1PR4A

Escherichia coli purine nucleoside phosphorylase complexed with 9-beta-d-ribofuranosyl-6-methylthiopurine and phosphate/sulfate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
237
structure length
232
Chain Sequence
ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHITTAAERQTTFNDMIKIALESVLLGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
total genus 80
structure length 232
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr4A00
4R2XA 5B7NA 4D98A 4DA8A 4D8YA 2H8GA 3KVVA 3PHBE 4BMXA 1PF7E 4DAOA 4NY1A 1K27A 1TCVA 1Z37A 4YMLA 1OV6A 2ON6A 3E0QA 3NM6B 1ULBA 3UAZA 4G89A 2RJ3A 3FNQA 4F3CA 3QPBA 1JE1A 5B7PA 1T0UA 4LNAA 3OZBA 4OJTA 1TGVA 1PR6A 2B94A 1B8OA 4D9HA 1Z36A 4JWTA 4QARA 1JDVA 1QE5A 5EFOA 1Y6QA 4TXLA 1T8WA 4M7WA 1Z33A 1T8SA 1K3FA 3OPVA 4JOSA 1Z35A 1YRYE 1A9QA 4PR3A 3EUEA 4YNBA 4PNPA 5CXQA 1CG6A 1PR2A 1OVGA 3ENZA 4TTJA 3IEXA 3NM5A 2QPLA 4WKBA 2GUWA 1RXCA 3NM4A 1V3QE 4P54A 4LNHA 1RCTE 4DABA 1G2OA 4TTAA 3K8QA 1VMKA 2A0YA 1U1FA 3LA8A 5CCDA 3SCZA 3DPSA 3DF9A 1ZL2A 5B7QA 1TCUA 2OC4A 2I8AA 4GKAA 1Y1SA 3PNSA 3OOEA 3D1VA 4MCHA 1RR6A 1JYSA 1Z39A 4OY3A 4DA7A 1SD1A 4GLJA 4G41A 3FB1A 3OCCA 3UT6A 1RXYA 2OECA 3FOWA 1TD1A 1ODLA 1OTYA 4FFSA 3OZCA 4TTIA 5EPUA 2BSXA 1JPVA 3KU4A 3O6VA 4UC0A 4YO8A 1A9OA 3KVRA 5I3CA 3PNPA 5CYFA 5EUBA 3KUKA 1YQQA 1ECPA 1U1GA 4U2KA 5F77A 4WKOA 1V4NA 5CXSA 2A8YA 5IU6A 1V2HE 3UAWA 2XRFA 5JPCA 5CCEA 2AC7A 3DJFA 3OOHA 1M73E 1WTAA 1YR3A 1Z38A 4QFBA 4QAQA 1SQ6A 1B8NA 1PK9A 4R31A 4EB8A 4IP0A 1RYZA 4WKPA 4JP5A 5F78A 4TYMA 3GB9A 2HRDA 1PWYE 4LZWA 3KHSA 1LX7A 3UAXA 2HSWA 1Z34A 1PR4A 3EUFA 1VHJA 1Z5OA 3P0EA 3P0FA 5C80A 1A9PA 4WKNA 3UAVA 3EMVA 2A0WA 4E1VA 1NC3A 4DA0A 3BL6A 1RXSA 5K1ZA 1JP7A 1I80A 3LGSA 4TXHA 4M3NA 4TS9A 1A9TA 5IFKA 5F7JA 2AI2A 1Y1QA 1LVUA 3EEIA 4WKCA 4KN5A 2QTTA 1JE0A 4OGLA 1RT9A 5FAKA 1ODJA 1PK7A 5CYGA 3DP9A 4F3KA 3MMSA 1YBFA 3U40A 4NSNA 1SJ9A 4DARA 3C74A 1U1DA 2QDKA 3K8OE 5F73A 4L5AA 4F1WA 3O4VA 4M1EA 4L5CA 2HN9A 1PR5A 1ZOSA 4L0MA 3IOMA 1NW4A 1ODKA 2I4TA 1JDSA 4H1TA 4F2WA 2Q7OE 1OTXA 1JDUA 2ISCA 5F7XA 5F76A 4D8XA 1LV8A 4MARA 1A69A 5ETJA 1U1CA 1NC1A 2HWUA 4LKRA 1C3XA 4QATA 1XE3A 1T8RA 1ULAA 1TGYA 3ONVA 4TXNA 3BJEA 4TXMA 4OF4A 4F2PA 1PW7A 2AI1A 4DAEA 2IQ5A 1SD2A 1RSZA 1V48A 4QASA 4X24A 1ODIA 1VFNA 2P4SA 1JDTA 4MCIA 1OU4A 2A0XA 3T94A 3OZDA 1CB0A 1Z5NA 4EARA 1A9SA 3FWPA 4BMYA 3OF3A 1A9RA 3ODGA 4BN0A 4DA6A 2QTGA 3GGSA 1YQUA 1Y1RA 3E9RA 4QEZA 1V45E 3E9ZA 2PGAA 3PHCA 1VHWA 4NS1A 4LDNA 1Y1TA 4OEHA 4I2VA 4K6OA 5KB3A 1V41E 1FXUA 1PKEA 1PR1A 2OC9A 4L5YA 1Y6RA 1PR0A 5DK6A 4R2WA 3BGSA 4D8VA 1K9SA 1OUMA 3BSFA 3INYA 3NBQA 3LBAA 4DANA 1U1EA 2OXFA 1PBNA 4GLFA 4GMHA 4L6IA 4TS3A 3KVYA 4RJ2A 5F7OA 3OZEA 2AI3A 4TXJA 3FAZA 4ECEA 1JDZA 1Q1GA 1RXUA 1Z5PA 4BMZA 3DDOA 4G8JA 5F7ZA 3TL6A 1RFGE 3F8WA 5B7GA 3MB8A 1N3IA 4YJKA 1T8YA 2QSUA 3UAYA 3FUCA 4OGKA
chains in the Genus database with same CATH superfamily
4NFLA 4HUTA 4JJEA 5CVTA 3OHPA 5B7NA 5AJYA 5DSXA 1TQ2A 2NZYA 5LQCA 4I7EA 2JARA 3SR0A 4FEAA 2IFTA 1GAEO 2GPSA 4L27A 1YDHA 1XRRA 1L7RA 1NX6A 3RNLA 2J3IA 4ZI5A 2BHTA 1WXFA 2AJ8A 2RK3A 3SJZA 1L4EA 4DR2B 2H4ZA 1RYYA 1Z0AA 2Y1XA 3ABIA 5DN6D 2AW5A 2YWCA 5CAEB 4BFXA 1XJWA 1ZHHA 1Z37A 1I7DA 3TZ6A 4B46A 3RYCA 4QBGB 4DUZB 4MYRA 1NKTA 1VLHA 2BGMA 3LK6A 2C98A 1OFGA 1L3IA 1YRHA 3NM6B 3IYLW 3ABRB 4AJLA 1BX3A 3CZPA 1O8CA 3GC6A 2AVDA 1U4OA 2X9LA 4G89A 1PQ4A 5ABPA 1K89A 2B83A 2UYYA 3BE4A 4UOEA 3ZQJA 1P0CA 3FNQA 1WB4A 4GP7A 3G88A 4TRRA 1U9ZA 3C8MA 3ZY3A 4CGYA 2BSQA 4LRQA 1T0UA 2Z5FA 3D3KA 3GJQA 3KEFA 4XWOA 4PPFA 1VGQA 3PXGA 4PANA 4MVJM 3SS8A 2J9FB 3WLKX 4QJ5A 4W5RA 3SMQA 1YZFA 5DBGA 3ONNA 3VC1A 2J3HA 1F48A 1G6KA 5IJZA 2EFGA 2NXNA 4W9NC 2JHPA 1KZ9A 1FSFA 5KKAA 3M6LA 3GGDA 1E60A 2DLNA 3HB0A 4QU0A 4MI3A 3TZKA 2CNWA 1NAHA 1U11A 1U7ZA 3RRJA 3THRA 1DUIA 4TWIA 1DJLA 1ULUA 3HCBA 2JLCA 8OHMA 5JAPA 3WGZA 1QM5A 1AS0A 1DEXA 2J3DA 1QAOA 1EDOA 2FVYA 3BS4A 3CINA 3DT6A 1UBUS 4FYIA 4MHOA 1IEVA 1A9QA 1Q7BA 2AIRA 3ER6A 4PLHA 4PQFA 2WHPB 3ZE9A 4TVBA 1X8JA 3O03A 5JJCA 4QVKA 2DCMA 4AZTA 4Y0VA 1L8LA 1UP7A 2CZGA 4P3NA 1NJGA 4AZVA 2UUCB 1JS1X 5C7LO 1L5SA 4BHTA 1HNXB 2QPLA 2O2ZA 2Q49A 4IJQA 3T5PA 1B4DA 1P5ZB 5F21A 3IKMB 3R5FA 4ND4A 4WEOA 3MGBA 2OMKA 2HYDA 2X8LA 2C7GA 4AF6A 3OQMA 1J1IA 2EARA 1YQEA 2X40A 1TU0A 1FDWA 1U80A 1RP1A 2IYLD 2SBTA 4O0LA 5H0IA 2Y2UA 1ZH4A 2HIMA 3AY0A 3TPFA 4AN1A 1JLMA 2XYPA 2P3OA 1VZ2A 4K05A 1AKVA 5JXWA 5J23A 4R2LA 3WJ1A 3AKDA 1QF9A 1FPQA 4S1WA 2X7HA 1K7FB 3E3NA 3L7DA 4OBXA 4Q16A 3BREA 1RRPA 2WICA 4LYAA 3LA8A 4ZYWA 3DHNA 2FW7A 3GLGE 1OKKA 2LNDA 4WZAA 4F3RA 1C9NA 1Y37A 3QXSA 1S1CA 3NDPA 4OP3A 4QVGA 4DIEA 4U1RA 2QT0A 1BS9A 1IUKA 1ZL2A 1XZBA 4UVGA 1C7IA 3X2SA 5FYQA 3W04A 3LY8A 3UTCA 1GNRA 3L82B 1U0JA 3GNLA 5FOXA 3R8XA 1PEKE 1SVMA 2C1ZA 1O94A 4RNCA 4BFWA 2IKQA 3GA5A 1L3CA 3RC3A 3ZKWA 4DDMA 3FYHA 3IILA 1YR7A 2FY8A 3CR8A 1U8UA 4CXMA 2ZIWB 6REQA 2VXBA 5KQSA 4XEHA 1R3UA 4EJMA 3TJZA 5EERA 3BUSA 1ZGZA 1SD1A 4G41A 1OIXA 1UBEA 2O23A 3DC2A 1DBQA 1OWNA 1KS9A 3D2BA 3EA0A 4EHBA 3U6BA 2W6IA 3OCCA 3GLHE 4H6PA 4QYTA 3AF6A 2JLAA 1K6JA 1CF9A 4DHWA 5IZCC 4MR9B 2ZPTX 2AUMA 4FU0A 4FKMA 5CT8A 4AJIA 2YZNA 3ITKA 3H3XA 3KPUA 2O14A 5BSUA 2L82A 5I7RA 3NH6A 1NNEA 4Q1EA 3HXKA 2VHTA 3VX3A 1CYDA 4R1OA 1Q0TA 2HPVA 3Q8WA 4X6UA 3AOEA 1OWPA 1H2ZA 2ZE6A 4C7OA 1NP3A 2VUSA 3LBIA 5C7OO 1XV5A 1PG2A 3NV7A 1HDRA 5LBUA 2DEUA 1VI2A 1IN4A 3ZW7A 2BGLA 4OH7A 1C4WA 1R5OA 2KQUA 2GRUA 1X1QA 5I3CA 2Z6UA 4EBBA 1VJ1A 4XDZA 1QKJA 3N2IA 1H94A 3M3HA 3PNVA 4L8WB 5K0GA 4KK3A 3OAAA 1GARA 3KCNA 1TNDA 1RRGA 2EP7A 4Y6QA 5FTMA 5FV4A 3LHIA 5HX7A 3ZE6A 2AG0A 1UOPA 4X5OA 3R5TA 1VKNA 4JCOA 4NAHA 5IT0A 1RWQA 1P6UA 1C9DB 3CEAA 4UBIA 3FDXA 1DKUA 4HTFA 4RD1A 4BLTA 4J1TA 3SKVA 2PKWA 4JI3B 4G07A 2A8YA 1IL0A 4WCDA 3CNNA 1LB1B 4E3WA 2RD2A 3OKPA 1H9CA 1J8VA 2JLUA 3W7AA 3FNIA 5FWNA 2R7AA 3D3JA 2COUA 3OCYA 3E5NA 2ZXFA 3JZIA 2LKDA 2E2WA 2H3HA 4FX5A 4CG0A 4DNXA 4F4DA 2W71A 3LP8A 3ZDXB 4A3SA 1YR3A 5GP1A 2WRZA 3ABSB 2Y99A 3B78A 4TLAA 2ZT6A 3TSWA 2RHHA 3V3KA 4HNHA 1J5EB 5CGQB 3FIJA 1LC3A 3D3NA 5HA5A 1JV2B 1C7QA 3DWEX 5EZ6B 1KQ3A 1KDVA 1G21A 2BR3A 1I5OA 2PQ0A 3O38A 2O48X 2V7EA 2GD0A 4ZEMA 1AHNA 1I6KA 4WZAB 4JJ7A 2UXCB 1ZO8A 5IAGA 1KEZA 4GLOA 5F78A 4C9BA 3II6X 5A4JA 2MT9A 9ABPA 4B6EA 4KREA 3M6UA 1U8YA 4ZHQA 4ER7A 1YL5A 2OAGA 4DC1A 3F46A 3FNGA 4LUCA 4XDHA 2OBNA 2A5GA 3NBKA 4YA6A 2G8LA 1I1OA 4WJLA 1G4AE 1B7GO 1SCUB 1X38A 3EGDA 3ZKWB 5FBVB 1OMOA 2CLIB 3PEYA 1Z82A 4DXDA 4PR0A 1RLOA 1GPKA 3NV9A 1CR6A 3LQ2A 1T2UA 2HNBA 2W98A 1H5NA 1A2KC 1CVIA 2Z3VA 4KBFA 4LJRA 4AT1A 2HLHA 4OHKA 4F71A 3AF2A 3ZIUA 3E7WA 4L51A 5CPFA 3AIOA 1QPGA 5A05A 2O2GA 1TL7C 5IVHA 5G0TA 4JYCA 3ROGA 1P4SA 1ZHFA 3ETDA 2JFWA 3OJCA 1FTNA 4OXIA 4WKNA 5FFNA 4BQEA 1AUVA 2GO7A 3BTUA 2P67A 3G8DA 4D96A 1IN1A 2HQSA 2ZG6A 3HFRA 5EHXA 4M9XA 1PAUA 1SXIA 3DCJA 3KWMA 1UPBA 2JCVA 1QLJA 2VTEA 1IHXA 2B5WA 4UEOA 2JGLA 1N0UA 2LBPA 3CZAA 4RVOA 1KHHA 1F0NA 1S4MA 3EBLA 4GFDA 4C7OB 3JD3A 5FOTA 3B3FA 4W5WA 2Z9DA 4FILA 3OEYA 4NJMA 3I9NA 1ND6A 4YP7A 5C4GB 5LPNA 3EJ6A 1Y1QA 4MGHA 2OESA 2LKCA 4GKKB 5EYPA 3DQZA 4OB6A 3R76A 4Q3LA 3E1GA 2J6BA 5IWCA 2MJLA 2Y2VA 5KYGA 4CKZA 13PKA 2PIAA 1TMYA 3FMVA 4IM7A 4OJNA 3AEXA 2D1RA 3LOUA 1SUPA 4LV5B 3OMWA 5CYGA 4EM6A 1P39A 3MM4A 3WA6A 3PNQA 2Z43A 2ZQZA 2ACKA 4K9MA 4B2PA 2JGKA 1BDIA 4HTFB 2YNMA 1GKKA 4E46A 1EUDB 1XT6A 1XG5A 3U40A 2KPOA 3N28A 5EJAA 3OQOA 4B40A 3UFXA 3E9YA 3VU9A 1A9YA 1QGUB 3IJPA 4X63A 5KWIA 2UZIR 3OKCA 4MW5A 2Y1EA 1T10A 1NY5A 5EIFA 5EHQA 4EMTA 3QA3E 1U3GA 2UDPA 4MPTA 2HFKA 4F97A 2NO0A 4OQLA 2RGDA 3D54D 2QY9A 1RAAA 3GDHA 3PLNA 1EK6A 3GARA 4XJVA 3F0TA 1OD6A 1G8SA 1SN7A 2CDNA 3KLBA 3M89A 3PQ5A 2Y1CA 3T7TA 5AM4A 2PUHA 1JKXA 3TRFA 1JYEA 5LIPA 2NVBA 1W88A 3AUKA 4XB1A 4RPIA 1YJXA 3PUZA 2I62A 1KYWA 4H4DA 3TW8A 4C7MA 1BYIA 2I2XB 2IIPA 1DEOA 3AHIA 3FY4A 4JLBA 1AH2A 3N75A 3SSAA 2RGRA 3ESBA 4BRZA 3K71B 2WVGA 4ZHQB 1P1FA 1WDKA 5HE8A 4DRYA 5LP1A 1ORHA 5C3UA 3HGTA 1G17A 3P97A 4JL6A 5KOIA 3FOZA 3DTYA 6ABPA 3BZWA 1EFAA 4YQFA 1HFKA 1KEWA 3R1IA 3M4YA 3UWOA 3UIEA 4QKQA 1U0NA 4LXYA 4BN4A 4CF4A 4OHBA 2NO5A 5ARCA 3N9IA 3P2OA 4POOA 3UK1A 1VYVA 3VR2A 2X0EA 4CQLA 4ARSA 1I8TA 1G3QA 4RFSA 5HPYB 2J7PA 3JXEA 1ZZEA 3ZWNA 1KQPA 4BO1A 4JR1A 3BMQA 3K5PA 3K1YA 1GUZA 3ZUPA 2AJTA 2PQ2A 3VZPA 1BDHA 2QK4A 3L8FA 3EPRA 5I3ZA 3C2QA 4TSRA 4ZT4A 1KH1A 1L8XA 1XQXA 2B4KA 4LAFA 2ODEA 2XUKA 3NAMA 4ZVQA 3UB4A 16PKA 1DJOA 2G9QA 4JT9A 3ON5A 3UK7A 4AMGA 5ALMA 2XMPA 3AVPA 1Y48E 4MZXA 2FN9A 3E53A 1V48A 2AN4A 1O95C 2P9HA 1JIUA 3JY6A 3ONDA 4QASA 2Q3EA 1VBKA 2O1XA 3QV1A 3FHOA 1DEHA 3MLBA 4J0HA 2QVYX 2X6QA 4HNSA 1KK1A 5IMSA 3OU7A 4M0PA 2CJYA 3LXRA 4R51A 1KFJB 1ZGGA 2VJAA 4NJMB 2C5SA 1QORA 1XYGA 2PMFA 1P3JA 4Z7JA 2EZUA 4B73A 1G8HA 1JHXA 2HJSA 1SQSA 2QGNA 5DTJA 3MWDA 1RVDA 1EUCB 4PQEA 2A9KA 4NMXB 5AYVA 2CVHA 3GNTA 4R9RA 3NVDA 1MA0A 3AQIA 2B3DA 1VKHA 3F6SA 3I2IA 2FQXA 2ODWA 2PGLA 2J0QA 1N2GA 1TQHA 3HVHA 4HK4A 4F4FA 5EIHA 4GNKA 1D2RA 4V0MA 2VPWA 2WP0A 1DG3A 4IMPA 3O9MA 3BHJA 5CA1A 4W8OA 1KARA 1KNXA 1KS2A 2REXB 2V7BA 4XJSA 2JFNA 2IA5A 2O57A 3UFXB 3VU9B 2RH4A 5CXUA 4TTPA 4AKIA 2QTRA 1AQ6A 3I0NA 1OXMA 4HH0A 4IF6A 1RC0A 3MIIA 4H7DA 2XH8A 2ZB2A 2VJOA 2OBBA 4MW1A 4W1SA 2YC2C 3EBOA 1TK2A 5FLEX 3QLVA 1ORRA 1T9HA 4Z6KA 2YJ4A 2Z5LA 2VH2A 3FA2A 1Z2PX 3FYSA 4WZBB 1CS4C 1ZWLA 2H5IA 4RSMA 4N0PA 2Q5QA 3ULKA 1FPMA 2ARKA 3BXOA 3HSSA 3PF9A 1EHCA 1K86A 3ITDA 1WF6A 1W88B 4DLXA 2XZOA 3TSAA 2P3SA 3BRWA 3L79A 5EZSA 4PLYA 3TW8B 4QM7A 3R3JA 5EFZA 2OXTA 4BX9A 3PRJA 3RS7A 1GLGA 2YH2A 2PN1A 4NCHA 3OFSA 3FMFA 3A1SA 3RBXA 4Z7OB 3V7WA 2C82A 3CMMA 2PBZA 4R2WA 1HYGA 1XVIA 5ENDA 5AW0A 1FU8A 2FMUA 5JBIA 5KTSA 4K86A 3WWEA 5AHRA 2OVFA 4QHSA 1XXHE 4I9NA 3TRDA 1F9AA 4KE6A 3ZWAA 2SKCA 3ZTTA 3IIJA 3V00A 1MFPA 4DR6B 3G8AA 5KNCA 4CQLB 3D2CA 4E94A 4RFSB 3E58A 1NW5A 4MP3A 5KDDA 4BEJA 1XZJA 3KLPX 1PHPA 3A4TA 3KTOA 1KBOA 3PFGA 3NIFB 3SOZA 1NWHA 1I2CA 4EG6A 2DX7A 1VSQA 3CX8A 3HN7A 3YASA 1G16A 2B5VA 3NVAA 1JNYA 2PLRA 4R0NA 1QHXA 2W5UA 3D6AA 4Z3OA 4LRSB 4YRSA 2WU1A 2Q5JA 4F3YA 2V7GA 1M6VB 2AR7A 2OP1A 2EFHB 2MSWA 3EOAI 3MBOA 4NU8X 3U37A 5FUVA 1JECA 2A58A 2QROA 4GXRA 4TUYA 2C7BA 2EWMA 2W83A 3RTCA 2VWGA 5HKKA 1XDSA 2W0MA 1G5QA 2K4MA 3CEMA 1YC5A 1C7EA 1H93A 3PVSA 2Q8NA 3HCEA 3DAOA 3ZVMA 4EP1A 1ZU4A 4HDNA 1KU6A 3Q5GA 4IJWA 2AFIA 3TLEA 2HJRA 1YQWA 3TFOA 1JH9A 4B48A 4O3MA 1T2AA 3QBJA 3D6TB 5IUJC 1E3JA 4UHKA 3KKOA 4D3XA 5ADHA 2ODAA 3CT4A 3H1BA 1NTOA 2W6CX 2EU8A 4YAGA 3QMWA 1QH1A 4GM1A 3P0JA 3LQRA 3I62A 4EL0A 2F90A 4TROA 4QOHA 1ESZA 3PFFA 5EWJA 4HI0E 3AFNA 4MSUA 2QUAA 5B7GA 3V6LA 1BH6A 4MWDA 1CEEA 1JAHA 1SXHA 1XNJA 4WUVA 1WCIA 4XGNA 3UMSA 4DQDA 1OLUB 1Q7TA 5BUSA 3AIIA 5TGTA 2I76A 3Q87B 3VJLA 4Q37A 3RDPA 4I4CA 3AR8A 1CIVA 5CA1B 4ABTA 5C4IA 4V3BA 4IGFA 1G19A 2E18A 2X5NA 1B8VA 3GF4A 3PU6A 5TF0A 1E1KA 1WXQA 2V7QA 3M5PA 2FGKA 1WCWA 2PMWB 3SY8A 4UCQA 4Y2TA 1JU4A 2IV7A 2NMVA 4M83A 3EZXA 4YT4A 3CF4A 5AW5A 4J16A 2XNDD 4INPA 4LZJA 3PHBE 4CLDA 3IV6A 4YP1A 1V3TA 3SQLA 2PFKA 1OX4A 1S89A 1K27A 2DMRA 1NWCA 3I72A 1KAQA 3NQ41 4BNUA 3H0KA 1ILEA 4RJLA 4D9MA 1TPZA 4DLNA 4MQBA 4QVIA 1YUMA 5DEOA 3ROPA 3ZGOA 4A2WA 3E0QA 1LDMA 3IRVA 4PNHA 4D5EA 5L8VA 4OQNA 5CK4A 2IYPA 4UE3S 1N8KA 2R62A 2XF2A 4KNVA 2XUGA 1KZ6A 1Z0UA 2JATA 2Y1GA 3AP1A 5DCYA 5DYGA 1W0KD 2KLHA 3STWA 3T3MB 1WR8A 2PH3A 2WSSD 3DVRX 3O3CA 3GJXC 3ZYZA 4CU2A 3G5LA 2PAFA 2BL4A 3FRHA 3IBFA 2GYVA 2XY4A 5TF4A 2C7OA 1POWA 1Z7GA 1I36A 2DPMA 1RLTA 3SJAA 3KJGA 1UBKS 2Q5CA 4KQCA 1MJFA 1O5OA 2VJQA 3IXQA 1J7JA 1LNSA 2GN4A 1M6EX 4G37A 5ALVA 1S2MA 2CL0X 2GEUA 3HADA 1J8QA 1JQLB 4I1SA 4QE3A 5LNK1 4II3A 1T8SA 3CVUA 3UG7A 4JB3A 3QM1A 4P84A 1YU6A 3JWJA 3I5UA 4IX1A 4AWXA 1I32A 1XEXB 2ZFUA 1U9JA 3EDYA 1BE1A 4ZXFA 3DLIA 5DW0A 3WIBA 4KO4S 4ICIA 4IRUB 3B5IA 3LUDA 5LQDA 1ZM9A 1ZOLA 4M1SA 3TO5A 3BB4A 3I9JA 2A14A 4N3GA 1WU7A 3G3EA 3U7EB 4TUYB 2IS1A 1TYCA 3BRCA 4H1UA 1HF3A 4LC9A 3ZY4A 4LF4B 4OU4A 2VHXA 4X6LA 3I1IA 4XM0A 4ESHA 3MC1A 4TLCA 3L02A 2O7VA 3AM5A 4WKBA 4XQEA 4Z9YA 4BGEA 3QVOA 1OH7A 2PKYX 3MTAA 2ORED 4Q3OA 1KIMA 2ZUSA 1YHZA 3LJKA 2AFIB 3R23A 4ZV9A 3PWTA 1HG0A 2VQ6A 5H81A 1MAWA 3RUAA 4BDTA 2VJLA 5BWOA 3QWAA 2JD0A 1AKQA 4DCJA 3OCJA 4KMMA 2P62A 4XWGA 2I0FA 2ZRDA 4PFQA 3H6GA 5LM3A 1L5QA 3JWHA 3PFIA 2VUHB 3PL5A 1BFDA 2HA4A 4RZUA 5JUWA 9LDTA 3DNMA 1WCIB 4P81A 1O6ZA 2D0PB 3AHHA 1CPYA 3BQMB 2CMDA 5CCDA 2OQ2A 3WYNA 4F2DA 3N39C 2VUUA 4NYIR 3ZQKA 3DCIA 1SVIA 2QD1A 4X7BA 2JCGA 2WF6A 2O0HA 4NAVA 2QMUA 4QDUA 4ETNA 1XCGB 2Z2KA 1CJUC 3OPYI 4N0DA 4EITA 2CMKA 1A7UA 3O7WA 1AKRA 2AQIA 3DVSX 2TECE 3C4VA 3RYTC 3FOEC 5MN5A 1B76A 1VL6A 1OX4B 4EG4A 3IDAA 1S3GA 3NEYA 4GMKA 2Q6TA 1LXCA 4U7JA 2M6KA 1I4EB 2IPAB 1TIPA 2WINI 2OO7A 2Q6IA 3P19A 4YCJA 4N0QA 4AG6A 5JS1A 2DWCA 4CKYA 3FI0A 4CCYA 4ME6A 5BT9A 5IRCD 3PHHA 3KYIB 1YK1A 3QSYA 4CL3A 1YVDA 4CKXA 2OCBA 1QQBA 3W5JA 1K8YB 5JZMA 1KP9A 2G4CA 4JOQA 2YVLA 3ICQB 1DQSA 2HDOA 4C6TA 5GJBA 2VHUA 3B1ZA 3HA3A 3QHQA 4MROA 1PBTA 4MUYA 4HWOA 4KVAA 4Z8YA 1E6KA 1KC1A 4HWRA 4QEDA 5AJXA 3UHAA 3VKHA 2FEKA 2X86A 3FD8A 4GPBA 4M8LA 1YGPA 2JDID 2NW6A 1E6MA 4ZI2A 3QVMA 2OHIA 3TNYA 3VR5D 5JFTA 3NP7A 3CPHA 3N5KA 4DKJA 1D2NA 1WVIA 1N5JA 3RHSA 3CLRC 4O08A 2W11A 1E66A 2VLBA 2XVAA 2D0DA 4L4RA 5COBA 4E5DA 1JEQA 2ZRIA 3U3DA 4LQDA 3I9KA 4QUGA 4XD7A 5DNDA 3NI2A 1IU9A 3FFWA 3W2EA 4LE1A 2C54A 5IKMA 5E9JA 3UUEA 1A95A 1YZLA 1AIPA 5LLSA 3VHQA 5T4BA 3DHWC 2DKNA 1BFKA 1D0SA 2C2YA 4GSYA 5IU6A 1NRJB 5FBZA 4H1HA 2NP6A 4RIIA 4JQZA 1SG6A 3HVJA 1M2VA 5AH0A 2PH5A 3H1AA 2JGIA 1I24A 4FFMA 5JWHA 3B70A 3HU3A 3ZHSA 2NU9A 3R4VA 2J0UA 3K15A 5KVVA 3Q41A 4X3OA 3TG2A 3RHTA 1R0XA 4CCAA 4LRWA 4QFBA 5AXDA 1IJBA 4ENTA 2A0UA 4PX9A 2PGOA 2JAXA 1PFYA 1EFRA 2OGSA 1U7TA 2WP8J 4QU8A 4ZYTA 4HN9A 4X8MA 5ITZA 2ONZA 2ZU6A 3W6OA 3CIOA 4UUNA 4XH9B 2IUFA 5HJ5A 4M0MA 3UMJA 1JDBB 2ZWAA 1I14A 2KBEA 1SY7A 4HFRA 4R31A 1XJ5A 1OFUX 3ZDYB 2FG5A 5CIWA 4EX7A 2A5FA 2ZB4A 1Y1LA 5TMBA 1J0EA 4A7PA 2VDQB 1SULA 2QR3A 2DY0A 4WA8A 1HY3A 2QRJA 2OTCA 4R1LA 2B4TO 2FI1A 3QU7A 1Z4QA 3QE2A 2WWHA 3KQPA 4GU5A 1FJ2A 1WMBA 1JDPA 4ID9A 3AIMA 2OFPA 1LX7A 5BYAA 4I46A 3HXOA 3JAKB 4IDQA 2FMKA 3NUZA 3QUTA 3PYXA 4OYRA 5DGCA 3AIKA 3PT5A 5L3ZA 4RTLA 3ZLTA 3BN3A 5I7FA 4XYGA 3ZV5A 3DGFC 5LB4A 4DBLE 3FYDA 5K0NA 1ADCA 1Z4NA 2W2MA 4BAZA 5GVRA 2B9EA 3O93A 4R8SA 5JPDA 3K1ZA 3SQDA 3PEUA 1VCIA 2RIPA 4WPGA 4CCYB 3EW9A 1VL5A 3AGPA 3D6FA 2WHRA 3HWSA 3P0FA 3HI4A 1A88A 1LNZA 3MWGA 5E7QA 1RJFA 3ZJYA 3VI3B 5KVCA 1W36D 4I1UA 2Q5FA 2VK2A 4G1MB 5IUKC 3L1KA 3A6EA 3NTQA 1L7DA 3PQ6A 5DM4A 1ENZA 3ZX5A 4JJ6A 4LJKA 1U7HA 1MB0A 2CXHA 2IL1A 4J9UE 3LBYA 2VHVA 1IFXA 2E3JA 4GZLA 3PEWA 1O0CA 1NDHA 4RHCA 3THSA 4O29A 4RV4A 3TPZA 2X1HA 5JANA 1V5FA 4U39A 1WS6A 3ROQA 5EXPA 2PH7A 4DPKA 4BKQA 1R2QA 1JR6A 4RETA 2CT8A 5TT0A 4YONB 5FL7A 4FFBA 1O6CA 1GO2A 3KYBA 4XR9A 4F38A 1NP6A 4W99A 2ES4A 1KMMA 1T2DA 1VYHA 4GNRA 1PGJA 1EDEA 4ILKA 4E6EA 1JEQB 1SQ0A 3P96A 5MF6A 1X1TA 3PWZA 2V6JA 2VRWA 1AGRA 1H4VB 3UPUA 3RK4A 4MAAA 2OL4A 5IHXA 2W70A 2OVBA 1AGYA 1G7TA 4F0JA 1Y5MA 4OLJA 1GKIA 1Z7YA 4B5KA 3UQYS 2G28A 1QX3A 1K5GA 3C3DA 2NV6A 4DG8A 3CUWA 5JQGF 3DL4A 3LDHA 2OBLA 1RE1A 1CKEA 3ENKA 1HMYA 1OROA 5DLDA 2COKA 3LCCA 3TLYA 4KO8A 3C74A 1THGA 1DFHA 2VPZA 3MJVA 2JH3A 3KQLA 4NG5A 2WWYA 2N42A 1N1MA 1SBIA 2Q9BA 1TEHA 4BO4A 2HN9A 1W1WA 5EQJB 1K63A 2YJTD 3KXIA 3MJHA 2XGMA 3L0OA 4F8JA 2VL7A 5ITZB 4ONEA 1XLUA 2BHLA 3EEFA 1ZUD1 3LWBA 3B5JA 1XQ9A 3TOCA 5M5BA 5HNKA 1N75A 1O6BA 1X80A 3U3RA 1GY8A 1PWHA 2EEZA 4NBSA 5CLQA 3CLUD 4MVYA 4JASB 3LT4A 4R2JA 1KO8A 1OTXA 3SKXA 1VKZA 3AZOA 2F7SA 2J3JA 2G9RA 5DO9A 1VC2A 3D6JA 4NU0A 4OLHA 4KGVA 4UFOA 4TX1A 4NNOA 3OIDA 3TLZA 1ETHA 1GGMA 1KVTA 2J5KA 1DRUA 3HMKA 3VHLB 2Q3JA 1KQOA 2XQJA 2X42A 4IILA 1G1MA 4OHOA 4EA7A 1P4HA 2CXRA 1G2PA 3HCOA 5BPFA 3R9WA 2UUPA 1SZPA 1T4GA 1Y82A 5I5GA 4R41A 2BN4A 5I4CA 3LIIA 1TUBB 2G06A 3SLRA 1YZUA 2IP4A 2Q28A 4ZMBA 1RLJA 2VP2A 4GSLA 5A3JA 5HZKA 1UJ4A 1M8KA 4JP3A 5I4BA 1L5ZA 1PDWA 1ICEA 1P7CA 3HP1A 3PFHA 3WAKA 3R7BA 2HK6A 3EZ7A 2I6SA 5IPFA 3EY9A 3FOFC 1XVVA 1XX6A 3MMZA 3T5CA 3CWZA 2IUEA 2VYCA 2GJ9A 2FX2A 3ITNA 4JAVC 1Y9DA 1GZUA 1Q12A 3AMVA 3R0JA 5DJ5A 1GZ4A 4FOOA 3WIVA 3IQFA 3Q3JB 3X43A 1CV2A 1ZGHA 1N8SA 2HD4A 2G8NA 5BVHA 3S5JA 4R84A 4TT3A 5D1NA 1JW9B 1VPTA 5KTOA 1WVMA 1GL6A 4WHMA 1UT8A 2BI4A 3HJTA 3HEBA 5E1OA 3U26A 4JI0B 2F17A 3IX7A 4RF5A 2QLBA 2YFYA 3HJBA 4FFBB 1XAHA 3NHAA 1C7FA 3T3IA 4JYZA 3OBIA 4WNAA 1GP2A 1CZNA 3JZFA 2XIQA 4X91A 5A4IS 4K6HA 3OY2A 3BDVA 4WBNB 4GO1A 3LKZA 1T29A 4ILEA 4X84A 1KJJA 4REOA 2R5FA 5LIRA 1SMKA 2IZ6A 3CVYA 4YACA 1KNQA 5TPWA 5EZYA 1LSOA 1ABFA 1E2MA 2D7DA 1GPNA 1KRHA 2JFHA 1A0OA 2DT5A 2WU8A 3D8SA 3LUFA 3WGQA 3AVTA 1FVFA 2I8LA 4D9IA 4TN1A 2YV2A 2J4CA 2X41A 1TECE 4XOIA 4RJTA 4A8PA 1YB2A 2FDCA 1GTJ1 2NVUA 2GD6A 2NPIA 3RSHA 5LZ2A 4TRMA 3FSGD 4GF5A 3W1EA 1L8QA 4J90A 3QW4B 2VXYA 4Q1CA 4TWJA 3VVBA 4CDNA 2ZSIA 3F9IA 3TINA 4LG1A 3VYVA 1LTHR 5IC5A 2ZUBA 3HZZA 3OP1A 5FF9A 3ZD8A 3HY3A 2ZM5A 1IVSA 2ONCA 4TMYA 4K6OA 1NKVA 1F4VA 3HJHA 4L8GA 5HEKA 1DB3A 2V9ZA 1G42A 1SQFA 1X80B 4I36A 4AZ0A 4ZIRA 1NW6A 3RI3A 4AJPA 3A3PA 1ZD3A 4EGQA 4MGZR 4L28A 3SZMA 1V2GA 4NYMQ 3T9DA 4LBWA 1UPTA 3IIIA 3KTAA 4LDJA 3H04A 2Q4TA 2B8WA 1NI3A 3VZQA 2WIBA 4IQFA 1JT9A 5IH7A 1X7WA 2YV4A 2IK8A 1VE1A 2FZKA 1SVUA 4Y7CA 3MG9A 2VZ9A 4PLZA 3GRYA 2WF8A 3TSZA 3FWKA 1WD5A 2UYOA 3PKJA 3DXFA 3VAAA 1D2AA 3WSTA 1FZQA 1U2EA 3TGPA 1DOHA 1D6JA 3GCWA 2WQZA 3C6MA 5CJJA 2H06A 2Z09A 4DQLA 4NBNA 1GTVA 1F60A 3PE6A 8ADHA 3I9V1 1NASA 3OWOA 2WJWA 1JPJA 1Z6QA 2ZBPA 2DUNA 5THQA 3VDMA 3E9NA 3F6BX 2G07A 3OOYA 3V4FA 1ZA1A 2RH9B 1RZRA 3R9XA 4YQZA 1DIAA 2RK6A 3F97A 3KBOA 3KR0A 4B4DA 1ND5A 3K96A 3GAMA 3EXHC 4WCFA 3DR3A 4XD2A 3OZIA 4Q3DA 1IB0A 1PG5A 5ILGA 2IPMA 3TZQA 3K5IA 1AT1A 1SK9A 3GXBA 3H86A 2HGZA 3D0KA 3QW2A 4Q4JA 2H2HA 2DHRA 5EE0A 4E15A 5BVHB 1WABA 4BO9A 2ZU0C 1EJ6A 4D7AA 2AUTA 3EYWA 1Q20A 2OOSA 2WYHA 4M53A 3DUFA 1PGPA 1E9VA 2D3WA 4ISBA 4TMZA 5K3OA 1RXUA 4KRGA 4XR4A 2EQAA 3WS7A 2Z8XA 4M8SA 3KSUA 4DBVO 1EP1B 1MJGA 3ZVNA 4WNAB 3DE7X 2JEOA 3MVEA 4Q1FA 1MX1A 3IEVA 2OM6A 4M46A 2P91A 5A1JA 1PYOA 1UPAA 4RNDB 5E7JA 1CY8A 3RAJA 3F8WA 1JN0A 1SCKA 5TPWB 3FAKA 5EZYB 3VHRA 1Y7LA 1ZJ4A 3QMMA 3MB8A 1M8GA 3PENA 4FHCA 1P4AA 4TQGA 3WTCA 3TQQA 3N7TA 3H9CA 4IXWA 4BDSA 1N9ZA 5JRZA 2HRRA 2YS6A 2ECQA 5ALPA 3DM9B 2V3CC 1RU3A 2NVUB 4FMCB 5CJ2A 5HILA 4OGFA 2BGJA 4D8YA 2MSEB 1W9MA 1G38A 1E79D 3KNZA 4JEMA 2JFPA 1J2RA 1R6BX 2WTEA 4BASA 2ZM6B 4GKBA 1IK6A 1CY1A 3A1TA 4KXLA 2FWPA 1VBMA 1YDGA 2QW8A 2QTCA 2WAAA 4EHNA 5C32A 4X41A 1YS7A 1ZXBA 4MQ6A 5F3DA 1ZK1A 3TJRA 3ZHUA 2FUG1 2IIQA 5FUWA 1GPH1 1B16A 4G9GA 4YAKA 1S2IA 3G0BA 4ZIRB 1USUA 2Q6OA 3KC2A 1TM5E 2HBZA 2JK1A 1XTVA 2CNKA 2VUIB 2WKPA 2ZBUA 1N6KA 1XL0A 3L41A 4JB2A 2RJ3A 3ORSA 5B58C 1PNTA 1U7OA 1QWSA 2PU5A 3KTAB 4GKVA 1J0BA 3H97A 2PGXA 4R8MA 3HYSA 3MCUA 3QBDA 1SU7A 1X7WB 1U90A 4MUHA 4NV3A 3H2IA 3LUPA 5F2EA 2VTVA 4RK0A 1MXHA 2QL6A 4PZ9A 4Q18A 3R9KA 4DMKA 2CVQA 3K72B 3BXXA 1B8OA 2C4NA 3FCOA 1V9CA 1ZEJA 4EWLA 4CT4B 3OX2A 4E03A 4RZ3A 5LA6F 5DYWA 2PX5A 3OO1A 3C7TA 3QJYA 4A0GA 3LOQA 1XOIA 3MTQA 4NU6A 1CERA 4Q7MB 5LP6F 1BU8A 4L9SA 4R2MA 1QIMA 1FY2A 2YVQA 4YV2A 3ZLJA 1G8JA 5LBTA 1EHIA 1EA5A 3DUWA 2O5RA 2IZOA 3L6RA 3MD0A 4GXNA 4IRMA 4BGUA 3R9XB 2CWWA 4K1XA 4W63A 1T8TA 3K35A 4XFDA 4EECA 5ED4A 1C50A 3A11A 2EJUA 4JI1B 4YIKA 4PWYA 4NHOA 2JKZA 2WZQA 4C0LA 2R4UA 4IOMA 1L5GB 2FR0A 3BVPA 2C2KA 1MB2A 3F7NA 2PX3A 4Q4JB 2ZYGA 3CR3C 2P9EA 3FYUC 3E7DA 4X60A 2P0AA 2X13A 5TDHA 4J4BA 2EL9A 4P5EA 1N25A 1NZFA 2CHQA 4GP6A 1T0IA 4Z53A 4QGGA 4W5JA 5HRUA 1QFSA 2R6R1 2C3OA 2NGRA 1A97A 1JVSA 3CW8X 4ZCLA 3VH1A 3ZWWA 1JFFA 3GEHA 1RCTE 2IUTA 4MWCA 4UTNA 1TYAE 1P8AA 3R2JA 3SX4A 1MO5A 1D9ZA 5CX4A 4JGBA 1XMSA 1KORA 3ACBA 3DV9A 3UXEA 3GO4A 4FLFA 4JJ8A 5DWQA 1M2WA 1HZZC 4CG1A 1R12A 3DQQA 3TUZC 3G0CA 4I4TB 1C7JA 1HT3A 1SWVA 3UO8B 2R8PA 2C7PA 3IT2A 2EKPA 3GEDA 3LIPA 3K9LA 2VP6A 1PZHA 4ARCA 2X2PA 3ELBA 2E5LB 3DF9A 3IPLA 4IFIA 3T3NA 4AU1A 5AJUA 5FUBA 3DOUA 4M7RA 1DI0A 1QIDA 1F8UA 1XDBA 4KQJA 1Y1SA 1R1DA 5J4VA 4GUAA 2WJ3A 3OT5A 4LK3A 2MINA 3OOEA 3U48A 4WA7A 2BLLA 1IWPB 2I33A 3I52A 3T0GA 1G9SA 1E2HA 2AF3C 3OURA 3SXUA 5JFOA 2WIDA 4KQ2A 4MCHA 1PL0A 2GZAA 2VXCA 4L15A 1FTYA 4GVPA 3HV0A 5JI3E 4I19A 1SPXA 2DU8A 4YAEA 4MW0A 2FEWB 3Q9NA 5EJ4A 4HVAA 3A14A 1OFUA 3QE9Y 1SKYB 4HUQA 4QEKA 2AG5A 1RHQA 5CBPA 1W0JA 3UT6A 1PJCA 2OAEA 4OI2A 2CLEB 1DCFA 3WQRA 3FGOA 1CX9B 3NBUA 1FTQA 2ZBRA 3PD7A 2DHCA 4LJLA 3SC2A 3JASA 4HB0A 1U9IA 4D02A 3E7FA 5GADl 4YK7A 2H4XA 1ZLXA 5JRJA 2VATA 2WWVD 2WJAA 3NANA 1DO2A 4MUIA 1MGOA 3GFBA 3ANYB 3H05A 4QUKA 1SB9A 3DZIA 1BN7A 1E20A 2DC1A 1QLHA 2HLDA 2JFUA 5L9AA 1WSBA 2ZP1A 2CNOA 4OFXA 1P1RA 4AUMA 1MAAA 1XUOA 4J0QA 3RVDA 3RYIA 2P5SA 3I4FA 3NWPA 4OCZA 1GRCA 1Y4ZA 3WHPA 4G0XA 3EDQA 3GAZA 5FEUA 1T1EA 2VEOA 3HCAA 3OEHA 4UZEA 2XDQA 2I71A 5EG5A 4ZANA 1Z5VA 1UCFA 5G41A 5H3CA 3TDNA 2P27A 1Y5NA 5CT5A 2I4MA 5EINA 4JQSA 4YB8A 4WAUA 5DTEA 4QUBA 1NUTA 2AQHA 1DL5A 3QKUA 4P3OA 3TKYA 3C8ZA 4QQRA 4UAGA 2WJYA 4BC1A 2ZS7A 3HVUA 2CNBA 2GHRA 3LVBA 4UNPA 2JGNA 2BR4A 3FXAA 1P5RA 1JLLB 1V4NA 1TZBA 4G1CA 3R7SA 1JJAA 2BDUA 1ZMTA 2BAGA 2JK0A 1XMIA 2VBFA 2XOXA 1ZL0A 3W2HA 2XRFA 4JLKA 2K2QB 4PS0A 4XI9A 2BFPA 3ZK8A 3R6LA 1YH3A 1K2WA 4ZU6X 2AC7A 3LBNA 5JDCA 3HJRA 1HE1C 2ATXA 2ZQ5A 1FB5A 1PGQA 3H8VA 1JFFB 1PL6A 4K46A 5TVGA 5KWJA 3U4IA 3DJYA 2GBIA 4JHXA 3EEOA 4EDFA 4EYSA 2C77A 1YQDA 4CYMA 3KFVA 2IE0A 5K2OA 2F55A 1G7CA 3HLYA 3GJ8A 3AEZA 4MIEA 1GTL1 1RYZA 1YTLA 4MI1A 3SNHA 2X8AA 1NMZA 1JXOA 3RGWS 1G98A 2FZWA 1ORDA 3QUCA 3NGMA 3RTAA 1LF0A 1ZCBA 2FN8A 4KQGA 5SY4A 3TRHA 3GLUA 3B8EA 1G7RA 3HABA 2C96A 1I1HA 3UUWA 2XCLA 1EINA 1NBMD 4H3VA 5A02A 5DHQA 4V0SA 5TPZA 1Z6PA 1UC8A 2HO5A 2OCKA 4K9QA 4ZAFA 4W7HA 4DYDA 2A7QA 2MINB 1Z6XA 4G4GA 4H7KA 3PJRA 3ESRA 3SXUB 4E09A 1N1EA 2X5JO 2YV5A 2QZZA 1KZYC 5D87A 3OT1A 3ZGYA 4AO8A 3I92A 1K5DA 5BN1A 5FKJA 4ZCTA 2O2HA 4BY9E 2V7VA 4R01A 3IQXA 4JBXA 3L1JA 4HUQB 3TRKA 2QVZX 1O4VA 4R3WA 5CBPB 2QGZA 5DN6A 1Z83A 3IALA 5IXYA 1TYEB 3PTZA 5B2FA 1KYZA 2A3NA 2DQ4A 4WESB 4EPRA 5EWLB 3VNQA 3H9JA 5J2TF 3TKAA 5HP4A 3PIIA 3GK3A 4CM6A 1RYDA 3SC2B 2ACWA 3JASB 3JQDA 5D6NA 4DA0A 7MDHA 5LSAA 4L9RA 5IH3A 3DE3X 4MR7A 4HP8A 4M54A 4AZ3B 1UT5A 3IL2A 2EZTA 3GEIA 4PG7A 5IJXA 4DCGA 1THTA 3PXDA 4HYQA 2ZI4A 3A10A 4I50F 1IE3A 4KXXA 3RYIB 4BX8A 4P32A 2VIIA 4ZQEA 1HI9A 2O8NA 2QVXX 4EYOA 3DLCA 5IMBA 2ZIVB 1I6MA 5FEMA 4F7DA 5ICEA 4YGXB 1YB6A 2XDQB 3L46A 1I2BA 3DE1X 3WBKA 1AU9A 1UBSB 2BEKA 5A4DA 2X3FA 2XB8A 3VPFA 1BRMA 4CUKA 4HNAB 4MIYA 3S8EA 3ADCA 1OILA 2YVKA 2ASVA 2BGKA 1PK7A 2UZ1A 2Y1LA 3GH3A 2CYCA 3V9AA 1OFHA 2QIOA 3REGA 2CNLA 1LD3A 1WPGA 2XQIA 2EHJA 3FJ1A 2W6PA 3N87A 3QPVA 4GX0A 5AIBA 2MDTA 2LDBA 1EE9A 2CUKA 1TA9A 2DUMA 1HOTA 3ISJA 5CEFA 5AVYA 1N5LA 1QZUA 3AFMA 4TKUA 3UWDA 2FH5B 3U80A 2BISA 4DDVA 1SBYA 3GJ7A 2HSEA 3M1IA 4DR1B 1WUTA 4DARA 3BXGA 1X1EA 2XR1A 1ZFNA 1EFKA 1B15A 1TU3A 3SK0A 3E48A 1XHLA 4IQ0A 3QNWA 1WBJB 4TLEA 1OXBB 4RVCA 3JVDA 5LR6A 1M2JA 1U2RA 2CXSA 4DLAA 3NAGA 821PA 4BU1A 1CF4A 1X94A 4KXVA 4JVLA 4QUIA 3TTUA 2AZ4A 3LQFA 1SZCA 2EW8A 4GXQA 5E7MA 1QFZA 3DOIA 1IPFA 4J0FA 1SXQA 4JLPA 3NHUA 4FUQA 1I6WA 1Z6ZA 3N05A 5JALA 2XADA 5KTKA 2OZPA 1NVMB 1PD1A 3EVTA 1JDSA 3FFBA 4QO7A 4I14A 3L7NA 2PCJA 4KXMA 4QFCA 2ISCA 3EZLA 4EG7A 3RU7A 2DUUA 4MQLA 3HDJA 3L8DA 2JG3A 5CUQA 4RD2A 3B9PA 1XEWX 1M75A 1YQXA 5TJHA 2JGJA 2VFAA 3K0BA 3PEFA 4H6WA 3AF4A 1U1CA 4UHFA 1YR2A 4N47A 4ZO4A 1XPOA 2QTBA 1JB1A 2C2BA 2HWUA 4LTDA 5C4MA 1EXWA 5G1NA 3IRUA 3KZXA 3OD5A 4FZ3A 4RF4A 4L4SA 5AKGA 4CIBA 1KYYA 3IH5A 5F2KA 3U81A 5AKHA 1DMSA 1FE8A 1KMCA 1Z4KA 4XIJA 4F2PA 1FNNA 2CHVA 1PNQA 3L07A 4QXAA 2WWXA 4M7OA 1MJ5A 4F6RA 4LQCA 1Z74A 4W82A 2JF0A 1BU5A 2ZVPX 3UAOA 4KXFB 4EHLA 1GILA 2NAFA 2CVOA 2G9VA 4P4GA 4YPOA 2VQFB 4MCAA 5KNDD 5LYJB 2K7ZA 3W3AH 1ZH6A 2C9OA 3FNFA 2HRBA 2RHTA 3IMGA 3UJ7A 2AN5A 4EHDA 3PJGA 3W34A 2F67A 1KI3A 2XOKA 4Y8VA 1VSBA 3CLKA 1RM3A 5BWBA 2G1UA 5AM5A 4F3NA 4L76A 5FA8A 2DWUA 3T7DA 2XXAA 1E61A 1Q7EA 1ACLA 2PEYA 1X14A 2UZ1B 3DAFA 3FZEA 5A9SA 3OF3A 4NC9A 3NHBA 1EX9A 3PIRA 3GT7A 4MEAA 1IXKA 1U5AA 5D6OA 1V4VA 3HCFA 3EGIA 2FSSA 4WH0A 3ODGA 4D80A 3R41A 5KNBH 1K6MA 3DE2X 4X97A 4TKUB 3S2FA 3E3LA 4G4JA 3S2EA 4EQ6B 4BEWA 2A86A 1BEEA 4I4IA 4WXEA 2WQ6A 1Y1RA 3E9RA 4GAEA 4RMNA 1TEXA 4Q7QA 4C7KA 5L51A 2ZLBA 2XRZA 4AJJA 1DQZA 2QQ5A 3KJXA 4FMDF 2PX8A 1JB9A 1MB9A 3ZWCA 1EJ0A 4BP9A 2GPTA 3AOGA 1XK6A 3IJ5A 3RUCA 5BMVA 3S8YA 3ILSA 4URVR 3SZ3A 1GVNB 2IVFA 1Y1TA 1A9ZA 3RT9A 4CIAA 2H52A 3OQNA 1IY8A 1SC1A 3K53A 3L0BA 3FSJX 1V6CA 2C97A 2H1OA 4DYVA 2AWOA 4OAQA 1QDEA 4A0SA 3WOVA 3C48A 4RK4A 2GXUA 3K0FA 4RH0A 4JT2A 1WZNA 4D82A 2WLTA 1JSLA 2B34A 2AC4A 2P9FA 2COEA 1OE0A 4E5YA 3RTBA 1IC6A 4K2AA 1RW4A 4EF5A 4FNGA 2C84A 1TLLA 2K87A 4EFKA 1BS1A 3SVZA 3OQHA 1XZDA 5AW3A 2NZ2A 3N0XA 3S99A 3W5SA 3B7GA 5E1DA 1RRMA 2HX1A 4S04A 4AIRA 3CPEA 3GOHA 4QNNA 3D3WA 3O1JC 3OZWA 2YR0A 1ZCJA 3REQB 5DISB 3M6AA 3KZNA 3VVCA 4UQLA 1LY1A 1XRMA 4IFTA 3M2PA 4EYKA 4BKOA 4KBGA 5HDQA 5HIIA 3T1TA 2EGHA 2E1RA 2X9QA 4D46A 2HNAA 1KJYA 1VLQA 2YJ3A 1DX6A 2ET6A 3H2GA 3UGQA 4LCJA 1OGYA 5BPHA 4F4CA 3T9BA 1ZQ1A 4F6RB 1LS1A 3OIYA 1KMIY 1LLDA 2JKYA 2IHNA 3KR1A 2A6PA 2C42A 5G4LA 1CVLA 2GXSA 4A8HA 4BAGA 1BHSA 2Z1MA 3KJFA 5AK0A 5BV2P 4WJKB 2XZTA 4WLUA 4JYAB 3D4OA 3IAM6 3ZD9A 3AWDA 1RI3A 3SGLA 1V8OA 2AQKA 1X1CA 2VDNB 2XMZA 5KYTA 2ZSJA 1NBEA 5JFGA 2FSPA 5EWMB 3GRCA 3ZCXA 1A2OA 3MB5A 2IUYA 3AKZA 3COPA 3PUIA 4FW8A 3ZZNA 2CLKB 2Q6KA 3EC7A 5C7YA 3VV2A 1IWBB 7AT1A 5A9SB 3TZHA 3VHXB 1TOAA 1CQJB 3V8BA 4HVCA 3RRYA 1I2AA 4BMNA 2M32A 1F3OA 1FTWA 2YCLA 3ELDA 4MQEB 4UULA 1P9OA 4EPTA 1U4NA 3ZH9B 3D6MA 1GYQA 3Q3IA 5TLSA 1U2GC 4F9EA 5EIBD 1E3LA 2RBKA 2W43A 3INRA 2QV0A 3LL4A 4MVJE 4YCNA 3GDGA 3AJ8A 3EIHA 2C0PA 3R3XA 2H7YA 2QRUA 4OOFA 4EX6A 3T4UA 1HDIA 1O96A 2H8GA 2VWPA 2NZJA 2J31A 4HLCA 2O8CA 3R7NA 2V4MA 2FR1A 2GCPA 2JL1A 3AH8A 4G0UA 2WKQA 2VQ3A 1LVGA 5BMVB 1G5TA 3WLRA 1ZVVA 3QVSA 4UBNA 2DFTA 1SELA 1E58A 2O1WA 3COYA 3WP0A 2V3VA 3EXIB 4MB6A 2IPOA 2QRVB 2R8BA 4L1KA 4LGMA 5C9ZA 1ULBA 5I4IA 4FGUA 3UMYA 2GASA 1CWUA 4UHDA 2PXHA 1QO0D 2NUTB 2JJ1D 1C0LA 1V1MA 2F3UA 4QXOA 4HTAA 4QU5A 1LDGA 5LQAA 1R6TA 3SHTA 2G6BA 2YW9A 1PVDA 2H1VA 4KIFA 4CMHA 3JALA 2JIZA 1QK3A 2Q1UA 4EI8A 2RHRA 2BY4A 2BWJA 3IQWA 1ORWA 1RHMA 1FNMA 4LFAB 1L4BA 1IXYA 1EGHA 1XTSA 1P80A 1OAKA 3UJHA 1FRFS 4RK5A 3CUTA 4D9HA 2I3BA 3FGNA 5KUTA 2I7VA 2QTZA 3PJDA 1C9MA 2BUAA 1IPEA 4I9GA 3VISA 2Q50A 3N5CA 5EFOA 2H1RA 3V1KA 3OETA 3D3WB 4NZNA 4EW2A 3WK4A 5COQA 1Q22A 5A03A 4JVMA 4IKPA 4M7WA 4O63O 1JEJA 1NN1A 1QE0A 2PSJA 3QKIA 4K3VA 4U00A 4ZCSA 3C14C 2BM9A 3TPCA 4ZCIA 4IXNA 1HTBA 1FP6A 2P2NA 2GXAA 2O3RA 1QPBA 4IX9A 1T9DA 3O8OB 5DI9A 4KV9A 4X3PA 2GN0A 2VF8A 5EMHA 2NTNA 4QPPA 5FLXA 1PR2A 1OVGA 3RIMA 1IZ7A 5FA6A 5IYZF 4DUGD 4HGRA 5IVIA 3DWGA 3GCZA 2IJGX 3KQYA 4CTJA 5JADA 4AMBA 5CG2A 4J4HA 2E4WA 3WQBA 3IIMA 3M4NA 1XEWY 3LRPA 4CF3A 1UQRA 4C88A 2P8JA 4ZRMA 1M74A 2JW5A 4PRYA 4FEEA 4F8EA 1VG9B 3HP7A 1T91A 4MWGA 5FWXA 1J25A 2CDAA 1NXVA 3ZU6A 1XDZA 2HK8A 3CRQA 3NXSA 3O8DA 4UVHA 5ESRA 3IERA 3UH0A 4Q3NA 4GPZA 2IZ1A 2IZ0A 4US0R 3UUGA 4M8IA 4YFYA 4R3NA 4B44A 5DM0A 4IPTA 1EX7A 3PD1A 4CFSA 4CMEC 4CW7A 4PCVA 3KSBC 3W8NA 4QOEA 1ZH2A 1CUFA 1N1GA 2EKBA 4EYQA 5KPDA 4OHUA 1COWD 1VJRA 2RGEA 4U5XA 2AL7A 2BEJA 3B6IA 4HEA6 4AJKA 5IK2D 2WYIA 2ZBVA 3EVNA 1WSWA 1IEQA 3C5WP 4GYYA 5DHAA 4ZVMA 3K9WA 4G5FA 4Z0NA 1EDZA 4NOJA 1M2OA 4Q3KA 1B00A 4BECA 5B7QA 1CCWA 2OA0A 1DC7A 1T4MA 1XVUA 2X9NA 4UVIA 1O96B 1WEKA 3I0MA 2BF4A 1SAYA 1XZPA 2IYFA 4IRXA 4KGXA 2O8CB 1E6UA 2FZ5A 4G4SO 2GCGA 1PWZA 2CL7X 3ANSA 5FH9A 4NDNE 4UCWA 2IOHA 3B36A 2X15A 2QMHA 2LRHA 2NZVG 4TMXA 4BP8A 4YJ2F 1ZU5A 4C3ZA 1E0AA 1U7UA 2YRFA 1S2GA 4NABA 4JGIA 3V4OA 2RG1A 1YJQA 3W9UA 3DFIA 1GXSA 2BJWA 3WB2A 2YYAA 3DB2A 2YZMA 4RUKA 4BNLA 1EB9A 1TD1A 2DQKA 3DXXA 1P2BA 1YB5A 2O4CA 3GGOA 5DXFA 5B3KA 2QZ4A 1XIVA 2OAQ1 2IEDA 3JALB 1QHNA 4KRXA 1N4AA 3ROXA 2P2DA 5CA0F 3I5AA 5L3VA 3P4YA 1Y5LA 4P0PB 4MV4A 2J09A 4IVPA 5ALJA 4UPVA 4Z1OA 3KQKA 4L75A 5BW5A 3V8VA 4KMSA 3J81A 1H2EA 3USZA 3OM1A 1Z4IA 3TM5A 4RPCA 4CKWB 1KTIA 1BSVA 3SIXA 3W1WA 4J0KA 4K8OA 3UOGA 3VJKA 5JMWA 5SYAA 3KSZO 1II9A 2LDXA 2EFEB 3G13A 3MT8A 1X8LA 2C1EA 3OWXA 5LOVF 2ZE5A 5CYFA 3V1MA 4UOZA 3THOA 1Z4PX 1G64A 3KIPA 3I04A 1E89A 4IOJA 3DZJA 4BZXA 4OBEA 5JPIA 4QDOA 3T41A 4L16A 1YR6A 1O94C 2IEZA 1N8TA 1WDTA 2PR7A 1ZRSA 1FP1D 1GQFA 5E9QA 3WGVA 4E2XA 2BP7A 3AC0A 4I1YA 3D0QA 3R7FA 3RVBA 2LR0A 3LCRA 5IUNC 5T6MA 4NVRA 4XWYA 4EY7A 3MSXA 5IASA 5JAOA 4HDCA 5BQPA 3VSDA 1Y3DE 4LX0A 2X5KO 3IDSA 2VCHA 5JXHA 2ONJA 2CD7A 1ZM2A 2PFGA 4DLWA 3OX1A 2CLLB 3LTEA 1RQNA 1JFRA 3FPAA 2UYQA 3OJ0A 5E2BA 4GGOA 1GPBA 4Z49A 5AVXA 2VBIA 5HW0A 2NM0A 3AVVA 2FR8C 1ENYA 2GYUA 3SF0A 4EKDA 1QS0B 1JTVA 3AP3A 5A3RA 3P9RA 3TTXA 2VHCA 4N9QA 5BXYA 3O9ZA 3W05A 1CZUA 1B8NA 1F17A 2NUBA 1B26A 3CSDA 5DX1A 1EM8A 1D9XA 4KO3S 3RTGA 4EUKA 2MSLA 3F2IA 3MJDA 3ZI7A 4WKPA 1NG1A 2I6QA 3CF6R 3MLEA 1XZCA 2IELA 2N47A 3RV4A 3SN6A 2B8JA 3CPJB 2IHJA 1E9AA 4ZHSA 2Q07A 2JIBA 4K87A 4HX2A 3ZIDA 1UBHS 2FTKE 2VHQA 4M8KA 2PKXA 3NHYA 1RJWA 4D45A 2AYYA 2OZVA 4ETIA 2WG1A 4B75A 2A0FA 2DTDA 3QYFA 5T6BA 5FA5A 2PUBA 1GAXA 3A9UA 4URHA 4X6YA 3MXTA 2KMLA 2WJ6A 1FSPA 4ENRA 3ESXA 4BCBA 1FFSA 4J1TC 1J33A 2QP9X 4DJAA 3IJRA 1AO3A 2XNDA 3KZMA 1UJBA 1YS6A 2BELA 5HQTA 1R5NA 3PDIA 4KQXA 3BDAA 4KX3A 4PVDA 4QA9A 3DLBA 4C5BA 2Z1NA 1JYFA 5GMOA 1EH5A 4HGYA 1GXSB 2A33A 3FCCA 4YDHB 1BHO1 5CVVA 3OTGA 4OXRA 1CQZA 2ZUUA 1J9EA 1ESEA 4ENVA 3THXB 1J1ZA 4H0NA 4Y18A 3VTZA 2GBLA 1CJCA 4JEHA 5F64A 4PCAA 4EMUA 1OXUA 4N5HX 4E1VA 1IEWA 2FRDA 1OWMA 3EGCA 5HS4A 2XTNA 2OT3B 1W0KA 4KC0A 3BJIC 1MVLA 1GCIA 1JP7A 1XKTA 2QTLA 5FI5A 1RXEA 1DRWA 2EJCA 4YJ3F 4CTMA 1MABA 5BN5A 4US2R 5GPBA 5J4YA 2H2FA 1KDOA 1P6QA 1SIWA 4KH1A 1C2TA 1F06A 4QDTA 1D2CA 4UZFA 5EEGA 2HMWA 2X4LA 3EA5A 3ME5A 4F9GA 5L6MB 4A0HA 3KV3O 3A70A 1GZ7A 1NNLA 2VJYA 4MJ7A 4OA8A 4OYYA 4QD3A 2NTEA 1VIMA 2R8YA 2H7CA 1WUHS 1X77A 3G9QA 4MRPA 5JI2E 1AV6A 4BIMA 4KQIA 4ZGBA 2DH5A 2JIOA 4F5DA 1AA6A 2LCFA 4KYVA 4A16A 4R5MA 3FPSA 3I8OA 1VL1A 4X54A 2BC9A 4V1CA 2UYHA 3TDKA 1WB9A 2DR3A 3F5SA 4U63A 5KU7A 4JBYA 2BP7B 1QJCA 2ZJ3A 1N2JA 1CDDA 4RKFA 1SB8A 3N70A 1ZW1A 1YZTA 2XMDA 4W5OA 4OIFA 1FLVA 2QPOA 4XB2A 2LXNA 1ZRHA 3Q6MA 1E3MA 1SVSA 3AKEA 1XRJA 3VKUA 1T4DA 2WWRA 4Q3AA 1Q57A 2G77B 2QDKA 3ROTA 2ID8A 2ZQYA 3ZHZA 1PX2A 2D7JA 3GJZA 3K1JA 1FS5A 1W87A 1YE8A 4F93B 2A30A 3WB9A 4CG3A 2FG6C 5HRCA 3X3HA 1ISGA 5KJ1A 1HPLA 2XNHA 3DEKA 5K3SA 3DBHA 4C0WA 4WK0B 2UYGA 1MU0A 1QIEA 2CEAA 4MTLA 5JE8A 3W2TA 1ATIA 2OHVA 1EM8B 621PA 4PXYA 4EW1A 2I4TA 2X1LA 1B2LA 1G60A 3L8HA 3PNMA 4R8LA 2H4HA 4HG2A 4CKCB 2ECKA 1JSXA 3CRW1 1XPRA 3L9XA 2PZAA 4NBKA 1ETUA 4OXXA 4Q6WA 4ZVLA 1UFOA 3KZ1E 1QKKA 3EXFA 4AY4A 3EXAA 4U3JA 1C8KA 4G9BA 4KGZA 3OEWA 2PUWA 4WIAA 1MW8X 4CV3A 1CUXA 1CHNA 3OZVA 4RMJA 3AEQB 3PXXA 1AB6A 3C43A 3W90A 4A92A 2W7TA 4C0JA 5B64A 1XE3A 1Z4LA 2XVMA 3GFTA 4YDQA 3SZOA 3CO0S 1DCMA 2PX4A 3Q15C 3T54A 1E7YA 5KYNA 4M60A 2PRZA 2QX7A 3CS3A 4CVNA 3BJEA 5DYNA 5EXEA 4EKYA 2YJ6A 1ZOPA 1V5IA 1DQNA 1M34E 1N6LA 1YWGO 2A3RA 2JJMA 2QRMA 3E22B 3EZFA 1UOOA 2RHLA 2HPHA 3E8XA 4S24A 1Z5UA 2OCYC 3IQIX 1OGIA 1GFWA 1WOYA 2QLTA 4Q4AB 5K0ZA 4IJVA 3E84A 1T1IA 4O25A 1EQ2A 2P75A 4BB5A 3BWVA 1PJ2A 1NBHA 1P7VA 1LDYA 4ZJUA 3ABZA 2RHGB 1UH5A 5FLKA 4EG8A 4Y2GA 2R8XA 5BN5B 1MABB 1P2GA 4R1MA 5LYJF 2BFFA 2DH6A 1BRTA 5JSUA 3NBZC 3NKLA 4TTVA 1YZGA 1R8XA 1M54A 3TYXA 4A15A 3LLMA 2YWGA 4CN8A 3OZDA 4KHPB 4LC1A 1IOZA 1TYDE 1XZ8A 5JH7F 4ER5A 4RADA 4RKEA 5DBHX 2GJ8A 5AKJA 1NI4A 1Z6TA 4GYJA 2JDIA 3WO0A 5ELXA 5T5QA 2W2PA 3AKCA 3C15C 2UXBB 3VR5A 1GOTA 1THZA 2HA5A 4X20A 3EG9A 1FLNA 4IR7A 5A62A 4ITUA 1YULA 4MV9A 4G86A 2E4ZA 5H1YA 1E5LA 1RE0A 2OHHA 1SC9A 4BVAA 5K3CA 3WI7A 2EBUA 3ENVA 4DIDA 5CD9A 2CZQA 1PT6A 3IESA 3OFND 4FYPA 4FYKA 1R15A 3PQ2A 4HQ6A 1L4KA 1KQGA 3G0GA 1HT0A 1TM3E 3BD7A 3LXXA 1LLCA 5BOSA 5BV8A 5ELMA 5HM6A 4JV5B 4MAMA 3HBFA 4DDTA 3M6WA 2BMEA 4UBLA 1TF5A 1QIKA 3PWKA 3DBHB 3W2IA 4DV2B 1BVYF 1C1XA 4FHGA 3WAJA 4RDHA 5KKCA 1QV6A 4YRKA 1EU1A 4YHBA 3LC7O 4I1PA 1H2XA 3PWSA 1VJTA 3PFCA 2QM8A 2NSLA 1MUUA 2FDXA 4I1IA 1CJKC 1F6DA 1XP8A 3MA0A 2GDJA 1OI7A 1FFCA 1DINA 4QC2A 5K05A 2V4UA 1H65A 3AGQA 2I7XA 3AXSA 1D2EA 2FVXA 2FZCA 3EIXA 3GA0A 3JX9A 1JIIA 4BAUA 4IXMA 1MOSA 2HC9A 3OFVA 4HEHA 5DK6A 1U5BA 3BHMA 4EDHA 2ZYHA 3EXFB 3HO6A 4TL7A 5C8VA 5DHTA 4RQTA 1PL7A 2Z04A 1ZN9A 3I01M 1DIRA 4HLQB 3A9WA 1RM0A 3VAZA 3JR7A 3COJA 1PS8A 4CHTA 4DANA 1FFXA 1GJRA 3L0SA 1RRFA 1GLVA 5L53A 4R71A 3OIWA 1L5HA 1JWAB 1TKRA 1ZUHA 3I5MA 3QE3A 4JKIA 5LKRA 4NQRA 4GLFA 4PW0A 4O4HA 2WNIA 1P7WA 3A1FA 4URXR 4EGSA 1R27A 1N77A 4KWIA 4FOTA 3NMUF 5JZOA 4FDAA 4GMGA 4TS3A 5IT5A 1OPXA 3A27A 3VU1A 1UBJS 4JP2A 4WLOA 5CB0A 3WK8A 3JQ7A 4DEVA 1P75A 1AHPA 1VZ3A 4OLBA 2RJOA 4LVNA 4J7CA 1GDHA 3L6UA 3IAXA 4LGVA 5AW8A 3U39A 3MRTA 3BH7A 1D6MA 4QG7A 1NM5C 1T6XA 1KKUA 3BIXA 2ZB3A 4GGPA 3BCRA 3RSSA 1NVWQ 1PJ8A 2JZCA 3FAZA 1NIPA 2BFFB 2WG2A 3IB3A 3OZAA 5ILQA 1KWGA 1BKSB 2R1ZA 4Q02A 3TNLA 3UM9A 4MV7A 4BMZA 2RDMA 2V7TA 1V3UA 3JQ9C 3VPAA 3O3MB 4Y2VA 2F00A 4UXJA 4BLVA 2XECA 2X0RA 4TZKA 1RACA 4CM9D 5L3SB 4YLYA 3ESZA 5FBQB 1M10A 5GWXA 3RF6A 1VIYA 3TQFA 4EFMA 1XGKA 4IZOA 4CG2A 1RFGE 5LWHA 4II2A 5DHPA 4C6RA 1KO1A 4ERXA 3FPCA 2QM0A 1WLSA 1B6SA 5I8ZA 2BMJA 1BCSA 4R3UC 1SCIA 4WOJA 5LP6C 1UKEA 3QA9A 5IWAB 4IF4A 2YWJA 3WLSA 3ADDA 1WZUA 1XTUA 5LCXA 4EVIA 2PUDA 3HXPA 4UZSA 3QEAZ 5BSTA 2PS9A 3GWGA 4UVEA 2B7BA 1YCHA 1Y7HA 4RPLA 1F5NA 5E6RA 2UZ0A 2RBGA 1Z16A 2XITA 1MAHA 3WMEA 4DAOA 3FVRA 3OFKA 4YJGA 2FMHA 1KI7A 2PMDA 1QO9A 5J5VA 1YFZA 5G0WA 1NR7A 1C1XB 3UBMA 3WDKA 5LMCA 2H9IA 5C5IA 3LECA 1T3GA 3FCUB 2VDRB 4DLVA 2GPYA 4BV2A 2J6IA 4HL6A 2INGX 3IOCA 3ADBA 3MUFA 2JLXA 1NXSA 2ZBQA 3QI7A 2RKWA 1ESDA 3ILYA 5DLEA 3AKYA 2CUNA 4OB7A 3UB3A 4DTCA 2OHGA 2A5YB 3M8KA 2DTXA 5D3ZA 3CE6A 1BE6A 4AG5A 2FZEA 4ZDIA 1JE1A 3JQAD 4MRNA 2FN3A 3G0IA 1UPFA 1Z7WA 4NESA 2E37A 5JBNA 1TGVA 2JJ2D 4ZVRA 3F4BA 5J2UA 1RXIA 4HH1A 4NMWA 1M2KA 3QY9A 1QVAA 1ZNYA 2YY6A 3JD0A 4IIJA 4U6SA 4WFIA 4TZ6A 2HV8A 4HZUA 3I6QA 4LSWA 1I10A 1IY1A 1FFXB 3BJRA 4HDSA 3UHOA 4A1FA 4ATNA 3HXQA 1I1QB 3THYA 4JU9A 1OWOA 1P81A 1LQTA 1T8WA 3WGYA 1GPUA 1PTJC 2FFJA 2H57A 3EQ2A 4O2BA 4PGAA 1EA7A 5AXBA 4O4HB 3RLIA 4HGPA 3B3GA 2R00A 3BD6A 4PGGA 5K3DA 1CZOA 3QY0A 1HDEA 2ZTSA 2D8AA 5K8TA 1A96A 2XGGA 1H9AA 4DKXA 3O1HB 1OHHA 4PR3A 1Z18A 2VT2A 3EUEA 3KZCA 1R0SA 4DC0A 2XKAA 4NEGA 5H83A 4EW3A 5HRAA 1OT5A 1RABA 1PR3A 3OLWA 1P7ZA 3EAQA 4Y2JA 3TZLA 4DEXA 5CLFA 1NRXA 5GJCA 3ZN2A 1WHTA 3KQOA 3GEMA 1JAIA 2J5RA 1TM4E 1VSUA 1MAVA 3VSAA 5A2GA 4FKBA 1Z0DA 1DNPA 1NSTA 2BFBA 4IIGA 1J2JA 4N7RA 2CZCA 2V9CA 1UKVY 1MV8A 2VPPA 7GPBA 2DWOA 4HDMB 1DHTA 2VJMB 2Q3HA 4MQUA 3J81k 1ATZA 2ZOSA 3I64A 1Z8HA 3EVFA 2JPDA 3KJEA 1N2OA 4RD3A 3W2FA 3CZQA 5EY5B 2AZMA 2JEYA 2XRYA 3SQWA 4O4JA 1EVKA 4LF5B 1SR8A 4J7XA 2C61A 2H59A 3KSDO 3GP5A 1VMKA 1IJFA 2CE7A 1W5AA 4FFRA 2AZDA 1BCSB 1ES9A 2VPXA 2X0IA 5IBPA 4PNZA 2Z2JA 4IUYA 1ZBDA 2FUKA 3Q1KA 4OQ4A 3ZH2A 3TTVA 4LOIA 2ZZMA 4MA5A 4OJKA 3AETA 3ERCA 2I3ZA 4MITA 5HCIA 4BNKA 3FSEA 1GCOA 4WERA 4PC6A 4KJXA 3ZKAA 1IXSB 2NYUA 4EHJA 3LAWA 1JR2A 3C4QA 3KYJB 3KKZA 5E6RB 1DWQA 4JUFA 3UGKA 4UMVA 1DWUA 3A6JA 1OZGA 4XQ0A 4LWPA 1XBTA 4YJGB 3ZTWA 2Z30A 1H5UA 4BQRA 3AJDA 4XIYA 1N34B 4GQBA 3PFKA 4RIGA 3A58B 4FGKA 4U2EA 1QMGA 4NBLA 1W4LA 3UXHA 5KJFA 4OY3A 3QK7A 5SY6A 4BEVA 2QW0X 1ZCZA 4LZNA 2RAPA 4BVHA 4DA7A 4WZAE 3J7TA 3KOYA 1K0FA 3FB1A 4HMOA 5CNJA 2RE8A 5K0JA 4C4RA 5IM4F 3BE6A 5CTJA 3DOJA 3NALA 4QRHA 1O57A 3K9HA 3CW9A 4LY3A 3WL6A 3B1XA 2HIAA 4RCZA 5JWRA 4BXOA 5SZIA 2NSDA 4TLMB 5J2UB 4B8YA 3C7DB 2GF9A 2FETA 4HO1X 4IIJB 1N2XA 2AFVA 2I4RA 4UBMA 3KELA 3R5HA 4C4PA 2QVBA 3GUYA 4HDSB 4HXEB 1P45A 5ES3A 1ICIA 2G5GX 3PGLA 3O83A 1LQUA 4PYRA 4CMAA 1KO5A 2OXEA 3N8NA 3WK7A 4A5OA 4PNEA 2Y77A 2REQA 5EJ7A 4OQDA 1ANKA 1XZQA 3PC8C 1MTOA 3LMKA 4IQ8A 2QXUA 3B2NA 1WAMA 2CLOB 4P80A 3HY4A 4CMIA 2C2GA 5FLYA 3BIFA 3U4CA 1DC5A 2D1QA 4MKRA 4WX2B 3GDWA 1E2LA 1UXIA 5DKFA 3FUXA 3KXLA 4G26A 3ZJTA 2C5LA 3M4ZA 1IZ8A 3VX4A 3VKFA 4Y2HA 5HSGA 4ZALA 3WYFA 1X7ZA 1UJCA 4ENWA 1VA4A 2FWJA 3D5EA 1IK4A 4DB4A 1XTBA 4WKOA 1U2ZA 4ND7A 3KKLA 4O4LF 2DYKA 4FXOA 3GFRA 5CDFE 8MHTA 3C1AA 5BT8A 4M9CA 4BJ5A 4WV3A 2H4JA 4RHEA 3UHPA 3E1SA 2D7CA 2PBFA 4LYEA 4DDHA 4FHDA 1M73E 3AM4A 1S8AA 4H7HA 2QLNA 3MPOA 1KVQA 3TMKA 3R6WA 3ENWA 2RAVA 3NBMA 2R68A 5B5SA 4YCAA 4O4JB 3I9FA 4OBWA 4FDVA 4J2OA 1IM5A 4V03A 2JI6A 2Q8PA 2VKTA 4IDHA 3VSEA 4S1PA 4IP0A 1CR0A 5AM2A 2XJ9A 5ECYA 4WOBA 1MRZA 2GPBA 3V7FA 1BFUA 1R0YA 1DJMA 1VI5A 5EI5A 4QUJA 4RL4A 3OLZA 4G85A 5IULC 5MFPA 1V6AA 2QAJA 3GB9A 4GP9A 2KWIA 3UATA 2PWAA 3BE8A 2EW2A 4D9NA 4H60A 5CU7A 4FZRA 3COWA 3VMMA 1S7GA 4G67A 1DQYA 2GAJA 2ZWIA 3OLVA 2QMQA 2JFGA 4OIMA 3I6IA 5J58A 4F91B 4J1QA 3S29A 2H18A 4MQ5A 4CGZA 1E79A 3L8MA 4E4YA 4CEHB 2XVXA 2VF7A 5DHUA 2FLVA 1UWVA 4K6FA 1NF8A 5AJHA 1VGRA 2HB6A 1CW2B 1KK0A 1LI7A 1NOJA 3MWFA 2PVSA 3B1KA 4Y6SA 1WZIA 3T7RA 1BYUA 4UQOA 5AHXA 4JLOA 5K4AA 3R4CA 4M1QA 1O95D 3PHLA 3FYCA 1E7MA 3NBAA 5HFAA 4WDQA 2BFCA 3P1JA 1A9XB 1ORTA 4ZT3A 2HWKA 1ZC3A 2H0QA 2PNFA 4TV8F 521PA 3JYLA 1XROA 4BXOB 1BCRA 2KE5A 4G84A 4J0CA 1KJZA 3MERA 4KODA 4OU5A 2BEWA 1ZY2A 3L0CA 4A26A 4YPFA 4ER3A 5I9NA 2XD9A 5JMTA 4MS4A 2QPTA 4WEQA 4P4NA 5AKLA 5A4FS 3Q3EA 3SZLA 5KO2A 1QRSA 4HDOB 2GGSA 3MMNA 2C88A 4G2NA 5HIJA 2XZDA 4GDMA 4Z4HA 1GPYA 1ML4A 2AS0A 3EEIA 3FGPA 4DUYB 1ORVA 3QEMA 1WBBA 4Y1GA 1DFGA 4EPVA 2H4YA 1SHKA 4IEFB 3NJ8A 3RRBA 1OXTA 2QNRA 1ODJA 3FUVA 4K9KA 3VR4H 3KB8A 3D6NB 1JR4A 2VPYA 5CT9A 3VU3A 2XQGA 3GUZA 4RTQA 3M0EA 1H1LA 3NETA 4UHBA 5IYZA 4FTWA 2ZTLA 4Y67A 3L93A 1BMFD 2N1BA 3UMBA 3R0XA 3SC4A 1SC3A 1W7AA 2P9YA 3AB8A 4A8JA 4LV6A 3AJ9A 4CR7A 4DIFA 3E18A 2QJRA 3TGWA 4D9GA 5EKXA 1T3ZA 2I6UA 2FMXA 3DHVA 2DULA 1J99A 4WACA 3NHKA 4R40A 1N57A 5FV7A 2OBYA 5GJVC 3WGIA 2R11A 3LGXA 1Q0LA 3ONWA 1RQXA 2BBOA 4NOKA 4EL5A 1EHYA 4TL9A 5AM3A 4MRMA 2C04A 2IP2A 2R47A 2FSHA 4S0XA 4WMLA 1FDIA 1RQLA 3QXHA 1NV9A 2RHDA 3ND5A 4UJ3A 3RKSA 2ZJ8A 3CQ9A 3IOMA 4XSVA 3H0CA 1ODKA 5FI1B 2F3RA 4H1TA 5THKA 4PIVA 4M76B 1UBLS 3HCCA 3IMCA 3U44B 1QQAA 1EFLA 2AOTB 1ZD1A 1SBZA 3KD2A 2Y71A 3KR9A 1YZQA 5CURA 1N9GA 4QQNA 1IRIA 3H2BA 4MIOA 1R0BA 1Y5RA 2VA8A 1LV8A 2XCIA 5G0VA 4S2EA 2CC2A 4EFLA 1R9GA 1BC5A 3RS9A 4WZBE 1A69A 1ZJ5A 3EQ8A 4L2IA 5KYXA 5AESA 1ZSNA 2X22A 2GBFA 1AX9A 5IABA 2IS2A 2R6JA 1HL7A 2H5LA 1ZM3A 2W4IA 4U2CA 4G5OA 4AKHA 1GAJA 1UBCA 4ZGGA 4JT8A 1R50A 2D1YA 2J3MA 2V98A 4LJ5A 2PZFA 2BUBA 3WGLA 4EKEA 4BJ6A 5F5XA 2PUVA 5CVCA 3EJWA 4TXMA 4GPTA 4EJFA 2NTJA 2QMZA 4OF4A 5FR1A 1DEAA 1RRCA 1H2YA 1QZ3A 1P0QA 1XCBA 2HXSA 2I87A 3B1JA 2BFCB 3BCUA 3I76A 4UDYX 5CA0A 3TM4A 1N0HA 5CNKA 4NJEB 4A0QA 4TKVA 1SD2A 1BCRB 2I54A 4YFVA 1RLUA 5HHTA 4C22A 2QP3A 1GQOA 3UNXA 4GVXA 3AP2A 4EGFA 1EUQA 5BQ3A 3TX6A 1NQ5A 1R7RA 3FMPB 3QLUA 1CBUA 3UCEA 1GPMA 3G79A 3ENNA 2C07A 3HWWA 5A71A 3MTBA 9LDBA 3K70C 2WTAA 1N5OX 3GJ4A 1ZXXA 1XMOB 1LC0A 2VYQA 3KL2A 2VJBA 4PIMA 5LXTF 3F4KA 4NNPA 4O3FA 2AD1A 4WN3A 1OAOA 5J63A 3CVXA 1EAMA 1JU3A 4C01A 3KKEA 1P6XA 2PYDA 4CMBA 1J90A 2D54A 1Z0JA 1Q3TA 3GGGA 3K20A 5MHTA 1HDZA 2E6KA 1QFMA 2Q5EA 2BMFA 3I6ZA 1JMVA 3LXMA 3O4RA 4PZDA 3TX2A 4Y30A 3P9CA 3ORQA 3WGTA 4LY0A 3EGOA 3OEED 4G9EA 2REBA 4CL8A 1FFYA 2O8BB 1O97C 2QN7A 1H0RA 3I32A 2WIJA 3MCVA 3RVKA 3S27A 1YI1A 3VBCA 1H1LB 6ADHA 2F48A 2H0AA 3KAPA 3PEEA 4KE8A 4ZRNA 2Z83A 1WDLA 3U19A 3VNSA 2OORA 4NBUA 3WNQA 1HDYA 1XLTC 4A8JB 3GJ5A 1B74A 3OCVA 4BFZA 1YHNA 4LZAA 1RI1A 4AJHA 2RHOA 3AY7A 2Q9AA 4DNPA 2PBLA 3MQFA 2YRWA 1IAQA 3CKYA 1QHEA 3B52X 4QEZA 1MHPA 4ALMA 4C0AC 1QP7A 4MUXA 3URKA 2B69A 2O2EA 4MP8A 2PGAA 2W6JA 3GZ4A 1YVPA 5KMGA 1VHWA 2YASA 1Z25A 1GA6A 4I4NA 4M1MA 1M0WA 2PL1A 3R77A 5C8YF 1ZMXA 2Z4TA 4V0ME 3RSOA 2DR2A 3I39X 4B6FA 1Z5GA 3BM5A 1NGSA 1XRSB 1FDRA 4LGYA 2XMBA 3WL4A 1W85B 1PKEA 1BWPA 5JYDA 1ML3A 3A04A 1YIDA 4IINA 4GRAA 3SMVA 4FR2A 3FYTA 3K32A 1UBNA 2XT6A 3WLIA 1XFAA 3QKSB 4P3XA 2JJ8A 4EY8A 1RKQA 2BKVA 1N9GB 4FLEA 5THXA 1R64A 4U7HA 3BSFA 4DWVA 2DCUA 1UMCA 3R0IA 4OTZA 1PJ3A 4L8FA 2AFHA 3G89A 3TSCA 4L2IB 5KYXB 4O0MA 1I9GA 1ZM7A 3UBTA 3BDIA 4NXNB 1R9MA 2JVJA 3Q3CA 1SK8A 2YHBA 3MQ2A 3LVFO 1NBMA 4G09A 3QXGA 5D01A 1WKBA 2F1RA 3W3ZB 4F12A 5CFQA 3WIOA 1U0SY 2DG2A 2YC4C 1STOA 4CIYA 2YICA 3LP5A 1KPGA 1IHUA 5C3MA 1BWQA 2FUEA 5I45A 1IZ0A 3BG5A 2FPWA 2I8CA 4H6XA 5G0UA 4JVSB 3DZ8A 4NMLA 3RE1A 1V8DA 3U6KA 3RVNA 3HXTA 3G5TA 5AMXA 2AJDA 1TFRA 2HOQA 4I55A 5L3RA 1VP9A 3GBVA 4TKVB 3WGHA 4OMCA 5IF3A 3W5BA 2ID7A 1XNHA 5AHKA 3KVYA 4DVJA 2XQFA 3KT0A 3BGDA 2N75A 2I1LA 1XJQA 2M1XA 5HUHA 3Q72A 2C9ZA 3H8JA 2WYWA 3AK4A 4IAOA 4C2BA 1R4AA 3L1IA 5C31A 3DBOB 3BTOA 1NBAA 2JHAA 1FRZA 3E23A 1NJ6A 3BBLA 3UK6A 5ALIA 4HAWA 4LXIA 4Y1RA 5FJIA 1CY6A 1HKHA 3BC1A 3TSOA 2BRUC 2VI5A 4PONA 5F7ZA 3BQ9A 1XZFA 2NSJA 4LECA 4N7BA 2GO1A 7REQA 1IN7A 4KNYA 2HLNA 1NFQA 3ED5A 1ADGA 2ZR8A 3VH3A 4AMVA 1U0BB 4CLHA 1RYFA 1MW9X 1WVGA 2HA3A 1KEEB 2FA9A 3FMOB 2HF7A 2GTHA 3GX1A 2KBFA 2PM8A 3KE9A 4YQYA 5JYCA