1XYYA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, homodimer, oxidised state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 51
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xyyA00
3FX2A 1CZKA 2FCRA 3EYWA 1J9ZA 1ZWKA 4FGKA 1KBOA 3EDOA 2HNBA 5LVAA 1F4PA 3S2YA 3NHYA 5TGZA 4DIKA 3TE7A 1D4AA 4DILA 1CZUA 4GR9A 4OXXA 1VMEA 1D03A 1KBQA 2F1OA 3JSXA 2FZVA 4C0WA 4DY4A 4ZVMA 1TIKA 4N65A 3SVLA 3UXHA 1YOBA 2X2OA 1AKVA 1DXOA 1JA0A 3OX2A 3OWXA 2V5UA 2FOXA 2MT9A 2MTBA 3GFQA 3OWHA 4ZVKA 1YCGA 4U7FA 3F90A 4HS4A 1J9EA 1E5DA 3GFRA 1FX1A 4ICIA 1C7FA 5JROA 1BVYF 1AMOA 4LTMA 1RCFA 2FAXA 2QX9A 1ZWLA 3KAQA 2QMYA 2BN4A 3G5MA 2Q9UA 4C76A 3QFCA 1XI2A 2MWMA 3GFSA 4ZVLA 2V5VA 2Q62A 5NULA 3U7RA 1C7EA 4LA4A 4N9QA 2ARKA 4XDGA 1OBVA 5LMCA 3HR4A 1SG0A 3W7AA 1SQSA 2BMVA 2QX8A 1AG9A 4YQEA 3HLYA 2QX4A 5B3KA 1FLVA 2MOKA 1V4BA 2WC1A 4FX2A 4QOIA 2ZKIA 1OBOA 2Z9DA 3HA2A 3NFRA 3NHUA 3QFRA 6NULA 1FLNA 1RLJA 2OYSA 4YAFA 4J8PA 3OJWA 1QR2A 1WSBA 4HEQA 3W78A 2BZSA 3FNIA 4QOHA 3O2NA 1YRHA 2QWXA 1CZNA 1B1CA 4YAOA 3NHWA 3B6JA 2RG1A 5EA2A 2QMZA 5LBTA 3N39C 2BF4A 1FUEA 3NHSA 4GQIA 4Y9UA 3NLLA 4PTZA 4CETA 1AKWA 1RLIA 2OHJA 2W5UA 3B6IA 3R6WA 4LAFA 3ESZA 4H6PA 4ZVNA 2N1MA 4XDHA 3TZBA 3LCMA 4PTYA 4BMPB 2Z9BA 1WSWA 1XYYA 1X77A 1QRDA 1FLAA 2A5LA 1T0IA 2KLBA 2OHHA 5LLDA 1YCHA 1AKQA 1I1OA 3OX1A 4H2DA 4YALA 2Z9CA 4C0XA 3OVMA 3ESXA 3NHLA 3UXEA 1XYVA 1AZLA 3P0RA 4FGLA 4Y9RA 2FZ5A 4BMOB 3ZHOA 1H66A 3NHJA 4CF6A 5LBUA 1T5BA 2R96A 5EMNA 2FDXA 3KAPA 1AKUA 3L9WA 5LJIA 1DX9A 4GI5A 5NLLA 2XODA 3O73A 5F4BA 5F12A 1YDGA 2QX6A 3NHKA 4LTNA 5F51A 2M6RA 3F2VA 4R81A 2B3DA 3B6KA 3RPEA 2AMJA 4FGJA 3K20A 4NLLA 1GG5A 3F6RA 3NHRA 1D04A 3OJXA 2GSWA 2X2PA 4F8YA 3W79A 1CZHA 1NNI1 2FVXA 3FVWA 3OX3A 1OFVA 3QE2A 4NULA 3KEGA 1CZRA 1AKTA 1ZX1A 3FW1A 5BUCA 3LT5A 1J8QA 2FLVA 5EAIA 5ULLA 3U7IA 1YKGA 1QHEA 2D5IA 2V9CA 3NHFA 2HPVA 3TEMA 2Z98A 4ESEA 3L9XA 4M0CA 2HNAA 4S24A 4YAWA 1QBGA 1H69A 2FX2A 3K1YA 1XT6A 2QR2A 4QOJA 4PU0A 3N3BC 5FX2A 1J9GA 4Y7CA 3N3AC 1CZOA 3GAMA 3F6SA 5FA6A 1JA1A 1TLLA 2OHIA 3ESYA 4QOEA 4QOFA 1FLDA 1RTTA 2M6SA 3ES9A 1FTGA 1YCFA 2R97A 1AKRA 4QODA 4C14A 4D02A 4U7HA 3D7NA 4N82A 1AHNA 2BPOA 2KQUA 5B3LA 4U7GA 5FUQA 5LJLA 3KLBA 3FJOA 1CZLA 3NHPA 1DXQA 4LTDA 3B6MA 4YAUA 2XOEA 1FVXA 4QOGA 3W77A 1BU5A 5A4KA
chains in the Genus database with same CATH superfamily
3TLEA 1K5HA 2ZJ7A 2H57A 3EXG1 2FEOA 3F73A 2DR0A 1DG1G 4DA8A 3QA9A 4ZAVA 3ZDDA 2E3JA 5HR5A 1Z88A 2P69A 3AVXA 4EPTA 3RK4A 4BNDB 2QSZA 3TGLA 2HIMA 2P6OA 2FW6A 4K0RA 4K6KA 4DLTA 2O8CA 4ICIA 3FJ1A 3ILVA 2DHEA 2OL4A 2PMEA 1F48A 4FQ7A 1D5WA 3O8RA 1BRMA 1DEAA 2CK3D 1P4GA 2ISSD 3L8FA 1YQQA 2QU7A 3R8FA 2K5UA 3C1UA 4PHCA 1VSVA 1XHLA 2Q62A 1UDAA 4QAQA 1ZXBA 2X0EA 4LJLA 4A2WA 3AHHA 2XGGA 3AFGA 1QTRA 3V1YA 1NQTA 3F78A 1SG0A 1ZIDA 1R4MA 5J63A 4ZOQI 1T3TA 1HG1A 1XKXA 4E6PA 3HKDA 4C22A 5LDHA 5F3WB 3W5UA 1DRWA 5LL6P 1UDBA 1W6UA 4D57A 3ETLA 2ZTHA 2Q1TA 1VIDA 3EQ6A 2AA3A 2IIVA 3AJ8A 2WTBA 3HCPA 3L43A 1CRZA 1NNUA 3LLVA 1U0LA 3DPSA 4IH4A 4JJ8A 4E88A 3MVEA 3JVVA 1K2WA 4NJMB 5E6UA 5K4HA 3KE9A 4D4MA 1SBNE 2BE7A 3ADPA 1F60A 4WNCA 5C1OA 2IOQA 3CLVA 3EX7C 2HJ9A 2GUWA 4UHHA 1Z75A 1D2AA 1E6UA 3CF4G 4FFDA 4G0ZA 1ISJA 2AYYA 5H7XA 3TNDA 2QX7A 3LM8A 4YECA 2F1RA 1I2AA 1NAHA 1XC7A 3FNQA 3P2JA 3RUFA 4RZ2A 5DXJA 3QF7A 1Z07A 3P0JA 2N75A 3CG0A 1Z7WA 4CF7A 4N7JA 3PX7A 2FSHA 1N6LA 1KPIA 1Z8FA 3GVPA 3LBYA 1MH9A 1YZUA 4YYEA 5EJAA 1KMQA 1ISSA 2PFSA 1CSEE 1X19A 4O4JB 2DWQA 4DSTA 3ET5A 4Y18A 1R4MB 1NF9A 4O2BB 4NOKA 3RRMA 3SFVA 3EPHA 2EF1A 4JNKA 3ZHCA 4AY2A 2VCYA 3E0XA 3BDAA 4KP7A 3Q3GE 4RD2A 2Q3LA 4TZ0A 4X8HA 4GT1A 3WLJA 2MSWA 4PAQA 1HFWA 4UUPA 3RWBA 3W79A 3E84A 1XMVA 1XLUA 1VTKA 2CV0A 3A2NA 4XVHA 3G02A 1M0WA 2JVJA 4OU4A 1HA3A 4OKIA 3GUZA 2Z1MA 3VHXB 1CTQA 4NOMA 5EAIA 3I01A 2EXXA 2H2IA 1QRTA 1SBTA 1UZAA 5GV8A 1RBQA 1EBFA 3EDMA 3GFVA 4UMEA 3T1OA 5LP6B 3T7AA 4JI2B 1YONA 2WTNA 1T2AA 2MHCA 2MMGA 4JMPA 3MA0A 4MUMA 1QGED 2IP1A 3CZRA 5GOTA 4TUYF 5D6NA 5FP0A 3TYXA 1RYDA 1UMCA 1QO0A 4X95A 1HQDA 2JIMA 4I08A 1JJ7A 3TTYA 3U44A 1KK3A 1Z8DA 3AEXA 4IH9A 1MX5A 2H54A 2W9XA 3S44A 3I42A 3PXGA 2QDKA 3JQBC 4NBKA 5JRJA 5KQGA 5J58A 4RDIA 1KSGA 2YN4A 4GLOA 4NBSA 4DV0B 3M1AA 1RDFA 3D6FA 4ILKA 5FUMA 1QE0A 2RHLA 1RRFA 5IKPA 3W8DA 4E14A 1X87A 4P0QB 2H65A 5TR9A 1N9KA 2JGLA 3PVZA 2NVUB 3ZWYA 4TMVA 1SPXA 4BMZA 3AC0A 4ESHA 3K70D 4JLSA 5JRZA 3CY6A 4HEJA 4BX8A 4GQAA 1J24A 4PF1A 1E4EA 4D9FA 2AQ8A 2Q3FA 5EJ4A 4TL8A 1ZCAA 4NMXB 3P2MA 3TRJA 1H42A 1NJ5A 3DHEA 2HT1A 4MV0A 4NCJA 3LKVA 5LU8A 1SXQA 4EVRA 2C20A 2BFFA 1JLHA 1PHRA 9ATCA 4BKPA 2DQSA 3WGNA 4LRQA 2FPPB 3COWA 4JBNA 1K88A 1DDIA 4L78A 3ZQ6A 4NBVA 5CFQA 1I7DA 2PIDA 1L7NA 1PIWA 4AZSA 1GUAA 1JWBB 2W6IA 1YGPA 2BKAA 4X3CA 2BDTA 1JEJA 4LYEA 4F5EA 1UBRS 4JP8A 5REQB 2R00A 3OKAA 5EQDA 2ZI4A 4WOJA 4B85A 2UYYA 4ABYA 4I3GA 3GLFE 1XRNA 2VDPB 1S8NA 1WULS 2UYOA 5AW7A 3LW8A 2H52A 3E22A 3H17A 5K3CA 4K6FA 3T95A 4PAGA 3TNJA 4N6NA 3AL0C 2EJCA 5JWOA 1UIRA 3CZPA 4KN5A 2MIIA 3PC6A 4NYIQ 3N39C 1I8TA 3NBFA 1ZH8A 1VG1A 2BGLA 1N5JA 1RYBA 4DZZA 4OK5A 4F97A 1MDFA 2H3HA 1NM5A 2HU8A 5LBIA 4H1WA 3N2EA 3M4JA 1FTSA 5E8JA 5LZ4A 4RD4A 2MSCB 3G7UA 3I0ZA 1YU9A 2J3MA 1R4NA 4NBWA 4D3FA 3OE5A 1RJGA 4C0XA 1XF9A 1OZHA 5CB4F 5J4YA 3AHFA 2B82A 5E9JA 2C5AA 4CL3A 5I47A 3AW8A 3V7YA 4BQRA 4R16A 1KNQA 1YVDA 1QKIA 4K3VA 3S27A 5EUBA 5FNVF 5BOSA 2BUAA 4JLDA 2VJCA 2G36A 2PKCA 4Z9XA 3V2IA 4JCOA 2B8NA 2QY6A 1JJAA 2FW1A 4PQGA 4WT7A 5EIOA 1ABBA 3IUPA 3KLOA 1XDGA 1ADCA 2QTAA 1H2ZA 3W5SA 5AJZA 4BDSA 4D0SA 4BB0A 4UVEA 3S2ZA 3O4RA 2R8EA 4XD7A 5MFZA 4HWGA 2JHGA 2NYVA 2CZCA 3ACBA 2MCFA 1LI4A 4LOJA 4WBNF 3TI7A 1LNSA 3FDJA 4GRDA 4IXNA 3BKXA 3IDAA 1RQPA 5BUCA 1GGVA 3QKWA 3GMSA 3IHLA 2JGEA 1W9HA 4Q7QA 4FM9A 5JNTA 5HCIA 3T38A 4DQDA 2C9DA 1V47A 2PJZA 5C8VA 4NCXA 4RORA 1WIWA 1XJWA 2ATVA 2HGZA 2W6MA 3K96A 3DZBA 4QDOA 3L05A 1T0BA 4NS1A 1T43A 4XPIB 2QR2A 3CEJA 4QOJA 5COAA 4QGSA 5TS2A 2EDCA 4D26A 3TS1A 4A23A 3N3AC 4AUMA 1CZOA 5FA6A 2JFFA 3NTRA 1BDBA 2DSTA 1NAIA 1EJ0A 2OV1A 2RSLA 5COQA 5KJFA 1T15A 1ND6A 3LGAA 4CKXA 3RJ5A 1P60A 3KRTA 2X9LA 2IZ6A 4RHFA 1JYSA 2ZWPA 4U7GA 3RB8A 3TBFA 4AZ3B 3GD5A 1S5PA 1W5EA 4PZEA 1XVVA 2XOEA 1NYRA 1Q7TA 2VPYA 2FZWA 3HXOA 2ZITA 2XYGA 4W8GA 1LSJA 1U04A 1YBMA 1UM9B 3NT4A 4DE5A 2G28A 5JIBA 4KQ9A 3BJRA 2CCGA 3E3LA 3FNGA 4H35A 3EXIB 4Y6RA 1QCZA 1A5ZA 2GBPA 3EHEA 3EODA 1C8KA 3IVMA 2J4CA 3ICEA 4ZIRA 1EIWA 5JD6A 1KMNA 4O63O 2GCNA 3KKLA 2DM6A 3CZAA 2OHOA 3JALA 3WWYA 4OTZA 3O4IA 3M6FA 3W8NA 5EVCA 4U3JA 3K9FC 1ZK2A 2X3FA 4NJOA 4YAKA 2GRUA 4QGGA 1P33A 5FI3A 4E6EA 5CBKA 1GG9A 1USVA 2QZ9A 4HDQB 2W2VA 4MWSA 2CEAA 1UBKS 4F4IA 4B6JA 3RSFA 2ZRIA 3DOHA 3I6MA 2VYFA 4W1PA 4CIBA 2KPOA 4MV6A 4R2KA 1AGXA 3V4LA 4KO1S 3FTNA 3O8DA 5KC8A 2AQIA 4HD8A 3O31A 3VR4A 1XXHB 1AG9A 4R05A 2WAMA 4PPYA 2F9MA 3T4UA 1YT5A 5B2ZA 1YR7A 5FQOA 2AFIB 4CI0B 5KAPA 2ZQZA 3C74A 1X7ZB 1RZVA 3MXTA 3QVKA 4WFJA 5JS2A 4O1HA 3QF4A 1NM5C 2O2ZA 1QIKA 2OESA 3GU3A 4UCWA 4RY9A 5ELXA 3O1IC 3U49A 2PCJA 3ZHZA 4TLDA 4C4OA 4DMRA 2WLTA 1WCIB 1EHYA 3ANSA 2FHPA 2IHKA 3R40A 1FSZA 4FHGA 5KNBH 3NVAA 3GCXA 4L8GA 1V2HE 2ZRPA 4FFRA 1JMVA 1AQ6A 2PZJA 4YJFA 2IYVA 4MP8A 5IF9A 5BVHB 2NGRA 1VPWA 4KQFA 1XTVA 1FFXA 3PR1A 1JF8A 3FPJA 3INNA 4CM9A 1RRVA 3W4IA 4M9CA 4JJAA 1LRKA 1CUZA 2VK1A 2IS2A 2IYAA 3T15A 2OGUA 5K0NA 3G23A 3CLTC 1TPZA 2P9GA 3C7AA 4E5UA 3VU1A 1UOEA 5JBNA 4M37A 2ZRLA 3ER6A 4INOA 2XNHA 3R1IA 2YNMA 4REQA 3KSMA 3BH7A 3DOFA 1D04A 1TD9A 3B8HA 2UXDB 4NATA 2FZKA 1XG5A 1DC4A 2N9UA 2O7QA 2RB5A 4FZRA 4H0CA 4RFVA 3WX0A 3ZE7A 5B1HA 5HOEA 5JMTA 1VLLA 1QTQA 1V1MB 1QNFA 3GFFA 4CFYA 2Q8QA 4TTJA 1VG9B 1N75A 3O9ZA 4PHTA 1QQ6A 3CMMA 1WDMA 3KP1A 2PGAA 1NJ2A 2FRDA 5C4GB 5EKUA 3P97A 3N3BC 4RE5A 4D2IA 2WWRA 4RTLA 3J81A 5KCMA 3SEQA 3OZIA 3H11B 3K2BA 1YD7A 2LZ0A 3MB8A 4YMHA 2AXPA 4HADA 3KQWA 1YF3A 1JHVA 4CCYA 3RADC 3UFBA 1PT8A 4S1TA 4ZXFA 2OAQ1 4MQMA 4P93A 2B4QA 1POXA 5ARBA 2CNKA 3CUSA 4GZ6A 3ZJTA 2FJPA 5AOCA 2W8BA 2KBEA 4DMFA 1OBCA 2GX6A 4NJMA 5TSDA 3ZG6A 2DH5A 5DNCA 2AZTA 3WLMA 2H4WA 4M55A 3S2YA 1U9CA 4BJ3A 1GKKA 3UWMA 1ZN2A 2C4KA 3JQPA 3RQIA 1MJHA 4UHKA 4DHWA 1ZI8A 4EI7A 3UYLA 4CQMD 5IH3A 3PYXA 4GBMA 2QM7A 3OWXA 3T5BA 4BBJA 5C4MA 4X7MA 2FSPA 3DTYA 1BDJA 2G5GX 4Q02A 3ZE8A 1GFWA 1NF3A 4BAZA 3UHJA 5G2OA 4FKZA 2E87A 4OGLA 4O0LA 4GLLA 4OLJA 3WGHA 2E5LB 7MHTA 3FUXA 4X54A 2B25A 4I14A 3QW4B 3PF9A 3RBVA 4YCBA 3IALA 4ZMSA 2EG5A 5I3ZA 4TM8A 2PZMA 3AVUA 4X62B 1JNYA 4UCQA 4X20B 3FSJX 4F8JA 4FX2A 3CH4B 4LECA 4NECA 2V58A 4HDNB 3BHMA 4JT2A 5DZSA 2Z30A 1II9A 3RVLA 2FMXA 2MR5A 1BWRA 2OWDA 3E70C 3N2KA 3R0XA 4YI3A 2PX0A 3IHTA 5T4BA 5HDBB 2CFIA 1T36A 1ZUHA 1CG6A 1BE1A 3VVCA 2FMFA 2Q3BA 5LBTA 1E94E 2IZ0A 3C7CB 3SQXA 4J03A 4NZOA 4MVXA 3LUAA 1YO6A 5B6JA 3KAJA 5BV7A 5EJ7A 3AR6A 4HRXA 4PG5A 3VISA 3ZCUA 2R7NA 4ODIA 1ECLA 2VK2A 2XDWA 1CETA 4JLOA 2X13A 2GGSA 4BQQA 3B1JA 5BURA 2XADA 5I7EA 3DPUA 4IQ0A 2E9SA 4IZ6A 4PZYA 3ETDA 3ZD9A 4FD2A 3TTTA 3UHFA 3X44A 2HUNA 2IEZA 1S02A 3EGEA 2H51A 4MWBA 1TJYA 4XLTA 3BUSA 4MUAA 2HA2A 2GZ3A 2QROA 2WWFA 1PP4A 1KGDA 3CZ9A 4MKFA 5C3MA 1JDNA 2XODA 4RGQA 2F8MA 1JHXA 4W1SA 2FRVA 4XJSA 3UK7A 5E3HA 4ENWA 4CTMA 3RVDA 1NRIA 3LKZA 4CHGA 5G3YA 5B3JA 1LTQA 4BNJA 4TQAA 1LY1A 4F60A 4EG0A 1IEXA 5CITA 4COKA 5H8WA 5KWJA 1YVPA 3PLAE 2KBFA 1R8SA 3L0PA 1LPMA 1N33B 1E98A 3IAM1 2QNRA 5JNRA 1J2JA 5K8VA 2BGUA 4TXJA 1KI7A 2V7XA 2CLKB 2FG5A 3PJGA 4TTAA 4Z2YA 2B34A 4ZAZA 3UGQA 4A73A 3K6JA 2EKPA 3AR8A 1HT1E 3KHSA 1B76A 3REQA 3CEMA 3LUKA 2PUVA 2C59A 2H5IA 1YS6A 2O8DB 3BIWA 5E6RB 1M0SA 1QHNA 2I99A 3BKWA 3ON5A 2JA2A 3DNFA 4QHTA 1GWNA 3GX1A 4MHOA 3RS0A 5IZ4A 4UE3S 1JJBA 3VI3B 1Q0PA 1JA1A 1VDMA 1VGQA 4KLAA 4X45A 3WMGA 2SKDA 5B7QA 5HCNA 3N0TA 1KJQA 3L7BA 2XY4A 4WI1A 1TVKB 3GAAA 2BFBA 1I14A 5T6BA 2XUFA 1U3GA 3Q0IA 4YAJA 1BE6A 2GLXA 5E6SA 3RTGA 4HATA 1DINA 3PHBE 1A8HA 1V43A 4FSHA 3OT1A 4JIGA 4BFWA 1IHDA 1FZQA 3WK6A 2DG2A 2VYND 5BVHA 4UM7A 2IYYA 4DV7B 3G1TA 4GZ3A 1NRXA 3WNDA 4JWTA 3OQMA 1A76A 3L82B 3RYFA 4EA7A 1T2EA 2GPYA 3C3KA 1CZUA 1OLUA 2YHSA 4BCDA 4IO1A 4J2TA 4Z8XA 1Z6YA 3IKJA 4DR2B 1WR8A 3B3FA 4LZPA 3T9EA 1WOMA 5JJLA 1Q74A 1SXPA 4OQLA 3BH6A 3D3WA 4PLZA 4WA7A 4UVDA 3S6JA 1I0ZA 1MO2A 1SC4A 4HYTA 5AVSA 4BO7A 2FW0A 2QTHA 2G0TA 3NYRA 4J07A 5DNAA 1RLTA 4MAAA 3FMVA 1NIJA 4JA2A 4JD5A 1G6Q1 2E0IA 3SP1A 2VCEA 3BFXA 5JQWA 1GQOA 2O3UA 1G5TA 3W3ZB 4JJKA 4CL2A 1RHQA 4Y2GA 2WY2D 4NEQA 1FMCA 3IOYA 2GEKA 3AFIA 2ODBA 2Q4RA 2P41A 1G5QA 2IY7A 3EARA 2WWTA 4LCEA 4PR3A 4BO9A 4AL4A 4G89A 4TTPA 2ZBVA 5FI1B 5IYZA 1PFKA 2JIQA 2WJ6A 1SRQA 4QELA 2O14A 2BELA 2R84A 5AIBA 5LUAA 2APJA 3I45A 3DOIA 3E3AA 3MGAA 4AUEA 4HFRA 3BTVA 5CW2A 1KERA 3SEAA 3QNMA 2O2XA 3ZEAA 1H9BA 1X77A 1Q44A 2WT4A 4HYYA 1RWOA 4Q5IA 1WNTA 2Q0XA 4Q1VA 5GIPE 4JBLA 1PGNA 2WYWA 1ML3A 2Q1YA 1GRVA 1ND5A 3OIVA 1I9GA 5LZ2A 1IBLB 5JSKA 2YJ4A 2E4WA 3AT1A 2PUGA 3W3AH 3G2JA 1JG1A 3JTMA 2GEFA 5ARDA 4YLGA 1ZMTA 4UAVA 4AF8A 1FFYA 1A8QA 4EBBA 1QU2A 3ITKA 3DSRA 1BMFD 1E4OA 1QHHB 1P39A 2ODWA 2YMLA 3N0XA 3PL5A 2R68A 1PBNA 2O2IA 1VGRA 3OO1A 4JXKA 1IWOA 2XRFA 5HJ2A 3WIEA 3ZWQA 2C07A 5A3VA 4JB0A 4M9QA 1FMFA 1DBVO 1KI8A 4GI1A 5LQMA 4PC1A 4U3JB 1EXMA 1ZOLA 2YTZA 3AKCA 3ML1A 4IYRA 2VK8A 1U8YA 3RUIA 3VC7A 5CB4B 1IQPA 4UBNA 1HX7A 1PJTA 1R88A 1VB5A 3GUVA 4G0MA 2NV2B 1QTNA 3ZS9A 2RGCA 3CA8A 3OO0A 5L3ZA 3IQDB 1WZ2A 4HTFB 3WRXC 4I6JA 1BA2A 3IOMA 2ZIAA 3D4IA 3Q7RA 5TLSA 1KEEA 3TRFA 2ZXEA 3NYWA 1CJUC 5JRDS 2QP9X 3VMFA 4JN6B 1W30A 2CLDX 4WY8A 1N2CA 1NVFA 2MMCA 3OTWA 5DJ5A 3HPQA 3UPDA 4HRAA 1C3VA 1DUVG 3ZWMA 4B17A 2H92A 3TLGB 3EFEA 1EZ4A 4KWTA 3LYUA 1YZYA 5CJJA 3EF0A 2VJYA 1J9ZA 1OWMA 1V2GA 4LGVA 1UK9A 4RV5A 3CLSD 3K1AA 5GMOA 1OIXA 1PD1A 5CG1A 1XMSA 3GT7A 4MO2A 3AL3A 4YCDA 2DKFA 1XRLA 2E5WA 2AE1A 2J31A 4XGQA 1DBSA 1T3SA 5HFNA 3ZX4A 2KX7A 3HZHA 3OJFA 3EEOA 4PYIA 4ARUA 1DLJA 3JAWA 1F0YA 3ZKWB 5L6LB 3T1YB 1E3EA 1YB4A 1R27A 1CUHA 5DCYA 4DAEA 4PWYA 3TL3A 2P3QA 3F5DA 1A8UA 1CFZA 4PPGA 3G9TA 3JS5A 3MWEB 3O4VA 4MEJA 5NULA 3WV4A 3KDPA 1TQ2A 5I48A 4LA4A 4QLOA 1V41E 5E0KB 3CGWA 3SS9X 1HMYA 1QB8A 1MO4A 1GYRA 1R74A 1W75A 2HKIA 2JFQA 3BL8A 1MC1A 4RV4A 4YQEA 4N54A 4EF6A 3HA2A 2WIBA 4DADA 1LBTA 1WV0A 2XMDA 2VTBA 1QUEA 4RVCA 4ZCMA 3F4LA 1QGUB 1Z6TA 2GJ8A 2GWRA 3F7NA 4J9VA 4WDQA 3ECCA 3WKBA 5JARA 5KINB 3HGQA 4BFXA 5A6SA 5EKSA 3IR6A 1D8TA 4IGIA 4S0ZA 3X3HA 4Z6KA 2REQA 3PFIA 2J5RA 2YFHA 2QAIA 4LYJA 2PE5A 4N3NA 3U26A 2GBLC 5C8DA 1WXXA 3DE7X 2REQB 4N5IX 4MMZB 3EQZA 4KQXA 2W83A 1LF5A 1MJNA 1RMYA 1W581 2JGAA 1OLSB 2QXYA 1NBEA 1Q6ZA 3OFJA 3K9BA 4K6MA 3VAAA 1EWKA 2J67A 3TMAA 4PNZA 5DHRA 1HEYA 1CUYA 1JB1A 1ZC4A 4YHBA 5EMNA 2YXPX 3KWLA 4MK4A 3NV7A 4TRMA 3TJZA 2ZWMA 5IYZF 1P4AA 2J59A 2ZTLA 1WMAA 1IMOA 2HJGA 1HOXA 1KH1A 1T8RA 1XKQA 3FKSD 2H9AA 4LXGA 3SI7A 3M82A 4UUMA 3U9TA 4KIFA 2DPYA 1LA2A 3F9IA 3O5AA 4QFMA 5DT9A 3OHMA 4V1CB 1MGPA 3VH3A 2OGZA 1ZOSA 3C3EA 4HFMA 4KW7A 4OBWA 3ROFA 1E6EA 4J7AA 2OUIA 2VHZA 5JBQA 4R31A 3I32A 4FNMA 2GBFA 3I30X 1FNDA 4DMGA 1F0NA 1PJ3A 1JXQA 1I1NA 1SUBA 3LO5A 3Q85A 4A82A 2WJZB 1T5LA 1LI5A 3HBAA 3OLWA 3WQHA 2IY9A 4AJ1A 2CSXA 2Z3WA 3EBPA 1W4AA 4J0QA 2PXXA 3JQAB 4U02A 3O95A 2ZRBA 1ZCFA 3DCJA 3HYCA 1DLIA 5A1TA 5KTKA 2QZSA 2M1XA 3C8ZA 2GCOB 2FFHA 3PU6A 1KHTA 4F8YA 1IB0A 4RSMA 5HF8A 4L9RA 2WINI 4GI2A 4UTZA 4OV6B 1VKJA 2R5FA 4KWCA 3OFKA 3ZXSA 4CIYA 5KYXA 1TZJA 2XECA 3OA0A 3CVYA 4OLAA 4KWHA 3AUFA 4WE3A 2O8VA 2P8JA 1XF1A 2W0SA 4PC7A 5BQ5A 4YRAA 1V4VA 5DW0A 4DIOA 5EKTA 4YVFA 2OFWA 3GXOA 5FLKA 1E1QD 1VHQA 1RHJA 3ZZ1A 4JJ7A 2Q5LA 1P7CA 3WL5A 1MOPA 4N8DA 4PXSA 4X6XA 2QRGA 4XM2A 3DAPA 1MNQA 3AHCA 3HRKA 3OP4A 4K8RB 4WZAB 1WL8A 1BMQA 2QVCA 2Q9BA 4KE8A 5B6IA 2X5XA 3F7MA 5HJ7A 3NONA 1DJQA 1VLHA 4FTWA 3AP3A 2HLHA 4HGOA 4RU1A 4WKOA 4YRBA 3P8ZA 5JROA 2HC9A 4F6LA 2CJFA 1MXHA 1NMSA 4QXPA 5LQNA 1TEHA 2OD9A 3G5MA 5FNZA 4BQPA 2MWMA 4LE2A 3QJGA 4Q9JA 2WFAA 3HKBB 3PE4A 3QMMA 2WVHA 3QUAA 5C8XA 3CINA 4TSFA 2CLOB 3C3PA 3AZOA 3KJEA 3UJHA 1D0VA 4KPUA 3GT4A 4G1MB 4IHJF 1U2PA 4CQMB 2ORYA 1OLXB 2A7XA 1XCJA 4U2BA 3LY9A 1LDMA 1FU8A 3DLPX 4UCXA 1IZZA 2R8ZA 3NUQA 5D51S 3TR5A 3X1WA 4BNTA 4WWHA 3LSTA 1PYDA 2FPXA 1EWQA 1UH5A 2A9RA 4DTIA 4MVJE 2OC9A 5JEEA 1DAGA 1WCV1 5CDYA 3ZX5A 3H1BA 4MGEA 1QF6A 4YP9A 2ISCA 4AN0A 3RAPR 5KSPA 4RLFA 3ADKA 4HAVA 4YO7A 2RG7A 3PUVA 4CR8A 3H5RA 2B8EA 1UFKA 1J5EB 1L4FA 3G0CA 3HWRA 4MSUA 2HRZA 5LB2A 3CE9A 2FF5A 4LXIA 3M33A 3QEBZ 3DBVO 1YR6A 2PD3A 1G9TA 4H1UA 1AM4D 4JB8A 4ROSA 4OFBA 4J0KA 4F2PA 1XDWA 4CIXA 1O08A 3OPYI 5FWYB 3RF6A 3IAM6 5DB4A 2HJSA 2DOKA 4NIMA 4ZCIA 3PJEA 5ICSA 2BGGA 4WKNA 1N77A 2OMKA 3OFND 4E94A 5HP4A 4MVCA 1TXGA 2EYUA 1QLJA 4Y2UA 5A4MS 1PKEA 2PRKA 4YP7A 4AQYB 4RH0A 1E7MA 2IQ5A 2BM0A 2NZYA 1KMMA 4LIPD 4XD2A 1J00A 1KNXA 2V97A 3BTOA 2BY4A 3D9QX 3OJXA 3CS3A 4MWDA 3ZNQA 2JAOA 2VZ0A 4IG4A 4DJDC 1SA0A 4EJMA 4WKBA 5IKMA 5EKXA 5ALEA 1M6VB 3RSOA 2IWRA 3HCFA 4MVJA 1YIDA 5CDGA 3QVUA 1TX4B 4WOCA 4YRLA 2VP5A 3UB3A 1XTJA 3M70A 2D5IA 1W36C 4BX9A 1UDXA 4V39A 3EGOA 2Z56A 1Y8AA 3IIKA 3R5TA 4EFDA 1RAIA 4R3NA 4QBTA 3C4QA 2GCGA 3GUHA 3N5KA 3CKYA 4D7AA 2VXCA 5ENZA 4NBUA 2C3PA 4KQMA 1B8UA 1D1PA 4ALKA 5KQMA 3R7DA 4LYAA 1DE0A 1OV4A 1G1MA 1XP8A 3DYVA 5E7MA 4ND1A 4D02A 1YCFA 3T1QA 2VZ9A 5TJ9A 1S8FA 1V45E 2R85A 4B3DA 1HYGA 3FOEC 5FOXA 4RDHA 3GWZA 2QZJA 5BORA 5ALDA 4ON9A 4EEKA 5K45A 3MLBA 2ZR0A 3Q3HA 4RA6A 1E1NA 1VBNA 2GCOA 3QEMB 4YASA 1U94A 4HZUB 4BNFA 3ZXIA 3LT4A 3KELA 4R1SA 5H80A 4Q4LA 3CT6A 4OD0A 1PL0A 2RH5A 3LUFA 2VDJA 2W6ZA 3ILHA 3VZCA 2Z8XA 3CNHA 3DO5A 3SIRA 4HGQA 3B36A 1PYGA 4LPKA 4M1SA 1UOQA 4QPPA 4M1WA 3RF7A 1M3SA 5EIBC 1DXOA 3SC4A 1YDHA 3CQ9A 2X5JO 2YMMA 5HPYB 4BO3A 1GG2A 3FMOB 3OKPA 4UXHA 1IM5A 3GG2A 4GKBA 3LNTA 1D4FA 4I4TB 4R8SA 2GPAA 1S2IA 4PG7A 3Q9NA 2CC2A 2ZS9A 5CLHA 4MITA 2I7XA 1V48A 3AIMA 4HFJA 4XQ0A 2OZKA 3EK2A 3SZLA 3EAFA 3JCZA 1SQSA 1RJ9B 1TIPA 5KTOA 1OU0A 4WJZA 1EVZA 2YHIA 1RWMA 4DZTA 1QMGA 5KOJB 4FZ3A 5H4HA 4DA6A 3NTUA 3I76A 2FTKE 4JOBA 3ICCA 2P5UA 4HPWA 2B9EA 3FVRA 4EB6B 2BLNA 2XNDA 1M2VB 4HNHA 2FWBA 3WMWA 5L3RA 4NBTA 4CKCB 4G86A 5SY6A 3A9SA 3NBQA 4MP3A 3QYJA 1JPUA 2C95A 2F4NA 2YVKA 3FCXA 1GAEO 3KBBA 3JWJA 5CCDA 3WHKA 3WLFA 1FFBA 4KGDA 2BUBA 1K4KA 2WD9A 5JNWA 1EMDA 2LDBA 1V6CA 1LV8A 2F43B 1VE6A 2VRNA 4F93B 4L3WA 4FGSA 5CFZA 4X66B 4BNZA 1RHRA 3WE7A 4OY3A 4PE5B 3L7KA 2HTEA 3A2MA 3WC4A 1P7ZA 2QRMA 4BZZA 3SSMA 2IHVA 2QOEA 2RGGA 4MUYA 2ZB7A 4XM1A 1GQSA 3O4FA 3DZ8A 4CU5A 4B7CA 4DM4A 1SUPA 2CNOA 3T6KA 1IY9A 3OJLA 2IYZA 4DKJA 1OPXA 4G63A 3DMTC 3FXAA 2Y66A 1A9SA 4CNBA 1YWGO 1A77A 2M6RA 1QH8B 1GZ7A 2ZWOA 4RKYA 2CJPA 2EX0A 4RIFA 3F2IA 2OYRA 3WRYC 1EEHA 2Y1CA 1F2TB 1DJNA 2HLNA 1QFJA 1X1QA 3GRPA 1TADA 2XDYA 2AN9A 3L8ZA 5HYVA 3K0BA 2HBRA 3IQFA 1NBMD 5INTA 1SXJA 3A3KA 2D7CA 4C7OA 1I6WA 1QZXA 5DNUA 2FPIA 3ZCPA 4RJLA 3NGLA 4NF2A 1RRKA 3WTBA 1U2GA 3IXQA 3STXA 1OC2A 1RJFA 3WBBA 1AMUA 1Z8HA 1DV1A 1IQ0A 1QHHA 4L0CA 2QD5A 4BU1A 1DB3A 1Z3CA 1MPTA 3FOCA 4BWYA 4KBFA 1W4LA 1ZRNA 1VL2A 1ZD3A 3WNCA 3MAJA 3PYLA 4WK2B 5CR9A 2YMPA 5EQJB 1XL1A 2ZJ8A 1AK9A 3UKJA 3FHTA 3S1SA 4EECA 4LY0A 1IONA 2C5GA 3ECAA 1W85B 3U3XA 4CG2A 3VJKA 1HY3A 1KKUA 1DKNA 1S8OA 1I5OA 1THMA 2FPSA 5H68A 1F1JA 4P92A 4RZXA 3M1LA 5EJIA 3BHJA 3MGBA 4K9NA 1J0EA 9LDTA 3ZY3A 1YI0A 3HJGA 3H11A 4G5FA 1CUAA 3EYWA 2AI1A 2IW3A 2ZJ6A 3KT3A 3OWOA 4RS4A 4JSRA 2NUTB 3UCEA 2EFHB 1EWRA 2O8FB 4X1YA 4E22A 3R5KA 2DUNA 2QJRA 2ZJ4A 3D0RA 2PSSA 5ECWA 3GY0A 3U5ZB 4Q03A 5F5XA 2J1LA 3PX3A 3ISTA 1G19A 1GL3A 1SU7A 1WDKA 2HSZA 4JYPA 4LJAA 1NVXQ 2VDWB 4JYMA 4IFEA 1N57A 4L2IB 4M7OA 3PXCX 2I7VA 1BVYF 3P9KA 1T8TA 3IURA 1PDOA 4G5XA 1HE2A 4YXFA 3BGIA 3FLMA 1EBBA 2X9GA 3VH1A 1NASA 4C21A 2JLUA 5BRNA 2ZAMA 1G8MA 1W2HA 1EK2A 1MP0A 5DX0A 1F0PA 4M7PA 4CW7A 4RETA 4LOIA 3E05A 1WP9A 1U4SA 2PFKA 4QPJC 3EXG2 5LMCA 1A8SA 1OX5A 4RPHA 3MMNA 4UDNA 3FTEA 4DSOA 3N7AA 1J20A 2ON6A 4BN0A 1FLVA 4JMLA 1J5XA 2ZCUA 3C0KA 3P0EA 4BVLA 1OH8A 1KFKB 2X76A 1SCNE 3OJ0A 1EWVA 5KYWA 3GLHE 5CDHA 3I28A 3AR7A 1BDIA 1WSBA 2NX2A 3O1LA 4IVPA 1K7SN 1CKEA 1SZDA 1TA0A 1UFQA 4RLHA 3TD6A 2PUFA 4L4RA 2XWPA 5JCJD 4N0PA 3SIWA 1RMTA 2EJUA 1N5LA 2GEDA 5KSWB 1EX7A 1M34A 1M2JA 1X86B 4F9TA 4O08A 4FQ8A 4PTZA 2WM2A 4MUEA 4EBFA 2UXCB 2V7WA 4E3ZA 4YMLA 1O57A 2JBAA 2GTPA 3HSYA 3AERB 4L4SA 5EIEA 5L8VA 3ZU4A 3CN7A 5EXTA 4AF6A 1PZNA 4COOA 3F47A 4E5KA 1FJXA 1KJNA 1SU4A 4L72A 4RVUA 3VBEA 3H05A 4O2AA 1REQB 5D2CA 5KSOA 1PG2A 2VEDA 3GH1A 3EEFA 3I9KA 3L7LA 2DXIA 4FW9A 5AVKA 4B3MB 5LP6A 4AKGA 1P91A 3M1YA 2XUHA 3O83A 1R0XA 2GJKA 1WVMA 1K6MA 1OKKD 1GTG1 2EERA 4OYLA 1U1FA 4QYIA 4U63A 1C4KA 1M6WA 1XZ8A 4RHUA 4UHEA 5TGTA 2ZYDA 1ZGBA 4RULA 3GH3A 4JBIA 1LH0A 4Q4HB 4V2UA 3RANA 4E7PA 2BGJA 4MW5A 3TLJA 2R6ZA 3LSYA 1XVTA 4E08A 2F1JA 4WCFC 1BN7A 1BSVA 5CK5A 4NCAA 4W9RA 3KL2A 2P9HA 1L1QA 4O2BA 4BPRA 1J42A 3LBIA 3MOSA 5IT9A 5A0VA 3VTFA 2DF8A 2QU8A 4B7ZA 2FSFA 3O1HB 4KLRA 1FFDA 3RSHA 2FMTA 2NXJA 3HL4A 4BVKA 4CEJA 2Q8PA 3ZWXA 3S55A 4Z1MD 4EHBA 3C8UA 1EFHA 1R9GA 4J4BA 5EESA 5TB5A 4EM6A 4F3NA 2R7KA 4I99A 3MTGA 1E1YA 4JS0A 4HEA1 3INYA 2FUCA 3DEHA 2QJOA 4KXVA 4DA0A 1KAQA 1QAOA 2UUPA 3RUCA 3WJ7A 4JBGA 1WXDA 4UMFA 2BIFA 3A6JA 1W36B 3NEYA 4CMBA 1ZMXA 3VR0A 2II6A 1G16A 5P8WA 4Q47A 2WJVA 3O8QA 3P19A 2BFWA 2P9ZA 2VJPA 2VXYA 3U4HA 3W77A 3WGKA 4YK7A 2EAUA 5TRTA 2X0IA 3T0GA 4CUZA 3KK0A 3DEAA 2MYPA 1D9ZA 5FNVA 3DWGA 1L5NA 4FWTA 5CX4A 1XIVA 2AUMA 2VG8A 3K73O 4I4IA 2WJJA 4XPIA 4X41A 1ADGA 3TIVA 2IBTA 1BHO1 2GZRA 1I2MA 4ESEA 1Q77A 3UFXB 5CAEA 2C58A 4DCPA 4BB9A 1PT7A 2V45A 1Z4JA 4I9NA 1LK0A 5THQA 4Z7OB 3KXLA 2Q49A 3WGQA 1GNLA 2OQRA 1KVSA 2AZMA 4RK4A 4RCYA 3V4ZA 4WCDA 3OD5A 1K4MA 2HRCA 2ZS7A 3BL5A 3ZQ4A 1CU1A 2PMWB 4QBHA 3GRVA 5IKXA 1SB9A 2GK7A 3MJEA 4ZT7A 1P7VA 2AZDA 2ZT5A 3MWKA 3NNSA 3GCDA 4PLGA 4B71A 2YWXA 4BQSA 4WK0B 1GTJ1 2HM7A 2E4ZA 1EUDA 3VDNB 2AYXA 4F85A 4D9JA 4TWRA 4QDUA 2CUNA 2GAOA 1M7GA 3AJAA 3B3JA 4AS3A 1EFUA 2F3SA 3Q0TA 4LYYA 4F4DA 3ZJUA 1YB5A 5DP1A 1O0BA 4G3XA 3HQ4O 2CFTA 3NASA 2BH2A 3M6AA 1I7LA 2O6LA 4UE6A 2EJTA 5DGDA 1W7AA 3B85A 2H5JA 2PYZA 1TZMA 3FOAA 4IO0A 1I5RA 4JJFA 3ZXYA 5CIYA 3TB6A 4LRSB 2WHEA 4M1YA 4QGBA 4B3CA 4BBAA 2NZ2A 2B30A 4GX0A 1KTVA 2HRQA 4FZ5A 5JG7A 3IFSA 1M1UA 1TVKA 1YQ9A 3KPJA 2B7LA 2BKVA 2JFNA 4U6SA 4WX2B 4N47A 1YB7A 3TH5A 1NW9B 2CZQA 3EUWA 3HFRA 2QTCA 3O8QB 4B84A 1CUEA 2R1VB 1WEKA 2G67A 1W36D 2CLCX 1A4UA 5I7UA 2VBCA 1P9OA 3A0UA 3DE0X 4MGIR 3TB4A 3THYB 5A6VA 3EGXB 1W4RA 4AKHA 3A1VA 4I1SA 3C5EA 4FIDA 3RYIB 4XQ9A 3REOA 4PO1A 2VK4A 4URZR 4J0GA 4BC0A 4MYHA 2JHFA 1HNWB 3BT7A 3UT5B 3SEFA 3GLFA 4YJHB 2XNSA 3K8OE 4C6TB 2VLBA 3TI9A 2QE6A 4FSDA 3VPBA 4C3ZA 1NUUA 4Q9HA 3GQBB 4E13A 5U1PA 1KYQA 3LW7A 3UT5A 3AZQA 5JXWA 3J7AC 1P2TA 4Y1RA 4RV9A 1L3IA 1YQXA 3AB3A 1KXZA 1NNLA 1YE3A 2AOTA 4EF4A 4PN7A 1USUA 4ZI7B 1ZEMA 5EHIA 4UQPA 3RSGA 2VJMA 4ZQGA 4IV8A 4G5QA 5AHWA 4DQVA 4CMIA 5AVTA 4BVHA 3U4QA 2J9FB 5AVOA 1NBIA 3KYBA 2YVUA 3OHPA 2XOXA 1Z12A 4NABA 2JFZA 2JGFA 1DBQA 3LT0A 2I9KA 1WAMA 1B8PA 1KZ7B 5ITZA 2QUJA 1BEZA 4NWIA 4BZQA 4R2WA 5JVDA 1SXGA 1N4DA 2X0RA 1TVMA 6AT1A 3IRVA 2FWIA 3AB8A 3SR0A 3DBLB 3IE0A 2RCYA 3SS7X 3QXHA 1AX9A 4WXPA 1ODLA 2XKJE 4IF4A 1Z2OX 3K9CA 3SLRA 2PRSA 3OBIA 3SFZA 4DCGA 2Y0EA 3UV6A 3O8OB 3ETCA 1DIHA 4QECA 1DXYA 4EUFA 1FXWA 1UBCA 2IC5A 3EW7A 3VGPA 2BFDB 2H3EA 1RYEA 4PYKA 3WP0A 3HKEB 5J4VA 1N2ZA 2WU3A 5DXAA 3RFVA 2XD9A 4BQOA 3RSSA 3SQLA 4IVNA 4HEA6 3K0AA 1LF0A 1JSLA 2I3DA 2ZVJA 5KDDA 2V4ZA 2DPHA 3EXFB 4S0XA 3SQMA 2YWGA 1S7GA 2VH2A 1VIMA 3FSRA 4CLDA 1KU6A 1PEAA 2O3JA 4OHZA 1OYOA 2PL5A 5KOHB 3L4JA 1ADFA 4PHGA 5EJ2A 2NZVG 1OILA 1TCVA 3C3CA 4G56A 3T99A 1DELA 3KKNA 4HH1A 3CRQA 1EQUA 4MUXA 4PTLA 3URMA 3WIDA 4QPZA 3FBTA 4R7ZA 1RM3A 1UKZA 1RKVA 2HH9A 2XMRA 2HJRA 3GL9A 3GVXA 1EQAA 3JD2A 4GKVA 4CXMA 3W78A 1PN3A 2IOFA 2B6NA 1RP7A 3WBKA 4KGVA 3G5UA 1GZDA 3UHOA 2I5PO 4JBXA 3QYFA 4D3SA 1Q1QA 2NNWB 3CF4A 4NARA 2RH8A 3R9IA 1T6YA 5D01A 3PS9A 3A6KA 3INRA 5C8YF 1PF7E 3C6BA 4K1LA 1M1YA 3V33A 4RESA 1EBUA 1MORA 3RVJA 1QE5A 2Z9BA 2Y05A 4FR5A 1JQBA 3HKCB 1MIOA 4RY0A 4PINA 4TTQA 3ZWNA 1RXVA 2VRCD 4MW0A 3ROTA 1PE0A 2G7MC 1DJOA 4NY1A 4EPVA 1TJ4A 5IDXA 4MVYA 1SOWA 2NO0A 2RBGA 3NJ4A 4V0MA 1GQQA 4JC5A 5AUQA 2PQ6A 5F3DA 3KT8A 4E2YA 1D0SA 5FUBA 4V3CA 2ONJA 1F2UB 1ORHA 2W7TA 2WKQA 5TF4A 5FOQA 3EG9A 3I61A 4B7UA 4O1MA 4B8ZA 3DXYA 4MPDA 5LQJA 1P72A 2BCJQ 4RPIA 2IF0A 4RIHA 4P53A 2QTZA 2QLMA 4Y2TA 4HLNA 5A7FA 3K1TA 3PE3A 1I1HA 4HXFB 3IKMB 3TSWA 2AJDA 1SUFA 2B1GA 2FLVA 3M2PA 5JH7A 1JZQA 4Z99A 3C3JA 2PWZA 3DBHB 4Q1DA 4B3BA 1M2GA 3ESAA 2DWCA 1F2TA 3KUDA 4MNTA 4RVNA 4TLCA 4XVCA 3G2PA 1N1MA 1YRAA 3EH2A 3MNFA 1A9OA 3QVWA 2EARA 4N0DA 5ED0A 3PKZA 4KQ1A 4YCMA 1HZZA 2IPMA 3NKFA 4MGZR 1UBHS 4S1PA 3ESYA 4LFCB 3E9EA 4AJJA 1W0CA 2B8JA 4IQ8A 4B1FA 4D1YA 2BTEA 4K6OA 1K08A 1E4YA 2LV8A 2BKEA 3TO5A 4C14A 5LOVB 2C8KA 4FDVA 2IP4A 4HNQA 5FPTA 1LV7A 5FUXA 3WKAA 4JQZA 4CCAA 1J33A 2WYUA 3BMCA 5ALMA 2RHMA 1QANA 3S2GA 3W1EA 1SCUA 2P4UA 4EKGA 4ZHSA 5FOWA 5T67A 2FH5B 1G9SA 1N8TA 1N2CB 2F3UA 2PYIA 2WOJA 1JPNA 3ZHTA 4AY5A 4M1KA 4D9KA 1JAZA 3IS3A 1L5WA 4NQRA 3HY6A 3WKDA 5THXA 2C9CA 4AY3A 4DN6A 3KU4A 2H63A 1HEUA 1LQ2A 4LSZA 4NC9A 2LTAA 4B34A 1M6YA 3PFGA 5CPBA 1R5JA 2R1TB 1UQTA 2OM2A 3LP5A 5ALLA 1K2VN 4TLAA 1LS6A 1YCGA 4R9UC 3VUEA 4HYQA 2A59A 2CVPA 1IOZA 5DM4A 3W6NA 1KFEB 4DLVA 3ZW8A 3H2GA 1DWOA 4R8RA 4XWTA 1Z6AA 3KWFA 1E3IA 3I6YA 3P2OA 5REQA 3RRXA 4E5SA 4QUIA 1ZVKA 3MCZA 3SSNA 2QUZA 5J47A 2EQ5A 2XUJA 2X1MA 3FOWA 1EM6A 3M4NA 3F7OA 4V1CA 2E89A 1PRYA 2YUIA 4BVJA 3TIFA 5I6DA 4UQLA 1Q2UA 1YFLA 2ZPAA 2H1SA 3USZA 4IDGA 5B3KA 2WP8J 5FLEX 4LVCA 1BA3A 5FPHA 2BSAA 1DHTA 1NPTO 3GLIE 2FW9A 4L5YA 5KTRA 3AEUB 3G1WA 1ODIA 2Q07A 3HZRA 2KI5A 5FWAA 5JSHA 5IXSA 4LUCA 3QTTA 2JIZD 1JR2A 2OCKA 2W22A 1JBEA 1UP7A 2L18A 4GYKA 1M8KA 4YV0A 1KMIY 1O3YA 3B6JA 4MAFA 2VCHA 2ODAA 4YP5A 2EU8A 4PNEA 3ZW7A 4UDOA 4LBYA 1W35A 1X6VA 3WADA 5HZMA 5EJMA 2HCJB 1GP2A 3EXHC 4X3PA 4Q18A 3DNPA 1T5HX 3OQ1A 1M2NA 3HLKA 3VR3D 2ZGVA 1T9CA 4H2DA 1X0XA 5CEJA 2PV7A 4FNOA 2Y8EA 1TO2E 5AW5A 4DLWA 1M34B 2HHAA 3PNPA 4CF6A 3D6HA 2VZ8A 1YULA 2G5PA 2QRUA 2AJBA 2CDAA 1SVLA 3OQPA 1T0PA 1O58A 3AU9A 3CNBA 2F8SA 1U2TA 5K0GA 4JP1A 1I4OA 1OAOC 2CUTA 1RS0A 3I6QA 3NHRA 1Q20A 3ENWA 3OZCA 4XGNA 3WGJA 1DKMA 1KZ4A 2HLDA 2NG1A 4M1TA 3QE2A 1IBKB 1Z34A 4YJHA 2VHWA 4KPGA 1JUDA 4WK4B 4OM7A 3OZWA 1UJMA 3ONEA 2LIVA 3P9ZA 1D7AA 1ONPA 3I01M 4MINA 2Y92A 4MVJF 1QNLA 1HORA 4OMUA 4DQXA 2DSNA 5IBCA 5BOSB 1R0ZA 1E4EB 2O50A 3AUYA 3C4VA 2RGWA 4WKCA 4CTKA 3NTQA 2IK8A 3OU7A 1OZAA 2Q2QA 2UYCA 2CV2A 2FN4A 1QKKA 4BO1A 4BNIA 1JBKA 2GTHA 3GAFA 4FFSA 4R8VA 2F17A 3RIHA 3TLGA 1FS6A 1LLCA 1UMKA 2GAJA 3AUAA 1OIWA 3GG9A 4GECA 1LW7A 4JUAA 3QSYA 1E3LA 4IWXA 5F9HA 4JI5B 4EJ6A 5IWAB 3DLHA 1C3OB 1YB2A 3GROA 4N82A 3UG6A 1YIOA 4F7WA 1CDZA 1TL7C 3HWX1 2LRHA 3FJOA 2Z6VA 1C9MA 3QXCA 4LY6A 5BNTA 1ESEA 1KP2A 2QVYX 3WS7A 4B6FA 2FPGB 3SZGA 4HTFA 2EW2A 2HY7A 3OTGA 3FVVA 1BWPA 2DQKA 4KAXA 4JB3A 2QTLA 1C8BA 3NHYA 4KKVA 2VF4X 5A2GA 1ATIA 2HFJA 4P2BA 1GRQA 2ZAYA 3VGJA 1UXOA 3PFKA 3BX1A 3Q6NA 3LD9A 4K9SA 5JHGB 1C5KA 1WPRA 1ONNA 3IP9A 3KEQA 3S29A 3DOJA 4H0NA 2DFVA 2QVZX 4M8SA 3P9PA 1MEJA 4D8WA 4GKJB 2H1FA 4XJVA 1NLFA 1IUKA 4LE0A 5GJWC 4MW4A 3TNYA 4G0NA 1YS2X 1OUMA 5P21A 3CONA 5JXIA 1YL7A 2WU8A 3EUFA 3O93A 3IP3A 4HAYA 1FNMA 2AMLA 2Q0HA 3JQGB 3CT4A 2V5VA 1VKRA 1YZGA 2PRZA 1VKZA 1QMPA 5BSWA 1NF2A 3M6IA 2FCAA 3S8MA 4DJEC 2CL6X 1CIJA 3NVDA 2IA5A 2FEAA 3D2AA 3PPYA 4TWIA 3ZIAA 2PUWA 2J6BA 1ONOA 1WB4A 3IA2A 1GQ2A 4LG1A 3AF3A 1ZNZA 5I9BA 3Q7TA 4E70A 4ALNA 4ZZ3A 4MYRA 5LQDA 1Z7GA 3NXSA 3E2PA 4FLFA 5L3QA 3L6CA 4U8HA 1Q0ZA 4TKLA 4EJFA 1HSZA 3ROZA 5GVSA 5LLTA 3ZHBA 1UJ2A 4A8JB 1GPAA 3BD6A 3D4OA 4IOLA 3K9QO 4AYTA 3IUBA 4LK3A 2ZREA 5EEGA 1GQYA 2LR0A 3BORA 5A5FA 2QKYA 1Y3AA 4IIBA 2ERCA 1NKTA 1VE3A 4F3YA 3IL2A 1O54A 3A8TA 3ESZA 1FK8A 1JTEA 5ALSA 3RV3A 1KZ9A 4CT4B 2AG5A 5DO9A 3JQ8A 5JSZB 3SHQA 3TVDA 2QJTA 4X71A 1VL1A 1DT5A 1XZAA 1U28C 4H0FA 1X3SA 2AOXA 2DX7A 2QMOA 4POAA 3TFOA 2CKDA 2MSLA 1P1CA 2HYIC 2AOUB 1RKBA 1JI3A 4KPEC 1FUKA 4LX8A 1A5BB 3K9NA 3JRXA 3TZCA 1ZP6A 3AGQA 1PNOA 3L41A 5AT1A 4RACA 4FGJA 4PW0A 2OCYC 3W9UA 3WJ1A 2YJZA 4OPMA 2HIHA 2QRQA 3IKLA 1NULA 3JZIA 3N70A 4KL8S 5ESXA 4ZJYA 3BERA 3NTOA 4CF3A 4CMEC 2AYZA 5ALZA 3W4KA 2YFQA 4B47A 3L0SA 5CA1F 1G5HA 4LF7B 1EK5A 1ZZGA 2ZSJA 3R3XA 2UVPA 3RUAA 5BNIA 1NG9A 3AR9A 1B8OA 1XELA 3C3MA 4R8LA 4KWIA 4P58A 3U6BA 1R6VA 1BW9A 2A0YA 5EE1A 3DZHA 3BXFA 4D46A 2WWGA 4QDJA 4GBGA 4ZV7A 3QVXA 5J3JA 2VPPA 3KEFA 2PS1A 2FUKA 4CIAA 4QRDA 4FONA 2P2LA 5I01A 5AI9A 4YWJA 1G9XA 3QVTA 2ZBFA 1KJ8A 1IY1A 5B3LA 4J3FA 5BXYA 1XXLA 3UWPA 3ONWA 1IIRA 2J0UA 1OWLA 2P1DA 3G2LA 3IR7A 2EC5A 3F5FA 4Y6LA 3R7SA 3T7JA 4JH0A 4QJ3A 4WNYA 4ZCQA 5HJ5A 5I4CA 5ECDA 1BAPA 4I1RA 5LVAA 1ISPA 3UMJA 1XTZA 4DIKA 3HDGA 4OXQA 1TAGA 5HKBA 1ZM9A 5JPDA 3JSXA 1YXMA 4GOOD 1F8XA 3HB4X 3AM4A 1KDYA 3REQB 2FDCA 3ZV4A 1NVEA 4H59A 1I6MA 2JCYA 2J6HA 4HN2A 2PU7A 1N9ZA 1X1BA 1E2MA 2BHLA 2MYNA 3UK0A 4LHXA 5B37A 2FAXA 4XLZA 3KJHA 3G5AA 3JQDA 5ITWA 4Y1EA 3WWCA 3A11A 1IM8A 1FOEB 3H2ZA 1G3IA 2WBLC 3C97A 1GDTA 4UQOA 1FXSA 2O0KA 1HL7A 4G0OA 1HK7A 1VHLA 2ARKA 1Y63A 3Q7SA 1X70A 2LCFA 2PUEA 3VKFA 1WLYA 2VDWA 2D0DA 2YC2C 2EZ8A 2YWFA 3JWHA 3F4KA 1SHZA 3UUWA 1KZ1A 4B3JA 2HV8A 5DN6A 4LYGA 5IAOA 2GCPA 2JANA 1CNEA 4FDTA 1S2MA 3JQ9C 5CK4A 4E03A 1Q0QA 1ZK0A 2YV2A 3R44A 4G6ZA 3OUZA 4JLNA 7REQB 1KOJA 3R6GA 2Q29A 3G13A 4F9FA 2JVKA 1UM8A 2IDMA 3LPLA 3TOZA 3I23A 5FOTA 1RXWA 5BUZA 2AIRA 1EVJA 1JE0A 1E2JA 2IXDA 3V1MA 4B2YA 3EZXA 5AO9A 2PGIA 3MWYW 3OPYA 1J0BA 1QRDA 5EWJA 1FLAA 4N40A 5HG0A 3W05A 3W8FA 3N07A 1C3LA 2A9FA 3O3NB 5TV2A 1U0OC 1Z8NA 2XXBA 4JUFA 4LZOA 2GM3A 3DL0A 4YIHA 1JHAA 2CCJA 2BEWA 5BNWA 4UMVA 2C2YA 4B8YA 5KNBA 3IILA 4IXDA 3L1HA 2X9QA 2JCGA 4RC9A 5H0IA 4B9AA 1KEEB 1Z37A 2QPTA 3PQ6A 3H3XA 2O0HA 2YS6A 4KMSA 1Q7GA 2GM9A 5EPUA 3AVWA 2ZQ5A 3OE1A 4M6WA 2ZT8A 5TT1A 5I5EA 3LI2A 4C1BA 2XSZA 5LOVF 5FRDA 1BXKA 1P1IA 2DWPA 2NP6A 1N5KA 5EMKA 2WVGA 3O21A 5CVJA 3AI2A 4R83A 4IDHA 3SYTA 2IBMA 5FOSA 4BNKA 2ZAIA 2B6HA 4UBIA 3HU1A 1N3IA 3IXLA 4OVKA 1T2UA 4PLVA 3QE3A 1DAIA 4TL7A 3QFFA 2R25B 3OT5A 4OEHA 3KPYA 4RGVA 1V39A 3FRIA 4G4GA 3FZYA 3HDVA 3E1SA 1FP2A 2YBDA 3OOYA 5IKEA 3NOXA 1OROA 1NJFA 1ZMRA 4YV7A 2I6TA 3MT0A 2WU1A 2DT8A 3F6YA 1QCDA 4WLFA 3ZH9B 4OSEA 3CUVA 4AMYA 2UUBB 1NUSA 1Z9BA 2PT5A 4RQAA 1TLLA 3JYOA 1CF4A 2H0QA 2HYDA 3IH5A 2Z1DA 2WHPB 1VLVA 3M2TA 3H0EA 3TAUA 1V9LA 3VPAA 1W1WA 2I1LA 5IS2A 2IYXA 4A91A 4KDCA 3R09A 1T9KA 4UOZA 1N36B 4B4VA 1X7YA 1JT9A 2NN3C 3TW0A 4MV4A 1EE2A 2RGUA 5CLIA 1EK6A 1GEEA 1LJ8A 1V7PC 2EEPA 3QLVC 2RONA 2WV7A 4CDNA 1JJVA 4J6FA 4DILA 3GA7A 2YR0A 2F8TA 2G7ZA 4TLMB 4YR9A 4DY4A 4ZHQF 1GZ5A 4IHQA 3K0CC 4BY9E 2WVJA 2ORED 2HSJA 3D5EA 3K94A 4GMXA 4W7HA 2DLNA 1G8KA 5HS4A 4WXRA 1N8NA 1A72A 1OI3A 1RHMA 4OHRA 5DIFA 2KW5A 3AI1A 1XRJA 4FWBA 4LJ4A 5BSGA 2WJ3A 1RBZA 5KNDA 3JQFA 5BQOA 3OQBA 4OU5A 4PICA 3TECE 2AFHB 1Y3IA 4ZALA 1OWOA 4OJYA 4J43A 4TS1A 3CLUC 4HVLA 4KQ2A 2D0IA 3G88A 3HYSA 3K53A 3QU9A 2AFVA 4QU9A 4FMBB 4UD6A 4GPTA 2GD6A 3D1LA 3HCEA 1BQ3A 1MCZA 1YRYE 1BFDA 2C61A 2YY5A 4JBYA 4FE4A 4KN8A 1FYEA 3K2IA 4RF4A 1T1SA 3RKSA 3OD1A 3RSQA 3FZQA 2ZJBA 4QULA 3TXYA 4XUGB 4FYPA 3IERA 2JCBA 2JRCA 2XRZA 1U7OA 3SC3A 2NV0A 1Q17A 3DTVB 2BEVB 4RJ2A 1YZQA 2ORVA 2H2AA 5I45A 4I2NA 1VCNA 5FBHA 4QVIA 2WV9A 4I4LA 3L84A 4QD3A 1H4SA 4M88A 3ACCA 4GX2A 2C5HA 4IIYA 4PAOA 1T9GS 1N1EA 1V16B 3GUUA 1O96A 1P3Y1 5DEIA 2ORIA 3V48A 5CBPA 1N9GB 4KO2S 3NW9A 1OFUA 4FMDB 1SHKA 4Z4QA 4GYWA 4D0GA 1U9JA 1TU4A 2IW1A 5FV4A 2H0AA 1K6IA 3GWGA 1M6HA 3JW8A 3NEPX 1KI2A 4MPJA 5BMVF 1JSZA 3QU2A 1BE0A 1ZM4A 3GZNA 2OA0A 4HB0A 2WMOB 4W4TA 2AOVA 4HDRA 3A1UA 5KU7A 2AN4A 5AVRA 2VWQA 3Q1LA 2BHRA 3RT1A 5AW6A 4EJ0A 3IT3A 4Q4JB 5J2UA 1NMZA 4M0LA 2WSBA 3BXXA 3M4YA 3VHXA 4BAGA 3IUQA 2ZB3A 5B6PA 5KTSA 3K5HA 4RQUA 1J21A 1B0PA 3QVGA 4ZCSA 3CV3A 5A7GA 3RYHA 2QV0A 1U2EA 3K5PA 3RJMA 1F7VA 2OO5C 5D86A 3DG9A 1IOVA 4H1TA 2J9GA 2I54A 3M81A 1WNFA 4K1XA 2XVZA 4RLSA 4LI3X 4IX1A 4UHFA 2PZGA 1NT2A 2I65A 5CLQA 4BV3A 3LWDA 1YKGA 1Z2CA 2OZVA 1V3TA 1V6AA 3PEEA 2FGJA 1S3SA 3GV0A 2IZ5A 4XW2A 3O0TA 2AC4A 4IDEA 1H6AA 1UAGA 4NG4A 1JQKA 2Q2VA 5ICMA 3WWZA 1OH7A 1XT6A 1II0A 4WL0A 1Y5LA 3IODA 2P79A 3H99A 4KN9S 5HMLA 5J5AA 4YCJA 1FMJA 1T5DX 3E9RA 3N59A 2XDQB 5FBLB 1FXWF 4XJXA 1PJCA 3V1NA 3AKYA 4AW9A 4D97A 1FTGA 1PS9A 3WY9A 3ZDXB 4BZWA 4YQFA 3OPNA 3KYIB 3K1AB 3KDSE 2HU2A 5EVJA 4RPKA 4AI6A 2HL6A 4AYWA 5K8CA 3ECSA 4DYDA 1MQ8B 4GOLD 1ULUA 2MSKA 4Q6BA 2P3OA 2CDBA 4AO7A 3PJDA 4HG2A 2FHSA 1E20A 1NI4B 2OPBA 1FSGA 2WIKA 4YJGB 5DOZA 3CX3A 1OTYA 2WA2A 2EGUA 2PKWA 1FX0B 2XRMA 5ERYA 5JLAA 4BATA 4PZUA 2MSDB 1EXNA 3ABOB 4GUAA 1XHEA 1Y82A 3LYLA 1E58A 2J0VA 1EXWA 1UJ4A 1V6SA 1P0MA 1TQ6A 1ESZA 1VMEA 1VB3A 1H2XA 1X15A 1ZXXA 1MJGM 4Y1GA 4CMHA 4RUKA 1G21E 4ER7A 6YASA 4GGPA 3LFTA 4I1UA 1KJ9A 4LJ9A 4OXNA 5D87A 4HQLA 4K03A 4TMZA 2WQZA 2Z08A 2Z0MA 3Q3IA 2JI9A 4HDNA 2FZCA 3W5DA 2GUGA 2JJ8A 4Z8YA 1E0AA 5CIQA 5H82A 3E53A 3D81A 3LKDA 4MYDA 4B82A 4KYUA 4EG4A 1X7WB 1MB2A 2Z3VA 2E6KA 2N42A 2OD7A 3CC8A 4HYEA 1X1AA 3INGA 2RHDA 4HKTA 3IT2A 1NBHA 1GUBA 1MHPA 1NY5A 1I1QB 3E9CA 1X38A 1JFVA 3HWWA 4B6RA 2L17A 5FI5A 1CERA 3IQGX 5KPJA 5LZ8A 1E9VA 5CDSA 1URPA 2VTKA 1K0UA 4GM4A 4X6YA 1DJLA 1XQ1A 3OMLA 1L5GB 2ZIWB 4UBMA 2OXRA 2XJ4A 1G55A 4ALMA 3K6SA 4WA8A 1JIQA 4HO1X 4JCCA 4HLDA 3DL4A 1KTIA 2HCFA 2GPWA 3UCFA 1TF7A 2NIPA 2QD4A 1XZJA 4I6EA 4EMSA 1YDFA 2B2CA 3HDJA 3O2SB 3QMWA 2R48A 3FMPB 5EERA 3X2FA 5IK2A 5IX8A 5JC1A 4KTTE 4ENTA 1T8SA 1HNXB 5FEMA 3R0QA 3AH8A 3NH6A 5DBGA 4FBLA 3DEKA 1P61B 1QGDA 2GF0A 2WJIA 4RTJA 1Z5ZA 1EKXA 4HDMA 3ZVMA 2X4IA 2IIBA 4ZT3A 3FTPA 2VF2A 4M4SA 1TM4E 2P9CA 2FZLA 4OYHA 5FBRB 3LC0A 3SBXA 2QP3A 3ESDA 3KD2A 3QK7A 1K7XB 2R4TA 4RANA 2OCXA 4IMJB 4ZHQA 1XKLA 1TD1A 4Q9DA 1HLFA 4KO4S 13PKA 1WP4A 4CDRA 4JJ4A 4PSVA 2PLFA 1Z47A 3TEJA 2ONCA 4OG2A 3UOAB 4XI9A 5FBWB 3VC3A 4LKOA 2FQWA 4BEWA 1LWOA 2C4NA 2CWDA 3EXHB 2J7KA 5B7GA 4J16C 3JWEA 3NBXX 3BRQA 5KKNB 2ECFA 1I2BA 1IJKA 4C3UA 4XWWA 3OCXA 3GRYA 4PGMA 2FR0A 4QSMA 3UPTA 4JEUA 3FN4A 5FPYA 1H8ED 2ZSKA 2XUQA 5C18A 1H6CA 4IAOA 3RRBA 3I0NA 5IRCD 1P2BA 3RFTA 3QKIA 2BRUA 1G7CA 3QE4A 1U11A 4MCJA 2OAGA 2WWIA 2WSMA 3FM9A 3UWDA 2ECQA 4DJAA 4N6GA 1XTQA 4P86A 3F1LA 5AI4A 4YAWA 1XZKA 1YTLA 3CW2A 5FOUA 4K81B 1N2SA 1YZNA 2N0SA 4TLEA 4KE7A 2Y93A 3ZBUA 2OHGA 2R1VA 5B4UA 4QFCA 1PU2A 1AUPA 5MDHA 3N58A 1Z22A 4LHEA 1ZM3A 4QYIB 4XZ3A 4PCLA 4G36A 3CNNA 2HSGA 4UDXX 2JARA 3DE4X 4WFIA 4ACAA 1KZHA 2OAP1 2J07A 4QGAA 4ID3A 1SKUA 4AG3A 5C32A 1Y3HA 2BTQB 3UJ6A 3O9MA 3BJZA 3NAMA 4EFLA 2BM8A 3MWLA 4XARA 5F1YA 4JI1B 3AF6A 1PR1A 1W0KA 1ACLA 4N5NA 3SKVA 3Q72A 3OQNA 4O4HA 3L0IB 2G1KA 3IUMA 4Q4AB 1AXGA 2IPNA 3NPMA 1GPYA 4U7WA 4KACA 2XNCA 3CBQA 4HNAA 4MDFA 1SCBA 4LJRA 3FTDA 1SWWA 2BCGY 1O0CA 2BSXA 3MRSA 4RTNA 1U2RA 2N1BA 3ND7A 1GVNB 5T7BA 1RE1A 1UUFA 5ELMA 1U7WA 3GDFA 2BCEA 3KS9A 3UV3A 3ZC3A 3JQAA 3FI9A 4O29A 5E38A 2XHZA 4YPOA 1YA4A 4DR7B 1X7WA 1YE5A 3E3MA 4CQLB 2Q9UA 4V0SA 3CXRA 3L4SO 3QGMA 221PA 1VJ1A 2VUTA 4BGIA 3PCXA 1C0IA 2EIHA 2G8LA 2KJQA 2IP2A 2CJWA 3C7KA 3GJ6A 3ZBPA 2VBFA 3GB9A 4O2LA 3UH1A 4OI4A 3R6DA 2C78A 1MFPA 3MTDA 4GBJA 4GPD1 2IOFK 4H7EA 4MQ6A 3BN3A 3KOZA 4E1BA 4MB2A 2B98A 1XCBA 1VE9A 1NW4A 4L16A 4R1MA 4ENPA 1AK1A 4Q4CA 3Q41A 2Q41A 3G2KA 4Z9AA 1V9SA 1SBQA 4IIJB 4KQHA 1DQSA 4AJPA 4ABTA 2DBRA 1H4TA 2I03A 4JT8A 4WH0A 3V34A 1PR6A 5HW0A 3OIWA 1NY6A 1OFTA 4YRPA 4A0SA 4KWEA 3BCSA 3E61A 1K3UB 3DDOA 3I1JA 4NL4H 4H7KA 4ZRMA 1DC7A 1XEAA 1AKEA 1HI9A 3B6IA 3EWNA 1CJCA 3NR2A 3R74A 4GDMA 4HDMB 3C5HA 2H5LA 4X97A 2NO4A 5JY1A 1BD4A 3FYDA 1TCCA 5CVVA 5BR7A 5JU6A 1X7HA 1XRPA 1DO2A 3EFHA 3DE5X 2J7PD 2ZI5A 4NS4A 3FDZB 2LD4A 4KR7A 5GY7A 1SC6A 2ADOA 1A5AB 4LPSA 5FBZA 1NVVR 1NYQA 3DQPA 3DD1A 2F62A 3U4IA 3V00A 4FBMA 3MRVA 3BS4A 3A6ZA 4TKMA 3PDCA 5AW9A 3D31A 3JQBA 2CDCA 2X0DA 2IYNA 1IAQA 1GHTA 2CD7A 3GA0A 3LL7A 4OQQA 3UJBA 5BSRA 1PZEA 1AH2A 4IV0A 3AP1A 4UU0A 3UJCA 2CMKA 3L06A 2D00A 3DDZX 2VQSA 3EGWA 4I66A 4JVMA 4KVZA 1JVSA 3KPWA 3WIVA 4DCUA 4JR0A 1CE8A 4KLCA 2R6DA 3CZCA 1XALA 2CLHB 2GH1A 2Q5OA 4Q16A 1SN7A 3RVNA 4R1UA 3A37A 4YJ2B 4DC9A 2QVGA 3UMBA 1E32A 1GTVA 1IG0A 1XO1A 2H1IA 4XIGS 1A97A 1EJBA 1NONA 2UZ3A 3B9QA 3DYBA 3E15A 3EVTA 1K8ZB 4HB2A 2J4DA 3BE4A 5HK8A 1CULC 1E6CA 1B93A 3W2EA 3K5IA 4QM7A 2POCA 2X41A 5CAEB 4G5OA 1UKCA 3RT7A 2UUOA 3IO3A 4BKMA 1J23A 3VO8A 3FNBA 1GGHA 1NVWQ 1LQUA 1RIFA 2Y1FA 1G6OA 2GPBA 4PYJA 1NGSA 5GZ6A 2P2NA 4HJRA 4XRRA 5I9TA 1WLSA 3NYIA 5DCLA 4BRUA 4R7TA 4YAUA 3TZKA 1CDDA 2QW8A 3D8SA 3SXJA 4KX5A 1ZITA 1PJ4A 3AVQA 3OPYB 4G1EB 4CMIB 3K8QA 3DTVA 4AWBA 4BNHA 2HK7A 1N7HA 3F6CA 2KYRA 2QYHA 3H8WA 4GL2A 1L4EA 1RVV1 2OD2A 5EWLA 3AXTA 3D0OA 3I72A 3RLIA 2Q6LA 5U4XA 2GLUA 2PX4A 3ZH2A 1NP3A 4F72A 5EIXA 2ZWAA 4IW3B 3IQZA 4ZWNA 5AVUA 1RXCA 3CW9A 4NFHA 4C20A 4DLYA 5KOHA 2D0PB 2C2KA 3AMVA 3RVKA 4EGFA 4Z0TA 4J7UA 2X6TA 1MQ9A 1LDBA 2YWEA 4XJTA 2R4QA 3QFCA 2WW8A 3R0JA 4ER0A 4YB8A 2BGRA 3F49S 1RAFA 4YTEA 2QM3A 2H31A 2R6GA 3CIFA 1G2IA 5KQLA 2ECPA 4GSYA 3R6TA 5IMBA 5CXQA 3T1VA 1ADJA 1F4VA 2C1EA 1MH1A 4LYFA 3W2FA 1D5CA 4C89A 3P2IA 5CH8A 4LV6A 9ABPA 3DZFA 3H9GA 4XTCS 1I36A 1PZXA 2CBGA 4PLYA 4AT1A 3HGTA 1HZZC 1Y6QA 2QTVB 4DG5A 1GZVA 2GZDA 2I4TA 4TV8B 4GPAA 2NUTA 5JOQA 2O8FA 2BFEB 2A78A 2O9JA 3DFKA 5AK0A 2GVZC 1BJKA 2ODPA 3GEMA 4LDAA 4XCQA 5KWVA 2FK8A 3O3CA 4CEHB 3HEAA 4LWOA 4WBXC 4F1WA 1QCYA 3NKVA 5E1MA 4CZ2A 4DGQA 2QLJA 2XHEA 3ONDA 4IDNA 5AJWA 1JH9A 4JZKA 4UM9B 1PL7A 5IM4F 1O95C 4ALIA 3PHGA 1GR0A 4O2BF 1E2QA 3DLTA 4B48A 4GPBA 4AKSA 4JI6B 2X0NA 4GP6A 2O5EA 1TM5E 3OJCA 3VKUA 2QN6A 2R6HA 3LO8A 2Q5HA 5EE3A 4YJDA 2M6KA 4DCTA 1U0EA 3KAPA 2QN9A 1CP3A 2VDKB 3NTXA 3OIDA 1XLWA 4G8DA 2RCNA 3DMYA 3B1KA 2QX6A 3FAKA 4A0FA 3NHMA 1TKBA 1DKLA 1UBSB 3A1TA 1GD1O 3OLYA 2NQ2C 3UMCA 2C03A 2BR3A 2FPPA 1G5IA 2PIAA 3VMMA 3NOQA 1QP4A 1R9NA 2ABWA 4YJ2A 1ICEA 1QHGA 3B70A 4S1NA 3CZ5A 3NWOA 1MOSA 5KUTA 1Q1GA 2GZMA 2ID4A 1CIVA 3P0IA 1TZ2A 3GGOA 1C9KA 1EX9A 3KJIA 3QPDA 4TT3D 5I7RA 2Y9MB 3O3OB 3ADOA 2ZIXA 3H5WA 1E1KA 4DBLE 3LX6A 4N5LA 1M74A 1QG4A 3FCOA 2X86A 3DKKA 5EQFA 2ZSIA 1E5LA 3JQFC 3LXMA 4GNKA 5U9CA 3LP6A 3ED5A 2OORA 2BVNA 1SCUB 1CLUA 1XOIA 3NPAA 2RH4A 5TQ0A 2WJ4A 5IMSA 1RTTA 5KOYA 3ES9A 1C9DB 2AG8A 1SCQA 4P8RA 2FPKA 2A1UA 4U7HA 1FW6A 2WFZA 2XTNA 3ITDA 4R98A 5JSYA 3HXLA 1ZK1A 3QZUA 4N3CA 5JSQA 1NMYA 1CZLA 1IATA 2M98A 4UFOA 4HAXA 4JXJA 5E4JA 3V9AA 4BP1A 1DV2A 3QFHA 4PLPA 4PZDA 1TA9A 2VZLA 1CY4A 3A4IA 3K0FA 4CRWB 4YMWA 1YTUA 1VYVA 3ASZA 4FW8A 2ACVA 4OL9A 4DUPA 2XEDA 1MB0A 3DCIA 3UAVA 3WYAA 4QDZA 4EB6A 1OX6A 3NRJA 3C1AA 1Y37A 1PGOA 1L4NA 5MN6A 4PFKA 4L6IA 4B7XA 1KQOA 4DCCA 3I5MA 4V02A 5B1EA 4N41A 2XKBA 1KI1A 4D81A 1A9YA 3MWDA 3ORFA 1FDIA 1YS7A 1U3CA 1YVEI 2IYTA 4MOWA 3TLAA 4E5YA 2POQX 3CO0S 4EI2A 4X64B 1OXSC 3H6GA 4RD0A 1E0SA 2ZBPA 2ALJA 1D2EA 2RMKA 2JCXA 2YZ2A 1NXWA 4LBVA 1VI6A 1C9EA 2ZDGA 5FL7A 2QT0A 3EMVA 4DHEA 1WDTA 1JLKA 3LHDA 2V3WA 3G0IA 1NPYA 3L77A 4MDEA 4JGBA 4X7RA 4LJYA 3K70C 4QM6A 5JDCC 1JEDA 2ERYA 1DUIA 2OLJA 2QRVB 4M22A 3LWBA 5GONB 5A05A 2XQKA 5K3AA 3HXMA 1QH0A 4DNOA 4WESB 5C8YB 1DAFA 2EL9A 1XRRA 2GN4A 4AU1A 2ZUUA 1L4GA 4R3UC 3KSDO 1TFUA 2R6FA 2ZUBA 2PHZA 1I4DD 3OF2A 4O5AA 5LP1A 3P26A 4B45A 1U63A 1E3QA 3DMPA 4TN1A 1GGNA 1JP7A 5KNDH 1YZLA 3LLMA 1MB3A 2EFGA 1ZYUA 3EA0A 4BO2A 2IWHA 2W8ZA 3A06A 1NOJA 1WXWA 2WHQA 2ZVQX 3B6ZA 4V24A 1TYAE 1JIUA 2R6R1 1CQXA 1DBRA 1KAGA 4RIGA 4MGHA 2O07A 2ZRGA 1FP7A 4WNAB 3E18A 4ZVOA 2BEJA 1YCHA 4ARBA 2WYVA 3WB0A 3L0BA 4BMCA 4Q3AA 1LQTA 1IQRA 1ZD4A 3KSAC 2C0PA 1T2VA 2BR5A 3N75A 2PZAA 5FHQA 1BCRA 4JVNA 4JFRA 5EWMA 3H9BA 1H5QA 1NN1A 1TRHA 1XZDA 1L7QA 4JBWA 2VP3A 4M1ZA 5IAEA 1G3MA 1E3JA 3B52X 5ESRA 1C2YA 5CEFA 1B42A 1SEVA 5IBRA 1WZCA 1NV9A 2ZI3A 3JWGA 5AM1A 5CVCA 3RO7A 2WF8A 4RHCA 5JMOA 3OTQA 5BSHA 2GQ0A 1SA0B 4P80A 3EPKA 1AGNA 1YFKA 1BGVA 3T7KA 5JLJA 3ADBA 1E4VA 4ZEOA 2Q7OE 3HTXA 1HYQA 4DUZB 4Q4JA 2X2EA 2CXNA 1LTKA 5J2UB 2JC3A 3DOEA 4QYTA 3NC4A 5E2IA 1YGYA 1Z0SA 2FG6C 1E2HA 2IQIA 5KTTA 3AILA 1MAAA 3EOAI 4ZVQA 1RE0A 4Q7MB 3KJQA 5FJJA 1P6XA 4HWOA 4XR9A 1TYDE 1V4NA 3DP9A 4AJNA 1K63A 3N6XA 3ZWCA 1CY7A 3WB2A 3OZ7A 4K87A 2ID9A 3HMQA 3UUEA 1GOTA 2VYNA 4HH4A 3TUIC 3E81A 1WX1A 3NV9A 5C2JB 4ZI3A 1PO7A 3DDNA 3SICE 3WOVA 3V7UA 1UJCA 2Y0PA 3DAYA 4DDKA 1E69A 4K86A 3OAAA 2XZPA 3NHAA 5IAKA 3OETA 2UAGA 1ZIXA 1O8CA 4ZOAA 4BLPA 4W9NC 3VPHA 4YMGA 3DHNA 4NZ9A 2DZDA 2G0NA 3UJ3X 5C1DA 1AQJA 3OIYA 3KZKA 1EXDA 4N3AA 2QN2A 5TDHA 3VOSA 5HIMA 4Z3OA 5I5GA 3VR5H 1QPBA 3BXPA 3G49A 2ZYTX 3HN6A 1U0RA 3LC2O 4OMCA 2E21A 4URUR 4QYXA 1RQLA 4M0UA 5FADA 4U9IS 4PSDA 1ISFA 3HB1A 3U9SA 1QAMA 5KJCA 2OGSA 1VJCA 3JQQA 2P7HA 4D8UA 4P7JA 1OXTA 5FBQB 1A4IA 1IOWA 1E5VA 3HDQA 3I9V1 4OHPA 3WFZA 4NH4A 4WVFA 3CSDA 4NX2A 2VHXA 4YC7A 1S2NA 3EH1A 3OCWA 3PEYA 4WZBA 4BFZA 2PXCA 3AYZB 5K5EA 3IEVA 2WDZA 2ZBQA 3IMFA 2YXNA 1F8YA 3BXGA 3L1VA 4OHWA 3UA4A 4B6GA 2BMVA 1QIEA 4BV9A 3DO6A 1RLOA 4QXMA 4DV6B 4JU9A 2HSEA 1CUCA 2E5FA 1KDZA 4Z4HA 2VJBA 2JGRA 2Q3MA 3U7JA 4FEEA 3F7TA 5JNSA 1Q21A 2HWWA 4X1YB 3NGXA 1DGQA 5BSKA 2JH3A 3MUEA 2E4VA 2FFQA 3LNCA 3O2NA 4ES6A 1T10A 2O48X 3WGMA 1W87A 2QA5A 4NBRA 4AKTA 1JHPA 3DE2X 3DZDA 3T3DA 3ZI4A 4RSGA 5JXHA 1FUEA 1E5QA 1U81A 2OKCA 3K92A 4C2TA 3LF2A 3N1UA 5M3BA 4F3CA 1IK4A 1RP1A 4FLEA 2BOVA 5D3MA 3A4VA 4MQEB 4ER5A 4F4HA 3FPGA 1LX6A 4LVOA 3P96A 4YJ2F 3NAQA 2FQQA 3ULKA 2RI1A 1PWEA 3FCAA 3HYRA 4R9RA 1O7JA 1IN8A 2I8AA 4P3OA 4E46A 3EFBA 1SGWA 2FUEA 1W2GA 2XD4A 3TGPA 3CXUA 1UMDB 3SXUA 3ZU5A 3A9VA 3PJFA 5DPMA 1XQ6A 3OURA 4BO8A 4RTSA 3PR3A 2JI7A 4LW8A 1GN9A 4V2IA 2W2TA 4PC6A 5AXDA 3AVTA 1JYEA 3RHFA 3P9QA 2EW1A 2YV5A 3BMXA 2CK3A 2M9MA 3MD0A 4HMPA 5EJ6A 1DPGA 1JKMA 1PG5A 4K7JA 1FBNA 1Z13A 2C84A 4IX9A 3C15C 2OBNA 1XA0A 1YB1A 3IELA 2V7QD 1QHEA 2PU5A 3L6BA 3NDRA 4HNGA 4X1IA 3GJTA 1V8ZA 3RBXA 3KM0A 5LA6F 4ETIA 3FKJA 3IIIA 1FNSA 2ZRCA 3TWOA 4F2DA 3OLQA 1TF2A 1DRJA 1U3WA 1L8LA 1O6FA 5KAMA 5CB8A 5BRJA 1QAQA 1S2LA 4KC0A 1JGTA 1ORIA 1U5BB 3WOHA 4LXUA 4UARA 1QR6A 1DC5A 4F7DA 4S1VA 4BBPA 5GZ1A 5BNFA 4G81A 1XZBA 3ZE6A 2R97A 1ZS9A 5C51B 4LZJA 4G0VA 3A26A 1TAHA 4PS0A 5JATA 3A10A 5KYYA 2D6FA 1PFWA 3N8GA 4HLUC 1IHPA 1QC5B 4LZZA 4ZT2A 1PZHA 5G3ZA 1W88A 2Y71A 1LC3A 1VE7A 3EIWA 3ND5A 4MP6A 4RY8A 4XQGA 2BGMA 2D5AA 1QP7A 1FFGA 4DTCA 3CZQA 5AKYA 3KZOA 1PK9A 3LRTA 2XYVA 5L45A 3CEAA 1MEEA 5E4TA 3CKMA 3CX4A 3E22B 3I9FA 1VJ0A 3W90A 4BB6A 4MRSA 3NJRA 2VNJA 5CHYA 1KEWA 4A6XA 2YW2A 2W2QA 3F96A 1Q50A 1QK4A 3C5CA 3L0CA 2B1IA 1E0JA 2F1OA 4JLBA 4JNCA 4KLNA 3I37X 4JVSB 5G4LA 5JYDA 1WHTA 4AS2A 1PUJA 1G21A 1FTNA 1R8QA 1WF3A 3E7XA 4C6SA 1IVSA 2ZAOA 4LMBA 3KSBC 1VA5A 3OTHA 4GOKA 1GGMA 2FPMA 4ZQHA 4KXMA 1MEOA 5H3HA 2ZJAA 5EZYA 5GONF 4TKUB 3ZN2A 2BHSA 2WG2A 3MQFA 1L8AA 3H18A 3PGXA 4DR5B 1SHLA 2C4VA 1Q1NA 4IGEA 5JNVA 2MU1A 5CU7A 3Q8KA 1FB5A 1CJVC 1ZBDA 3ZZNA 3EZYA 5B55A 4F4UA 3KYJB 3UQYS 3LECA 4RF5A 3ZE0B