The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
90
|
sequence length |
305
|
structure length |
302
|
Chain Sequence |
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDNPGEKAFYGSVARLAAERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQGSRLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the Escherichia coli ArnA N-formyltransferase domain in complex with N(5) -formyltetrahydrofolate and UDP-Ara4N.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| source organism |
Escherichia coli h736
|
| molecule keywords |
Bifunctional polymyxin resistance protein ArnA
|
| total genus |
90
|
| structure length |
302
|
| sequence length |
305
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2016-04-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00551 | Formyl_trans_N | Formyl transferase |
| A | PF02911 | Formyl_trans_C | Formyl transferase, C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 | Formyl transferase, C-terminal domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Formyl transferase, N-terminal domain |
