1QS0B

Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
338
structure length
338
Chain Sequence
ATTTMTMIQALRSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQTKYGKSRVFDAPISESGIVGTAVGMGAYGLRPVVEIQFADYFYPASDQIVSEMARLRYRSAGEFIAPLTLRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEPKRLYNGPFDGHHDRPVTPWSKHPHSAVPDGYYTVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAEESGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVVVHEATRTCGFGAELVSLVQEHCFHHLEAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKKVMEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA-SUBUNIT
publication title Crystal structure of 2-oxoisovalerate and dehydrogenase and the architecture of 2-oxo acid dehydrogenase multienzyme complexes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 100
structure length 338
sequence length 338
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qs0B02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qs0B01
3AHJA 4GM0A 1X7ZA 2WVAA 1T9AA 1YI1A 1OLSA 5ERXA 1OLUA 1T9BA 3IAEA 2BFCB 4K9QA 2EZ9A 3EXFA 2JI8A 4GPEA 4JUAA 2UZ1A 5I5EA 2QTAA 2J9FA 4QQ8A 3EXFB 4JUFA 4GG1A 2O1SA 2IHUA 2EZUA 3FSJX 5EJMA 1UMBB 2VK4A 3DVAA 1UM9A 1X7WB 1YD7A 2EZ4A 2Q28A 3EA4A 1U5BB 3M7IA 4JU9A 2Q5OA 4RJJA 2WVHA 1B0PA 2XT6A 4D5GA 1QPBA 4GP9A 5DGDA 5EXEA 2QTCA 1W85A 1KEKA 4ZP1A 1GPUA 2OZLA 3ZHSA 5EJ4A 1NI4B 1AY0A 4MZXA 5HJEA 1MCZA 2NXWA 2VK1A 2BFFA 3KOMA 3HWWA 1TKCA 5FEMA 2JLCA 2Y0PA 5K3SA 3AHGA 1V1MB 1T9CA 1ZPDA 3DV0A 2R5NA 1WCIA 3OOYA 1QS0A 5I5GA 2DJIA 3M49A 2PGOA 4FEEA 5C4IA 2IHTA 1X80A 1WCIB 1W88B 3HWX1 1PI3A 2C42A 2BEVA 2BFDA 5I51A 1DTWB 1V11B 1UPAA 1X7YA 4KXYA 2BFEB 2UZAA 5ESDA 4K9LA 2IHVA 2JGDA 2FN3A 1YNOA 3DUFB 4FEGA 1R9JA 4JUDX 1X7ZB 5K2OA 3FZNA 5HYVA 4KXVA 1OLSB 1UMCA 1OLUB 1T9DA 3EY9A 4KXUA 4XEUA 2UZ1B 2AG0A 5EJ9A 4K9OA 2Q5QA 2J9FB 2R8PA 5EJ5A 4D5EA 2G28A 1OZFA 5DEIA 1V1RA 1BFDA 4COKA 2C3UA 2BEWA 3DVAB 3EXHC 4RJKA 3AHFA 3L84A 1UM9B 4JU8A 2C3MA 5I4IA 1OZHA 2BEWB 3M34A 4Q9DA 1IK6A 2V3WA 1OZGA 4K9NA 1W85B 3ZHUA 3LQ2A 2JIBA 2Q29A 2EZTA 2OZLB 2Q5LA 2YICA 2C31A 2PDAA 1QGDA 3EXHA 3EXG1 2EZ8A 2BP7A 1UMDA 4WBXC 2E6KA 3AHDA 2BFFB 2BEUA 2C3YA 1V16A 1V5FA 5EJ6A 2XTAA 3ZHTA 3EXIA 4JUCA 3AHEA 2Q27A 1YHZA 2G25A 2VJYA 1YBHA 1OLXA 3DV0B 1V16B 1QS0B 3D7KA 1Y9DA 2PGNA 3M6LA 1TRKA 1PYDA 2XT9A 1X7XA 3IAFA 5HHTA 1X80B 1UPBA 2G67A 4RJIA 3ZHQA 2JI7A 3AHIA 1POXA 2W93A 3F6BX 3UK1A 2BFBA 3EXEA 2BEVB 2BFDB 2VBGA 4K9KA 4KGDA 4KXWA 4C7XA 2VBIA 1X7YB 2O1XA 2YIDA 5AHKA 2JGDB 3E9YA 2BFCA 1UPCA 4JUBA 2VK8A 3MOSA 1UMCB 5HGXA 2AG1A 1TKAA 1V5EA 3ZHVA 5EJ8A 5EXDA 1UMBA 5EJAA 2Q5JA 3JU3A 1L8AA 2VBFA 1X7WA 1U5BA 2JI9A 1V1RB 1N0HA 1PVDA 3HYLA 2JLAA 1Q6ZA 4K9MA 1RP7A 1NI4A 3LQ1A 3AHHA 2C3OA 3RIMA 1OVMA 4GM4A 2IEAA 1Z8NA 3LQ4A 5EJ7A 2C3PA 3EXHB 5K6RA 2BP7B 1YHYA 4MPPA 1UMDB 3FLMA 1NGSA 1V1MA 4MPJA 2JI6A 2BEUB 3AI7A 5ERYA 3EXIB 1JSCA 1W88A 1TKBA 4MQ5A 1OLXB 5IMSA 2X7JA 2FWNA 4KXXA 2PANA 1PO7A 1X7XB 3EYAA 4GM1A 3AHCA 3F6EX 1V5GA 3OE1A 1DTWA 5DGTA 2R8OA 3UPTA 1V11A 3EXG2 1YI0A 4QELA 2BFBB 2BFEA 4MPRA 3EXEB 2WVGA 4QPZA 4JD5A 3LPLA 5K6TA 4C7VA 1ITZA 3DUFA 1POWA 3ZHRA 4K9PA
chains in the Genus database with same CATH superfamily
4CV3A 4N9QA 2R8EA 4D4KA 1ZJZA 4BWFB 2BBSA 4PIVA 4DR6B 4N5DA 3TSZA 4DCOA 2ZRGA 3ACDA 3HY3A 4Y1EA 1EX9A 1WDKA 2EJVA 3B52X 1VRWA 3FDJA 4HVAA 4IHQA 3PX3A 3KZ1E 1ZDMA 3LS2A 2KS6A 5HQ3B 1HLDA 1TQ4A 4MV4A 3WLEA 1CZRA 4OYLA 5BOSA 5JBQA 1UINA 4MIKA 1ENYA 1VSUA 1CDZA 2A1IA 3RVOA 2C4MA 3SD7A 2HUPA 3ZUGA 4RVDA 3TDKA 2O06A 4CG3A 1W47A 4QPPA 4JUAA 4RLSA 1FX0B 2GZRA 2I99A 1V7ZA 4IINA 1GZDA 4TWBA 3F74A 1PEDA 3JASA 3SHTA 3V8MA 3QELB 1Z68A 5CFLA 1YB4A 2J87A 4HUQB 4WSOA 1I1HA 4UEWA 2HV8A 3WKCA 4LOAA 4A8JC 3B9RA 1YE5A 2O0HA 1O08A 2W6ZA 4N0MA 1Y3AA 4YS6A 3CX6A 3UAZA 1IPHA 4EENA 4OKIA 4EP1A 2B1RA 2GN8A 4IOMA 3CX3A 3IBTA 5JD3A 4PG6A 4JI2B 1YBAA 5AXDA 1F8GA 4QDXA 1EH5A 1MOPA 1RHUA 3OCYA 2HCTA 4MAAA 4Q37A 1OXTA 1NFFA 2H00A 1Z6TA 5ECGC 2PY6A 5H68A 1J2YA 3D0KA 3EASA 4BV2A 4DQLA 4AI6A 4B8WA 4HNVA 1CJMA 1G0OA 4Z9BA 2ZRMA 4CCSA 3QVGA 2XF2A 3QUQA 1GOTA 3FVVA 2Q6LA 4KAJA 2Z30A 4PVDA 2X4GA 1MRNA 2P6OA 2QV7A 3D6HA 1R88A 1B0PA 3K9QO 3PNSA 4K86A 1M5RA 3ZU3A 3BWYA 4D5GA 4YDHB 1QQAA 3I6YA 3U3MA 3AO0B 2UVDA 4UVHA 3TTSA 3DF9A 4BLSA 4DG8A 1ZM9A 4BVGA 1N77A 2Z6VA 4PO3X 4ZAXA 4O4HF 2PMFA 2VHQA 5HBRA 4F5DA 3IJ5A 1G3UA 3PC6A 5AXBA 1Y8QA 3ZHSA 4AYTA 1UT6A 3HXKA 1JDVA 3FJOA 3ED1A 3I2IA 1LDMA 1S3FA 2UYQA 2WSSA 4O2BA 3EQ6A 5BMVA 3GB9A 4IGKA 3KUUA 4TVOA 1TVCA 4KKVA 3NTUA 5LUAA 1NLMA 2WQ7A 1AZLA 1S8FA 2RB4A 1GKKA 4JWKA 3EMKA 5IFLA 4YA6A 5CB8A 1Y1SA 4P0TA 1R0WA 4TV8F 5CLJA 1E2KA 1DMSA 3CTPA 4YCNA 2IYOA 4E15A 2Y1GA 3DQZA 5CFOA 2VJMA 4L6IA 2J3EA 1I2MA 1R0BA 5IK2A 5A5EA 1E94E 1Z4LA 1QYXA 1VYUA 4O29A 3OUZA 4G24A 2QQEA 2AWNA 4KSYA 2W6CX 3EVNA 4H6XA 1N5MA 1FQOA 1PT7A 4ETNA 3TAXA 1JLKA 3TLCA 5EIOA 4ZU6X 1W19A 2QRJA 2V7QD 1XSEA 1F2VA 2OECA 2DWQA 3WGOA 3CSSA 1MMFB 4P31A 2XUIA 4PPQA 5BN4B 1DAPA 2G17A 4B82A 1GTRA 4QFMA 1VBMA 2J85A 4F84A 2Q4BA 4YHHB 3M49A 3VU0A 3N0XA 4MRRA 4B6QA 2HLDA 3FPLA 4XYBA 2AC4A 1ZRNA 3FCUB 4Q4AB 2PWZA 2H4JA 2WE8A 1HT1E 2A7XA 3QF4B 1KY4A 1VG0B 2F00A 1M75A 3R7WA 1K97A 3EZ7A 3RE1A 1X1BA 5DB4A 2ONYA 2NU7A 3W6ZA 4O4JB 4TYQA 3EQ9A 3UWDA 2CJPA 1NRJB 2C77A 3EGIA 1VLLA 1FYFA 2FRDC 2NTYC 4P3NA 2NZ2A 3E8MA 4MH0R 3SIXA 1KIAA 3AM3A 2IZ6A 4WKNA 3QG1A 5B2ZA 5AVRA 4OHBA 2NXCA 1U5CA 4DR2B 2H0QA 5AM2A 1QQTA 3NBKA 4H7JA 2BMEA 1PJBA 4OQLA 5HW0A 2QQFA 4M2LA 2Y1OA 3NB0A 4R83A 2QTRA 1TE2A 1DC6A 2ZLBA 1X1DA 3SFVA 3DXZA 3IA7A 4UHDA 4V2UA 1UZNA 2JFOA 4X1KA 4Y2JA 4U5QA 2F9FA 4C7KA 3PEWA 2FRDA 2AF3C 3CVUA 1GP2A 5F9HA 5REQB 1QHFA 3ZDFA 4J8PA 4RIIA 2JGDA 3VO2A 1NIPA 2OOSA 3HJBA 1XEXB 3WNVA 4ED9A 4PF1A 3HKDB 4AN4A 4OFXA 3M4YA 5KSZA 4ZI7B 3U6BA 1MXHA 3A3NA 1RCUA 2FK7A 5CYOA 3SCZA 4MS1B 8ABPA 2GBLC 2JD1A 2OK7A 1VCIA 2GF0A 2ZJ4A 3QFSA 1CRPA 1ZI9A 5A3RA 1M8FA 1W93A 4GSYA 5HYVA 1M1XB 2R44A 1UIMA 1JEQB 2ADMA 2OQIA 2XBUA 4MUJA 4WT7A 1Q1GA 1T8WA 2B9VA 3DE2X 5CX4A 4TMTA 4F3TA 1N5KA 2HUNA 2G83A 2N0SA 4X1YB 5ESRA 1A9OA 4ARVA 3D6MA 3K6RA 1QIFA 3ZTYA 3G59A 4DSOA 2GZ3A 1J0CA 1EFHA 2XADA 5DPMA 3GJ0A 1K63A 3QKTA 5T4FA 3AB7A 4QPCA 1TM4E 3TTUA 4CNBA 3R7NA 5CDGA 1C3OA 5K3OA 1G21A 2WG1A 2GBLA 3RRJA 1E20A 4D1YA 1IM8A 1WZIA 1HFJA 5DX0A 5H80A 4E08A 4KZKA 1ORRA 1BE1A 4HUTA 3BAFA 2CXNA 1WXGA 1YBVA 3AY7A 4GQBA 3MB8A 4IOLA 4WXHA 4RTPA 3ETLA 2HC9A 3FSRA 4D0SA 3ZNPA 4X97A 4R2LA 1SHZA 3FLBA 3Q7QA 3STVA 2QR5A 2XGGA 1GCUA 4Y6GB 4P9NA 2NSLA 2PS3A 4MW6A 5J1SB 2Z9CA 4RK4A 2C9ZA 3D0RA 1N5RA 4JSRA 4WCFB 5EESA 2GRUA 4JU8A 4RHTA 5JIBA 2HHCA 1KIMA 4QUBA 4I6EA 2I2AA 4MOWA 5FI0B 2AXPA 2BY4A 1GN9A 2OC9A 5CYGA 2H7CA 2X5JO 1MX1A 3A1FA 2I1LA 1LLCA 1ISGA 4D82A 4YY3B 3THWA 3E03A 2FW7A 4IV0A 4ETMA 5ILOA 2XUFA 1QIGA 1IK6A 2BKEA 2QLJA 4UDXX 5D51S 2WV7A 3QV2A 1QFMA 4Q12A 4RPHA 2YXEA 2JIBA 2F8TA 1A8SA 3I2GA 1U2EA 2OZLB 4JC4A 3T7IA 3T3HA 2VT7A 1JV2B 3DKVA 4J0HA 4DCGA 3AL0C 3TNDA 2QP4A 3FSEA 4AMYA 1QCCA 4CQMB 4NJEA 3RBZA 1ZGHA 3SIPA 4XLLA 1OWLA 3E82A 2HK6A 5CW2A 4P0PB 1KQFA 2OO3A 2GQ0A 2WJ6A 4BFXA 2PM8A 1NRIA 3THOA 4ZT5A 1C7EA 2XCRB 3QEMA 4OJMX 2BGWA 4J29A 2CNLA 4D26A 3C41J 3NRBA 1U2DA 4P3OA 2DUJA 3MRVA 4KX5A 1TTTA 2HU8A 2R7AA 3WGYA 1P0PA 2FW0A 4JYAB 2MMGA 1QIJA 2F3UA 4TS1A 4CF5A 4F91B 1HQCA 3VJMA 1ECCA 1DAMA 4CKBA 4AJHA 3SVZA 3H1GA 3U9SA 4FFWA 2PGAA 2R65A 2RKBA 4JUCA 3A05A 1PYOA 3WSTA 1E7MA 4QQFA 5GOZA 4OMFG 1BJKA 1VG1A 4LY3A 2ZSHA 5GQSA 1DWQA 1CUXA 3ICPA 1RPZA 1Z4MA 1OXXK 1VPDA 2OM2A 1SOMA 1W46A 2WDPA 4IX9A 3AM4A 4AZTA 3J7AC 2YYYA 3D6TB 3MJDA 1CF4A 1V7CA 2PGNA 5LU8A 1RZVA 3EGCA 5LQNA 4QASA 3NHPA 4BQEA 2B8TA 1SHJA 3LK7A 4I1YA 4OQNA 4P86A 3NFRA 3FOZA 5EL0A 1A7JA 3OEWA 1U0BB 2X7HA 2HIGA 3RHZA 1OLOA 4JIMA 5MFZA 2P2GA 3JWIA 4L5JA 4FHZA 2V3CC 3WAJA 3TVDA 4I9NA 3ZDAA 5B6JA 1RXUA 1KY2A 5JSKA 4Q1DA 3SXJA 3GAFA 1UAGA 5MF6A 1CIPA 1GAJA 3MS2A 1KFJB 3HY4A 2HRDA 5TIIA 3OCCA 4OH1A 4JYCA 4M1ZA 1Z4PX 4YP7A 1M2VA 4LC0A 4UMEA 2ETVA 4RACA 4F2WA 2BEVB 1R64A 4IDHA 3DFZA 4V38A 2AMYA 4I1OA 4ZI2A 3NOOA 3KKZA 4MKFA 1I0IA 1M7HA 3N7UA 4YJ3F 1WETA 2BKAA 4E22A 3E05A 1WU8A 3ZXYA 1IEXA 5BRAA 3OZFA 1UK9A 2XEXA 1ZA2A 1JNYA 3PQ6A 4IVRA 4MUYA 3WQHA 5EHXA 3KT8A 4OATA 5LD2C 1JEYB 3HKEB 3LDGA 2FWJA 1WSWA 4RNDB 1R8XA 3VKHA 1C3LA 1VJRA 3ZD9A 3RHTA 1T8RA 1TUBA 1IWOA 2BGIA 3HYSA 1SEPA 3OQIA 3SQLA 4CTJA 2VA9A 2B7LA 4DLKA 3VPXA 2KJQA 3GGCA 1TMGE 3VZSA 3DMFA 4CUZA 3T1YB 3G8DA 5ELXA 1AGNA 3QMMA 2BZSA 4XFKA 2G72A 2G9UA 2UUOA 4H0NA 4PW0A 5TQ2A 3U40A 1HBJA 4P5DA 3UAGA 4ZVRA 5CB4F 3MMSA 1PJLA 4PGGA 2VJCA 2WM3A 3T15A 3EF3A 1T3ZA 3KRTA 1FUKA 5CCBA 1PBNA 3AONB 1RMTA 4YN3A 3DEIA 2ZANA 3PIRA 3TQOA 4QC2A 4MICA 2F48A 1RTKA 3L7NA 3E1KA 3EBLA 3F3YA 4Q4HB 1U8FO 4TQAA 4YRIA 1K8XB 4MI6A 4ALMA 3GD7A 4NHEA 1UMBA 2GETA 1XU9A 1OBVA 1BO6A 4DLZA 5ADVA 1PD0A 2I55A 3ICQB 3MXTA 2WU0A 5BSHA 2VBFA 3N8GA 4G56A 4AS1A 1I6KA 2CXUA 5T41A 4BFWA 1G59A 1M2EA 3W8NA 4EBFA 3A6ZA 3EPJA 1H9BA 1GLNA 1DFHA 2V3VA 5HFAA 2Z2KA 3FTPA 5FCDA 4MRMA 1J1IA 4PYNA 1PWYE 1NKTA 3H2ZA 4GXNA 2I9PA 1G1AA 2GTIA 2Z3VA 1TQ6A 3UPUA 1LXCA 3AEZA 3M33A 4HDAA 2P6MA 3IVGA 4TS4A 3INGA 4V39A 1T1SA 2CCKA 3KC2A 4W5HA 5AJYA 3V8PA 2WHRA 3NT4A 1GCIA 2AS0A 3WMRA 4P7FA 1M2JA 3KEOA 3P2IA 4Y98A 4Z9XA 4B6EA 4C01A 1N1DA 2PT6A 4QEKA 2VRCD 4S2UA 3F2VA 3WMWA 5AVXA 2C3OA 4IMRA 2POCA 5JSZA 1Z34A 4INPA 4ROTA 1W5TA 3W5HA 1T5HX 2IV7A 4HL6A 1U3CA 1PS9A 3PD0A 2IEAA 3GJ3A 1GARA 4JJIA 3TQSA 1LK5A 2IZZA 1U65A 3G9QA 2N42A 3TOVA 1KO5A 3ZGOA 4RTMA 3RS2A 1OB2A 1R74A 1KH1A 2HBYA 3DE0X 4IQGA 4JB8A 4URYR 2DM6A 4GXRA 4B7CA 5C46F 3Q9SA 2Z1DA 1EZ4A 3PIIA 1EFAA 3CISA 4JC8A 4E5UA 3DTTA 2MT9A 2HT1A 2OFFA 4ZXFA 4TZ6A 3BGDA 4BNMA 3NHZA 5T3YA 4OXRA 1S1MA 3ITNA 2PSFA 3LFTA 4YDRA 2IYRA 2PPVA 3MUNA 2RBEA 4UHCA 1NC3A 1PT8A 2I66A 2YN2A 4MUBA 4KP7A 1UWKA 3LLSA 3FUXA 4HUJA 2ZM6B 1PLLA 3QSYA 3QF7A 2LXNA 1VMEA 3U1TA 1QRDA 1GTMA 3KR9A 4TUYB 1U02A 2V5UA 1N9ZA 4JLJA 1VIVA 4UVDA 3PS9A 2PX3A 3R0QA 1OXBB 4MVCA 1U31A 5JSYA 3UIEA 2X9VA 1UQRA 2ZR8A 2I7VA 3GPCA 3UMMA 3OLCX 3LL4A 4BIMA 5L3VA 5G0UA 4RGYA 3RWOA 3L6BA 1LTKA 1NW6A 2DR3A 3QBDA 5WRFA 2LCQA 4BRSA 2OP0A 2GA8A 5AT1A 4YX9A 5MDHA 2PKQP 4HB4A 3RIHA 3CWCA 3EAQA 2BFMA 2R751 1OCEA 2O2EA 2VHJA 3KB6A 4PHTA 4DLVA 3BT7A 1JLLB 1QAQA 2NSHA 3TZHA 4BASA 1U8UA 3BRSA 5TPZD 1PG0A 1C1YA 1XEAA 2WVJA 4YJHA 3IOYA 4YUVA 1HURA 3PQDA 4RQTA 1RRCA 3DEYX 4JJFA 4M49A 2R2AA 1KI4A 1A9ZA 4TXJA 4LRYA 4ZOAA 3SYTA 4EX6A 4OJKA 1Q15A 2I34A 3HB4X 1UZUA 1RAFA 3IBCA 2QW1A 1FF9A 4JBHA 1NA5A 4ZARA 4I46A 2XVXA 1ZL0A 3LUCA 3ESBA 3FGOA 1KVUA 1G6Q1 4XQGA 2QTZA 2ATVA 1IAVA 4JT2A 4WBNF 1XTKA 3EF0A 5J4VA 5F51A 3TZQA 1ACJA 2A9KA 2GEBA 5IASA 2ZIVB 1LPOA 4C30A 2JAXA 4RLFA 2QDXA 1KTIA 2XMRA 4Z53A 2R8YA 2A5YB 1Y7HA 4FLFA 1B43A 4HQRA 1UKZA 3PFNA 2I91A 5FADA 5AI4A 2CE2X 1K7SN 1POWA 1KKMA 3HYNA 3O3OB 3UAWA 1N2HA 1THGA 4UPDA 3M2TA 1E59A 1MORA 4DBZA 2C0CA 3Q3CA 3BIFA 1TQ2A 3GEDA 2Z5LA 4AP6A 3LCVB 3HVRA 2XZLA 1E64A 2XAUA 2ZXUA 4M8KA 3P0HA 3MGKA 2OB2A 1X70A 1VL0A 3E9QA 2DJ5A 2PJRA 4D0LB 4ZCSA 2NV6A 2IITA 1M5UA 4P92A 4EG7A 2Z5FA 5IDQA 2EIXA 2VXYA 1PNVA 1L4KA 5E7JA 2A33A 3EW9A 3MLAA 3VJKA 1TZCA 1RABA 2AEMA 3JARB 4B45A 1HH4A 2QVGA 5FH9A 3IOEA 3OQ6A 4CPDA 5KQSA 2CV1A 3MCAA 3X1DA 2QYSA 4EYSA 1W5FA 1ADCA 3HA3A 1QLJA 2C03A 2ZSFA 2ZKLA 4HRYA 3LZCA 1NBMA 1SWVA 2O2HA 3GCWA 4NAVA 2WHXA 4H60A 1JPNA 1P2VA 1YULA 2CLLB 3A10A 4LDNA 1II9A 2XZTA 2OHVA 1ULAA 3DBRB 3DDSA 4I9UA 5FO0A 3V2GA 1PUJA 1USGA 3PWTA 3SC2A 5FUYA 5C8VA 4KAAA 3IP1A 2HQSA 3VYWA 1NJSA 3HEAA 3WG9A 4CEHB 2FTKE 4OXNA 4F3YA 4Y2TA 1RJFA 3COVA 1O9BA 1JFFA 3WYFA 3DGEC 3RVKA 3FHOA 2C9OA 1IN7A 3IS3A 5IC4A 4PQEA 2R5FA 1SU7A 4IGEA 2RHTA 1W1UA 3PXBA 4ZDJA 5JCJA 4MNTA 4D9BA 2A3NA 5JJIA 3BD7A 1JN0A 2CLDX 5JSQA 3IQXA 3WA6A 2WLTA 4O08A 1PJCA 1H23A 3SYRA 1KEEA 1ZJ4A 4UARA 5TSDA 1A71A 4G09A 3FWZA 3ROKA 1CJCA 3PITA 4WEQA 4AG3A 5AVUA 4DUZB 1LNSA 4JYBA 4QEZA 1PNRA 2GN6A 3DOFA 5BOVA 5CAEA 4EMSA 3VC2A 4OQQA 1R9MA 4QVIA 2RHOA 1ZD9A 1NR5A 1TL7C 2JIDA 1F2TA 1DX4A 5IBCA 4G63A 2NO1A 1ODSA 2AMJA 5IKOA 5C1PA 2BWJA 2CK3D 2IWRA 3L6RA 3N7AA 3WJ1A 4LNUA 2BE9A 4CU2A 5AVYA 3DNMA 4JHXA 3KKPA 4HMOA 4MWBA 3NCHA 4OD0A 1PQ4A 4HPJB 4PPGA 3TQQA 2Y4OA 2H29A 2Z9BA 3Q3IA 3IMFA 1D1QA 3PLNA 3H6HA 4RDXA 5D87A 3GA5A 5BW8A 1G18A 4YMUA 2NXWA 1BTOA 3JVUA 4LHEA 3KQHA 2DPHA 2W4QA 4G0YA 1GWNA 4CEIA 3DUWA 2F3SA 1E61A 2PKEA 1VMKA 3H4TA 1D07A 1RZUA 4IEIA 3WIEA 4EKEA 3A6KA 3EZ9A 3HXQA 2WWTA 5BYKA 3IRVA 3NRCA 3D8TA 4MWEA 1LLUA 1XAIA 4JVNA 5M04A 4HQLA 4RPGA 1HYEA 3NALA 3VC1A 1KPIA 1FXWA 1S9DA 2ZJ8A 2C58A 3E35A 1LVUA 2X40A 3V1UA 1PSZA 2VWHA 2NV0A 5DNAA 1YS2X 4OJQA 1PT5A 4AJ2A 2ZIXB 5F2OA 3O83A 1Y42X 2PGOA 3JQ7B 3LX8A 5LBTA 4MWGA 1H5NA 4FKMA 4I9FA 2OBFA 4JI1B 3VAYA 5EJEA 5LXTA 1Q0TA 4F2GA 4HEA1 3DNPA 4QRHA 5F1PA 4F56A 2J5BA 2O2XA 1TYBE 3O38A 3RUIA 4UEQA 3IAS1 4FP9A 1MV5A 1B2RA 4MQLA 1TRHA 4NNPA 3LUHA 1J0DA 4QLAA 3BXPA 3L04A 2Q07A 1YDMA 1L8QA 2VZ8A 3L02A 3Q0IA 4JJGA 5JJBA 4DAEA 3ZV6A 2O8BB 5FLKA 4X91A 5J2UA 3FIUA 4CKCA 1QVZA 3HMQA 2GX6A 5D8DA 4EF6A 2RC6A 3ASYA 1CW2B 5FYDA 1NVVQ 4MDFA 2Z5GA 5F78A 1N7GA 3FUCA 1G38A 1U7HA 2FFAA 5HVNA 2NN3C 2AYYA 4I81A 4KBFA 2C2WA 4MVJG 5E3JA 1WV0A 1OV6A 4O2BF 1GL3A 1PF7E 2FPIB 3P0FA 4F96A 5BMVF 1TKRA 1EFVA 2ZQ5A 4O4LA 3ZK9A 4D9EA 1FFYA 1MJFA 3UO8B 1TO6A 5BWMA 1DX6A 4XTCS 1HQYE 2YV2A 2MMCA 4D43A 3FD8A 3WYAA 5JSFA 1PTJC 2WMNB 4FT2A 4ECAA 4FB5A 5KTRA 3P9RA 4RV5A 3USZA 4ARIA 2FUG1 2GBPA 4IQFA 1E1QA 1V5IA 3CNBA 3DCIA 3JZDA 3NJ4A 1ULSA 3OZIA 2MSEB 3DFFA 3LSYA 1GUDA 3IELA 4B2IA 2XB4A 3KM0A 3O1HB 1PV2A 4IJ5A 3OQMA 2PCJA 2I1VB 1EVEA 2H92A 4QRIA 1GJRA 3TW0A 4HRVA 3PE6A 2VDNB 4AKTA 4L5AA 4P2GA 3OEHA 4NESA 4XWAA 5CH8A 2XZDA 4EYQA 3L05A 3N2KA 4KPUB 3ZGNA 1WSAA 3QW4B 4K6MA 1PTJA 3L7AA 3PTAA 5AK5A 2HU7A 1DBQA 1S2LA 4Q3NA 4LYFA 4XEUA 1BRMA 4DBVO 5JCZA 5L4NA 1QNLA 2GZHA 4MQEA 1HKHA 5DKFA 3FMIA 4FCCA 1ELOA 3WK4A 3STHA 4AX4A 1VJDA 4HDQB 5TEWA 2QSYA 3SXUB 2X3YA 2AN9A 2X8WA 4K9OA 2WWYA 2VH1A 1TQDA 1ZN7A 4PNHA 4AO7A 3LUBA 2Q3MA 2ZDHA 1QQ5A 5TRTA 4EQ6A 3FWHA 5KOJA 2DLCX 3KPYA 2H16A 3JQ9C 1EQAA 2IDJA 2IXAA 5CB0A 1O03A 1BFDA 2FW1A 3L4SO 3PK0A 5FF9A 3BZWA 3ZZNA 4AX8A 3KQYA 4RCVA 1GFZA 5LIRA 3KKLA 3HCBA 4C0XA 1Y9EA 1RYDA 3ABQB 4ZDWA 4U63A 3CMMA 2EVWX 3N2IA 1QGAA 2DFDA 2YNMD 4LBZA 2H52A 4G85A 3M6VA 3VC7A 3ZX4A 4C7MA 3EB9A 3U19A 2EJBA 4JA0A 4QSMA 1JVNA 3PT9A 2FFJA 4BO5A 3G5AA 4Y8VA 3H5VA 1JA1A 4NV3A 4BHTA 3JQ9A 2E1PA 5CHYA 3D3JA 3PCXA 1QC5B 3LWZA 5I45A 3B6IA 1NT2A 1ZK3A 3MMNA 3QGMA 4YRKA 2H5EA 1IHOA 2YS6A 3I2FA 5HM8A 2C0PA 1MAUA 2DPYA 1NP6A 2CXSA 1JTEA 2HJ9A 3GJRA 4CMKA 1K3FA 3OBBA 5FA8A 3FNBA 4MVWA 2LZ0A 4G4GA 2HMTA 4YJGB 2FPWA 1RT9A 1WTAA 2V9ZA 2VAMA 4XOIA 1XPUA 3O03A 2D2EA 4JMPA 4WBXC 4BX0A 1DBVO 3T38A 3RBXA 1NJ8A 3JQQA 1OVGA 4QDTA 4XSHA 4BKQA 3AHDA 1XG5A 2AR9A 1A0OA 3D4OA 1E6KA 3IYLW 2KX7A 3DLTA 2OV2A 4IFBA 3LPDA 1MNAA 3VYUB 4BVHA 4PSDA 3ECCA 1PR6A 3P8ZA 4GQAA 2QTGA 3GYGA 2M6RA 4B76A 4OHZA 3ORYA 3AUJB 4EM6A 4QARA 4CT4B 2QN9A 1YHZA 1E63A 1RWNA 2XUQA 3HCCA 2ZJYA 5JCOA 1KVSA 4K0KB 2WJJA 4EUKA 4PZYA 5DNCA 2ZSDA 4FW8A 5IZCA 1Z5NA 4G1EB 1DBIA 4CL2A 1RWWA 3JQEA 3FBGA 3L7YA 4AJ1A 2GWHA 5JJKA 2HJRA 1NVMB 4TSFD 3VDRA 2VR1A 3QVXA 5CXSA 4DHWA 5JARA 1R8SA 1P61B 2H1CA 4UBMA 3UJHA 3FZYA 4EY5A 3ROXA 4HQ6A 2J3LA 4FDAA 5LP6A 3ML1A 1OB5A 2K7ZA 3LHSA 5KYGA 3C3EA 2VAXA 1TJYA 1UXGA 3LUJA 3FYUB 2VP3A 4Y7DA 3UGTA 1JHPA 2J32A 4AZ0A 5A0TA 1BXGB 1KDZA 2IELA 4HKTA 3I2HA 5DI3A 4KNWA 1F2UB 2NU9A 2KW5A 2GK3A 2Q5FA 3F6BX 2YFKA 5HG0A 1DADA 4PLGA 1B0AA 2JLBA 3HMKA 4TMKA 1JHZA 3KFLA 1BHSA 1N1EA 2OM6A 2BMAA 1AM4D 3O6VA 4KPGA 3HJFA 1HYHA 2QN7A 4M0FA 1OFUX 2R8RA 4LW8A 3MTGA 1HDEA 3Q85A 2ZDGA 2Q3LA 2E4AA 4IIGA 1ZUHA 3B1VA 1M2OB 3ORQA 2EP7A 3V4LA 4UTRA 4Z7QB 2X6RA 5C35A 3G8AA 3Q3JB 4QUJA 3H1TA 2GPBA 2W42A 3HDHA 2BEJA 4D3ZA 4AQYB 4UTPA 1TFRA 2HCJB 3I28A 1UXHA 5FD8A 2E87A 1H9CA 4MQ4A 1K4KA 4YCDA 2OZKA 3C1AA 3MS7A 2XUDA 2IQIA 2FMTA 5DCWA 4FPXA 5KJ6A 3R44A 3V1YA 3NIWA 4R84A 5FTJA 1US8B 1P1JA 3I52A 5KHAA 3V7WA 1OC4A 2OC4A 3BX1A 3ZGVA 4NYIR 2FJUA 1T3LA 3T61A 4MYUA 3AR5A 4FILA 4IVPA 5JAIA 1MNQA 2NVUA 3VUFA 6GPBA 3V48A 1JR6A 4JUBA 1JWAB 4CLRA 2DTXA 1LQ2A 3TLYA 4ICIA 5LB2A 1JSLA 2F4VB 5T7BA 3DHEA 3F6PA 1N2GA 1TD1A 1P1FA 1WUKS 1DXQA 4EPVA 2FDCA 3LLMA 2Y2VA 3D6UA 1UMCB 4NS1A 4YJDA 3JSXA 2B9EA 3NKVA 4EA6A 8ADHA 1PJ8A 1XYYA 4B3IA 1VYVA 1KGDA 4LUCA 3O26A 5C3UA 2I7TA 5AVZA 1U98A 1P1IA 1P2DA 4KYIB 4RETA 3S27A 3WNZA 5SZKB 2OEPA 1ZG3A 4TXLA 3UV6A 5CUQA 2GJ8A 4AMBA 4CU5A 2K5UA 2Q4TA 5DXAA 3A2MA 4Z8XA 5B7NA 5DN6D 4QREA 2GXAA 4HDCA 2VPQA 1DRWA 5B7QA 2Z56A 4PPFA 3UJPA 1UFRA 2SCUB 1LC3A 3IOMA 1SA0B 3NM6B 5FP0A 3BXOA 3NT2A 5JAQA 2HAEA 1M2GA 2NT4A 3K5PA 4L72A 4PLPA 1K6EA 1V3VA 1SVMA 2HCRA 3BMCB 3PXXA 3WGKA 1ZOIA 3SIWA 4EUNA 4ZAZA 3U26A 2VWPA 3Q3EA 2ZSBA 3M1AA 5FPHA 2P62A 1E2BA 3AEQB 2XE7A 4WN9B 3O4FA 4DM7A 1C1DA 4X3CA 4KSCA 1I1NA 2NUPB 3ZH2A 2QE7D 3CO0S 3K53A 5ENDA 2XWPA 3IQEA 5BXQC 1B8NA 2OBNA 4IHJA 3TIXB 1IXKA 5A03A 3IPXA 3T7AA 3PHIA 3T3GA 3DE1X 2FMUA 2E4WA 4GT1A 2CLOB 2GVNA 5C5IA 5BV7A 5CITA 3PDUA 1IMJA 1CF9A 5BPFA 2G09A 2ID8A 1UBFA 1TEVA 4IIVA 2QQ0A 4XZ3A 1N2OA 1ST2A 1M67A 1K7FB 1GT6A 1EDEA 1T0BA 5E4FA 3ECAA 2GYWA 4XVUA 2W2XA 5HE9A 2BUCA 2C9CA 1I33A 1L8XA 2OGZA 5JXGA 5K6RA 4MUFA 1DI0A 1MW8X 4FJ1A 2CL0X 2GKSA 2P3SA 2CUTA 2QYOA 5KX5F 2J07A 4D4GA 1NG9A 2XUKA 4JIGA 1IN5A 6LDHA 4MA4A 5ALYA 5B1SA 3PQ4A 1JE0A 5I9TA 2B5WA 1VP9A 4LVOA 3R2JA 3WWCA 5HZGA 1CYDA 2VKTA 1A97A 4PC6A 3DB2A 3NAZA 2W22A 1KDRA 5ERYA 4YRJA 5A4DA 3I04M 4HTFA 2XDAA 5AWFC 1HK7A 1RFLA 3MD0A 3SE0A 4EHLA 5A4MS 5JISA 1LW6E 3E7WA 1D8TA 1NPYA 6AT1A 1I2ZA 2FX2A 2NZ8A 3AF1A 4LJLA 4M36A 5BRNA 5IJ0A 2IHNA 1QVRA 3RWBA 2CDAA 1Z17A 3OY7A 3AP2A 2V96A 2Q2VA 1D1SA 1O58A 3KFVA 3H2YA 1A2OA 2OGSA 5CYPA 1UBEA 2P2SA 3SR4A 1VDMA 4RORA 2IZ7A 5U1PA 3ADBA 1YR6A 2AX4A 3TKYA 1XN4A 4IIFA 4BMXA 3IGFA 3E9ZA 3P52A 5KU1A 1U0OC 1DKUA 3R5KA 1FNMA 3F5SA 3VTFA 1SC6A 2QP3A 1ZC3A 4NMXB 4Q1AA 4CMIA 4QVGA 3WIBA 2R8OA 2ADOA 3BDAA 1QYRA 3BAZA 3EGXA 5EWLB 2IYNA 3TG8A 1TEZA 4Z4FA 2R1VA 3C14C 4XR9A 2X0NA 2PYDA 4BMVA 2ZBUA 1QV6A 3E1SA 1YJ8A 2XHEA 3KEMA 3N2GB 1E9EA 4BFTA 3A2LA 2JIOA 4I50A 4OM8A 5CFQA 1OH8A 3QH4A 4OGKA 3DP9A 5IW8A 1IHUA 3UBTA 3C8UA 2B34A 5C81A 5FBKA 5K6TA 3PXCX 4C7VA 2C8JA 5FDFA 1WWKA 4YXWA 2D0IA 4BVJA 1BGXT 1DRVA 1GG8A 3DOCA 3FPJA 3OMXA 1LWOA 4FQ7A 4GF5A 3BWCA 3VZBA 3S5UA 3WLQA 5ICEA 2NP7A 2B25A 4MP6A 4OYRA 5HIKA 4KL8S 4N12A 4POAA 1EE2A 1FYXA 1BQ4A 1G5QA 2H3EA 1CERA 2LBPA 1J49A 1E2QA 1PDOA 3R6GA 2X8LA 5CURA 3JQAB 1WF6A 5DHPA 3D8BA 1HM5A 1LQUA 1IUPA 3UMCA 2WU4A 4UUAA 3DZHA 5DBIA 1I4TD 3RARA 4NICA 1D2HA 2D5LA 1CJKC 2ZAGA 3QX9A 2OKCA 2EZ9A 3DM5A 1JHQA 1UP4A 4K9SA 1ZK1A 4HX5A 3LIPA 2ZQYA 2VF4X 3NC4A 4RENA 4FKZA 4P4SA 3WLMA 1R6DA 2IU0A 3PXDA 3T1NA 3F46A 3HDTA 5CNIA 1PKEA 4MIEA 5F2NA 2HTFA 5IG2A 5JDCC 1PJ4A 4B3DA 2XJ9A 1G55A 2QRMA 3S6JA 3TZLA 5JZMA 1FYDA 4HZUA 3PNYA 1NYTA 1DO2A 5LPNA 4FW9A 3PNLA 3HCRA 2HMWA 3KPUA 2CHVA 3N05A 2DY0A 5JXWA 1W581 1FSZA 1NVDA 2UYYA 4UE6A 4XTRA 2NO4A 5TS2A 1CK4A 2W4MA 3K8ZA 3R40A 4QBKA 1T2FA 2O8NA 4NC9A 4BEVA 1RI2A 4GD3Q 1SB8A 2FFHA 3TOSA 1TAHA 1T9KA 3KYCA 1ZR2A 1I5OA 1N9KA 1CG6A 3WYCA 1TAUA 5L3SB 4NSNA 3WYNA 1U7OA 3ZTTA 3G3EA 3ZS9A 5JDCA 4C0LA 2J33A 2XH8A 4NZNA 4WASA 4OHYA 3VR3A 2XAAA 1HLPA 1BU8A 2H4XA 3IIEA 1DRUA 1FTSA 1N6KA 3WLHA 4EYOA 4GI7A 2C7GA 1DT3A 4WOJA 3R7LA 1C1XA 2QTMA 3OTHA 5LA6F 5C8YB 4LMBA 3ZWWA 2XF8A 3MMZA 5CDHA 5IMBA 4B47A 2GCPA 3IVCA 4M6WB 1XZGA 1ZJWA 2FMFA 3F6CA 4TTVA 1PJAA 3G0BA 1M2FA 1DAOA 1R5OA 1C9EA 2IU4A 3NHFA 2HB6A 3S0JA 2OBBA 3T9BA 3GG9A 3VVLA 2PN1A 4FN5A 4HO1X 3IILA 4LJ6A 1SCKA 1GPYA 2W2OA 3H2HA 2YJZA 3JQ8A 1JG3A 1P91A 1ZL2A 3AKDA 4J1TC 2R8ZA 4WVFA 3W4JA 2QX7A 1NMQA 3FPBA 1U2GC 2H1RA 3JVDA 4QNMA 3WIUA 4DLWA 1J07A 4F04A 1B8UA 2V0CA 4PLCA 3IUNA 4MQMA 3OD5A 1MB2A 3BULA 2P8SA 4PS0A 1ESZA 5D85A 4FWBA 2C5LA 3DO6A 2GXUA 3IBYA 3JTMA 4ZOLF 2XDQB 1IHYA 1T10A 3N6XA 3WLIA 3BTUA 4DPKA 4UFPA 2K7FA 2XYQA 2FETA 4X65B 4R6XA 5MGBA 2HCBA 3V4ZA 5GJBA 3RNLA 3D9QX 2ZB4A 1SOUA 1B42A 1X8JA 2DWCA 3HFGA 3NVAA 3MTEA 4S1NA 1V39A 2JJ1D 2PG3A 1U2GA 2PZKA 1Y6ZA 5CFPA 2XVYA 4AY4A 4PFJA 4BVAA 4EX7A 4GS5A 3HR4A 3DMNA 3AUFA 3GN1A 4M7RA 4CTOA 3NG1A 1NDHA 2ZBRA 3F6SA 3TM4A 4BFYA 4ND8B 3KJFA 3NVKI 4PSVA 2QT9A 2ZYIA 5DTMA 1PL0A 5HSGA 4EW2A 2PXCA 4HR7A 2MR6A 4HVCA 1KWGA 4LC1A 4FYKA 1CRZA 1KH3A 4FJ2A 4H1WA 4YCMA 3ZVLA 1BXKA 4N47A 3MXOA 5DP2A 5EHGA 1AKQA 5BSFA 4KLZA 3QE4A 1ZIPA 2BF4A 4IGFA 2WFLB 3FMOB 4FLMA 4DA8A 3RT1A 4H2DA 2XGOA 3AVUA 1BGVA 3R3YA 2DFKB 4AF8A 5DIFA 2QRKA 1GPDG 3FFAA 3R9XA 3OZWA 2IIVA 2FFBA 3QITA 3PDHA 2Y1FA 4KWIA 2JGFA 4CF3A 1FSSA 1WEKA 1HSZA 1PL6A 1UDCA 2HFKA 2P77A 3JRWA 2IH4A 4X61A 3OH8A 4TMVA 4KLRA 4AY2A 3CNQS 5DYYA 3MYRA 3PGXA 5I51A 1GRQA 3GG2A 4EG0A 2JCYA 2ECOA 4CM8B 3L77A 4TLDA 4OLJA 1T9GS 3C2QA 3LUPA 1ZGBA 1M1YB 4FS3A 2JDIA 3GNQA 1AUQA 5SY4A 5K51A 3QBTA 4H18A 3BGWA 3L5OA 3DB1A 2C5SA 3L0OA 5BWLA 4RESA 1H85A 1TVKA 3F2IA 2WWFA 1U2RA 4DY6A 4K9RA 4ESHA 1UKEA 1I5RA 2VYVD 2ZRHA 3QEOA 3QNUA 4RABA 5GOTA 1GQ2A 2G9VA 3L9WA 3V7FA 2HTEA 2QSUA 1E4EA 2QMYA 3CZ4A 4U00A 2HQRA 7MDHA 1Z16A 4EVIA 2EX0A 1YACA 3WI7A 3DZIA 2IUSA 2Z2JA 2RHWA 1WPXA 2P40A 2IV3A 1O0BA 1VKRA 1CEYA 1DO0A 1XZEA 2P91A 3ONWA 1O97C 1YA4A 4G0UA 1T8PA 5ALPA 1WKCA 1J20A 3HBNA 3MJ4A 5LXTF 2Z95A 3NHLA 4MW5A 2WM2A 1UC8A 2O48X 3OETA 3PUIA 3OFSA 4NE9A 4P83A 4QDUA 3UJDA 5E0KB 4AZVA 1NT4A 3P26A 4OXXA 2I8AA 1EEHA 521PA 4OVKA 3WK8A 2IU3A 2PQ2A 3EGVA 1E4OA 1O77A 4HFRA 5BQOA 4JOQA 1A2KC 3H4IA 1DZIA 2QD3A 4OOFA 3S29A 5J2UF 3R20A 3P2EA 1FIUA 2QR3A 2HF2A 1RAAA 4FT4A 1OX4B 4A0HA 3FB4A 2A4MA 1BN6A 3OMLA 3ZLUA 4MLPA 5DV9A 2C83A 4KO3S 4URFA 4PLYA 1R9GA 3RKUA 4DDMA 3ZJVA 1SIOA 2IS6A 1M6VA 3T0FA 1E2NA 3MJHA 1XZMA 5FI3A 2W9XA 5JYEA 3UJ8A 2GVDC 3HN2A 2Q5IA 8GPBA 5DH9A 4PXYA 4YRTA 3G0DA 4XPZA 4DILA 2BMJA 4TV9B 3P2OA 3ZS8A 3MINA 4AUEA 4I4NA 1CRLA 3CIOA 4DQUA 1S4MA 4AUKA 5IM4A 2PUCA 5HP4A 1DGQA 4P7KA 5JAMA 3DV9A 3IBFA 2ATIA 1A9PA 1M54A 1THTA 2ZGVA 1WHSB 4GZMA 4DA6A 2WHQA 2H4FA 5JXJA 1IPEA 1KVQA 4MVJD 2VIIA 5H7XA 4GE3A 4AL4A 4ENSA 2GPYA 5M29A 1MKYA 3SXPA 2ZSKA 4FBMA 1AXEA 1YOVA 3WADA 1JHVA 2X2FA 5TR9A 4O33A 5DHRA 1A50B 2VP5A 5GONA 1FDOA 3LVFO 3IB6A 1ADJA 3S8YA 2W6MA 3K0CA 4IDNA 2NAFA 1X92A 2JATA 3EW7A 3HNOA 1CU1A 1S02A 1Z22A 4RH1A 2O54A 2H5JA 3SZMA 1FFBA 1T25A 3KJXA 4LS3A 3M3PA 4FKBA 2FOXA 1O54A 3BWDD 3L07A 1W34A 2VPWA 4K6OA 5MHTA 3UT6A 4XQCA 1XNQB 5TMEA 3HZHA 3ROPA 2JFHA 3C7AA 2G25A 3G5UA 2JD2A 2Q6OA 1KE2A 4KVAA 4C76A 2BMVA 2FN9A 4F38A 1VDZA 1B6TA 5CX1B 4WIAA 5FB3A 5A0FA 1CS0B 1P80A 1SXJD 3CJRA 3FFWA 3Q40A 4QYIB 5JSHA 2P6NA 4MJ7A 2VNAA 2VQSA 3DOIA 5GIOE 3DL4A 1C9KA 3OD1A 3NWBA 4R8SA 1ZXXA 2IHBA 4RZXA 5EFOA 1O94D 3O8CA 3AM5A 3BBLA 5K3BA 1ZD8A 3G6WA 1L7AA 5KDLA 2P3LA 3WRXC 4KK4A 1U11A 1Z4KA 4EO7A 1AKVA 3L8GA 1XU7A 1DMRA 5LYJB 3TTTA 4L51A 1WD7A 1J9ZA 2CLKB 1VB5A 3GIDA 1WUYA 4L75A 3AFHA 1L5OA 5DXFA 1W25A 1ZN8A 4ZCIA 2Y27A 4HNAA 5E2BA 4B43A 4BEBA 3SX2A 3WLJA 2GEVA 1NNUA 3C8DA 4LNAA 3LWNA 4IOKA 3U44A 4RM2A 3X43A 3NDRA 2KWIA 4YMSA 5LQAA 1RJDA 1E8DA 3WRXA 3ND6A 1QHGA 4KEAA 4Z1OA 1E79A 3IVAA 3QKSA 4I2VA 4KQEA 1UT5A 4EZEA 5BW4A 2RAVA 5JFTA 2P8JA 1PZMA 4YCJA 4OG2A 2QM7A 4B7XA 3WWOA 1XMXA 1SZDA 3DCYA 2Z6QA 4BXOA 3L79A 3D8UA 2YYZA 4JODA 1E9AA 2P4QA 1FFSA 3ZXXA 4UE3S 1VSQA 3H4VA 5JECA 4BQSA 3WKAA 1NX9A 3TO5A 1AU9A 4P08A 4IRXA 4F85A 2YWRA 4BNDA 4B3BA 3EUWA 4G0PA 4P3PA 3SQNA 4ZK2A 4G5GA 1SHKA 4ND7A 1BXZA 3UMBA 4YIKA 3IAS6 2XYVA 5F12A 4AU1A 3GRUA 1XEWX 2FLVA 3SVLA 3I2JA 5ALGA 4RX1A 4F60A 2CY0A 1M1YE 1J0AA 3OKAA 1JBQA 1PK9A 3D2CA 4OIMA 3ZY5A 1Y1LA 1O5OA 4KC0A 1CUWA 2GD2A 4IOJA 1AMUA 4YONB 1W7AA 3QMVA 3I12A 5JC8A 2IYYA 2VZLA 2FMXA 3ANYB 1J9EA 1TB4A 3TQRA 5I8ZA 1U4OA 1LX6A 2VA8A 1AGYA 1YZHA 4QOSA 1KORA 3VR5A 1X9GA 3IVRA 1TKAA 1RU3A 3TH5A 3ZHVA 4B7AA 5KHLB 5L9AA 4QXPA 4X90A 3O9VA 1SUEA 1WZ2A 4L8LA 5H0IA 7AT1A 3Q8KA 2EJCA 1PL7A 3AW9A 3VBCA 4DR7B 4O4JF 1OBFO 4OK5A 5GM2A 1B4DA 1Z0SA 2QJOA 3DDHA 3D2BA 1DBRA 1CUAA 1RXEA 3VNRA 1Z5WA 1JLHA 2ZAMA 1XZJA 2FQ1A 1JDNA 3P0IA 3W9UA 2JH9A 5EOVA 4CCYB 2FUG6 4DC1A 1HQDA 1CY0A 1PW5A 4DV0B 3DHWC 4W1PA 2O57A 5JJCA 1LSUA 3IKMB 4GPBA 3FUWA 3V97A 5JWOA 2DGDA 4JJ8A 4L02A 1AV6A 6NULA 4W1SA 3FHJA 3UUEA 4B31A 1YS6A 1D0SA 3LBAA 2EDCA 4U2DA 3VNAA 3ADPA 4YASA 2G4LA 5GM1A 1B15A 2JFPA 1H2HA 2KPOA 1VECA 2YWGA 4DCVA 2XRFA 3K71B 4K5QA 3GUCA 4KO4S 1KGSA 2EBFX 2AQ8A 4D56A 5TMBA 4EL0A 1KO8A 3OKPA 3VMFA 4HHEA 2PUBA 1C14A 3F5QA 2QTWB 1AQYA 4ZOBA 4XDYA 5AP9A 3U4CA 1E8MA 4F0JA 1O2DA 2VLBA 2R6AA 3EFHA 3Q7IA 1PWXA 4H0FA 1REQB 4ILKA 3ZDEA 3ZWPA 1J1UA 3IUPA 4FFBA 3LT2A 3PFIA 2AB0A 3CW9A 2GARA 4P8RA 1SCNE 2ZUBA 3LPAA 5J4LA 2AZDA 2P9CA 3NLLA 1RKBA 3HKCA 2J0EA 5K0EA 4DB2A 3TZEA 4O2AB 4G2TA 3CPJB 4M8IA 1YJQA 4C7OA 1QGZA 1JT9A 3RCBA 4G4SO 1KK2A 1FC0A 1KO7A 4EATA 4X20A 2V6JA 4U1RA 3WBBA 3OCUA 4F12A 3LYHA 3CZAA 1JJ7A 4OHOA 1MTZA 2BMFA 2ZWAA 4JUIA 4ASUA 4EH1A 1Y8ZA 2BC9A 1P0IA 2XCIA 2A0UA 3AI7A 3P94A 1P62B 3E9DA 4D46A 3A26A 1DKRA 1J0BA 1HZZC 4BNVA 4G0NA 2R3SA 2RGYA 3IEKA 1XPJA 5E1OA 3DW3X 2Z57A 4AUNA 5IS2A 5TF4A 3UC5A 4CETA 2BOVA 1LBHA 1MN6A 2Q6KA 4JL5A 1SBHA 4R1NA 1A3CA 2D2XA 4EEZA 1YR1A 3T3EA 3E81A 3BTSA 5DX1A 3FRHA 1T6BY 4INOA 4LHYA 1JDJA 4Y0VA 3TTWA 3FPFA 4D9GA 1H2RS 4F1JA 1LDNA 2PANA 4BEWA 5EUMA 4JJAA 4UAGA 4CEJB 4XWWA 2G0TA 2HT6A 4IDCA 1GHTA 2PWAA 2AUTA 4LMRA 5TE9A 1HZZA 2FR8C 3C45A 2PEYA 1YCFA 1P4SA 2BT4A 4RK5A 4F9FA 1EUYA 3F6EX 3UXYA 3I62A 3SM3A 4JV5B 4ZANA 1K89A 5F2KA 4IHJF 3OFNA 3WDKA 1U1CA 1BU5A 1KXJA 4HV4A 1V11A 1X38A 2PT9A 1Q22A 1E7QA 2JD0A 1LTHR 1JMYA 2NO5A 3G2MA 2YVQA 3R0VA 3EXG2 4EECA 2V8OA 3ANNA 2GXQA 5DNWA 1Y37A 1S7GA 1JPUA 4J0JA 1M2WA 2VTKA 1YRAA 1QKJA 1UZMA 3O74A 1Q1BA 3QQPA 1VIMA 2O59A 5I7VA 2FR8A 2ZVQX 2DQKA 3G49A 4E1AA 1BDIA 3EC7A 5DTQA 4ZKDA 5K8LA 3NVMB 3U31A 2NP6A 3HLTA 5HX7A 5ESXA 1EVLA 4F3CA 2W00A 1RFGE 1RXSA 4OQZA 4PXSA 3TG2A 3KL4A 2RFLA 3BMNA 2VNHA 3LCCA 2GS9A 4M86A 4M8LA 4DIUA 5JQGA 1QP4A 2NU6A 1P6UA 4IQ8A 4US0R 3KQKA 5BN1A 1YCGA 2DMRA 1T29A 4NPAA 4ITRC 4CKEB 2CFRA 2DE0X 4BAZA 3WRVA 4GOOD 1ODCA 3RUPA 4KQJA 4P1ZA 3N5KA 2JASA 3IEUA 3CKLA 4UM7A 1R8QA 4MO2A 4XX0A 5DTEA 4F8EA 3MTQA 3NYQA 5SY9A 3Q2KA 4BO9A 4MUMA 2ZM5A 5IX8A 2J9GA 3JAMA 3CH5A 1XALA 4X7RA 4M0MA 1E58A 3B6EA 1DV2A 3U3ZA 1ZX1A 1WXFA 3SKXA 4Q7JB 3N2LA 3SDZA 1HR0B 3MSCA 3KDPA 4A1OA 1T8YA 4FNMA 3T54A 3TOXA 2PBRA 1OI3A 3IUEA 4FGLA 2P5TB 4KO2S 1DELA 1E6UA 3PPIA 4MIYA 2J09A 3DO8A 1CQJA 2PVCA 1GRCA 2Z0MA 4FEAA 2ZYSA 4OIFA 5IJZA 2IHUA 2ZJ6A 4O1IA 1RQPA 4ALIA 3KQTA 1YAHA 2IE8A 1Z25A 1U3TA 2GZSA 4P38A 5AK6A 1JAYA 3AEKA 3VR2A 4W5OA 2Y92A 4OHPA 1OTXA 4PIPA 5IH3A 5C32A 5CIYA 1GYQA 3CLSD 1Z33A 2HDHA 3K4PA 4D6XA 4WXPA 3BH7A 4AZ3B 4JJZA 4RKYA 5KQMA 1XN1A 1UJ2A 4J16A 1SBIA 2UU9B 2I2XB 3ENZA 3NIGB 4I50F 2N46A 1DFIA 3I39X 3G7SA 3AL2A 1N8SA 2Y71A 4FR0A 1Q21A 4CM6A 4XUGB 3G13A 1TYDE 1EAYA 4MGKR 3HV0A 5JHGB 2GBCA 2QXTA 4M1QA 4OF4A 3MD9A 4IH4A 4GQIA 2BM0A 4RAOA 5ILQA 2J31A 3I9KA 3J81k 4WCVA 2C54A 2HWUA 1GEGA 2TRSB 4WZBB 4P5EA 2J0UB 4EGAA 4ZAFA 4BO4A 2JHPA 4PYRA 2F55A 4YAOA 1G8AA 4FDTA 3WNBA 4Y2YA 3DZKA 1Z75A 3JVEA 5AKGA 1X13A 4MWDA 4YMLA 1QDLB 1XXHB 3H1BA 3ODGA 4J7UA 2FSPA 2HDNB 3GT3A 4G5HA 1ANKA 1H0KA 1DUIA 2ZTSA 4IDGA 1F2DA 4L3OA 1BVHA 1MQ9A 1S9HA 4OO3A 1L8OA 2JPDA 1LNZA 4QFCA 1GSOA 1FS6A 2HMUA 3DV2A 4QL3A 1WBJB 3CX7A 3PA6A 4EY7A 7REQB 2WP8J 4DBLE 1F17A 1P4RA 1R2QA 2Q1UA 3K15A 2QRPA 4U6QA 1YQWA 5FPPA 5E3HA 3LTNC 4WZAB 2PH5A 5FV7A 3AF2A 2O8CB 2Z3ZA 1Z0IA 2UZIR 9ATCA 1X8XA 3VR4A 3T5TA 4CQLA 1S01A 2GN4A 4XGNA 1QB7A 4IIBA 1WUTA 1O3YA 1SK9A 1Y5RA 1IOLA 1D2EA 3T4PA 3ZGLA 1AUVA 4GRDA 1F4PA 2G1UA 1Z5ZA 4FNAA 4FSHA 1XTQA 3HP1A 4TMFA 1CS4C 5EG5A 5FTLA 5CGQB 1KU0A 4HDNA 3KD2A 4RKEA 3OX1A 1AZSC 5C4IA 1YGYA 4C03A 5FOSA 4JN6B 1WCIB 5CT9A 4AJKA 5B3JC 3BJRA 1W88B 2O7QA 5CA0A 4AXBA 4C07A 2I2CA 5CJPA 1FFXB 1H1DA 2Z8XA 4E6PA 4L28A 1UDRA 3VDXA 1Z7YA 4F2HA 1Y6QA 1QAMA 3EIFA 4PAOA 1KSHA 2BR5A 2M6KA 2C42A 3SNHA 1GZHB 4UPVA 5KO2A 1VBNA 3HYCA 3KKEA 4YO7A 4B87A 4D8YA 4IGIA 4MWCA 3HA5A 4ILEA 2XLBA 3A32A 3O8LA 1JDUA 2J41A 1BX1A 3CZMA 4ZT3A 2CLFB 4F2PA 4TKVB 4R2XA 5D3QA 4TKUB 1A88A 2WSLA 1DTWB 1XJCA 3MTIA 3PKZA 1OC2A 3J80A 4OQXA 3SP1A 1R8JA 1DXHA 1ORIA 4N41A 5D3MB 2I67A 3H13A 1M0EA 2JBWA 1LDBA 2BFEB 3N0RA 1EJ6A 4JC0A 3OIFA 3D31A 3PNBA 4XPIB 5ESDA 5K0NA 3W3AD 4EI8A 3AP3A 2RJOA 1UC5B 1HE3A 1K27A 4GKBA 4HQ0A 1DFGA 3OLWA 1P44A 1B26A 2FDRA 4L8VA 1WVGA 3HO8A 4J6FA 2AR0A 3F7OA 4RULA 4HZGA 5JOQA 2PKCA 1YR2A 4HATA 4FEGA 3ZCXA 3B85A 2WF8A 3GCGA 4MYCA 1QHNA 3OP1A 5I7RA 1L7DA 4J0KA 4JUDX 4YQZA 5JFGA 1GM5A 3GFGA 4NU5A 2PWBA 1YJXA 3OUUA 1C1HA 5K2OA 3LK6A 3IKVA 4AIRA 2DH6A 3L3BA 4J90A 4H6VA 4ZVOA 4QPNA 3B6MA 1KZ1A 4HB2A 3SF8A 2Q9BA 4NE2A 3TBKA 1FW6A 4D25A 1ZWLA 2GOYA 2HCFA 3PBKA 4FZRA 4MP8A 4WN3A 1GAXA 2SKDA 3OEEA 3R8XA 4AJJA 3O3CA 5DBOA 2I78A 3DEZA 1BCRA 3EK2A 4OMUA 2W6JD 3ZWNA 3NHYA 1L4LA 2XCLA 1BMFD 1KY5A 5L51A 4CDRA 4KXQA 1E2JA 5AI8A 3HKBA 5EJ9A 5KJCA 2ZWPA 3WP0A 3IH5A 1BE0A 1UK8A 3HBMA 3LX4A 1GRVA 4PYQA 5BP7A 4IR7A 2YHAA 4I4IA 3IB3A 4ENPA 4G4JA 1KYVA 3DP7A 3HU1A 1W94A 3KZOA 4LN1A 2CV0A 2VRBA 3Q41A 3RJZA 1VKZA 1VI6A 2IBMA 1NVXQ 3CUEF 1NAIA 1RBQA 4AWXA 2ILVA 4M60A 1SQGA 3U7JA 4HDKB 4L4ZA 3SZOA 2Q1YA 1HDCA 2Q4RA 2W6PA 3P45A 1G3QA 3HPRA 2D7JA 4OEHA 5J3JA 4JLSA 2IPOA 1E9VA 5HIIA 1O9HA 4DUYB 1RWBA 4FFRA 1JQLB 3CN7A 1VG8A 2XITA 4L2IB 1CRWG 4RA9B 2WINI 2LD4A 2X19A 5ALLA 5HJ5A 4DV1B 3ZCPA 4CG1A 2P9QA 5F1KA 2UVPA 2BEWB 5LBUA 2CNDA 4LBYA 4PLTA 3M3HA 4RJLA 4RY0A 3ZWXA 4M9RA 1HT3A 3KTDA 2FYTA 4QOIA 3KSRA 4ZQBA 5J5CA 2GGSA 4G0ZA 4K9NA 4F45A 1QQBA 3E9CA 3WRWA 1ID8A 1E98A 2WA1A 3L6OO 1JFLA 1KZ9A 4JLBA 3ZHUA 3WLPA 3EWNA 2BGUA 1CUYA 2FU5C 3GPBA 5ALWA 5KDOA 3HXOA 5J4YA 3OX2A 1E9DA 3SKYA 3E8XA 3RYTC 2FEOA 4Y30A 3U4DA 1W49A 3IDAA 1UJ5A 1KDYA 2NU8B 5CDFE 4PG7A 3ORHA 5BUCA 4HX9A 5K3CA 4I4TF 2OK8A 3LY7A 4XDZA 3HTXA 2E6KA 2V7UA 3P0RA 3SGLA 2JHCA 3LNCA 4ZGWA 1BCSA 1WU7A 2RK3A 4WZBE 2ZE7A 1NTOA 2VJNA 1UFVA 3ZEAA 1LB1B 2V1UA 2DFLA 4XUCA 1NMXA 3WNCA 3T7RA 3QX3A 3MJRA 4ZAGA 1UBJS 4ZJZA 1GAQA 2AEFA 2P3QA 3H5AA 5FWYB 3M6AA 2AJTA 3DL0A 3REFA 1EIWA 3RI3A 1XXHE 1Z39A 2IQ5A 1JW9B 4M0LA 2XB6A 2PAFA 4GR9A 1E6CA 1YC5A 4INAA 2PZEA 2R6R1 3GROA 4ML3A 4OAPA 3ZHZA 1KMQA 1HFKA 2IYZA 2OXCA 2YXLA 3WKBA 1AH2A 3EFOA 1PSDA 2PYIA 5GVRA 2CLMB 1YFZA 1ZVQA 2VP9A 2Z6UA 4BFLA 5I9NA 2NOAA 4XVRA 1I36A 1ZA1A 2DOKA 5GGYA 5IJAA 2J67A 1L1RA 3WSWA 5G4KA 1CQIA 4RPLA 3FYDA 4A8JA 1KMHB 1MBZA 4FHEA 2JEYA 2A0FA 3IO5A 3AV3A 1X1TA 3K6JA 4I55A 4I3HA 4PQYA 4CYMA 3A1SA 2JIZD 4U3JA 4IXMA 1KA9H 2YV4A 1U0HC 2VSNA 1I3KA 3CZCA 4O5AA 4PAQA 5IM4F 5IKXA 4DA4A 4JOCA 4XQ9A 1X8KA 5IBQA 4MV0A 3VKVA 5JNSA 2ODPA 3ZE8A 4F93B 1QPGA 4E5DA 5FBZA 4QT0A 2H5IA 4NNOA 4PX3A 4TL7A 5AW2A 1TO2E 1W36C 4FONA 2XOKA 2CFSA 1KERA 3ILHA 4NNJA 5PGMA 3KYJB 1V6SA 2FPPB 1GR0A 5BMOA 2EC5A 4K9KA 1OF1A 3FJYA 4DABA 3BE5A 3QVUA 1T1IA 4KGDA 1ATZA 2F17A 3QTTA 4YP5A 2KQUA 3C3AA 3HCPA 2ZB7A 1XB2A 4QFDA 2HLPA 3TEJA 5CLGA 2JFFA 3IUYA 4LRUA 4U2CA 3QKRB 5E8RA 4GPTA 1RI3A 5GONF 4GX0A 4DARA 4PYKA 2RKOA 1L7VC 1MX5A 1ODFA 3LA8A 2P1ZA 3OE5A 3IQGX 4LZNA 1P5JA 1F1BA 1II0A 2GDZA 2NV2B 2QIPA 1EDBA 2QKYA 2ZUSA 2HSGA 4ZCMA 3A1DA 1PFVA 3SJ7A 2J3MA 4YECA 1JG7A 3AZOA 1K88A 3D3EA 4LBVA 3OIUA 4URZR 4WESA 3UWPA 4DIOA 3OZTA 4LSWA 1F7UA 3CEJA 2W83A 4WOCA 4BWVA 3NAQA 1NV8A 5FA5A 4ZT6A 2Q9AA 4CUKA 3AG6A 3LGSA 2YUTA 1OTHA 3U48A 2F1OA 4M3NA 3RSQA 1JSZA 3N58A 4LNHA 3GLHB 1V25A 2HPHA 5KAPA 4DFDA 5BSEA 1FUIA 4YYEA 2XKKA 2F8MA 2GJKA 4NVRA 1X39A 1RC8A 3LPCA 2A5JA 1ECFA 1C4OA 2J6CA 1NVBA 3AC0A 3L82B 3I72A 4OHCA 2HNAA 3FPSA 4K2AA 5H4HA 4BJ1A 4E3ZA 3CKKA 1HORA 1FYEA 1U9YA 4DLPA 1ICEA 4LE0A 3NBMA 1NDQA 4ZVSA 3MHPA 4IUBS 4F2DA 3OM8A 1QORA 4PQFA 2KB0A 5EXDA 2XODA 1N9GA 3SSNA 4D4MA 1QTRA 1J70A 3GMTA 4MUXA 4TVBA 2R7NA 4U5XA 2VHCA 3B20A 3BCUA 1KYWA 2H9IA 4ZVVA 1CUHA 1VYHA 3K3PA 5KWJA 3EIUA 5HFJA 4KLNA 3F1LA 3IPAA 4G1MB 5IANA 2EFGA 1DWPA 5JRJA 1JYFA 5ENZA 1A95A 3UPDA 2XUAA 2AZTA 1QHIA 1QNFA 2GAAA 3DLCA 1TCAA 4MRNA 2AL7A 1C80A 5IKPA 3FVQA 5ALKA 3L2OB 1XIVA 3QUCA 1GV0A 1ZNXA 2GD1O 5KKNB 1EWYA 4HRXA 5JS7A 3GFPA 4HEJA 4KYUA 5IXSA 3FTCA 2W48A 3PUWA 4YDQA 3H9BA 3HR7A 4IIHA 4LWQA 1OFHA 4WLNA 5K0CA 4GEKA 1Q95A 2W90A 1G16A 4ZAWA 4ZV9A 3KK0A 1NQ5A 4FMDB 2VHTA 1B1CA 1Z5GA 2DCUA 2PVPA 4YQEA 1SXJB 2XQJA 3E5NA 4KBGA 5A6SA 3SYNA 3TSYA 2PPLA 3KPVA 1RC1A 3TBHA 1UANA 3VPFA 2GASA 5CXXA 1HC7A 5DTIA 4CM9A 1T8SA 3LY5A 2VYQA 1UWVA 3MTBA 5H81A 5B37A 3PENA 4XM0A 3KJHA 4KQWA 2QJTA 3K8QA 3N8DA 4LE2A 4MPPA 4N6GA 4O25A 4U39A 3TL6A 4QGHA 1YJAA 3FKQA 1YI8A 1IQRA 4MDHA 1TJ5A 1P6XA 2PL9A 4JGBA 2P68A 1HT0A 3LHIA 1EBBA 3M6UA 3OJXA 1H8HD 4LX0A 1JT2A 4BLOA 4RKWA 5LQSA 1CNFA 2C1ZA 5DK6A 2G06A 4ZYLA 3M6WA 5GJVC 3TW8A 4ETIA 5DWQA 3KUCA 5C5DA 1RNLA 4GMDA 2Q6IA 4PZUA 2XA1A 1EINA 3A37A 3IXLA 4DYDA 1TK2A 2JZOA 1N8KA 2PLRA 1M6NA 2GPTA 4I3FA 1JHDA 3TLGA 5I01A 4IWNA 2QRUA 2AI3A 3TYXA 3K9GA 1B93A 4MR8B 2X7JA 1PFYA 4NAUA 4I19A 6PFKA 2XCTB 1A72A 4NEGA 3W3AH 1JIIA 4WCDA 3WP1B 4Q4DA 4A82A 3FYHA 2P4HX 1QR2A 4F6RB 4E21A 4GM1A 4U7PB 4EHKA 5AVQA 3F1KA 4XH9B 1SKYB 3CSUA 3ET4A 3H1EA 3THXA 1VPTA 3JVIA 4ABTA 2CLEB 1N32B 1WP9A 1HDRA 1ZK2A 1KI3A 1EB8A 3I6ZA 1PGQA 1VCNA 2ZKIA 1RBZA 3KV1A 3PYXA 3BJEA 4ZYUA 1UKAA 3IL2A 1PR1A 3HXTA 1TTPB 5CIWA 3GLFB 5CEEA 4FM9A 1DXOA 3W2TA 3T5GA 1JEJA 5BVHB 1KEWA 1QFZA 1QVWA 2PKQO 2QVZX 4MPRA 3AETB 2JH8A 3B9PA 4JD5A 4L73A 4P80A 5BSKA 1NUTA 1QV9A 1Z0UA 3IC5A 4JBGA 4LHZA 4M38A 4LY9A 3KWJA 1ADGA 4P36A 5ALOA 2HEIA 1E0SA 4BNKA 1IZ7A 5F7OA 5KJ1A 4BKMA 4Q3EA 2Q5CA 2H2IA 1TNDA 2YJ4A 3JYOA 4YPOA 1ITZA 4Z1MD 2VP4A 1C4WA 4D92A 2QRVB 3EBPA 4S24A 1ZJ6A 1CR4A 2WJVA 1N34B 4PSKA 1E3LA 4YCSA 4D3DA 2QPLA 1FVHA 5C34B 3UGQA 5EHNA 1H0SA 2JGAA 2UZ0A 3KELA 2BHRA 3H9GA 4YJ2B 5DSTA 1EQ2A 1YE8A 3VH2A 1HG1A 4ZYWA 3F73A 1XDGA 2R4TA 3KAPA 3R4VA 1NQUA 4F5WA 3QELA 3FVRA 3TIIA 4OQPA 2V8BA 4JMLA 4JLNA 2BMWA 4G86A 4NYJR 1XA3A 3FTQA 3L4BA 1NOIA 2OG2A 2PLFA 2PX8A 4UU8A 1S3GA 2OWDA 3HCAA 5CH5A 2OOKA 2J30A 4NZZA 2ZIUB 4P81A 3BEOA 4WFKA 4E09A 3JQRA 3QU4A 5AKJA 2JLZA 3NWOA 2BJWA 4HDMB 1XAJA 5EKXA 3ORFA 3RKSA 5L6MB 5FUXA 1EDZA 4ZPJA 4BBZA 4NJMB 4G8JA 3GY0A 4KQ1A 3ZJUA 3B12A 4EFMA 3HFSA 3PD1A 2EBWA 4TYYA 3ABIA 3GDOA 4GG1A 4TM7A 4WNAB 4RY9A 2C4WA 4K03A 3VHXB 1WR8A 4EO9A 2GILA 4MR9A 4ND6A 2CWDA 3URMA 3U4QA 3S68A 2ONJA 2GB4A 3PXUA 1VYTA 3GHHA 2TMYA 4JAVC 1SBNE 1IBLB 3VYSB 1Z07A 1WMEA 2GLXA 3VJRA 3NONA 3GLHE 4DQ0A 1KRWA 4R05A 2ZROA 1Y8CA 3LFHA 4XQEA 5DM4A 1GKLA 4Q00A 3G0GA 4V0LA 3G5TA 5JJ5A 2WTUA 1Q0HA 2A1TS 2WWWA 5EZSA 1L6RA 3KQNA 2EZ4A 1M34B 2HXGA 3MWLA 1WPRA 1NW3A 2CUKA 2XYHA 1CUBA 2VWQA 2KLBA 4MVJE 4UD2A 2EYQA 1MEJA 1T1RA 5ULLA 1PS0A 1O4VA 3RUCA 1D6SA 4HDRB 2W6OA 1CR0A 3RVSA 2YW2A 4HLQB 2BAGA 5IUKC 3TAHA 3TLMA 1W85A 5CDUA 1QRAA 1T6YA 3EG9B 3RYFA 4ND5A 4ZP1A 2Q9CA 2WNHA 1P77A 3ROEA 5KNDA 3WYBA 4CLXA 5L4LA 4HH3C 2VPIA 3REGA 4CI9A 1VHWA 4EHAA 5JQGF 3GNLA 2EIHA 5DWDA 3U60B 3BMQA 1B14A 2I3AA 4XDHA 1JPJA 4JVOA 3V4PB 2RKWA 3WK6A 2C7PA 1EFTA 3F5FA 3VAAA 4CZ2A 1YQEA 2AVNA 5BR8B 2OE2A 2I7XA 1NUHA 1VJTA 2QJRA 3DTVB 1HGXA 4Q3AA 1WXIA 4X45A 5K8VA 4EJ2A 5ITWA 2IDMA 4D8XA 3C87A 3TLAA 3V6MA 5DEOA 1XK7A 1Y81A 4DV4B 1IY2A 1EFPB 1RIIA 4YFVA 5A04A 3ITDA 2MYPA 4PU0A 4O0LA 5EZ5A 3GNTA 1BHO1 1K8RA 4DEXA 1DLJA 4Q4CA 5IKEA 3SLRA 3PTZA 4PTLA 1MXFA 1L5NA 3ASZA 1YVPA 4MV7A 1ORHA 3E9EA 4OXIA 1GITA 1P0CA 2QTNA 1SXJE 1V1MB 2R84A 1E92A 4DV5B 3ZV5A 3MUOA 1EHYA 2J9ZB 3AYZB 2GN9A 2QX4A 1AK2A 3S2ZA 2C5AA 1V43A 2G5PA 1T0IA 2X6TA 3PJDA 1RPTA 4PRYA 4US2R 1ZD4A 5JS2A 1WUHS 2EGHA 3R23A 4UMDA 2PZ8A 4QXOA 5J9FA 1M6HA 4U7DA 4KR7A 2R6JA 3PVZA 4OI2A 1P4AA 3DC7A 3IP6A 1BE8A 5A7HA 4KUGA 2FQXA 5IC6A 1KKUA 1U6IA 2AD1A 3A3OA 3VX3A 1NMZA 3LKZA 4TT3D 4RZUA 2YXDA 2E49A 1M73E 3K0KA 3THRA 1C9DB 1RRKA 3ELDA 4HN4B 3ZR4B 4HS4A 3EIHA 3K1AA 5KYVA 1SC1A 2NX2A 3W5IA 3HDQA 1NVEA 2Y68A 4UW9A 1A4XA 3IPLA 4M1MA 3UAYA 3UT5A 5CVEA 3K96A 1N2EA 2VWGA 3KSUA 4FUTA 1KR2A 5KTYA 3I01A 3KYBA 1E2GA 1T15A 5EP4A 3A36A 4X66B 2CEKA 1DQNA 2F9LA 4OLBA 4OI1A 3ZWMA 3RG8A 1ESEA 4MR7B 2UKDA 2XE8A 1N2SA 5IU6A 1XO1A 2J3QA 5KQLA 1BA3A 1QF6A 4IV5A 2ZI6A 3A4IA 2PZJA 3OZXA 2HLDD 1SZJG 3QOXA 5G41A 4ZEMA 3NIDB 2VH5R 4B9EA 1HDOA 2HIAA 3EGOA 3T9FA 3MJTA 2JNWA 4XB6B 4FOPA 2ZSAA 3AP1A 3IV7A 2HOQA 3RVPA 1W52X 4RHXA 2Z43A 5DO9A 2A0WA 2YVAA 4RMIA 4O4HB 3L0ZA 1HRKA 1W0JA 1X7ZB 3GLFE 1JDBB 2Z08A 5BT9A 3RIXA 1YDWA 2Z8YA 5K4HA 1KPGA 1SWWA 2A94A 3FNGA 3FZNA 4B6RA 4Q48A 3HJTA 4GH5A 2Q1XA 2C2BA 1YVEI 4TZKA 1RYMA 2FMHA 1LK0A 1DIAA 3QUTA 1V8ZA 4CM7A 4ZQCB 4H77A 4BRZA 3B5IA 5COQA 4E4RA 2XGSA 3OA2A 2AFHB 3LRXA 1IY9A 3P9NA 3TGWA 4X8OA 3HB0A 3MWFA 2VCYA 4TV8B 2GF2A 1E0JA 2BLNA 2QZZA 4FFVA 1V47A 2POQX 1P7PA 3C43A 3CINA 1ODJA 5K0GA 4YCLA 1YCDA 2YFYA 1MDBA 2BHNA 2ZI3A 2OGTA 1IY0A 4BUCA 3KSZO 3MWYW 5KDDA 2B1QA 2C5HA 2JGLA 1Q1ZA 3ZIAA 3AEYA 1NSYA 1IOWA 2X77A 2Q9UA 4KXNA 4QTUB 2LCFA 1OJ7A 2QAIA 2V97A 1IN8A 1NQTA 5SZHB 4DADA 3T9AA 1XVIA 3O9MA 4DR3B 4UCQA 1YVDA 3VBEA 3I37X 4H1UA 3EWSA 2B20A 1RWVA 2Q7XA 4MYDA 1IB0A 1P0MA 2GPWA 1D5WA 4KE8A 1XGKA 3DJFA 5ALMA 3UUGA 3FMVA 2RHCA 2VDWB 4Z54A 5GZ1A 3ESZA 4C7BA 2OQRA 4CMGA 1BS1A 1ONNA 1XXLA 4DTCA 1GPAA 3BSFA 2DQZA 3ZV7A 4AMGA 4WFIA 4G25A 1JXAA 3SHVA 4B4WA 4CKWB 4LGMA 1JAZA 1AK1A 3IT0A 2EX4A 2CGEA 3RADC 1V3QE 4J3FA 3GJTA 3MPUA 4OUDA 4RZIA 2X8BA 5KNCD 1J8VA 4GXTA 2GBGA 3I1FA 2ETXA 4LTNA 2QGNA 2ANCA 2AUNA 4MB6A 5ANRB 1NQOA 3L93A 2GFQA 1COWA 3FROA 3MT9A 4R9RA 5CYFA 4WKBA 3QXSA 1OILA 2PTGA 2E1RA 1UADA 2Q5EA 1QZ3A 2XE6A 4ME6A 1G8JA 4UNNA 2Q1TA 1JHMA 3LT0A 3TQFA 5A9TA 1JWBB 3JWPA 1QZXA 4GI2A 5AK3A 3HI6A 2WG0A 1NJGA 2HA6A 1M34E 4WLOA 1WDMA 5ECWA 3T7DA 3K5WA 1WQ1R 3OY2A 4F9EA 3S99A 1DQZA 1JVSA 1V1JA 2QMQA 5I9LA 4N54A 5COAA 3MBIA 4FINA 5KTTA 1RMQA 3BK1A 3IUSA 3R24A 1J8YF 4B7UA 1T4DA 2ZIWB 3ZLJA 4N8EA 5ER9A 1J5XA 1R0CA 2HK9A 1XDZA 4JP3A 2W0MA 1G3MA 2BEUA 3L7JA 3A4YA 1MJGM 2IK8A 2JRLA 4B44A 4C78A 5KVAA 1NNSA 4FFMA 5ICSA 4FDLA 3ASVA 4K46A 4KIFA 4LV6A 2FAXA 3A9TA 4HH0A 4M37A 1FPMA 2H06A 3EOZA 1ONSA 2AOUB 4PHCA 1EDDA 1ILWA 1J8QA 4N0DA 4C89A 3KAQA 1X7HA 4UNPA 3ST7A 3W90A 1OLXA 4OJYA 1ISRA 1EM6A 1EWVA 3F6YA 1K3UB 1PD1A 1SCUB 2H48A 1ZCFA 2E9SA 2NUBA 1KI2A 4HGYA 3UOAB 2AYXA 2VPXA 4W9MC 3VR6A 1T2AA 2HF7A 5EYPA 2VTDA 3EPLA 3PICA 4M7WA 4RH3A 5EFZA 1C8BA 1J7JA 3TFWA 2HKIA 4PYLA 3OOWA 1OKKA 4REQB 4DJFC 2J7KA 5LQMA 4DM3A 4NDZA 1T8UA 4OSPA 2P9HA 3PFCA 1H0HA 1Z2PX 2JCBA 1GCOA 2RCYA 4PAGA 1IM2A 1JAIA 5FBWB 2PSHA 4W8OA 1TUEA 3GK3A 3H9UA 3RYCB 2W93A 4D44A 4L3WA 5DM70 4ZREA 2FFRA 2BFBA 5HKKA 1HY3A 1EFUA 3C1TA 3T3PB 2NYUA 1V0JA 4LZZA 3HFJA 1IEWA 3P19A 1QGUA 2QL5A 4YUXA 2B6NA 3BG5A 1SIBE 1JKJA 1W0KA 1I51A 2HV9A 1C3VA 2J6HA 3KR0A 1JR3D 4J0CA 3GDGA 5TS3A 2G07A 3R7SA 5LOVA 4KB5A 3B1XA 4OJTA 3VYTB 1BWSA 4UOEA 2IS2A 1NI5A 2VAPA 3L1HA 3IQHX 1XD2A 1ZN9A 3B3GA 3OPVA 5AHWA 2JC3A 4D3YA 4H35A 3JPYA 3RRYA 3H3JA 4ZFNA 1X6VA 2VJBA 4XI9A 3IP7A 4RIHA 3SAJA 1KO1A 1DOAA 1HRDA 4A23A 5JYBA 3F4KA 5F2EA 4N18A 1PCXA 3ANLA 3I53A 4QXRA 3ZIDA 3V2IA 3P4UA 4FYPA 3KLMX 3SBXA 1XNRB 2NM0A 2AJLI 4X7BA 2Z5VA 1QO9A 1DSSG 4BU0A 4XJTA 3M82A 3U0VA 4CF6A 4ACAA 4EUHA 2PUAA 4NXNB 2JANA 1HF3A 3MJSA 4CFZA 3M83A 1DKNA 3EF1A 4GYWA 2FA9A 4C87A 2KI5A 1N3IA 1P2UA 4BMYA 3ESYA 5J4HA 1JPVA 5I4BA 3HWSA 1CUEA 4V02A 1U04A 3PR1A 3R3XA 2G9NA 3OT1B 4ZVMA 5BV0A 3WTBA 3D8RA 1TIKA 2FZ5A 4DCSA 4AYXA 4I55F 4EA9A 2PQMA 3VO8A 4HAZA 3ZDDA 2WF9A 5CNKA 4L7QA 4PV7A 3SNKA 3NTQA 3DLAA 1K9VF 2IS1A 2YRFA 1ZWKA 5EKSA 4AY6A 3C4VA 2NW6A 4YUWA 1YUBA 1PZFA 1VKJA 2DFTA 4I9HA 4TWJA 3U7HB 1HNXB 3QVOA 1GA4A 2QAJA 4LZPA 1JU4A 1ZUD1 2AFHE 5FOTA 1AS2A 1X86B 5UKDA 3T7TA 5A4FS 2XWSA 4W5TA 2I8LA 2ZWOA 1UPXA 1ZISA 3BUSA 3U7QA 1Q7GA 3WKEA 4DE5A 3GP8A 1P0QA 1M1NB 5FV4A 3W5BA 1EUDB 1B76A 4BFZA 3W6NA 2CSXA 3HH8A 5BT8A 2LUOA 2ZI7A 5ALXA 3ONVA 1FW8A 3KIPA 4B3HA 2XUPA 1FP4A 4A4DA 4F72A 4H1HA 3E3LA 3C15C 4V0KA 3HHEA 3MPOA 4ZQEA 5DMXA 4A10A 1Y4UA 4Z4GA 13PKA 3MLEA 4CM1A 4ZCTA 4KR3A 4BB6A 2ADFA 3DOJA 1CP2A 3MQ2A 5FUQA 3G8BA 3FW1A 4LDPA 3TUZC 1NYRA 1Z5UA 4CLOB 4FC7A 3NTOA 3RS4A 3VR1A 5J58A 5JBNA 1N0IA 1ISFA 3OJ0A 1O8BA 2A9JA 4Z9FA 2QK4A 2SICE 1GPKA 2UV8A 1F5SA 3QV1A 2A78A 4MLCA 3TZ6A 2HN9A 2PSDA 1I9CA 3S2EA 3TVTA 5IABA 4N3NA 4YJ3B 3AKCA 4Q1CA 4C4XA 2JGNA 2YC2C 3B9QA 1DAGA 2FRVA 2PRYA 1XHEA 2O7RA 4R41A 5CPBA 2QNIA 1ECPA 3NYIA 3DOUA 1K2VN 2A1UA 3BD6A 121PA 4CHGA 4F11A 5IJ9A 1Y63A 2GK6A 3IT2A 5KYXA 3FLMA 1UZAA 1KOLA 3OLYA 2WYVA 2MTBA 3BL8A 1C5KA 3VPGA 3ZCSA 2D7DA 1EG7A 1DC5A 3UFXA 1Z37A 1JB1A 3CTMA 5CDYA 2WTMA 2O5CA 1R9NA 2PZBA 4X8HA 3DBIA 5KTNA 1Y7TA 2DBQA 1Q14A 3FIJA 1B74A 1IHPA 2A9FA 2YW9A 3L0DA 3R3ZA 4JSYA 4AKSA 2SBTA 3LQRA 1UJNA 3R75A 4QIHA 3WY9A 4D98A 3TW6A 2AOTB 3FHLA 4F7WA 2BKLA 2YV5A 4OX9Y 5E0OA 3BQNB 5ARCA 4TWAA 1EI9A 1N3LA 4EMUA 3B7PA 3HZZA 1QTNA 5AMXA 5B5SA 5CB4B 1Q2XA 1IIRA 3FPEA 3KZXA 3O1LA 1MV8A 1FMTA 3GARA 3NDPA 5AXCA 1CEEA 3DDWA 4WK2B 5C7IO 2B8NA 2HZBA 2OILA 4BNZA 3ZD7A 3DEFA 1QOPB 2YY7A 3PE3A 4AIIA 5LYYA 2AHOA 4DL9A 1UKCA 1RZRA 3KO8A 5JNLA 4R1MA 2GAJA 3GA0A 3OPQA 1Z73A 3AUXA 4XVQA 5LQRA 1BRTA 1UWCA 4AWAA 1TGYA 3P2MA 2INGX 3UPTA 1BD3A 2Q45A 4OTZA 5F76A 3LZ6A 1HE4A 2EQBA 4FX5A 1GU1A 1OWMA 2WHPB 4IS3A 5KSPA 1OFUA 4DRXB 1G8YA 3CR8A 2VH2A 2H11A 1SMKA 2WLSA 4PTZA 4QPZA 4UQPA 4MMXB 4HAIA 4IQ4A 4ZRDA 5FWXB 4HQOA 1W9HA 3TDMA 3RAJA 2BH2A 2VTBA 3W8FA 2O8FA 1ZGCA 2D7CA 2AE1A 3OWXA 4M9ZA 1JQ5A 1OOEA 1YRLA 2EKBA 4LYGA 3V1TC 4LHVA 5C51B 4Z2YA 5FLXA 1H3EA 5FWNA 1Q7CA 1WUJS 2ORWA 4M98A 1AKMA<