1XYYA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, homodimer, oxidised state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
total genus 51
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xyyA00
1FVXA 5EMNA 3EDOA 1SQSA 1OBVA 2QX6A 5LVAA 4YAWA 2Z9BA 2OHIA 1QRDA 4N82A 4YAFA 3O73A 3HR4A 2FAXA 5LBTA 1ZWKA 3GFRA 2ARKA 5F12A 3NHSA 3R6WA 3F90A 4YALA 4GI5A 3G5MA 3JSXA 5F4BA 3LT5A 5LLDA 3L9XA 3GAMA 1CZHA 1CZOA 4QODA 2MT9A 2V5VA 3NHYA 2QMYA 4H2DA 5FUQA 2MOKA 4QOFA 4DILA 1SG0A 1AKUA 4PTYA 1AKQA 2Q62A 3K1YA 3QE2A 4S24A 4U7HA 3SVLA 4ESEA 1FLNA 3NFRA 1V4BA 3B6MA 3TEMA 2FCRA 2RG1A 4PU0A 4LAFA 3FJOA 4QOEA 4HS4A 3ESXA 3F6SA 4PTZA 1AG9A 1DXOA 2V5UA 4ZVMA 1XI2A 3OX2A 1RLJA 1QR2A 1YCHA 1ZX1A 2MWMA 4NULA 3QFRA 3NHJA 5F51A 3B6JA 1WSWA 3ESZA 3W78A 1YRHA 2X2OA 1X77A 2FZ5A 2FZVA 1FLDA 3B6KA 4BMOB 1DX9A 2XODA 2FOXA 4LTMA 2FVXA 4ZVLA 5TGZA 1JA0A 1DXQA 5LJIA 2Z9CA 5B3LA 3F2VA 3ZHOA 1XT6A 4QOHA 4FGJA 1D03A 4YAOA 3P0RA 4M0CA 3W7AA 1QBGA 4XDGA 3FW1A 2HNAA 4CETA 1AKTA 3KAPA 2MTBA 1J9EA 1YCFA 1ZWLA 3U7RA 3UXEA 5NULA 1CZKA 2ZKIA 4C76A 2GSWA 4QOGA 1C7FA 5LJLA 2FDXA 3GFQA 4Y9UA 3K20A 3LCMA 4D02A 3NHLA 4QOIA 3OWXA 3HLYA 4BMPB 3UXHA 3O2NA 4H6PA 3NHRA 1VMEA 1RCFA 1TIKA 2N1MA 1FUEA 1C7EA 2W5UA 4R81A 2AMJA 2HNBA 3FNIA 2OHHA 1CZRA 3OJWA 2OHJA 2QR2A 2BMVA 4XDHA 3TZBA 1NNI1 2QX4A 1I1OA 1KBOA 1J8QA 4U7GA 1J9ZA 3NLLA 3ESYA 2M6SA 1RLIA 2D5IA 4LTDA 1XYYA 1CZLA 2X2PA 1CZUA 5ULLA 3W79A 4CF6A 2KLBA 4GR9A 3D7NA 3N3AC 2HPVA 4LA4A 4U7FA 3N3BC 3OX3A 1AMOA 1T0IA 4N9QA 3OVMA 2M6RA 3QFCA 1H69A 4HEQA 5BUCA 2Z9DA 2A5LA 4ZVNA 1FLVA 1YOBA 1FTGA 3L9WA 3NHKA 4DY4A 5FA6A 4ICIA 2KQUA 5EA2A 1AKRA 4QOJA 4ZVKA 4C0XA 2BN4A 1RTTA 1YCGA 1D4AA 4LTNA 1KBQA 3KAQA 5JROA 3F6RA 3NHFA 1YKGA 2QMZA 5EAIA 4N65A 3NHUA 4F8YA 4FX2A 2BPOA 1XYVA 4OXXA 4Y9RA 1FX1A 3NHPA 2B3DA 2R97A 1FLAA 2QX8A 4DIKA 5LBUA 5NLLA 3N39C 1D04A 4Y7CA 3OJXA 2F1OA 3ES9A 1B1CA 5FX2A 1YDGA 3S2YA 3NHWA 4GQIA 1AKVA 1T5BA 3B6IA 1J9GA 1OFVA 2WC1A 4J8PA 2XOEA 1CZNA 1OBOA 3OX1A 3U7IA 2FX2A 2OYSA 2V9CA 1AKWA 1WSBA 4YAUA 2BZSA 3EYWA 4FGLA 1TLLA 3TE7A 3FX2A 1F4PA 3GFSA 2FLVA 4FGKA 1JA1A 2Q9UA 3HA2A 4C14A 2QWXA 1BVYF 3OWHA 1QHEA 3FVWA 4YQEA 3KLBA 6NULA 1BU5A 5B3KA 5LMCA 1GG5A 2Z98A 2QX9A 4C0WA 2R96A 1E5DA 3W77A 5A4KA 1H66A 1AHNA 4NLLA 2BF4A 1AZLA 3KEGA 3RPEA
chains in the Genus database with same CATH superfamily
1Z4MA 2YIDA 4LNUA 4XVHA 4YASA 1BG6A 5DRTA 4GWKA 2Z6AA 1UWCA 3CRNA 2ZGVA 1ZD3A 3SGLA 2XVMA 3L49A 4BO2A 4ZYLA 1RYHA 1BXKA 2BEKA 2ZSAA 4OPMA 2NYRA 1OBCA 3DE5X 2XUKA 4NMLA 3RYIA 2GYWA 1IONA 1Q1NA 1NT2A 1O4VA 4BPRA 4ZMBA 1I4LD 2VDJA 4WE3A 3NT4A 5IJXA 4IJMA 3T7CA 2JIRA 1B3BA 1JSRA 2ZSJA 5FFMA 3NBFA 2RHTA 2IHVA 4OUDB 2H1CA 4ZQHA 5KVAA 4G5OA 4W4TA 3KQMA 1TX4B 1U94A 2CNNA 4N82A 4AZSA 1M6VB 4H7DA 3VC2A 1W5FA 4FQ5A 3V8VA 2ZP1A 4X3CA 1VLHA 1TAQA 4B1FA 1XAHA 3FXAA 4CJXA 5HQ3B 1QU3A 2FW1A 1MC5A 3F6YA 2NQ2C 2XXBA 1QGUA 3K4PA 3QKRA 1ZWKA 4LXHA 3RFTA 1NPYA 1HTTA 1X9GA 3VKHA 1Z6PA 3PQ2A 4HOYA 4Q9KA 3A9WA 3PTAA 2ZJ4A 4UDXX 4RDCA 1P6UA 2O3QA 2ZU6A 1U7TA 1WXGA 2Q5HA 4WLUA 5C4MA 4KLAA 4YALA 4ZZ0A 1PL6A 3T3IA 1H9CA 3S70A 5JZSA 1Z56C 2G8LA 1CUCA 5K5EA 5HJ2A 2JAHA 1G8YA 2D74A 4LVUA 3EDYA 1Q7TA 2H0AA 3RG2A 3ZXXA 2BI8A 5BOSB 1KTIA 3SVTA 3FTEA 4RVDA 4Y0AA 1MAHA 4ZRMA 3T7AA 3UT6A 3O0DA 3N86A 3K15A 2YWRA 5FFNA 1T4GA 2YHUA 3FMGA 3FPKA 1CZOA 4OB8A 1RXEA 3TYXA 4RNDB 4CM6A 4CIBA 1NMZA 1TD9A 4A1OA 2EEPA 4ASUD 2WHPA 4BGEA 4HYYA 2AS0A 5LYJF 2G09A 4IW3B 4JB8A 1W29A 4Q3OA 4D4LA 3IPYA 3D7SA 1M2HA 1JHDA 3CKLA 1FNDA 1T6YA 1OKKD 2DWCA 3ANXA 1VDZA 5CMLA 5LQNA 1TLTA 1ADBA 4RGQA 4BFWA 3DVAB 3LX8A 3DE1X 2JGAA 2P1RA 4LVNA 4YRKA 3UVEA 1PZFA 4DILA 1ICIA 1T0UA 1E3WB 1T9KA 3EG9A 4Z9YA 1ODIA 2GTIA 1PS8A 3OTQA 4PHFA 5E2AA 4LJLA 5LZ2A 3C70A 1KFCB 1RFLA 1SB8A 2DFNA 3PFHA 2BEVA 2XYQA 2ZYTX 3L6DA 2OC4A 2PYZA 3PJFA 3SEQA 2VP6A 5FWDA 4FFNA 2ZB2A 3REQB 3DTTA 1KSFX 3GGSA 4RELA 5JWOA 4QRHA 5FI3A 4P7FA 4DSZA 2AIRA 4H9GA 5L7YA 1FBTA 3BCUA 4GXRA 2QI9C 3KOMA 1FFDA 1XPJA 1UBEA 3KALA 2TMYA 4PGFA 3OJ0A 4QO8A 1R6TA 1TQ2A 2A6PA 1SXIA 3EGIA 3AVOA 3FJOA 3BSWA 1J0XO 1PZHA 3NIBA 4M0KA 4JI5B 3EW9A 4ZXFA 4I66A 5CXXA 1BSVA 1H8EA 2QJTA 2VAPA 4PG6A 2HZBA 2CVPA 2FX5A 4QA9A 2WWYA 1T5TA 3FDZA 3Q9SA 1T13A 2P5SA 1ZJ5A 3AR2A 5B4UA 1K6MA 1URPA 2DFTA 2IYSA 1YCHA 1W0JD 4CHTA 1WMEA 4EG7A 1U8XX 2HN9A 5DX8A 1RQPA 2GSDA 4LSGA 2GKGA 3JAMA 3SHWA 5AVSA 1X7HA 4E0BA 4M9XA 2FN8A 2DAPA 4RIEA 4UJ5A 3O90A 5DM4A 4KQMA 3WDMA 1L1FA 3ISVA 3WBKA 4YHHB 1KMQA 2Y8EA 3BFXA 1V3QE 4JC8A 4E30A 2BE7A 4LECA 1NJFA 3K6JA 4WA8A 4DA0A 1JLHA 2VNIA 2VRWA 3BA6A 4EJ2A 2VT3A 4XM1A 1DS6A 3GJZA 3IMFA 2W00A 4LOJA 1CJBA 4RA6A 2AVDA 4YRJA 1PJTA 4B2LA 5KWIA 1UXHA 2P7HA 2C83A 1PLKA 1TIPA 2ZRHA 1KWGA 1WR8A 3T9EA 3EMDA 3TLXA 1GFSA 1S2IA 3UT0A 3C85A 5ED4A 4ZO4A 2A9KA 4H1TA 4JODA 2RGCA 5F1KA 2C5BA 2OV2A 1YMUA 2RJ3A 1SCDA 2KWIA 3WADA 4NJEA 3GBVA 5ALTA 2A35A 4F56A 2Q6VA 3GPBA 2PT7A 3HMQA 3VR4D 1U9ZA 1QSGA 3IVRA 1O1YA 4JJ7A 2IITA 2Y77A 5KSYA 3KOOA 5KYXA 3ZCVA 2OZPA 1ULHA 2HV9A 5JDCC 3RU7A 5EJEA 3GHHA 1EDEA 1H2YA 1DTSA 3HU3A 1VE1A 1PVVA 4OQLA 2F3TA 4ZV7A 3SAJA 3TG2A 1XQ9A 3DHNA 5F2OA 4G0UA 4BEJA 1DBSA 3L8CA 1E5XA 1UJNA 2WF5A 4R5MA 3TXXA 4P0TA 5K0CA 4BAGA 2BM8A 3NYQA 2YFHA 2RK3A 4HGYA 3SQLA 1SC3A 1U9CA 3B7GA 4JBIA 3DE3X 5AUQA 5DTMA 3ZVRA 3HPQA 4Q9NA 3SYRA 1XCMA 1GNVA 1MJGA 2WSBA 5KSPA 3UXEA 3LC0A 3ZV6A 4U6SA 3C8HA 4MR7A 1RHUA 3S0JA 1OXKB 1PW5A 3VAAA 3MMXA 2NYUA 1X2BA 2Z1MA 1F38A 4XE5A 5FJJA 1IEWA 5SZJA 2AN5A 3IUNA 1MJHA 1O97C 3S2UA 3ZXSA 1PFGA 4MP8A 1MQSA 5T4EA 3WKCA 3F8WA 4DMCA 1EINA 1OZHA 2NU7A 3X2SA 4A16A 4DDMA 1UCFA 5EXTA 4B44A 2CGEA 3MGAA 4OL0A 1BCSB 8GPBA 1L5HB 1SN7A 4L8LA 1H6DA 3B3AA 4TWBA 4K6CA 1TPYA 1TK9A 2HQOA 2Q41A 2BGLA 1L7OA 1QFSA 3EVGA 2NUBA 4K9MA 3EQ2A 4PX3A 3RYCA 1ZNWA 5EI5A 4FMPA 4BE7B 4PGMA 3HXTA 2NNLD 4Y18A 1TM4E 4HDNA 1T34A 4IIHA 1E2UA 3O4JA 4FIDA 1M33A 5KJEA 1FFHA 4G63A 1IDOA 5FBHA 3HRHA 1ZXLA 2POCA 1GV0A 2QTVA 3MJHA 4I1VA 3L4BC 1GRQA 4G5SA 4EY7A 4H6PA 1O94C 3E22A 4QGGA 4B87A 1EFAA 3HYNA 3JWJA 3JR3A 1CR1A 1VI2A 5HK9A 2YBDA 2QZSA 4UZFA 3LA6A 1LS6A 4ITVA 5E4FA 4EJFA 1NLMA 3DD1A 4LXTA 2QVBA 4LQDA 4NV1A 2W71A 2HOQA 4RXMA 2QTLA 3RHFA 5JECA 1XPOA 3RC8A 1NA5A 2WD7B 1LNQA 3GEIA 4W5WA 1W49A 1Q17A 3RYCB 3QPUA 1BC5A 4J4BA 4NNOA 5HDBB 4A5SA 2V1UA 1VZ2A 4FOLA 2PSEA 3M2PA 1P5JA 1P9RA 8LDHA 1BS1A 1YQUA 1XTKA 5EMMA 3ZU5A 4UOEA 1HT1E 1UK7A 2QRQA 3H7IA 4OUKX 4JVLA 3ZH2A 2JFHA 5AW6A 1KZ7B 4F45A 3ER9A 2F8TA 1JHAA 1L2TA 1ZI8A 1A9ZA 1UC9A 2XWSA 2ZDQA 5ALNA 4MB2A 3KHTA 5ANRB 5U1PA 1GSIA 2O8DA 2CMFA 2WUWE 3GFPA 4GOMD 3GD7A 4PBSA 4KGDA 4OHFA 2BGTA 2JCYA 2OCIA 4DV4B 1O7JA 2JJQA 3K8ZA 1J8QA 3A9UA 2XGSA 2NUPA 5DHTA 5BWBA 2PZJA 1P91A 1KPIA 2Q8NA 5LWHA 1H42A 1JAYA 4YV0A 1J9ZA 4JJ4A 4QPPA 4M46A 3E7PA 2GYUA 2ZUUA 3HK2A 3OHPA 2WFMA 4XSVA 2Q5IA 2VUSA 2SKCA 1PD1A 4HRVA 1Z35A 2OAP1 3DV2A 4EH1A 1IU9A 4HDOB 2CXTA 4X1KA 2JI7A 1SKQA 4CF6A 5IT5A 2OOKA 5KU7A 2VC2B 2QDXA 1ENPA 4IWYA 4DCJA 1JXMA 1EWVA 2AT1A 2IEAA 2DLNA 2J9RA 3D31A 5IAOA 3IA7A 1Z0FA 4QU5A 4BNDA 5DHFA 4L73A 4PIVA 3ORRA 3N2YA 1OUMA 4X9XA 2W6ID 1GPMA 4PIMA 1Z2EA 3UH1A 1K86A 1JNXX 1PZEA 3KOXA 3VI4B 3X43A 3E84A 4Q34A 1WY5A 1ZRNA 3IIEA 3QFFA 2DHQA 5ED0A 4CIVA 2UAGA 3P52A 2VJKA 1G0NA 3MCTA 4PO8A 1QYIA 5AXCA 3JYHA 1FTGA 1QQAA 3JWGA 4EKDA 4JLAA 3T15A 1ZVQA 3PT5A 2E5WA 1XVIA 1WV1A 2VJMA 3PQFA 4TL9A 3WRXA 4BMCA 4FT2A 3WL8A 5C53B 2KQUA 4CLRB 3GMIA 1I30A 1ZUD1 4FONA 4N0EA 2GVNA 3FAKA 3HKBB 2BN4A 3P0IA 3H5OA 1UKVY 1QNFA 4DDKA 4TGLA 4RF3A 2X1LA 4JVMA 3G13A 4V03A 4QQRA 4EQZA 2XIJA 2L2QA 3PIRA 1OH6A 2HK6A 4LWPA 2GCNA 5D6NA 3ETJA 1XKQA 1B15A 2JLSA 2XMBA 3R09A 2Q9AA 1T8YA 1C9NA 2OXCA 2QX7A 2XYVA 3PNBA 3ETEA 3PPIA 3F73A 1WP4A 4HK4A 4ZOBA 1R0WA 3LU1A 4HLUA 4CKEB 5FWNA 2QAGA 2ZRDA 2GLUA 1DPFA 2R6R1 5M5BA 2R4UA 2XRFA 2WKSA 4N65A 5LPNA 4OQDA 1DG3A 2CNWD 3FY4A 4OHUA 2VATA 4TX1A 2H4FA 2C2BA 2Z2YA 1OROA 4Y1FA 2OHXA 3EHDA 3L79A 4FHDA 1VG8A 4FE7A 1XYVA 2D0PB 3AM3A 1UXGA 2AQHA 4P35A 4KW7A 1GL7A 2G1JA 4F11A 4RTLA 5DNEA 3E2IA 5HRUA 1LSUA 2YINC 4O3FA 2OHGA 4UQOA 1L7XA 5CRIA 1GJRA 3W7VA 2EJBA 3LI2A 4FILA 2DCMA 5LBUA 4DCMA 4JK3A 1DBIA 2QG6A 3IXQA 4ALKA 5KTNA 3E7WA 1CUXA 4IMJB 4HV4A 1GPNA 2RHCA 2WMYA 2O3UA 6CHYA 1U1FA 3RR2A 1B1CA 4L8YA 1X42A 3HTXA 1W4LA 2XBUA 1IUNA 2IF0A 4FMBB 5FX2A 5DSXA 1HQDA 1N7IA 3GJ5A 1UBJS 2BBOA 3EZYA 2G36A 3L02A 2R87A 3CONA 3IV7A 1RYNA 3LCJA 3T5CA 4DV6B 3L8EA 1F2UB 5KTMA 5ALOA 3I2IA 3OU2A 4YMSA 1DWPA 4UCQA 1BKYA 3UUGA 5I7OA 1GM5A 3JD0A 1M76A 3BQMB 1ZCBA 4DM3A 3ZWCA 3VOSA 1QAQA 5C8DA 1Z45A 4IDAA 2H1SA 4L6IA 3I5AA 3ZVLA 5I3ZA 1GRVA 5CX1B 2A88A 2ERXA 3SSNA 4AWAA 3BL6A 4OXIA 1N2CB 2D3WA 1YZHA 2P9TA 3Q6MA 3LGSA 3PB3A 3QEMA 5FO1A 2J32A 1EWKA 3A1UA 2C0QA 3FPCA 3P45A 3SR4A 4ZKDA 5DHQA 1EFVA 4I4CA 2C20A 3VTZA 1PR5A 1U0OC 5CGZA 3EPKA 5AHRA 1VG1A 3HCNA 3PBKA 1HTWA 1ZU4A 4ZCPA 3VR2A 1EVIA 1M1YE 4U9IS 3EC2A 2EJCA 4L78A 3NIGB 2Q4EA 1A5SB 1EE2A 4Z0HO 2IRWA 4FGLA 2IUFA 3TQQA 5K99A 2WYHA 4JNKA 4Q3EA 4BEWA 3SX2A 2JFNA 3ZHQA 3MWEB 1YBVA 2Q1SA 3RRBA 2W42A 1JB1A 3V34A 1ZM3A 5FA5A 2D4HA 5IJ0A 2VAMA 1WU8A 3WYCA 5JH7B 1MT3A 4XASA 4MQ5A 4XQ9A 3WP1B 1NY5A 3TTUA 2ZR7A 4JMPA 1LQ2A 4UFPA 4GBJA 1L5MA 1A7UA 2FSUA 2DB3A 2VP2A 3Q9UA 3FD8A 5B64A 1XTQA 1E8DA 1ZU5A 4IKOA 2CHEA 1FMJA 3DW3X 4ZGWA 1GEGA 2C9MA 1NBHA 1JT9A 1Y1RA 2FWRA 2EQBA 2QD4A 2WFAA 3KEQA 3ZWQA 3EQZA 4CIYA 1G2PA 1MEEA 4EELA 3I4FA 4HBZA 4TUYB 1DG1G 5JXJA 3DGFC 1MT0A 3RYFA 4X44A 4CFSA 1S1MA 2XMCA 3L5KA 3QIAA 4G4JA 3DD5A 1K2WA 1QS0A 4RK5A 3CA8A 1C30A 1J56A 4IZ6A 3RUCA 4E51A 1M66A 2IYAA 2Y1KA 3ZNPA 3FSEA 3O84A 4KFCA 1TM3E 3S29A 3P5SA 2IQ5A 1TQHA 2R68A 1E2BA 2IHKA 2RIPA 4JXJA 3QPWA 4O2BF 3F7NA 1NJ6A 2YV5A 4GMFA 4MDEA 3TIFA 3W06A 4AP9A 3ZOZA 2YX1A 3TLGB 1ZXBA 1Y34E 2ONKA 3SKYA 2V6IA 1ILWA 3U1BA 4KO4S 4C2UA 3FJYA 3KQSA 3QVGA 2CDAA 5K0TA 2XCUA 5DM70 3IV9A 4PR3A 1GFWA 3I9V1 3SDBA 1E2PA 2DUJA 3RYFB 2HRZA 4C4TA 2BEUA 1G8JA 3TAHA 4B6EA 3SM9A 4ZCMA 1YJ5A 1AUVA 2I78A 3O7MA 3U7HB 3KOUA 1Y63A 4P7BA 3RKUA 3FCEA 2JGJA 1E2EA 4H3SA 4MHOA 5ALWA 2WM9B 1KO8A 1H2XA 1S2NA 2VHYA 3GCGA 3L0ZA 2I76A 2CZGA 4NMXB 5DYIA 2IX3A 2WHEA 4JS0A 3EPJA 1V25A 4BJ3A 4D25A 1X8JA 3ZCQA 3QVGB 3AB7A 3HJTA 2CKDA 3F1LA 4ZT3A 5JU6A 2NT3A 3QYJA 4ND1A 1XD9A 2QG9A 5ALGA 4NQRA 1DIOB 3E3MA 3BE4A 1DX4A 5BQFA 1W0CA 3EWNA 4HZIA 4ZT2A 3TMAA 4OK3A 3AOGA 4Z54A 4TTQA 5CU7A 1CRWG 1LUAA 4UUAA 1OQAA 1PR6A 4CT0A 5CYPA 1AOXA 4FB4A 4MA5A 3O95A 5B2ZA 1RADA 1A9OA 5E9AA 2YUIA 1G7RA 3I0MA 1UAGA 2VJCA 4NCKA 3WL4A 1O97D 4YMUA 3TM5A 3LOQA 2DULA 4IIVA 3JQ8A 2BDUA 2R6JA 4MWOA 5C3UA 4B3FX 4CV1A 4MI1A 1EE1A 4YIKA 2QK4A 3ICCA 4I36A 1TVKA 4IEEA 5KDDA 5LD2B 1XDWA 4NCHA 1XNJA 1DCFA 1SK8A 1GZHB 5DTEA 4EBBA 4NQZA 4XVQA 2BT4A 3ER6A 4ZT6A 3AKYA 3P9CA 4BMVA 4R2JA 5HBGA 1EVQA 5HRCA 4FW9A 1E1RD 4P36A 1U3VA 3NDJA 3L0YA 5BUZA 4FYPA 1MXHA 3O91A 4UBOA 5KNBH 1SVSA 4GKJB 1DCTA 1LTKA 4Q9HA 5AVRA 2HSWA 2H7XA 1EEXB 3LZ6A 5GY7A 3UAWA 1N5IA 1RAFA 2V7QA 3B2QA 4AJEA 2ATEA 3H2YA 4JBHA 2AEEA 1QYCA 3KKNA 1KXJA 5DRYA 2B0CA 5DLEA 3U1TA 1O94D 4BFLA 4RTRA 4ZWNA 3WGVA 2DPGA 2VQSA 5AO9A 5EC8A 1XWFA 5JMWA 5CM2Z 2OTCA 4XYGA 2HIAA 4ZAZA 4DW8A 4II7A 4B2PA 1ZR4A 1U9IA 2GILA 1YR9A 4OD0A 4EJ0A 1MP0A 1IJEA 3L7IA 4QOFA 3ZXYA 4MQBA 1L4LA 4Q4AB 3M33A 4J90A 4YJGB 1KJ8A 1QRAA 4LK3A 1E0KA 2G17A 2IU4A 4ODIA 4R71A 3I9LA 1JUDA 1X80B 1DFIA 2QT9A 4KZKA 4MEAA 5IT9A 1DUSA 2CF5A 3UO8B 4EARA 3VR5D 4GLBA 4Q01A 5AI8A 1US8B 2XA2A 2OKGA 4CI0B 1LQTA 1DKOA 1K6IA 5C4GB 3Q8KA 2CNOA 2KPOA 1GT91 4A6PA 1YK1A 3B6MA 1BH2A 5DGHA 3I39X 2JGDA 4R8MA 5CVVA 4BV8A 4F4JA 3LBNA 5LSAA 3ANYB 4EEKA 1F20A 3TRIA 1R0ZA 3GV0A 1KDVA 3ZI0A 5EKTA 2RD2A 4Q02A 4WK6A 1ETHA 2ZPTX 4QYXA 3RSLA 1FDIA 1XJ5A 2C88A 2GWHA 2P35A 3PL1A 3GCWA 3QLVC 2WWGA 2GZSA 2SKEA 4GBED 4P3PA 4XQ0A 3UMRA 3WK4A 1BS9A 2VJYA 3DDHA 3KKEA 5TQ0B 3OU7A 1MC1A 2RAPA 2VH1A 3F5FA 1K9VF 2CHGA 2L19A 2J3QA 2PMCA 2VF7A 4OYYA 4GT1A 3KPYA 1H8HD 1GA1A 3DJYA 4Y1RB 4ZVQA 1AIPA 2UUBB 1M7BA 2QL6A 1OWMA 3KQWA 2HXGA 3LL4A 1QR2A 4R84A 3RASA 5I7WA 3H05A 2XXAB 2IUYA 3AJ8A 4A6EA 1KL7A 2MWMA 3VX4A 1C9JA 1XTIA 3C39A 3EIFA 4WZAB 4ZOCA 1JWLA 5KC9A 1Y9JA 4KK3A 4YGYA 1B8PA 4I50A 1CDOA 4U7WA 3E1KA 3WLSA 5A3VA 1O0BA 2C3OA 4H3VA 4W9MC 1GGVA 2VWGA 4Q4LA 5F51A 4JLOA 5TNXA 1G4HA 1M75A 5AVOA 3RUEA 4CUJA 1L8OA 2V54A 1NJSA 1YHYA 4ZJYA 3L05A 1VE5A 1RPNA 3H9BA 3DMRA 4ZN6A 3UHPA 3F3MA 1IXKA 4BU1A 2HT6A 3M5WA 2QTCA 4KWHA 2NSDA 1ZN2A 5ALVA 1N78A 2HA5A 1FLDA 4ZPXA 5AW2A 3BUSA 1V8FA 2KHZA 3KZKA 4KI0A 2GJ9A 2HX1A 4FSHA 5IG2A 1HSOA 1AK2A 1N6OA 2DHDA 3DM5A 4MTCA 2GTHA 4FGWA 2QQEA 1X1AA 2C5AA 2FQ1A 3O8RA 4B3HA 1NDUA 2GEJA 2BFOA 4G56A 4FFLA 3WWOA 3GW8A 4F6RA 3F2VA 4KXXA 4G1UC 1NUUA 5FYDA 2JVKA 1B0PA 4TTJA 1L4KA 1ADFA 2O8NA 4JUAA 1BN7A 1TM2A 3C3JA 2OBYA 5L95A 4M0DA 1U2EA 1FXUA 2G9QA 3SQOA 2B9VA 5HKLA 1MA0A 1DUIA 4X61A 1XVLA 1Z7BA 2D54A 2NT4A 2O7VA 1DQSA 2ZI7A 3OIWA 4HB4A 2VF4X 4ML3A 5DE3A 4BFYA 2C7PA 4IMRA 2PUHA 2QNRA 4O2AA 1MABA 5F4ZA 4KK4A 1K5DA 5SY4A 1UWKA 4XDGA 3D54D 3VJKA 1XR3A 1ZOIA 4LPKA 1GKUB 3FW1A 3WWYA 4Y6SA 2WOOA 4KRXA 3OSZA 1QHIA 3DT6A 3K3PA 2ZJ7A 3BZBA 3Q12A 4HQFA 4OSEA 4PC7A 2GEVA 4MPDA 4LVOA 2ICAA 3T0FA 3QVVA 1DFHA 1XE3A 2O07A 4QE3A 5DF1A 3VYVA 3IERA 4BO7A 3CB2A 3ORYA 4LIPD 3LQYA 1I3CA 1OAAA 3LT2A 4MWTA 821PA 3MBIA 3U6BA 5TMEA 2Z4TA 5NULA 1NMSA 1U81A 2AUMA 3A7EA 4I9NA 3IALA 2EWMA 3JQ7A 4EA8A 4D4JA 1Q91A 2ZKIA 1PT8A 3C43A 4R1NA 2G5GX 3HBAA 5CH5A 4A8HA 4ENVA 3DKPA 1DE0A 2X40A 5E9JA 4U2FA 1ORVA 3AFMA 5GGYA 3UUFA 4QOGA 2F9LA 3NT5A 4O33A 1GQOA 2PQMA 5FOTA 2A67A 2FEKA 4N8EA 4WINA 5BT9A 3ZKAA 1ZN9A 3LXRA 3NVAA 2E5LB 1E8NA 1V11A 3VNVA 1DU4A 4QYIA 3UCFA 1G8AA 2PT5A 2ANBA 3A4YA 2OB1A 4IJVA 2GQ0A 3NU1A 1ZGAA 3DAPA 4QOIA 3DLBA 2Q2NA 2PWZA 3P0HA 5FV7A 2Q07A 2M1XA 4URXR 5ABPA 2QRPA 2I0FA 3HDYA 4HNAB 1P7ZA 5FEUA 1IZ8A 2JAPA 3VVMA 3AUJB 3F1KA 2OCXA 1VBKA 5AJYA 2I2CA 1ZP6A 3TSYA 4JYZA 2WY2D 2ATXA 3BWVA 2I8CA 3C4VA 5HS6A 1SZDA 5AW9A 4EVRA 3BMXA 3A9SA 1NBEA 3BHJA 4TM7A 2LIPA 2W5UA 1CY7A 1JJIA 1R12A 1ZK2A 3K9QO 3SVZA 3V7NA 4C2BA 2D1YA 1RFGE 1VIDA 2HMAA 2N47A 4ZTZB 5T5QA 4P4NA 2CHVA 1E6WA 3AYXB 1RLUA 4A0GA 5JYEA 4W7IA 3RC1A 1A27A 5D1HA 1XB2A 2JD0A 3QUSA 3R4VA 5AI6A 1Z4JA 3FETA 3ILSA 1TF5A 3UMSA 3GC6A 1W5AA 1ZYUA 3OA0A 4H1UA 3ZTTA 1KE1A 5A5DA 2WOJA 2NTYC 2X22A 5EZ6B 4ZZ3A 2Q1UA 1JXAA 1U7PA 1O9HA 1B0ZA 1NNUA 4AJOA 4EZBA 1CRPA 2RGXA 1B41A 3LBAA 3T1QA 1OXTA 1MC8A 3DBVO 1RR6A 4A3SA 4CMIA 1MOSA 1JJVA 1NY6A 4MV1A 3ZDEA 4UFNA 3C2QA 2FQXA 1NWHA 1CUYA 3FKQA 4JEMA 1C3XA 2QHXA 5CBPA 2PSFA 3HDTA 2NXNA 1FTYA 3KC2A 4OBWA 1EA5A 4RK1A 3CVUA 2J7PA 1KI9A 4MV6A 4R0MA 2Q45A 4R9NA 1XMXA 2O7NA 4GYJA 1SXJE 2Z3WA 3VR0A 5AXDA 4BP9A 2SCUB 2VTBB 4TRNA 1BTOA 1QE3A 2X9LA 4IS2A 4GGPA 4EKGA 9ABPA 1EGQA 3CLRC 1JEEA 3MEQA 5EVCA 3S1AB 4G84A 4L5YA 4J0DA 2ODAA 2O2YA 1D0IA 2QGZA 2P9EA 3JQBC 4E31A 4ARZA 1HNXB 2GCOA 4JWTA 1F8UA 2JFWA 1QV6A 2DHRA 2R1ZA 3N3BC 5MN4A 1T5OA 1ESZA 5C5CA 1CFZA 4C29A 5TY0A 1P60A 2RC5A 4ZI5A 4V3BA 3EUAA 3KL4A 3ZWKA 4HDMA 2J3EA 1STOA 1L7PA 3BWCA 2M6LA 2EEZA 3KPVA 4EP1A 2GYYA 2P5TB 3MTJA 5I4BA 2HUPA 1M8GA 1V3UA 1DEKA 3BK2A 1O6ZA 4KEAA 5B36A 1M9NA 1RZVA 1JIKA 4DY4A 4X7BA 4OGFA 4COOA 3B9PA 3G0CA 2V3CC 4KR7A 1QG4A 1R0RE 4S1OA 3BRCA 5C1PA 4ZXPA 1CUZA 1LX6A 1NF2A 3OQJA 3SJUA 3LY5A 1SXGA 2A0KA 2E4AA 2GF9A 3EXHC 4EPRA 1XO1A 5B3JA 2WW8A 3I2HA 1X7YB 3KZ1E 1L5YA 2BHLA 1QXSA 2WWTA 5ALFA 1N3YA 4V0OA 3RC9A 1UL1X 3EGEA 1PFWA 4RGVA 1JEQA 1K4MA 1KAHA 4MAFA 3HR8A 3GRVA 2ZWIA 3WGMA 1O5IA 2RC6A 4PYNA 5I7FA 5KQMA 1IPFA 3KD3A 4X45A 4FINA 4QYWA 5HVNA 4LZJA 4TVOA 1NNLA 1RBZA 3QWBA 2C5SA 1O3YA 1PSDA 2XTNA 3H19A 3NHFA 4LHVA 4LQCA 1D2RA 3AEQA 2NZXA 1LEHA 4JITA 4B85A 5J4KA 5LZ7A 2BI7A 1JJBA 1R4MB 3UJ3X 5KJCA 1L5OA 4IFBA 2XW6A 1BRMA 1CJVC 3O8BA 1H2HA 2I1VB 5T8KC 1RRFA 1NMEA 2HPZA 4EF6A 2B8TA 5GGXA 1P1RA 1X9HA 4JUIA 4MV7A 3NKVA 1V8PA 4WZ6A 1DXYA 4ZO7A 1U9JA 2GRUA 2Q0XA 2QROA 4OO3A 4BNNA 2EC5A 4MGEA 4ZDIA 1D2CA 2B3DA 3B8EA 3ZD6A 1LJ8A 1QIJA 4XD2A 2XNCA 3MCAA 3ZQ4A 4B7XA 3WLAA 2OXFA 5KOHA 3PJRA 4J91A 4ND8B 1MPXA 1Z62A 3JWPA 4LPSA 4G0PA 5CIQA 5KYVA 2YN2A 1R5OA 5K2MA 1GCGA 3O8QA 4FOPA 1Y8ZA 2PGLA 3P27A 2GM9A 2XQKA 1U4SA 4MQEA 1PEAA 1T26A 1R00A 2QUKA 2ZE8A 1Q84A 4DDVA 3UENA 1SBHA 1SKUA 2CHQA 2D62A 3M49A 4KCGA 4L7VA 5EUMA 3GAZA 4RX1A 4YAJA 3WJAA 4XDZA 3IVXA 3NHWA 1TVMA 2GZHA 2I3BA 4EZIA 3WAJA 3FUWA 3L06A 2EKQA 3BDAA 4KKXB 3DQZA 4NHOA 4Y2RA 2Z83A 1GZ6A 3CKKA 2ALJA 3CZPA 3ZWOA 4AO8A 2OFOA 4FDLA 4LJ4A 3L1IA 4HS9A 5FUVA 3IT2A 5KNBD 1XGKA 5IKMA 2XUGA 1F0KA 1EUCA 1G98A 1W76A 2W8BB 3ENKA 2B5WA 3PGKA 2MINB 2CVZA 3EGXB 1XAIA 2Z09A 2BRUA 2NO0A 3FVRA 3L0DA 1P2VA 3N7UA 3QNMA 3J80A 1Z47A 3AEUA 3KQKA 4C5BA 5FYQA 3UGKA 3GLIA 3EZ2A 1IN6A 3GJ8A 5HK8A 4JELA 1W4RA 4IIFA 3OQ6A 1IVSA 3U19A 2C29D 2NV6A 5A7GA 4RWZA 2BDTA 121PA 3OKCA 1DT5A 2ZE5A 4LHSA 1PS9A 3GFVA 2GHQA 4E5DA 4REQA 1M1NB 1RQ7A 1SVOA 1M5TA 3NXSA 4E13A 2GO1A 2I7VA 2DETA 2WJZB 2CB9A 3CUSA 4E2WA 5E3HA 4CRWB 5JNLA 5D86A 1PKEA 1HE4A 2TMDA 3IOEA 3F78A 3M4XA 1JA1A 1NFFA 1C1XB 3HR7A 4P80A 3BXGA 4UHKA 3TQIA 3ZBTA 5AVZA 5EJ9A 2PGXA 3TGLA 1RWWA 2I4RA 1J7KA 3DZKA 4KNVA 1C9MA 3D4LA 5SYAA 4FDVA 3HYSA 3MUEA 4I4TF 3RVQA 3CQ9A 3ND6A 4IV5A 2PL3A 1H9AA 2O3TA 4J9UE 5F3DA 1BVYF 2GJ4A 3RW9A 3OWHA 2HTFA 4BLPA 4ENSA 1G8SA 4EIWA 3LCCA 2DERA 2D5CA 4WWHA 4TZTA 2H85A 2ATIA 3B3QA 2B8JA 3CO0S 5GQSA 5TC4A 4K6OA 1OYYA 2BFCB 3GF4A 1N2ZA 3MZ0A 4L7QA 1ECBA 4MP6A 1IEVA 1C1YA 2WG1A 3HO8A 1YRBA 1I6KA 5B3KA 2ZSIA 1PBTA 1DELA 3THYB 1L5SA 3EVAA 3H13A 4V0LA 1DQZA 2BEJA 4W5QA 1R6BX 4G5QA 1Q0LA 2FB9A 4GX1A 1K5GA 1PV2A 1C0EA 3DP7A 3SZ3A 2GFHA 4GQAA 4WOKA 5ADHA 3ACCA 5EP4A 1W2HA 4C7VA 4DLYA 2C07A 2C92A 3N8KA 4PPYA 2GNPA 1JIUA 2Z2JA 3CUVA 1E2IA 3ETDA 1G3RA 3FOAA 1QM5A 3FYUC 2X1MA 4IGEA 1ESNA 2GB4A 1S2OA 1PGPA 2PV7A 2ZE7A 3LZDA 3QENA 4LHEA 4TKMA 4ZAFA 1CNMA 4MUBA 1Z3IX 4E6PA 5FHRA 1X8KA 1EDDA 4LFBB 3CM0A 1WS6A 4QEDA 5DYGA 4PNHA 4WBNA 3N8HA 2C4NA 3FOZA 3QJYA 1HDXA 3HGTA 1R9JA 2GDZA 2QUJA 4TL7A 3UA4A 4JQCA 4BGUA 2B2CA 3RU9A 1SBIA 2DR3A 1ZISA 4GPD1 5FQNA 3IE1A 1MO4A 2IV2X 1JZSA 3AI1A 4IYJA 3QFTA 4X6LA 4XYEA 3HVRA 4HWGA 3E58A 1MD9A 1W44A 2I66A 3RVMA 4DMHA 4KLNA 4GLFA 5H4HA 2C2XA 2XLCA 2OGTA 2V6GA 3WHKA 3OM0A 2P1DA 3JZDA 1IZ7A 1WZNA 3MOIA 2I4IA 2DUNA 3PITA 1F7VA 3I6BA 5DM60 2PG3A 4S1NA 3PLRA 2CLFB 1G6Q1 1KK0A 3QI7A 4UCWA 4U2GA 4JXXA 2FV8A 4IXDA 3H84A 4HZUB 2Q7OE 5EE5B 1CEEA 3H1BA 4B6GA 3O0TA 5IKOA 2H18A 4KPEC 3NGXA 3WSTA 4Q7KA 5AI4A 4QUIA 5LXTF 4DG9A 5IYZB 1N5LA 1N2BA 2OWEA 3HYTA 1WSAA 3GFRA 621PA 5IK2D 3OZBA 3KETA 4V0ME 1RNLA 2HJVA 5HA5A 3T12A 1L5NA 2OCDA 3GJ6A 1SU6A 1VE3A 3VM6A 4CMAA 1ULUA 4RZQA 3KXIA 3NM5A 1KY2A 3QEBZ 1R0LA 1M2VB 2XCOA 5FUXA 1MFZA 2HEGA 1YQWA 1XF9A 4R8SA 4F2GA 2PVSA 3TLMA 4B4VA 4EHBA 3FOCA 3A1EA 2F1JA 5FOXA 3VC3A 5JFOA 5EFZA 2WICA 5LQUA 1KRXA 2Y0BA 1BVHA 4HWOA 2XCQA 4DMUB 5KBYA 4KWEA 5ALYA 3W9BA 2O8BA 5HZKA 3B12A 3AR7A 3K94A 1I33A 1ZAYA 1P77A 2HB6A 3LBFA 4FE4A 4P4LA 3C3KA 5TPWA 1OYWA 2V5VA 1QOZA 2G88A 6ABPA 2HM7A 5D1NA 1M5RA 2P0YA 3B1WA 1CQPA 2CBXA 4J7AA 3IOMA 4O4JF 2ZJOA 1UAYA 1PFQA 2G72A 3INYA 4UZEA 4Q7MB 2FUG1 4IRXA 3O03A 3WSVA 5L53A 1M7GA 1X9IA 1C1HA 2YRFA 4HDKA 3ZDXB 2ZZKA 3PEVA 4IHQA 4KYUA 4NPHA 1BYUA 1DBWA 1AO0A 4PZEA 2Z6UA 4TVBA 4Y1EA 3EE6A 1QRTA 1XWWA 1MN6A 1SUWA 2IYOA 2AFVA 2HU8A 3R41A 1G5FA 1KAOA 3ONDA 4HGOA 4J9VA 3U3XA 4L2IA 2EERA 3H9UA 2WSMA 4P0PB 3KUCA 4I4NA 1JLLA 1II8A 2JAWA 3FVVA 3IEXA 4IZIA 4LSZA 3DEJA 5KVCA 5JO0A 3HJBA 3N8GA 2XMPA 2VJBA 4NENB 3NFRA 3RFCA 2B30A 1GA4A 3MRVA 2HYIC 1WBJB 5HGJA 3SEZA 3AVUA 3OPYB 1JJ7A 4Q4HA 4EKYA 4URFA 4FMCF 4DCCA 3HI6A 3VSDA 1XJ0A 2LRHA 4GMKA 5DN6A 4O29A 3U3RA 1ISGA 2AG0A 1XCJA 3A7DA 4W5HA 2BHSA 1HQCA 2CL7X 3A1FA 3DAHA 4MUAA 3G1UA 3UUEA 3S8YA 2WLSA 3VA7A 1ZK1A 3A25A 3CLRD 4Q00A 4BCCA 2HGZA 3AL3A 5CPFA 1JLLB 5MGNA 2V5UA 3WV5A 4BXOA 5H5JA 4IIJA 5IXSA 4ZC8A 1AA9A 3ZLJA 2VHCA 3N2GA 4BV9A 1VA4A 1E0AA 2ODNA 3QF4A 3DEIA 3KQTA 4PZ0A 3USES 2Z08A 1ZR2A 3ETHA 1S2DA 3COYA 3EQ6A 5F21A 3UK2A 1Z2AA 3W3AD 1K7YA 1GAXA 4U7JA 2JKYA 3AQ4A 3RC2A 3CZQA 1PR2A 3JX9A 3MMZA 5EHQA 4YT4A 4RQTA 5H68A 5HUHA 1Z25A 3T7TA 1TZJA 2Q1YA 2I91A 4DFDA 5EOVA 5IEJA 1C3LA 3U7FB 4RZIA 4NIMA 1KZHA 2HRBA 1FA9A 2VYND 3DOHA 5LOVF 2PMBA 2FZEA 1SC4A 4ZVLA 4Z4CA 2CUTA 4YJ3F 2JLUA 4R7GA 3UC5A 1VBNA 4UATA 3WQBA 2HD4A 2F1IA 4QXPA 4QT4A 2ZJ3A 3DXXA 4QECA 1V5GA 3GLHA 3LW7A 4Y6QA 4L8VA 2JFFA 3RFFA 3WQRA 3SQNA 1BFUA 5B58C 2EOAA 2P6PA 2XOXA 2BKVA 3RVRA 3V3KA 2ZYWX 5DWQA 1PT6A 4N0PA 2WHRA 2GESA 2NUTA 4LX0A 3NPAA 4X92A 3HA3A 5LKAA 2AMFA 4IIUA 2ONYA 3GXBA 1SGWA 3P0RA 1F0PA 4JT2A 4KAFA 3RSCA 1SXJC 4DKXA 4PBRA 5BSFA 5DI3B 2SECE 1IMJA 5C81A 1QPGA 1UIMA 2QRZA 3C5HA 4F4IA 2XEXA 1Z5GA 3BHMA 3NJ8A 1TTPB 4IILA 4ZIRA 4UDNA 4P86A 2IUEA 5EWLA 1YVEI 3AVTA 4L3VA 1CJCA 1FDWA 2YJZA 2P4SA 3V32A 3R3HA 4L95C 4MWEA 3VNBA 1TT7A 4C0QC 5EUCA 3VMFA 3AU9A 1BGWA 1I9GA 3PZRA 4YP7A 5GJVC 2PGOA 4WXYB 2VCHA 5G4LA 5LU9A 1QB7A 3RIGA 4HRAA 1NBAA 3FYTA 2BGIA 3OBIA 5ENZA 3U9LA 4BATA 2WIJA 2ZG6A 4C1BA 1G6KA 4YI5A 2OGUA 1L7QA 5DTRA 1UC5B 2BONA 2F43A 2WHYA 3Q6NA 4KXWA 4TQUS 5D5PA 3WFZA 3ILVA 2GSWA 5L51A 3GY0A 3C5EA 4V0KA 1ZL2A 4EB6A 2B69A 2C4VA 1RHKA 3CR8A 3T7EA 1TC1A 2E87A 4UTZA 3RTDA 1WOMA 4OA5A 3AEKB 2WYUA 3FTDA 2C9YA 1BE6A 1RI2A 2IU3A 4UMFA 4WBXC 4XD7A 4ZU3A 4ZC1A 4YXWA 3RRZA 1SU8A 3HKEA 4INOA 4M36A 1EFLA 1N5RA 2HCFA 2OLJA 2R00A 3FAZA 1K0FA 3NBQA 1AH2A 5JSZA 1ES9A 1GZ3A 2PGNA 3UXHA 2G70A 3T7DA 1Y7TA 2GRAA 1X13A 4PHTA 2D7JA 4TXHA 1U7DA 3GRYA 4P4SB 5FPYA 4YUXA 4YT2A 3CVWA 1VMEA 1GRRA 4CN9A 4IDBA 1VL2A 1C7EA 1UJ6A 3SXUA 4C3UA 4EITA 3ZS9A 2FMTA 2Q49A 2D3TA 3HG7A 3PIDA 3CINA 4WXHA 1R6UA 6YASA 3GDWA 5ICMA 1ULBA 3DPSA 4ZPJA 3INRA 4L5AA 4NPAA 5DNCA 1Z6TA 4L8WB 4WJKB 2HMTA 4LY6A 2HU2A 3IE2A 4OHOA 3I3OA 4P5EA 2IPNA 2R0QC 3C3WA 3GBPA 4CEHB 4GEKA 5LDGA 1CY6A 3OKPA 4NONA 1J1UA 4G89A 3WIDA 2P9ZA 4F3NA 5ER9A 2WWRA 1JVSA 4LYJA 5HUQA 1A8UA 4DSUA 4YMGA 1SKAA 2JB9A 3PQEA 4LMAA 3O1JC 3ZHSA 1B0AA 4KQCA 1HE5A 4MS1B 4GAEA 1JQKA 1HZZC 3JSAA 1E1QD 4QAQA 1V8DA 2GPTA 2CLCX 2IHNA 1VMIA 3OCUA 4RKQA 2PBZA 2PX2A 4FJ2A 1NVWQ 1P1FA 1R0BA 2C9OA 1NQ5A 2ECOA 3PEEA 5ERGB 1A9TA 1ZM2A 4RVUA 1GU7A 4ZT7A 5IZCC 3URMA 1RLOA 4RQAA 1I1HA 3OFVA 4TZ6A 2VT6A 2RGNC 2DKFA 4P53A 5KQGA 2VIIA 3IQEA 1EVLA 5FAXA 2VJNA 421PA 1RPZA 2I4TA 2PH5A 4JBGA 3N3AC 1MCZA 4M9RA 5ITZB 2JIPA 1B1AA 1DZIA 4RC9A 4EPYA 5BNFA 4W5JA 1D3AA 1YKSA 1TADA 2FETA 1SQ0A 3B6EA 2M6RA 1D07A 1NJ2A 4CQMA 3TNDA 4Q0MA 3QF7A 2G9RA 4HX9A 4LF9B 2I8LA 2PM8A 3LVQE 3FPJA 3NNSA 1L6RA 5L3QB 1NURA 3G7UA 2OVBA 4JXZA 1OFHA 1YVUA 1A98A 2D0OB 5KVSA 4EKEA 3IAM6 3L9WA 1R9MA 4YRMA 1UWVA 1HZJA 3E8SA 3KYCA 2FXVA 1E99A 5K3BA 2H48A 3O4GA 3ROZA 4UNRA 4NP6A 1YZVA 2OP1A 5LZ9A 3WWZA 5DISB 3U56A 4GR5A 4C0XA 8OHMA 4IO1A 1SUIA 2JBWA 4ERXA 1CUWA 4MGIR 4ZEVA 3AUSA 4TXLA 4OLFA 1OWPA 1KK1A 3ZGNA 2A59A 1A4IA 1IQRA 2WU8A 3PFIA 2ZSEA 3ZJ5A 4QFDA 4KQ6A 3TZLA 5I9TA 4MPRA 2Q3BA 3A14A 4IUDS 4J16C 2WMOB 4KUGA 4MZXA 2M98A 2OV1A 3IXLA 1XQVA 4WK4B 3IPRA 2AOTA 1Y1LA 2V7BA 2Y1OA 4K6HA 4Z4EA 4BO1A 4CEIA 4M76B 2R3SA 4OL9A 5GMOA 3OP4A 1DC6A 3C1UA 6ADHA 3CJQA 3K0CC 4B3XA 2YVLA 2NLOA 4MKRA 3I5UA 4REOA 2UVPB 4F6LA 3BFKA 1FJGB 4LNHA 4OXXA 5IAJA 1FX1A 4OHZA 3GLVA 2H2FA 2BFDA 2P69A 3L6BA 5I51A 2ODEA 3HBFA 3MOGA 4Q15A 4R2LA 4YYZA 2AG6A 3W5HA 1SOUA 1A3CA 2ZTLA 3OIYA 2I55A 2ZBVA 4I1PA 1CJKC 1TF2A 3GEBA 4ZU6X 3CURA 1QFJA 4FGUA 3F3YA 5KZMB 1BWRA 1NYRA 2SHKA 2WUGA 3A1NA 2ZSDA 3S2YA 2HRRA 3G02A 1Y1SA 4KR0A 2XEDA 5U4XA 3GP5A 2IUSA 3EXAA 1QH1A 2P27A 3FB4A 3HB5X 4DADA 5JEEA 5ES3A 4EYSA 4O4IA 2RH8A 3TTXA 2CW5A 1TAGA 5E95A 2WF9A 2YJ3A 2ZJ5A 3GPCA 2VK1A 4LNAA 4MO2A 4ZQGA 1IBCA 4J8PA 2PD6A 1NYQA 2TS1A 4MUJA 2QTMA 4G0NA 3OEHA 1E2NA 1WW3A 3W6ZA 1FP4A 2V6JA 1LLCA 1M1YB 2XB8A 3EZFA 4ZK2A 5A03A 1SA0B 5EJAA 3W5IA 3O1LA 2VO1A 2AC4A 3MGKA 4AYXA 2O2SA 2VZ8A 4QTXA 4C1NA 2XR1A 1YZUA 1TUBA 1U8CB 5FTWA 2XF8A 1DO8A 3AM4A 3EXHB 3KSRA 4QG7A 1CQXA 3M34A 5KYWA 1JDPA 1XNGA 1UPCA 2PGAA 5K4AA 2FQWA 1TZKA 1B2RA 3LWBA 3D9QX 4XWKA 3L7KA 1EM8B 2HYDA 1MXFA 2OM2A 1A2OA 1MJFA 3DYBA 1EVEA 1SAYA 2PH1A 1E4EB 2VZ0A 1MAVA 1ZGHA 1ORDA 2JIMA 2RHWA 3D4NA 3FIUA 4UM7A 5CDGA 4J3NA 2EKZA 3EASA 3ETLA 3FSGD 3RVDA 1IN5A 4EMBA 3C41J 3H5AA 3O4VA 2CFIA 2W2NA 1PU2A 3N2ZB 1UKCA 3OOYA 3E03A 2NPOA 3BG5A 3K53A 2VUTA 3VPHA 4AX8A 3LBIA 3LWNA 3N0XA 3HHEA 2VQEB 3R75A 2JIOA 1RWBA 1T1GA 3IKTA 1JSZA 1ORTA 1YDHA 3H99A 3PFBA 1TQDA 2ZU0C 5HNKA 4JX9A 1NN0A 1KQOA 1WCIB 1NQVA 3CN9A 2UXBB 2FZCA 4UHCA 4RHXA 4YA6A 1CQWA 3LC7O 3QMVA 5BSRA 3TOXA 3MB8A 3IAUA 4ZQEA 2P8JA 1QP8A 2HO4A 5KUTA 2O0HA 2P2NA 1NXTA 3HA5A 1HE3A 4AN4A 5IFLA 4P4UA 2NTVA 1GGJA 4YCNA 4TV8A 1RDFA 1VJCA 3MGGA 3KV1A 4UASA 3IS3A 1AGNA 1G16A 1ODKA 4U2CA 8ABPA 4NKRA 3AXSA 1E64A 3LF2A 5DYWA 4U3JA 1X19A 2WJ3A 1WKBA 3MUNA 4L8FA 4M1SA 4P8RA 5FPHA 3WGYA 4D79A 4BVGA 3UFXB 1RZRD 4M1TA 1YBAA 1E1KA 2YQ5A 5JQGA 1M2KA 3ILXA 4C0HA 3RJ5A 1L5ZA 2XH8A 1DC3A 1ISRA 3RTCA 4HTFA 4FUTA 1FZTA 3OZUA 3ESBA 1NC3A 2PL9A 4WX2B 4O08A 1XZLA 2PH7A 3QBJA 1TK3A 3WJ1A 1JSXA 1S8NA 4GEGA 3PUWA 1K08A 1LX7A 1YIDA 4OGKA 4Z49A 2A1TR 4EMUA 3CSSA 5FL7D 1YS4A 2D5LA 3LNCA 3IDQA 3CE6A 1N4DA 2WNHA 1KVUA 4JHXA 3UA3A 2PJRA 3DZGA 1EK6A 2ID4A 2HQRA 3O1IC 2JATA 1SXJD 2R5NA 3PC6A 4UBMA 3VBCA 2YWHA 4XLZA 5KX5B 1PF7E 4YAWA 2PS0A 5ENDA 4JGGA 4NC9A 5KHAA 1JFTA 2LVBA 5KKCA 3VJRA 3UAYA 3RSQA 4QQFA 4AVYA 3H87A 3VZBA 3KAKA 5BY2A 2M6KA 4YC7A 1DRKA 3QWFA 3O8CA 4JI7B 1LPMA 6PFKA 1ZOOA 1LSJA 3NGMA 1TVCA 3M6XA 3IQZA 3NHAA 2NZYA 3HFGA 1V95A 2ZROA 3DSRA 1YQ9A 3ITEA 4KYVA 3OA2A 4MKXA 3O73A 4FVTA 1FDOA 3R74A 2PMDA 4HYTA 1L4YA 2I7TA 2NTEA 3HWSA 5DGXA 2D59A 3KRTA 1VPVA 2QKYA 1LVGA 1PUJA 1YOVB 2BC9A 1H5QA 2O3SA 4ZAYA 3VKUA 2C5EA 2ZRLA 4BC1A 4XVRA 3BD9A 4AW9A 4KQGA 4NCNA 4YMTA 2D2VA 3L93A 3SOZA 1BW9A 2H11A 4HAXA 4MI3A 3DT9A 2JFUA 4UXIA 1W96A 2AXEA 1WKCA 4A2WA 2AJBA 3MWKA 3OLVA 4DT1B 4ND5A 3ZGZA 2NO4A 4M88A 4TOIA 4RTOA 1JIQA 2Y99A 3ZIUA 2E85A 1EA7A 1G9TA 1KNXA 1Z6ZA 1D7OA 1UINA 4HNSA 1VHJA 4FGSA 4JR2A 4MYTA 2NO9A 5T64A 1YDFA 5LLDA 5EINA 1YL7A 2QB5A 1QQ6A 1IY9A 5BV7A 1RI1A 4X84A 1JU3A 4IIDA 1WQ3A 4C4OA 5KS2A 4F4DA 3KQLA 4YJHA 1OZGA 5FTMA 3RSZA 3FYUB 1GAJA 3MWFA 1G5TA 1T8WA 2J46A 2W90A 4IV0A 1ESDA 4WNIA 3V4PB 1XPUA 3L4JA 4BBAA 4G8JA 2VJOA 4RCYA 2XOKD 1R8XA 3H2GA 1UP6A 5CA1F 2J9GA 5JLAA 2WM8A 4MLZA 4QGHA 1UANA 2G1AA 4QASA 2AW5A 3SIWA 1WVMA 2E37A 5A4JA 4D56A 1N5DA 1MEJA 3OC0A 3PRJA 2XQGA 3KJNA 2MOKA 3KOZA 1XRNA 3HEBA 1EG7A 3I34X 1GTL1 2XADA 4BN4A 4PLGA 2C2MA 2QNIA 3WRVA 4TYNA 1XX6A 2OBBA 4HGNA 3KPJA 4QSMA 1PNQA 1Z6GA 1OFTA 4DSTA 2JFXA 2BM9A 5G3YA 2FOLA 3JVEA 5DTIA 4MCJA 3BCHA 3HKCB 1ORHA 1JKJB 2GA9A 5E2BA 5TXGA 3R0JA 3IIIA 3ORSA 4WEQA 4QFCA 3V1KA 5JATA 1I4TD 1T4MA 1OPRA 1V2HE 3PYXA 3NAMA 4XWOA 3IHLA 2UUAB 2EFCB 2QZJA 3AG6A 4OJYA 4Z9BA 5TB5A 4G41A 2PWBA 2B8EA 2DU8A 4URHA 5DT9A 2YHIB 4G85A 3IEVA 2AEMA 3P4UA 5BWCA 3DHYA 1UMKA 1J09A 2WU1A 3DOFA 5ECYA 1V6CA 2HMYB 2INGX 4PTZA 4GD3Q 2J5KA 3OE7A 3I6ZA 2BFBA 3GLSA 3OZEA 5F9MA 1AXRA 2QTGA 3MJTA 3CMCO 1ZC4A 4UW9A 3JYNA 4QO7A 4NULA 4XFDA 5EN4A 4ARCA 4ZCSA 2FEWB 4JC5A 1BQ4A 3HUEA 4CTMA 3L7AA 1JSCA 1IJBA 3EIXA 1N6NA 4FCWA 3R7AA 1UBNA 3VAYA 1HX7A 2VT2A 2R47A 1EBBA 3F3KA 4PLHA 4WZBB 2OC9A 1SBZA 3A3YA 3WBFA 3OFJA 3M9XA 2BKXA 3DLHA 4W1QA 3UXYA 4DR1B 3U7JA 4PYLA 2QXUA 3WICA 2X2OA 3KJXA 4WESA 2V7VA 3BN3A 3O8OB 4P3KA 4X1OA 2HMSA 1Z68A 4M4SA 3IEIA 3NUGA 1E1DA 1FRVA 4DSNA 4Y6RA 4L9SA 1Y8QA 1JQ3A 1M10A 5JJKA 3RE1A 4DV2B 2FZ4A 1JA0A 4AQDA 1AHPA 1EUDB 1SBNE 3KZMA 4MMYB 4DQVA 3GFBA 3HB7A 5CIWA 2HSEA 4B34A 1U1IA 4FMDB 3QX8A 4GBMA 4TYPA 2HCBA 4WASA 3VMMA 3LX4A 2PS9A 1IWPB 4KLZA 3FLMA 1PT7A 1V47A 3KR9A 4YVFA 4HLQB 3KU1A 4CFYA 3H4IA 3JQGB 4UTPA 5B3LA 4C87A 5HKKD 3UMMA 3KFXA 4MULA 1GLGA 1GKIA 3JV7A 4LJSA 2I5PO 2JLAA 3AETA 3CWZA 4D46A 4DIFA 5HKBA 3DXYA 5IWCA 5CLFA 5JSFA 2A5GA 2HK9A 1QGOA 1TLFA 3OZ7A 4RV9A 2LE0A 1R4AA 2GMWA 2WUEA 3HBNA 4Y7DA 1ND6A 1PHRA 1IWOA 2QSYA 1JR6A 3D1LA 2B78A 4RD1A 1ZSVA 1F9AA 4DE5A 4GRAA 1A9SA 4PWZA 1GFIA 4WT7A 5JS2A 4S2EA 1PR4A 1ZRMA 1QO0D 3WGKA 1XC7A 2LTAA 3QUAA 3SX0A 1TMYA 2BGMA 3TNFA 3FHCB 3MOSA 3W2TA 5JSUA 3NS7A 3FWKA 5IMSA 3CT4A 4AJKA 3WYDA 2BLLA 3VYTB 2Q3MA 4ACAA 4DV3B 1X3SA 1XYGA 3BWDD 3D2LA 2G6BA 1GCIA 2JLBA 2XMDA 3AO0B 3NALA 2OPHA 3KO8A 1FL9A 4HLDA 3ZK7A 2C77A 4B4OA 4DJEC 3AR3A 1YUMA 2VUUA 1GZVA 3PEFA 2GVZC 2ZETA 3TF5A 2YNMA 1YHNA 3KUXA 4KE7A 3JY6A 1IK4A 1D8AA 1CZKA 3FBWA 1CD5A 3B6ZA 1ORRA 2FMIA 5G40A 4D9KA 1KI4A 2XZTA 1UOOA 3NHMA 3PR1A 5T6BA 1BXRB 4JBYA 3KQNA 2XZDA 3BVPA 2J59A 4I5EA 3ELWA 5LJLA 1MW9X 2DPYA 3GFQA 3LKBA 3P0JA 4TV9A 4AJNA 1PAUA 4XIIA 1LTHR 5F9HA 1QZ3A 1IBRA 4GDMA 5DW3A 2DBRA 3KXPA 5FI5A 1E7MA 5SY9A 4ARVA 8MHTA 4QJ5A 1KPHA 2XDAA 1EU1A 3WIOA 1Y3HA 4BMPB 3TQCA 1DAIA 4CG3A 4OLAA 2JW5A 2XCRB 1TUGA 4B3TB 1KEEB 3IVCA 1JQLB 4ZAWA 3VV2A 1WHTA 2UYCA 1EK1A 1TE2A 3NHRA 3GGGA 5ALKA 1TIKA 2Y92A 5JNUA 1R5BA 1QX3A 4WLOA 1Z8FA 4S1VA 1ZHOA 4GVXA 2ZUEA 2IYNA 2VBCA 2O4CA 4N3NA 5FLKA 1Y3BE 3NC0C 1E9AA 3PPYA 1F6BA 3IJEB 1MZVA 2V96A 2NM0A 4EPWA 1ZD8A 1W4BA 1Q0HA 1BJKA 2ECKA 4D9MA 5CLQA 1IHDA 3B70A 4JZYA 2YZKA 4LHWA 5A06A 3ZUGA 4MW5A 4R51A 4RLSA 2BVNA 4B84A 4DEYA 1ETUA 3JAKB 3R23A 3D8SA 4TXMA 2AZMA 4ZU1X 1SXJB 2XBLA 2HSJA 5E4JA 1HLGA 3SYNA 2R48A 5CFOA 4DJ5X 5KOJB 1U11A 4I46A 4INPA 1Y1KE 1H3FA 3VPFA 1F2TA 2Y76A 1FOEB 4DIBA 2IS1A 1XROA 2AH5A 1IK6A 1KEUA 3DV0B 3WGJA 4BDTA 1JIXA 1WUKS 2P2YA 1QVAA 3FNQA 2OD2A 3PRKE 1LDBA 1NJ5A 4RTSA 4J0HA 4OJKA 3AUXA 2HV8A 1QVWA 3LDHA 1J8YF 4IIBA 3UFBA 2CLMB 3AB8A 1GGEA 1LBTA 1U7OA 2PRYA 4E70A 4XCXA 3TKAA 4E5NA 3EF0A 2A1UB 2W2PA 3T3DA 3I8XA 1K7EB 4PGAA 3W79A 3PJDA 3AP2A 2WQ7A 1DKPA 3MTAA 4GKAA 4UHBA 3ZG6A 4KXNA 3IP5A 4F1KA 2XB9A 1FFXB 1U1GA 1IXSB 4HC4A 3SJ7A 1WTCA 5D3QA 3NNNA 4IH1A 2PLNA 1SOVA 1SBQA 3WNQA 4D42A 4XLTA 2WKQA 1M67A 2NAFA 4N9QA 4JGBA 2WIKA 1KDYA 1R2QA 2EKDA 5MN6A 4AY2A 4F2PA 4A2PA 4QBIA 5H8WA 5BN4A 3CF6R 3R5TA 4EY8A 4XVCA 4FHGA 4CR7A 3CTPA 5IJ9B 1D2GA 4ZVNA 3VPXA 4KHPB 3EWIA 2Z1NA 1NI3A 2JBAA 3OTHA 3QMMA 3I5YA 3AHDA 2VEOA 1U2PA 5BV8A 4OGWA 4E09A 2YWXA 2X8JA 4HFJA 5EJ5A 2BSXA 2IXFA 1J1ZA 3Q9NA 5I7UA 4MLPA 1R37A 4LDZA 4OATA 1DJPA 2IPXA 3AWIA 3JALB 5TPZD 3ZY2A 4PGGA 4A6DA 2WFLA 5BSEA 3UOAB 5EIOA 1M83A 3VU1A 4N5DA 3VVLA 1VSVA 2JCXA 2ILVA 2K2WA 4L85A 1SRQA 4E94A 1MRZA 5L7TA 5IZCA 1P1BA 4RPJA 1EESA 4U6NA 4CR6A 3AJ9A 4PSVA 3QXXA 3Q3VA 2Q21A 4L57A 4GL2A 2R5FA 1F2VA 1NMYA 3CBGA 1UZMA 3F6RA 3MK31 3DTYA 3NOOA 1YQTA 2QYTA 2FSPA 1L4FA 2O1SA 3I9V6 3MPUA 3QXSA 5C8VA 1HYBA 3TW0A 5JHHB 3PPWA 5C8YF 1G5RA 2E55A 4KH0A 5KTYA 1Z4NA 1L8QA 3GUCA 2VLBA 2E21A 2VZ9A 4RKFA 5DU2A 4B6JA 3O26A 2CYCA 1G291 4OOEA 4ZALA 5JCJA 2CFRA 2EFHB 4MQLA 1Z0JA 5JAZA 1ZHHA 2XVZA 1REQB 1X74A 4CLOB 4ZEWA 4XH9B 3TLCA 2X77A 3T06B 4ABTA 2X9GA 2EBFX 1JDZA 1OX4A 1NONA 4KE6A 2JFZA 4HPJB 4YBZA 4AP5A 5DIFA 3WSWA 3V97A 4F5EA 3THWA 3RT9A 1BMQA 1ZQ1A 4X54A 4E11A 1NLYA 4AK9A 3PJGA 5TGTA 4PWYA 3WB9A 3KOWA 1AD2A 3EPRA 4ES6A 1A9XB 1W8DA 1JAIA 4WN9A 4YV2A 1Z3CA 4FKBA 3P96A 4CPDA 1HV8A 1NTOA 1T25A 3MAAC 4GOOD 5FWYA 1TXGA 2PU5A 4R68A 3T3GA 3GFOA 1UEIA 3E5MA 4IWNA 1P4SA 5TMBA 4X8LA 3JARB 4G1FA 1CUFA 4QXRA 4RD4A 4V38A 2JI4A 1AKVA 1T5BA 3WQSB 2R6GA 1TVEA 2QA5A 3QWIA 4WQMA 3T38A 2XT0A 3IQWA 4L27A 3W4JA 3EQ8A 4QRIA 4G5HA 1M8PA 4J16A 4C78A 3KR1A 4UFOA 1JXQA 4JFAA 2AD1A 1VYUA 2NSYA 3H6KA 3OAAA 2JIZA 3JZFA 4M0MA 1WKVA 2GNAA 1FSZA 3EH1A 4RHFA 3WOHA 3DF7A 3SQXA 2ZIAA 1USIA 1UADA 1V3VA 2PZEA 3D59A 3RWBA 4BIIA 4BLSA 4NG5A 1XXHB 2Y1WA 1DV2A 2QGFA 4L75A 1AKWA 1E9DA 4ZCQA 2AN3A 4YLGA 4N8SA 3WL6A 2QRVA 1XZNA 2PKYX 5JIBA 2IYWA 1WSDA 2R7KA 3W9SA 1TO1E 1QLHA 3ZDYB 3AR4A 5D3MA 4KOEC 5IVPA 4B35A 3M9WA 3TLZA 1BEEA 4RQBA 4B31A 2CE7A 3NUQA 1ML3A 3O82A 1JHQA 3G59A 3O8DA 2AVNA 3LUKA 1E3TA 3UOWA 1BJRE 3HXPA 1NR7A 1HG1A 5KVQA 5CFMA 4ITUA 2GVDC 5EG5A 4B4KA 4AUNA 3ZQ6A 3K9NA 1RAEA 1DMSA 3FKSA 4H7FA 3G2IA 1KO1A 3JQFC 3N8NA 1O2DA 2Q9UA 4N3AA 3F96A 2PZAA 1KDRA 2DSTA 2WK1A 4MVJE 2NZ8A 3JR7A 4L3WA 4TRRA 1AXEA 5CA0A 3AR5A 3OIFA 5BSMA 1CCWA 1V7QA 1GQ2A 2F4VB 3A3NA 1M2OB 1PZNA 4QUHA 2JDIA 1KAMA 2I54A 2PO5A 1C4XA 2EW8A 2Y2VA 4MR8A 3ZS8A 1QDUA 4DR7B 1TCAA 1N8KA 3PFWO 4I6EA 4RNCA 1E2QA 1XVTA 3K1AA 1BU5A 3ZDRA 4MGYR 1PJLA 2XCLA 5IC5A 1CJSA 4ZO9A 1GR1A 1NZDA 1U2GC 1V37A 2CT8A 4UBJA 3A26A 5EPUA 3T94A 3W2GA 4LV8B 4C7OA 2IBSA 1EK0A 2XKJE 3JVIA 1RXSA 5G0VA 2JGIA 4I1OA 3QIVA 4JOQA 1DMRA 1R16A 4PYIA 1E5DA 4MUFA 1M2EA 1QHSA 4U1RA 5BMVA 1N3LA 1XU9A 2RBGA 5J5AA 1GADO 4QGBA 1U3UA 3FCSB 4V0MA 2KBFA 2R9VA 1AHNA 2JS7A 2VPQA 3WMFA 1GFZA 2PUFA 1CEQA 3KT3A 5EIEA 2K4MA 3C8MA 3X2EA 3C7KA 3VZDA 4AUMA 5FORA 1KJ9A 1GGKA 1D9ZA 2W6PA 4LGYA 4EF4A 3PVZA 3OURA 3MMPA 4JT4A 1YR1A 1XIVA 5AVXA 4O02B 1OI2A 3HJRA 2IOQA 2ZVPX 4U5QA 4WERA 2NXWA 5DO9A 4YMLA 1P2SA 1QUFA 4FB5A 5JYBA 5J9FA 4PRYA 1SQ6A 5F23A 1EGVB 4X20B 5DNDA 2OPBA 3T9FA 1I3MA 2V74B 3CX6A 2XGMA 4WIAA 2NIPA 1VFPA 1EXDA 2OLEA 3GVCA 1NBME 1JYSA 4CCYB 1LW6E 4LF5B 4M1EA 1CTQA 3M5PA 1VJ5A 1T2UA 4DPMA 4E7PA 3NR2A 3T52A 2VDWB 3UXMA 6LDHA 3DHVA 2Y4NA 4QU9A 4IJUA 4R8KA 5JO9A 5KJ1A 1A9YA 1XDSA 3QVMA 3TSAA 2DPLA 4TLLB 4URYR 1ISSA 2YVAA 4NESA 3RYHA 3B52X 5IW8A 4AZ3B 4DHWA 2FEAA 1T3ZA 4FQ8A 4ZYXA 3EW7A 4QTYA 4JEIA 2FPGA 3QI2A 3OQHA 4ZVOA 3W6NA 5DI9A 2FFJA 4N5LA 2GK6A 3LAWA 1P4RA 2KYRA 3RNLA 4J0QA 3KV3O 3OQNA 4GXNA 1WQ1R 2HRDA 4KJZA 4HF7A 4N7BA 4LJYA 2N3ZA 4IFIA 5KDOA 1PP4A 1U3CA 1H2FA 1MIHA 2ONZA 5CB6A 4YP6A 5IVHA 4PN3A 5BW4A 2ODPA 2D1RA 2HSGA 2GHRA 4I4TB 4I9HA 5F1PA 2OYCA 4FD2A 4CODB 3IPXA 3QOXA 3ASZA 4HUQB 4P2BA 1TKRA 4YRLA 4IJ5A 1E61A 5EL0A 5HJ5A 5KOIA 2IY9A 5AIAA 2HY7A 4DB4A 3LT5A 1BE1A 3H0KA 3H9GA 1HFJA 4LC1A 2XUOA 1OAOC 1QG6A 1G21E 3DMPA 3Q1KA 4UJ3A 4EMSA 2YW2A 4L4XA 3TZHA 3AVXA 1Y5MA 1ZD9A 1DAFA 1XTJA 3A70A 3IVAA 2H4HA 3MVEA 1QHHB 1BXGA 4YLEA 4B09A 1ABBA 3B78A 5CURA 4O0LA 1M0TA 4UBLA 1YJCA 4OQZA 1W1UA 3HH8A 4NYMQ 1YQQA 3CH4B 1E7QA 1NXPA 1TKCA 2DECA 3I72A 4R9SA 1YXMA 3O3OB 3OQIA 4KXMA 1JLKA 1BROA 1UBCA 1XKLA 4CLXA 1Z2NX 3FPBA 2WZDA 3RADC 4FCTA 4ALLA 4PHGA 5ALIA 4OK6A 2Y0CA 1UBFA 2JI6A 3KJZA 4ZCLA 2FEPA 3HKDA 4FI3F 4HFNA 3R9XA 4UEOA 4EDFA 4JASB 3WWPA 1GYRA 1YS2X 4UBNA 1JG2A 5JZMA 4CMKA 1W9HA 2NVWA 1CP3A 3Q7EA 2YRXA 3SC4A 4P81A 1M1ZA 1U3FA 1VRCA 2FQQA 3ZCPA 2C98A 1R0YA 2PR2A 1LPBB 3PJEA 4RLQA 4U2DA 1V43A 2O50A 3EAGA 2C97A 2QGNA 1G5HA 3LQ2A 1VJDA 3QKSB 5J43A 1E62A 3KCQA 3UJDA 3UV3A 2IOFA 3PWSA 1FU8A 1Q2XA 3PNKA 3WRWA 5HDQA 1BH6A 2W58A 4Q1AA 1N9GB 1VI6A 4B75A 4NYMR 3RRNA 3FZQA 3LC1O 1TQ8A 4H7PA 4JI2B 1JG6A 1YNSA 1MJ5A 2LUOA 1EFRA 4L22A 5DOZA 4HDSB 5E6RA 4V0RA 5CEEA 3KLOA 5JAQA 3AYZB 2OFPA 3K09C 2HFJA 3NRBA 2GUGA 3TL6A 4DCUA 4E4TA 2ASVA 5CLIA 4YJ2B 3W7BA 1N2HA 4HQKA 4O5OA 4PCLA 2HA7A 3EODA 1FFYA 1CR6A 4NOLA 4QWMA 1AG9A 3PNYA 2Y3IA 4JI1B 3WS7A 4XQEA 1FNBA 4YB8A 4HATA 2XE7A 4MLDA 4MB6A 1P2BA 1MOQA 4MQFA 3A3OA 4A0SA 3MA0A 4CKWB 2XRMA 4D5EA 5LXTB 2O8FB 3V1MA 4TMTA 4F7DA 3BS4A 1J4AA 1YB5A 2FFBA 2G0NA 1PK8A 4RY2A 5CHYA 5SYNA 4EZEA 3A1TA 1XP8A 5CAEB 4O4LB 2BUCA 1C8BA 1NP7A 3NWJA 4M9SA 3CPHA 1WSWA 1WA5A 2A3RA 3S5UA 2IKQA 4E32A 5EJGA 2VK8A 5LMNB 3ILHA 1B76A 4MH0R 3BMNA 3L0CA 5JDIC 1NJGA 4XGQA 3H5TA 3P9SA 1I7NA 3QLEA 2QDKA 2HSDA 1P4GA 3CEHA 2IK8A 3RSOA 1DX9A 1P5FA 2A9PA 2FOXA 4Y98A 2J4DA 2A4MA 2VEDA 5EJFA 4BMDA 1I7QB 3GLQA 3JD4A 1UOEA 4QPCA 1Q21A 3LG2A 1GARA 3GGDA 4G3XA 3QG1A 4AUKA 4AMYA 1W9MA 3G2KA 1QGAA 1C3VA 2IEYA 3P0FA 3UJPA 2VHVA 3R9IA 4BQPA 4YMHA 5JCPA 3AP1A 2PUWA 5GVRA 1F8GA 1MOPA 2YWGA 3EMVA 4M9CA 3D6TB 3FZEA 1U5CA 2G40A 3I05A 1OZ0A 1IQ0A 1F9EA 1ZO8A 2XVAA 1B4DA 1NHWA 3C6MA 5LP6F 4YUYA 5JOQA 4BNXA 5KKAA 1E7YA 2CFOA 4MRRA 4Z7QB 4H18A 4WVLA 2G67A 4LF7B 2WIAA 2R7MA 4L51A 5A1TA 5ADUS 3DPIA 1CYEA 3X1ZA 5C5DA 1WPRA 2WM2A 3BXXA 1F12A 1PJ8A 2I1LA 1Z6QA 4DC1A 4MWDA 1NI4A 1E9VA 4WCFC 3VR3A 4KV9A 5D85A 1T0HB 3WO0A 4IDEA 5AHWA 4UMDA 3OPMA 1JEYA 2RKOA 3SQDA 3EARA 4EJ6A 2FXIA 2ZITA 2QPTA 3G5LA 4WKBA 4XUCA 2C2HA 3VO8A 3VPAA 1L7MA 2W37A 2J0VA 4I4IA 4Z5XA 1XTUA 4JU8A 3QFHA 1QIMA 3RQIA 2QJFA 4AWXA 1IATA 4FMCB 2C4MA 4KN8A 5A05A 1D6SA 3UW3A 3K72B 1L5VA 2PZGA 4PNEA 5IN5A 1Q1QA 2FSVC 1WV0A 1K8ZB 4DAEA 5CB4A 1OA0A 2XE6A 2R11A 5ILQA 5FBWB 3P1JA 4AJ4A 1I4WA 4JKIA 1PNTA 3SZRA 2VPZA 1UMCB 2GZ3A 4GYKA 4R1UA 1O89A 5ES4B 2A0WA 1YK0A 1N6LA 2VL7A 3E48A 4N54A 4NECA 3V7FA 4R8LA 1G7CA 1NOJA 2GD6A 1EVJA 1ZM9A 3AG5A 5AKEA 4BV3A 1KTVA 4C6TA 5J2TA 4KR6A 5FQOA 1QG0A 4NZMA 4AF7A 3OLQA 2FZWA 2VSYA 1E1NA 3BB1A 5JJBA 3JWIA 3A0UA 5K6TA 4UXJA 1U2DC 5ECGC 3ZV3A 3NHLA 4RMJA 5DT2A 3NCHA 2AFHE 5K01A 1E9EA 5BQXA 3RAFC 1WXFA 2ZB7A 2YV3A 3GQBB 3HO6A 4EVIA 3TJMA 1KBZA 3JAWA 2ORED 4XOIA 3F5MA 3DUFB 3JQQA 3GNSA 4HMOA 3GRKA 4OF4A 5DHUA 1ANKA 2Q6IA 4QYMA 3WLLA 1PN3A 2VYVA 3JASB 5KQLA 1S8OA 1KYYA 4DLZA 2BMAA 1G59A 1ECJA 2AMJA 1SCAA 5KWJA 4B6FA 2Q3LA 3I23A 3R0ZA 4NU0A 4DCNA 3EEBA 3USZA 4ZV9A 1YR2A 4MIOA 3D4IA 3BJZA 4YJ3B 4V1CI 3HRKA 5AVTA 1UBOS 1E1CA 2XUIA 3H5IA 3I58A 2I8AA 3Q3IA 3R6TA 3ONEA 4JI6B 3HLTA 1HDOA 4Q7LA 3OJWA 4IFTA 4GGOA 3AVQA 4DUGA 3S3TA 1SUCA 4H7KA 1K27A 2HDHA 3ZXIA 5FPQA 1DAEA 1YA4A 2CXXA 4XIFA 1IB0A 2IY7A 3C4JA 2IGTA 2REQB 1CE8A 1YR6A 4J1QA 2EBHX 4MINA 4E5VA 3DOJA 1M74A 1OFUA 1U31A 4Y8VA 4EW2A 4BFZA 3WHIA 3DC2A 4M3NA 2R8EA 4R7TA 3TZCA 5CDYA 2ZZNA 5DYNA 1IIRA 2PKRA 2BEWA 3CB4A 4Y0NA 3V46A 4V1CA 4R54A 5JS1A 1ISHA 4U7GA 2RI6A 2C42A 2Z56A 3BL8A 3BRWA 3DZJA 4D45A 4F3RA 5E0OA 3ZLTA 2P65A 3KSAC 3LZCA 4NF2A 4JQZA 4BAUA 1T5SA 3LDGA 2J0QA 2P1ZA 4ZYVA 1T1EA 4F71A 4NS1A 1CZUA 2B8NA 2IT1A 2TYSB 1NRWA 3CPSA 5FOWA 4ZAXA 3ZLUA 2ZVDA 2A9OA 3VO2A 5GIPE 5JR3A 1CE8B 2Z2IA 5I7EA 1XTTA 5K0SA 4WA7A 3PUVA 1M1XB 2BEWB 4EA6A 4DIDA 4AKIA 1EH5A 1KP2A 3OVMA 2P9QA 2NAPA 3FUTA 3LUBA 1NXQA 4AKGA 3DHEA 1CW2B 1KOGA 4MVJH 4AJ9A 5BR1A 1SPBS 4EGSA 2Z9DA 4LDQA 1J24A 5LZ5A 4ZI7A 5F2NA 3GPIA 3HVUA 5M2QA 1FIUA 3IBTA 1KJZA 4D9JA 5DVZA 3QE3A 4K9QA 3NHKA 2OO5A 1N5JA 2QMQA 2UZAA 1QF7A 3B5EA 3TGWA 1XN4A 2FUKA 3JVVA 3IR5A 4FX5A 2J9YB 1AKRA 3GZ4A 3PUHA 3CLSC 4H6WA 3H1EA 1ZH8A 1NRIA 3BPSA 1RJ9A 1VRVA 2Y4OA 1QP4A 2WD8A 1QZTA 1DTWB 2WJGA 3E2PA 3EOBI 2R60A 4G0OA 2FWMX 1H1LA 4QFBA 4WXMA 4F8JA 1Q11A 1JV2B 2C7OA 2HA6A 4A10A 2BJHA 1Y48E 2WUVA 4G9EA 4E15A 3BWMA 4IKPA 4MYHA 4PLWA 3MRTA 2O8EA 1TJNA 1QHGA 3LGAA 4GMDA 4MRMA 5HRAA 3L7DA 3DOCA 3HM9A 2H1OA 4IOMA 3TW8B 4Q1EA 5KIAA 5JPCA 2AOXA 4HXEB 1ZJ6A 5DHPA 2YY7A 3OKFA 2CDBA 4JB2A 4EBFA 5HJ7A 2RI1A 2DWUA 2QSUA 4MUXA 5ALSA 5FNVA 2IXGA 3SC3A 2O54A 5PNTA 2H1VA 3E53A 3FSJX 3EGDA 3HP1A 3PHGA 5E0KB 4BLUA 4HAYA 4OB7A 3UGTA 3AGPA 4P2GA 5IUKC 1RM0A 2AI1A 1H4SA 4YRSA 2RARA 4DTCA 1JZQA 2V3WA 2XVYA 4RK6A 4EAAA 2R97A 3WIEA 3SYTA 5EKSA 1MO2A 4DIKA 4AJLA 2I6SA 3E3LA 4FS3A 4UUBA 5K8CA 3LVRE 3RUHA 2UZ3A 3K30A 3N39C 4EG3A 1VIVA 2AI3A 1KPGA 2QLBA 3MYYA 5JAHA 1ZINA 3OZDA 3MWDB 4XWWA 4L08A 4EUHA 5H02A 4UTXA 3W1VA 4K5QA 3UNXA 1DTEA 4BNTA 4ZOQI 2IUUA 3ROQA 3PPVA 4C88A 1G64A 3CNHA 4NJMA 5L7WA 4NK5A 4PYRA 1HI9A 2WV9A 5K3FB 4IUYA 4DUZB 3MLBA 2B98A 2FUCA 3OEEA 4UU7A 2ZWVA 3V4OA 4S05A 3MNFA 4N0DA 2VDOB 1B7GO 3EZ7A 4PX2A 3F49S 4RK7A 3GDOA 4LY3A 2H3HA 1VG0B 3F67A 1ENOA 1TI7A 4QRDA 4IIEA 2Y1XA 1KKUA 4WUVA 1VHDA 3ZW9A 1HTBA 2WJ4A 1KRHA 4FCVA 3ST7A 1R4NB 2Q5EA 1IEXA 1UFVA 1Z12A 1KNQA 1U6KA 4C05A 4C3OB 4HT3B 5CXUA 3ZWMA 1FFAA 4MCHA 2BMJA 1XDUA 1YZTA 3EUWA 3I1IA 1N0UA 4IDFA 5HF6A 5LC1A 1A2KC 1U4NA 3R0QA 2XDYA 2EL7A 3GJTA 5BNIA 1T3HA 3FF4A 1HLPA 1A2QA 1TJPB 2J3DA 2XKKA 1EVYA 2GN0A 2JHFA 1NF3A 5I8PA 2CF6A 5KTRA 2RONA 4D41A 5HF9A 3LQKA 4BASA 3KYDA 3F4LA 3K70C 3UEOA 3EZ9A 1T8TA 4XEHA 2H1RA 4G67A 3S2SA 4AG6A 3VVBA 5DXFA 2H2WA 1JFRA 3WFJA 5C8XA 2ECPA 2RGUA 1Z8HA 1AV7A 4DLTA 3S81A 1GQRA 2WWWA 4LJRA 2FUG6 5F64A 3CS3A 4D44A 5BVGB 3NOQA 3ZWNA 1M3SA 4LDRA 4XKJA 4HN4B 4TKUA 4UPEA 5LYJA 5EWMA 3C1AA 3MCUA 3D2BA 3ZJTA 2Z8YA 3AKEA 1IN7A 3EXIB 1Y6GA 2OUIA 3IT1A 5E1DA 1II9A 1TGVA 2XSZD 3QBTA 3GGCA 2VI5A 4R9UC 5HP4A 2GK4A 2WDZA 4YP0A 4YJFA 2AXPA 2X41A 3DLCA 3TGPA 2AOUB 2BCEA 2FMFA 4RMIA 4LSWA 2Y67A 2XMZA 2IYQA 4BVFA 4J7CA 1VYTA 3PDIA 2BUBA 2V8OA 4RPKA 3NONA 5EY5B 4FFBA 4ZVUA 2ZM5A 1I3KA 5KWVA 5L6LB 1TEHA 4TTIA 3K31A 4P3XA 3F9CA 1UMDB 1IBLB 2WJ6A 5HR5A 5FXMA 3AHJA 1MORA 1PEYA 5HYVA 1V16A 4PRKA 4BB9A 1JFFB 2ZUSA 4G1BA 2ZYIA 4L9AA 4BV2A 3AERA 1GTSA 4H17A 5REQA 1KOFA 1HNNA 3ZKWA 1ISPA 2A7QA 2W4IA 4YJFB 3OZSA 3DFFA 4QUBA 2HRCA 2REOA 1K6EA 1WMAA 2VPXA 1QC5B 1YU9A 3AXTA 1FVXA 4NXNB 4TZKA 4OHVA 5JLJA 4H1HA 3EYAA 2YS6A 3ZW7A 4GH5A 1M1UA 1SQSA 2V0CA 1O96B 1PJ3A 3WK6A 3NTVA 1G3QA 3LPAA 4NSNA 5A4AA 2XDWA 2XUPA 4CDMA 4X24A 3RUDA 3HB1A 4WHMA 2BKAA 3HZOA 2GPNA 4PYQA 4A8JB 2J41A 5DSZA 1WB6A 3GFFA 2AYZA 1QWOA 3NX4A 2A5DA 5IAGA 1J8VA 5REQB 3IQGX 2FRVA 3CGWA 4FK8A 1TCUA 3D6VA 3E6AA 4P31A 2ECQA 3RSSA 4N76A 3P2OA 1VMKA 4M6WB 3VX3A 2JVIA 4RK4A 4MV3A 1W88B 4M0UA 4JBWA 4DKJA 3D5QA 1TEXA 1ZL0A 4MUGA 4NV3A 3VDNB 4OHXA 1EP2B 3BTVA 4LSMA 2BDEA 4IWXA 1JH9A 4ZHQA 3PUZA 4UCXA 3BSFA