1QS0B

Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
338
structure length
338
Chain Sequence
ATTTMTMIQALRSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQTKYGKSRVFDAPISESGIVGTAVGMGAYGLRPVVEIQFADYFYPASDQIVSEMARLRYRSAGEFIAPLTLRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEPKRLYNGPFDGHHDRPVTPWSKHPHSAVPDGYYTVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAEESGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVVVHEATRTCGFGAELVSLVQEHCFHHLEAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKKVMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-oxoisovalerate and dehydrogenase and the architecture of 2-oxo acid dehydrogenase multienzyme complexes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA-SUBUNIT
total genus 100
structure length 338
sequence length 338
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qs0B02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qs0B01
2WVAA 3ZHSA 3EXIB 1X80B 2EZ9A 2BEVA 1YD7A 3LQ2A 2R8PA 1V1MA 1OLUB 1QS0A 1ZPDA 5I51A 5HHTA 2Y0PA 5FEMA 1X7ZA 2XT6A 4D5GA 3JU3A 1X7XB 3HWWA 3ZHTA 2IHVA 1UM9A 3FZNA 2PDAA 1UMDB 4C7VA 2VJYA 3DUFA 3F6BX 5DGTA 1X80A 3OOYA 2JI6A 3FLMA 2AG0A 2BFCA 1W88B 1DTWB 4QPZA 4JUCA 1V1RB 2JI8A 5DEIA 3L84A 2Q27A 4QELA 2Q29A 2JLAA 1UMCA 1OZHA 1X7YB 1NGSA 2FN3A 2Q5LA 3ZHUA 1OZGA 1PYDA 2V3WA 4GP9A 1UMBA 3ZHRA 1W85A 1QPBA 3DV0B 2PGOA 2BFBB 2VK8A 3EXHB 1JSCA 4K9QA 1B0PA 2BEWB 1KEKA 3IAFA 4JUBA 4QQ8A 5EJMA 2XT9A 3AHDA 4KXUA 1YI1A 1PO7A 1QS0B 2QTCA 4GM4A 3EXEB 4MPJA 2VBGA 2JGDA 2Q5JA 1N0HA 3E9YA 3IAEA 2WVHA 2UZ1A 5EJ9A 1OLXB 2E6KA 4C7XA 5EJAA 3AHFA 2R8OA 5ERXA 3RIMA 4MPRA 3AHIA 2BFDA 2EZUA 2C3UA 1V11A 2JIBA 2NXWA 4JU8A 2BFBA 4Q9DA 2JLCA 1OLSA 3DVAB 3EXFA 1U5BB 4MPPA 3M7IA 2IEAA 1OVMA 2Q5QA 4K9LA 2DJIA 5EJ4A 2YICA 4K9OA 2JI7A 3M49A 2C3PA 2YIDA 4GM0A 4KGDA 4RJKA 5I4IA 1V16A 3EXG2 1ITZA 1Y9DA 1WCIB 1GPUA 4XEUA 1YHYA 2AG1A 2EZ4A 2J9FA 2VK1A 2VBIA 5HGXA 3DV0A 2Q5OA 1UPCA 2EZ8A 2OZLA 5DGDA 2O1XA 1T9AA 2C42A 3UK1A 2WVGA 1NI4B 1DTWA 1T9BA 1IK6A 1V1RA 2XTAA 1YI0A 2C3OA 3FSJX 4K9NA 1YHZA 2QTAA 3D7KA 3OE1A 2JI9A 5ESDA 2R5NA 2G67A 1X7WA 1POWA 2BFEA 1UM9B 4JUAA 2BFCB 1UMDA 4COKA 2PGNA 4JUDX 3M6LA 2BP7A 3AHGA 2VBFA 3DUFB 5EXEA 2C3YA 1AY0A 1V1MB 2IHUA 4GM1A 4WBXC 1X7ZB 1V5EA 3EY9A 2Q28A 3EXIA 1UMCB 5C4IA 1OLUA 2C31A 5HYVA 2PANA 4FEEA 4MZXA 5EJ6A 1V5GA 2BEUA 2O1SA 3EA4A 4ZP1A 5EJ5A 1Q6ZA 2IHTA 1X7WB 2OZLB 1X7XA 1T9CA 1V5FA 1V11B 2EZTA 5EXDA 3EXHC 1L8AA 2FWNA 1PI3A 1QGDA 5HJEA 2W93A 5IMSA 1WCIA 3HWX1 1YBHA 4RJIA 2G25A 1OZFA 1MCZA 5K2OA 4MQ5A 1V16B 5I5GA 3F6EX 5EJ8A 3EXFB 2BEVB 1TKCA 3DVAA 3HYLA 3EYAA 3AHJA 1T9DA 1TRKA 3AHCA 2BFFB 4GPEA 1U5BA 5K6RA 1NI4A 2J9FB 3AHHA 2BEWA 2X7JA 4FEGA 1POXA 1TKBA 2UZ1B 5I5EA 1Z8NA 5AHKA 2C3MA 2UZAA 2BEUB 4KXYA 2JGDB 1TKAA 2G28A 3LPLA 3UPTA 3EXEA 4RJJA 5ERYA 3M34A 1RP7A 1BFDA 4KXXA 1OLXA 1PVDA 4KXVA 1UPAA 4JD5A 4K9MA 4GG1A 1OLSB 3AI7A 1YNOA 3LQ1A 3KOMA 3EXHA 4K9KA 3MOSA 4D5EA 1W88A 2BFDB 3EXG1 3AHEA 5K3SA 5EJ7A 5K6TA 2BFFA 4K9PA 4JUFA 4JU9A 3ZHQA 1X7YA 2BP7B 3ZHVA 1R9JA 2VK4A 1UPBA 4KXWA 1UMBB 1W85B 3LQ4A 2BFEB
chains in the Genus database with same CATH superfamily
5FXMA 4WY8A 1SXQA 4FC6A 1CRQA 3GNTA 2AOTA 2GDZA 1HDZA 3BHNA 2Z1NA 5JATA 1D2EA 1GZ4A 1QV9A 1WD5A 3AEKB 1W4AA 1EK5A 2LIPA 4B35A 1XT6A 4GPTA 4PYKA 1R27A 1QLWA 4AZ0A 4DA6A 3DPUA 4IQ0A 3U7EB 2L17A 2QJTA 2HNBA 3NW9A 2JATA 1J0DA 3EPPA 1MAVA 3OQHA 2ZJBA 4E1BA 2GYUA 4P3PA 4KZPA 5EJIA 1PWEA 3NIDB 1A8SA 5CA0B 1CJMA 3ABRB 2B1QA 3QWFA 3PIIA 4FLEA 1DXOA 1PW7A 1J2JA 5HFNA 4DLYA 5KHAA 1ZBDA 4PZEA 4PTZA 5ALOA 1F6BA 5FD8A 4YT5A 1H4TA 3HLTA 4C1BA 4FUTA 4CMCA 2RGNC 3IC5A 4GM4A 4IXWA 3RJMA 1HYGA 1R4NA 2W7TA 3V2IA 3SJUA 3SYRA 4NXMB 2IIBA 3FOCA 1N2OA 2RH5A 3R41A 4KAAA 4TV8B 4X6LA 1TF7A 3BZBA 2FK8A 1PE0A 1R18A 5L4NA 5DM0A 2YJ4A 3IT0A 3WP1B 3LC7O 1QZXA 2J07A 3NAQA 3A6HA 1EP9A 1FY2A 1G2OA 3KKKA 2I4IA 3L8HA 3QE2A 1PFWA 3R2JA 4GH5A 3RASA 4CFZA 5JPDA 1NW9B 2JBAB 4LHZA 5TT0A 2GGSA 4KIFA 3GAAA 1NDQA 1Q95A 4LECA 1WHTA 4DMRA 3PHJA 3OESA 2WIAA 3F46A 3UAVA 3THXA 3GLRA 2AE1A 1Z2CA 2OQIA 4L08A 2FPXA 5FPTA 3VHQA 4CODB 3ROXA 1MC8A 2WFLB 1B0AA 3AJEA 2R1VB 3DOFA 3KZ1E 3R0VA 1BHJA 4M2LA 4DCNA 3MUFA 2Z6AA 2H1OA 1CUHA 3KSZO 3OLCX 1T1IA 2D5LA 2BKEA 2WHPA 3ITKA 3O8LA 4Q9LA 5ESDA 2AB0A 2YYSA 2ZDHA 1F2UA 3IUMA 4DPKA 3GLGE 4PHGA 2B69A 1J0AA 3G1UA 3QEKA 4DQXA 3RAPR 4DC9A 1BJTA 4DA8A 2IYTA 4B83A 2HJ9A 1GA4A 5A5GA 1E6UA 5M04A 1KEUA 5IKEA 5KTKA 1ZGJA 1UH5A 4XB1A 3SSMA 1EK0A 2QMOA 4XSVA 1S01A 2X9QA 1P17A 2GM5A 2BGNA 2P79A 3E15A 5EP1A 3NP7A 1M74A 2AVNA 3GT3A 4EEZA 1BKSB 4OX9B 2HT1A 2XECA 4UD2A 4Q82A 3EXHC 5EPUA 3D6JA 5JU6A 4PZLA 1LFDB 1PI3A 2HWYA 2OGTA 3ESAA 1UDXA 4YI3A 3H6GA 1LSSA 3QXJA 4Y6RA 1VGQA 1MX5A 3LQQA 1Z36A 2M1XA 4TN5A 4ZAXA 4QYSA 4Q1CA 3ZDRA 3KVYA 4Q02A 1CZOA 2VAWA 4EFLA 2Q5FA 3DEFA 3PC2A 5SZKB 3TNYA 1YB6A 1AQLA 3PLRA 2IF2A 3K09C 4PLTA 5IAGA 5TSDA 2VATA 1FFBA 2UZ1B 3LGXA 3SYKA 4EPRA 4B40A 1O97D 3EXEA 4E5UA 2P9CA 4BNGA 2QEQA 3CKMA 4FEAA 5JZ9A 3R7NA 3ORFA 2C95A 1VJDA 3FTCA 3LQ1A 2QLFA 1ZRHA 5CM9C 1WVIA 2BM9A 1ZONA 1REQB 1WTAA 3D4BA 3IUEA 5KOHA 4LYYA 1CK4A 1GTG1 1KMIY 2YASA 3RIHA 3GVHA 1PWYE 2H6EA 3DBRB 1ULUA 1ORIA 4MKIA 4PINA 2DBZA 4O2AA 4U7GA 4V3BA 4YRDA 2F1JA 3LCVB 2X2PA 1X80B 3WDKA 4BO2A 3ZD6A 4IV5A 3QA9A 4PYQA 4BHTA 3IAUA 2J45A 1LSOA 3NIFB 1CUXA 1PWHA 2B1RA 4IQ8A 4XWGA 5J2UB 1F1JA 3JVDA 1FXWF 2ZRFA 4IXDA 4Q7LA 3EF0A 3N2KB 4QAJA 4D79A 3U80A 5M2QA 4OA8A 2O5CA 3QPCA 5IVIA 2XKBA 3GJYA 1W1UA 2O2JA 3E5NA 4BV3A 1I80A 2P2LA 3QVVA 4EITA 1SCKA 2ZRQA 5A6SA 4FGZA 2VCHA 3AT1A 5IW8A 4KAJA 2QAGB 2X9VA 1IU9A 2DPYA 5CFPA 3BERA 4JOQA 2PZFA 2AXPA 3DKIA 2GO7A 4KO4S 4L6AA 3ANTA 3H9CA 4MVYA 4WK4B 4LJAA 5F51A 1SXJE 2BMAA 4WPGA 3N53A 4X95A 3EUAA 5HSGA 3I6IA 2OOKA 3H1EA 3P26A 4I6JA 4U6NA 2BM1A 1L5KA 5J4LA 2YUTA 4WASA 2B4TO 1GPKA 1PVVA 2X8LA 2Z30A 3MMNA 3MT9A 3SXJA 4B31A 4EWLA 3DBRA 6PFKA 3NWPA 2SICE 1BD3A 4O4HF 5A4DA 2ZVPX 3USZA 5BQ3A 1L7MA 3SWWA 1ZGHA 5F76A 3SY8A 2NXNA 4MEAA 3PPIA 2IZ6A 5CDYA 3D64A 4Q34A 1XPJA 5CBPB 5JZMA 1GOTA 4BC1A 1VRVA 3WBJA 2NO5A 4NCXA 4GX0A 2HA7A 2NAFA 2RKBA 5HG0A 1H9CA 2A5DA 2VHWA 3USCS 3V7WA 4IIHA 4UOQA 1QDEA 2H08A 1I6KA 3ND6A 4QBGB 1JAZA 3VZDA 4WUTA 2YQZA 5KVAA 1H69A 5J2TF 4DTIA 4K26A 1T5SA 4Q1BA 2EP5A 2GM3A 2QN1A 1XD9A 5HJ7A 3UT6A 3GNSA 4G84A 4XGNA 1WDWB 1ORDA 2VDMB 4JHXA 4A73A 1RWKA 2NUTB 1SOVA 2XWQA 3OU2A 4CV3A 1JS1X 3AKYA 3JALB 2XYVA 3C87A 3RRXA 1K8YB 4X6YA 3H2GA 1E9BA 4PM4A 6REQA 2BGUA 1ZXXA 3P9KA 4KO2S 4NMHA 1UJNA 4GKJB 4F2PA 2R0QC 1PRYA 2QROA 4DJJA 4TYYA 1ZKMA 3GMIA 4MMZB 5DNEA 3QI7A 1MH1A 3C4QA 1KJNA 3HWSA 3NOQA 4DA4A 4CR6A 4KW7A 1M6WA 4MVJM 1QIJA 3RSZA 5MF6A 1WUYA 1OX4A 1V48A 3R8CA 5M7EA 2JC3A 4ZRMA 1RQXA 1P19A 1UPUA 2ZBQA 3HWX1 1YR3A 4HB3A 3AVTA 5ER6A 3ZZMA 1RWXA 2C97A 1SBNE 2VXCA 1DHTA 8ADHA 3KQSA 5CX4A 4J4HA 4HDRA 4MLCA 4ZC8A 1J7KA 1D8TA 2R60A 2RHGB 5GONA 2WB2A 4CL8A 4C7JA 1N5LA 2GEBA 3BBLA 4QA9A 2W43A 1HSZA 4D9KA 3CA8A 4EHLA 1N32B 3TMYA 2QVYX 2PSEA 5U4QA 1PJTA 1VHLA 3ETCA 5LD2B 1RR6A 2GTIA 3IDOA 3ZWYA 2ZIXA 1ZXBA 5THKA 3HFGA 4JL8A 4RUKA 5C5DA 5DW0A 2J3HA 3N39C 4N54A 3VRHA 3AUXA 2JEYA 2Q4RA 2F1OA 3D6FA 4FBGA 1E2MA 3DZFA 3ZWQA 3QXCA 3NV7A 3PJGA 4PXSA 3MCUA 2JLWA 1E2EA 1W85B 5AUPB 4MHOA 2FMIA 2ZETA 3MGKA 4BMXA 1ZYUA 4D6PA 5H0IA 5FWXB 1FDIA 3L4BC 4DLRA 4EIWA 1HNXB 4MJ3A 1K88A 1ZEMA 2FUEA 2GPSA 3T1HB 1ZOLA 1T6YA 5DGTA 3L79A 5IT5A 1M34A 1R8QA 1NATA 1XZHA 2VSQA 4G81A 4JLMA 1GSOA 4DEXA 4F5YA 4DGQA 1TM7E 3GYBA 3HCDA 3ESXA 3OJLA 3R3ZA 2FQQA 2L69A 4R9RA 1LTHR 3RRYA 2OM6A 4TZTA 4D4MA 4DIDA 5CD9A 2GHTA 2X4IA 1QH8A 1XDBA 1YR6A 1NRIA 2XQJA 1MORA 4G89A 4Y9DA 2P35A 3FI9A 1IG0A 2VXBA 1JSCA 1DUSA 3DF7A 1AS0A 2BEWB 1Z22A 2DRIA 1PJLA 3TNJA 3SQDA 3RKSA 2JGKA 5F2OA 4CF5A 2NZXA 1I5RA 1THGA 2BE9A 5ILQA 4RY0A 2CNDA 3C7AA 3RYFB 5ALGA 4XM1A 4X62B 1IVYA 1CR4A 1TMOA 4QRIA 2H63A 4UBOA 3NU1A 4ZQBA 2F4VB 2LR0A 3WGKA 3GMDA 3GDOA 4B47A 4EUKA 4FHFA 1L9KA 2W6JD 2CLOB 3NO4A 1IMOA 3PNOA 4JEIA 1JJBA 2PVCA 3O2SB 1NP6A 4MV5A 3NI2A 4EY5A 1I1QB 3LVRE 2D0PB 1DWUA 1JRLA 4WOJA 1HWYA 4TZ0A 1KEZA 2O1XA 4MOWA 2JGRA 3CW2A 3STHA 4Y1FA 1MJGM 5E1DA 2O2GA 3LPCA 4N0DA 2XB9A 3LW7A 1OTYA 4TKVA 5JWHA 2XNHA 3HB4X 4KN6A 1H93A 5JE8A 5A6VA 5CXXA 1QAOA 3T4XA 4WWHA 2IV2X 4ENSA 1E9AA 2R8BA 1TCUA 4MWSA 4B6PA 4YJ2F 3C5WP 1U1FA 3VYVA 1XK6A 1XTSA 3B12A 1DOHA 4JL5A 4XM0A 2PUFA 2FW9A 2PCLA 5HMMA 1TXGA 4RDHA 4ALLA 1PF7E 3QH4A 1E6LA 4WD3A 3M4JA 1O77A 4R2XA 4PRKA 3RU3A 1HR0B 3G7NA 2YCLA 3U16A 4XM2A 4KX5A 3VR3A 1T4BA 2BMEA 1FFDA 3EBLA 4Z8YA 4TUYA 1T6ZA 2EF0A 3I05A 3IKJA 3OLQA 1G16A 2FWNA 2HHJA 4J16A 4PLVA 5AR1A 5U4XA 2BSXA 3MA0A 1WCIA 2CHEA 3N7UA 3QU4A 1NSTA 4OM7A 4C76A 4BN0A 1YVRA 1BJRE 2AYYA 3BHMA 3JQGA 4FYYA 3U4CA 1NJ2A 3OQBA 3WNBA 2AK2A 1A9RA 3RU9A 3VZPA 1KWGA 3DTVB 5EFOA 2XQVA 2QLTA 4LF9B 4HGQA 1JDTA 5EIHA 2B6NA 5FORA 5FBQB 2IE0A 2H8GA 3TQSA 1NBWB 2V7QA 2N1BA 3HA5A 3PQ8A 4J1QA 2LD4A 4K7JA 1SD1A 3SDZA 2CE7A 3MBIA 1MIHA 5T3UA 2CLIB 1KY4A 1P44A 2QM7A 2X41A 3Q3CA 4JYPA 2QL5A 3OHSX 1J21A 4UMDA 4IOKA 3EVZA 5EJFA 1OXMA 3JPYA 1YNSA 4RHFA 2R85A 3ZKAA 1IDOA 2ADFA 4WN9A 2E85A 2ZJFA 1D2HA 3P0EA 3TK1A 3HB7A 3MHTA 5K8JB 1UXJA 4HS9A 1SVIA 2PWYA 3I2YX 4ESVA 1Z6ZA 1H4QA 1RBYA 4DCOA 2QZSA 1ECGA 1E2PA 1DEAA 1GGEA 1I9GA 2C88A 3ND5A 1CQWA 2DC1A 1C1DA 2ESRA 1PIWA 1GSIA 1E9CA 5HCNA 3D7MA 2CNWA 2G7MC 3OZWA 5KOIA 2FMKA 3WWOA 3KSRA 3CF4A 5G0WA 1L1RA 1QGZA 3WWZA 4QYTA 3I2JA 1WQ3A 3T4UA 5P21A 3BK2A 3GLUA 3IO5A 1GQOA 2E48A 1CQXA 4BGVA 1V47A 1BQEA 3HI4A 3KEGA 5JAOA 4TMTA 2PJRA 2B4KA 2Q3CA 3TTYA 3AY6A 3MUOA 4L22A 3NXKA 4FXOA 2IQ5A 1Z6AA 2IYSA 3PFFA 1P72A 4D98A 3WDLA 4XTRA 4DLVA 1U28A 3P9RA 2CDBA 3QWBA 1CVLA 1Z13A 3IOYA 1RHUA 1B15A 4XD2A 4IJ5A 5T8KC 2OXIA 1E0JA 4BLWA 4TMFA 3HJGA 4JUIA 1L1EA 3PNKA 1H2EA 2BFDA 3L7LA 1QYXA 2GLTA 4OY3A 4XCQA 5CNMA 3RIEA 3GJ3A 1TYCA 4LEIA 4MVJG 3SC6A 1K2VN 2G0AA 3MCVA 4Q3EA 2ORWA 2G5GX 2PZ8A 3UMCA 3W3AH 3FHCB 3EOAI 2O9JA 4MXDA 3PFHA 3V4SA 4Z7OB 5JCOC 2DWUA 1IONA 2H1FA 3IP9A 4QGFA 3U2QA 2B4AA 3LIPA 4BFVA 5I3CA 3G68A 2AEJA 2MSEB 1IBLB 4AL4A 1UQTA 4DBVO 5JI2E 3MJHA 3RLFA 4F9GA 5T7BA 5IM4F 3PPYA 2C9DA 1HDCA 1SVSA 3O5AA 4N8EA 4P4LA 4R1PA 3OUTA 4MDEA 2PMCA 3JATA 5DNWA 1E6KA 2CV0A 3DWIA 2CHVA 5AKZA 4LYDA 1PBTA 1DC8A 2IXDA 4UU7A 1JQBA 1J6UA 2BDUA 4K2AA 1CUVA 1KEWA 1DAGA 1V1MB 4O5AA 4QDOA 4TWRA 4YO7A 5IJZA 1R8JA 1KBZA 1Z3IX 1VJ1A 4JBIA 5FNVA 1LQTA 2QX6A 1KZGB 1QORA 1QG0A 3R1IA 2PMBA 1I4EB 2OUIA 1HTWA 1OR8A 4TKMA 1XDZA 2EJVA 3R9IA 3L7NA 4LZOA 1XQWA 1FFEA 2ZAYA 1IWBB 3PFWO 3SFVA 4KVGA 3TI9A 4EG4A 4WBNB 2XB2A 2VP6A 4ZK6A 2OL4A 5KVCA 5LLDA 2NUTA 1B1CA 3I62A 1VJRA 2P5UA 4AJNA 2XUDA 5JZBA 4BFLA 2XPCA 3EDQA 3NUGA 3RSFA 5DP2A 2JW5A 3W8FA 3SOPA 4B3BA 2ZCUA 1M1NA 5IK2A 3UAGA 1XCBA 4WSOA 1GNRA 2E4YA 4DY6A 1QP8A 1Z8NA 3NDIA 4ON9A 3I64A 3WJAA 4B4UA 2HV9A 4X1OA 2QTZA 1JV2B 2W70A 4CJXA 5EPEA 2NTVA 3AJ8A 4RJJA 4C01A 1CJTC 1FLNA 1YZUA 4D0RA 1RVDA 4FYKA 5JZOA 4CEHB 2N9UA 1BWRA 1AMOA 1U8CB 2VT2A 4DARA 3DMNA 3REFA 1II8B 1U65A 3K0FB 2Z43A 1MC5A 3CWCA 4CIAA 5CK5A 5FBLB 1GQRA 3LQ4A 3U19A 1EA7A 1LRLA 2PS1A 2CVFA 4F4FA 1Y8AA 2R4QA 3QVSA 2BKVA 1RVV1 4HDCA 1OLUB 3IP1A 4BIMA 2DFTA 3D5EA 4KYTA 2DQKA 3NEJA 3W7VA 3WE7A 4H7EA 4QPNA 3BF8A 1D0IA 2Y67A 3JARA 1BGWA 3L06A 4FSHA 1ZM2A 4Y0AA 1QYRA 4HS4A 4YJ3A 1Q22A 3QBEA 3KVOA 1J1UA 1RJDA 1LLCA 2XYHA 1NG1A 2BUAA 4E11A 1A9TA 4YLGA 4CUKA 1RM0A 4X64B 1J23A 1G3IA 1ZI8A 2CJYA 3AM5A 3LPAA 3I23A 1OAKA 2WQZA 2PBFA 2FX3A 3Q6MA 3M4NA 4CEJB 1MRNA 4QJBA 4CXMA 3GQBA 1BOFA 4RFVA 1DMSA 1YQWA 1Y8QB 3NNNA 2N3ZA 5G0SA 4YC7A 5F4BA 3ZQ4A 5KJ6A 2C8VA 2FSVA 1QTRA 4I6EA 3BQ9A 2WHYA 1XZLA 2KPOA 1FRNA 1SCUB 3GW8A 4IBOA 1JMVA 1I4DD 3KWFA 3LF2A 3AR3A 3MTBA 4HQLA 1UT8A 4IDQA 5DYYA 5B7GA 1Q16A 5A71A 1Z7GA 2BFAA 3AB8A 2ZQZA 4HBGA 4RD4A 4NEHB 2H4HA 2JFGA 2JKZA 2X9GA 1WABA 4XWTA 3FBTA 5IU6A 3M2TA 4P84A 2ZQYA 1P33A 2B8WA 1ITZA 3CW8X 3RC2A 1GZ3A 2YRWA 1N8KA 1XX6A 1ORVA 3PE3A 5T57A 3ND9A 4D3YA 4DC0A 5HZGA 3FOEC 1SHJA 3NJ4A 2IXTA 1R0YA 121PA 3HY3A 3KQKA 4M9XA 2W6IA 1DJNA 5TE9A 4TVSA 5CVVA 3C8HA 2QZZA 1DEKA 2NO4A 2NU6B 3FVVA 2B7BA 3S1AA 2OBNA 1TM5E 2GVZC 1RWPA 4M7OA 4NC9A 1KYYA 5K9ZA 2C1ZA 1PKEA 2IY7A 1KZ6A 1JHAA 1ULAA 2CLMB 4BOYA 3N87A 1ARZA 1G1MA 4BWYA 1QG6A 2DYKA 2ZULA 5JSUA 1MW9X 4KP7A 2Z1DA 2GJ4A 2BCEA 4N3BA 2PNJA 2PH5A 4IJVA 2FH5B 3L7OA 1QO0A 4KQJA 4WINA 4WACA 2G70A 1XRMA 2R66A 3GZJA 4WA8A 2ZT8A 2C29D 1SN7A 4UVEA 3TLGA 2YFYA 1Q6ZA 1ORWA 3G2JA 1KFJB 1WV0A 1USVA 3RSOA 1GN8A 4EQ6A 2HRRA 2IYFA 3FPFA 2HPVA 1W5EA 2COKA 2HK6A 3IEVA 2LWIA 3FSRA 1FLAA 1J09A 3P2IA 1ZU5A 1LU9A 4TM8A 4ESHA 5BQ5A 1MIOB 3RS2A 2JHCA 3K35A 3WLTA 4EB6A 5BWLA 4FOTA 2C7VA 1AX9A 3ELUA 4G5FA 3UMGA 2X3YA 5CTJA 4CU5A 5KIAA 1OPXA 5CLIA 1H2BA 4TWBA 1IOVA 1D7AA 1E6CA 2J0VA 4NV0A 4YAGA 2YVKA 1PR4A 3EBOA 3HHPA 3JCZA 2WIGA 1RLMA 2NYVA 3BL8A 4FZ5A 4NAUA 4U3JA 5BV0A 4XPZA 5DCYA 4DCJA 3LCUA 1YJXA 1FNNA 3AGQA 1EG7A 3GY0A 2P4QA 3KUUA 1ENOA 3B8HA 1GGKA 4K9MA 4Q1FA 3QYFA 4UEKA 1VJ5A 3ZDXB 3PIDA 1QF6A 4F91B 1I30A 2GSWA 1U9ZA 2LRHA 3WZ2A 4S24A 4XVHA 1J2TA 2HK9A 2Q0HA 1JHDA 1J1ZA 1I1OA 1XTPA 2QPLA 1WUKS 4B6FA 1UPBA 2YMMA 4TS4A 4B6JA 3WXBA 4XGRA 2RHHA 3FXAA 2P2CA 1UFQA 4I4IA 1QYIA 4Y2RA 2WFLA 5DHTA 4ZU1X 3W7AA 5HHTA 1WM1A 2EFHB 4ETMA 4GR9A 2GHQA 5DB4A 5GVRA 5DN6D 2I3BA 4X7BA 5K3AA 2CXOA 5B3LA 1Z15A 1VCNA 2GZDA 3DMTC 1COWA 1QZZA 4WUVA 1XZQA 3D6AA 4AROA 4RZSA 3BB4A 2CF6A 2BTQB 3KHUA 1G9TA 3KE8A 4JVSB 1C4WA 1N8TA 1QK5A 1RE0A 3PC8A 1TJNA 4J90A 3RSCA 1FE8A 3FOBA 4EK9A 1NGSA 2FUKA 1NN3A 3DCIA 4MQMA 4EI2A 5BN4B 2FG6C 3ONWA 3HJNA 3JYLA 3LY5A 2NUPA 3L7BA 4XKJA 4D3SA 2IS6A 4K9QA 1HH4A 2VOEA 1Z4LA 3Q7PA 4KRFA 1A9ZA 4IRUB 4BO4A 3R7DA 4GMHA 2W48A 3F4KA 1G59A 3QF4A 3GYGA 3O4VA 4UAUA 3S8MA 4YHHB 5BOSB 5GVSA 3KSMA 4CMJA 2ZCJA 2HJGA 3VJRA 3F47A 5EWJA 1B73A 2IDMA 5EYPB 1ZD8A 1T4CB 2A1UB 4G86A 2X8AA 2C2OA 4TSKA 4DR4B 1RW4A 4JJZA 4D8UA 5ICEA 2XDWA 5JYDA 3K9CA 3RFVA 2HD4A 1MPTA 1OWMA 4G09A 4QPDA 3ZE8A 2FSIA 4QOFA 3EQ8A 4KR0A 1ZEJA 3X1WA 2J9FA 4JOCA 3DBVO 1ZHOA 3D7LA 5D01A 4GNKA 3Q2OA 3W77A 2IU0A 1E66A 5ARBA 3IMEA 4BJ3A 1I9CA 4GECA 2ORIA 4IYJA 4M1WA 3RS7A 1E96A 2I2BA 5B37A 3ZLVA 1GPJA 2R5NA 1HFEL 3K2QA 4FGJA 4G1UC 5F1YA 1Z0DA 2WWHA 3FLEA 4LDNA 3GN2A 3M6LA 2BDTA 3L4BA 2Q0QA 1E61A 2RKOA 4LDAA 4PAOA 4YB8A 3F4BA 3JVVA 4EVSA 4QG7A 1MNQA 1QU3A 3G8CA 3FHOA 1QHEA 4QIHA 4EUSA 1MJNA 2QX7A 4XI9A 4ND7A 2BVNA 4G5GA 4PYRA 1P1IA 2E21A 4CT5A 1HGXA 4Y3UA 1XGKA 3GPBA 2ZI5A 3NHFA 1N2IA 1U3GA 2GASA 1LJLA 4EF6A 2AVDA 1GAXA 2PUWA 4EW3A 3S8YA 5BV7A 2WOOA 1PEAA 3W34A 1FFGA 3U6KA 1F7UA 1IZYA 1OYVA 1N1DA 2FMUA 1JECA 1WCWA 2EL7A 2JIRA 2OP0A 5ALMA 4AWAA 3L8GA 4LZZA 2BT4A 4TTSA 1X7GA 4HWSA 5ALIA 3ZE6A 4DLBA 5B7QA 3I5XA 5K3EA 1T0UA 4KWIA 2ZR9A 3LY7A 1HA3A 4I1UA 4ZEXA 3BEOA 3VFDA 3AF3A 4M0EA 4MA0A 1V0JA 2J3KA 1KI2A 1KI1A 2ZE5A 1O7JA 3B85A 5JHHB 1MKYA 2XEDA 3C7DB 5IAOA 1XZJA 4EZIA 1JKJB 2CB0A 1STOA 4P86A 1JX6A 4KXVA 1CTQA 1Z4IA 4EHJA 5DSTA 1XUOA 4QVKA 4AZVA 1QANA 2HADA 5I8WA 4PG5A 4NHOA 1DAOA 2BHLA 2C0CA 2C9YA 1KI3A 1R9JA 4FMDB 2XEXA 3TLJA 3KV1A 3B89A 3OZFA 4DSTA 2R97A 5CM8B 3FCCA 4K46A 2NYRA 4FS3A 2PH3A 3H2SA 5GM2A 4PNZA 4P4TA 3H87A 2A5LA 1AURA 2CDCA 1QRTA 3KQQA 1F14A 2FSGA 3C39A 2DKOA 2C03A 3E9CA 4UDYX 5K3FB 1QC5A 1APBA 3STUA 3QKRA 5F3RA 3U4QA 5ELLA 5GGYA 3MJ4A 1U04A 2A58A 1L0BA 4NOLA 3DHEA 1KEPA 3R23A 2Q1TA 3GJRA 4QHYA 4ZOEA 4R7TA 4R81A 1QHIA 1R64A 1Y6FA 3BGDA 2AG0A 2NU6A 4PR0A 4D6YA 1G8PA 1TW2A 4WMLA 5EMKA 4ZU3A 1P7VA 3MRTA 4NAVA 5BYAA 5C80A 4RYLA 4OKSA 4F06A 1IHPA 3TIXB 3MVEA 1UMBA 2M32A 4EZBA 1DOAA 2WNIA 1VLZA 3MJTA 1DZIA 2YC2C 1Q11A 4QLBA 4E3ZA 5GZ6A 1EFAA 4NK5A 1W49A 3CR7A 1M6VB 1BEZA 1V3VA 3AWDA 4A27A 3BWYA 4BQOA 2OHJA 4FZJA 3P9PA 3JW8A 4CL2A 1OMOA 3KFVA 3WICA 5TV2A 3ZE2B 3TFWA 1NJ1A 3TUJC 1N36B 1CY6A 2YINC 4RIHA 3QFHA 4Z2AA 4V38A 4LMPA 2Y9MB 3HDQA 3MWEA 5DNCA 4DMUB 4ZALA 1W5SA 4PZCA 2WDZA 5TQ2B 4CM7A 4CCAA 3BCSA 5BXQC 4IMJB 1QIGA 3IAM1 1N6OA 1PZMA 2QDXA 1ZXLA 3STVA 3SF8B 4MITA 3DEIA 1OFTA 4AVYA 3TF5A 1TA0A 1HE1C 4G5SA 4H1WA 1JP7A 1R5JA 4CDGA 2CJWA 4I1YA 4J0IA 1Q50A 3AV0B 3OPMA 3OU6A 3PF9A 5ENZA 3G9TA 4OB6A 4TROA 2QD4A 3DUFB 1E6EA 3ED5A 4HQ0A 4XAQA 2H7CA 1RWOA 3E22A 3PGA1 2RHMA 3K6SA 1R6UA 1BZYA 1LPBB 3HO6A 4G5XA 3RAFC 1M2VA 2JIMA 5ARDA 1AF4A 4GGPA 3DPIA 2O19A 2VN8A 3COYA 3CG4A 3H8JA 3NKLA 4F8EA 5HVNA 1KH2A 5JJ5A 4GQIA 4MCHA 1K6EA 5DHAA 2QTFA 4PIMA 3E5MA 2BH9A 2Q46A 4I6GA 4CT4B 1OAAA 2ZXUA 2XMSA 1JHZA 1RMQA 1ZNZA 4Z7QB 5HMLA 1R0KA 1ZOPA 3CNHA 5T6MA 2OOSA 5LXTB 1H6DA 3INNA 3NDRA 4GX5A 5DEOA 3ESZA 3I5AA 4YIKA 3KR1A 3DO6A 1RKBA 4M98A 1XJ0A 3C15C 4X65B 1PJBA 4FOLA 2H1HA 1XQ6A 4ERXA 2QN3A 1DRVA 2ASVA 4MYCA 3AY7A 1QZUA 4L9RA 1YF3A 2VYVA 3MYYA 3OT5A 4A6DA 2EJUA 3N2YA 5B3KA 1OBCA 4GNRA 2P3QA 2ODTX 3HYCA 3C16C 3MZ0A 1NMXA 2ZTHA 2A84A 1XU4A 4KOEC 1YRLA 5DHUA 1FUKA 3ZHQA 1QAQA 2VHJA 1P4AA 4OMUA 3RC8A 1ADYA 1EJ0A 4HXEB 5B12A 2ZI4A 2VDQB 3UJ3X 3U4AA 2PH1A 2F3SA 5DGXA 5DBEX 3HEMA 1FU8A 4UBIA 4I9GA 4E5MA 2UYYA 5FT9A 4U9IS 1HV8A 4QT0A 3GV0A 4EG0A 1CJBA 3QFFA 2JHGA 3R5KA 4Y0VA 3KVNA 3JQAD 4WCFA 4CCYA 3K0SA 3QW2A 4DF3A 3OLZA 3NH9A 3OWOA 4II2A 5ALTA 4JA2A 5IAKA 3VPXA 1P4JA 3E9ZA 3RR2A 2QTLA 2IUFA 2ZSHA 2JFFA 3QPVA 4LSGA 5HGJA 3SX0A 3QUQA 4KLAA 4N03A 4XR4A 2V7XA 5HCUA 3VR4H 4IHJB 5CG2A 3T35A 1Z08A 3DV0B 2IYEA 2WJ3A 4V1CI 1Y3CE 2JVIA 1W6RA 4NE9A 5EJ4A 4ICIA 3PFKA 2W2PA 4HLUC 4QYIB 4CG0A 1SUBA 1ISJA 1DAIA 2YV1A 5ULLA 1L5HA 4ZI3A 3U3MA 4QOJA 2R1UA 4BP3A 3L7JA 4QGBA 2C4MA 1PX2A 3RS9A 5AIBA 1ENPA 2I6GA 3A2LA 3FVTA 2GD1O 5C8XA 3MMPA 4RTQA 4C22A 2ZYIA 2MR6A 3LGAA 4Z99A 2Z3VA 3V4PB 1XNRB 2WEKA 4KIGA 3RS5A 5KU7A 1KQNA 5AKXA 3K1ZA 2R5WA 1EDEA 2BV3A 1JBKA 2QGNA 4ENQA 1NFRA 2WMOB 4IG9A 4JELA 3BT7A 1XVVA 3K05A 3IVMA 2CBGA 3NPMA 1DX9A 3A9UA 5I4KA 1T9AA 3PC3A 4GLFA 4MWGA 2K5UA 3E8MA 1Q7RA 1I1NA 1Y98A 3U9TA 1IOWA 1NVWQ 1Z68A 2BUCA 3OPNA 5SZJA 1CFJA 4P92A 2YS6A 1POWA 2CXTA 3KJZA 1AN9A 3FSGA 3WIVA 2WT9A 3FUCA 4KFTA 5ERGB 3WMRA 4Y9SA 4EY8A 1NW8A 3HUEA 1XPOA 1TJ4A 3GEEA 3JD2A 4UHBA 2HHHB 4JZKA 1TOAA 1KQPA 2V98A 3TCNA 3VHRA 2IF0A 3FCOA 3X1YA 1AHHA 4CF4A 1J2YA 3OZGA 3SHQA 5LDDC 1Z7YA 4FEEA 4AP5A 2NO1A 1C1XA 2DT8A 3EA4A 5JNRA 5HFJA 3AI1A 2ACVA 2W2NA 3KYCA 2PRIA 5DSXA 1YA8A 2AI1A 2XHEA 3BH6A 2OQVA 3MLEA 3PUVA 4U2GA 3VM6A 2LCQA 4CWAA 3JAWB 3HUDA 2KYRA 4HFRA 1QRAA 3PBKA 4JS0A 1W5BA 4ENVA 1U3UA 3IAS1 1XDUA 4Y2JA 3RF7A 4XQCA 1XQ9A 3GJQA 2GNOA 4RO0A 5C2JB 4AYXA 2NNWB 2VSXA 5C8YB 1T5OA 2IUEA 2PG3A 1M54A 3KOXA 1EBBA 4KMSA 2YWGA 1A0OA 3O91A 3RT1A 3L46A 1QHGA 1AKRA 1RAAA 1YDFA 2FJUA 1T8UA 2QT9A 3SE0A 3GLIE 1VSQA 2PJDA 2QM0A 4QGHA 4BAUA 1A04A 5KYKA 1TKAA 2G28A 3C14C 1H2YA 1VPLA 2ZXEA 1X0VA 1DAMA 2X6RA 4XA8A 1H65A 3A4LA 4M7PA 4A4DA 1B6SA 1T1SA 1H3NA 1CEEA 3ILVA 1P5FA 1RCFA 3CB2A 2MMCA 3PICA 3KT0A 4XD7A 4XGIA 2C8KA 1WMAA 3HO8A 3WMWA 2IWHA 4RMIA 4I81A 2VI5A 5AKIA 4KV9A 1MFZA 2OBBA 2NO0A 3NG1A 1KEVA 3AUJB 5B3AA 2AX4A 4FFBB 2WZBA 3JVIA 3H1BA 3G2HA 2QM8A 4GFDA 4LVCA 1X7ZA 2PHZA 4HDKA 4IDAA 3SPXA 4KN8A 3QHPA 4AZSA 1XLTA 1P0QA 2OAQ1 2PBLA 2IKSA 1P4SA 1X80A 4HNGA 4J3JA 2QVXX 3L7AA 521PA 4JP1A 3R5XA 3QOFA 1PZEA 3HL0A 4Z9FA 5AOCA 4AZTA 1ZWKA 1PJAA 1CUWA 1M5UA 4RL6A 3PHCA 3HJRA 2A94A 3IOEA 2V3WA 5H5JA 2C0QA 3BGSA 2PGAA 3H3FA 3IHWA 2BFBB 4H31A 4JWTA 3T3OA 3ZXUB 1ZD9A 1YMVA 2DHEA 2WKQA 3AJDA 4HNAA 3T1VA 1PO7A 2D5AA 3ACCA 1LPMA 4HPJB 3KAJA 3O03A 3VOSA 1SVNA 1A9SA 2GBCA 3OQIA 4HDSB 2MYNA 1BVRA 2QPTA 1Z47A 1J5EB 1VGVA 4ZTUB 1TQ6A 1KF0A 3RADC 1EQAA 4Q21A 1GA6A 1U2RA 4IZIA 5ED0A 4AB1A 2O2SA 5TC4A 3P32A 1TW3A 2RHWA 5ECWA 4RJTA 1K68A 1YRAA 1FK8A 1Z0AA 3LKVA 4UZFA 3UQYS 3FGPA 3HP1A 2IHNA 5C51B 4RWZA 1JTEA 3SSOA 5AKGA 1YQEA 2Q41A 1C3LA 2WWGA 1JIIA 3BVPA 5ALJA 3FGNA 4BMZA 1H5QA 2DHQA 3AR7A 1DRKA 4RABA 3KD3A 4ZANA 1ECLA 1VI6A 1G0NA 4QOEA 1RFGE 4EGQA 1ZK2A 1SVLA 4ZKDA 5HRCA 5L7YA 1D09A 1PEYA 2MJLA 1SCBA 3A1TA 4L57A 3WFIA 4B7XA 4LWZA 1YS2X 1DO0A 1KJYA 4OFXA 3KQMA 4QJ5A 4U2FA 5BMVF 3DOUA 4R51A 4RVFA 2IELA 3ISVA 4C5BA 1NYTA 3RU2A 2VS1A 3WAGA 1HKUA 4CLHA 1TLTA 3E9DA 1GKUB 3EG5A 3PX7A 1D4OA 5HZKA 1KQGA 1XMJA 5ALFA 1WJGA 5U9CA 1FP2A 3QKWA 4DIKA 2ZTVA 4CLOA 3GLQA 5DDIP 1QF9A 1U8FO 1X42A 5BUSA 3KQTA 4LWPA 1GUDA 3ZE0B 5JFGA 3CF2A 3ZK7A 2F4NA 4N3NA 3X3HA 2BFPA 1PJSA 2B7CA 2BHTA 3D2CA 1PL7A 2FDCA 1PJ4A 3N0XA 4AMUA 4JFRA 1Y0BA 1DO8A 1HUQA 3ZY3A 3U09A 4OSPA 2G09A 1T6BY 1TF5A 1EWRA 1YS6A 3AR8A 4KKXB 5ES3A 5C5IA 3THWA 1DC3A 3RGGA 1Z4PX 3BOSA 2R8EA 3N1UA 1PTJA 1U7UA 1CRLA 1HDEA 1IH8A 1OLXA 1TT5B 3EZ7A 4FE4A 5EA2A 4IF4A 4MGZR 3ZPXA 4BVAA 4DLLA 4MP6A 3M3HA 5CB8A 1QGYA 4OO3A 2NU9A 4CLDA 4REOA 2GZSA 3TTWA 5LP6A 1SXGA 1Y7LA 2NZUG 3IBTA 3GK3A 1BD4A 3ZTTA 4DG9A 2NU8B 4RKRA 3FNEA 4AZ0B 2B25A 3HXPA 4X44A 4HDAA 4LHYA 3QMWA 3IE0A 3LZDA 4RU1A 4WA7A 1VE6A 2FFJA 2ZANA 2NW6A 1BE6A 3N7TA 2TMGA 3LQ2A 4JJ6A 5FOUA 4CLOB 4LG1A 3PDUA 4L8YA 1KP2A 5DBHX 5IC4A 1DJOA 1YKGA 4KRXA 2JLUA 2YN2A 3FDIA 4MWCA 2VQSA 1TO2E 1NUAA 2Q2NA 2IEDA 5I7UA 2LTAA 1UUFA 4UU0A 1QFMA 3RWMB 4HAUA 4BLQA 1JJ7A 1PJZA 1MF7A 3BIWA 1KI9A 4KQFA 4ZQFA 5K0BA 4ZRDA 4TYPA 3E5RA 4YYEA 3R09A 5CIWA 3DR3A 1P1HA 1MQ8B 4FYPA 2XXBA 3PK0A 5IN5A 3UMSA 1EUZA 1DUVG 2J85A 2UVPB 1ID1A 5MGBA 3FROA 4Q66C 3EXEB 5AKYA 1TIKA 1X6VA 4IR7A 4P0TA 2Z8YA 5A9SA 3AF6A 1VL0A 3F6PA 3IDQA 1NMEA 4PZYA 3WKEA 1P1CA 3WR5A 3R74A 4RPCA 5D87A 1EFHA 2GBFA 2IYYA 3MIIA 2PJUA 1IJKA 1RAEA 2H0RA 4PXYA 4BB5A 4RY9A 4D41A 1WB6A 5HJ5A 2WTEA 4QYWA 1NV9A 4HDRB 1LQ2A 3MTAA 2FZVA 4QUAA 3UUWA 3JD4A 4JROA 3GJ5A 4YAEA 5KTPA 3WFJA 5K20A 3LHSA 2CSUA 5IJ0B 1SKYE 3C43A 1DELA 1QWSA 3KTAB 1OXBB 4N5IX 3UK1A 1MHTA 2BC9A 5EIBC 1TCVA 3EWSA 5D1HA 1PZNA 5JSZB 2G8NA 4YJKA 5K99A 2RBGA 1DFHA 4EHAA 3O9MA 1C7JA 3E7XA 4JMLA 4KQ9A 5HRUA 1DBPA 3I0MA 1RACA 4L3WA 4M1ZA 4EYEA 2EFEB 1OREA 2BP7A 4PZUA 2WJHA 1MDFA 4JB0A 5CLHA 5TNXA 2NXEA 3CRNA 1GG9A 1E79D 2C3YA 2QN7A 2PVSA 2R1TA 4E4RA 1LUAA 2CVHA 2QNIA 4L8VA 2W6ZA 4MA5A 1MJHA 1UR5A 1X92A 2VH5R 4OXIA 2WPDA 3S4YA 4MZXA 1ULHA 5JRJA 4D9CA 2H5IA 4R1UA 5HTOA 3AVWA 3M1YA 3TL3A 1I13A 4YRJA 3M4YA 3UJBA 3VU9B 1V8ZA 2WFAA 1DJPA 4DLZA 5DT9A 4HX9A 1CY4A 4N7MA 4OBBA 1QOZA 5IMSA 4UHEA 6YASA 4Q03A 7MDHA 4AY2A 1LBTA 1V96A 4R54A 4DV0B 2IX9A 3TLEA 3D6NB 4ID9A 4Q3AA 1VIMA 5ITZB 2JD1A 5B58T 1IN7A 1FYFA 4I1OA 2I9KA 3KQWA 2HU2A 2AZTA 2H4JA 1ZN8A 2YV3A 3KEMA 4ZT3A 3EC2A 3M5CA 1B3BA 3DFUA 3JZMA 2O8NA 1Z6XA 5EXSA 4G56A 1S2IA 4DNXA 1XZMA 2HY7A 1KC1A 2I8LA 5D5HA 4UUBA 1Z4NA 2R7LA 3GEGA 3JQGB 1AG9A 3LPLA 4F3YA 5KYXB 2Y68A 3RUPA 4K0RA 2QRNA 1J22A 4N82A 4IO0A 2ODAA 4H60A 5CAEA 3U60B 5EAIA 1JJFA 2HK8A 3D7SA 2HHAA 1IN1A 1UPXA 3ENNA 1CNEA 1B8PA 3AX6A 1AKTA 3EVBA 5LZ2A 4B73A 1P0IA 1I6LA 4CM9A 2VCEA 1IULA 3KXIA 3PXXA 4KXFB 4LIPD 4OH7A 5JSYA 3REQA 4C0HA 2D8AA 3OFVA 3I76A 2VJMA 3QU5A 1AH2A 3V1MA 2NWQA 1H94A 4GOMD 4D5GA 1P18A 3C7TA 2G76A 4J0CA 3EAGA 1V26A 4X54A 2FR8C 4TKVB 3WYNA 3TX6A 4GD3Q 5TQJA 1BCRA 4K6HA 3WGHA 4RZ3A 2XKJE 4W5TA 2GN4A 3ZGXA 1AB5A 2J32A 1ESNA 2FHSA 3DDSA 4UHHA 5ESWA 2CL6X 3HJAA 3PQFA 4YJHB 3TZCA 4CI9A 1BX3A 5AI8A 5KYWB 1S2DA 5IEBA 4H7IA 3HXTA 2FWRA 2BZ1A 4LF7B 3D8HA 1XF9A 3PLNA 2ZVJA 4DLWA 3DTVD 3WNCA 2PT9A 3Q1LA 1ISRA 3HJHA 5CAEB 5AW8A 5JDIC 1KS9A 2E6KA 5IJ9B 1PP4A 1BS1A 3EH2A 4QECA 4YDQA 3QPAA 2DPHA 5H59A 2PLWA 5JJIA 3CZPA 1YRQA 5ADVA 4A36A 1H0KA 1J24A 3VPHA 2AC2A 5DLPA 3P52A 4JKOA 4BMOB 3EGVA 1XWFA 4P83A 3LXXA 4ZOLA 2NZ2A 4OLAA 5DWDA 3WIUA 2Q3EA 1R10A 1UWLA 1UZMA 1N6HA 2P9FA 3R75A 1NQWA 1Y9DA 3NHMA 3SEFA 3TFQA 4LYGA 2VTBA 4JEUA 3W1VA 4C4ZA 3CEPB 4P1ZA 4EHKA 4NNOA 4V3CA 4HEQA 1RHKA 1O94C 2NTYC 3ZIUA 3WGIA 5F7XA 1G291 2JZCA 3STWA 5F1OA 1DGQA 1DTWA 5G02A 2H11A 5LQNA 4E5SA 5BN3A 4ND4A 1MMFB 4DRXA 2HA2A 5JQWA 1ZVJA 3U4MA 4YCSA 4MW2A 1XU9A 1EVIA 4RVDA 1G8FA 1ELOA 4GU5A 2WU3A 3HXMA 3O73A 2P9GA 3AXTA 4DIUA 4CVNA 5H3LA 2JANA 1SWVA 5DRTA 1C9JA 1PQYA 4MR9B 3VJLA 3T1QA 1GPNA 2ZUCA 4DDWA 1YDHA 4YCDA 3RK4A 1KP3A 1V5FA 4WIAA 5KX5B 4AULA 1O4VA 2QN8A 4HGRA 4E7PA 5GP1A 2XCQA 4EH1A 1NYLA 3CH4B 3CEJA 4FC7A 1F4LA 4LISA 4M76B 1SBIA 4FTWA 3RC9A 3TQRA 1BDHA 2DH5A 5TR9A 1NLZA 3ABZA 1K66A 1GGHA 4ASUD 4DXHA 2RFLA 1T26A 2I6UA 1QVZA 2OQ2A 1FS4A 3KKOA 2OHFA 2WD7A 4B2LA 3PDHA 3C97A 3D43A 1AXRA 2ZAGA 5GJCA 1EB9A 2GCIA 3TZ6A 4PC2A 3ZWDA 3JZAA 1Y3AA 1VIVA 5B1IA 3OP4A 4MLPA 4JR2A 3H4VA 3QY9A 2D7CA 4E3WA 1CF2O 1WXXA 2DAPA 2AH5A 3IAHA 4DE5A 5F7OA 3IA7A 3JWHA 4GL4A 2BKUA 4HVCA 4K0KB 4R2MA 2C4UA 4MWZA 1CFZA 2ZBFA 4NPHA 4EELA 1UDBA 4EI7A 4WKOA 3G7SA 2RGCA 3KLNA 2BFDB 2C82A 1I5EA 2NTNA 4XPIA 2O23A 1VE3A 4C07A 4NV3A 4DA7A 2XUJA 1CRWG 2CLSA 2OPBA 4JUFA 2H1CA 5CR9A 4ER6A 5K0GA 3D6HA 1G7RA 3IQZA 4HRYA 3NTQA 4IQ4A 5EIBD 4DBLC 4Q3BA 5LJLA 1KSGA 3JQ8A 4EA8A 3MN1A 1NLUA 5ITSA 2J3IA 1P6XA 3AEQA 1ZPDA 3KQNA 3FAZA 2D1TA 3TRFA 5BV8A 2UUOA 5FTWA 1RWQA 2CKMA 2D1QA 1IOLA 2F3PA 1JEOA 3D3JA 3O3MB 1II8A 3EUEA 2OG2A 1E5LA 2AMFA 2BL4A 3F74A 3QELA 4ALKA 3OOYA 1HFWA 1RMTA 1UJCA 2VNKA 4H1TA 4IX9A 4NWIA 4Q3OA 1DCTA 4N0QA 3KUKA 2EGUA 6CHYA 2J9ZB 3O1HB 3R9WA 4KVZA 4IILA 1VL1A 2HA3A 3A1CA 1ZM9A 4N7JA 4BQFA 3SZGA 1NKVA 1EZZA 1TGVA 2H1WA 2QQFA 2A33A 2VF4X 1N7HA 2O1WA 1C3XA 1PV2A 1Q3KA 2VK8A 3F6YA 3R44A 1A88A 1UK8A 4PSKA 4KDCA 3D8RA 3P7MA 1XJ5A 4L9WA 4UM9D 3W2GA 4BO9A 3GLHB 4LDQA 3JD1A 5KB3A 2D2EA 4XX0B 1NC1A 4A8JA 1L8QA 4FW9A 3GJSA 3D59A 5TT1A 1F5SA 3ZBPA 4AMZA 2QLMA 4UUQA 4CEIB 1ULBA 3B8EA 3FVWA 3FWHA 3P4UA 4EUNA 4YPOA 3HCRA 3DA8A 3IEKA 3UHPA 2C5HA 1WSBA 3AJ9A 4R01A 5FPSA 3TZHA 1Z07A 3OBBA 4JR1A 1Q1NA 1ZSYA 3SBXA 2PUAA 1VJCA 4TMZA 1SCIA 3NIGB 4LXXA 4GKAA 3PP8A 1E63A 4XEHA 4BX0A 2GZMA 3U17A 4US2R 2P9HA 1TIPA 3EGXA 3LFTA 4U2CA 2V58A 3TW0A 5CB0A 3BHJA 2IYZA 1PR6A 5E6SA 5KJFA 1UFRA 3MJEA 1PGQA 3PXUA 3F7OA 1VHDA 4B3HA 3ZE9A 2OHVA 1DBVO 3CSDA 4WBNF 2CNNA 3C8MA 1KDPA 1SM4A 5BSUA 5LNK1 2QF7A 3HP4A 3VR2D 1C3VA 1RWBA 3D8UA 2B4RO 1JR3E 1B4DA 2OD9A 4GOXA 1N1MA 4CTJA 3QVTA 1UBJS 4EATA 1E2JA 3LA8A 3ICOA 4YMLA 1E5TA 1LI7A 2E55A 1TL7C 2H2WA 1R0XA 2R5FA 4M0CA 1XDWA 3OETA 3MMZA 2CCKA 5E2IA 4C0JA 4YRMA 4Z1MD 5CEJA 2CLEB 3R24A 4FDTA 4FI3C 1W4LA 3QM1A 3V8NA 5JSZA 2OM2A 3I2GA 4MWOA 2Q07A 3L7YA 4OFBA 3URKA 4XWYA 4LXUA 1O89A 3O4HA 1E1DA 1OZFA 3MQFA 2RGEA 1R12A 3PNVA 2EBHX 3FOFC 4X1IA 1KZHA 5K6AC 1TYEB 1KVRA 1P2DA 2PL9A 3MWKA 2AR0A 3AFMA 3NUQA 4L07A 1BWQA 1YZTA 4M7WA 4R7ZA 4OHOA 2FQWA 1SC6A 2RG7A 3OX4A 5HJ2A 4HRXA 4XWOA 1MTOA 3K5PA 1GGNA 4YQFA 4CEJA 1NONA 4MIOA 4BFZA 2SCUB 4DRYA 2DZDA 4L8WB 4LXIA 3MRXA 2AQHA 2EEPA 3Q9UA 4UTRA 1FTSA 4GG1A 4NZPA 4IIDA 1WVMA 2WWWA 3KHKA 2AC4A 3ME5A 3MJVA 2ZSFA 3Q11A 1EGAA 2AFIE 2H1RA 3B2NA 5IZ4A 1FC0A 2QIPA 4P3KA 3URMA 3CXUA 1FFSA 3RTEA 621PA 3AEUB 2M2IA 1Z33A 3ESQA 5F73A 1L5GB 1EP3B 4OHCA 3A9CA 2YXNA 3D8BA 1AZWA 2J1LA 5KYUB 3RS0A 1SJ9A 2QL6A 3ROFA 3G0BA 5HF5A 3TSCA 1CUZA 2B36A 3NNSA 4MGIR 2C2KA 3BE4A 4UUOA 3EQZA 1PG0A 1RPNA 2O3UA 3BXPA 1LK5A 2Y93A 3H1TA 4NZZA 1Y9JA 4EO7A 1OFUX 1WVGA 3DE3X 3BWVA 3HB5X 4KACA 3VA7A 2Q3MA 4RFSA 4MV6A 2F8MA 1F38A 3AL2A 4RVNA 4S2EA 2ZJ2A 3U6BA 5AXDA 1U4OA 4KX3A 4Q7MB 3TGWA 4Z8XA 4ZO7A 1A2KC 1TMGE 1VYTA 1BS2A 3OX3A 5DTRA 3RUHA 1CE8A 1QKIA 3HBLA 4BBJA 2CK3A 1XFDA 2VBGA 2PRZA 1VL6A 1AV7A 2Q3FA 3RI3A 4WXEA 3FZEA 5FLKA 3AL3A 3LSTA 4Z7NB 2H17A 3VR3D 4KK3A 2W0SA 3H2IA 2OECA 2I67A 4IHAA 1HE8B 2F8TA 4Z53A 3TO5A 1O97C 4NG5A 4DSNA 1F9EA 3TNFA 4BNZA 4HDOB 2ZREA 4DCUA 4JBHA 3FTFA 1P7WA 1ZCAA 2D54A 1SXIA 2JIZA 1QHHB 4YV1A 3CC8A 4IIEA 5CDGA 3GLVA 3OPYI 4P54A 3AL0C 1LPNA 4RYDA 2ZQ5A 4UQLA 5AKKA 5LIPA 3LO5A 4TT3D 1FF9A 1QQTA 5EHNA 2WWIA 2FE4A 3QF7A 2Z3ZA 1WS6A 3B6MA 3UJHA 5BSTA 2XZLA 2EQ5A 3IAAA 4IFEA 1X74A 5K1ZA 1CZUA 5AVWA 2IY9A 3L77A 1CNFA 2ECQA 2V03A 5CVJA 1YCFA 2KX7A 4O2BF 2C78A 3F7TA 1ZCFA 4GVPA 3U39A 5JOQA 1OSNA 2OCBA 1JQ5A 1V7ZA 3O74A 2XMRA 3H3JA 3NJRA 4DZRA 4YBZA 5BNWA 2H8KA 1EDZA 2QAGA 3PTAA 5EY5B 2ZVDA 5AI5A 3N86A 2IYQA 1W44A 4G0WA 5LUBA 1U9YA 4MW4A 4EYQA 2W2VA 4A6XA 3C6YA 2WD8A 1NBIA 2QDKA 4AN4A 3WGGA 4F04A 3ET4A 3IB3A 2B98A 5F21A 1J42A 1EAMA 1JTVA 3QNUA 4I5IA 4BJ5A 1N6LA 3Q15C 4DQDA 4EGAA 4ITRC 4GKKB 1H0HA 5L95A 4MRPA 1MABA 3WQQA 3SS9X 1ULSA 4MSUA 1AMUA 4E5YA 5JJLA 1CLUA 1QGUB 2VDWB 4FFVA 1ECBA 3H75A 1G63A 5E0KB 1KE2A 4D8XA 1ZJWA 3V8RA 3FYUB 1E3TA 1CU1A 1UEXC 2FPIB 2Z9CA 3D1VA 4LZJA 2PXHA 2XUIA 4UAJA 1JEDA 4KXYA 3DOHA 3TXAA 4MEBA 3T3GA 2PEYA 1R6TA 3DHYA 4A2CA 3GLHA 4RQTA 2AZ4A 1M0TA 4ED9A 3ZHOA 3ISTA 2NTEA 1N5IA 2FPPA 5IT4A 2VDUE 3H13A 3IV9A 4IWNA 3AVVA 1W75A 3S2FA 3P97A 1Q0QA 3JWJA 5FOVA 4HQOA 3GVIA 2J5XA 1WOMA 2RAVA 1NW7A 4DDMA 2PPLA 4F5ZA 1L7AA 5F3WB 1EJ2A 1G55A 3PC6A 3DAPA 4FGUA 4OQPA 1FTYA 4P4UA 1II0A 2GARA 3SKVA 1TGYA 3CSSA 5EHXA 4JXZA 4I9HA 4M88A 3ULKA 1KJ9A 1LK7A 3K96A 2O8FB 4KI0A 3OIDA 4Q7EA 3BTSA 4FILA 5C7OO 3I92A 3UA4A 3DUFA 4P08A 4FFWA 3T52A 3O94A 4OK5A 5E3HA 2QSZA 2J31A 3IUSA 1P7CA 2ZWPA 3OMWA 3IDFA 1Q1EA 1NULA 3Q7TA 3HR7A 1VG0B 2R6FA 2FEWB 2HPZA 4F9TA 2GZ3A 2QG6A 4QFMA 3UPTA 3ESDA 2C1EA 4B43A 1K0UA 1H1DA 1UXIA 3GXOA 4JODA 1O9BA 3HSKA 2WFZA 4TL8A 1S1MA 3DXFA 4B44A 4F84A 3COJA 1VP9A 4HH0A 1U1IA 4DRXB 5KHLB 2Q45A 1BN6A 1I2ZA 3AHDA 2ZLBA 2W8BA 4TMWA 3WLLA 1SKYB 4BQEA 4RTMA 3V1NA 2O8DB 2PD4A 1F8XA 2PLRA 4X6XA 3A6GA 4TWAA 5LQJA 2JCYA 4DDKA 2ODNA 3F8SA 2CUNA 1OH7A 3ZWKA 4MINA 3LKBA 5CFOA 2C3UA 2XITA 4H27A 1TAQA 1MV8A 2C9MA 3TW8A 1P7YA 1OXXK 2Q6LA 3QXXA 3ZOZA 1L3IA 4G1EB 2PS0A 1H5UA 3LYUA 1M6EX 2CFIA 2FN9A 3K9LA 1OFUA 4FFSA 1H8HA 4M0FA 3ZJYA 1BYIA 4P5EA 1YRHA 4JLAA 4QAQA 2WWYA 1PVOA 2XR1A 3LSYA 1JJIA 3R6GA 3ESBA 3PFCA 5FH9A 5EZ6B 1NQUA 1ODTC 4BWVA 3ML1A 4C3OB 4ZHSA 4JP2A 3U3KA 1E1QA 3BE8A 1LLQA 5AOAA 2IOQA 1OROA 1NFFA 4RK7A 4ZZ2A 1JSZA 3FCUB 1YL7A 2JI9A 2XNKA 4H4EA 1GL3A 4UW9A 3TM4A 5JQGA 1CJKC 3NTXA 4OYYA 3C1AA 3ACBA 5L53A 1PK7A 5GZ3A 4L0MA 3ZH9B 2ODWA 4E13A 1UZUA 3FCEA 3NRBA 5AICA 3GDFA 3GJZA 2OBXA 2P1ZA 1S5PA 2NUPB 3HVRA 1AXGA 2RIPA 2GXQA 1JIQA 2OESA 1M6YA 3GRCA 4RIIA 3O8QB 2B1GA 2XTMA 2HDOA 2YV4A 5KYUA 4KBYA 1AKVA 4IICA 2ZZNA 4D9BA 2WTNA 3EFOB 4LCJA 3EGXB 5C34B 5TPWB 4D9FA 2IZ5A 2M9MA 2YN0A 4J16C 2NVUB 4KN5A 5AHWA 4BBAA 3H04A 3S40A 4LJ7A 5FPPA 3B1ZA 4O4HB 1NUPA 2Z98A 1IB6A 3A3PA 3E58A 3H05A 4LS3A 1OY1A 3ROZA 3TKAA 3PNMA 4MQ5A 5IHXA 1JLKA 2FEOA 1C9YA 1JH8A 2FUCA 2C2WA 3KQOA 4FYIA 5L6LB 4I46A 2WYHA 3U4IA 4B4WA 2HSDA 1LNQA 4JI0B 1BKDR 2C4VA 4L76A 2Y1XA 3O2NA 4UTXA 3K4PA 4IJQA 3IXMA 5KX5F 3H7IA 1QIDA 1Y33E 4TRMA 4NBLA 5ILOA 2I4TA 2W37A 3AI7A 4IIFA 1GUAA 4L3VA 1SG6A 3ZQJA 1QZ3A 3SAJA 1DVRA 2BEKA 3ZGOA 3ZI4A 3WSTA 1ICIA 4UD6A 3UTDA 1GXSB 1DQSA 1G19A 3PRYA 3I6QA 3ZHVA 1H2HA 3ORSA 1E9DA 2I5PO 3L8MA 4NICA 3M3PA 1C2TA 5IT9A 5FYDA 5EKXA 4XSGA 4Y6GB 3KCNA 1S1CA 3G0OA 4D8WA 4ML3A 3K7EA 2PRKA 3T7CA 3ZWVA 3K32A 3QEMA 1YQUA 4CLEA 2QORA 4H7DA 2OFWA 2X1HA 2C07A 4GYWA 5G4KA 3EK2A 3OFJA 4DSAA 3JAMA 4WVFA 1ESEA 3VYUB 3RHTA 4DMGA 2AN3A 4Z3KA 1UMDB 2ALJA 2RBKA 3UAWA 3VHXB 4QXPA 1RIFA 2X3UA 1HT2E 3OLYA 2WG1A 2CXRA 5DEIA 5A3SA 4RIGA 5HKLA 3KL2A 3OHMA 4MLZA 3GLFA 1VBMA 2JJYA 4BZZA 4DUYB 1RCUA 4YQZA 4G0PA 3AEUA 3MB5A 1WPGA 3FNBA 3PDIB 4L3OA 3RAJA 4CU2A 2QGFA 5EJMA 4ZO9A 1C8LA 5FX2A 5KWSA 5L7TA 5EKTA 5G40A 4R2KA 5CB4A 1SVKA 1U6KA 3M5DA 3WLAA 2AJLI 4I1RA 3ZOKA 3AETA 2PO5A 4BKRA 4O2AB 1YC2A 4B2YA 3DWGA 1UQRA 1AUOA 4CGYA 2EP7A 3KXDA 1SHTX 3O47A 3GGPA 4AJJA 4Q18A 1D03A 1JDNA 2B3TA 4F0JA 2NXWA 1KVUA 2NP6A 1LVHA 3KKQA 5FBWB 1LEHA 4IH1A 2XOKA 4LRWA 4YAKA 1TZJA 2VJAA 2ENWA 4MMYB 1V35A 3JWPA 4PAGA 3BMQB 1SC1A 4Q16A 5E7QA 4ZEOA 2H5EA 4Y1EA 5DO9A 1E3WA 1J2RA 1JHMA 4BPRA 2V7WA 2EYQA 1EWKA 2A14A 2QK4A 3RROA 1DHRA 5A6SB 2W58A 1JT9A 1VRWA 3AY3A 2BLNA 1Y3IA 2R8XA 1GU7A 1LH0A 3I45A 2QTAA 3SU8A 2UZ3A 1E2KA 1FDVA 2OAP1 2Z2ZA 3WSVA 1Q0TA 4J0KA 2X4LA 3W6UA 1IN8A 1CETA 3B2EA 1VDZA 4XVRA 3WYEA 1A7JA 4B4DA 3SR3A 1K4YA 4RD3A 2XDQA 1D5WA 3TL6A 3HBJA 1QUEA 3GFGA 3OEYA 4RWEA 3HUFA 5EXEA 3S27A 4ARZB 4C05A 2PZJA 4ENRA 4F92B 2UU9B 2WMDA 3OOHA 3ZD7A 4WCDA 1X1DA 4OBXA 5JH7F 1S4QA 4GZ6A 4XJVA 1U7OA 4P33A 1PW5A 1KVTA 3FGZA 3LXRA 2WVJA 1Z39A 2BWJA 3CB4A 4WBNA 5KYNA 1NXOA 1YFJA 3U0BA 2QENA 3UM9A 4JXJA 1FRFS 2Y0BA 1ZAYA 3IAM6 3MTEA 3WGYA 4JLWA 4DEVA 3ON5A 5AVTA 5TARA 5I4CA 4AKGA 1E3WB 5DHQA 3UK2A 4EGSA 1VJTA 4AIRA 3CX6A 2XOXA 2CCGA 2VRCD 5JVDA 4PQEA 4RFLA 3WB9A 1TYDE 3O31A 4I9NA 3NATA 2VQFB 1TTTA 2C00A 4X94A 3NP9A 3L01A 2TECE 4MWEA 4HMOA 4URYR 1YT5A 1TCBA 2F90A 4JXXA 4NOKA 4RX1A 1FP7A 3UA3A 1TPZA 4H3VA 1ZW1A 5JRZA 4J43A 2YZNA 4UULA 5EQTA 4BMPB 1NF2A 3HPQA 2XOEA 3LFUA 4YJ2B 1RDFA 3ZHSA 2PE5A 3O8BA 1L4MA 1K0FA 1C9DB 1SGWA 5H02A 3HJFA 3EULA 1V1MA 3OCWA 1BJKA 1EM8B 2OWDA 2Y2UA 4RPKA 5BUCA 2ZTUA 4AF7A 3EA5A 4Y98A 3BAZA 4C7VA 3SFTA 3GB9A 3GEHA 3P1JA 3HCAA 3Q2IA 1XWWA 4PS1A 4YASA 4RK6A 5A5EA 3CMCO 1MX3A 3E70C 2V8BA 3P5SA 4BKMA 4ZYZA 7MHTA 1ST3A 2CVPA 2VTKA 4RTLA 3W5BA 4NZMA 1J90A 1YU9A 2P9EA 3BJEA 4OJKA 5EEGA 3WC4A 4HEHA 3SYTA 2HW8A 4ND6A 3FPHA 2J4CA 2O14A 4AJPA 1KRXA 2HCFA 3SN6A 2HZ7A 4GMGA 4YFYA 3BRWD 4ND3A 4BLVA 4TYWA 3FJYA 1XRQA 1K4KA 2C7OA 2O2IA 3N8IA 2EG5A 4QEKA 4A9AA 2YHIA 1G3UA 2FSVC 1FTGA 5EEHA 2HJRA 4G8BA 3CLHA 2GESA 2AG6A 1A97A 4LK2A 4PX3A 4L4ZA 2OGSA 2RMKA 2VHEA 1U8UA 2BFBA 2FUNB 3T99A 3U4GA 1HRKA 4KWCA 3Q5EA 4HZIA 4K9OA 4M49A 5EXTA 3PJRA 2C3PA 1ODCA 4V02A 4QL3A 1H3FA 1SQ6A 5LYJA 2Q7OE 4DVJA 4OFWA 3OIGA 4DOMA 1HYHA 3FPCA 2VF5X 2O0HA 3GVPA 5CYFA 1UP6A 1W1WA 3CH6A 3DLCA 2O8DA 4HAZA 2B8TA 4V03A 1W48A 1PX0A 3UB4A 5AOVA 4D97A 4ARCA 4KDEA 3RREA 4ZT4A 1R16A 3MQ2A 4GI7A 2D06A 1YVEI 3L0IB 4H1UA 1HNZB 2Q6IA 4IDOA 4U5XA 3UATA 4LOLA 2OSVA 5EVJA 3GEBA 4CHTA 3WSWA 3L8CA 2CZCA 3K70B 3SZRA 3OT4A 3QJGA 5EQJB 4I8XA 3R5HA 3CZCA 4KUEA 5E4YA 2N42A 2QRLA 4WECA 4DBLE 3DMHA 4J7UA 5LP1A 4AX4A 3WQSB 1RYZA 1F4PA 3PKJA 1EZ4A 1RRVA 2PKEA 1TTQB 1AJEA 2AEMA 3KC2A 3ADPA 4PCUA 4RV4A 1D2NA 5JNUA 4TL6A 1YB4A 3BBPA 4YCNA 3G88A 2VJOA 4L8LA 5CH8A 3GBPA 1P8JA 2QZ9A 3LTEA 4EL0A 1R8SA 3DW3X 4H7KA 3DOOA 1QPZA 1PT9A 1QR2A 2WUWE 1NVTA 4QICA 3UH1A 3NHRA 1G18A 3JX9A 3DVAA 1T2FA 1YBMA 3ND8A 3PFNA 4NZOA 3RNLA 2JHAA 3CTMA 4IJWA 1TRKA 3LP8A 3OTHA 4LE0A 2Q2OA 3H5VA 3IP5A 4FEGA 1Z7WA 3ENQA 2VZ8A 5JSKA 5FPKA 4S2UA 3QLVC 1FRVA 3OQIB 1PGOA 2ZITA 4G67A 5TQ2A 4ATNA 3EFOA 3OICA 4GDFA 1CY1A 4PVDA 2DEUA 3T6KA 2W8ZA 2FFHA 1HURA 1AUVA 2O0LA 3L5OA 1NBEA 1PS8A 1XEWY 3LDHA 4NBVA 5JS2A 3HDTA 4DHEA 1PU2A 3P0IA 4ZFNA 2F7SA 3AM4A 4DV4B 2GN0A 1I7DA 2B7LA 1ZIPA 1KYIA 2E7ZA 2I9PA 1J07A 3VYWA 3W8EA 3G8DA 4C21A 4QASA 3AOEA 2GTHA 1HG1A 5WRFA 3J81A 3CH5A 2RHDA 1EUDB 2FRDA 4H7PA 5FUQA 1GVHA 2YR0A 3L1HA 1JSLA 3V1LA 3PXAA 2MHCA 3EDMA 3DMTA 3CUSA 2O2EA 4G2NA 4X90A 2GZAA 1UBOS 1SR8A 2D62A 1JR3A 1W1IA 1D04A 2J9GA 2DUWA 2QAGC 3DVRX 5CBPA 1C7ZA 4OI2A 1A3CA 1Q0LA 3RH0A 2JLBA 3WB0A 4TMKA 2VUSA 3ZNPA 4U02A 5C5EA 3R3SA 3V4FA 2HB6A 2ZRBA 3B78A 1Y5NA 3X43A 2ZSIA 4BC0A 4FJ1A 1NVGA 1G60A 1SBHA 3I5UA 2XNDA 4DUGD 3C3WA 4CL3A 2GZ2A 2H06A 4Q37A 1Y1SA 3AW8A 3C3XA 4ZT6A 5TF4A 4Q3DA 2ZIXB 5B36A 3OOEA 2QJOA 2WHQA 2QLJA 1IL0A 4PYMA 5K0TA 2EGHA 2HA6A 1L5ZA 1Z7EA 4B5LA 3LUGA 4U2KA 2NUBA 3CRW1 3AINA 5C53B 4YQYA 3VH2A 1X1CA 1V9SA 1EXMA 2F3RA 1E58A 3PSHA 4CKYA 5HF9A 1W581 3TB4A 2DJIA 3RBZA 4EJSC 4GXNA 3RRNA 4K9RA 5DNUA 5H7XA 1V16A 4BV9A 4IYRA 4PYOA 4Z9XA 2JH9A 1GPUA 1HYEA 2HCJB 5EZYA 2HUNA 2RK4A 5D84A 1AKNA 4OYHA 1BMQA 1VHTA 4NVRA 3L4SO 5H3CA 5E1OA 4KMRA 2TMYA 1DQRA 1GPBA 3IBSA 4ZOBA 1Y82A 3UJNA 2GXSA 1CPYA 2CLHB 5CEEA 3RANA 1PNVA 4P8RA 5G3YA 1A77A 1NP7A 2VDOB 4J3NA 1NUQA 4IEEA 4DPMA 3DAYA 4NK4A 1NQTA 3AI3A 1VBKA 5LLTA 4FGSA 2QN6A 3DKRA 3KDPA 4A91A 1ZVVA 1K8XB 3ZD8A 3EISA 1A98A 4POOA 3CXRA 3MIZA 4BFWA 3L43A 4BYMA 1ZJ6A 5C3UA 3OFND 4HZUB 4MA4A 1VM6A 1CQZA 2VIIA 4FGLA 1X7XA 1JMYA 2QMEA 3U13A 5AK5A 5BQFA 4IJKA 5E9AA 2HQRA 4PPYA 2PN1A 4AJHA 1VBNA 2BJWA 1L1FA 2V7QD 3OIVA 2PKRA 2NQTA 1Z82A 4R5HA 4XYEA 3T7DA 3EAQA 2GK7A 3DAGA 4B1FA 5I7OA 1PYOA 3IEMA 1JBEA 1TKCA 4RENA 2BRUA 1IVSA 2BELA 4QKQA 1YZYA 4HVLA 4B7ZA 3ZV6A 1IATA 3U61B 2IS1A 1XMVA 3GFFA 3LU1A 1Z4QA 4MVWA 4COOA 4N3AA 4KO8A 2BHRA 1RQRA 2HSJA 3OTOB 1W36B 1S3FA 2FB9A 3KXKA 1Q44A 1U9CA 3N0WA 5KJEA 2O4UX 2E2WA 3OOWA 5K0FA 2FP3A 4ZA2A 1PJCA 5JXGA 1XCPA 5A2QA 1GTMA 4RM2A 3SJZA 5L3QA 4Q19A 1M8GA 1YONA 4D45A 3NV9A 1ZMBA 4O4LB 5AW7A 4CYMA 3SHVA 3G2QA 3KQVA 3OF3A 3T7SA 4U7PB 5DZSA 3LX6A 3JSXA 3EZFA 4PCLA 2L2QA 3OKPA 1VPVA 5REQB 3SDSA 4F6CA 5B2EA 2CVQA 2VYND 5LZ8A 5TIIA 5AJZA 1DBRA 1H23A 5G0VA 3AU8A 2GX6A 2XGSA 3F4LA 5T8KA 3ZY4A 2Y0PA 4P3YA 2F1KA 3BL6A 1JEQB 4ZCPA 3BGWA 3WRXA 5CT4A 2YWDA 3WZLA 1WMFA 2XX3A 1IWOA 5C1OA 2D5IA 4PFKA 1DCMA 3ELWA 4Z4CA 4N5HX 4P7BA 1OGYA 1QV7A 3H11A 1DNPA 3HR8A 3GFRA 4Z6KA 4W9MC 3C8DA 2KQUA 1BSVA 1ABEA 2I62A 1O9GA 3P45A 2VHXA 5KNDD 1KAQA 2H3HA 2OV6A 1U11A 2ONJA 3V4RA 4BNXA 1BNCA 1VECA 2FX5A 2X1VA 4ND1A 3A11A 4BFXA 2WIJA 3A2NA 1CQPA 2ZIWB 1E3DA 2QKYA 3N58A 3H0EA 2HLPA 2MIIA 3KPVA 4L4SA 2ATCA 2HXSA 1TT5A 2ZYWX 5H9VA 3T7AA 5JWRA 1QQAA 3TPZA 2P0YA 1OWLA 2GK6A 2NU9B 1NAIA 3JD0A 2WM2A 3ENVA 3LBIA 1NVVR 2PIDA 2IXGA 4QUBA 1W35A 1QH1B 3CY6A 3MWYW 4GMDA 4DLXA 5ITZA 1M7GA 4HUQB 4XYGA 4F11A 4DIEA 3ZUGA 4D0LB 1ACMA 1CS0B 3NAZA 1YASA 4R1NA 3FOZA 3SIPA 4JV5B 3H1PA 4TRNA 3T4PA 4AQ7A 1Z6PA 3DCYA 3RNOA 5KYGA 4I1SA 3SNHA 1BA3A 1NBMA 3M9LA 3RRBA 3P9IA 1W0KD 1M33A 4GW3A 3PE6A 3WGOA 1U7WA 3OE1A 2PUDA 1LGYA 2Y05A 4J7CA 4UM9B 3H6KA 1W30A 4IMIB 4NFHA 2V4UA 4BVBA 4PO8A 3AQ4A 4NNJA 5HXAA 1H2AS 1UOPA 1QYCA 1KO4A 1HT0A 3IT2A 1WIWA 2D3WA 1JR3D 3P4XA 4GOLD 3N2LA 5LZ9A 3REQB 4DILA 1G4HA 4KTVE 1L4NA 4I1VA 5CYOA 1D9XA 4RA9A 3LWBA 2B8NA 2W6NA 5SY4A 3K9BA 2Y1LA 3KL4A 5FWYB 1ONBA 3B6JA 3S7TA 3W06A 2W2OA 2YNMD 3ZWCA 4H9GA 1RCTE 5ICFA 3OJOA 1I14A 1T4DA 2C5SA 5AT1A 3U81A 3ZE7A 3BG5A 4FYVA 4L0CA 4O4IB 5LQRA 1CG6A 3KR0A 3LT5A 2GLXA 1ZSNA 2ZZMA 4KKVA 2R6DA 4UDNA 3GLIA 2C92A 3UENA 3MTIA 4JJ4A 3AIKA 1TVKB 2HU8A 3GXBA 1GYRA 3QXHA 4Q15A 4TYQA 3V1UA 3VU1A 3QUCA 2R79A 4WESA 3TR6A 1ODJA 1PKXA 2PIAA 5EHQA 2FA9A 1M2WA 2Q5EA 3Q7QA 5KWVA 5EMLA 3V7FA 2OG1A 2V3CC 3ANSA 4X8OA 3H42B 2X4DA 4TS1A 2IEYA 3I0ZA 2FAXA 2PV0A 3N8NA 1BYUA 1SK9A 2F00A 3AOGA 4G5OA 1XVUA 4TVKA 4E4TA 2BP7B 2F48A 1AQNA 2GPYA 4B4VA 3ADDA 1WHSA 3GZTB 3UUEA 4DY4A 2GXAA 4PAMA 3LK6A 4KXNA 4I4CA 4FOOA 2YYAA 4JBNA 3BZUA 4IFTA 4QBIA 3E22B 4JX9A 5L6MB 5I51A 2E82A 4ND8A 2DE0X 2FSFA 3TQHA 2XMDA 4AECA 1N2HA 2IYOA 4WW0A 1QLJA 3HUUA 3VNQA 1EIWA 5J2UF 5J63A 4B33A 3W3ZB 1DC6A 1IY0A 3LYAA 3U49A 1ILWA 5JANA 1TAUA 2CGEA 3ZHBA 3FPGA 1ZN2A 5AVRA 4JUCA 4RAOA 1XAHA 3RE1A 3K1TA 4KXQA 1ODFA 4QFBA 3UV3A 5GZ1A 1Q57A 4X92A 2BUBA 5J5VA 1FIUA 1T5BA 4OI4A 1U0SY 4LN1A 1AK1A 3CKLA 2YJ6A 1EG2A 1WBBA 1JGTA 1E7SA 4FQ5A 4BDTA 1EUYA 1QVRA 1YS7A 1KC3A 2NACA 2V8OA 3LBHA 2XVYA 2OT3B 2ZE7A 5FNVF 5G53C 3DR5A 4NJMB 3INGA 3WL8A 3V6MA 2ZB3A 3BQMB 1RQ7A 3E7WA 3VC2A 5CB6A 1QVVA 4QUEA 5DLQC 1NI3A 3RVDA 2OMKA 5ABPA 4XRGA 3HKEB 1QFYA 3OCVA 4XH9B 4YMWA 1N2EA 1JEAA 5ALUA 4II3A 2R48A 4RAQA 3SSNA 3TMKA 5A5VA 3FETA 3U0VA 4QE3A 3Q3IA 2QRVB 5T5QA 4QRHA 2C2ZA 1U1EA 4RIEA 4HAYA 5CUQA 4EUEA 4OQNA 5HGXA 5EUMA 2PR7A 2R00C 4E15A 1QDUA 2QUBA 4Q3LA 3KVRA 3VOBA 1YS4A 2REQA 5F35A 4IIXA 3VKHA 1YE8A 1X19A 2Y6UA 4JLVA 1HLGA 4U7FA 4HAWA 1RNLA 2XUFA 3C74A 4CG3A 1BCRB 3LP5A 5KOYA 4OI0A 4OHYA 1PQ4A 2X8JB 2H59A 1JMKC 1P8AA 3KU1A 2PKYX 3FNRA 1GQQA 3H19A 5EXPA 2HIHA 4BGIA 1GNVA 1E89A 1ZNQO 4IGAA 5KWIA 2HGZA 4MRSA 2G9VA 4UU8A 2RSLA 5P8WA 1OTXA 3FPKA 1GLGA 1KMHA 4QYXA 4QXAA 1K7CA 2G5PA 1JKIA 2QVBA 1DL5A 1F8UA 5T4BA 1ZJ5A 4RJ2A 4ALNA 3CCCA 5ALWA 3JTEA 3JYQA 2VP2A 1VPDA 3RVOA 1J33A 3KSDO 4FW8A 1NY5A 1PT8A 4FR5A 3MXTA 4PONA 4OIMA 1EX6A 3IGFA 3NYWA 3TINA 3A7DA 1IJEA 3L2OB 4MAFA 5E6UA 3WKCA 4JJEA 2EBFX 3IX7A 1EQ2A 4J94A 3QVJA 2B8EA 5FO0A 5LJIA 2CL0X 2QJRA 3K5HA 1PWXA 2ZDGA 3NDJA 3FRHA 3F0TA 1ZR2A 1S3SA 3T5CA 1KSFX 3COZA 5KTMA 3P2JA 3Q3GE 3R7FA 3GJ6A 3O21A 2P75A 4ZO6A 4KIJA 4LC1A 1OYOA 2X7HA 4IINA 3KHSA 5FBZA 4ACBA 3GRFA 4PGAA 3BE6A 2V55B 3IOBA 1GN9A 1ATZA 1FX0A 4JB3A 3KKPA 4OV6B 5SYMA 3A25A 3RS8A 4S0XA 1EFRA 3RUDA 3VNSA 1KJIA 1QIMA 3UPDA 4PPQA 1YKFA 4OQLA 3FKSD 1P75A 3ZCSA 1CULC 1XDSA 2GF0A 4H2DA 4I50A 1BFUA 1G64A 4INOA 4Y18A 1OV6A 3TKYA 5CXUA 3U7JA 1OASA 1D1SA 2A9RA 2DPMA 3JYOA 3N76A 3TECE 1IE3A 2AKYA 3IODA 2ZWVA 1IHUA 5CIQA 1JG2A 1PSZA 3QVOA 1EWVA 2GZHA 4J6FA 4R8MA 3W8DA 1QPGA 4YMHA 5IEJA 5L3SA 1IM8A 1T8TA 2VK2A 1GHTA 1RKVA 1YDMA 2EHDA 4ZT7A 2PSJA 5CT8A 2JI6A 3NM4A 3EFHA 5BVHA 4QEDA 5BRNA 2P9TA 5BURA 5F5NA 1ZGZA 4L72A 5HE9A 2DFDA 3S70A 4M9UA 1KK3A 3PUXA 4JCOA 2CXNA 4MRNA 5BOSA 2EL9A 2JZNA 4NPAA 3R7SA 4D9MA 2H9AA 4QU9A 3EEYA 4C4TA 4DNOA 4UM7A 2OBLA 3LH5A 3ZX5A 2FMHA 3RWBA 4RGVA 1EX1A 1SRRA 3O92A 4MPJA 3ZW8A 3GNLA 1SBQA 2R2GA 3EN0A 2QLNA 3EGIA 3I58A 4PBTA 3W5UA 3U37A 1CUUA 1WMBA 4DJAA 3TUZC 4PRZA 2ZT5A 3MK31 5IRCD 4Y9RA 2IDJA 4OB7A 2XSZA 4UZSA 1U0BB 1KYWA 1AUQA 4EBBA 2VDWA 3UMRA 3QKSB 4B7CA 4X3PA 2CSXA 2DCUA 4S1PA 2XOKD 1GWNA 3FYUA 4A1FA 1BVHA 3Q8MA 4OX9Y 4UVIA 5JROA 5IFLA 3WV4A 3T9BA 3UWKA 3TLXA 1ND6A 2X4GA 4HATA 3JQ7B 5KBYA 1FQJA 3G8AA 3FD8A 1SZPA 1H05A 3GH1A 4B6EA 4KE6A 5HE8A 4Y6QA 3HO1A 2JAHA 1XHEA 4X6UA 2O8BA 3B5EA 4R1SA 1IRXA 4RK0A 2QX4A 3UUFA 1ZRSA 3J80A 2H7XA 1GNTA 2W42A 1TJ3A 5ELXA 4I2VA 1K86A 2I8CA 1RLJA 1Z2EA 4DQUA 2O0KA 5B64A 4B0PA 4TXLA 3VJKA 3AIMA 2EHJA 1GO2A 3AEXA 5IKMA 5JCOA 3CTPA 1G17A 3BN3A 4EA7A 4REQA 1SFRA 4IDPA 5ERXA 2PO7A 2HO5A 4G8DA 4PLYA 3EPHA 2ILTA 2VZEA 3GD5A 3PVCA 3SZLA 3ZVRA 1RPAA 4O1MA 5D3KA 3V32A 5IVPA 2O6HA 2I87A 2EVWX 1RXCA 4K9DA 2O1SA 2WSLA 3IEPA 5EJ5A 2H31A 3K70C 3H84A 4K2HA 3V2GA 3UAOA 1IXKA 2ZFUA 1MT3A 1OYWA 3D0OA 1GNQA 1M3SA 4UU1A 1L7OA 4MIYA 3ZLUA 1A8UA 4FKBA 1GNSA 1SCJA 1JG1A 3E2MA 4GWGA 1CUBA 1PNRA 3AU9A 3FVQA 2CLLB 4XDGA 1US8B 3L6UA 4RPIA 2TRSB 2B83A 2XGGA