1PR4A

Escherichia coli purine nucleoside phosphorylase complexed with 9-beta-d-ribofuranosyl-6-methylthiopurine and phosphate/sulfate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
237
structure length
232
Chain Sequence
b'ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHITTAAERQTTFNDMIKIALESVLLGDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
molecule tags Transferase
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
total genus 80
structure length 232
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr4A00
1Z5NA 3OPVA 1JPVA 3OZDA 4M3NA 4OGKA 4TTJA 4QATA 2QSUA 4OEHA 4LNHA 4YMLA 4R2WA 3NM5A 1U1DA 5F73A 3UT6A 1Z37A 1NC3A 3D1VA 3KVVA 1ODIA 4L5YA 1JP7A 2A8YA 1Z33A 4TXLA 1SQ6A 1Y1SA 1ZOSA 1JE0A 4E1VA 4DABA 4TXMA 4EB8A 4OJTA 5B7NA 1QE5A 3QPBA 1NC1A 1WTAA 2HWUA 4QASA 5B7QA 4YNBA 3PHBE 1VMKA 4L0MA 2QTTA 4M1EA 3IEXA 1TGVA 4KN5A 5EPUA 3DP9A 1OVGA 3K8OE 1VHWA 4F1WA 1Y1TA 4DA7A 5CYFA 1Y6RA 1V45E 4OGLA 1PF7E 1JDSA 4TS9A 5CXQA 3P0EA 4BMZA 4X24A 1CG6A 2HSWA 1PR4A 1RYZA 2RJ3A 1YBFA 3KU4A 3SCZA 4PR3A 1Z39A 1T8SA 1V3QE 4F3KA 3EUFA 3E9ZA 4G8JA 1PBNA 4LDNA 2B94A 3LBAA 1OTYA 4D8YA 3EMVA 4OY3A 4LZWA 4MARA 4NY1A 3UAZA 1FXUA 4JP5A 4TTAA 1Z35A 1ULBA 3MMSA 3FOWA 4QARA 3OZBA 4DA8A 4WKOA 1Q1GA 2P4SA 1PWYE 2AI3A 1YRYE 5B7PA 1SD1A 3OCCA 1Y1RA 2AC7A 1YR3A 5F77A 4EARA 1ODKA 1JDZA 4D9HA 3PNSA 1A9RA 4TS3A 3LGSA 1TD1A 3INYA 3GB9A 1A69A 4UC0A 3O6VA 1B8NA 5JPCA 3BGSA 1A9SA 3BSFA 3ODGA 1A9QA 1A9PA 2A0XA 2OECA 1PK9A 1Y1QA 3U40A 2A0YA 5F76A 3OOEA 3BJEA 3T94A 2PGAA 4M7WA 3ENZA 5CCDA 2IQ5A 1U1GA 1T8RA 4L6IA 5KB3A 3PNPA 3PHCA 3DPSA 4FFSA 4GLJA 4LNAA 4P54A 4GKAA 3DF9A 1M73E 4IP0A 3ONVA 4DANA 3KHSA 4QAQA 1V2HE 1PR1A 3C74A 4K6OA 1I80A 4U2KA 1OTXA 4WKNA 3FUCA 5DK6A 4DARA 1A9OA 1TGYA 3NBQA 5IU6A 2QTGA 3UAWA 1PR5A 1Z34A 4BN0A 4D8XA 1RXCA 1Y6QA 1PR2A 3OZEA 1PR0A 1RR6A 1ULAA 1K27A 3BL6A 4DA6A 1PR6A 3KUKA 1U1CA 1Z5PA 1PKEA 1G2OA 3E0QA 1VFNA 4MCIA 4YO8A 2OC9A 4DAEA 2QPLA 3F8WA 3KVRA 4L5AA 1N3IA 1LVUA 2XRFA 2Q7OE 4PNPA 3UAXA 4F2WA 2ISCA 4MCHA 3DJFA 5F78A 5CCEA 1RXSA 2AI2A 5EFOA 4TTIA 1YQQA 5ETJA 1NW4A 3LA8A 3NM6B 3EUEA 3O4VA 5IFKA 1CB0A 5F7JA 1V48A 3FB1A 1YQUA 1JDTA 3K8QA 1TCUA 1SJ9A 1A9TA 3TL6A 3FNQA 5F7OA 1V4NA 4OF4A 1RT9A 3OOHA 4RJ2A 2GUWA 1U1FA 3KVYA 1JE1A 4H1TA 4F2PA 1XE3A 3EEIA 4QEZA 3NM4A 2OC4A 4TXHA 4BMYA 1ZL2A 1RFGE 1OUMA 1OV6A 3E9RA 4TXNA 1V41E 4D98A 5CXSA 1ECPA 1OU4A 1Z5OA 5B7GA 4YJKA 1SD2A 4QFBA 4TYMA 3P0FA 1RSZA 1K3FA 1C3XA 3DDOA 1Z38A 4G89A 3OZCA 1T8YA 1PK7A 1T0UA 2I4TA 4GLFA 1RXYA 4WKPA 3UAYA 1B8OA 4GMHA 4L5CA 4G41A 4WKBA 5F7XA 5FAKA 2HRDA 5CYGA 5I3CA 1U1EA 4NS1A 4BMXA 4ECEA 3IOMA 1PW7A 5C80A 4R31A 1ODLA 1ODJA 3GGSA 1VHJA 5K1ZA 2H8GA 2QDKA 4LKRA 4JOSA 2HN9A 4I2VA 4DAOA 1RXUA 1LX7A 4DA0A 3OF3A 2I8AA 3FWPA 4TXJA 1TCVA 1LV8A 4NSNA 1JYSA 3FAZA 1JDVA 5F7ZA 2BSXA 4WKCA 2ON6A 1T8WA 3UAVA 2OXFA 2AI1A 4F3CA 1JDUA 1K9SA 5EUBA 4JWTA 1RCTE 2A0WA 4R2XA 3MB8A 1Z36A 4D8VA
chains in the Genus database with same CATH superfamily
3GPBA 3UB4A 4YQFA 4QHSA 5J47A 5E6UB 1CR1A 2QTFA 3RC1A 4BFZA 2B4TO 1E0KA 1NSTA 1CJUC 3TTUA 5ADHA 1Q14A 5EE0A 1IEVA 1CDEA 2JLRA 2YDXA 1YT5A 3H16A 3LKVA 9LDBA 1YK0A 3L5KA 3VSBA 5EGNA 3CURA 1FQOA 4ZT7A 2BZ0A 4ZIRB 1IBCA 2QVLA 2IX9A 3EZ2A 3EZLA 5BUZA 1OX4B 3IO3A 4LF6B 2ANCA 4NE7A 3ZJVA 2JZNA 3ANMA 5JS7A 4UCWA 1OPRA 2OD9A 1NVGA 3CLTD 5DN9A 5BURA 4LYHA 1JP7A 2R8BA 4D4LA 3R8FA 3A31A 4IYRA 4ARSA 1Q0LA 1U2GC 4YRQA 2W2XA 2QX9A 2GJKA 2BMAA 2OAQ1 3GNTA 4ZTUB 1DOAA 1Y1SA 3H4IA 3IFSA 1I24A 3JCZA 3L8ZA 2KYRA 3GLRA 3SHWA 2IYXA 2PBRA 2Q1TA 3OWOA 3V6MA 3MWFA 4DABA 3L4SO 4XFJA 2VZ8A 3FOFC 3KM0A 2W2NA 1E79A 3ZPXA 1KK2A 3NDJA 1QE5A 2QMZA 3NC4A 3V48A 5FX2A 5H9WA 3GLIE 5EJ7A 4U2EA 2OUIA 2XUGA 4L0CA 4NCKA 1ZU4A 2GLXA 1GNQA 2Q3DA 2VIIA 4I6GA 4OMCA 5ESWA 4ZVQA 4X65B 1A5TA 4B84A 2R8YA 4L9WA 4Q4HA 2V1UA 2B3TA 1H6DA 1XNGA 1LPAB 4CMEC 2NSHA 1F0PA 3T5CA 1FFXB 2QF7A 4OQZA 5MFPA 2D62A 4IQGA 3FKSD 4F93B 1AG9A 4LRXA 4V0KA 1NDHA 3ZVMA 1FMJA 3I28A 3Q8WA 4PAGA 4R7TA 3H9CA 4IIJF 4K7JA 1GDHA 1E7RA 4ZHQB 1O95C 4ZCMA 4RU1A 2PSFA 3NDRA 5H4HA 1A7JA 1SA0B 3EMKA 4C3OB 4JUIA 2HIHA 2ZYVX 4I50B 5B6IA 1J8DA 4BMNA 3OEED 1SIUA 2VSOA 3GRUA 1ELOA 3ASVA 4WEOA 2C20A 1CY6A 1M8GA 4YRLA 1U4SA 3F9CA 2CGEA 3HGQA 3JQAD 4QU5A 1YZVA 2BH2A 5EKXA 1GGKA 3NRBA 3ORHA 4X24A 4N7BA 2D1TA 3PC8A 1TUEA 3EAGA 1VYHA 2QR3A 2PKXA 3IDZA 3EDMA 2G67A 4IBOA 4DG9A 3L8EA 1B0UA 4O6VA 4B76A 1YA4A 3LWNA 5BQ5A 2XF8A 2XUJA 1H9AA 3FYUB 4O25A 2DTDA 1WY5A 4LBYA 1VL0A 1CR0A 1DKNA 1YB5A 2PKQP 5ALMA 3ZGZA 4HDSB 1U7XA 1GAJA 3A25A 1KSHA 3O38A 5EXTA 5H3CA 3FOEC 2OY0A 4NTZA 4ZJYA 3MBKA 1L4UA 5JT1A 1ZD8A 1T4GA 2P9ZA 1EAMA 2PPLA 4HN4B 2XMDA 5EIAA 1EWKA 2L18A 2EEZA 1EDDA 1NXPA 2WMDA 3D3NA 4LSGA 1XEAA 4HWPA 4PLPA 4EEZA 2O2DA 3TRIA 4M49A 1IEWA 2ERCA 2F3QA 2ZTUA 5TNXA 4E32A 4ZOLA 1W36B 2VJPA 2BTOA 1ZUWA 5CK4A 5EHNA 4C29A 4TTAA 1Y3AA 3NDPA 2QGZA 3C14C 1UODA 2G04A 5EE1A 1F2DA 3MBOA 2I1QA 5FUYA 4U63A 4KX3A 1KXZA 1DDOA 5DSTA 3ZHOA 3F1LA 1EBFA 4DDTA 1XZ8A 3M6IA 1C7FA 3JQGA 4MP3A 5IJ0B 1Q1GA 3DTVB 4O4JA 3RS5A 3WAKA 3IERA 3TM4A 3S6JA 1YO6A 4KIGA 1O9GA 1RJ9B 3MJVA 5BOSA 2IIBA 2G17A 2HK7A 3I1YA 1W75A 3W4JA 3MSCA 3IV7A 1OXMA 2HOQA 3FYHA 3T9BA 4DNQA 2QN2A 2CNDA 2WVGA 1JDZA 2WWVD 4C6SA 2DR3A 2C7QA 3PNSA 4EG3A 2WBLC 4RZUA 4ZTZB 3BMOA 3TPFA 3KDAA 5HK8A 2Z5VA 3K16A 4I6EA 1PZXA 2EG5A 4L02A 4YTEA 5LQSA 1JI0A 1JLMA 1XU7A 3COSA 4HLQB 1BKYA 3U3RA 4DHWA 2PZFA 3DULA 5JPCA 4EATA 3BGSA 2VP0A 1IUNA 2BC9A 5B1HA 4EKIA 4A8HA 2VT2A 4RM3A 5FUBA 3Q2KA 5IF9A 1I5EA 1DG1G 3NLLA 4K87A 3V4OA 1YA8A 3TTTA 1KI1A 1P0CA 3IP1A 4TRMA 2ACEA 1EE1A 3CSDA 3JWEA 1UP7A 3HP7A 3HNRA 2VTBA 1Z5UA 4JELA 2FHPA 3DE7X 4I1IA 1E9BA 2C9CA 4BJ5A 2Z04A 1ISJA 3LUPA 5EE3A 3IIJA 4C0LA 3V46A 2YX1A 2PRJA 1RYEA 1MQ8B 6REQA 1TEZA 5CFZA 4CEIA 4YK7A 3DVRX 4L6IA 4GKVA 3EZNA 1C1HA 2FP4A 2AWOA 2ZTHA 1KYYA 3AF5A 1AC5A 2VKTA 3PZBA 4Y2RA 1WVMA 2E87A 4BMPB 2O8DA 1GPKA 2XZTA 2B20A 2EKBA 2HBYA 4TYQA 2BJHA 1SKQA 3IUSA 5I6DA 1GRRA 1X7YB 2NQ2C 1TTTA 1OBFO 3AFNA 2I6QA 3FSJX 5CM2Z 4ZT6A 5BVHB 2P27A 1U28A 3A3YA 3F8TA 1WUYA 2EATA 3OCXA 1QFZA 4LGVA 2PDAA 3R7DA 3AETA 5AJTA 1UFVA 1WF6A 2W4QA 4UAJA 2WIKA 5EWMA 2P6PA 3C74A 3DT8A 4JI4B 5JXIA 1N5OX 1RADA 5FEUA 4Z9FA 3RJMA 2CXTA 4M0DA 2RGCA 1AKNA 2JHFA 2PH1A 2PSSA 2VRNA 4D44A 5HK9A 3H1FA 2VQFB 1II8A 4XB2A 2DU8A 5DK6A 4JI2B 2GHQA 5CDUA 2A94A 1OA1A 2HF8A 2X8AA 2ZJOA 3MELA 4G2TA 1GTL1 4GI2A 4LRUA 3UAWA 3WNBA 4DLXA 4DNOA 1E79D 1AZWA 5IZ4A 3REQA 4RE6A 3V4SA 4BRUA 3VR3D 2P9JA 4YPOA 1ULUA 4KBGA 1TCCA 3AHJA 5ENVA 3QHPA 5FLEX 5J58A 1G17A 4A15A 4GZLA 3OZIA 2XEDA 4BYMA 1IE3A 2H57A 1E2NA 1CUGA 1U5BA 4CR7A 5KHOC 2OHOA 1JBKA 5J2TF 4CR6A 3HGTA 1CRQA 3W2TA 4HH0A 2H18A 4II2A 3QUTA 1GCGA 2BGJA 2H1HA 2OCIA 1LXCA 1QO9A 2DFVA 4GOND 2HA2A 2KW5A 2DBYA 3LC1O 3U60B 2EX4A 4E94A 1YZQA 2IYWA 1Z0ZA 4MS1A 1EWQA 2BR3A 2BEWA 1TZKA 3ZE1B 3QEAZ 4BAZA 1FDWA 2D3WA 1K7CA 4MW9A 1JUDA 4Y8VA 5JD4A 3D7RA 5GTDA 2BUCA 4JROA 3T7CA 5C32A 4OG2A 3U7RA 2CV2A 4BZXA 2XVZA 4C03A 1RACA 1NI5A 1VXOA 3S5JA 1R0SA 2YZNA 4Z0TA 1YUBA 1U8XX 4RZSA 3OA0A 4P84A 4PSKA 5DW0A 1YR9A 4HZIA 2QK4A 3ZVKA 1CCWA 1NE2A 5C35A 1KMHA 2NACA 3TGWA 1ID8A 2EFJA 3QKSA 4HOYA 1GSHA 4P5EA 5TX7A 5AW8A 4FJ0A 2IWRA 4GSKA 2IHKA 1B6TA 3N7AA 3MQ4A 5EZSA 2XF2A 4FNMA 3S7ZA 2ZIEA 4W4TA 2NZVG 3K94A 4EVIA 3QKUA 2PN1A 3VSDA 2WJJA 4N5DA 2B5VA 5EIXA 4RHTA 1JDBC 1V8PA 3FB1A 2B99A 1YQUA 2IZ0A 3OOYA 4YGYA 3AKYA 4G3XA 1GL9B 2ODTX 3ZV7A 5IPFA 3T5AA 5KO2A 3VXKA 1W6RA 2G9UA 2IDKA 3MC1A 1RKQA 1E5LA 5JR3A 2OQRA 3GW8A 3A1CA 3ITKA 2HA0A 4TRRA 5DFAA 4MI1A 1C5KA 2H3HA 3A6GA 5IRCD 1KMQA 4BN4A 4NLLA 2J31A 2V5VA 1DINA 3RS7A 2QQEA 2O7QA 1KAQA 1UBNA 2RGYA 1M8KA 2YV1A 1ZOIA 3KP1A 4GI1A 1ISGA 1MVNA 4OD0A 3JXEA 1QQBA 2AN5A 1KSJA 4ERXA 1B2LA 4XA8A 2H7CA 3TW8A 1VIYA 2WSSD 4J75A 1JA9A 1NN5A 4LCBA 3SBEA 1ZUNA 2J5RA 4WTOA 3CYFA 4DZZA 5HIAA 3K1AB 4L8GA 3JVEA 3HCRA 3LY8A 4G85A 4GOMD 4ASUA 1NKVA 3HCCA 5BN5A 1RW4A 1QH1A 2HT1A 3A58B 4NNPA 1BCRA 2ISSD 5A6SB 5LA6F 1Q83A 3B89A 3T15A 4FIDA 3D5TA 2OAEA 5F2KA 1DBRA 3WLTA 4FONA 2X0FA 2P3QA 3RYFB 1TQ4A 2QV0A 4G5RA 4L2IB 3DDSA 4OFXA 3VC2A 4E11A 4ACBA 1EFAA 4DDKA 1Y82A 2XDAA 2IL1A 3PJDA 2ERYA 1DC4A 4DIEA 4L3WA 2QTVB 2ZIWB 4F4HA 4DIKA 4NU8X 2CD7A 4OA5A 2FFJA 2VQEB 3E1KA 3PUJA 3EPJA 4OK6A 2L0XA 2B9EA 2BV3A 1SIBE 2HPVA 2ST1A 1KH2A 4AMUA 4W5TA 4YAEA 2YVKA 3ZZ0A 1A8SA 3X43A 5IX8A 3FYUC 4HZUA 1IWPB 4FR2A 3FVQA 1UP4A 1RXVA 3W5VA 4Q16A 4Q9AA 1CHDA 5HGJA 3PS9A 3T9EA 4XYLA 2Q07A 2VNJA 1MB0A 4PZLA 1J8QA 3E35A 3QSGA 2IYQA 3QKSB 5C8YF 4ENSA 3HDQA 3EVBA 5JSZB 2XMGA 3HACA 1J8YF 5EJFA 1Z2OX 2FMUA 3CMCO 3DKVA 1I7QB 4O2RA 1HQCA 4IIUA 2N46A 3BJIC 3LLCA 4H9GA 4JQCA 4M1YA 4W5WA 1KDZA 5SYMA 4DMRA 2JGKA 2RC5A 3RIEA 1KMNA 5EJIA 1MB9A 1SWVA 2C94A 3D1LA 3BFKA 5E4YA 5AKJA 1K08A 3TIIA 4DRXB 2OGUA 1QU2A 1W4ZA 1M2VA 1TMGE 2H9AA 2I2BA 3R6GA 1W0KD 3TUIC 1PTKA 2ZWMA 4DZRA 2XTZA 1GL3A 2P5UA 1NMQA 4JT2A 4B3JA 1CLUA 1GA4A 1NXVA 2PK3A 1F3LA 3P9PA 3IIIA 1ZGZA 3PC6A 1WUHS 1MW8X 1F2UB 1WOMA 1XV5A 3MHPA 3DOIA 3Q1LA 4X6YA 5FBQB 3MCAA 2OBMA 4Y1RB 1XQYA 1BH6A 4NJOA 4ZAYA 2PO5A 2ZM5A 3AL2A 4RTNA 3O2NA 4RESA 3LI2A 3MWYW 3AUFA 5EWJB 5K09A 4B4WA 4CHGA 3CPJB 3MMZA 3VR6H 5CCBA 1XDBA 2H7XA 3W1WA 2EFCB 1M34A 2H4WA 3WRXC 5BWCA 3A0RB 1RQPA 1N57A 3IBSA 2KM1A 4MYRA 4U7GA 2XAUA 2HNKA 4MQFA 2VXOA 4EUSA 5JVDF 1PUJA 3GT0A 2NN3C 1X0VA 5ED0A 4WBSA 1CUXA 3L7LA 2QD3A 4O4LB 3LYHA 4X60A 4AT1A 1HFWA 4TLCA 2YHIB 2Z6VA 4TUYA 1ZVMA 4OSOA 4D8WA 4I0WB 1ZH8A 4BX0A 2QLBA 1PW7A 1TRHA 1XLUA 1YVDA 2EJWA 4ZEXA 4K86A 1ESCA 3CU5A 2BELA 3RUAA 1JB1A 1GPBA 3CB2A 3NC0C 1E1KA 4NBKA 2C8VA 3L4KA 2BHLA 4NONA 3MN1A 2JFPA 4DHEA 3GGSA 1B93A 1VHJA 3P9NA 2ZRPA 3C87A 4LRYA 4LHXA 1U81A 1IJFA 3H0KA 1NYRA 1GIAA 1IBSA 3D0OA 1R0YA 3BTOA 3NOXA 4NAHA 1Z0DA 3AFIA 3S8YA 4MO9A 4PZEA 4CKWB 4RVCA 4E2ZA 2P30A 1K3TA 1T3TA 1JEEA 4LV8B 1PVVA 1IPHA 1R15A 1ZK1A 3A6ZA 4X54A 1ZSVA 1PSDA 2IHUA 3DBOB 3KKMA 1ZUHA 3OF3A 4F72A 1XFDA 5JDCA 1K7EB 1NBWB 2PUGA 4IRXA 4YUXA 1W87A 2XLBA 4Y1GA 4ZEVA 1CF2O 1ODTC 2OBLA 2HEIA 4B46A 3B8HA 4NULA 1E96A 3IHTA 5DX8A 1PJBA 3MUFA 3GLFE 1EX6A 4MVXA 1KPIA 1WB5A 2ZSKA 3JSAA 4DSNA 1MXFA 2BSXA 4Q9JA 4AKIA 4COOA 1VFPA 4CQJA 1G0OA 3UAVA 3LHDA 2O3SA 4EYKA 3DWEX 4CIVA 2AXEA 1XD9A 4EA8A 3KD2A 3KJZA 3ESYA 3NETA 3MRXA 4TZ0A 1AMUA 2VWHA 2PX6A 2OK7A 2WKSA 5MN6A 1GAXA 1E3WB 4AS3A 1T1RA 1SC3A 4KN9S 3C7KA 4R2XA 4D81A 3R2JA 3GJ0A 2NX2A 1ND6A 2IFTA 3O90A 1SM4A 1Z36A 3AWIA 3HKBB 4W7HA 4IHJB 1QLHA 3H5WA 3MCVA 3VR4D 2WUVA 2F43A 4ZAGA 1CP2A 2JJMA 4YHHB 3K9FC 4F6RA 3HZHA 1ORVA 3TZ6A 1PKXA 3R0VA 1IN7A 421PA 1QIIA 4ZVKA 1E98A 5CLGA 4B79A 4IJMA 1QPBA 2BTQB 3QUAA 1ORDA 4BVAA 2O05A 3TUZC 2GN6A 3I09A 5ELLA 2HC9A 3IP6A 1QHEA 3VNBA 2AMLA 3CE9A 3L1IA 3CX7A 5DTRA 1EXDA 3CJTA 2R7MA 5EYPA 4Z49A 5BOSB 5C53B 5EAIA 5CLLA 1U8ZA 4EMTA 2ZK7A 1FUIA 3H75A 1R16A 4BX3A 4UMDA 4BLSA 3FRJA 3ZV5A 1CEYA 3NHRA 2UXDB 3Q40A 2O8CB 5K3OA 2JAUA 2NU6B 1NIPA 2VUTA 4BATA 4F71A 5M5BA 2D00A 2W8BB 3LWBA 1HI9A 3SJBA 1EUCA 1QVWA 3DE5X 3BHIA 4N5NA 4UXHA 3CNLA 1W0JD 3K2EA 4CM8B 4DQLA 3MTIA 4CXMA 4TXLA 3OP4A 3IUNA 2OV1A 3VDMA 4LFAB 1NR5A 3ICEA 2WG0A 4ZRNA 4DUZB 3EB9A 5GM1A 2QMOA 1E3MA 1UK7A 5LQDA 1BCSA 4HNVA 3DL7A 4XB6B 5DO9A 1U4OA 1WDTA 3MWJA 3RU2A 5BV8A 4R0MA 2Y4OA 3MGBA 1OMOA 4LZPA 1VE7A 3TEFA 3UXHA 4KITB 5JANA 4BEJA 2FF5A 1ZI6A 3UCXA 5ICGA 1E3IA 4BXOB 5FPKA 3O1LA 1KFBB 2AXNA 3UJBA 2XCRB 4YNBA 3COPA 1BA3A 4IJWA 2I3BA 2XTNA 3KOYA 3RSHA 5CITA 5KX5A 3O8QA 4R7GA 3PC7A 5FOWA 6PFKA 5LU8A 4H6VA 3EGDB 3EXHA 1VLZA 1D2MA 2ZWOA 3LQ2A 2IS2A 5TB5A 1I7DA 3LQ1A 4X00A 4NU0A 3RI3A 3GUVA 3BGIA 4XASA 3EQ2A 4DS3A 5JHHB 2DWOA 3HUUA 3K72B 2VUIB 3LUFA 3MXTA 3PV0A 5LP6C 5CYFA 5JV5A 2QN3A 2GERA 3SYRA 1XPUA 3JQAA 3R0XA 4IDAA 4YCDA 3U1TA 2LCIA 4J90A 5ESDA 4OQXA 2XJ9A 3TSOA 1GRVA 3RRZA 4EZBA 5CXQA 2QPTA 3P0EA 2XYRA 5IEJA 3TDMA 5DM60 5TE9A 1BEZA 3ZBPA 3OEWA 1YQEA 1CG6A 1Q2UA 1L7NA 2RJ3A 5ITZA 1RYYA 1NXTA 2QRMA 4TKVB 1I0LA 1KVRA 2CNWD 1NR7A 3ERCA 2JFGA 2DQYA 3T3IA 4F60A 1UWVA 2HDHA 4BNYA 4IVNA 1D1PA 5LKAA 2B1GA 1V3QE 3VTAA 2V7PA 2Y0DA 2DC1A 2W2KB 2H8KA 3RVNA 1T8UA 3BIWA 4IGFA 3PQFA 2DUJA 3PTLA 4WBXC 4URWR 4L74A 5K51A 3JTMA 4WA8A 5EOVA 1OH6A 3ZLUA 4MNTA 3I9NA 4AM8A 4BO1A 1XAGA 2CZQA 1WHTB 3BZBA 5KTSA 5FBWB 2C5HA 2FR8C 4UEJA 3UK6A 2O5EA 2EDCA 3NHFA 3RD5A 4EQ6A 4MARA 4FINA 1C14A 1V5WA 2HEGA 3OT5A 1ZVJA 3FZEA 4YJHB 2Q4EA 4EABA 1ULBA 2QIPA 4I1OA 3LXMA 4RKFA 4L8FA 1TFUA 5HQ3A 2N75A 3TLZA 1OAOC 1LB1B 4U39A 3HM9A 3S2EA 1JPNA 2NTVA 1IN4A 5HG0A 1J99A 1V9CA 1ULTA 2B36A 1VTKA 1G64A 2VJLA 2WJWA 1EFDN 3AV3A 4WKOA 3R7BA 4CIAA 2KHZA 3WRWA 4GKJB 1QH8B 4P82A 5ELMA 5B7PA 3V97A 4BPRA 1SD1A 2RSLA 1X14A 3OZAA 1P31A 5KTMA 3STYA 1RQ7A 4G1EB 2HMYB 2Y2UA 4GPAA 3O4GA 2G4LA 2ZBDA 4MS3B 5F2OA 3PD0A 4EG4A 1WIWA 1EVYA 2VZEA 2G0TA 1NBEA 3AF6A 1VYUA 1JXQA 1MOQA 1TD1A 5A9TA 4CCSA 1XZKA 2BEWB 4G5SA 1P2SA 4JR1A 1R6UA 2UYYA 3WDKA 2LR0A 3ADDA 2ZSUA 2JDID 3HA3A 1NI4B 3M9LA 4ONEA 5HA5A 5JWHA 4RTJA 4MGKR 4OB8A 2OHJA 1GWNA 1SBNE 5MDHA 1IM8A 2I76A 1T9HA 5CDTA 3EULA 1RLMA 2B1RA 2ZJ5A 4TMTA 4BQEA 4EA6A 4P7FA 3PXGA 1ZLXA 2XCOA 2H4ZA 5BQ3A 5C4IA 4YJFA 3ADCA 2DHQA 1BH2A 1FMLA 2GF0A 3KZXA 1GHTA 1Z7WA 3NVDA 1ACLA 3TB6A 4ALMA 1WCIA 2X9LA 5TGTA 1FBTA 3OX3A 1QAOA 1O5IA 2VRBA 1Y9EA 2PX2A 3K9CA 1KVQA 5TXGA 1K68A 1Z5WA 3WWDA 1H2AS 1C1XA 3A26A 2F3UA 3EGWA 4R1QA 3W5CA 4F5EA 4ID9A 5HMLA 5K2OA 2CBXA 2HTFA 4GF5A 1AV7A 3UUEA 1WXHA 2C0CA 2ECPA 2XMZA 3BTVA 3KZCA 4KIUA 1XAJA 4ZDWA 5FRDA 1H4QA 1JIQA 1ZOLA 3P4YA 5ALLA 3D54D 1NFQA 5A05A 1QGOA 3PDUA 2CLOB 3PNKA 5F35A 3V7FA 3CX6A 4KWTA 2XQIA 2AFHE 3IAS1 2UZ3A 4P08A 3KQOA 2QORA 3N3BC 5LXTF 2OQVA 1E8NA 4S1NA 3DOCA 3TIFA 4AS1A 1JHZA 2YWCA 4ZQBA 1M1NB 2RCYA 1J09A 5DYTA 1DS6A 3R40A 4YAOA 3KHSA 4BJ6A 3V1YA 4UAUA 2J7KA 5JZ9A 4N76A 1GFWA 3LZDA 2Y1DA 2PFGA 4JEIA 5GADl 2I1WA 2VYQA 5KYWB 1O4VA 1PR1A 1QZ3A 1TFRA 3AB3A 3ZD7A 5LQMA 2GS9A 3ER6A 3TW0A 4IMPA 3NWEA 1U63A 2Y77A 4YLGA 1DMSA 1YK1A 4Q0MA 3R0QA 1P72A 3C1TA 3IBGA 3T06B 5CEJA 2NP7A 3KSUA 1N2OA 3BULA 3GFTA 4YJ3A 4ZPJA 5EKSA 3I3OA 4WE3A 2PD6A 5C52B 1RM3A 3UANA 4U2GA 1PVDA 1Y5LA 3IAXA 3PC4A 3PFHA 4M1KA 1EP2B 4YBZA 1A98A 4FZVA 3M9WA 4B0PA 3QEKA 2FW7A 1L7EA 5KDLA 3UW3A 1Z07A 1S3SA 1Z45A 4W5RA 4HYEA 5TC4A 1SZPA 2NVWA 3BF8A 3RVLA 2Q2OA 2WD8A 4R6WA 3REGA 2Y66A 3FGZA 3CLSD 4X0EA 4QPNA 3K6JA 1P17A 2VHQA 4MVWA 4V3BA 3RFFA 4A82A 2UUCB 1AS3A 2VPWA 1PG0A 2BZ1A 2FNAA 1W4BA 3L05A 1NONA 4ND7A 4YI3A 2HRRA 5LQKA 4OAOA 4AMVA 5F9FA 3HHPA 3SIWA 3LSYA 4PCLA 4KQGA 1PDWA 3KE9A 4XCVA 4CDGA 4YRAA 2WD7B 1EFRD 1R2QA 2I65A 3FMIA 1UPCA 1P1KA 4TWJA 1ZU5A 3ZQKA 3QK7A 3RAPR 2H5LA 1N3IA 1CJVC 3B5IA 2R7LA 1LVUA 5BN4A 3N75A 1PZNA 3FUXA 5FXMA 4M0KA 4BJ3A 1CK4A 5KREA 1IRXA 2ISCA 3OX1A 221PA 2XVMA 3JQGB 2E1RA 4JUBA 3KPWA 4RSRA 1QP4A 2QP9X 2YN4A 1UXOA 4QUHA 2VOJA 2VAXA 2XT9A 3NWOA 3VZPA 3DMRA 1AB6A 3CIFA 3AKZA 3I52A 2VK1A 2F4VB 1E3QA 3AIIA 1CYEA 1IN6A 2WIDA 2BDTA 5K05A 5BV0A 2WM2A 3DHEA 3DOOA 5GM2A 3VPBA 3VGJA 3QUQA 5JHGB 3MK31 8AT1A 3NCTA 4C4OA 4NICA 1B73A 1Y8AA 4I5GA 4CHTA 4AZ3B 2QNRA 5F7JA 4G4IA 1K75A 4RS4A 3GGCA 3V4ZA 1DAFA 1DP4A 3ZX4A 3FHCB 1HE3A 1CEQA 1CUIA 1YJXA 3M0EA 2YYYA 3OFKA 1KZHA 1OFTA 2GZSA 3RHSA 4DSUA 5ADWA 3J80A 3TRFA 5CDFA 3EGCA 2A4KA 1BIFA 4G1VA 4GW3A 4KAJA 5A5FA 4ZVUA 1SCKA 2EP7A 1KVSA 1R5NA 3R3VA 2HW8A 3WYGA 3OICA 3TQOA 1UPXA 2DG2A 5C8DA 2L2QA 1TM7E 4HLUC 3H2SA 4Q9DA 1JKMA 2JHAA 4AL4A 1QTRA 4XLTA 3NALA 2CN1A 3GMDA 1E62A 5AK6A 4KR6A 4DLUA 3KUUA 4KIWA 2GVNA 1BW9A 4PZUA 4OXQA 3T3NA 4O1MA 1VXRA 2I6TA 2JA2A 2R6GA 3O8CA 9LDTA 1NJ2A 1VMEA 5KNDA 2NTJA 2VJOA 2CUTA 1DRJA 1R74A 4TT8A 4DV3B 4Q9KA 3L6BA 1EI9A 1TM2A 1W94A 1YZKA 1L7QA 1ZI9A 1DXHA 1YDHA 1FYDA 4P53A 1X0XA 1IAVA 3E5NA 1ORRA 1C3VA 4MDEA 1J8VA 1PFUA 4A73A 3TVTA 1GGEA 4MYCA 2JB9A 2E2WA 1JI3A 3M4JA 5L3VA 3KWJA 1CT9A 1KS9A 1XZEA 2WW8A 4HAWA 3HSKA 4Q3EA 5TVKA 1KTVA 4R6XA 3BRQA 2YY6A 2DFLA 1GU7A 4RVNA 5IM4F 3E8MA 4UDXX 5ECYA 2CVPA 2DF8A 4R1TA 3S1LA 3TIGA 3GLIA 3MW8A 1C0KA 3A1VA 4HQLA 3QQPA 2Q5JA 5D3ZA 1IVNA 5IKPA 5JFGA 2BBWA 1E5XA 3AEKB 1DKRA 2HSDA 4TYWA 3S8EA 5E7JA 3M6MD 1J7KA 1XPJA 1X80A 1J2YA 2EL9A 5EC8A 1DVRA 1Z12A 3F7MA 1QHHA 3HYLA 4YJKA 3PLAE 3KVNA 4DDVA 1TZCA 4BAUA 1OWPA 3WJ1A 4JP1A 3R09A 1D2HA 5I8ZA 5DB4A 2GN0A 1ISFA 3Q1KA 3IIKA 4YUVA 2GJ4A 2AQ8A 2PX5A 3LKBA 4UD2A 4M6WA 5BSEA 3ORFA 4LY3A 3GJZA 3BD6A 4YUYA 3KUDA 1BG6A 2QMHA 4LOLA 5H16A 1JLSA 3REFA 3NAGA 4Z54A 1VRCA 1V3TA 1S5PA 4YCBA 3PJGA 2C2BA 2JLSA 4RTSA 1BXGA 4QQFA 2Z83A 2A5DA 3AHGA 4QUGA 4CN9A 3J81A 3I6QA 4ARCA 4EJ0A 4TMFA 1FYVA 3HWWA 3BGVA 4ZVRA 5HJ7A 1NRXA 3OI7A 5CVCA 3GGPA 5LJIA 3X2EA 1FZQA 3A1FA 3W06A 4E4TA 2FX5A 1BA2A 5LPNA 4DV2B 4UCQA 5H5JA 2JLAA 3HEBA 5HIIA 5ECGC 1N78A 4FFOA 1FTYA 1Y9AA 4CIBA 1B8UA 1ECJA 4MS4B 4LE0A 4RZHA 5GV7A 1AQNA 2F8SA 1BKSB 4L1KA 1FTWA 3RWOA 2ZJ0A 3FH0A 3HPRA 2H4HA 1O6FA 3ZZUA 1H4TA 1ADGA 2I71A 2BFEB 3L0IB 5P8WA 3O4HA 5ALQA 2O8EB 2QRNA 3RVQA 1BMFA 2WRZA 3QP9A 3C6KA 4C88A 1XZGA 2D2EA 4KFRA 4S0XA 1YZYA 5BWOA 3TMKA 4DCJA 2O8EA 3GFSA 3OTHA 3WISA 5TMPA 2IPOA 1B1CA 4N82A 4ZODA 3ICQB 1VI2A 1CQXA 4HC4A 4XB1A 4KKXB 2HA7A 4C1BA 4B43A 3DTVD 3ILSA 1QKJA 5LA6B 1SCIA 2JJ2D 3HDHA 4J29A 4F45A 5F9HA 3BIJA 1H93A 1HE8B 3IAAA 2A30A 5HKKD 1JSRA 3NAMA 2K2QB 4QOEA 2P0EA 3JASA 4JMPA 1M6HA 4LXGA 1LKZA 1YUMA 3OZ7A 3RSFA 2A9FA 2OR3A 3HDGA 3ZC3A 3SJAA 4QX6A 3FA2A 3ZCSA 3CS3A 3KJEA 4RHUA 3RYTC 4EYOA 1U99A 3ENQA 3QYAA 4OHUA 4XVQA 5ALIA 5GWXA 1Y8ZA 2FFAA 2W48A 4U5XA 4QODA 4QSHA 4YMGA 1O54A 4BQRA 3B6ZA 2WNIA 1AKUA 3MWEA 5JEEA 5KQLA 3PEEA 1MB2A 4UHEA 1TCVA 1ZISA 4HGPA 4DREA 3K71B 1N0HA 4U7WA 4TKVA 3RIYA 1CQIA 2Q2NA 4I7EA 4H1VA 2GARA 4K28A 2ZI5A 4X6XA 4DLLA 5B30A 3PLRA 2GK7A 3F5FA 5AQEA 3RF7A 4JT4A 2Z4SA 3MPOA 5CXUA 3TRJA 1V5IA 3LY7A 4HJXA 4RETA 1ZMTA 5IYZF 1T8WA 3EIEA 2PQMA 3GDGA 3OF2A 4BNKA 3CNNA 4WXHA 4CT5A 2ZJ8A 2VLBA 3OQOA 1T29A 4WZ6A 4DA9A 2XX3A 3N1UA 2Z6UA 3SXPA 1C1DA 4I8IA 5DNDA 2FZCA 4DMHA 3DYBA 5BORA 4X91A 3FX2A 4E5PA 3M34A 4N03A 1E1QD 3UZUA 3C6BA 3I04A 3QEMB 3TTVA 4KW7A 3BHNA 1NRWA 1Z6AA 4M9UA 3DHYA 4UZSA 3KFVA 3SX4A 4PG7A 3WA6A 5IJWA 2FPGA 4OHYA 4HNAB 2D0IA 4CQMD 1NATA 3Q6IA 1F9AA 4QYIB 4OYHA 4WAUA 3OZDA 2Q2VA 1SVLA 3KB1A 4EENA 4YCMA 1BMDA 1VJCA 3N6RA 4Q00A 1GPMA 5CBPB 2R2AA 3MRVA 3T7SA 3BKWA 4C2UA 1RAHA 1XVUA 2V7QD 3VSCA 5I9NA 4RIEA 4LXTA 1RYNA 2CXPA 2BM1A 3KT3A 4YH1A 2SICE 3OZUA 5CVUA 4YMLA 4G0VA 3N8NA 4CMIA 3OKAA 1NVUQ 4I5FA 4RD2A 4PCAA 1BMTA 3E3OA 3IR5A 2BFEA 1ILWA 4JLKA 4JDUA 1W1WA 2COKA 1EGQA 1ZFNA 1D0SA 3FPKA 4M87A 3HEMA 5AKGA 1DBSA 3GFFA 4BBPA 1BD4A 4FE4A 2AQIA 3ASZA 3DBIA 1DKOA 2E18A 2J3KA 3EZ7A 5IJ9B 3L3BA 5M34A 1SQ6A 1WUJS 3MYRA 1H1DA 2O0LA 1D4AA 3I32A 5CJ2A 5JZOA 5D51S 2V7TA 1OAKA 4PAWA 3Q7QA 1A50B 2RARA 2NZXA 3OHMA 2JD0A 3WHLA 1U6JA 3RLFA 3RROA 1Y4UA 3PGA1 4LHEA 3IODA 3JR3A 3ZIUA 4JJGA 1V16B 1XR3A 1DXOA 2YRFA 3IJPA 4OAQA 3VI3B 3OTOB 3HXKA 3KQKA 3VPAA 3F96A 4UBJA 2QD5A 1M2VB 1H1TA 1SU8A 2QXTA 3I12A 3NWJA 4UU0A 3N86A 4P7GA 5BRNA 3RYCB 5D1NA 3KSRA 4PWZA 3NC1C 1H2XA 1E61A 4QT4A 2BFWA 3GELA 5ALXA 4EKYA 3U16A 2QU7A 3LT2A 2P67A 1NOKA 3FFXA 2HCJB 4UHKA 3DP9A 1F4PA 1QV9A 1MOZA 1DOZA 2AFHB 4P4SA 3W6UA 2EX0A 1RWNA 2BEVA 1GYPA 1D2EA 5M3BA 5C37A 3EFOB 3OE7D 1KKMA 4UXJA 1DAGA 4DA7A 1XRSB 3N87A 4G0YA 4Y2GA 1KI3A 3ILYA 3BQNB 1XHEA 1E3JA 1I3CA 3OSZA 3RE1A 3SE0A 2LWIA 4ZCTA 3S0JA 5EQTA 3IAFA 1KF0A 1J6UA 1U3CA 2H31A 2AV6A 4QYSA 4GI7A 1Y9DA 4L7QA 4P4TA 5FFMA 2GPAA 2DLCX 4AULA 3BIFA 1B6SA 3AUYA 3N2IA 4WD3A 2A9QA 3DXYA 3IESA 5FFFA 3IVMA 3VX3A 5AIBA 1JKJA 4JJZA 2SNIE 4NESA 3OVMA 4MVJD 2CK3A 5K3AA 3NHAA 3CRRA 1EWVA 1DTEA 4HDKB 1MD9A 1XRLA 1Z39A 4PR3A 4EMBA 5JMWA 3EA4A 2I4LA 4Z9YA 2HD4A 3EUFA 3LOQA 4HNGA 5GVRA 4I08A 1RHJA 4LVCA 1BOFA 1LRLA 4YONB 1GZSA 5L3RA 3N6VA 3K9QO 1BX0A 4NYMQ 4V3CA 2DP4E 4D9IA 1Y48E 3UATA 4XWWA 1ARZA 1FDVA 2G9ZA 1G8GA 1NOIA 1S1MA 2BAGA 1MO5A 2ZIUB 3GLSA 3ZZNA 2VP4A 4YUWA 2TMDA 2P75A 3K9GA 2ZI4A 5DTJA 1CUJA 4F5DA 4XVUA 1XZFA 4PSAA 3RRYA 3K5IA 4C2BA 3PDJA 1YFKA 3L41A 4HDMA 3QOXA 1APBA 3AZPA 2OCBA 2QVCA 4FYWA 4ZOQI 1M1ZA 4NFLA 4LF4B 1EFPA 2FKNA 2ORED 4PGFA 4QICA 4RCVA 2PGNA 4V0RA 5HE9A 4MQUA 2I4RA 1Y98A 3CUTA 4V0NA 3TS1A 5A4JA 5JNVA 4QVIA 2AI3A 5HS4A 2Z8YM 1Z0UA 1ORTA 2PUJA 2R6FA 3CW2A 5DNCA 4J1TA 4EFNA 5CA1B 2DWPA 3UA4A 3VI4B 4R1MA 4X61A 3TFQA 2JFZA 2VPXA 3K9WA 1X6VA 1N92A 1CNMA 1CVLA 2SHKA 5DJ5A 1ADYA 4EMSA 4I99A 1QQ5A 3LUJA 3CBQA 4H15A 4XSHA 1JR2A 3H2GA 4XGQA 4L9SA 3UKOA 1N1EA 2KSQA 2O4CA 4M98A 4FYKA 1THGA 3USCS 2ZAOA 1SK8A 3KYIB 3UCFA 3WB2A 1UPBA 2X8BA 2Y99A 4PTYA 1R0WA 3WLEA 4MIOA 2GSWA 1EFLA 4MVJI 4AVYA 4EITA 1T4DA 1O7JA 3I92A 4CMEA 3RRNA 1F0YA 1S2IA 1D7AA 2GCPA 2HZ7A 5FYQA 4C7KA 5J2TB 3K35A 3GZJA 2I7DA 3MTJA 1QYIA 1NW9B 2GO1A 4NQZA 1A9PA 4PRZA 3DE2X 1E1NA 4RFVA 5FR2A 4EI8A 3PNYA 4DY4A 4K2HA 5TQ2A 5K6RA 1DBIA 3CVXA 1OBCA 2O3TA 1YDMA 2P2GA 3RJTA 3GEMA 4CDNA 4AYTA 4DADA 2H2FA 2A0YA 1ZIYA 3QF4A 1I8TA 1L4GA 1NN1A 4IIXA 1KC3A 4TVSA 2UYGA 4FJ1A 2CMGA 2FG6C 3GUZA 1GUZA 3ND9A 1EGMB 2VHCA 4FQ8A 4D45A 4D4JA 2FMFA 4AP9A 3ZU6A 4ME6A 4CLHA 2JGIA 2L42A 1CQZA 1X94A 4LPSA 4AZ0B 1WQ4A 5BMVA 1NVVR 3GUYA 3EAFA 1CERA 5DBFA 4POAA 3EZGA 2HLNA 3AY7A 4MRNA 4X8HA 3WICA 2QR5A 3GL9A 3DS8A 4G25A 4QELA 2P62A 3ORYA 1DCKA 1CY2A 3DEFA 1CW2B 3G0GA 1YSCA 2H0AA 3F2VA 3TG8A 3EWNA 4EX7A 1UDXA 1X7ZB 1J20A 4YREA 3WWOA 4FYMA 3LQFA 3FSRA 4CGYA 2VNKA 2BR4A 1GSIA 3OHPA 4FDMA 3CWZA 4BLWA 4K9RA 1N5RA 3V4LA 3ADOA 3OX2A 1V1MA 4K6OA 4UBLA 3RDPA 4ZDKA 1MVOA 4L07A 2PNFA 4B3CA 4E2XA 5AW7A 2FKAA 4U2KA 1RAIA 4KQKA 4LY6A 3CT6A 4WKNA 4AJKA 4MVJM 4QUAA 4QDTA 1I1HA 3HKEA 2CDAA 2XQVA 4JT8A 3EBLA 1HLGA 2XIQA 1IK4A 3GLHE 4MKFA 4BGIA 1CUZA 2SBTA 3QVKA 1U9JA 3ZHBA 4EGAA 1SUWA 3DOJA 3L6CA 5HF9A 3MGGA 4RZQA 3PLNA 4G1MB 1H85A 2JLCA 3PCTA 1PV4A 4G09A 1RNLA 2PKEA 3P9XA 1AUQA 1MJGA 2EZUA 1S2LA 3F8SA 4JC0A 4PVDA 3Q41A 1GITA 5M7EA 2YIMA 4RGVA 3SZUA 2YC4C 1JU9A 2P2YA 4HV4A 3S2YA 4RYLA 5SY4A 5AQ1A 3VU8A 3KB8A 4Y2XA 2EKLA 1NNSA 3IC5A 4KX5A 2GCNA 3OBIA 1FJGB 4P98A 3C3PA 1OHHA 2EAUA 4DWJA 4ZT5A 3I2IA 5CPBA 1L7DA 1DAOA 2GHRA 1HE4A 2OPBA 2QXUA 2C7BA 3KYCA 4JL8A 2O06A 4RW0A 4UJ3A 3BGDA 1J24A 1X80B 3DHNA 1W8IA 1M66A 2X23A 2WU1A 3EDCA 4YJGB 3SC2B 2XBMA 5I48A 1KQNA 5HMMA 5T6MA 1HDYA 4WI1A 4BB6A 3IURA 4URUR 1R1DA 2VP3A 3U3KA 1OE0A 4PC2A 5C7IO 1PJLA 3RRMA 1Y8RB 4ETNA 3UV6A 3DB1A 1O95A 5IAGA 1ATZA 3WAJA 1YRAA 4E2FA 2RGDA 2QVGA 4PO8A 3MWDA 1JR6A 4YIHA 1FRQA 4CTOA 3PQEA 5JD5A 4D25A 3PPVA 4A2CA 3SKVA 2XKAA 4MV6A 1C9MA 1U31A 3VYVA 2E7ZA 1FTGA 1MV8A 4MPDA 1IM5A 5G3ZA 5DKFA 2GGSA 4LOIA 3T5PA 3NNNA 1VSVA 1QTNA 2WA1A 3WK4A 1QRAA 2BGTA 2X8JB 1X39A 3H4VA 5IAOA 4Q4AA 3KQTA 3H3XA 2GBCA 3G2MA 2V7VA 2CXHA 2P2CA 3AILA 1NV9A 1FP4A 4INPA 4QXAA 4BLTA 1AN9A 2VF4X 5BWBA 2GH1A 2NIPA 3ACBA 5FWAA 2WKRA 2RHHA 5CFLA 1KE2A 1XMJA 3EQ7A 3N2NA 3QU9A 4RFSA 1SHUX 4CQLB 3ZJUA 1NBOA 4BVJA 5E1MA 4GBED 2JKZA 1R6TA 1BROA 1PG2A 3H18A 1G3UA 2ZJ7A 1XDGA 2YDYA 5TLSA 2WTBA 2IOYA 2LW7A 2J9YB 1GZ6A 3D31A 3AI7A 3DWGA 3CUVA 3NFYA 2R2GA 5EIBC 1HKUA 3DL0A 5LZ8A 1Z2AA 3BL8A 1V4NA 3EW7A 1ZM3A 1OWNA 5CH8A 4TV8A 4C5CA 4UUQA 1OFIA 2AE2A 2J48A 3THWB 3G2IA 3WLMA 3WIVA 1KI6B 1QIDA 2BF4A 5IVPA 3LUCA 3DOHA 1D3AA 1GJRA 1PQWA 3MT0A 4FBMA 4ZZIA 5G41A 2Y71A 1F2UA 1KMMA 3WB0A 1VGRA 3SFVA 3THXA 2OESA 4UREA 3EQ8A 3GCDA 4OGGA 3P9RA 2Z9CA 1OH5A 1PO7A 4QDJA 3OT1A 3AEUA 1SY7A 2OORC 2GEVA 4WOBA 4YP0A 1DXYA 5DI9A 4F2PA 3B3QA 3SZLA 3LAWA 4JSTA 1C8LA 4JXXA 4UEQA 1K06A 5FFNA 3G0IA 4EDFA 4YAIA 1HSOA 1A1VA 4J4HA 1L5LA 3G9UA 3ONNA 2IEIA 3HKBA 3KZ1E 2OFPA 1B6RA 2ZWIA 3KDPA 2JAWA 3WG9A 3U44B 2HF9A 3GYGA 2EZ9A 2GILA 3MTGA 4OGFA 4C22A 2PRSA 3PXXA 4R1LA 5AJXA 4YRKA 1L5RA 1SXJD 1TPZA 3HO6A 2QJRA 1E20A 2C5AA 2AH5A 1OUMA 5ERYA 4WZAB 2CXUA 1E4VA 4HUQA 1C3EA 4MLZA 2C88A 4N0MA 3BB3A 4QDOA 1B74A 2A4MA 4TXNA 5K8TA 1U3WA 3WJ7A 4R3WA 3PJRA 3BMXA 4ARBA 2ZUBA 5M29A 1GAQA 3JAWA 3T3MB 2ADOA 2J6BA 4YALA 3HFSA 3HXPA 4IF4A 5DULA 3EEBA 1JJFA 1JVSA 2HLHA 2HU7A 1XP5A 2YZKA 4RORA 1GDTA 1R6BX 3E2IA 2VTBB 3OHSX 4TYMA 3GNLA 8ABPA 1SCBA 3GVXA 1X1EA 4S1WA 4BO6A 1SRQA 1NMZA 4JI6B 5JD3A 3CNQS 1B2RA 3TRDA 2PYZA 2GHTA 2PUBA 6CHYA 2GNOA 4CKXA 3Q3IA 2KMLA 4LXHA 5DHUA 1SC9A 2H06A 1FPMA 3K6SA 1IL0A 3HJRA 4K6MA 3AHFA 4GWKA 5DM2A 8ADHA 4OQYA 1JU3A 4IJQA 1JIJA 2X41A 4LY9A 4KAXA 2QRQA 2PZJA 2HA4A 3GCGA 3GDWA 5CIWA 5HZMA 4ARAA 1M2KA 1SB9A 5H80A 3G8BA 3IGFA 2ANBA 2VG8A 2TSYB 3OQPA 2P40A 5F7XA 5LJLA 1QE3A 3ADBA 3HADA 3FTFA 4EHIA 1FNCA 1IH8A 4LVUA 5DM0A 3L06A 2AYYA 4PC1A 4D9NA 5HJ5A 3PPXA 3WYNA 4MZDA 4G5OA 4XFDA 3UENA 2R87A 5BRJA 3M3HA 1BRTA 4BV8A 2HRQA 1YB2A 3ZEAA 3I5XA 3TKLA 4E0BA 1AGNA 3ZHUA 4RHYA 2O3QA 3ETGA 1XTIA 2P9FA 2RAVA 2VHXA 3NBKA 5BR8B 3AUSA 3GBSA 1ZHOA 3PUHA 1JIIA 1U8YA 3WNQA 4AZ3A 1R5OA 5TJ9A 1GTG1 2R1TA 3DF7A 3VR5A 4ER5A 3B6KA 2E4YA 4FEAA 3ZHXA 3ZKWA 3RAGA 1BFDA 2WT8A 3E3LA 4O5OA 3WBKA 2Z2YA 4AP5A 4DUGD 3FPJA 1D9ZA 2QUJA 2I99A 1Q0SA 3C41J 3KTFA 4ZQFA 3FPCA 2G5PA 3HGMA 3TD2A 4GXRA 2CXOA 2Y9PB 3ENWA 1YE3A 4HDSA 1OXKB 1KAOA 4HGQA 4PQGA 4XVHA 5JTUA 4ZVVA 1L7RA 1VE6A 1SBCA 2VZLA 1MO6A 1GPH1 1D1SA 3ASYA 1C4XA 2IDMA 3IAEA 3P94A 1F60A 1AGPA 1NXQA 2J3IA 1XZQA 1HDEA 3D6JA 3QVOA 3OM8A 1T9GR 2NTEA 4HBZA 2WYUA 4W7SA 3T3PB 1DI0A 2HA3A 4EA7A 4EF4A 5I9MA 1QP7A 2JIPA 1TTQB 4KV9A 2IEDA 4AKTA 3CRZA 3H6GA 5K0CA 4NSNA 2VDKB 1FFEA 4QDUA 5FL7D 1JYSA 3IUYA 1SCQA 2AX3A 2RK6A 4WHMA 4B74A 1KO5A 1N2EA 5KYVA 1L8OA 2BLNA 2AL7A 1QHNA 2X77A 3BSSA 1I32A 1AMNA 5CW2A 1NZJA 2XQKA 5LIRA 2JH3A 2BMJA 4EB0A 3L8HA 3AKDA 4M1MA 4PQRA 2CK3D 4MR7A 2NO6A 1S2DA 3I76A 5J2UA 1LSOA 3KQMA 1JAIA 1SOUA 3L4BA 4DXDA 2NLOA 3H1PA 5AUOB 3K5HA 1ONBA 2XIJA 1P3Y1 1TJNA 3T1VA 3WLJA 3IXLA 2IYLD 5K3FA 3I6BA 4B7AA 2H16A 3EG9B 5I5GA 1F9EA 5HJ2A 3FZYA 3I05A 1AXEA 4IGKA 1EXWA 2PX3A 4QUBA 4XD7D 4ZO9A 2VPTA 5HZGA 2YHBA 1VLMA 5TF4A 1YU9A 2OHGA 2DRIA 5CFRA 4NXMB 4RSGA 3WKCA 2WZDA 3W3AH 1SVMA 1TLFA 5H68A 1JWBB 5CM8B 3OWHA 2IU0A 3I2GA 1AHIA 4Q1AA 4QUIA 3VOTA 4B3HA 5K8VA 1N6KA 3NB0A 2F9LA 3HNOA 4GR5A 5AVUA 2XWPA 2Q5HA 4QG3A 1MR3F 4N5MA 5L7YA 1ONSA 4QATA 3ICOA 4U7PB 5BUQA 4LRQA 5KQPA 2MINA 3V00A 5NULA 5AM2A 4DV0B 1U1DA 1L4KA 2QJWA 1BHJA 3WLSA 3KT8A 2WILA 4LMBA 1LBTA 1E99A 1PX0A 1X38A 4HFMA 1M75A 1TO2E 4J91A 4KYTA 3SHTA 1VI6A 2W6CX 1LX6A 3DO8A 3VH2A 1AGXA 3I1IA 3O9ZA 4LZOA 1J33A 2GF2A 3NTQA 4R2HA 3W7BA 5KVAA 4RO0A 3RIGA 4BFCA 3R3XA 3JQFA 4KO3S 5EUQB 3AUXA 1E2JA 3N5CA 5EL0A 5YASA 3FDIA 4E1VA 2N9UA 1AY0A 2HQOA 3GXOA 4BDTA 3NDIA 4ZI7A 4RMGA 4EUFA 3OZXA 3E48A 1KEUA 1XKQA 4YAGA 1K63A 1PVOA 2HWUA 3HWRA 4R7ZA 3BM5A 4LQDA 5KTRA 4B3SB 1QBKC 1ZN9A 1KDPA 1UOQA 2JFBA 2PPVA 3ZS9A 4YYZA 3ELWA 2IHVA 4RMNA 1BAPA 1GOTA 1IB6A 4B3FX 2UYCA 1NUUA 3HABA 3G23A 4FZJA 1UIMA 2RI1A 4P8RA 5B3AA 3RF6A 4TV8F 1D6NA 1TNDA 3GFVA 4IV8A 4Y9DA 2CFIA 1KPHA 3SMQA 3W7AA 4A36A 1R0BA 3UQYS 5ECWA 4H4CA 4RV9A 1QYCA 4UNSA 5C1DA 1L1EA 2FR0A 4LN1A 2AXPA 1OLSA 3N2GB 821PA 2WSBA 5CT9A 2G8LA 2OL4A 3ZD8A 5FV4A 5LVAA 5A3RA 4X3PA 1BHO1 2AFIB 1G9SA 2QG6A 3AEQA 4BC1A 4CTNA 4FGKA 2O6LA 2GUGA 2ENUA 1QO0D 4RKEA 1W5SA 2PL3A 5IBRA 2ZLBA 4C6TB 4NMMA 1BX1A 2QVYX 2JVKA 3NEPX 3ESXA 4F21A 3K09A 2OBNA 3JARB 1B7GO 3ROQA 4BVHA 1ADCA 2FQWA 3IOBA 1M3SA 1RYFA 2AD1A 3BB1A 4UNNA 4RQBA 3R5TA 2ZYHA 3I9JA 2FUG6 1YRBA 4FC6A 3QBDA 1XMSA 2XWQA 5AH0A 5ITVA 4BUZA 3EZYA 3F3MA 4Q4JA 1JJBA 3ZLVA 3G2KA 3L1JA 4PICA 4N3NA 5A71A 3KOZA 3QJYA 4KFUA 3PSAA 3TOVA 2IELA 1DIRA 2WHRA 3FZGA 3L4BC 5HILA 2K7ZA 2XEXA 2QR2A 4KACA 1TJ5A 2FJUA 4JKIA 4MYHA 5CIQA 2E3JA 4JP5A 3H2BA 1NBIA 2GK3A 1GGNA 1KJYA 2JKVA 3P96A 2O0HA 1V1RB 2R97A 2AQHA 1VECA 2ZBPA 3DE4X 3SBOA 5BSGA 3G49A 3J81k 2PKCA 5JAOA 3AR7A 3WWEA 3AX6A 1S8AA 1VG8A 4Q1VA 4MKHA 2IV3A 3DAGA 1DC6A 4L7VA 2O2YA 3A4IA 1XN4A 3QWBA 1MC8A 4UM9D 4D9BA 4ZCRA 2DQKA 2FLKA 4RABA 3WZMA 2CJPA 1IOVA 4J3JA 2WHQA 2RG1A 3AP2A 4IMJB 1K6EA 2PKWA 3JWJA 5EY5B 4YP7A 1UJ6A 3HCDA 5CVTA 4PPGA 2AVDA 2QTHA 1ODKA 3BREA 2BFPA 3IEIA 3EJWA 2QE6A 5JPDA 2MMGA 2XMSA 4O2AA 2EEPA 1XP8A 3PRJA 4RTMA 1OR8A 1RZRD 2ZB3A 4K8RB 1KDRA 1B16A 3G2PA 1RWKA 2LP4Y 4W1RA 3HHEA 2B2CA 1NVXQ 2DUMA 3GMSA 1CUSA 5EESA 3AWDA 5JCOA 2XGOA 2OXIA 1Q91A 1E1RA 5IWAB 1KZ7B 1N8NA 1J9ZA 4O29A 4ZJPA 3WYBA 2MDTA 1SCUA 3NIGB 3RVDA 3THYA 2P2ZA 2P65A 3CN9A 3GFPA 3QLUA 2WIJA 1F4LA 4TS1A 1CQPA 1RD4A 1TEXA 2EU8A 2VDUE 2YFQA 1IZ8A 2FSIA 4RAQA 1LU9A 2QD4A 3IMGA 1Y1KE 2OM2A 3NEJA 4R9SA 4FNOA 3QU5A 4AZWA 1AK9A 4MP6A 2ZCJA 3FUTA 4DT1B 1PK9A 2HA5A 2ZTVA 3U40A 4QOFA 3W7VA 1PI3A 3EG9A 1FFXA 4I5IA 4DJAA 4C30A 2FAXA 3O8QB 5DDIP 5ALUA 1QS0B 2NAFA 2HK9A 3N74A 2QSYA 3QXXA 2PGAA 2BHRA 2Y1FA 4M7WA 1SUSA 3FW1A 4TMWA 2Q3BA 4ZO6A 4K46A 5BWMA 5E6RB 3ZK7A 4RJIA 4KO2S 1E2FA 4RVUA 2PA0A 1YA6A 3PNPA 4FOLA 3WGUA 3JASB 3Q72A 4DJDC 3MIZA 5IK2A 4A8JC 2VSYA 4DY6A 1M7HA 2O1EA 3AC0A 2GK4A 2J1LA 3BK2A 1NJ5A 2JIZD 5LA6A 3WWYA 1GV1A 2FDCA 2YUIA 4RFLA 2RIRA 3DF9A 2DHCA 3T1OA 4O4HA 3TTYA 4QYXA 1LLUA 3EDQA 3C7CB 4CLOB 1M0WA 4TV8B 4WCFB 2EW2A 2JFOA 3D6VA 3F6EX 3Q2IA 4MQBA 5GZ3A 2JLWA 1NF8A 3I5MA 1F4VA 5DHFA 3INGA 4X41A 2XNHA 2XYVA 1SVNA 1XYYA 1XHLA 2PT9A 3HVUA 4YMSA 3ONWA 1YI0A 4ND8B 5FULA 4C4PA 4UUMA 2NUTB 3N05A 1AZTA 1E6CA 3M5CA 4PC7A 3O03A 2WJVA 4GRIA 2RHRA 4CLRB 3W5DA 2Z4RA 3LW7A 3UWDA 1V0JA 1MJHA 2ETXA 3AYZB 1OAOA 4JWKA 3UWPA 3AIMA 3OZEA 1B14A 3OZWA 1PR0A 4RV5A 5HCIA 3RS8A 4RGYA 1EK0A 1RIIA 1S8OA 1ULAA 2Y0PA 3CF0A 1FX0B 5FWYB 3T3GA 2FPRA 1VPDA 3PHJA 2ONCA 2VHWA 2PAAA 2H4JA 3ICVA 1PHPA 1U1CA 2KJQA 5BMVB 4MLCA 2HV9A 1CY1A 5TMDA 4BJ1A 3C1OA 2FOLA 1E3WA 1FXSA 1NVDA 2CDBA 3EK2A 3PNQA 3WLKX 2XGMA 1NW3A 4LC1A 3X0DA 4PN3A 1T2AA 4NYIR 1B0AA 2RKOA 6ABPA 1V9SA 3GXBA 1SC4A 5K0FA 2I9KA 1EDEA 1RI4A 3TL2A 1DWQA 2H1RA 1QOQB 3EXEA 4YO8A 4AJPA 5JNUA 1IBRA 1WU8A 4GZ3A 2HHCA 4JLVA 2MSNA 3D8UA 3DZBA 2WR8A 4LJAA 3OIFA 1T5LA 5KYUB 3C3YA 8GPBA 1TLLA 3F8WA 4L5AA 4MB2A 3FZQA 4DL9A 4P35A 4PV7A 3BFJA 1KY4A 3RG8A 1BE8A 5GIPE 3I9FA 1XMIA 3OFJA 2H1WA 1MA0A 3D6AA 1E4OA 3URKA 5C46F 1EXNA 1U7UA 1HYBA 5TDHA 1IZ0A 3I53A 4BKPA 4HZUB 3QYFA 2XQFA 4HKTA 3RKSA 3HXQA 1OU0A 2DFPA 2XB4A 4ZYLA 2JIZA 2WA2A 3AJ8A 2WF7A 1WXIA 3ZNOA 1R6VA 1R4MA 2YWEA 4L4UA 1VB3A 5JJBA 1T0PA 1XZJA 4RGQA 2WWIA 2XRYA 4RACA 5BRAA 3GRRA 1JIKA 2VJYA 2R66A 4G1UC 1RJEA 1WUIS 3KK0A 3LE8A 4TMZA 2JGRA 1C30B 1N7HA 1SELA 3EUEA 3GNQA 1CB0A 1RHMA 5COQA 3UMJA 3CEAA 3IPLA 5D1HA 1UBLS 1MKYA 1FNBA 1QYRA 2NPOA 3PC3A 4IDHA 3W3ZB 3DV0A 3F0TA 3H9QA 2ZITA 4W8HA 4U3JA 3O82A 5TIIA 3FLAA 4E5DA 2X3YA 2OCPA 2ZS9A 1FY2A 4HAOA 3MD9A 3ZQ6A 2PJRA 1YR8A 1MO4A 2FZ5A 3OU2A 1TU3A 1A9TA 1PRYA 2H7YA 3C48A 4OUKX 5DIFA 3VJLA 4LF5B 1KAGA 3CHYA 1II0A 3HYSA 1OH8A 4AJEA 1SUIA 1YV9A 1M1XB 1DQPA 1SOAA 4AIRA 3AW9A 1YL7A 1GKLA 1MQAA 1MQSA 2C4TA 2BSAA 3MOGA 5TARA 3TSZA 3UK7A 3CVWA 3OO0A 2ZDQA 3PZRA 1EQAA 4CI0B 3B6JA 4DUGA 5BXYA 1KEEB 2EJBA 2J46A 4I66A 4RKYA 1JAHA 2IXBA 3HVHA 4MWOA 1ZZGA 3WL5A 3VR6A 1SPXA 1Q3TA 1KEEA 3R3ZA 4H1HA 5HX7A 2H65A 4PLFA 4NMLA 2WIFA 3A6HA 4Q7LA 4DLYA 5EHXA 2EKZA 2OV4A 1OIVA 4GR9A 4ZOBA 3CR3C 3LPMA 4ZKDA 1JE1A 1LV7A 5H83A 4RQUA 2IU4A 2X7HA 3FETA 2VHTA 5GJBA 3TTSA 1BD3A 4N7MA 5EVCA 1RKUA 5SYNA 1N33B 4NCNA 4QEZA 1KI4A 1SK9A 2VH1A 3DW1X 1WXEA 4QUKA 1ENZA 1L7MA 4MUHA 3X2SA 3DAYA 4O8ZA 3WIOA 1VLHA 2JPDA 1GRNA 5KJEA 4R1UA 1ZKMA 5BNWA 4HTAA 3RYHB 1RRPA 1CP3A 4IF6A 4MA4A 2XOKA 3T7JA 4UQPA 2W2LD 1UH5A 4LHYA 2JBWA 3HO8A 5D6NA 3DEKA 3EVFA 1ZXLA 3IRUA 1QYDA 4RF4A 2FEXA 2ZI3A 4UFPA 3SEZA 4XJXA 1J39A 2PRKA 1QJCA 3UV7A 4CMJA 1O03A 3BXGA 4PF1A 1HTWA 3TL3A 4UMEA 4JB0A 4XYMA 4FFBA 3DDNA 3K05A 4H1UA 4WA7A 4HSGA 3MPUA 4C06A 1NU6A 5K9ZA 3C3CA 1X7HA 5FL3A 4X6UA 3PWZA 3BXFA 1JQKA 3KJFA 5KYXB 2D1FA 5CFMA 1KJWA 3TECE 2IHTA 2Y1CA 3SM9A 1RXIA 3RC7A 3ZU5A 2YV4A 2JEOA 1OI4A 4MCAA 2PRIA 4IOJA 3UF0A 3MGKA 2YJGA 1MCZA 2AYXA 1I2BA 3ETLA 3MTBA 4JJKA 3VDQA 4F9TA 3NKVA 5KNDD 1DFHA 4XQGA 3WV4A 4CL2A 2ILVA 2R8OA 3HJBA 4NBRA 1XL0A 1AMOA 1CRZA 2WIBA 3TCKA 3BXPA 1R0RE 2OCLA 1U0GA 1S2MA 1Z4MA 5DWDA 1KWGA 1J0AA 1NFRA 4C0AC 2XJ4A 1TB4A 1X42A 4B4UA 1B8OA 4BE9A 2C7RA 4ABYA 3JALA 5FWYA 1G21E 4JQSA 3H87A 3Q3JB 4E22A 2ODQA 1TAUA 3IPAA 4B17A 1H0HA 5T8KA 3DJYA 4KP7A 4XGNA 3X1WA 3FWZA 1QGAA 2R4TA 1IIBA 1QQ7A 3PPIA 1E2LA 4CIWA 2YW2A 5FEMA 2XHEA 4LJLA 5CB4B 4RPLA 4TL9A 1HYQA 1CLEA 1KFEB 2VBCA 4JS0A 4NJMB 3M6AA 5E7QA 4C3UA 4R31A 4NFYA 1ODLA 5IBPA 4RTKA 1N0VC 2BUBA 2B30A 3SE7A 4LWQA 4N5HX 4HUJA 1KK3A 2DPMA 3HBMA 4XSGA 1BU8A 1FMTA 2UAGA 3OPQA 4FYYA 4Z1MD 4ZYZA 2XUAA 3KFLA 3VNSA 1WNFA 1KU6A 2Q0SA 4JOSA 4RA9B 2MYTA 3EFOA 4PG4A 4FKZA 3ESQA 1C9KA 2O23A 4XAQA 3U1BA 2PLAA 3I04M 5CD9A 1CRPA 2NNLD 1NKSA 4RS3A 2XUFA 5EUMA 4OVKA 4TXJA 4TM7A 1XWWA 4G1CA 2ZIXB 1BWSA 5TV2A 5U4XA 3M4NA 1J70A 1YVRA 1O57A 2PBZA 4ARUA 4IFEA 4YJ3F 5LIPA 2PZBA 1FXWA 1Y6ZA 3OJCA 5CVVA 3RREA 2XXAB 1O0BA 3MAAC 4WMLA 4X1YB 1OIXA 3R7FA 2GCEA 3GJ5A 3LYUA 4YPFA 2PG3A 1JA0A 2GBPA 2PL5A 2OXFA 4X20A 3UGTA 5A3SA 1WD7A 2O1WA 4R1NA 4EY8A 1HQDA 1CR2A 4WBNF 2J07A 4NCAA 1SXPA 4D6YA 4HN2A 2A1IA 2NZ2A 1T2FA 3EVGA 3KLBA 5JCXA 2WTXA 3MT7A 1WETA 3D9QX 2QV7A 2GVZC 1YZ3A 3LQQA 5EI5A 1HOTA 1ZRNA 4JWTA 1AO3A 4EHFA 5IJ9A 4K5QA 5EJ5A 2RBEA 1Y5RA 2XDQB 3HKEB 2ZXUA 5FB3A 1Z4QA 3UMFA 4ECAA 2IGTA 3E58A 2O20A 2J8ZA 2A1TR 1FFGA 1G8KA 1Q0UA 4N18A 2ES4A 3FLEA 3FWNA 1NLZA 4P4LA 5FL7A 1PGNA 4LX8A 2QLFA 1S6YA 5C8XA 1S89A 3OD1A 4DNFA 2J3LA 4IG4A 1CIVA 4W82A 2WUFA 4EJ2A 1F12A 1A95A 2Z09A 5EIBD 4NF2A 2W2PA 5EE9A 2GAFA 1BJTA 4RANA 4B2IA 4LGYA 3UK0A 1D04A 1SU7A 4R8VA 5E95A 3AHEA 3D4BA 3AF1A 3P9YA 3U62A 3SM3A 4OXRA 1R3UA 1GKKA 4RPHA 4JC4A 1U9CA 2WHXA 3CRQA 3UHPA 1YAJA 3WBFA 1Z37A 5C5DA 2PQ2A 4OFZA 4KE6A 1J0XO 5E8RA 2O8BB 1XJCA 1OVMA 2NO7A 3DR5A 4P9NA 2VHVA 4IZ6A 3HK2A 2P4QA 1L4HA 4F2DA 3AMVA 1KZ9A 1I4EB 5DYWA 4P83A 4XZ3A 3ZDCA 4HAYA 1EQ2A 1N2BA 4H7DA 2FUG1 2ASEA 3FYUA 1E4YA 1WS6A 3ZTYA 3CXUA 2PMBA 2UZ1B 3DKIA 2RCNA 4PFQA 5LFAA 1WCWA 4MAFA 4YJ2B 1XTUA 4JDPA 4EQZA 7GPBA 2QUIA 2PL1A 1U94A 2JA1A 1XNRB 4JN6B 5COBA 4WESA 4FE7A 4EY5A 2NPIA 3GT7A 4PY2A 4RWZA 1L5MA 4OUDA 4QXRA 4GEGA 4UM7A 1YC2A 5EP4A 3IQIX 3L1HA 4NPHA 3IXQA 4CODB 4TMKA 1N6IA 3HR7A 4GUAA 5FWXB 4HY3A 4Y1FA 3SI7A 3V1MA 5ISMA 1I51A 4ROSA 1Y0BA 3E7WA 1GO2A 1JDBB 1W5TA 1SUDA 2G76A 2OP0A 4P0TA 1J8FA 5KAPA 2YVQA 3AL0C 2O48X 4LHWA 4X84A 3D3WA 2EYQA 2O3JA 3OPYB 3QOYA 3FGOA 4ENPA 1U8TA 4FI3F 1YRHA 5H1YA 3U3OA 2P2DA 5DTEA 1U8CB 1GUAA 4O4LF 3V1UA 1CETA 4EIWA 1BVRA 3K0KA 4D4KA 1YVPA 3B51X 3C3DA 3OEYA 4TWRA 4MJXA 4LX0A 5F3DA 3WLLA 4BFVA 1XLVA 3OH8A 3H9GA 4OGLA 3VYTB 4C05A 2BE7A 4EPWA 1XRNA 1YFJA 1CR4A 2QM0A 2WMOB 3ON5A 2P1ZA 1ZKDA 3OFND 3OCWA 4IUDS 4MVJG 5JTTA 1RYZA 2FOXA 2W83A 3AR9A 3GFRA 2ZIAA 3NEYA 1DEOA 5LMCA 4I1VA 3KU4A 4RMJA 3C0KA 3CEMA 1KI9A 2FRVA 3NNDA 3H2HA 1YQ9A 1TT5A 3PFGA 1YONA 3ZUGA 2Z8YA 5HHTA 4TN1A 3IVGA 3BEDA 1WAMA 1QWSA 3GFBA 4Q3AA 2AJDA 2JHPA 2OV6A 4QUDA 1VI5A 3QE2A 1T3ZA 2Q3EA 4A92A 1O94C 3A2NA 3UJ3X 1JLKA 1K2VN 1TCBA 1D7OA 4LRTB 3UK1A 1YVEI 2VP9A 3AOGA 3UXMA 2XGGA 1I36A 2X2EA 1MJ5A 1AHHA 1K9VF 2AG0A 4A9AA 1E69A 2VP2A 3IV6A 3NH9A 1Z0FA 4NABA 1UDAA 1Y3HA 3EDYA 4F06A 1ZA1A 4KFCA 1TAQA 4GDMA 1AK1A 3UAZA 1Q6ZA 3ZLBA 2HU5A 4A5SA 5K0JA 2HWWA 2E82A 2R85A 4FHDA 2CHGA 3GN2A 4IIGA 5E9JA 3DCYA 5T5QA 5CNJA 4BB0A 1YJBA 5G4LA 5AW4A 3QE9Y 1SKYE 4RYDA 2JFUA 4WOJA 4N1AA 5B6PA 5A4IS 5ERXA 3LUHA 1QP8A 4CLDA 3HYCA 4BBJA 1ADJA 2QGFA 2QY6A 1HH4A 1LDGA 3VMFA 3JVDA 1XLTA 3MQFA 3FXAA 2E4ZA 2R7NA 3K3PA 2Y3IA 4JEHA 2Q4RA 4AJJA 5I7OA 1ZN7A 1YS4A 4OV6B 3TZCA 1FQJA 2Y1GA 2IS4A 4PC6A 4WN9A 1BGXT 3LUGA 2O1XA 5JDCC 3RSCA 5KMGB 3CV3A 2WT9A 2LPMA 1Z8NA 1PWEA 4PXYA 4A8JA 5ERGB 4QTYA 5AW1A 4BVKA 3PC2A 2A5LA 1ZY2A 2PA3A 2EFGA 4GGMX 4RL4A 3C4JA 4OLJA 3B2EA 4HBGA 3L6RA 1D6MA 2F9FA 2UVPB 3D81A 3AESA 3PQ6A 3UC5A 4IL5A 2I4IA 3T1TA 2WQ6A 4GL2A 5CA0F 3CCFA 5D7BA 5JSYA 1UJ4A 1GYQA 1NR1A 1O2DA 4B35A 3ODGA 3M6LA 3S2ZA 4GICA 3UMYA 2QA5A 2JH8A 2GETA 2A9PA 3ZJYA 2FPGB 1L4EA 1RVDA 1EUYA 4CT0A 2XLCA 3PE3A 3P2IA 2OCYC 4HVAA 3ZGXA 4URZR 4H4DA 1CRWG 3RSQA 1QG6A 5AD1A 5L4LA 1L7BA 2CUZA 1ZNXA 1QIGA 3ND8A 4TRJA 3HG7A 4LOKA 3ZU2A 1QTIA 1IBLB 4MVJA 4O0MA 5FUQA 2NV0A 4B34A 5DRYA 3RGWS 2CFRA 3ENZA 2X9NA 4GZMA 4RIHA 2H1OA 4IQ8A 3AVPA 2B98A 4HAVA 2IUEA 2P68A 4K9MA 3BE5A 4N01A 5FO0A 3ZS8A 2FPUA 3F49S 3HVIA 2IH2A 3U7QB 3I1FA 4ZGWA 2RMKA 1V7CA 3NTOA 1G55A 2GN9A 2H2HA 2OSVA 3PHCA 3DNMA 4GGOA 3U4DA 1IY1A 2IS6A 3KJGA 1F0NA 4ARZA 4GLJA 4JLOA 2CMHA 3LK6A 1Z9BA 1YMUA 3FFAA 3K1AA 2DERA 2CB9A 4L95C 1L4LA 3IILA 1PQUA 2FXIA 3HSSA 3X1MA 1ZINA 5HJEA 3ZBUA 2V3WA 4DANA 4G5FA 1USVA 1KR2A 1JZTA 1JQDA 2PUHA 3KJQA 3AVOA 5IHXA 1SCJA 2PH5A 3AEKA 5F3RA 1N2CE 5HNKA 1Q7GA 3I2KA 1FK8A 3BFPA 4OL9A 4FGJA 3OMXA 2A1UB 3QV1A 4J9VA 5A2QA 1Z29A 2W2KA 4O2AB 4RVGA 1A5AB 4UOQA 1OTXA 4O2BF 2ZT6A 1C0IA 1Q7CA 4II7A 2J09A 3TFOA 4JJ4A 4R8RA 1KO4A 4E88A 1ISMA 1G9TA 1JG4A 5CDSA 1ZH4A 4ND2A 3LBFA 1R50A 4Q15A 2V7XA 2C00A 3K5WA 2QN6A 5JS1A 1T4CB 5JAPA 4GNRA 1H4VB 1I4WA 2QQ5A 1ZIXA 4E08A 5AVZA 4AJIA 3T52A 2W6PA 2P2SA 2V9ZA 4U1RA 2C5EA 3V34A 4F11A 4JV5B 1CZLA 2BGUA 3I9OA 3SSOA 3RC8A 3KQUA 2CFCA 3E22B 2XSZD 5K0GA 1DTSA 1P4JA 3E7PA 4IEIA 4LGMA 4CEIB 2CMFA 5AHWA 4W5OA 3WP0A 1WPQA 5DP2A 4D5EA 5AI9A 5LZ4A 1TYEB 4D9EA 1EFKA 3V80A 2GEUA 2OBYA 3LY9A 4U9IS 2WJGA 1C3OB 4KGZA 2ZBEA 4YCSA 3PR3A 4YQEA 3LCCA 1AXGA 4BX2A 2A9JA 3EC7A 1NP6A 4NE9A 4REQB 4N3BA 3H99A 1PL8A 3CCBA 2XW6A 3B6IA 3QPAA 4ZQIA 5J2UB 3SP1A 3VV3A 4RPJA 1VMIA 2WOJA 5A9SA 4KO1S 4TSKA 2AD5A 1MAAA 2X5JO 3DZGA 3ES9A 1ZC4A 2OWEA 4ON9A 1TQ8A 3B1KA 3WNVA 4NZYA 2YMPA 1FTSA 1IULA 3WRXA 5FNZA 2C03A 4BNZA 3DEIA 5FBKA 4RSHA 5DMHA 1DC3A 3QFRA 1I6MA 1MMFB 3TW6A 5FYDA 4EKEA 4R54A 4W8OA 4MHTA 4MV7A 1BMFD 4DILA 5CCEA 1XTRA 1F8FA 2B21A 1CQJB 3QVLA 4TVOA 1ZCZA 4WK2B 5I7FA 3F7OA 3GGDA 3OIDA 5C7OO 4AY6A 2C4NA 4OLFA 2GNAA 3O94A 4NARA 1VPTA 2OEPA 2Q9BA 4WDRA 3N8KA 3G1WA 3WDLA 3TZEA 1S7CA 3LW8A 5JMTA 3D8SA 3QH4A 7MHTA 4N0DA 1X19A 2Y6VA 3BCUA 3TWOA 4C4SA 3QA9A 3JPWA 4DCNA 4Z4HA 5IT5A 2P9GA 1NHWA 5TSDA 3DBRB 5K45A 4B87A 2YNMC 1REQA 1XOIA 3EA0A 4C5AA 5LBIA 3WGKA 2CE7A 1LY1A 1R88A 2D13A 4H17A 1X7XA 3ABOB 1G9XA 1SOWA 2OB1A 3SFZA 2NOAA 1GQRA 1DIHA 5DYYA 2PNJA 1T9CA 4D4IA 4OMUA 2HCTA 3VPFA 1HYGA 4J94A 1TXGA 3U5ZB 2W90A 1VE1A 1F14A 4C6HA 2QRVA 2QVXX 3N0RA 3S4YA 4M76B 5F33A 2WB2A 2VWPA 1U5AA 2VHZA 3OFNA 1KAMA 2OLEA 2R8RA 4IXDA 1U9IA 3GVHA 2EZTA 2PWPA 4REOA 5K6AA 1NHGA 2FCRA 2FPIA 1AVTA 4Y2QA 1GGHA 1QHGA 3GEHA 4DYHA 3SOPA 2PS3A 2BH9A 2ZRFA 5IJAA 3SC4A 1QAQA 3AM4A 4ISBA 1EBBA 3D4NA 1H6BA 1OOEA 1YIAA 2PGXA 2EIHA 1H65A 4BFLA 5IBQA 4PAOA 4YV7A 1WXXA 4GC5A 1B3BA 1E60A 4OL0A 4L16A 3L1VA 2J6HA 2VCEA 1W34A 3ZDBA 3EEIA 2ZBRA 3TI9A 4RFSB 4CQLA 2GD2A 4EAQA 1OGJA 2N47A 4EM6A 1E0AA 2B4RO 2FW8A 1RMYA 1Y7HA 5IG2A 2DR0A 3QX7A 3PF8A 3B2NA 5EP3A 4EYQA 4E1BA 4PQEA 3DE0X 4MPRA 5FOVA 3UNXA 2X0NA 3QGMA 3DV0B 2P7IA 2VUHB 2IA5A 3V7WA 1P4SA 2NUPA 2Z1MA 3V8VA 4B82A 4PR0A 1J90A 2JJQA 4HWTA 2NVOA 5G0TA 3L93A 1Q6YA 4FC7A 5KTNA 2GYUA 2Q50A 1JHVA 3ABSB 3C1AA 2OO7A 1CC1S 4IJ5A 1KIAA 4KOEC 5I8PA 3ZDAA 1HORA 4CCWA 2MT9A 5K20A 2X5NA 1ZITA 1XAIA 2AYZA 4XWKA 3AR2A 2QN8A 4Q4HB 5IDXA 4WH0A 3IBFA 4JOQA 1R0LA 1U9YA 2X3UA 2X8WA 5GJWC 5TVGA 2Q5QA 5CPFA 4ZHSA 1IHXA 1NE7A 1ZHHA 4R2LA 1WABA 1B4DA 1R7RA 1U3TA 3N2LA 2BUAA 1DX9A 1Z0IA 1EMDA 4IDPA 4QFBA 3PNOA 4Y67A 4CW7A 5BSHA 2FUNB 1DX6A 1T15A 4MRVA 2EQAA 3NBYC 3OQ6A 3E5RA 1MB3A 5DI3B 3TOXA 2H2DA 2R44A 3TBFA 4O0LA 5CEEA 5LB4A 2YXNA 3LVBA 3I4FA 4JNKA 4W1QA 1JTFA 1RKBA 1SG0A 2GPBA 2QE7A 3G2NA 2GF9A 2BE9A 1J4AA 1GG8A 2JFYA 2N0SA 4UJ5A 5G3YA 1KDOA 2P6UA 2HJVA 4GQIA 5DLEA 2YNMD 1RP7A 3HUDA 2PU7A 2OO5C 3CNOA 2GJ9A 1B41A 1T8YA 2FRDA 1DPFA 3FNEA 2KLBA 1XG5A 1XDDA 4N9QA 3TD9A 4DV7B 3ESDA 1T0UA 3GJQA 3DD5A 4DC1A 5DEIA 1AKEA 2XSZA 3GJ6A 4PGMA 4XEUA 1XDWA 3KXPA 4ZOLB 4CV1A 2CXQA 4XPIA 4Z0PA 2KX7A 3AHDA 3HDYA 3EHDA 3B85A 1A8UA 5L3SA 2R751 4ZDJA 1HQYE 4LFBB 1JTVA 1KBOA 1QGUB 5AO9A 1XYVA 1Y5IA 1CF9A 1Q11A 2X8LA 3Q7PA 3QVTA 1L5SA 4L5CA 4OKIA 4ZO7A 3SIXA 4IJVA 1Z7GA 2ODBA 4BU0A 2WJPA 5D5QA 4H0CA 5ER9A 4LCJA 1DJOA 4RPKA 3RCBA 4F96A 4A91A 2OCKA 3LWDA 4PYOA 1D4FA 3GX1A 1UBMS 2XTJA 3EXIA 3UTDA 4OM7A 3IOMA 1ST3A 2OK8A 3N8IA 3Q11A 3QPDA 2A5JA 1FRNA 1XFAA 3HBNA 2IOQA 2Q5IA 4ZHQF 2QDXA 4K40A 1MZVA 3L6EA 4JJ6A 4BGUA 3B6MA 3E84A 1C41A 1GU1A 5BMVF 1BFKA 4MWSA 4R51A 3RIMA 1LNQA 4A03A 4ZKEA 3HUTA 1YS9A 2DPGA 3P4UA 3R20A 1TJ3A 1PFQA 3QE0A 3C3XA 1F20A 5DI3A 2FK7A 1YZHA 3F6YA 3ZW7A 3E27A 4MRMB 3DT9A 3R6WA 4BAGA 4GOOD 1U9IC 4HMQA 2AMFA 4A10A 2QQGA 3I37X 4P6VF 1VBFA 3KHKA 5JMPA 3RANA 3A3NA 1C4OA 3S7TA 5DOVA 4AQDA 4CG1A 4ZFNA 2XITA 5LDDC 3VNVA 3IUJA 2X8JA 4O4HB 2QBYA 4YFVA 4G5GA 4S3MA 2V7QA 3HYNA 3BDVA 3QITA 2ZYWX 4KFSA 2UZIR 4Q1BA 3ANXA 4OKNA 4F3RA 3P2KA 4G8CA 4W9MC 1QOPB 1X1TA 1XTPA 3MUEA 4O2BA 3SBXA 1XQVA 2BDEA 5B1SA 5LQAA 3ROTA 4QPJC 5EFZA 1RRVA 2XV1A 1E2BA 3T6KA 4BNLA 4F12A 4ZN6A 4RV4A 5F7ZA 2R8PA 1HFEL 2NVBA 5HPYB 1FPQA 3CUYA 4ZO4A 2OFOA 2D5BA 1KMIY 2DOKA 4J0FA 2ZRLA 2RONA 3FBWA 3HKCA 3BMQB 2B6HA 2XH8A 3NTUA 4OPMA 1TRKA 3GBPA 3INNA 1TZBA 3GQBA 5I9BA 4PFKA 4XYEA 4BVBA 1WX1A 4DLTA 2DXIA 2NW6A 3VR2D 1QFSA 3HI4A 5L7TA 3V8QA 5E0KB 1KOJA 3LBYA 1VCIA 1UQUA 4J03A 2YCLA 2E5LB 4CFYA 1ENOA 1M2GA 4F7WA 4AZSA 2EG9A 4AC9A 1QRTA 5KX5F 2NU7A 1UXKA 1SIOA 2Q27A 2GK6A 2QUAA 3H97A 4KN6A 2EKQA 4DR5B