NA 2Y1WA 4IDGA 4CL0A 1PLLA 4ICIA 4KAJA 1RYZA 4KOEC 1ZY2A 5BMOA 4I2NA 4CODB 2GPJA 4N82A 1CY4A 2IXTA 4MK4A 2Q1XA 3DZFA 5DM1A 3WKEA 3LXMA 3CIFA 3NAZA 1YXMA 2GD6A 2JDIA 2YY6A 3D8UA 4OJMX 2DULA 3T15A 1Q0ZA 2GPNA 3U1TA 1DBVO 1KK1A 4P58A 4G23A 4OGWA 4QAJA 4YJ3F 3P97A 3E9DA 3RBAA 2ZI5A 3U7FB 3ZVNA 5IX8A 1ZR4A 1GFIA 1Z29A 1A77A 1WXFA 3AUXA 1KJ9A 3Q9SA 3BIXA 4YJGB 5FP0A 2HJHA 1V95A 3F4KA 3GEDA 4I9NA 2PAAA 4W6ZA 3TVYA 4QOGA 2JJ1A 1VHLA 4LOAA 4WCFC 4ALIA 4CMBA 4WBNB 4WNCA 3CLRC 3QV2A 1QHYA 1CUUA 1Z38A 1ZNZA 4G0XA 4IWYA 2HO5A 4I1IA 1NVVR 2I4LA 1X8XA 3I58A 3VOBA 1MG0A 3D4LA 2YZMA 2OCIA 4K2HA 1JQDA 4BO9A 5BV0A 2GXSA 4W5JA 2ZANA 1DFGA 1N5KA 4MV5A 3ZTWA 2W2VA 3FCAA 3RAGA 1SU6A 1A9TA 1BD4A 1O96A 4D74A 2P2GA 4NV1A 3I9KA 3MT8A 4Q9HA 3KWFA 1HTWA 4CMEC 4PO9A 1ONNA 2CW5A 2UYCA 2UZ4A 1P4SA 1J0AA 1FFHA 1XTSA 3U7EB 2JGMA 5K8JB 4PZYA 3C3XA 1AHNA 1WTAA 3AWIA 3EVZA 1RTTA 1P18A 3QE2A 3H11A 5AMXA 1CS4C 3RF7A 2PGOA 5EXDA 2VTKA 2W9XA 4CTNA 3VDQA 3ZI7A 1SVMA 2P3QA 3P7MA 5GZ3A 1ISHA 4L8GA 1P8JA 2X7XA 5FQNA 3H75A 1RTKA 2DY1A 3GDHA 4BMCA 4UBJA 4QODA 4BX0A 3URMA 4GE3A 4E4RA 3A10A 2A5FA 4KBYA 4Q21A 1A5AB 2XR1A 5CITA 2IOQA 1YOVA 1R5JA 1S2GA 1IC6A 2OKCA 4CDRA 5BUCA 1JX6A 1TMKA 3FTQA 4FX5A 4JYPA 5K99A 3QI2A 3SMVA 4F2WA 1D2MA 1VLJA 1Q0RA 4GKKB 1ZVJA 4I4NA 2KLBA 3R5JA 1J5EB 4KE9A 2ZRAA 5FNVB 1VLMA 2PV7A 2XF8A 4BB6A 3ZV5A 3AGQA 3QM1A 4BLSA 5E1OA 1Q3TA 3DOHA 3WMEA 1PJ8A 4MQFB 1OC4A 2Q3EA 1P74A 5B1DA 1ENOA 3KYDB 4P3PA 3KEOA 4M22A 2HMVA 1U80A 4UAUA 2HLPA 3HYTA 3W8DA 1UKVY 4WVLA 3HJBA 2J0QA 1VMIA 3AQ4A 2FR0A 1ZJJA 4Q34A 1GG8A 1VPVA 1JJVA 3KELA 2C84A 2JFXA 4NMLA 4RPJA 1NZJA 4XE5A 5CBPB 1KYVA 4CF7A 5AJVB 3ZZNA 5IMSA 2ZWOA 3G0BA 5LD2C 1SVKA 2C5GA 1I5OA 2QTRA 3GZNB 2H17A 4RESA 1F48A 5I47A 2X40A 4FT4A 5K0NA 1OFGA 4LXTA 1LC0A 5LXTF 1JTFA 1NY5A 3KT3A 3CSSA 4FS3A 4GMFA 3OOEA 3K6SB 1X19A 4JZKA 2PMDA 1LBIA 3HCBA 5JARA 4GXTA 1P7VA 5K3CA 4G0MA 1LNQA 5JJKA 1C9JA 4UM7A 1XJ5A 1WKVA 2I9PA 1F2VA 3A8TA 3MGAA 3WL7A 1DUSA 4C76A 1P1FA 4YS6A 1FJGB 2G70A 2HA0A 1KEUA 3DZJA 4UTPA 1IL0A 1IXRC 5IKPA 1JEOA 2BHLA 5T41A 2GK3A 5C37A 1G8MA 1QCYA 4J91A 4PZZA 3QP9A 1FLNA 4OQZA 2RONA 2BCEA 2UYGA 3ZUPA 1BVRA 1CUAA 1PUXA 4I0WB 1BDMA 1P4HA 2R25B 3HU3A 4L85A 1YQXA 3SYNA 3RUCA 4LHVA 3SZRA 3FGNA 4TWJA 4EJSA 4JNKA 4NS4A 1CUHA 1PFWA 4QM6A 3CNNA 3CX4A 4BNHA 3TOSA 4NIMA 1G6KA 4YP9A 5IBCA 4QU5A 1XA3A 2BEWA 5DOZA 3LQKA 3QX9A 4YJ2F 2C94A 4ZVRA 3WNQA 4ZOCA 2XLCA 2Q9CA 3K1JA 1R74A 3Q6MA 4H3SA 1VSTA 1MT0A 4Y3UA 4PZCA 4CL3A 2LIPA 3QFHA 4A8HA 3OZFA 4CM4A 3DTVA 2DCMA