1QS0B

Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
338
structure length
338
Chain Sequence
ATTTMTMIQALRSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQTKYGKSRVFDAPISESGIVGTAVGMGAYGLRPVVEIQFADYFYPASDQIVSEMARLRYRSAGEFIAPLTLRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEPKRLYNGPFDGHHDRPVTPWSKHPHSAVPDGYYTVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAEESGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVVVHEATRTCGFGAELVSLVQEHCFHHLEAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKKVMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA-SUBUNIT
publication title Crystal structure of 2-oxoisovalerate and dehydrogenase and the architecture of 2-oxo acid dehydrogenase multienzyme complexes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 100
structure length 338
sequence length 338
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qs0B02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qs0B01
2FN3A 2EZTA 5HGXA 2C3OA 1OLXB 2Q5OA 3AHCA 4GM1A 3HWWA 1YI0A 1V1MA 1Z8NA 1R9JA 4COKA 4RJJA 1DTWB 2XT6A 1V1RB 1X80A 1BFDA 2IHUA 2PGNA 2JI6A 4KXUA 3EY9A 2YICA 3OOYA 3M6LA 1PYDA 3L84A 4KXWA 2C3PA 1X7ZB 1T9BA 4MPRA 2BP7A 1T9CA 1TKCA 3AHHA 1YI1A 4XEUA 1TRKA 1POWA 4QQ8A 3DVAA 5ERXA 3E9YA 2BEUB 2EZ4A 1V16B 3EXHA 1OLSB 4K9QA 4RJIA 1UMCB 1T9DA 1PI3A 4JUDX 3AHJA 2R8OA 3OE1A 2AG1A 2PGOA 2XTAA 1YNOA 5FEMA 2Y0PA 3HWX1 2Q5QA 2J9FA 3FSJX 3DUFB 1MCZA 2JLCA 4JUBA 4GM0A 2VBIA 2AG0A 4RJKA 5DEIA 2DJIA 1U5BA 5IMSA 5HHTA 4C7VA 1X7YA 5EJ5A 3DV0A 4KXVA 1Q6ZA 3ZHVA 4KXYA 1V1MB 3IAEA 4ZP1A 5ESDA 1AY0A 4FEEA 2BEVA 2OZLA 4JUFA 2WVGA 1OZHA 2Q28A 3ZHTA 1X80B 5EJ9A 4JU8A 1QPBA 2UZ1A 1UPCA 5EXDA 2FWNA 4MQ5A 3ZHQA 2W93A 2EZ9A 5I5EA 3EXG2 5K6RA 1QGDA 3D7KA 1PVDA 3UPTA 2BP7B 2VK4A 3F6BX 2UZAA 3AHIA 2VK1A 3DVAB 3M34A 1OZGA 5I5GA 1YD7A 2C42A 2C3UA 3EXHB 4K9MA 1UMBA 4K9LA 2VK8A 3LQ2A 1B0PA 3EA4A 2O1XA 5AHKA 1UPAA 2BEWA 2R8PA 5EJ8A 2Q27A 2J9FB 5DGTA 1RP7A 3KOMA 3F6EX 1GPUA 1KEKA 2C3YA 2IHTA 3EXG1 5EJ4A 4MPJA 2QTAA 1YHZA 5K2OA 1NI4A 2WVAA 1QS0A 5K3SA 4GP9A 1U5BB 3JU3A 4JD5A 1POXA 1X7YB 2JI8A 3HYLA 1UPBA 3DV0B 1UM9A 1V5EA 2JLAA 4JU9A 1WCIA 1NGSA 4Q9DA 2BEVB 3EXIA 2OZLB 5C4IA 2C3MA 2PDAA 3ZHRA 2JGDA 2JIBA 2JI9A 2C31A 2UZ1B 1V11B 1YBHA 1L8AA 1TKBA 2QTCA 4MPPA 2EZUA 2BFFB 2V3WA 3M7IA 2G25A 4JUCA 5HJEA 1OLUA 5I51A 2PANA 1V5GA 4FEGA 3EXFA 4KGDA 2BFEA 1OVMA 1V11A 1UMBB 3AHFA 5EJ6A 4WBXC 5EJ7A 1T9AA 1V5FA 2BFFA 4MZXA 2BEWB 4QPZA 1UMDB 1TKAA 2JI7A 2XT9A 2BFDB 5HYVA 3ZHSA 5EJMA 2BFCA 2IEAA 1X7WA 2WVHA 1X7XB 4GPEA 3LQ4A 4JUAA 3EXEA 1NI4B 1Y9DA 1QS0B 1OLXA 1UMDA 2NXWA 4K9OA 2X7JA 2BFDA 4D5GA 3MOSA 3AI7A 1DTWA 1W85B 1V1RA 1UM9B 2R5NA 3FLMA 1X7XA 1WCIB 5K6TA 4GG1A 4GM4A 3UK1A 5DGDA 1YHYA 3EXIB 5I4IA 1OZFA 2Q29A 2JGDB 1IK6A 1X7ZA 1W85A 3M49A 1W88B 1N0HA 2BEUA 5EXEA 4D5EA 3IAFA 5EJAA 1V16A 2E6KA 2VBFA 2O1SA 1OLSA 2YIDA 3LQ1A 4KXXA 3RIMA 1UMCA 4K9NA 1OLUB 1W88A 2IHVA 3EXFB 4QELA 4C7XA 2BFEB 3FZNA 3EYAA 1PO7A 4K9PA 1ZPDA 3LPLA 3DUFA 2VJYA 2BFBB 1JSCA 2Q5JA 5ERYA 3AHEA 2VBGA 2EZ8A 2Q5LA 3AHGA 1ITZA 2G28A 3EXHC 2BFCB 3ZHUA 4K9KA 3AHDA 1X7WB 2G67A 2BFBA 3EXEB
chains in the Genus database with same CATH superfamily
3LJKA 2UYYA 4TLEA 1GNTA 3EFOB 4MCHA 721PA 1RBQA 4L27A 1QBGA 2CE2X 4MR8A 1CR6A 3TLKA 4G85A 1W0KD 4WBNB 1UBOS 2DZDA 4R2IA 2J46A 1TUBA 2WM8A 4L95C 1B93A 4QXRA 2FPGB 4PWYA 1FFCA 5EGSA 4C4ZA 5TQ2B 1PZFA 3CCCA 4DIOA 1WHSB 1HXHA 1STOA 4G0ZA 2FX2A 1NG9A 3BQ9A 4Q9KA 3HU5A 4DLKA 3UFXB 4PGHA 3KJQA 3ODGA 1JTEA 1JIVA 3HKBA 3RUCA 3S1AB 4IDDA 5KSOA 5LDGA 4DQ0A 1JJAA 7GPBA 2G5PA 2H06A 1ML4A 4IPTA 4JKYA 4LJ7A 4EW6A 4MICA 3P45A 4X3PA 2D0DA 3L0CA 1VGQA 4HUQA 1CQXA 4S1VA 4D1YA 2JKVA 4D26A 3KLNA 5DK6A 3RO7A 5DIZA 2H5EA 4KYVA 3PL1A 1EG2A 3T3EA 3LRXA 1BN7A 1JPUA 3D4NA 1QCZA 2I4OA 1NQUA 2HLPA 2A1UB 4FYYA 5BYAA 1NRXA 2VNHA 4Q4JB 4X1KA 1QIIA 3I04M 1CQPA 1JEQB 2B6HA 1UUFA 3JWPA 2GUWA 3M6LA 4L08A 4XQGA 5DHPA 5AW0A 4I5GA 4J1TA 1MG5A 4IIXA 4OHMA 1NBHA 3QA9A 1WAMA 3A1UA 3FN4A 5CT6A 1HSZA 1YA8A 4L5AA 2OXRA 5DHAA 2BCEA 2Q99A 4ZTBA 3QE9Y 2RB4A 2RHBA 1T9CA 2DB3A 3TIFA 2GFQA 4OQNA 3H5WA 2OPHA 4BN4A 5BWNA 2FY8A 2VDNB 5C2JB 2JIQA 3DZHA 5F7OA 1ZJJA 2H1RA 3ABQB 1ZUWA 3D4LA 2IYWA 4HQOA 1SBZA 4QC2A 1B4DA 4UBOA 4C0JA 1QF9A 2Q5CA 4U3JA 5HDQA 2Z09A 3PJEA 1J0DA 2GTIA 4Y2VA 1DKUA 3DB1A 3M2PA 4YQYA 4AKTA 3FVTA 1KK1A 2I7XA 3DZCA 1B8PA 4YJ2B 3ZEIA 5JSKA 1Q12A 2CL6X 2V0CA 2YN0A 4FOTA 3G2HA 4MV8A 2FEWB 3N5KA 4GQBA 3RBZA 3JATA 3F7OA 4FLEA 4JUDX 3KQNA 4L8LA 4WEOA 4O0MA 5JXGA 2R1TA 3WGOA 3NBMA 1I10A 1K63A 1FTQA 4OO3A 2GPTA 3WLRA 4DLZA 3PR2B 1IJEA 1TVCA 4IWNA 4JENA 2NZ8A 3CU5A 1RJ9A 3ZU3A 1XU9A 2OOSA 1GV1A 1XQVA 3GRZA 3W4IA 3WLJA 4LF6B 2Q3LA 4IJ6A 2HW8A 3JQ8B 1D2CA 3OX1A 3TJRA 1IE3A 4QG7A 2YXEA 1JIIA 4U6QA 2ZT8A 3RYHB 5IJWA 2YWXA 1E77A 3N7TA 2VQSA 3E1GA 2XXAB 2CNKA 2JJ1D 2NZWA 2OL4A 2R6R1 3ZIAA 2W2KB 3MTDA 2IXAA 4OATA 2GCIA 4TUYA 4JC0A 2ZSJA 3UMCA 1D2MA 2X14A 4A27A 1Y5MA 1KDTA 1XBTA 1I2BA 1H4TA 1NYTA 3M83A 4ZT4A 4LJYA 4HAOA 2FPIA 4CIWA 2R751 6PFKA 1A9RA 1E98A 2ZRJA 4X8LA 1EUCB 3S8MA 2HJHA 3ZV3A 4V0SA 2MYNA 4FHCA 3S4YA 2O7RA 3V4PB 4C2TA 2H4YA 3AR7A 4XYMA 3H1PA 4F9FA 3IQFA 3I9MA 3MRXA 4HVTA 1HDZA 1PT9A 2P9JA 5ALJA 3PU6A 2G1PA 1KJQA 3LT5A 4DRZA 5JAMA 2I9KA 3AIMA 2W58A 2ZYUX 3MRVA 2Z5GA 2RIPA 3GP8A 3TBFA 2H57A 1IVYA 1AVTA 1M1UA 3BMXA 4LGMA 5JT1A 3ZG6A 1B0ZA 3B1FA 3JQRA 3WKCA 4XSVA 3QX7A 3FOFC 4LHXA 4QUEA 4MRMB 1KJ9A 4YONB 3O74A 4WXYB 4KR3A 2NSLA 3P2MA 1NP3A 2JAPA 2XLBA 1YAJA 3N53A 3SX2A 1W47A 1CB0A 3GLFB 4M87A 3SKXA 2XKBA 1X1DA 1ZC3A 5LP6C 4NONA 5FAKA 4Y1RA 2AC4A 2J31A 5B3LA 4YCMA 1RRCA 4FB4A 1LLFA 3UMMA 3FTDA 1J2EA 3AYXB 3GXBA 4UUMA 5D8DA 1JDZA 1C2YA 1NVBA 4QFBA 5FI3A 4ZD6A 2C57A 4NZPA 4QOJA 3PWKA 4HYYA 2C9MA 1IVSA 3N0VA 5K5EA 3G5AA 5EP1A 3OLXA 4U2CA 4PZEA 1WXGA 3KKZA 3BMNB 5GVRA 4BVFA 4ZICA 1RI3A 2PBRA 1ZM9A 5I9MA 1NXVA 2XHZA 3L0ZA 4HDKB 4Q7LA 4RTMA 4FHFA 3GH3A 3TUJC 2CK3A 3JVIA 3MTJA 5F7ZA 5B37A 5A04A 1YAHA 2HFKA 2XI4A 4ZOLA 5K0NA 3ZV7A 2QUIA 1PJBA 2D3TA 4NFLA 4D0LB 4PM4A 4DILA 1LJUA 5CLHA 3Q2KA 1ORHA 1KY2A 1Q0ZA 1X1QA 3EVTA 3GFQA 1AIPA 3HI4A 4JHLA 1ZM4A 3L8ZA 1VIMA 4KQGA 2JIOA 4HPXB 1E2QA 3GDWA 1NW6A 2O2GA 3ZKWA 4V0QA 4HDSA 3LCMA 1JQ5A 2M9MA 3IHWA 2N0SA 1XCBA 3GJ6A 2AFHB 4B45A 1CF9A 4LJSA 3KR1A 3Q7RA 4EHDA 1BHQ1 2QB5A 3H3XA 1K5DA 4ND7A 3I0ZA 2GI4A 4EIWA 2VP3A 1IMOA 2B36A 3MUFA 1GZ5A 3QEJA 1VB3A 4ZZIA 3ND7A 1DRVA 3DMTA 5T5QA 2RONA 2VHZA 4X1IB 3EA4A 4HR7A 1F2UA 1ZGCA 2VJQA 4XKJA 1CZKA 2AMLA 3LDUA 4QGAA 1XTQA 3ICWA 4DA7A 4EUEA 1JVNA 1SUWA 3T95A 4UM5A 2HHJA 2CUNA 3AIIA 3T34A 2VZ8A 5IT5A 1WB9A 1DADA 4YRKA 1SZDA 3K1AB 3OZAA 2OBMA 1QRUA 4MV7A 4I3FA 4E5KA 4R0NA 5FF9A 2RGNC 3K2EA 4UZEA 4Z1OA 4LWPA 1E3SA 1CY6A 4M0MA 4NZZA 4FGSA 1N3BA 3FNQA 1QAQA 1TT5A 5E2AA 2YWDA 3L0IB 4A6DA 3FA2A 2REQA 4BZZA 5ALKA 8ADHA 3A9WA 4JNCA 4O8ZA 2FMKA 2ZOSA 4WRRA 5L53A 1KYXA 3T38A 2YJNA 4NICA 3SG0A 3M6FA 3NCHA 5KQRA 1VMEA 2AX3A 1O08A 1TD1A 4Y8VA 2AN9A 2IDJA 3OEYA 3PGMA 1Y81A 1E2FA 3PFFA 4O08A 2CXHA 2PMEA 1RAHA 3D3KA 1ZVKA 4IYRA 1U28C 2PKEA 2FMXA 4MYHA 1NQOA 1POXA 2XE6A 5CJ2A 4ESOA 4TQUS 3TQHA 5HXAA 2YWEA 1FJXA 3RUIA 3S2YA 2JLBA 3EHDA 3N58A 3IUQA 3ME5A 5D51S 5ALPA 4Z3OA 1Q14A 2MU1A 3L6EA 3FR7A 2PBLA 5HBRA 2Z04A 3G0IA 1Z75A 2GHIA 3OTQA 2WABA 2WYUA 5EUMA 1EPUA 2BJVA 4Q9DA 3T7JA 4AS3A 2RHLA 3K8ZA 4JXXA 1I3OA 4XFKA 3FOWA 1NM5A 5IKEA 2ZXEA 2J5XA 3R2JA 4K9RA 2AR9A 3DWIA 1T5HX 5ED4A 1MX5A 4CEJB 3LX8A 5BNFA 1S8AA 1DV2A 2B69A 3SC3A 2G1UA 5IXSA 5JIBA 5KYNA 1W1IA 5ALOA 3OJ0A 3QLUA 3RR2A 2AZTA 2QHXA 2FQQA 2V54A 3QOFA 3T7IA 3SVZA 4GHWA 4M46A 2EKQA 2VDWB 1O97D 3I4LA 2OGZA 5MFPA 2VP2A 1TAHA 1NNLA 5CGQB 3L7OA 3EZFA 1QJCA 1VI5A 1AB6A 1XE3A 1ZK1A 3A1FA 3CUVA 3HDQA 1EBFA 2YWJA 1ZMBA 4KQWA 2DBQA 5B7PA 4UU1A 3DDWA 4I4CA 1V11B 3I04A 1AF7A 3DG9A 4KAJA 1P3JA 1E1DA 1YK0A 3R8CA 2Y66A 3GAZA 4MW2A 4QQNA 3TQOA 4BNTA 5I9NA 4YCNA 5DI3A 1Z6GA 4OOFA 3N3BC 4YC7A 2XHEA 4Y2UA 4MI6A 3ZU6A 2OYRA 2GESA 2WR8A 4I08A 1EFVB 1SR8A 2DBYA 3JZAA 4EYEA 4PG8A 4O2AF 3ML1A 1UANA 1GTSA 4U5QA 3JQPA 3P27A 3JW8A 1PZNA 1T4BA 4H7FA 1UKCA 4H7HA 4QLOA 1E3DA 1NWHA 3N76A 4W8HA 3WS7A 5C8DA 3R3JA 1O95A 5DBGA 4G24A 2F1IA 5EZYB 5GONA 5H7XA 1N9GA 3DDNA 3ROZA 3UAZA 4BO6A 1UZAA 3EXFA 4ZHQA 1INLA 2X76A 1U2QA 1EINA 3D81A 3I3OA 3ZWPA 4BV9A 1TZCA 5K4GA 4Y6LA 2ZSFA 1UF9A 4WI1A 2I7DA 1JQDA 3P96A 1JA0A 4L51A 3CE9A 4DAOA 4EG4A 1UC4B 1H4QA 2DGDA 4JYCA 5J40A 2UKDA 2PKRA 3C0KA 3V8EA 3STXA 1S8FA 4BNLA 2BFFA 2ZGVA 2EQ5A 3ZWOA 4H4CA 2R7MA 4HNQA 4RPKA 5AM4A 4AJJA 4E3WA 2BGGA 1AZWA 4N48A 3SM9A 1QGZA 4S1OA 3RG2A 1KI8A 3C6MA 3QVSA 5G0WA 3RYFB 2AQKA 4FE7A 5TT0A 2C96A 1R4MA 2Q6KA 2QX6A 1DTEA 1H85A 1SHZA 4S0XA 1A5AB 2ZB3A 3TINA 4TYWA 2HYIC 1SUEA 4Z7NB 1NLUA 1XELA 2B7BA 5BYBA 4ERNA 4ZIRA 2C9ZA 4MINA 1OYWA 4CLRB 5EZQA 5JARA 3C97A 1X7WA 3KDPA 4U0JA 1JI0A 2B78A 2R00A 3IXLA 4WUVA 5DNVA 1W73A 5FL3A 2BE9A 2OD2A 1UP6A 3OZGA 4KVGA 2R7NA 4MQEA 4U39A 2O8EA 4GL4A 2KX7A 4JP5A 5CFNA 1HT2E 4P9NA 3MPUA 3UAXA 1OLXA 4KN8A 3DW3X 3E6AA 1KQ3A 4XDGA 4F3RA 5CDUA 1UODA 4WLUA 2VF2A 1LDMA 1H66A 3ESYA 3KHKA 1XZNA 3VR3D 3EZ7A 1WEHA 2BZ1A 1H6AA 3OJXA 3VHXA 4IZ6A 5F2KA 3I9V1 4IAOA 3VKFA 4E1VA 1V4BA 4KCGA 2GBIA 2V6GA 3VC2A 2OCYC 3GGDA 4M53A 4W63A 3FIUA 3O9MA 4MXDA 4XIGS 3SK0A 3V8PA 5ALMA 1SKAA 4AMVA 3FLMA 1CDEA 1N2HA 2PLNA 3P9RA 3P2EA 2HWKA 2PS1A 4JH0A 5HQ3A 2WK1A 3NH9A 5AVOA 5KI6A 1GAXA 1N7IA 4G1BA 2WPNA 3R0XA 2XWQA 3WXBA 4YAEA 3KSUA 1Y5NA 4AMZA 3A26A 1AXGA 5BYJA 1UR5A 3LUCA 1HLPA 3KK0A 3Q3GE 3O93A 1BW9B 1BJRE 2D6FA 2BE7A 3PQDA 4DR3B 2OCXA 3WLAA 3PDCA 2OXCA 1P77A 5CPBA 1P1FA 5BR1A 2NO6A 4OHZA 3F6YA 2DLCX 3KP1A 3RSCA 3VZPA 1TO6A 1X7ZA 1MQSA 2JDID 3QX8A 1W85A 3DFKA 4OG2A 5EE0A 2X3UA 1PSDA 1I4LD 2XA2A 1J1IA 1LNQA 3GEGA 2QM0A 3H2IA 5DT9A 3ROXA 3VR4D 2BLNA 3NBXX 4MB2A 4UBLA 1PBNA 3ZGYA 4ESVA 1W88B 3N07A 2W6NA 3UFBA 1JAXA 1RKQA 2CFSA 3VR4H 3LL4A 5TPWA 3RUHA 3RRXA 2PLWA 5TE9A 3TDMA 2PS3A 1JQKA 4FP9A 5CCXA 4FI3F 3OD1A 3BOSA 2WJIA 3LT1A 4UCXA 4RTJA 1PNTA 3E0QA 4PZCA 3VKWA 1TLTA 5I9BA 1T0JB 1TM7E 3AUJB 3NR2A 4G1EB 4S35A 1E94E 2PTGA 1PN3A 1ZN8A 3C4QA 3H99A 4F4IA 1KOGA 1E7MA 2ODQA 3CRRA 1O8BA 3QKUA 3V42A 1RC1A 1ZU5A 1JL3A 3HBJA 4RTRA 3WGLA 3SS9X 2CFOA 3K20A 1I9GA 4V2IA 3ZPXA 3RD5A 1WQ3A 2I4TA 3IPRA 3FZNA 4P08A 5CBPB 4MVJP 1V6AA 2AXEA 2FQYA 3M9XA 1ZPDA 1ZVJA 2ZIVB 1NJ8A 3P2OA 4XVCA 4QNNA 4WA7A 2ZPUA 2AYZA 3DUFA 3MGBA 3CY6A 3SVLA 5I48A 1QF6A 5JR3A 4NAVA 5C0OE 1N2JA 2PCJA 2ORIA 2FLKA 2CMDA 4HQRA 5E7MA 3GVXA 4RF3A 2WEKA 1S4MA 1T10A 2ZUBA 3E53A 4D3XA 4K3VA 3TRDA 3QUQA 1DP4A 4RYLA 5ALYA 4C4SA 4WOJA 4B3IA 4I8IA 4MHOA 1V95A 2BGLA 2NPOA 3VO1A 4NR0A 2GVNA 4B35A 5A5VA 3TTTA 1FYWA 3V1YA 2WICA 3AF4A 3CO0S 1JDSA 3VR2D 1T35A 3KDSE 3ECCA 3KUCA 3EGXB 1BU8A 3H75A 5HA5A 3E7XA 4DCNA 1OFTA 1HQDA 1VL5A 1YBFA 3MIZA 3QELA 4PEVA 1COWD 1FP6A 2ZIXB 1B74A 4PGAA 4Z3DA 3U80A 1H8ED 5LZ9A 5UKDA 1MRNA 1Q19A 3EXEB 3MCTA 1XZBA 4L28A 1N78A 3JZIA 1OXBB 4LGYA 2KLBA 4ND5A 4Z1MD 1P9RA 2IIQA 5BMOA 1HE8B 3FYTA 3P32A 3SQMA 2R0QC 4YPFA 3BL5A 3AQ4A 3U09A 2XD4A 4FOPA 1WXIA 2A58A 4MA5A 1RJWA 2C9BA 2ZIUB 3HB1A 4QECA 5EFZA 2EOAA 5J59A 1KZGB 4CLOB 2PS9A 5AM3A 4DR6B 4ZODA 1QMGA 4HDRB 1RM3A 3U4QB 1V4NA 3GB9A 3WWDA 1SOVA 4L5JA 3BBPA 4BRUA 1ZWLA 2QUKA 3OE7A 1KU0A 2QI9F 4JB0A 4RJJA 4CMCA 3NKLA 4I19A 4FFOA 5CDFE 2EF0A 3HB5X 4E32A 2Q6TA 4YV7A 5CLIA 2ECFA 2OEPA 1ARZA 2PM8A 3NHUA 3EXAA 4MWTA 4DJTA 2CLLB 2ZT5A 4U4AA 4X7RA 1AB5A 1ORTA 1FXUA 4XA8A 5H16A 3QU2A 2WKWA 1GZ3A 4K6KA 2C1ZA 3M5CA 1GPLA 3OI7A 2WZBA 5A4AA 3EZ2A 1TUIA 1UEJA 2R68A 4QIHA 3OOYA 2J0SA 1ZOIA 4OLAA 4KRFA 2Q1SA 1S1MA 1ZK3A 2Y1WA 5DCLA 5JE8A 4M21A 1T5OA 1M54A 1L1QA 4LOHA 5HIMA 3PC2A 2BHTA 2Y2UA 4ZO7A 4E15A 2W90A 3OQVA 1FTWA 5H59A 1CDDA 1J7JA 3AF2A 4NDAA 2W6MA 1TKCA 2NZJA 3HCPA 4H1VA 2P2YA 1RWWA 4XEUA 3RRZA 5HKOA 2GK7A 2G04A 3E9YA 2AN3A 1XIVA 3IURA 1AH2A 3L3BA 2XCUA 1ZNYA 3SEZA 4D8YA 2I1QA 3HRHA 2VWHA 2CYAA 2X1VA 2A1UA 4LEIA 4Z5XA 2FFAA 4A6XA 1CJVC 4PXYA 1NFQA 4AO6A 1BRMA 1JEQA 1F60A 3EEFA 2QR2A 4HNAA 2V45A 4YK7A 3SZ3A 5M2QA 4OKNA 1AQYA 2YZ2A 1QH0A 1TU3A 2Q2QA 4E07A 4EWLA 2QVZX 1NQWA 3RIGA 2XR1A 5KNLA 4BQPA 3RIEA 1OXKB 2ZKIA 1GP2A 4AZ0B 3KLBA 2I3GA 3UJBA 4QZVA 3OFSA 1XP5A 1DB3A 4WVFA 4GX5A 4CI0B 2GTHA 2XTAA 2WTUA 2HN9A 3QPBA 2DKOA 3SJBA 2Q9AA 4YMTA 2JFHA 1P44A 2GHRA 3R7LA 5J5CA 3ADPA 2J9FA 4H3KB 4B2LA 5DBOA 2L69A 3TTXA 1JVSA 1OAOA 1RCFA 1YR3A 3G8DA 3MF4A 4LJ8A 3UO8B 1J39A 2M32A 3EBLA 1DQYA 1TL7C 4Y1EA 4PN7A 4NCHA 2GH1A 1G2IA 3SJZA 4BB9A 3OWOA 9GPBA 3CH6A 5AKHA 3UWKA 5IW8A 5K8UA 4EFNA 1KO4A 2FOIA 3UVEA 2ZIFA 4AJKA 4QREA 2W2XA 3CLUD 3LC2O 5FOSA 3T7AA 4E70A 3I28A 3O3NB 4Y1FA 2B4RO 2QU8A 5G2OA 4CM8B 1P7WA 3QIVA 1UDCA 4Q9JA 1SXJB 1U5BA 2ATXA 4QBFA 4BLTA 2PUGA 2D2IA 3GJ3A 4TT8A 5KYVA 2NADA 1QYRA 3F9IA 3GCWA 3IODA 3R7WA 3VMFA 3TGPA 2GT1A 3MCUA 4LWQA 2P3SA 5D6NA 1USGA 3QW4B 5ALZA 4MTLA 6Q21A 1AXEA 3HR7A 1E9BA 3MGKA 5C3UA 1DKPA 4OSOA 5T57A 4B81A 4C4PA 2DP4E 2WFZA 4GPAA 1VLZA 2OXIA 1CUYA 1F0KA 2AHRA 3P19A 4KACA 4L7QA 1SQ6A 4GX2A 3N87A 2QUAA 1P1JA 2EBHX 3ESXA 3LVRE 4AQYB 3CLSC 1Z16A 2XGSA 2HTEA 3R0JA 3SF8A 4QDJA 3H4VA 2OAP1 4IXNA 3T9EA 3ZHVA 2EL7A 3ZVLA 2ECKA 1G7CA 3CSSA 3X0DA 5AXCA 4E22A 3OHPA 1PAUA 4DRXB 4MLPA 1SH7A 3OZWA 2IUUA 4NMLA 4TT3A 3EOAI 4A0GA 4QG3A 4C7OA 3AUFA 2WLSA 3QG1A 5FQOA 3FPJA 4KR9A 3DE3X 4JUFA 4D4MA 1VG9B 3UYKA 1OZHA 2X19A 2HF2A 2VTBB 4G56A 1XU7A 4BB6A 1Q1AA 1X80B 3L5OA 4N7JA 4ZHSA 1TUGA 2OBNA 3FAKA 2DWPA 1AGRA 3WIEA 3WK9A 4RPJA 3W4JA 3HO6A 4XIFA 1TMGE 2RI6A 5HF5A 5KTRA 1IPHA 1G3MA 2BHRA 2WB2A 4HH3C 3CB2A 3WYNA 4DZTA 1L1FA 1GT91 2UZ1A 5IANA 3BWMA 5EMMA 3RRMA 1H1LA 1XSEA 2RD2A 4ADSG 2Y2VA 5I5EA 3D2CA 3UGJA 3BFXA 4A8JB 3TPCA 5FDFA 4B1FA 5GIOE 3IQEA 4NG4A 1OYVA 3ICQB 5EHIA 4G6ZA 3DVLA 4D3DA 3TSAA 5SZHB 1AMUA 4P4SB 3F6BX 2V03A 2UZAA 3IIJA 3NRCA 4KQIA 5FYDA 5J9FA 1GGVA 3BL6A 4MVJM 3NFYA 4J8PA 4TWZA 1LDBA 5ICMA 3MBOA 2C7RA 3U3XA 3UT6A 3QTBA 4OREX 1ZNZA 4DR1B 1NY6A 2G4LA 4I6JA 3F3MA 4MYDA 2AJBA 5EE9A 2WU1A 3MWJA 4PC1A 4FZ3A 1V9CA 3CR8A 4UPVA 3W9YA 4NCBA 1E3JA 2H7VA 3DP9A 1VHLA 3Q40A 3PQFA 4YACA 4R5MA 3KFXA 5LKRA 4EA8A 3VBCA 3UWDA 3QLEA 4CG0A 2RI0A 2EU8A 2CK3D 5J23A 4DMHA 5B57C 5KREA 3T7TA 3BJIC 1U2ZA 3C1UA 4HDKA 4CTJA 5CTJA 4ZGGA 4TYNA 3NQ41 4D41A 1DE0A 1USKA 3DEKA 3GVCA 2N42A 5D5QA 3TZKA 3U39A 2O1XA 4K8OA 4WGFA 3MXTA 1PX0A 4RLSA 2IOYA 3KQUA 4MGZR 2HPAA 3FCXA 2A9JA 2I6GA 3HFRA 3U1BA 1ISSA 3ADKA 4AXBA 1YS1X 4JBWA 3QEBZ 2WF9A 3HKCB 4I4TF 3HCDA 5AVJA 2CLKB 1SCQA 5JS6A 4BLRA 1BAPA 3RNOA 1DMRA 4AXXA 2H0RA 3KOMA 5IXYA 3QF7A 4CMBA 1IBKB 1GEEA 2QVGA 4JBIA 3PKIA 4Y18A 3G23A 2JFZA 2P91A 3DEHA 5A7HA 4M7WA 1L7RA 5JQWA 3PFCA 5LP6A 2L82A 4MPJA 1SHUX 3HTXA 3C14C 1A4XA 1SUIA 1Q3HA 1RBZA 2JA1A 2Q50A 4OGGA 4RCZA 4N3BA 1E2KA 1JMVA 4GP9A 3SJAA 4DDTA 5G3ZA 4R0VA 3S55A 5DN6A 5G4LA 3ETHA 2B9VA 2R62A 2DFNA 3LQFA 3N8HA 3WDLA 2IYQA 3V9AA 1IHOA 4H16A 2ZE6A 4WZBA 4KNWA 3U3MA 2QEQA 1E8DA 2BTQA 1UFOA 3R5FA 4MMYB 3GA5A 4PSDA 5DWDA 1GITA 2DFVA 1FP7A 3HYLA 3U4DA 3V7UA 2JGLA 1EUZA 2I7TA 5AOVA 5TQ0B 5KVVA 3AESA 3DQQA 4IUBS 1V5EA 1W52X 1T5IA 2C2WA 2WV7A 3O4RA 2NTYC 4UUQA 4MQFA 3HFJA 2D7CA 4JDUA 3UOWA 3HR8A 5AXDA 4EEZA 1WTAA 2GPWA 1NR7A 1JE1A 1E59A 2IV3A 3A27A 2AJ8A 2QS9A 2PKWA 1H4SA 1PNQA 1E3MA 4J0FA 2D8MA 2D2VA 4WL0A 2H2GA 2VH1A 2GOYA 3FDIA 3IOEA 4OA5A 1UXHA 5JAUA 3PE4A 5I9TA 3F6SA 3JQ7B 1MIHA 4E5UA 1GNLA 2HSGA 1SQGA 2F8MA 2J3DA 1KC3A 5EC8A 3PXUA 4NDNE 3USCS 1QGUB 3UGKA 5L3SB 1WSAA 4FUQA 4LHVA 2NSJA 1NNSA 3N75A 5JANA 4F6RB 4PAGA 1X1AA 2YMLA 4H4DA 3VAZA 3VR5A 2A4KA 3ZCXA 4DR4B 3GCZA 3NHLA 4WN9B 4Z2YA 1U7XA 2FN9A 3PI7A 3B3QA 4G3XA 1VA4A 5EMJA 3RWOA 1UKYA 3PQ7A 4C14A 4MROA 2QYOA 3OLYA 5IDVA 5EXXA 3CO5A 5BORA 1YBHA 2CCGA 3LTEA 4Q3KA 5LMZA 2C4KA 5DM0A 2VP9A 3IBCA 5AW4A 4WZAB 2BV3A 4XXHA 1P7CA 3LT0A 4UTZA 1YA6A 1X2EA 2JAOA 1GCGA 2HRQA 4IH4A 4PYIA 3WO1A 1MX9A 1NI3A 2ZREA 3BMQB 3DZ8A 3IOBA 5IAOA 2DMRA 4IIJA 5I7AA 3A11A 2D62A 1PQUA 3W5HA 1ES9A 4ZVKA 3T4PA 2B30A 1T2UA 2OCGA 3CF6R 4KO4S 5DP1A 2PZKA 3C70A 1FSGA 4JGBA 5AJTA 3WO0A 3F97A 1YIDA 4JC4A 2FHPA 4BNIA 1M2JA 2P2DA 4B33A 1KBZA 2AI3A 4PC7A 1WSDA 4LFAB 2WMOB 1XL1A 1X77A 1V11A 2FXIA 1V7QA 2G08A 3I8OA 3QKRA 4FQ8A 4BNNA 1OIXA 1GNSA 1PL8A 1SCDA 5D1NA 3SZUA 2H18A 3DF7A 4E13A 5JI2E 5BMVA 3AI3A 1JB1A 2HDWA 2WA2A 3GJXC 2NSYA 4F9GA 1KYZA 5JNWA 1U28A 2ENUA 2LDXA 5G0SA 4D46A 1AJEA 3MJTA 2P9ZA 2I22A 4BDSA 4HH1A 5CHYA 4DMRA 4FEAA 1SULA 3ABOB 3BGIA 4URXR 1RRFA 5C1DA 2NPIA 3RC8A 2BEWB 4KUEA 4WE3A 4S1NA 3BWCA 1C9EA 2Y9PB 3ET5A 3U4IA 2R1VA 1ZH4A 3F0TA 3EUEA 4X7PA 3ZHSA 3INGA 1Y6JA 1C9JA 3D0OA 1VXOA 4PQGA 1F5NA 4ITRC 1DWPA 2VHVA 3KUUA 3L43A 3TO5A 4BVJA 1GPBA 3MBKA 4YDQA 4NG5A 5JDCC 1ZUNB 2IYOA 3P9NA 3IT1A 2QF7A 4B5KA 3ROGA 1LSJA 1Q21A 1O89A 3WGHA 1SCAA 3HDGA 3KLMX 3WRVA 5LP1A 4WLEA 1GSOA 2J0VA 3MJHA 4YBRA 1JR4A 2QUZA 3K0FA 4V3CA 1B16A 3K6RA 4TS9A 4WW0A 3C15C 3N86A 3TNDA 2YVQA 2HJGA 4BO7A 3TZBA 1GIAA 1ISFA 2PY6A 3ELUA 3JQGA 4IQ4A 3RYFA 1C1DB 4Q19A 1KVRA 1CEXA 3S5JA 3UK0A 5SY9A 1L9KA 1T4GA 3C1OA 3K1YA 1ISJA 1BOFA 4G1CA 1IXSB 4JI6B 3THSA 1ID1A 1DIRA 4R8VA 5FT9A 4W5OA 3CVVA 3AXSA 1G20A 3RC2A 2I76A 3U3OA 4DG8A 5DT2A 1P6UA 1EU1A 4C78A 4QT4A 5JQGA 2GUGA 3FUCA 4RTKA 1WKVA 1ZAYA 4PHFA 2FUKA 2XNJA 3EYWA 1XNQB 4JLMA 1JDBC 1ZD4A 4H7IA 3IUEA 2XMCA 1D0VA 1R9GA 3IB3A 2WPDD 4OQLA 1C0EA 5FORA 3SF0A 3DBLA 2B61A 2X0IA 1KNQA 2RG7A 3IPAA 4EA9A 3U13A 2P62A 3HM2A 4FDAA 1D2NA 2KB0A 2OVBA 5MN6A 1DG3A 1RIIA 1DBRA 5FWDA 3QV2A 4KVZA 4UHDA 1U4SA 3ZGVA 4XVUA 2HMWA 1WHTB 1YKGA 1VJCA 1XTPA 2QXYA 1XD8A 3TRIA 5FPKA 5KJ1A 1DAGA 1P6XA 2GKGA 4TZ6A 2WD9A 3AUUA 3GK3A 6AT1A 4B3HA 5EYPB 2NUPB 2IIPA 3PRJA 4DW8A 3LC7O 3LQKA 1YH3A 3QVGA 1N2BA 1XQ9A 2OZKA 2O1SA 2DULA 1T8UA 4EENA 1JEJA 2GZDA 3WY9A 5GJBA 2IY7A 1N92A 2IUFA 5D7BA 1LX7A 4TMZA 4GOXA 4QO7A 2CL7X 4MVJA 4YAUA 3EGIA 4RFLA 4N47A 4UTNA 2BISA 2XNDD 1N1DA 1W88A 1X39A 3K72B 4YRPA 4AUMA 1R9NA 2OUIA 3GW8A 1XCOA 2I0FA 1PWZA 4C1NA 1QO7A 2H08A 2QIPA 2NPFA 1HWYA 1JDTA 4ZXPA 5HRCA 5ALQA 2XUJA 1ZHHA 4JP3A 3L4KA 3ZOZA 3R1IA 1PJSA 1SVWA 4O2AB 4EJSC 2IVZA 2AYXA 2OCIA 3PGA1 3W5JA 4EO7A 1V6SA 1Z7GA 3EIUA 5ESXA 5FO1A 4A91A 3KQMA 3DVQX 2CHUA 3H2YA 1H6DA 3OSUA 4O5OA 4YFVA 1L5OA 1WQ1R 1KJWA 3RHSA 4GR4A 3O26A 3RW9A 4AT1A 1PQWA 5B6JA 4JI0B 1A71A 2WWHA 2ZR9A 5HCIA 2G28A 5B3JC 2QRQA 3NYRA 5AKZA 1N57A 2BRUA 4DCVA 4YMVA 1QV9A 3TRHA 1MOZA 2VH2A 2VHUA 4OQ4A 4EVRA 2QKYA 2BFCB 2Z3VA 4HQ0A 3WYGA 3IVCA 3HRIA 3OZXA 5JALA 2H85A 4YCBA 3OUTA 4RHEA 5J4KA 2D4HA 2Y05A 4KR0A 4X66B 4ILKA 4M9UA 4KQJA 3WGKA 4JCOA 4DDMA 1F7UA 1Z22A 1CYEA 3PFWO 5F7JA 3SSAA 4XQ0A 3BB3A 1YK1A 5ARDA 1XTBA 4BBZA 1ZMTA 3QBVA 4KXMA 4MUAA 1EFLA 2A1IA 2V58A 4ZT2A 5AJWA 1HRDA 2Q5OA 2PMWB 3MTGA 5KYKA 3BXEA 1BU5A 1R4ZA 3N2GB 2NVWA 1LU9A 4NCJA 2JIDA 5KYXB 4I9FA 1V1MA 3UYLA 5AFSA 3HXQA 4PAMA 2UXCB 2NO1A 2EFYA 1NULA 2BOVA 2PU5A 3IP3A 2F3UA 1R9JA 2F1HA 3M3PA 1PE0A 4KP7A 4OJMX 4IMRA 1UL1X 4F5DA 2KBEA 3MB8A 4EI9A 1ILWA 4NZMA 5ALDA 1GTZA 3GCXA 1GU7A 1C3JA 1C9MA 2K6GA 2QG9A 4MW5A 1NZDA 5CB6A 2QZSA 3AW8A 3DW1X 3O92A 2AC7A 4EA6A 3KPWA 4XCQA 3FFTA 2CVFA 4JYAB 4TX1A 4E5YA 2IF0A 5LB4A 3HYTA 2IXBA 3HXKA 4ZYWA 3V1NA 3EVGA 1U0TA 2QMHA 1B14A 5D85A 2H7XA 4K8RB 1VJRA 4J43A 1ESNA 3K5WA 3MW8A 1BJTA 2K7ZA 4E4YA 3TRKA 4YRIA 3QU5A 2M2IA 2QK4A 5DMHA 1DO2A 3PRHA 4Q0MA 3GYGA 1A9SA 1FS6A 1E2MA 1J20A 2HQOA 3OZCA 3PYXA 4IKEA 2NM0A 1T9BA 4NS1A 2VUSA 1ZA2A 1A4UA 5DLYA 4L57A 5J2UF 1AQJA 1YR6A 1Y1SA 1HURA 1GQFA 1DARA 1FSSA 1JJFA 1G6KA 1Y3HA 3CURA 3LYAA 2OFFA 4S3MA 1G2PA 1R6AA 4UARA 2G8NA 2YJ3A 1YU9A 2G4CA 2HY7A 2VUHB 3K30A 4ZOBA 3W1EA 3W1VA 4DN6A 5A5GA 2L42A 5IXJA 2R25B 2WJWA 4Y2HA 1L5NA 2EQAA 1OLSB 4LOJA 4MJXA 3U7FB 4EFMA 2Q0QA 1V43A 3H18A 2QVBA 3CIOA 4BWVA 1M2NA 2KS6A 3DZIA 2ZYDA 3PD0A 1Y6RA 4YDSA 4DMUB 2QLBA 4JIGA 2HLHA 1EGAA 4ATNA 821PA 2RK3A 1E96A 3PGLA 4AU1A 3CONA 2O2HA 2Y3IA 4PZ0A 3E70C 2Z98A 1ST3A 1K5GA 3K09C 1J42A 1GN8A 2HMAA 5EMLA 4B82A 3FTFA 5AOBA 1JDVA 1O58A 4FFPA 4JVSB 3LCJA 5CD1A 3O8CA 3WGZA 2HDHA 3A6DA 2AQHA 5AD1A 2XJ9A 1CLEA 3FE2A 1MCZA 4WMLA 4JROA 2P7HA 3V8QA 1QP4A 3PEYA 3ZBUA 2Q1TA 2MMCA 1H65A 4JI1B 1ZD1A 4ZT3A 7MHTA 1CULC 3V34A 2JLCA 3QVJA 4RL4A 1LH0A 3FZGA 1F38A 1XNGA 4ZVOA 1KETA 5J63A 2ZRHA 2WJAA 1G21B 1YBMA 1J56A 1KBQA 2PH1A 3FYSA 4K88A 2IXDA 3JPWA 1FIUA 4UDNA 1SKBA 1PTKA 1YFKA 3UH1A 2HZ7A 4RVHA 1RXYA 1W0JA 1FFYA 4UJ5A 2H4XA 1FYXA 4I9NA 1N4AA 4DA9A 2IEBA 2RI1A 2XITA 1WZEA 1XTTA 2JKZA 2PCLA 4H17A 1Z2OX 2VJCA 1JAHA 2UDPA 3PDIB 4HGNA 2UUPA 3JQBA 1H69A 1SCUB 2G40A 3EQ2A 3FOBA 1XZQA 3PTLA 1RADA 2WBLC 1SEPA 2LW7A 1PFKA 1JHMA 5U9CA 4BQQA 4OMDA 4CI9A 2FR0A 4UM8B 4F2WA 3OA0A 1NLZA 1UBHS 4KXVA 3TXXA 1TIBA 3NKFA 1MKYA 1XA0A 1TUEA 5TDHA 2QT1A 1CYDA 3DOCA 2J3MA 5A9RA 2ZM6B 1I1NA 3LSYA 3WAJA 2FCAA 4KIUA 3DQZA 4OEHA 1WD7A 3RS7A 1L6RA 1USVA 2NO4A 3ED1A 4ZP1A 3IFSA 4YJ3A 1Z4PX 4ZI7F 3C5HA 4HYEA 4WKPA 3ONEA 1JKMA 1WSWA 2Z1DA 3H2JA 3ETDA 5AK6A 5JLJA 1JHYA 1VBFA 3RS3A 2CMGA 1RM5A 3UJ6A 2HMSA 1NX9A 1F6DA 1JKIA 3UXEA 1P39A 1OKKD 4MW6A 1S7GA 3QGMA 1G0NA 4L4SA 4TV8A 3OF3A 4AMYA 4ZN6A 1MQAA 6NULA 1YQGA 3K31A 2CF5A 3NVAA 4PO1A 4Z0NA 4P84A 3DP7A 4TTIA 4ZC1A 1QRTA 5EXDA 3KYJB 1CRPA 2P4QA 1H93A 3TWOA 3GGJA 4LFBB 3I32A 1V8DA 2EGGA 4M0UA 4RA9A 4ZOAA 5IBRA 4MDEA 4KPUA 2SKDA 3SAJA 4E5NA 4NATA 5CM8B 3QPDA 2CLEB 2SICE 3VZBA 4D98A 1P72A 2YIMA 5AKLA 4CKBA 3PB3A 3BXHA 4KMMA 4XH9B 2A3RA 3HJAA 3RFXA 3RU2A 1PZGA 4KLCA 2OAGA 5JROA 3NHYA 5KNBH 4Y6OA 2A3NA 1B42A 1IDOA 2RSLA 3THWB 1T9GR 4FS3A 3WLMA 1UPFA 1ZAKA 4DLSA 4G4SP 3TLGB 4PU0A 2O2CA 4IINA 1W36C 3IHTA 3TNLA 4V1CA 2X42A 5CFPA 4YREA 3I1JA 4RKEA 4RPHA 3LLCA 4R1NA 2J7KA 2IEDA 5AM0A 2PUDA 2J0EA 2BKVA 4HNGA 5L7WA 1KU6A 1S6YA 2I9PA 3DWEX 1JAYA 1WMSA 2Q8PA 3T9CA 3W5AA 4FONA 3QFCA 4P7KA 1FS5A 4NZYA 4PRKA 4QLAA 5JS2A 3WMEA 1Z68A 1I2ZA 3AR9A 3CZ4A 3TFOA 2QGFA 3DBHB 3ZVKA 1KFEB 3KWFA 1JG4A 2BI4A 3U5ZB 4D4HA 3R0VA 4BLWA 5KQGA 1D8TA 1GTRA 2A5DA 3OZUA 1CJSA 2F3RA 5FI5A 1FFXB 2WD7A 5LWHA 3QEKA 1XEWX 4HI0E 1PSWA 1YOVB 5GINE 3ZJ4A 1SN7A 1CHDA 4EL5A 5B7NA 3MUOA 1THTA 3RVBA 5L3QA 2OG1A 13PKA 1GPUA 2CY0A 3K0BA 1XRMA 2ZSIA 4GPBA 3W1WA 5L8VA 4XFDA 2IH5A 2ZUEA 3OLQA 1PL7A 1NC1A 5LIPA 3MJDA 4FSDA 3VGPA 2ZG6A 2RK6A 4KQCA 4ZU1X 3JQAD 4E7PA 2OB2A 4UBIA 3ICEA 3Q4GA 4IYJA 1RDFA 5EWLB 1DQRA 1SC9A 4OHYA 3CKKA 1NI4A 2F67A 4RS4A 5IJZA 4RVOA 4XGIA 1DHRA 1SVMA 4GFDA 3Q8MA 2QAGB 4JP2A 1TC2A 2ANBA 3H17A 1A95A 1FDSA 1MFZA 4JI4B 5HJ2A 3JQ9A 2ZVPX 3L6UA 1LXCA 1EDBA 1JLRA 1PJ4A 1H42A 2XZPA 4X8OA 1OR8A 3CCFA 1II8B 1P8AA 3G6WA 1MDFA 2PL1A 4QAJA 3SZMA 5KKNB 3EVAA 1IH8A 1PEDA 3D0QA 1X9IA 4B0OA 3VKVA 3WA6A 3EF3A 3EIEA 4UTXA 4IZOA 4Q1BA 5BP7A 3L5KA 1M0TA 1N8NA 2WF5A 3AMVA 3HO8A 1PDOA 5KO2A 1XFAA 1L7VC 3A2MA 4KWIA 2CDBA 3UK2A 3B7WA 2D4AA 3TLZA 1E1NA 3V8RA 4CKEB 3HEMA 4D3SA 3CLRD 5JNLA 4NESA 3ZQ6A 3FLEA 2FW6A 2IP4A 4QSHA 4C03A 1M9NA 1GGFA 1BE0A 2VLBA 4HQKA 4DQKA 2OZLB 1RM0A 4B80A 5JAZA 1WDTA 3IP8A 5LB2A 1GQOA 2GKOA 3HA7A 3TEFA 4F3KA 2O52A 4NH4A 2PWPA 4G5GA 4GE0A 3PX7A 3SQOA 2HKIA 1DO0A 2AD5A 3GRKA 3N2YA 4L16A 4MTCA 4YAWA 4Z9BA 3OE5A 5L3RA 4RD0A 1Y7PA 5KNDA 5MGBA 5F1PA 5BNZA 4MUIA 4UCFA 5E2BA 1D6JA 3H11A 2C31A 1LBHA 3QTLA 1QLWA 2IYNA 4XIYA 3V7FA 2GN1A 3PUWA 1IPFA 4RS3A 2YIVX 2V9ZA 4BJ3A 1YA4A 1M2EA 4RC9A 3RRNA 4Q7MB 1QGED 4I8DA 3U40A 2ENWA 2H0AA 3VVCA 1V2GA 3KXDA 1JFTA 1NXTA 2YXLA 3BWVA 1GARA 3LUAA 2EWWA 4LDPA 4R2LA 5DCWA 3IBYA 5JWOA 4LPSA 4F72A 1HKHA 4RVUA 1CUVA 3GV0A 3IEPA 3SC4A 1GGMA 3TZQA 1Y8CA 3JRWA 5AUPB 1DJNA 1DUVG 5FNVF 2IZ5A 2AW5A 2RH5A 4PZ9A 3FVQA 5H3CA 3DLIA 1QV6A 1U3UA 4QNRA 2IH2A 2DTDA 4B9AA 2RH9B 2BIFA 1E5DA 1BWSA 1XVAA 2DLDA 3P4YA 2W11A 1T1GA 1XEXA 2HCJB 2HSWA 1XQ1A 3K9NA 2CDCA 5CEEA 1Z4QA 4ZO6A 2C5SA 4BVBA 1HM5A 1YKFA 3UGTA 3U3RA 3N9IA 3OQBA 5DXJA 3LIIA 4DV1B 2XEXA 4C6SA 2B2XA 5JAHA 3R75A 2B3DA 1AKUA 3E7WA 3IVMA 4JLDA 4OXXA 3CZPA 1ECCA 1P73A 4R69A 3RSSA 2FZVA 4AICA 3Q3EA 1K6EA 2GEJA 1MEEA 5ESRA 2R8RA 4RTSA 1QU3A 2HO4A 2C97A 2EFJA 1GEGA 3ZLUA 3NEJA 2QW1A 4WPGA 5JJLA 4MQMA 2C2OA 4TWAA 2FQWA 3W2FA 5AW1A 1KDPA 4F4DA 1JFFA 2X23A 4IXWA 3MMZA 2I5PO 1W6RA 5JC8A 4L9SA 5EN4A 2NQTA 4A7PA 4MS1A 1Z5UA 4NVRA 2VP6A 3LPDA 3LDGA 5F3DA 4QDXA 4Y9UA 5J4LA 1C7IA 5F2NA 1DNPA 2C94A 3PQ8A 3TCNA 3P2JA 3X1DA 3WQSB 2FKAA 1DELA 1CSEE 1Z6TA 2H51A 4PYNA 4XLTA 3T3NA 2UXBB 2J0QA 1PKEA 3OZIA 1GNQA 1FMLA 2HIMA 5FUVA 1UAAA 3TTSA 4DJEC 4KV7A 4NJOA 1LK5A 2BDTA 2V6FA 3CLHA 5J2TF 4DNQA 3FPLA 4I4TB 2GBGA 1XOIA 1I7QB 5COBA 4AKHA 2Y0BA 2L17A 2C2MA 5DLPA 4LHYA 2ADFA 4IFIA 4BJHB 1KE2A 1CRZA 2PZEA 2RBEA 4Y9RA 3IP6A 2A7XA 2AFIA 2B5WA 4B74A 1FRNA 1UBNA 1E2HA 3RVLA 3FW1A 3Q88A 3X1MA 2OM6A 2WHRA 1F2DA 4QQFA 1TCVA 1QTIA 2P2SA 4J9UE 4P4LA 4QFDA 1GU0A 1PJZA 3F67A 1J1UA 3K6SB 1J8MF 4D7AA 2PMFA 3CPHA 2YOFA 1ECLA 3USZA 3KD3A 1DU4A 4FYJA 2Z8ZA 2H48A 4H59A 4LWOA 1XZCA 1T29A 2ZETA 5BOVA 3GUYA 1SU6A 2DQSA 1OYYA 5FHQA 1U65A 5HIAA 2JBHA 2WZQA 4R7TA 5IYZF 2PT6A 1E3EA 4QA9A 4PLTA 5DGDA 1BWQA 1GILA 1ZCZA 3F98A 4QTZA 5DX8A 5BR4A 2FE4A 2O9JA 3PGXA 4WK0B 3GEEA 1C1DA 4FZVA 4EQ6A 3PLAE 3TKLA 2MSLA 3VTKA 1JA1A 1L7BA 4TVSA 1W94A 1Q22A 4J0IA 3R0IA 3V1TC 1BHO1 3VPAA 4OX9Y 3BRCA 4CLHA 4DBLE 4P86A 2HB6A 1IRXA 3EQZA 4A8PA 1LUAA 5AESA 4BB0A 3V6MA 1NLYA 4BP3A 1FU4A 1XJ5A 2NTVA 3MD0A 4BASA 1PJAA 2BZGA 4JEIA 2MSCB 2V0NA 1IMJA 3KSDO 4ISCA 1PK7A 1AGPA 3DJFA 3P2KA 4M36A 1GUAA 3IV9A 4DLXA 3A31A 4F7WA 3O84A 4I55A 1ZCJA 2WT8A 3EWAA 1GZ6A 4D8XA 1I5EA 2CXUA 1TJPB 4I9UA 3ZWBA 4PR0A 1YASA 4CDNA 1RZVA 1CVIA 2ZJ7A 4EABA 3WICA 5BN1A 2V7BA 2O8CB 3GA7A 1KSJA 2ZXFA 2P2LA 3GG2A 1YS2X 1JT2A 3D6UA 3RNLA 2BBSA 2G3YA 4ZOQI 1VYTA 2DY0A 3AWIA 4WLFA 5JDCA 2BC9A 4LUCA 5JNVA 3E22A 3VU9B 4B87A 3EJ6A 5I4KA 3A37A 1U0FA 4OHRA 1NDHA 4HSEA 4ZALA 1N32B 1IN5A 4BECA 1VPLA 2C9CA 1P9OA 3D2AA 3QPWA 4JELA 4H1WA 1BXRB 1PO7A 4KWCA 4NFHA 4K9PA 4M60A 5B1HA 3HJGA 5DGXA 5LZ5A 1OC4A 4JQCA 2MR6A 1NXWA 5L40A 2ZUWA 1DEOA 2GSDA 1ISRA 5CGZA 4ZK6A 4C21A 1E7QA 3P52A 3NONA 4MVJD 3CUYA 2CJXA 1ZRNA 2E1PA 1ZGJA 1ZFNA 3A05A 1P4RA 5FNZA 3RFCA 1E1QA 1L4MA 4M1WA 3RUDA 5C51B 1MW8X 3I8SA 3ZE9A 3Q6MA 2CT8A 1E89A 3E8XA 4Q16A 1LF0A 1SIOA 2FZLA 4PGGA 1J90A 4LC9A 2BMAA 2YY6A 1L4HA 1NUPA 2XRYA 3W9BA 4ZV7A 2IKSA 5IJ0A 1KKUA 1RWKA 3SYNA 2O5CA 1PJ2A 3WL8A 3H4MA 3HV2A 1KAQA 4RFSA 2Y0CA 1ZW6A 4BBAA 3I72A 1F8XA 3D6JA 1WCXA 2WHYA 5AUQA 2ZZNA 1FQOA 3WRYC 2J5RA 1K86A 4GKBA 3OM1A 4EI2A 3JQAB 5D3KA 4XASA 1C0KA 4IV5A 4DKJA 3WC4A 1AO3A 4W5RA 3FB1A 2REXB 3THRA 3DWGA 2AR0A 1YQWA 4KE9A 1Q2XA 2IEGA 1WXXA 5K8IA 1DAOA 1HQCA 2VAWA 4CEHB 1PS0A 4LZZA 1SUPA 1NKTA 1F2TB 1SVIA 2MJLA 4FBMA 3RI3A 4D92A 3BTVA 4EMTA 1N8TA 1PZMA 1GG5A 4FD2A 4N5DA 4KI0A 3QEAZ 1YMUA 4JJFA 2YYYA 1GAEO 2PNFA 2ZYGA 1R8QA 2C07A 2C2KA 3BDIA 3MILA 3MWDB 3QLJA 4QQKA 1G5QA 3RIXA 4K1XA 1BFDA 1EWQA 3C7CB 3NV9A 1UFQA 4IIGA 3S2ZA 1K8YB 4M0FA 4UU8A 3VU1A 1ZOLA 2C4UA 2JI6A 2XV1A 4CODB 4IMJB 1ESEA 1PVOA 1VYHA 4K6FA 4TSFD 3U4MA 1JR3A 3PIDA 2P2ZA 1EVYA 3AVWA 4F11A 5KYXA 1ZGAA 3HLKA 3CWQA 5KX5F 2ARKA 5KOJA 3PA8A 2X3YA 3F5FA 3T7RA 3GP3A 2QV7A 4KXWA 1E5TA 4U9IS 2XQFA 1XCPA 3JCZA 1J06A 4FGUA 1G291 4DXHA 1E4EB 3G9UA 4MRVA 4D4LA 2P8JA 1N0UA 1P9WA 2Q4DA 4LOAA 4I1OA 1H94A 4UBMA 1ADBA 2AE2A 1C8BA 3EOBI 3KAKA 4ZT5A 4RMHA 2X4LA 1I0IA 3A3KA 5M29A 3KQLA 5I3ZA 2PUEA 2Q0SA 1V16B 3A6FA 2EJUA 5B3JA 3K70B 2PD3A 4E2FA 2Z4SA 1X74A 4L5YA 2VQEB 1E9CA 2AQ8A 2ZK7A 4U2KA 3CS3A 3OAAA 1D1TA 4JR1A 5E4TA 1A77A 3DEJA 1DAFA 3A1SA 3Q8KA 3Q9SA 2PK3A 2ZSUA 1UMCB 3KPJA 3UMYA 4YUWA 2FYTA 1FEZA 4OB7A 4HG2A 5BURA 1TNDA 1NW9B 3N0WA 4LC1A 5FI1B 5FA6A 3S68A 1QO0A 4R1MA 3KU1A 5TVKA 2J09A 3K3PA 3X43A 2QIOA 4D6YA 1YNOA 2QDKA 3ENWA 1YRHA 4N3CA 1DEAA 3CW8X 3GEDA 4HO1X 1QOPB 2FVYA 2IHKA 2LPMA 4JFRA 3BIOA 3ZDFA 5CCDA 4YEDA 4D9FA 4F3YA 4F3CA 5JNRA 2PYZA 2P6UA 4GX1A 1BWPA 3C8MA 2VWQA 4RMGA 5COQA 3ZK7A 1MT0A 4R9UC 3C4VA 5B64A 5K0EA 1JG2A 3MAAC 2G5GX 2Y27A 4WK2B 1VLJA 4HDOB 4JQOA 5F2OA 5GOTA 2B20A 1Q20A 3MUNA 3P9CA 2VDRB 3QBEA 1F8GA 2B35A 2VRCA 3KKNA 4KJXA 4BNUA 1NFRA 3CX6A 3DZBA 3L6BA 4IXMA 4TRRA 4MJ7A 4QYIB 3DPUA 2I33A 2FN7A 5KNCD 5DYNA 5KPDA 3Q3CA 1YIOA 1P91A 2ZDGA 3Q8XB 5B1YA 2QTVB 1Y4ZA 3HVUA 1F3LA 4ARZB 5KNCH 5E4JA 3ZW8A 3AY0A 4BAUA 4N1AA 3P4UA 1IDN1 5K1ZA 1S4QA 2VDUE 3TZLA 3UT0A 2XF2A 3L06A 4IG4A 1JHAA 4MB6A 2CHVA 1QFMA 3WNVA 2UUAB 5EERA 1DUIA 1IOVA 3FBWA 4G0VA 5BW4A 1E3LA 1FK8A 3EDYA 4IGFA 2O8FB 2GN4A 2JAQA 3ZJYA 3JZDA 3EMDA 5JWRA 4F2HA 1Y8ZA 3MCAA 4W7HA 5F4BA 1HNWB 4L8YA 4NQRA 4V0NA 4B17A 1BJKA 2H1IA 3B5EA 3ESQA 4ZYUA 4RDXA 1QUEA 1V5IA 1JS1X 3EN0A 4JR2A 4BWFB 2YYAA 4DV6B 4BATA 4URUR 1Z2AA 4S0ZA 2H7YA 3LVFO 4CCAA 2Q4BA 5EINA 2Q0HA 4DR5B 4ZMRA 4MA0A 1F17A 4FT2A 3C3CA 4RMJA 3R0QA 3LLSA 1AV7A 2YWHA 3UMJA 4NJMA 3WGQA 1X1TA 2B7CA 3AJRA 2EKLA 4Q3LA 4DIFA 3OJWA 1LS1A 2XNSA 3T06B 2JIRA 1FS4A 1NW3A 4GKAA 3UPDA 4HQFA 1T13A 1HFEL 1I4WA 1NSTA 1PJ3A 1X8XA 2NZ2A 2QD3A 5IVDA 3S1LA 1RJFA 1RQGA 4EZEA 5KJ6A 3IIKA 1GVNB 1QPBA 2CNWA 2IPXA 4BYMA 3A3YA 3DOIA 5E9AA 4M2LA 3RAPR 4IM7A 3GPLA 3F7MA 1SK8A 3GRAA 3IV7A 4ZDKA 3WWZA 4A03A 2W93A 4A16A 3PR3A 5CG2A 5K6RA 1EE9A 4EDFA 2R2GA 1EQAA 3FCCA 3K09A 3PR1A 1LZKA 1TQ4A 3LHKA 5BVHB 1P4AA 3TR6A 3URKA 5B30A 4RULA 1YZQA 2QG4A 5CX1A 5J5AA 3AF5A 3I53A 5CFZA 4RTNA 1KZ4A 3CX4A 1JVBA 3OECA 4I6EA 3CJQA 2VPWA 5EQTA 1W0CA 1AG9A 4LV8B 4P7JA 1L7NA 1R8SA 3DEFA 3R44A 2P8SA 4DY6A 3K8YA 1RABA 4FLFA 1NC3A 3PFNA 4G65A 3RLFA 1RJDA 2DBVO 2ZUUA 3DEZA 2UUBB 3N5CA 3I64A 3U44B 5H1YA 4X6YA 3UHOA 1SHJA 1II0A 3AU9A 1D6MA 4TYPA 4Y7DA 4C4XA 3EFHA 3U3ZA 1RKBA 5J2UB 1A69A 1JA9A 3G5TA 3QFFA 4AX4A 2W7TA 2I2AA 4XIIA 4BO2A 4NU6A 4DSNA 1JH8A 3H8VA 2NTEA 4GOLD 4KSBA 1E20A 1I3MA 5AWFC 1KFJB 4Z86A 4HZGA 1XTJA 2ZUTA 2O14A 2W6JA 1N2EA 1SG9A 1XTVA 3HM9A 2FUEA 1C4XA 2ZRLA 1IHPA 3KXKA 4LDAA 3PZRA 3MC1A 4I8XA 4J07A 5SZIA 3CVUA 2R5WA 3MFYA 4D56A 5BV1A 4B6FA 1Q7GA 4I5IA 4JXKA 1PW5A 3UMBA 4M9CA 2CLIB 1KO7A 4YJFA 5DHQA 4ZJZA 2CMHA 1EQUA 1RYNA 2CV1A 2CHGA 1MH9A 2E0IA 4NMMA 5BWLA 3FM9A 3KJEA 1JHZA 3KQVA 1ESZA 4QRDA 1AKYA 2VSOA 2DFLA 3I6BA 4HWTA 4L74A 1FMTA 1MEJA 4R1QA 2XDWA 5BV7A 5EJ4A 5FLYA 1VL6A 2DUNA 5H68A 3USES 3E27A 4G0YA 4H0FA 2QVCA 3PIIA 1J0BA 1FFXA 5CDGA 1BGWA 3N70A 4TOIA 4Z4HA 4R16A 3R7FA 1ABEA 4IDBA 2M98A 4KH0A 3ETGA 3KKEA 4MQ4A 5B5SA 3B5JA 3ST7A 4EG6A 3MTBA 2CDNA 4K3UA 4UVIA 4D9HA 3FTEA 5KHAA 3KJXA 4FFDA 4L6CA 4BMZA 4F46A 4B75A 1X7YB 1P9LA 1DJPA 2GF0A 4R9SA 4WJLA 4GXTA 2Y1CA 4ZCSA 2E21A 4OAQA 3I6ZA 4GVPA 4GWKA 2XB9A 3S28A 1C7ZA 4JLVA 5EWLA 4CQMB 1LSOA 4ZVLA 1S2DA 3U2QA 5HKKD 1HNNA 2ZWOA 2MTBA 5I7VA 5JCJD 5T6BA 2X22A 4PG6A 1BGVA 1U0NA 1KQOA 4G26A 1K8QA 4JSTA 3T9AA 1DQNA 6REQB 2P9HA 3ECSA 4M98A 1HLGA 3M6MD 3VPBA 3WQBA 1VKNA 2PDAA 3CNHA 3QFTA 4C0BA 2FP4B 4DUZB 2LRHA 4GRAA 5E6UB 3SOPA 1LVUA 1QANA 2AOUA 3ZXXA 1JHOA 1YUNA 3C45A 3HUTA 2WNIA 3OZFA 3HEAA 2DCMA 4G1VA 4TN1A 1JDPA 3DDZX 1GGKA 4BNVA 3N6RA 4HAZA 5DCUA 1VC2A 5TQVA 5IUNC 3CF2A 3E7DA 4H18A 4IBOA 2P79A 4L73A 3O8QA 5CVUA 1UC8A 1LPSA 4JJZA 3C6BA 4WXHA 4CFSA 4EG8A 4ZI7B 1B00A 2IHNA 5DM4A 5G0TA 4BFWA 2QA5A 5JSUA 3CZMA 3S44A 3A6KA 4XD7D 3FCSB 1OX4B 1ZBDA 1OU0A 2IC5A 2O4UX 4RHFA 3T0GA 1Z5VA 1R4NA 2ZAIA 1ZH8A 4WASA 4UVHA 5EZSA 4ZJYA 3BBLA 5HOEA 3E3OA 3NIDB 1B76A 1G8MA 4OU5A 1LC0A 2G25A 2WIJA 3BN3A 3QBJA 2CFRA 2WP0A 4WKNA 2BHSA 3GFBA 1F5SA 1PFWA 2WU8A 1I2MA 1UBUS 4FEGA 3BJMA 5HJEA 10MHA 1SD2A 4UNNA 3SU8A 3H5TA 4FPXA 1A4IA 4UASA 1AA6A 5NULA 4XIJA 3IO3A 4K05A 4V38A 2VR1A 1QLHA 3Q3HA 4K81B 3FPEA 1LV7A 1YB2A 4YMSA 4DIUA 1YJAA 3OLVA 5E6SB 4ES6A 5EJ6A 1PT6A 4F56A 1G18A 1U9CA 1ZEMA 2JAHA 2TSYB 2IT1A 1MTZA 1LK0A 3BE8A 1JYEA 2VXYA 1C2TA 4DZRA 1ZMXA 4LYYA 1GDTA 5JWHA 2ZBPA 3I23A 1CUZA 2DKFA 3HJNA 4C7BA 1XWFA 1JALA 1RMQA 4OHCA 3WAKA 1G8SA 5J4HA 3BAZA 4F93B 2WFAA 3Q10A 4OYRA 3H04A 1CZOA 1MGPA 4AJIA 3KYIB 2JI7A 3R9WA 1MOPA 2J7PA 1TYAE 3ZBTA 2E4ZA 3BIXA 2GS9A 4FDLA 1R8YA 1DFGA 1JLLB 1B6RA 2B0JA 2Z08A 1VRWA 5DTQA 5FP0A 3UJ3X 3SZOA 2QU7A 1ISPA 3GJ5A 1OB2A 3Q0IA 3H1GA 1VKZA 2JGNA 1QNLA 3KYCB 4GMKA 1ECBA 4EY6A 1OWOA 2QSZA 2XE4A 3KNZA 4YMUA 3VHLB 2HTFA 2C5EA 3D02A 1HMYA 1BROA 3GDFA 1R74A 3HGQA 1TIKA 3I9V6 3QKTA 3TZHA 3TYXA 3VDNB 3HBMA 1KQPA 2I1WA 2P7IA 2ZAMA 4UREA 4F12A 2I66A 1A82A 1T15A 2CNLA 2O4CA 4HAUA 5JC1A 4PTYA 2I2DA 4Y6PA 2Q5HA 4L85A 3K5PA 1E6WA 1O9GA 5K0LA 1BCRB 1R6XA 1YIAA 3A9VA 3OZVA 3NOVA 3WBBA 2P4UA 3QENA 2VFAA 2YTZA 4B40A 4NNJA 3OA2A 3D7NA 4RK4A 2W8BB 4UTPA 2N47A 3NGXA 4LZNA 5C9ZA 5HTOA 2QBYA 4FC6A 1QH1A 2A57A 1KGDA 3IJEB 2QPAA 1AM4D 3PT9A 5D3MA 5NLLA 2CJWB 4HDMA 3G49A 4JT9A 3MINB 1V4VA 5B58C 1ZJ4A 2ZYIA 1P0QA 5FA8A 2A1TR 4GLOA 3AERB 4O4HF 2GEUA 3FOCA 3F5MA 2Y9MB 5A3RA 1C3OB 1AC5A 3NHSA 3A0UA 5LQUA 1WW8A 2HJ9A 4HRVA 1QQ7A 3D4PA 3WADA 1RT9A 6LDHA 4E03A 1R5BA 3C8HA 3BB4A 4K0RA 1FFGA 2X8JA 3ANNA 4QTTB 3SZRA 5IAAA 4CXMA 5EVJA 1JH9A 1ZLYA 1KO5A 5T3UA 1VQ1A 3M3HA 3A1TA 1X19A 4X93A 5REQA 1U2GC 1P0MA 4OSPA 1JEYB 2BEUA 4HK4A 2GJ8A 5E4FA 4DR7B 5HOQA 3WNCA 3D8NA 1R5OA 2R6HA 1ZP6A 3NTXA 2WOOA 5EJAA 4EY8A 3K16A 5DYTA 4US1R 4HAVA 4RFVA 2GCNA 2OV3A 3GPCA 4JLKA 5AVVA 3AOEC 3FDXA 1KZ7B 4D6XA 2JJ8A 1IWPB 3A4MA 3MHPA 4BBJA 1APBA 3G89A 2PV0A 2Q2VA 1TM1E 4CMGA 1MJFA 1X8KA 1M67A 4I99A 5JBQA 3VO2A 4JCCA 5KS2A 2D1SA 1LBEA 2BD0A 1DRWA 3KE8A 3ZEAA 1WWKA 4EHHA 2ECQA 3OT5A 3AKDA 4PYOA 1GZHB 3AY6A 3TSOA 1BEEA 1ZGGA 2BFEB 2HQSA 1SD5A 3LUPA 4YVFA 2DUJA 1I7NA 3AJEA 3UG7A 3S70A 1BXKA 4L8VA 2HWYA 2I4NA 2NT4A 2PRKA 3IDZA 1TDJA 1BKSB 3TCKA 1UZUA 4R1UA 4DLWA 2VNAA 3WZ2A 3AG5A 4G2NA 2Q6IA 5FNVB 4C6HA 2IJGX 4CG2A 4L9RA 2YV4A 5FWYA 5JNSA 1G1MA 4G5SA 4YRSA 1T4DA 3F96A 3I6QA 3ID6C 4LVCA 5ES4B 1FYFA 4MHSA 5IJ9B 4LF5B 4FHDA 1TAGA 3K9BA 3VU9A 4C0AC 4LQLA 1PWHA 1KEUA 2X4IA 4S1WA 4HRXA 3C2QA 5DYGA 1AKRA 1V8BA 3ETEA 5BW5A 5LQNA 4ZAZA 3U6BA 5IG2A 4YP0A 1BXRA 1VCOA 3QSYA 4ZREA 1M1YB 4X44A 4R51A 2EC5A 2RHJA 3HCRA 2YBEA 1FTYA 3MMXA 4FN4A 2GPSA 3X2EA 1XD2A 4LQ4A 5F9HA 1DRKA 5CFRA 2WHEA 2W8ZA 4BE9A 4JI2B 3ILVA 3IUSA 4GMHA 4E2ZA 2W00A 2R47A 1DTSA 1OFHA 2VJOA 3R3YA 2P78A 4K1LA 3FPSA 5F52A 4P5EA 5SZKB 4I50F 4WZAE 1GDHA 1L4LA 3ADBA 4HXEB 3EBPA 1KIFA 3DLAA 3OU6A 4WCFB 1FTSA 3SC2A 2BF4A 4NBNA 4QBTA 1IBCA 3LNTA 1PGJA 1E0KA 4GXRA 2XCTB 3OP4A 4GBGA 4CG3A 3PXDA 4JS0A 1JBQA 3V2UA 2MINB 1HT0A 4N12A 3W5IA 4ENSA 3NXKA 3W6PA 5BN3B 2VQ6A 3OMWA 4GVXA 3HVRA 5J2TB 1WZCA 4UE3S 2PRIA 3PD7A 5LMNB 1JNYA 1GQ2A 4URFA 5A4KA 4GD3Q 1PT7A 1F4VA 1FDVA 4KKVA 2GCOA 3PUHA 3EGEA 4L4YA 1C8KA 1FFSA 1GUBA 4NENA 4WKBA 4GO1A 4OAOA 3R6DA 2ZR7A 4PNPA 1KEZA 4JJGA 4W7SA 1G17A 3HU3A 4ACBA 2QD2A 2CHQA 1C29B 1ZRSA 3A04A 3LUFA 4MUHA 5IKPA 1E6LA 2DWOA 4FGKA 2BDUA 5EPEA 5L4NA 5FR1A 1YVDA 3NRJA 2V5VA 2GWHA 4CKWA 3BMOA 4MNTA 3K9FC 1Z63A 1T3SA 4IOKA 2GBPA 5DRTA 3NORA 2FOXA 4J9VA 4RANA 4NV0A 4B85A 2ZRBA 2CNDA 3OQ6A 1VHJA 2WUWE 1Z7BA 1Q17A 3MCVA 4ARIA 1ECPA 3HA5A 3K4QA 2BP7A 4FMPA 3T3HA 4ZXFA 2OP0A 1YI1A 1D5WA 1ZITA 3AEKA 3VOTA 4C20A 5IBQA 3JWGA 3AB7A 1UOPA 3QHAA 3EDQA 3FRHA 1OREA 2WLTA 3FAZA 1BVRA 2J0UB 2ST1A 4GAEA 5KTNA 2V7QA 3NC0C 4C05A 3J7AC 4EFKA 5L9AA 3OKFA 3ANYB 2NQ8A 1UBKS 1HC7A 3PHJA 4TZKA 5JV5A 1PJ8A 1RC0A 1Z4KA 2I99A 2XNCA 1UXIA 2EAUA 3I9KA 2O2YA 5CHEA 1EGHA 1MT3A 4YB8A 1JHRA 4LS3A 4BLSA 2XNHA 4F1KA 1ZOSA 2BGJA 5HWSA 2GXSA 3ZI0A 4B79A 2ADMA 1Y9EA 3H0KA 3DBRB 5GMOA 2IS6A 1WY5A 4YN3A 5BVGA 2JFVA 2WWIA 3H9CA 3MWGA 3O83A 4CV2A 1OILA 5FEMA 3R7DA 1T36B 3T5PA 3FYDA 1JXOA 1U5AA 3RT1A 2CDAA 4GNRA 4DUYB 4PTZA 5LYJA 3P7MA 4N54A 1DG9A 1XMPA 2HGSA 3Q8WA 4DHEA 3H6GA 3A6JA 1L1RA 3FKJA 3OQJA 4M8KA 1UXOA 4PYMA 4ARUA 1Y37A 1XKXA 3ZE6A 4L5IA 4J1NA 1E1CB 2K2WA 5MFZA 4IR7A 3OZDA 4YECA 5BSEA 3ANMA 3IBFA 4R9VA 1N2IA 5F51A 1NXXA 1TLFA 3TGLA 2ZROA 3GJYA 4L7VA 4PSUA 4KMSA 1L6IA 5BN4B 4ZU6X 4FIDA 3L0DA 4PPGA 2AG0A 2V3VA 2JIMA 2QY9A 3LDAA 1L4KA 1VKRA 4XUGB 2QNIA 3I9LA 2VHQA 1IZ7A 1GCUA 3H5LA 3AY7A 1H0RA 5I7OA 4B3GA 4OKSA 2Q3CA 4I3HA 3TI9A 2RGGA 1BDBA 2NLOA 3NG1A 1AURA 1DI0A 1GWNA 3HVIA 3PXXA 1VCMA 4ZPXA 4YTEA 2MSWA 2FSIA 3U0VA 1FY2A 4MR9A 3E9MA 3U9TA 1PR1A 3B9PA 1W4RA 3EDOA 3HYSA 4QYIA 4Z54A 4C76A 4IFBA 4KXQA 1EVKA 5BOSA 2X9GA 1LQ2A 3PNLA 2CBGA 4HYQA 4OXQA 1CUWA 4MV6A 1EXNA 2RDMA 2A9QA 2E6UX 2ZBVA 3VAAA 2C8VA 3GLHA 3RC7A 4DDKA 5LQCA 4S2UA 2YOHA 3HCBA 4LHEA 1GKIA 4IDPA 2C61A 4ZTZB 1E1YA 5EJ9A 2HPVA 2QZ4A 4JU8A 3IH5A 4Q00A 5K2MA 3GJ4A 4E4TA 1O4WA 2VHEA 1BX1A 1D9XA 3LZCA 2HWXA 4D57A 2YINC 2XTZA 3FDZB 4NPHA 1DOZA 1M2OA 2A92A 1CQIB 2R6DA 1AUOA 3OD5A 4J90A 4MS4B 5TGZA 1MF7A 1J2UA 1RPTA 3A4IA 4U9HS 4B73A 5BSWA 5FV4A 1AK1A 4RBNA 2DQZA 1YQXA 4H4EA 3EX7C 2QXUA 1C7EA 3FHJA 1G41A 3TR0A 1F0NA 2P41A 4OI2A 1J0EA 4AJ2A 4LCEA 1YS9A 1XJ0A 4HP8A 2EWMA 4M1KA 1PVDA 1J9ZA 5AJXA 2C83A 4PRLA 3T3DA 1ZMRA 2FEMA 4G5QA 3W3AD 3ZDRA 4F21A 1UJ6A 4P4TA 5F98A 3AP3A 1EJ0A 1BDHA 3ZC3A 5L6LB 3PHGA 2RCNA 3M34A 4X1OA 3W3AH 2XKKA 3TRFA 5JZ9A 4ZI3A 3DZKA 3MA0A 2A67A 4W5TA 2PD4A 4IGKA 1P3Y1 1T8TA 4Q02A 4UMFA 3TLYA 5FAXA 1BVYF 1WJGA 5KX5B 3T61A 4Y2GA 1FDTA 1UZLA 4L8WB 4CDGA 2FMTA 4OY3A 2HV9A 2IYEA 2Z8XA 3N05A 4BX2A 5IABA 3C48A 4NP6A 3FF1A 4TKLA 1WW3A 4QJBA 1T2DA 4ENUA 1PP4A 2X0KA 1GRCA 2OO7A 4X45A 3E58A 5JADA 4YX9A 4F2GA 1O96A 2N75A 3LPCA 3RHZA 1Y3IA 3C3XA 3ELDA 1KRWA 5DSXA 3KD2A 3ZWDA 4TMWA 4BGEA 4BNHA 4GKJB 2DEUA 1M8KA 1L7MA 2BMDA 3O3CA 4N01A 1F9EA 5DI9A 1Z17A 1BVUA 4B2YA 3LK6A 1P74A 5EUCA 1P4GA 4JT4A 1E0AA 2OQVA 1XF1A 4Q37A 4CN8A 1EUDB 2QPLA 3A1EA 3F6CA 3B1XA 2C3YA 4PIPA 4B3DA 2IYAA 3ZDDA 1N5MA 5C18A 4DA6A 3E48A 1Y0BA 3FGOA 3E4DA 5AI5A 2ZRIA 3OIVA 4JL5A 5G40A 1MQ8B 5DNUA 5THKA 2ESRA 4PGMA 4R2WA 3AM1A 1ESMA 2XRZA 1QS0A 4AIIA 5IFLA 3Q2OA 5P21A 4YXFA 1KYTA 1QQTA 4I4LA 3AVUA 5JSZB 3VGJA 1DWQA 2V7PA 3Q0TA 3H2HA 2NXNA 4OTZA 1NVWQ 2B4QA 3GDOA 5F73A 1E3QA 5LSAA 2NVBA 4OI1A 4FYXA 3GRVA 3O31A 4M9RA 4GZ5A 4NF2A 1I7SB 3FMFA 4EG0A 2QQEA 3C1TA 5ALHA 1UJ4A 5JZMA 4CL2A 4MWEA 4U6NA 1D1PA 1EKXA 3NJ8A 1NIPA 2PUTA 4Q9HA 3UMRA 1UM9A 3QVLA 4JU9A 3TW6A 1TO2E 4CTOA 4EF6A 4O2BF 3CUUA 3CUKA 4RK0A 3PT5A 3ZU4A 3OQOA 1ZIPA 3GZJA 3PJFA 2P2NA 1ZH6A 2UUCB 1P4HA 4F8EA 1Q50A 3REFA 4AJPA 3SE0A 1DQSA 2IZ7A 3A36A 4UNPA 3VHRA 3MCZA 3IDSA 3UUWA 4HNUA 4K6CA 2JGEA 1YZFA 4W9RA 3QWAA 2ZI3A 4CGYA 1US8B 1QC5A 5C4IA 3SVTA 2O7QA 3CGWA 2HSJA 4IZHA 4P22A 4BX0A 4GLJA 1Q57A 1P2VA 3MS2A 4QUKA 5GM1A 4WXRA 2GM9A 2QX9A 3FCYA 3O3MB 3TBKA 2FSSA 3HXLA 4L07A 3WMWA 1G19A 3TQCA 3RAGA 3P5SA 1JWLA 2OV1A 1J5EB 1K2VN 3NT2A 1OTHA 3KZNA 2O5RA 3EA0A 4CQMA 1NVEA 4YMIA 1W36D 4X97A 4H08A 4KPFC 2X0FA 2D5AA 1O5IA 4TTJA 1DFHA 3HNRA 3LH5A 4LZOA 3P9IA 3PJRA 2H92A 2PX8A 2IDMA 2XZDA 4ALIA 1G21E 3UATA 6REQA 3FNGA 1EVEA 3EFBA 1XVIA 3QJGA 1I9CA 1GUDA 3MD9A 2ZYSA 4N82A 3N7AA 1XLTC 3SR0A 3TLMA 2PJRA 1C1YA 1QDEA 1T1JA 1SBHA 2EZUA 2R84A 3CNEA 1NW4A 2QUHA 4HCJA 1CRLA 2ZJFA 4KOEC 1KK0A 3V80A 1BFKA 1E5QA 5A6SB 1CXZA 3L4SO 5EXPA 2XXJA 3TAXA 1YR2A 2O8DA 1OI3A 4LYDA 1EBUA 3OJOA 1FNDA 1XQ6A 2GYUA 3EMKA 4X24A 4BRZA 1BIFA 4QDUA 2VOEA 5THQA 1WBBA 1IIBA 5JZBA 5FOTA 3SLGA 4GYJA 4ZI7A 3IVGA 1KPGA 1NASA 5CAEB 1AK9A 1UEIA 2FMHA 1MAHA 1PNVA 1DAPA 1WRBA 2GYWA 3A1DA 4NK5A 5E3HA 1Z5NA 2PUFA 1KPHA 2GYVA 4IJMA 1NF2A 1Z56C 2SKCA 4A1OA 4AM8A 1E1KA 3DHEA 1JXQA 1IQPA 2FUCA 2IH4A 3LC0A 3ZXIA 4W1SA 4FMDF 4PZDA 3IPLA 1NT4A 2WNHA 3GZ4A 3GLUA 1T2FA 4WWHA 3ZE1B 1A7UA 1NNUA 1UMDB 1KS2A 3OLZA 4KX3A 3UUEA 1P5HA 1QVRA 3NIBA 3MJFA 1J2YA 4JYMA 5CMLA 1LLUA 5HYVA 5CCEA 4MO9A 1YB7A 1ORDA 2OLJA 1MV8A 1H2RS 2OR3A 4D3FA 4B3CA 3PD1A 1GZVA 3VNUA 1Z0UA 5K3BA 4GPEA 2AVDA 1GYPA 1VLVA 2PSSA 2EYQA 2RHWA 4A23A 4QT0A 1CF2O 1PZXA 2C98A 1YCDA 1Z12A 1GJRA 2AK2A 2JPDA 4Y9DA 4UPEA 4E4RA 4YR9A 3LP5A 3RK1A 3FKSD 2P1DA 4G9EA 3ZX4A 2DUUA 3NUQA 2HV8A 4RWEA 3RC3A 4LKRA 5L7TA 2R2AA 1U0RA 1TKRA 4V39A 4BNDA 4F06A 5A1JA 3KKKA 2RC6A 2A88A 3DD5A 3RTGA 4KFCA 3MOSA 3QNWA 2J41A 3H1FA 1CRQA 3HZRA 4DDVA 1AKTA 3ZY5A 2PQMA 3N0XA 5LXTA 2QZPA 4Q05A 1NP6A 2ASVA 1W75A 5FKJA 3AETB 3Q5GA 2VAPA 3L40A 5EWJB 2H7CA 3DZGA 2AX4A 2BFWA 4TMVA 1IJBA 4XD2A 3SYLA 2FR8C 1HT3A 2OC4A 3LL7A 4KTTE 4RORA 4Q47A 3DEIA 4NYMQ 1U7DA 2FJUA 2ZTUA 4BLQA 2QRVB 2IBTA 3DO8A 1PWXA 3E84A 2W22A 4HFRA 4FR5A 1XRQA 3MUEA 5AKJA 2CV2A 3Q8LA 1NOIA 1Z73A 2Y1DA 4MYRA 4YJHA 4MUXA 4DCTA 3I9FA 2JGDB 3R3HA 4MIYA 3KPYA 4BC0A 3U56A 1TEHA 2R7LA 4X92A 3U3DA 3KWLA 2W8BA 3TIGA 4ROSA 3LFHA 2GN8A 1DT3A 1DXYA 4KV9A 2FW8A 1ZZGA 4W1PA 4OP1A 3WHIA 2WT4A 2XQIA 3P20A 5EHNA 4P7BA 4PSAA 2ZSEA 5H70A 3DZDA 4F91B 1L7OA 4ZK2A 2P5SA 3DAGA 4R9RA 2Q6LA 2A0KA 2CWDA 2JHAA 1XUOA 5EXEA 8GPBA 2C9DA 2CL5A 4G1MB 3ZN2A 1Z2NX 1KFBB 4DIBA 2HEGA 4E09A 5MGNA 3AERA 4YRGA 2H17A 3TX6A 2M1ZA 4TYYA 1YRWA 1EM8B 1TJ3A 3C6XA 1YZYA 4TS4A 3L4EA 1U7OA 2PX0A 3O7WA 2P6RA 2E4VA 2PZ8A 2C03A 5HKLA 3TD6A 3EASA 3V33A 4OFWA 4C4YA 3WYFA 1QRAA 4PWZA 2O0LA 1Q91A 1U8ZA 1OXSC 3O9VA 3OZEA 4ND8A 2HRDA 4QJIA 5BWCA 1JLMA 5G3YA 4ZYXA 4S1PA 3PZBA 1WE2A 4EL0A 5JH7F 3PHIA 4DIEA 4QBGB 4WESB 2F2TA 3I83A 4DMFA 3ESZA 2JAWA 2CLSA 3LD9A 3W0LB 4EB3A 3FBTA 1MB0A 2KM1A 3P5BA 3RABA 4OHWA 2DFKB 3C3BA 3M6IA 3REGA 3ROEA 6GPBA 3E82A 4GL2A 5CA0F 1UC9A 2GKSA 1M5UA 3L7DA 5TPZA 4MV5A 3R7BA 3HGTA 3HJTA 2JJ2A 3OT1A 1A97A 3BXGA 5EIOA 1EWYA 3BRQA 4BCDA 2Q5JA 5LQJA 4I1SA 1SIBE 2G88A 4G0QA 4PYRA 1YC2A 1HV8A 3I34X 2B8NA 4JITA 2RHHA 1U0JA 4WLOA 1Q77A 1HFKA 2DQYA 3EDMA 4PVCA 1ENYA 4TMYA 1TU4A 3KR9A 1QE0A 3EXHC 3I2KA 2N1BA 3EGOA 4HDNA 2G83A 1UDWA 3V32A 4A5SA 1F8FA 4WBSA 5IPFA 2GAAA 1R6TA 1REQA 2JLYA 4NMHA 4KQ9A 2GVDC 4ZQBA 4XWAA 2YZMA 1YOBA 4H15A 3I0NA 1FFWA 4UZSA 1IN7A 1E6CA 2VT6A 3DKRA 3KBOA 2R3SA 3FYHA 4R3UC 4C0HA 3D5TA 5BT9A 2CV0A 4YAGA 1E60A 3UUFA 4CT5A 2RGBA 3GJSA 2ADOA 1ORRA 2UYOA 2SCUB 2CB9A 2ZTHA 1Z8HA 3AJDA 2NYRA 4O4JA 1C3LA 3IV6A 3RFFA 2XTJA 2IYZA 2O7NA 4QWWA 4C22A 5JCZA 5JSQA 4OLBA<