1XYYA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, homodimer, oxidised state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 51
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xyyA00
1T5BA 3W77A 3GFSA 1E5DA 1I1OA 2FDXA 1D03A 1AZLA 3FNIA 3HR4A 2WC1A 3NHUA 4ZVLA 3NHRA 4F8YA 5LJIA 1RCFA 3GAMA 3TE7A 3LCMA 2X2OA 2GSWA 3P0RA 1ZWLA 3R6WA 1AMOA 3D7NA 3SVLA 1YRHA 1J9EA 1QRDA 1CZUA 2KLBA 1J9ZA 2MTBA 1FUEA 3B6JA 3FVWA 3JSXA 4GI5A 3ESXA 1ZX1A 2FZ5A 2KQUA 2QMYA 3GFRA 1CZRA 1BU5A 1DXQA 2BN4A 3NHSA 4U7FA 3OJWA 1RTTA 4H6PA 5FUQA 2R96A 4H2DA 4D02A 4YALA 3N3BC 4PTZA 1C7EA 3N3AC 3NHKA 4PU0A 1CZNA 2BZSA 4Y9RA 1F4PA 1YKGA 2HNAA 2V9CA 2W5UA 1WSBA 5A4KA 3KEGA 4LTMA 5ULLA 1XT6A 3U7RA 4YAUA 1KBOA 3UXEA 3L9WA 1C7FA 4BMOB 5B3LA 3ZHOA 3NLLA 3OX1A 3F6SA 4YAOA 1WSWA 1XYYA 3OX2A 3QFCA 4U7HA 1TLLA 1ZWKA 3W7AA 5LBTA 1QHEA 1JA1A 1CZKA 2MWMA 3K1YA 3NHPA 1BVYF 2X2PA 3O73A 5LMCA 4ZVMA 2MT9A 2F1OA 2QMZA 5EAIA 2QR2A 3ESZA 4N9QA 1YCHA 4XDGA 3EYWA 1GG5A 3OJXA 3ES9A 4LA4A 3W79A 1FLDA 3KAQA 4LAFA 4OXXA 2FOXA 1B1CA 1AG9A 1D4AA 4U7GA 3O2NA 3OWHA 5EMNA 4C14A 2R97A 6NULA 2FAXA 1FVXA 2FX2A 4Y9UA 4QOJA 4YQEA 5F51A 4DILA 4DIKA 3F90A 4QODA 5LLDA 1FLAA 2N1MA 5JROA 4ZVKA 5FX2A 3L9XA 3NHFA 4HEQA 1AKVA 3QFRA 3EDOA 1FLVA 3KLBA 2XOEA 3FW1A 4S24A 4YAFA 5BUCA 3NHWA 1J9GA 5EA2A 2FVXA 5NLLA 4N82A 4ESEA 3B6IA 5NULA 2OHIA 1QBGA 2M6SA 3LT5A 1VMEA 3N39C 1XI2A 2FZVA 3S2YA 4C0WA 2ZKIA 1AKRA 4ICIA 1AKWA 1FLNA 2B3DA 2M6RA 2MOKA 2ARKA 1SQSA 2OYSA 3G5MA 1H69A 3FX2A 4XDHA 4DY4A 3NHJA 3TEMA 4ZVNA 5B3KA 2HPVA 4QOGA 1OBOA 2FLVA 2QWXA 2Z9DA 3TZBA 3K20A 4QOHA 3OX3A 4M0CA 5FA6A 3HA2A 3HLYA 4C76A 2Q9UA 3QE2A 4PTYA 3F2VA 4FGJA 4FX2A 2AMJA 4FGKA 4QOFA 5TGZA 4CETA 1J8QA 1FX1A 1RLIA 1V4BA 1CZOA 2QX8A 2QX9A 2V5UA 2V5VA 2XODA 3U7IA 1DXOA 2HNBA 5F12A 2QX4A 1KBQA 2OHHA 4NLLA 3RPEA 4GR9A 3NFRA 4QOIA 3W78A 1OBVA 2Q62A 3KAPA 1X77A 2OHJA 4N65A 4QOEA 1TIKA 2A5LA 2RG1A 1AKQA 3B6KA 4LTDA 1JA0A 4GQIA 3FJOA 4J8PA 1YCFA 2Z9BA 1H66A 5F4BA 1AHNA 2Z98A 3NHYA 4CF6A 1CZHA 1YOBA 5LVAA 1SG0A 3NHLA 2BF4A 4LTNA 4R81A 1FTGA 3OVMA 2Z9CA 1NNI1 5LJLA 4NULA 1XYVA 1YCGA 2QX6A 4YAWA 3GFQA 1DX9A 3ESYA 3UXHA 1D04A 2D5IA 2BPOA 4BMPB 1CZLA 4C0XA 4HS4A 2FCRA 1OFVA 3F6RA 4Y7CA 1AKUA 1YDGA 3B6MA 4FGLA 1RLJA 1AKTA 2BMVA 1QR2A 3OWXA 5LBUA 1T0IA
chains in the Genus database with same CATH superfamily
3VU9B 1TI7A 2FDXA 4ER7A 3ZVKA 1M7HA 3ZK7A 4AULA 1KF0A 2CCGA 3NJ4A 5A5FA 1QZXA 2P9FA 1O5IA 4Y30A 3TTXA 1QRDA 1BA3A 4S1WA 1PZFA 2BL4A 4JUCA 1QTNA 2RHWA 2JCGA 1NG1A 4ARAA 4I1SA 2Z4TA 3SBEA 4A9AA 4E11A 4HQFA 1RZUA 3DVSX 2QSJA 3PL5A 1KL7A 3H1AA 4JMLA 4EYOA 1AV7A 1BZYA 5JS6A 3R9WA 1IK4A 1DEKA 1E69A 1US8B 2PT6A 2NUTB 4AS1A 2JATA 3FB4A 2C2YA 5JV5A 5ALFA 1ZEJA 3H4IA 3SLRA 3K6RA 3F5DA 1FW6A 5JC1A 2AS0A 3RV3A 2AXNA 1CRQA 3HB4X 3LOUA 1EAYA 1OKKA 4OGLA 4QWMA 4ALNA 2JJ1D 2H9IA 1ISJA 2P2DA 3GLQA 3I05A 3R2JA 2QTMA 4POAA 1IZ7A 1XXHA 1A8HA 4NU0A 3T7AA 4YQFA 4R05A 5TF4A 3CF4A 2VPXA 1NURA 3R7WA 1L4FA 1LTKA 3EQ6A 4BNKA 1J8VA 3W8EA 4IVQA 4TUYB 2JLAA 1JU9A 3NBKA 3AETA 1B41A 4LRXA 1V95A 2KB0A 3RIMA 3H99A 2EP5A 4PANA 5C7OO 3F3YA 2YXEA 5E6UA 4WERA 1PSZA 3L0DA 5CGQB 1TMYA 4HNHA 2R8XA 4ZZ1A 5LMUB 2I7VA 3H5WA 2GNPA 3WLQA 2B8WA 2IW3A 1A71A 3M34A 2JAPA 2Q0HA 2W2XA 2ZRPA 3PCXA 3Q0EA 4N9WA 4NCJA 3W5HA 1QH0A 4OXRA 1GZ6A 3QVOA 4M1QA 1DOHA 2WJGA 3EFOA 4EPVA 4L5IA 4LX0A 4OKNA 5FUXA 2V7VA 1N34B 2NPOA 3H8WA 3DL0A 1SHUX 3B6IA 3WGQA 2HPHA 1P1BA 1VPEA 2PYZA 1DTWB 3UUEA 2ZZNA 3GXOA 2M2IA 5L3VA 2MOKA 4EKDA 2OAQ1 5E3IA 3CNLA 3WIUA 2W4IA 1OQAA 1MJGA 3EGEA 1UR5A 2RIPA 4IXTA 1KTVA 4CHTA 5CCXA 1P7YA 1N2IA 2FN3A 4DRYA 2GK6A 4QXQA 4DBVO 3QHAA 2H5LA 2WJJA 3JYLA 4YP6A 1FS5A 5B2ZA 3E0XA 3IMKA 3NKFA 2ZUSA 3WK7A 1DPGA 4GBMA 2HRQA 5ALHA 4FZRA 1E4EB 4OM8A 5D5PA 2Q3DA 3WG9A 1OSNA 2EARA 1NIJA 2GESA 1WW3A 3WYBA 4ASUD 3AR7A 4XUDA 1VKOA 3T4XA 4B3XA 2D4AA 4CN8A 5ADUS 4HDNA 1IN4A 1QUFA 3H83A 1KH2A 4NENB 4GQIA 3TNLA 3RB8A 5EKDA 1YAJA 4BNYA 1J1UA 4GNRA 4L16A 2OHVA 3UMMA 1AB6A 1PGQA 4Y0AA 2JG3A 2JF0A 3Q3GE 1BFKA 4LVUA 3BFPA 2YIDA 1KJQA 4DR6B 4F60A 1QGZA 4EFDA 2H5JA 3VR6H 1U2TA 1P8AA 3D5QA 3KLOA 4C0XA 1HRDA 2AUNA 5FPSA 1I2CA 4BNWA 5FDFA 4QUIA 4JASB 1FNNA 1UQUA 1ZJJA 1FBNA 3Q1KA 4GBGA 4HLDA 2JJMA 4I1UA 1OYYA 2ZS7A 4Y8VA 4C5AA 5GOTA 3D4BA 3MC1A 1TM5E 2HBRA 2EBFX 2WC1A 4X8MA 4MJ3A 4R7ZA 4DB2A 3UK7A 3ZQ4A 1W85B 3NOXA 4P3XA 3RS3A 2QENA 3DMDA 4AMVA 4RJIA 3KBBA 1OMOA 1EMDA 2UUAB 3SHQA 4YLYA 1SUBA 3FGNA 1EM8B 3VR2A 4JJZA 2OZLA 5DPMA 5IC4A 4BXOB 3RUAA 1JHAA 2EW8A 3ZWMA 3BVPA 4S05A 4OGFA 5I9IA 5TR9A 3VVLA 5JI2E 4UZSA 3U6KA 1CWUA 4M98A 1UZMA 4RXTA 4ALMA 4CIBA 3KJEA 3U7RA 1LV7A 1G38A 2CB0A 1Z62A 1V11B 2IYQA 2XTNA 5T4BA 1CRLA 2VBFA 1CCWA 1RJ9A 3NBUA 1YI1A 1ZGZA 2FQ1A 3O74A 4G6ZA 4N5MA 4MLPA 4BWVA 3HB1A 4L4YA 3IYLW 2HO5A 1CUBA 2FN4A 1L6IA 3HKEA 2F1HA 2I4TA 3K16A 3I2FA 5KUTA 2N3ZA 4NESA 1U9ZA 1E0SA 2H4FA 4NMHA 4QU9A 4TXMA 1SB9A 1NBAA 3KQUA 2AN3A 1P0CA 4O2BF 4HATA 3RG8A 4IIEA 2CFOA 4OHVA 1ZN7A 1U7XA 2OG1A 1KGDA 3L8FA 3FFWA 5ERXA 3DBVO 4EFKA 5BV2P 4KREA 1EFVA 3R0QA 3UZUA 1MP0A 4AZTA 4QXAA 3DFUA 1ETUA 3D4LA 1Z5WA 3X44A 1LX7A 1E9FA 2PKCA 3TG8A 2HJHA 2R47A 3NV7A 4N7JA 5EEHA 3C5VA 4UREA 4NKRA 4OHUA 1W36C 3R0XA 1D2MA 1K4YA 3QJ5A 1DX4A 4MVJP 2H48A 5EXTA 4BLWA 1RBQA 2DH6A 4F8YA 2HMSA 1E9BA 3TB6A 1ESMA 1MAAA 1FFXA 3AM3A 2HJ9A 4OXQA 4Q6WA 4XTCS 3NHJA 1U8YA 3L7YA 2MSLA 4RDHA 1Q11A 4CM9D 1RFLA 2IKQA 2QZJA 4CCYA 3AESB 1XZMA 3BSFA 2XTZA 4CQMA 4BMSA 1Z4KA 3TZCA 3UV6A 1R5NA 1GG8A 2C3YA 4GZMA 3W2IA 1MEJA 4R1MA 4P22A 1EUZA 5A4AA 2XB4A 1YONA 3A04A 1HXHA 3W78A 1GKUB 2OXFA 3R3HA 2HDHA 1S2IA 4N40A 4XGKA 1XQ9A 4C01A 3IXMA 3MF4A 5JCOC 5LB2A 2GZSA 3ILVA 3OE5A 1KPIA 3LLSA 3RFFA 1WB6A 2VBIA 4IVPA 1RR6A 2WJ3A 4O4IB 2AMLA 1O7JA 2XUOA 4JLWA 4NE2A 4F86A 2A33A 3V4ZA 4OIMA 5CFQA 4M21A 2JFYA 1XDDA 5GVSA 4ZCTA 3B8EA 4P0QB 1Z0DA 2B9VA 1SA0A 1OJLA 2X7XA 2D5IA 1PEAA 4ZCSA 3TIXB 5BRJA 1PO7A 5LIPA 4U2EA 4AECA 4E1AA 4EM6A 3VU8A 5IAJA 1PTJA 5EJ4A 4TTSA 3U4MA 5HUJA 4B3SB 3ROFA 3BULA 4LY3A 1HKUA 4LZZA 1PLJA 2HLNA 2BKLA 1GQQA 2YJ5A 4MW0A 3ASVA 1Y5IA 1XZNA 3JQAD 3UJDA 2QBYB 4R8MA 2YHUA 4JBLA 4RH0A 1FVHA 2YXBA 2IELA 2NAFA 3TZ6A 1JR2A 3OQHA 4US0R 2NPFA 3ZHUA 2O57A 4G4SO 4FZ3A 4J2HA 2Y1WA 6NULA 3CUYA 3N2IA 1XAJA 4H4DA 4C4OA 3HB5X 4HL6A 4U6SA 2YZNA 1T2FA 1OFHA 3I6IA 3FPGA 1XAHA 1O96A 3JASA 1IN8A 1RHRA 1SZJG 2WG2A 4NJMA 5JZ9A 4D02A 1IVSA 3SMVA 1F4PA 3R3WA 4JJKA 4G1CA 4QUHA 3L7LA 4JNKA 1D6SA 4NYMR 3TDNA 3AF0A 1IZYA 2JBAB 2APJA 1BJRE 1TMKA 4EI9A 4JSRA 1VKJA 1LX6A 3FGZA 2CMKA 3PI6A 3N2GA 3CYFA 4B6RA 2I6FA 2WMOB 1SBNE 3I42A 4UVIA 1ZN9A 3F49S 3K9FC 2X19A 2AK3A 5GGYA 4BNUA 2PLRA 3SS7X 1T24A 3FYUA 3MLBA 2MT9A 1U90A 2YN4A 1DFIA 3RO7A 2EW1A 1EA7A 4M6WB 3ONNA 5BSUA 2F3PA 4GFDA 4B1FA 2B8JA 2BTQA 3N74A 2RKWA 3GMTA 1E62A 1Z83A 1W36B 2DUWA 3C15C 3UNXA 1A7KA 3ZQJA 2NACA 1E8DA 1RLOA 3AF6A 1CUVA 4UNPA 3S70A 4DDTA 3PC8A 2CBGA 1QIMA 2GO7A 1WW2A 3ANXA 4HUQA 4IH9A 3STTA 4DEXA 1AKYA 3THSA 4I4NA 4YDSA 3KUDA 1XXLA 4TXHA 2BKXA 3DP7A 5DJ5A 2HV9A 1YFJA 5CTAA 1WXIA 1JYEA 3FHLA 1EGHA 1GR1A 3HJNA 2PUHA 1Z7YA 1PL6A 3KCNA 1QH8B 4B8WA 4D9EA 3NBZC 1XNRB 3WRXA 2ONCA 5FLXA 2O3UA 16PKA 2HTFA 1JQAA 1SU7A 3O3CA 5DX1A 4ZQEA 3FSGA 4HDSB 3ST7A 2WTBA 3LUJA 3DFKA 5H7XA 2H6EA 1VJ1A 3ND5A 3UQZA 3F96A 1J00A 1C4KA 4W7HA 5JXIA 1FSPA 1G5TA 2G9QA 4RY9A 5CH5A 4JJ4A 3FBGA 1YBVA 1DUIA 2HQBA 2JZNA 3WL3A 1OY1A 2IHTA 3GB9A 5ANRB 3G02A 3FOWA 5EVCA 4ZT3A 3VU3A 4ZEWA 4HRYA 3MTJA 5LKAA 1RP1A 2WRZA 1NW4A 1JP7A 1RCTE 3TZQA 3KV1A 4CQJA 5A9SA 2Y0CA 2DEUA 1PEKE 4N65A 2VZ9A 5HIMA 3TLGA 1SVUA 1SPXA 3KVYA 3MJFA 4K05A 3LPAA 4YRFA 3JQEA 1Y6ZA 2KBFA 4G0PA 5C1BA 5AVZA 2WTNA 2P77A 3HUUA 1AGNA 1GKYA 1RHQA 1U9JA 5FFMA 5LP6A 3V1LA 1GV1A 3LPLA 2CL0X 2I4OA 4X63A 1X2BA 5F5NA 3QUQA 4ZO4A 4M8IA 1VMDA 4Y0VA 4I6JA 7REQB 3EK2A 1XEFA 2BAGA 2FR1A 3EE6A 3OUTA 4I99A 4MQUA 2N46A 1ZR2A 2O5EA 4TMXA 4V0MA 1VL1A 4BQQA 1JW9B 1EDEA 4UXIA 1Z63A 1J7JA 1I3OA 1MO4A 3TPFA 1RLJA 2AOUA 2BMVA 4F6CA 1U9IA 1Z8NA 5SZIA 1JZTA 4NBKA 1K88A 1RI2A 4PRZA 3FOBA 3ADKA 2VJCA 1UT8A 2BMDA 2PUJA 1K89A 1OXSC 2CCJA 1ZIOA 2A78A 5AW4A 4DC1A 4FSXA 2VJPA 3OZ7A 2WUVA 4Z7OB 2XB6A 1K8RA 2XGGA 2ZJBA 4O2BA 2V7UA 5HHTA 1YR7A 2JGMA 2RGNC 1NMEA 2DQ4A 3FCAA 1D09A 2QGZA 4J07A 1I6MA 2ORED 1ONPA 2XZLA 4LYAA 1GL6A 1T43A 4ZZ3A 3VR5H 2ZREA 2DFNA 4WTOA 4P3YA 1RJGA 4PCUA 3GEDA 3IHKA 4Z51A 2GERA 1Y4SA 4M0PA 3IVXA 5GJWC 1A9XA 1EK2A 1ESNA 2YL2A 1Y3BE 3UKOA 1IY1A 5ENDA 3HRKA 2DGDA 3NWPA 2WWRA 5B1IA 4Q37A 2AIRA 2WLSA 4NHEA 4M87A 3D3WA 4J0GA 1GCOA 3QYFA 1SCAA 1W5FA 2BZ0A 2QSUA 3E5HA 3U4AA 1GGMA 3GLIE 4NOKA 4TV8A 3ENKA 4XJSA 1TYEB 1YMUA 4LF6B 1BTOA 3OM0A 1TIBA 1NUAA 4QGGA 5LM3A 1YCHA 1SXJD 4RQTA 4X94A 3GLGB 3EQZA 2ZT5A 1RLMA 5KQMA 3VNUA 2B37A 3MT8A 4B87A 2NO4A 4B47A 1O8CA 4LAFA 2YVQA 5JMOA 1L7RA 4UC0A 1DFGA 1JRLA 1SKQA 1MFPA 4LWPA 1G60A 5KYXA 3PXBA 1Z7BA 3IQWA 3GJ6A 3N7AA 4Q48A 1D0SA 1XC7A 3R20A 5JDCA 5FOVA 3LUPA 3KSDO 4UASA 3COWA 4NFYA 1OLXB 1XF9A 4M0DA 1JB1A 3KHSA 2O7VA 4K86A 4Q01A 3KHTA 4BEVA 1KK3A 4YMVA 1CNFA 3ZDZB 4CLXA 3DOOA 1HF3A 1U2DA 2H7VA 1RJEA 3ZIDA 3D9QX 2GXQA 3K0BA 1UOOA 2J32A 1TW2A 3UANA 3L0PA 3AWIA 1TGYA 3ZNOA 4LG1A 4NFLA 4KWHA 1JFFA 5KHOC 1KDVA 4TTAA 1LEHA 2ZAIA 2EKZA 1F6WA 3PPYA 3KBOA 4LCBA 4IHKA 1JHQA 4O3FA 5A6SB 2GS9A 3ZU4A 1YJ8A 1S0UA 2GM3A 2VJQA 3TEMA 4YXWD 4RZXA 3M2TA 1X7XA 2R5NA 4FI3C 4DV1B 1ZCAA 5IDYA 1XWIA 4KR9A 1JA9A 4WHMA 3EAGA 3S7ZA 1YOVB 2G63A 3BERA 5EQFA 1PZNA 3GUZA 2W8BB 1P5RA 4YH1A 4YRBA 1ZHOA 2ZBVA 2D7DA 4CM8A 2P78A 9ATCA 4UE2A 4M60A 3T7DA 4MI6A 1ZK2A 4PSDA 1FW8A 3EZ2A 2B0CA 2FWAA 3EVBA 3BRWA 2P9QA 1FXUA 5HQ3A 3T7IA 3GMIA 4HAYA 4OXIA 1G9TA 1VJCA 4IXNA 5K6AA 1I7PA 3OQNA 2I8CA 1UDBA 3HJFA 3B78A 2ON6A 4NCAA 1XYVA 1ZIPA 2BEUA 2C57A 2H85A 3EIEA 1JHXA 2DR0A 2HA0A 4K87A 2SKCA 5AJHA 3ZGVA 2UZ4A 1F8YA 4IVNA 1SXPA 4R9RA 3SSMA 3U4QB 3U4DA 3Q8XB 4WMLA 2BM9A 4OO3A 1SVKA 1DX6A 1VYVA 2NSYA 4MUBA 5AT1A 3HJRA 4B0OA 4Z99A 5LSAA 3T3GA 3W2HA 4YRGA 1RBZA 3Q9LA 5BYKA 3VTKA 1BMDA 1XCLA 4LJSA 3ETDA 4WAUA 5D85A 3U26A 4QYWA 5HKKD 5IHPA 3WGVA 3NNDA 1OR8A 4NCIA 4RK0A 1U0OC 2WK1A 3RVLA 3R6WA 4MUXA 3S2ZA 4KBGA 1J2UA 2IOFK 4OAPA 3C5EA 2PT9A 5C4MA 5JT1A 2MR6A 3DE3X 3UIEA 1VIYA 1K68A 4OG2A 1KMHA 2HC9A 3H2YA 2WBLC 1I1QB 2ZDGA 1NXPA 3X43A 1ZJYA 5CB4A 4ZK2A 3HA5A 3JQRA 1NXSA 4JLAA 1CQPA 2QGNA 1FJXA 3K9BA 1Y1KE 3CRW1 4GWKA 3AINA 2FK7A 5D3ZA 1N2CE 3A27A 1H05A 3ZLJA 1XT6A 1CQJA 2Y77A 2FZGA 1NXOA 1ZCZA 2W70A 5ADVA 4D96A 9ABPA 4Z54A 1G3MA 3Q4GA 4KV7A 1SOVA 2OMKA 4WXYB 1H3FA 1G55A 4KNWA 1FNDA 3PJEA 2QEQA 3M6LA 1QK5A 4ZCLA 1W88B 3KYBA 4RORA 2O8CB 4ZVMA 1W44A 2EKPA 1L4GA 3FCCA 4FR0A 1UAGA 1JI3A 3CLTC 5DO9A 4AWXA 2WKRA 2WSLA 3I73A 5FWYB 5T4HA 2OLJA 5TQJA 3CPSA 3B52X 4IJUA 5CUQA 3JS5A 1JAHA 3BHIA 2HXYA 2HBQA 3LCRA 4R1QA 1RADA 4UBJA 2JLWA 1HOTA 3QVUA 1E2DA 1XN4A 4M1TA 2HRDA 3K5WA 1S2MA 1FP1D 3IP9A 2P3QA 3QV2A 4PC3A 3U81A 1JQJC 3RIYA 1Y3IA 2OGWA 4C4PA 2GCOB 3KELA 4WCDA 1BD4A 4YCLA 2W6IA 4J3JA 1W7AA 1T8RA 4HNSA 4KMMA 4TMKA 5FNVB 3CV3A 4IEEA 2Q5OA 4BX9A 4L0CA 4HAXA 2X23A 4IGFA 3ZZMA 1JX6A 2O2XA 5H8WA 1UMBA 1SQ0A 3CUKA 4N82A 4UUAA 3C1OA 1TYCA 5F21A 1RRMA 4BAZA 1PWHA 3GLVA 2IQ5A 2R4UA 2H2HA 1Y80A 5JFTA 1XI2A 4KGDA 5GINE 2FETA 3IRVA 1CV2A 3M5DA 2PVSA 3JXEA 4X6LA 4E21A 2CVZA 4E32A 1EVJA 3MTIA 3R1IA 3I23A 3SHOA 2JARA 4W5WA 4D4MA 2C4WA 3IEVA 1L4EA 4PTYA 4UJ5A 5C0OE 5HZMA 3EMBA 4W8HA 3W5JA 3GZNA 1HDEA 2QX9A 2GZMA 2EERA 1N8NA 3VFDA 3I32A 4BNHA 4BBJA 4DZZA 3RS0A 2MMGA 3UMSA 2BFBB 1CERA 1A0OA 3KL2A 3EH1A 3C85A 2ZJZA 2GAIA 3LX4A 2Z8YA 3G89A 3AHGA 3WHPA 3P9KA 2ZK7A 1NG9A 1EDOA 2EX1A 1X80A 3KXIA 4AUKA 1Z07A 3UA3A 1JPUA 3H6KA 5BURA 4JLKA 3S2UA 1ECCA 2WWHA 1XMQB 5F7JA 5C34B 3BH7A 2X5NA 4PG7A 3G8BA 5I7WA 3TQFA 4RAOA 3PNKA 1REQB 3DD5A 3KZXA 3RASA 3VTAA 4IWNA 5EERA 3W5IA 2WIGA 5IU6A 1FU7A 2X0RA 3UKDA 1RMTA 2EFGA 3EIHA 4G8BA 4L5CA 4OUDA 4Y2PA 2DMRA 5JSZA 1L5QA 4NS4A 1QGED 4BQIA 1T35A 5A6VA 5HZGA 1BCRB 1D1QA 2JJ1A 4CLEA 1T4BA 1F1JA 1ESDA 1RM4A 4BFVA 3ZZ1A 3NIBA 4GZLA 4JSTA 4TYPA 4MHSA 2DM6A 3I1FA 5LZ2A 3P0EA 1FXWA 3UXYA 2BLNA 2I6GA 3SKXA 3VR0A 5L7TA 3TGLA 2BGGA 2W6QA 2XRZA 3SQLA 1XGKA 1MD9A 2AF4C 3CPHA 3MJCA 3CBQA 1UZAA 1ZOIA 2VF5X 5JI3E 3EVAA 3FNRA 3KJGA 3L1JA 5IS2A 2CJXA 3Q3CA 1VLJA 3I9JA 4LWQA 1W76A 4LK3A 1RFGE 1JJIA 1WOYA 3KOXA 1EPUA 1Y6FA 3IHTA 4GM0A 3S5UA 1CQWA 4W6ZA 1RE0A 1CUFA 2RCYA 5L8VA 2UYCA 4J1TA 1F5SA 1RRKA 2PDAA 3T7JA 1WLSA 3UJ8A 2O8BB 5KAMA 1I0ZA 3LKZA 4FDAA 4AY3A 1WJGA 2A3NA 4I0WB 3G5AA 3LUDA 1V41E 2VJAA 2Y4NA 3B82A 3K92A 4DJ5X 2ZJFA 3HMQA 1SCQA 1O95D 1W47A 3E3AA 4ZOCA 1VE9A 4V3CA 5BXQC 3NOQA 1BHO1 4IIFA 2NAPA 1Q0UA 3X1DA 4BO4A 4UNSA 1PT8A 5K03A 4CEJB 2IDMA 2GA9A 4J1QA 3AUUA 3IHLA 3OKFA 3O75A 4EPRA 1JEQB 4NMLA 2Y76A 4KSCA 3TLAA 3BMNB 3OIGA 3PLNA 4NOLA 4S0XA 3DQQA 2NYRA 2CSXA 1P9LA 2XZDA 5E8RA 5JCJA 4JQYA 2Z0MA 3IDFA 1C1XA 4IM7A 5KYGA 2Y1XA 1GARA 1MC4A 4CKWA 2RHMA 3MG9A 1NVAA 2OFPA 4MRRA 1KDTA 2JLCA 2NU9A 3GU3A 2OHFA 4O08A 5DWDA 5FUVA 4AF7A 4LRYA 3INRA 4X61A 5TGDA 3IUYA 4CM8B 4YUZA 3SX2A 3U61B 5C1PA 2WJIA 4F91B 3T5TA 4N7RA 4DQ0A 2XWSA 1BW9B 3KQNA 1OXTA 4RUKA 4TZKA 3KLNA 4C76A 2V7TA 1IVNA 2W37A 1GUBA 5L53A 1UBJS 2GKGA 2ZVDA 3ILYA 3NCTA 5FJJA 3U49A 4OQMA 4P7BA 1MO2A 2B8NA 3R7FA 1SOWA 5AHXA 3VNSA 3FYTA 4DDUA 4OSPA 4DYVA 1QQTA 4HNGA 1OF1A 1LBSA 3ZDXB 3NAQA 4XIIA 1TCCA 1XNGA 3GX1A 4GW3A 2WY2D 2JA1A 2OZPA 3BB1A 3HDYA 3M3DA 2AG0A 2R6AA 3GQVA 4XWWA 3I9KA 5DYGA 4MYHA 3QPAA 2GZRA 3SZGA 4Q47A 5BWMA 2BMFA 1LSSA 3AONB 4OBWA 2G08A 1N2SA 2IYTA 4ZO6A 1CB0A 1FFAA 1NC3A 2JCXA 1LDMA 1Q20A 1QS0A 4FDMA 2QTBA 4G0XA 5JOQA 1E3MA 2ZPUA 2OV4A 4HS4A 5BSKA 1R0CA 1P0QA 4RX1A 4TZTA 2NU7B 5FFFA 5ADWA 2GZDA 3TTSA 3PEUA 3VNBA 4WD3A 4ZU6X 2QNRA 3J7AC 3SC6A 3W77A 5JBQA 1F3LA 2XIQA 3I9LA 3T1YB 4KYVA 1Q0HA 2D13A 3DONA 3QIVA 1ZW6A 3TSYA 3H11B 4DUPA 4D4JA 2XMBA 5DTMA 1IL0A 3LDHA 4JL5A 2GCPA 5IBPA 1NKVA 3ZZTA 5K01A 3NHZA 2W58A 1I3KA 1L2TA 2D1SA 2IZ0A 4BMCA 1R4NB 3G2MA 1IBKB 1WU7A 3D7SA 3ET5A 3Q85A 4Y2SA 2BMEA 1H5QA 1VLZA 2WZCA 4QBTA 1DKLA 3WICA 1C1DA 1UFOA 3COPA 4QECA 5TSDA 3TUJC 3UWPA 3ER6A 3OLVA 3IO5A 5CDTA 1A1SA 1V1RA 1F4VA 5JXWA 2KHZA 4AMZA 5CITA 4WECA 1NOKA 1VIVA 2XEDA 1EVIA 2NXNA 4NOMA 4TLEA 5BNTA 3JWHA 1I4OA 3LQRA 3U0VA 2QSYA 4CQLB 4N47A 3UTCA 3CZAA 1OKKD 3KV3O 2XADA 5CT6A 5IT9A 1F7VA 1N6NA 4RIEA 2CVQA 2PWYA 4F4CA 4YHHB 5J2TA 1T3ZA 1PLKA 3ABZA 3AVOA 3FZNA 3QYAA 1MEOA 4FC6A 1BXGB 2ZM5A 2FKNA 2FPXA 1P6XA 2XWBF 1CUUA 4MH0R 2Q6OA 1KAGA 1L4NA 4TMWA 5AMXA 2FJ0A 1XVVA 3PG5A 3L8DA 4A5SA 2FGKA 4DLUA 3TINA 1PBTA 4F21A 1XCMA 1XPRA 1W46A 1YRYE 1I9GA 1BQ3A 4KPGA 4PG4A 1RAEA 3R5FA 3T1NA 1WKCA 2WUFA 5DNUA 1EI9A 3QPVA 3W2GA 1V9LA 1T5DX 1CSEE 3GLHB 4QUJA 4WOPA 1W8IA 4LYDA 2C7BA 4AZSA 2DB3A 5TMPA 2W6ID 2VPPA 2QVZX 4GZ6A 3O4GA 5GONF 1RSZA 3KUUA 4LXYA 2AOWA 5DXJA 1LW7A 4DLTA 2CUZA 3NGXA 2YMMA 2ZTLA 4LE2A 4LJKA 1N33B 3K0AA 2YOGA 5I47A 1Q19A 4M9QA 3IODA 3WGHA 5IMBA 1EGAA 4E70A 3IP8A 5IZCA 2ABWA 3E8XA 2QWXA 4RSHA 3KPWA 3DBRB 3GT7A 1QLWA 3BKXA 2P0EA 5DRTA 4L0DA 2XRMA 5I9SA 1G2IA 3H4TA 4NL4H 1EUDB 1ZM4A 3ZU3A 4XD7A 3ZQKA 2QN7A 2D4HA 3KOOA 3KJXA 1R4MA 4I3GA 2DWUA 3FY4A 3M8KA 1X38A 3TCNA 2HFKA 1VE7A 3RSFA 5LB4A 1MVNA 1XNQB 4HZUA 4KBYA 4CLDA 1Y1PA 3QLVA 1SMKA 2OECA 3B89A 2VCEA 5KINB 3BJMA 3A8TA 5HQ3B 3PHIA 2J6CA 4KNVA 2F90A 5B1EA 3AC0A 4IV0A 4G4IA 4UTPA 1BJTA 1XK6A 2DTDA 3OP4A 1JYFA 4RK5A 2XQKA 2ZIVB 4TLMB 3TQRA 1FRZA 4Q1EA 2FCRA 2H1WA 2H1SA 3Q5EA 3R6TA 3TRFA 2IY9A 1A97A 1HYGA 2ZIFA 1YR1A 2OV3A 2AE2A 1Z6QA 3P94A 4RHEA 3GFGA 4JUFA 1H0KA 3G3EA 3GGJA 3IEXA 1P9WA 1M5RA 2IS1A 2YWDA 3W9SA 4J7CA 1GDTA 4YPOA 1WCV1 1ZL0A 3HTXA 1MRSA 1IDOA 4RTKA 4EQ6B 4GVPA 1J6UA 2GZAA 3ELWA 1Z2DA 3CF6R 4IDHA 2MTBA 4G5QA 4GI5A 3NYQA 4LWOA 5EQTA 4W9NA 4EG7A 2O3JA 4EUEA 3NNNA 2MSEB 2I80A 1MA0A 4AJ9A 2XBLA 2EP7A 4NIMA 4JVMA 1Q3KA 1TZKA 2R7NA 3LT1A 3G0IA 4HDCA 4PPYA 2DR3A 1AUVA 1D8TA 1OZGA 3D7KA 3MJTA 2YXPX 4KQJA 1GADO 1R6AA 2I0FA 1LVGA 1P1CA 2UYQA 4Y18A 2FUG1 2OP0A 4UM7A 3RQIA 4A2WA 4J0QA 4HC4A 2G71A 1BWQA 4CE6A 5CBKA 1TM4E 3MB8A 4X66B 1PR2A 4KK4A 1DMRA 4M7PA 3DVLA 1VBMA 3AXSA 3OURA 2G80A 3SLKA 2GPYA 3MS2A 1FFHA 2HCRA 1GITA 1W9MA 4JBNA 4Q19A 1E64A 3PFNA 4E12A 4WNAB 1G21B 3MGKA 4ZANA 5E6RA 3D0KA 4EQZA 2WFAA 4ER0A 4TRNA 4X1YB 4OHRA 4A92A 2JIRA 4JJ6A 2HWXA 1MAHA 4TLLB 1PHRA 3GCXA 3P5SA 3LW7A 3OTHA 4CGZA 1JWBB 1ZPDA 1Y4DE 4F96A 5HWSA 3IDAA 5G4KB 3SX0A 1Z29A 1E3DA 2B83A 3GLRA 1IHXA 1J5XA 4Z6KA 1SKYB 2H4YA 4EG6A 2E6KA 4B3MB 2GCOA 3ZY6A 1A8IA 3UHFA 1Y33E 4DKXA 3GK3A 3KFLA 2AN9A 2PGNA 1B43A 5EN4A 3RTEA 4TVSA 1M0WA 4YP7A 1KH1A 1MW8X 5MN5A 5IYZB 4BUJA 1Z7GA 3VR5D 5KWIA 4HPXB 1SC1A 1DBVO 1GZVA 1YRQA 2ZYTX 3NPMA 1Z2CA 2I62A 2VJBA 2ZT6A 4N0PA 4C3OB 5K8VA 1ZK1A 2JI7A 3GJTA 3BE8A 3FBWA 1B00A 2RGGA 3REQA 4I2VA 4KR7A 3DJYA 3FKSA 4FHZA 2PRSA 4ARSA 1W2HA 3OX3A 4B35A 1KAMA 3SHVA 2V03A 3H1GA 3P71T 3QE2A 2FPGB 4E22A 1K2VN 2QS9A 3L0SA 4MNTA 3OM1A 3VOTA 3OH8A 1DI0A 1RAHA 3G2OA 1DV2A 1QHFA 4HQRA 4LJ9A 5HJ5A 3NIDB 1CQIB 1DDOA 4LQDA 5JZMA 3WOVA 2NYAA 2X0NA 2OAGA 1ELOA 3CISA 1MENA 3NXKA 2PX6A 2X4DA 3PNSA 4NMWA 4P31A 5GVRA 3R76A 3B6KA 3L7IA 4PLHA 4PY2A 1QDEA 1V3QE 5EZ6B 4DG8A 1M10A 2ZJ7A 1NXQA 3SCZA 1FTWA 2IU4A 1V35A 2HJRA 5SZHB 1FFSA 2P3SA 1U28C 4I8IA 3IAHA 3EMKA 4IDQA 4KBFA 5AHKA 3RTCA 4CCWA 4QTYA 5A9RA 1MU0A 2HCBA 1BWRA 3NAMA 1XU7A 1O03A 1UBRS 5DGIA 4MV8A 1H4VB 3R6GA 4EW1A 3AILA 3TX2A 2O0JA 3IPCA 1WY7A 2GO1A 3UWOA 4MUHA 3KKKA 3DMFA 4ZT6A 3D81A 2QRNA 2D0OB 5JSFA 1U7TA 4BCBA 1UOQA 1QRTA 1VPLA 5IDVA 5JG7A 4R5HA 2HF8A 1ULBA 2Q4DA 5KDDA 1RI4A 3KTAB 3WLHA 2VF4X 4D6YA 3WLLA 1IM2A 3D6MA 3OKPA 3OP1A 4F6RA 3DR5A 5EKXA 4CKBB 4Z1MD 2VL7A 1H6CA 2HGZA 1QO0D 2BT4A 1X39A 2AMVA 3H84A 2HPZA 3PJGA 4RCZA 5GM2A 5I5GA 3KE9A 5EXDA 4C7OA 1W96A 4EFMA 2PSSA 1BNCA 1PLLA 1UBNA 3MUEA 3MBIA 4DRZA 1GPDG 2Y66A 4OF4A 1U8EA 1IQUA 1XEXA 5FRDA 4BFTA 3BCHA 2WJ6A 4DIUA 2IDKA 2ZB4A 3GARA 3ZPXA 2AQIA 1MXFA 3B3FA 4H2DA 4KQWA 4LNHA 2P6OA 3C41J 4TQGA 4HKTA 4BHTA 2BEUB 5EJIA 1IBRA 2WZDA 2PVCA 4UCXA 3DBLA 4AVYA 3KFVA 2X0EA 2BW0A 2CEKA 3MQ2A 3QP9A 3PGKA 3PUJA 3QX9A 3TKAA 3DNPA 3EA0A 1WF3A 1WL8A 4FFOA 3MMSA 4M38A 3KU4A 3VO2A 5F9FA 1QHEA 3CURA 4LMAA 5GONA 2OUKA 3COZA 5LMCA 4NBNA 1KHTA 1BDMA 1NI4B 2B1JA 3VYTB 3JQAB 4AYXA 1R64A 1DGQA 5EXSA 3QPUA 4PLPA 4UPEA 4TMTA 4KDFA 4DM3A 5F3WB 4IJKA 4M36A 3VH1A 4Z7JA 4JJIA 4LZNA 3ZGOA 1M8PA 1APBA 3V2GA 1KEEB 5KQRA 1CJKC 1WMDA 2GN9A 3K1TA 4YRLA 3MJEA 3DTVD 4EOGA 2CMDA 2ZB8A 3W3AA 4L28A 1FUYB 1VJGA 3ZU6A 4FM9A 5KMGA 3IKVA 4FMDF 1MB2A 4KITB 2HRRA 4D9HA 5D3MB 5L40A 4XKJA 3LT2A 1N8TA 2DFLA 3IOYA 3PC4A 3T12A 5INTA 4NR0A 1UWVA 2J9XB 4MUNA 5A04A 4WFQA 3B36A 3WR5A 1QGUB 2EFJA 2XMPA 5BR1A 4MVJA 3URMA 4UD6A 2C2OA 3LBNA 4JR2A 2Z9DA 4IIDA 3DMTC 4O4HF 3VDMA 4RWZA 4TRJA 1SK8A 1H1LA 1OCEA 3BRSA 1R9GA 4ZOEA 1T2AA 3WLAA 5JDIA 2AK2A 3AY3A 4UD2A 1D2HA 1EP1B 1I6LA 4CT0A 1BGWA 4EKNB 1DQPA 5LXTA 5DYTA 1U02A 3GBPA 1FMFA 4E07A 1XP8A 4GLOA 4ZGBA 1KMCA 2VSQA 1WVMA 3FDZA 5HCIA 4GQBA 4PO8A 4JT9A 1ZJ4A 4RMJA 3KXDA 3VKVA 3DV0A 3IPRA 4V0KA 1DNPA 4PO1A 4K6KA 4QQKA 3DWIA 3U17A 1CRPA 1AZSC 1RLTA 1CJSA 5BW6B 4BLUA 3GRRA 3O8OA 1FMCA 3GJ8A 3ISJA 3RC7A 4KXMA 4ODIA 4YBRA 4YTEA 4AY2A 1SKBA 2WM2A 5KYUA 1VG0B 1IVYA 4IKPA 4JN6B 3ZKWB 3KD2A 3Q2IA 2J33A 4FFBA 3WGNA 5KQSA 1CEEA 1CYDA 1OGJA 2O0HA 3SM3A 3QFHA 4HFNA 3C4QA 5I9BA 3TTWA 4G0VA 2BFPA 3FE2A 3QVVA 5F5LA 2C04A 4LZJA 2KLHA 3QH4A 4L50A 4L4UA 4NAHA 1N5OX 3H9GA 4FWIB 3L7BA 4CEJA 3WP0A 3HR8A 3Q12A 4LE1A 4MTLA 3OY7A 4JOSA 1Q17A 1CF2O 3MYRA 4YI3A 4YAIA 1FSZA 1JR3A 1LJUA 1OXVA 4NZMA 4FB5A 5JQGF 3CZCA 2H2GA 2LDBA 3WGKA 1JTVA 1JKJB 3CONA 4E5UA 1NT2A 4AI6A 3V00A 1RHKA 1O4VA 4ZZIA 3BSSA 4JJEA 2ES4A 2CE2X 2F3TA 2DHCA 1CIJA 2P5YA 3R0VA 3FIJA 3CEPB 3ITNA 2I4LA 2N1BA 3G9XA 3AERB 4RKQA 4BLTA 3LBFA 1UAAA 3DTNA 1V37A 4MVJI 3QX3A 3E9ZA 2HQSA 1IPHA 5KWVA 3KQPA 5EHQA 3SYTA 1A9TA 1AOXA 1GGJA 4Z9BA 5EAIA 2O9JA 1XL1A 4LGYA 4RVOA 3RM3A 4Y6OA 1T34A 2JJQA 2YWHA 2AB0A 2JIZA 1Q3HA 2JCSA 2VQDA 4XVUA 1IC6A 3DOFA 2WF9A 2ZCUA 3F3SA 1EESA 3S8MA 5F7ZA 3BMQA 1FVXA 3TLEA 2G9UA 5DIZA 3NTRA 4ZTBA 5CIWA 5G53C 5GADl 1U8AA 2AFRA 2DYKA 4W5NA 4ZEMA 5KIAA 1UMBB 1C2TA 1JKXA 2FRDC 4PGAA 4HGRA 1KYWA 3M49A 4MRMB 3O4HA 1JU3A 4B09A 4XRGA 3R6LA 4ARZB 3EARA 3TN7A 3A9RA 3GJSA 1QHSA 5JECA 2FSVA 2GAAA 4GPD1 4BVLA 3DHEA 1X9GA 1J0EA 2GF0A 1GZ4A 1QIFA 3CN7A 1HUQA 4AK9A 2EU8A 2ZRBA 4YXFA 2JHCA 3IP5A 4JJ7A 1PYOA 4Z9FA 2Q5FA 2YS6A 4XYGA 3T3HA 3VSAA 3D0QA 4YLEA 1M5UA 3J7TA 4TYQA 2Q6TA 1OBOA 2Q3JA 1N0VC 4O25A 3ISTA 4FWTA 2X8BA 4AJ2A 4I1RA 1VIMA 1Z28A 4Z4QA 2JLVA 1TE2A 1LLCA 1ISMA 2V5UA 3ED5A 2X0IA 4QASA 1GTG1 2RI0A 1Y34E 1KJYA 4FKBA 1YVEI 3M4YA 4OEHA 5DCUA 1I01A 2D8AA 2JJ2D 4WPGA 5FL7D 4JI6B 2OV8A 1SD1A 1UC9A 3A1SA 3A9CA 1U2RA 3C48A 3ID6C 5FOXA 2J1LA 1O0CA 2O8CA 1X0VA 2RG1A 4DM4A 4FC7A 1YT5A 1WMEA 4ZAXA 1LSUA 1V1JA 2VUSA 2ZTVA 1LZLA 4JDUA 1C4WA 1QKIA 3EXEB 4LTNA 3VC1A 3TW6A 5AJZA 2OENG 4KWTA 5LNK6 4GMXA 2RGAA 3UXHA 4DXHA 2IH5A 2JFPA 2I55A 1KSHA 1L5RA 2OC4A 3T4EA 1MOSA 2CHEA 1ZMXA 3VPDA 4R83A 1SCNE 2QLLA 3PWSA 3UJ7A 3ZY5A 5BUZA 3RS9A 3THOA 3UA4A 5CT4A 5EE3A 5KOIA 1KEKA 2YWCA 3KNZA 3KTFA 2AUMA 3P9RA 3ZU5A 3ZWYA 1QOPB 2EIHA 2IITA 2ZYVX 4HYTA 3THXA 2GD6A 4M1YA 4MPJA 1AF7A 1V8FA 4W5TA 3PGXA 3X1MA 5JNSA 2FMIA 1W5TA 2CL5A 3Q88A 3GNTA 3A7DA 2IXAA 3NUZA 1CZUA 4TKLA 4DLVA 3B6JA 3HU3A 5IZCC 2JEOA 2XA9A 8MHTA 4YT5A 4QM7A 2ECOA 5HRUA 1Z5NA 2TRSB 1Q74A 4QDKA 4V39A 2H1VA 1VMIA 1WDMA 4GOOD 4Y1FA 3VSBA 4G63A 4HP8A 1VB5A 1TD9A 2XTJA 4WCFC 2IKSA 1PKXA 2NX2A 5D01A 2ZIEA 5JH7A 2IF0A 1W0KD 1MAUA 3K9QO 1S9HA 4L9AA 4Q24A 4ZT2A 3RG2A 5J2UA 3EPKA 3BS4A 3ET4A 4P4UA 5JLJA 4B2YA 1SZPA 5BW8A 4EY3A 2JFUA 3P20A 3HU1A 1I7NA 3EWIA 1OWNA 4YUVA 5TQVA 1DJOA 3ZS9A 3II6X 4B40A 1ZS9A 3QEMA 1H0HA 3TCKA 3VI3B 4Q0MA 1HK7A 1FP2A 4BMDA 4CDNA 3LA6A 4HAIA 4BEWA 2I6QA 2ZI7A 1CS0A 5DNAA 2ZYUX 2ZSEA 2E2WA 1OW3B 5FTJA 3I45A 1B15A 1XVIA 2ERXA 4MKXA 4NAUA 1YDWA 3ACDA 3R41A 4DE5A 1ENZA 5BN3B 3SVTA 2FW7A 3CRNA 1FP4B 3ETCA 4W9MC 4N0EA 5FUMA 4REOA 1Q1GA 4EB0A 3FCYA 2VP0A 3FYSA 1QWSA 1MJFA 4CLOB 1Z4OA 3ECSA 1THZA 1KJNA 3AR9A 4JVNA 3BL5A 2QRZA 4YMIA 2WTXA 3S2IA 5LPNA 2AFVA 4KRFA 5F78A 1CVRA 4RA9B 4JNCA 2HB6A 4RF3A 3C6ZA 1P6QA 3CZPA 5ICSA 1N75A 4KVZA 3NDJA 1QIIA 5A0TA 2W2PA 3HL4A 3EIOA 1G19A 1Y3CE 2QJRA 1HE2A 4H3SA 4M3NA 3SIPA 3WLSA 2PGJA 1QQAA 1CK4A 3G8CA 3TZEA 1LS6A 3HCOA 4I55B 2HMAA 2IE0A 1Q77A 2IUTA 3JQCA 4K1LA 2WUGA 3TTUA 3UB4A 4B3IA 1EFRA 2OWDA 1E99A 4PNHA 1JE1A 2B92A 3FBTA 3DZIA 3I9OA 4KIJA 2B21A 3AOEA 4KAXA 2QX4A 2ISQA 1LTQA 2FX3A 3DHVA 5JS2A 1FTNA 3ZG6A 4CZ2A 3BF8A 4LVCA 4RZUA 1WM1A 3P96A 2B94A 3NG1A 1ZLYA 4UE3S 2COUA 1PZHA 2ZW9A 5EE1A 4OI1A 3AH8A 2PH5A 4EY6A 4PG8A 5SV2A 4R0MA 1AHNA 4P4NA 3FFBA 4INZA 1HDYA 4C0BA 2Q5QA 1NGSA 1Z4LA 4D9IA 1DAOA 5LQJA 2FWRA 3QFSA 4X1KA 3OPYA 2G1KA 1KR5A 1S96A 3UMFA 2FR8C 4XGQA 1NVEA 5CNKA 2VYCA 5A7HA 1D04A 4J16C 4WBSA 2K5UA 3I4FA 1QM5A 4DC9A 2XGOA 4RIFA 3B6MA 1AUXA 4GNKA 4AJJA 5BSFA 1PKEA 5DDIP 3FF1A 2ONYA 4G89A 4J76A 2QAGA 1UINA 3BMNA 3MM4A 1W49A 3NVMB 3MWEB 2WU3A 1CY6A 5EJEA 3BRWD 4FYPA 2BFFB 4HAUA 4H7EA 2NM0A 4LDZA 5DXAA 3QWBA 4HVCA 2EX0A 1MX1A 1GP2A 2X2OA 1E2GA 3G8DA 1QGAA 3MOGA 1YRHA 3PL1A 1F8XA 4CM4B 1P81A 5IKPA 3R8FA 2FZ4A 4MWEA 3OECA 4CG3A 3V5NA 1ZRSA 1BCSA 3VZCA 1PDVA 3HBNA 2ZBDA 3EEFA 4K0KB 5LQKA 5ALSA 4YBZA 1ACJA 1VGRA 2JW5A 2ZR9A 4PS1A 1XQWA 4GO1A 4ZFNA 4NXNB 2Q8NA 3TWOA 2Q4OA 1EXVA 3A28A 3TW8B 1XRPA 3HWX1 4NFHA 2R8ZA 2X0DA 3L82B 3C3EA 4LF9B 2JFNA 5DCYA 2YWGA 1GEEA 4R7GA 3VO1A 4ZYXA 3LYLA 2CL6X 3O1HB 1ULZA 3RVMA 4MUEA 1GGFA 2JI9A 1V8DA 5FBZA 3OAAD 1X9HA 2X1VA 3MTQA 1EJ2A 3VJLA 4KAFA 1XA3A 3FCUB 3WS7A 4EYKA 3OJFA 1N92A 4UDNA 4V0QA 5D2CA 1DEAA 2C7QA 2ADOA 4DV7B 1R0YA 2KS6A 1W87A 4O63O 4U7JA 3I5XA 1G5RA 2JCBA 1JG2A 1XD8A 1U7DA 2P2SA 2PFKA 3GH1A 3I3SR 3OZFA 2LWIA 4W5HA 3Q8LA 1BE8A 5EMKA 4ALKA 4MDYA 2UDPA 3HEBA 4NBVA 3W8NA 3LQ1A 4Z3OA 5TJ9A 4QUKA 2HR1A 2PKYX 1SVWA 3I6ZA 2AG5A 3WKCA 1XTJA 4N7BA 2NU6B 2WVGA 5H70A 2EATA 2BJHA 2HHLA 3HEAA 4IILA 1NNUA 1XZCA 5DN6A 4X3OA 1ZSNA 3KB1A 5K0FA 4WK4B 5J1SB 1GN8A 1V5EA 2B4KA 3MS4A 4ER5A 4RCYA 4TSKA 2F8MA 2QL6A 2XH8A 1R6VA 4FOSA 1D2EA 3ITDA 1YH3A 5JY6A 4BFZA 1TKCA 5G0VA 1VKRA 1IE3A 4PYMA 5LYYA 5HNKA 5F7OA 2XKBA 2OBMA 4IMRA 1F48A 2AJ8A 2H2FA 4IWYA 5A1TA 3H05A 5CDSA 3JSAA 3NO4A 2CV0A 4P7FA 2WVJA 4QHTA 1TKBA 1TJ5A 4US2R 3WYAA 4GR9A 2Z5GA 3O91A 3P9SA 2YQ4A 1N5RA 3P0HA 4CMGA 1S02A 2IOFA 1GDDA 4ZAWA 3UT0A 1TMGE 5DF1A 1AKQA 2O5CA 3NH6A 3C70A 1TT7A 1HTWA 1B4DA 4XGRA 3UG6A 1ML3A 4HD8A 2PBLA 3W6ZA 1GNLA 4B8ZA 4WY2A 4DZRA 3DDCA 3HN2A 3Q11A 4WINA 3R5TA 3HBAA 3QWAA 2VT2A 3HXQA 4QDUA 5JO9A 1DQZA 4NENA 4MGHA 1YCGA 3WNZA 4CMHA 1PG0A 3PPWA 3HUDA 2PSFA 2Y2UA 3K0HA 1SHKA 3JWEA 1JPVA 4B46A 3C74A 4UHEA 3T9EA 4B8YA 3IAM1 3M9XA 5CDHA 2GBPA 4PXAA 3KCQA 4DPMA 1DJLA 3PD1A 4MVJG 5E0OA 4ND1A 2O07A 3VPFA 4E30A 5A62A 3ECCA 4Z4GA 4U00A 2HN9A 4F9TA 4MKIA 1OZAA 3O31A 3PVSA 4JYMA 1FB5A 1DE0A 1C41A 1H2WA 6AT1A 2YRFA 3C7KA 1T3SA 1J8YF 3VDNB 1KKLA 1U2QA 1ZGGA 3O21A 5IM4A 1N6IA 4KZKA 2ZRJA 2HJGA 3ENVA 1CDEA 1FZTA 2ATXA 1SG6A 1H2ZA 1KAHA 5HGJA 3GELA 3MJHA 2FSHA 3GRUA 1QCZA 1YRBA 5BSTA 4YGYA 3N3AC 1E58A 1DC5A 3GNLA 2YBEA 4JX8A 4CKYA 2VKTA 4FT2A 4DR4B 4LQLA 4FFMA 4HAWA 2VDPB 1WNFA 1DIHA 5F7XA 3G8YA 3N6RA 1LLFA 3UCFA 5E6RB 3L4JA 2WG1A 4L8FA 3L7JA 3RUHA 3R3SA 3EVEA 4B6JA 4UULA 1Z7WA 1R10A 1Z6ZA 4XX0B 1P29A 3AV3A 3HVHA 3PCTA 3K2QA 1E4VA 3WKEA 4EITA 4Z4FA 4MQFA 3IKTA 2JK0A 4KUHA 1IATA 1L8LA 2J3HA 5HYVA 3SQDA 3SQWA 1C1HA 1C29B 3THYB 5EJ6A 3G59A 1UMCB 2PN1A 3K8OE 4N8DA 1M75A 3FZGA 1KO7A 4LZAA 4EG8A 3IQIX 4H1TA 1V4NA 3DWGA 2A4MA 4XR9A 5BYJA 5B7GA 3SQXA 4KDCA 5K20A 2BEWB 3OPXA 1X1AA 2IY7A 4QOJA 2W2LA 3P97A 1AO3A 1B8UA 5TS2A 4J1NA 2XAUA 3B38A 1K5PA 1IHOA 3L92A 4HO1X 4RHTA 2BR5A 2P6RA 4I55A 2PCJA 1CY2A 3TBFA 4NOJA 4IQ8A 4DV3B 1SR8A 1MIHA 4MW7A 4RIGA 4D3FA 1MABB 3UJHA 4UATA 2XLCA 3FR8A 3ROGA 4ESEA 1VOTA 4ETNA 2IHKA 3ZJTA 4ALIA 3H5TA 3BMOB 3WISA 1FDIA 2UUOA 3BICA 3ZE9A 4G41A 3CJTA 3I0ZA 2P30A 2DQZA 5AVJA 1ISHA 4IIJA 1H2YA 4JU8A 1JPJA 3P2JA 4MS3A 4ND8B 4AJEA 2ZUFA 2V58A 2XNDD 2YYSA 4ZO8A 1NBHA 1OLUA 2C5BA 1OAOA 5IABA 2F7SA 3D5TA 1BX3A 2R4TA 2ZTSA 3R4CA 4H16A 1Z6PA 2HWUA 3HVUA 4GYYA 2BVNA 4JXJA 3RSLA 5IJ9B 1BE0A 2EQAA 2PUWA 1XKTA 5HF6A 5JCJD 4CEHA 3ZJ5A 5E4YA 3MGGA 1GTMA 3WJ1A 3ROPA 3BTVA 4FMBB 1SUFA 4LC0A 4KHPB 5B37A 3F9RA 3CCFA 5TPZD 3HS3A 1RWNA 4ZOLB 5KOHA 3NAGA 5D3MA 3F4KA 3OU6A 5TVKA 2ZWVA 1T9GS 3CZRA 4M8KA 4BS9A 1C81A 5JZSA 1DQYA 5AJTA 4PNEA 1DBQA 3EEQA 4XCQA 1BXRB 5A5GA 2A5FA 3IHWA 1NBOA 1IAVA 1PK8A 2FPPA 4HBGA 3WKDA 2CXRA 1T15A 4F3RA 4S1PA 5CG1A 4KDRA 4EPYA 2BPOA 2ZE6A 3KYDB 3TQHA 4BMPB 4D3SA 3KQMA 3OOSA 1Q16A 3VU1A 1X1QA 4HRVA 3UGQA 4D4LA 3NX4A 2NQTA 4ZV4A 5IVHA 1WY5A 4WNYA 4JWKA 5BN5B 3EC1A 3T5CA 2Z6QA 1W1IA 1B8PA 3HKDA 4HDOB 5EUMA 4N5HX 3AEYA 3TOSA 4F2WA 1SG9A 4X7RA 5EJ5A 3L79A 2IE8A 4PFJA 1ETHA 2HQRA 5EIWA 3HFGA 3FRIA 1GXSA 3KPUA 3SSNA 1AUOA 4B43A 3UUWA 2PMEA 2RGBA 5A3RA 3MBOA 1QU3A 2VAWA 2WYVA 4OSEA 1H6AA 1CFZA 3AJ8A 4YYEA 3AEKA 3AHCA 4UEJA 2R1TB 3NYRA 4M0KA 2PKQO 3CH4B 2C2WA 4RU1A 3W06A 4BKQA 2H0AA 5D3QA 2JRCA 1US8A 1JQEA 2WV7A 2MDTA 4OM7A 1E60A 3TQTA 3JQ7A 4ZVSA 1JBKA 1O96B 2Q28A 4IF6A 1P60A 4AZ0A 5H9VA 3UB2A 1FFWA 1DAFA 4ASUA 4EPTA 2O19A 1FYWA 2EJTA 4XARA 2HSWA 1IY8A 3JQFC 3BRQA 2VNIA 3B7GA 4W8OA 1HYQA 1KYZA 3MN1A 2SBTA 3P27A 4QQFA 4R2HA 4S3MA 5DWVA 3TCXB 4TLBA 1TUBB 1QTIA 1ZXBA 1Q92A 2X14A 5ALOA 4X92A 1KOGA 4J0IA 2ZRHA 1IUKA 3IA2A 5CHEA 3PTLA 1XVUA 4C08A 5J23A 2CNBA 1JMKC 3IE0A 5K3FB 4CV3A 3AUSA 2ZSHA 1WHSB 1JLMA 4BFYA 1W4RA 2EJWA 3CRQA 1CS4C 1BSVA 2XQFA 1IIBA 1W85A 4EMTA 1DXHA 1Y89A 3HYNA 1EDBA 3ZXXA 5JTUA 2WSSA 3GGSA 3QOFA 5AKHA 3DEIA 4G65A 4NSNA 1GPKA 4HEA1 4MUKA 3L8MA 4TVBA 5LC1A 1IY9A 1D5CA 4H6VA 5JCPA 4BECA 1TKRA 3LPNA 5JNTA 3ESBA 4MS1B 1JL3A 1RZVA 2PYIA 4R40A 4PZPA 4TKVB 4JLNA 4X9XA 1K75A 4LHEA 3HA3A 5C1DA 3PGVA 3ZV7A 1VPDA 3GQBA 4LJ6A 5C80A 2JLZA 3OIUA 1VRWA 4D81A 2WHXA 3E9NA 4C3ZA 4Q4JB 3UMRA 3FPJA 4CKCA 4W82A 1EJBA 4XEHA 4TS3A 5FNZA 3K0KA 4C7BA 3C6XA 5JMPA 2HM7A 3TJZA 1G8AA 1H4TA 3E9MA 1PFYA 1U4NA 4C7OB 5FCDA 2ZU0C 1V43A 1YULA 1RLIA 3U7IA 4F4DA 5K6TA 4BLSA 3E9CA 2AKEA 3LOQA 3K7EA 1KY3A 3A9WA 5JDIC 1IQPA 4H0FA 3ZTWA 4FFNA 1MDFA 2W6ZA 3CLRD 3KAPA 3M83A 4I4TA 4AXBA 3DE2X 1MORA 1ZJ6A 1WS6A 3CC8A 4MUJA 1T4MA 5EWLA 4B3JA 3RHSA 3MOIA 4YAGA 3PGMA 1FJGB 4MYSA 2O8NA 1HURA 4FMPA 1Z3IX 4WCVA 1UAYA 3MELA 2BGLA 2YXDA 2JB9A 5FPQA 2H7YA 5REQA 3TLGB 6YASA 4QFMA 5LWQA 2QIPA 1UC5B 2FE4A 5D6OA 5H3CA 1E94E 3M5PA 4HWSA 1M2VA 3AZQA 4NBWA 5BSRA 3RARA 3R9IA 1M74A 2DU8A 1GNRA 2QKYA 3FJ1A 1K3TA 1B6TA 1O6GA 2GHTA 3SDSA 4OAOA 4YRAA 3E70C 4OH1A 2PU7A 3EFEA 3T1VA 5KQLA 3UM9A 2HCTA 3JAKB 3PKIA 1IXRC 4LKRA 2AVNA 3R3XA 3PFCA 5CA1F 7MDHA 1WZIA 5C5DA 1QVZA 4PZZA 1C7IA 1R0ZA 3TE7A 4ZI3A 4A36A 3FFAA 2YINC 3HE3A 3P19A 3QPDA 3K35A 4GOMD 4M49A 3QEAZ 3LY7A 2HA7A 2ZITA 1E9SA 3QKSA 3INTA 5DNEA 3TOXA 4L0QA 3JD0A 2VNSA 4G9BA 1DEOA 1FVFA 2NSJA 4LSWA 1KYQA 1H9BA 4Y9RA 1Z47A 4LZLA 2HA3A 4LZPA 4F7DA 2GTHA 3ZWBA 4KRGA 4P80A 3OZWA 4Y1GA 3FUTA 4HXEB 5TQ2A 2QRVA 1VI2A 1KAQA 4IINA 4KFCA 3X1YA 3RKSA 3LRPA 1EUYA 4R8KA 1YBAA 3JQ9C 3UFXB 4B81A 3AU9A 3FWZA 3LUBA 3ZLTA 5B1HA 5DGTA 1Q0QA 2FQWA 2H4ZA 4L6AA 1S2OA 2A4KA 3L1VA 2E0IA 4Q3KA 3PC8C 4X71A 3CVUA 2O2YA 4L9RA 3EH2A 3O4IA 4RFVA 4NABA 4BLRA 5JS8A 4GLLA 3ICEA 3ES9A 5I3CA 1TF7A 3IH5A 2Q4RA 1O95C 4TL7A 3BDVA 1O89A 3GR6A 5M29A 2WT8A 3PXXA 1J0CA 4OI4A 2D0PB 2JGKA 3SNKA 2XZPA 2VYFA 3W8RA 2IOQA 4RKRA 5ALMA 2AD1A 5HMMA 3DSRA 2PZGA 4IH4A 1FLAA 2PRYA 3W2FA 4NG5A 4PQYA 3LHSA 5L9AA 2P41A 3WB0A 4PONA 3ULKA 4DVGA 1EB8A 1JDUA 2V9ZA 3ADBA 4C7MA 3ZE0B 2CF5A 2BGRA 1QR6A 2CK3D 2XUIA 3Q7TA 4Y6SA 2BGKA 5IM5A 1O5TA 1QMGA 4IUDS 4IXWA 2PZMA 3NC4A 4ZEOA 5CM9C 5DM1A 3SC3A 2GB4A 2H7CA 2A59A 2EYUA 3OEYA 1EDDA 3FWKA 5CT9A 3V3TA 4TLCA 2B7BA 1MRZA 2IPMA 3RJ9A 4YRZA 3BHNA 3OJLA 3CW9A 2WTAA 4WASA 1JG6A 2AF3C 2BBOA 2SNIE 2YRWA 2UV8A 2J3QA 3E7FA 3FLAA 3O3MB 4KFSA 4RETA 2E89A 2ORVA 3ELUA 3X1WA 4AY5A 4WN9B 4CI0B 4D0GA 3FI9A 4F0JA 2E21A 1D07A 4CL8A 1KWKA 1SHLA 3PPIA 4IS3A 3R7NA 2ZUUA 3ADOA 2HSZA 1EVYA 4TV9A 4M8SA 2XE7A 3TL2A 1FX1A 3U7GA 1QCDA 3C7CB 1JNXX 3F8TA 2O7RA 2OVBA 4TWRA 4JMPA 1XAIA 3HCWA 2H5IA 2PSJA 3EUWA 5CLIA 5E4TA 3VOBA 4DLXA 3T0IA 3BDIA 4IX9A 4HH4A 3ZE8A 4DYHA 3IJ5A 4DDKA 5JJIA 2ZRAA 1U1DA 5EC8A 4QVIA 2CNDA 3QNUA 3PE3A 4QQ8A 4MCAA 5F4BA 5JATA 1EUCA 2XKKA 3CW2A 2REQA 4HGYA 1B1AA 2HJSA 3VPHA 3ABIA 1XQ1A 1FL9A 1WKBA 1TDJA 4RKYA 3MMNA 2AEMA 4IH1A 4KRXA 2WAOA 4TS4A 3UJPA 1PSWA 1TAGA 1EFKA 1N9GB 4G84A 1TIPA 4C05A 1K98A 4L9WA 3MW8A 2BD0A 1SXGA 2POQX 3PX3A 2HU2A 4KE7A 5AJXA 5BMVA 1OZ0A 3ZIUA 3PK0A 5K4GA 3OMWA 3RYFA 1XXHB 1Z6YA 2GF2A 2REOA 5BR8B 1GDHA 2I7DA 1Y3AA 4FE3A 1I1OA 3O0DA 1R16A 1R74A 1N7JA 4RD1A 3QEKA 4IEIA 4KMSA 4PFKA 1F14A 3OTQA 1H8ED 1DAEA 3CX8A 4RXUA 1E7SA 5FUWA 4UOZA 1GV0A 1A9QA 1CUHA 2FW1A 5CB6A 3GRCA 4URFA 3NXSA 2QZ4A 4J43A 4RM2A 4N12A 5FOTA 3EC2A 4PX9A 1JT2A 4H7IA 3PRYA 3N3BC 1AUQA 5CVEA 3TVYA 4B6FA 1M8FA 3QU7A 1S6YA 2F9LA 2GETA 4XQEA 4WW0A 4KIUA 3FKJA 4LEIA 4PSVA 3PNMA 5CA1A 4EO9A 1Q7EA 1OX5A 3HDTA 4FX5A 5A5EA 1F51E 5K3FA 1TJYA 1JTFA 1RWPA 4EJSA 2BGMA 1ZIXA 2HY7A 3IP7A 2R1ZA 1UPFA 4PAWA 3DULA 3SDZA 4WVFA 4JDPA 4ZAGA 1NHGA 1WP4A 1VQ1A 5GOZA 1LKZA 3A1FA 2RB5A 3T15A 1ZH2A 5IBCA 5K8JB 2HBZA 3ASZA 4E94A 1W0JD 1M9NA 3E8SA 4KQXA 4KXNA 4Z9AA 5JQGA 1G66A 4MGKR 3K9HA 1QDLB 5LQAA 3V34A 4TVOA 4LCJA 3TUIC 1RWWA 5JHHB 2O2HA 3L40A 1X1RA 5JRJA 1CIVA 2FWMX 4O4HA 4JH0A 4M2LA 3TRDA 2GK7A 4IYRA 1A9XB 1PQ4A 3HP7A 4JR1A 3WQBA 2Q5HA 2NZUG 3QHPA 1ONSA 4JI7B 5ETJA 4YY3B 1NDHA 3FA2A 4PVCA 2IYWA 1QVRA 4RJJA 4BO2A 5CX1A 2Q3LA 3MK31 2DCMA 3UJ3X 3IBYA 3CNHA 4HDKB 1Q1EA 2OMEA 3HNOA 1ISRA 1JIKA 4XOUA 5FWAA 2O0MA 4YWHA 5CG2A 1SCBA 2OYSA 1XRMA 3U4HA 3LYAA 4E15A 1VTKA 3GA7A 5JWHA 3VC2A 2ZUDA 1K7FB 1JDJA 3B1ZA 2GBCA 3P9XA 3Q6MA 4JLMA 3TLCA 5DNCA 4HAZA 2PUTA 4G9EA 2X9VA 3HVIA 3OF2A 2YZ2A 1AIPA 4DA9A 2GEKA 2VCYA 3LI2A 4EYSA 1E18A 1FSSA 1ZD5A 1GL7A 2QK4A 5DLEA 1SVNA 2VQSA 3GYGA 4G4JA 4KHZA 4UNIA 5BV7A 3WYCA 4RA6B 2ZJYA 3KEFA 5DT2A 4IMIB 4AJHA 1QGDA 1NU8A 4RF5A 4B4VA 2J7PD 2V5AA 1ZUHA 1E63A 1T6ZA 2NU6A 1IQRA 2YWXA 3PC3A 2VHZA 3FLEA 3ZIAD 5KOHB 1XDWA 5AW6A 4HK4A 5EPEA 3DW1X 3F46A 3L04A 1ILWA 2MSKA 4PBTA 2G1UA 1XTQA 2J6HA 3R24A 4JBIA 1KERA 4QU0A 3RADC 1B74A 2O0LA 4EI7A 4J94A 2ZSAA 1IIRA 4OB8A 2NXEA 3H17A 5EQDA 1DBWA 3FUUA 2AWOA 3OQIB 1A3CA 4NATA 4WIAA 1YE8A 5H1YA 3VR6D 4PCVA 4F3CA 3W5CA 2DG2A 1NUPA 1MR3F 4F5DA 2FTKE 2B20A 1JLHA 3KWFA 1K5DA 4DS3A 2VQFB 1JFFB 2OWEA 4RFLA 2ID7A 4N8SA 5KZMB 4KXYA 1QFYA 2HK6A 5SICE 3MGAA 4F9EA 3GVCA 1HA3A 1M2OB 1OIVA 1RC1A 2Y1EA 4M83A 2REXB 1XQVA 4JQCA 2JGEA 3QMVA 3DOUA 4EHNA 1ZK0A 3P2OA 3SEZA 1E1NA 3E4CA 5EIBD 3BGDA 4MAFA 1TVMA 4JLPA 3OCZA 3CUVA 4GP9A 1E9VA 3GG9A 1L4HA 1FRFS 1YGYA 3QKUA 4QVKA 5TMDA 3T7EA 4UXHA 1JWLA 4DBZA 1R66A 1L9XA 2H51A 4MR9B 2R6CA 1L5YA 1XD9A 3AKDA 4MI1A 1JAYA 2P7IA 3AT1A 4WJZA 2C5GA 1V45E 2QLTA 3O90A 4XRRA 1NA5A 5C8YF 2KM1A 1UXIA 1QPGA 4MKHA 5GAJA 1T9DA 3RVKA 4B76A 4F1KA 2QE7D 4G67A 2WZQA 1N3IA 3JALB 1GUYA 5KHAA 3VXKA 1SUAA 2IS2A 1LQUA 1OZFA 3NBFA 6REQB 2IHYA 4EYGA 2AKAB 3GI1A 1PS0A 1C0PA 1VI6A 4I5DA 3FCSB 3KXLA 3EG9B 2FEOA 3SPXA 3GVXA 3K96A 3SQNA 3PNYA 4F9GA 5AIAA 1NFQA 2PANA 5B55A 5FV4A 2P35A 2XOKD 3KB2A 1ZNZA 2FCAA 5MDHA 1XEWX 4RTNA 3FGOA 1Q91A 2LCIA 3WJ2A 3GF4A 5CU7A 4MLDA 1Z12A 2Y3IA 1LDEA 4PLFA 4RIIA 2VZ8A 2H29A 2VJOA 5LCXA 1D6MA 1T1IA 4O2AA 4B4OA 4R1PA 4J16A 5CLGA 3RC2A 3TW4A 3PHLA 1RD4A 1AKEA 2JLRA 4N76A 4X1KB 3RUPA 1JAIA 3PD0A 1XMJA 1R8QA 2EBWA 1ZVJA 2XECA 1UPBA 4HB3A 2VSXA 1HDGO 1KZYC 1U2SA 3JARA 5COBA 3S44A 3WSVA 1CDDA 3GBVA 2M98A 3GMSA 3N5CA 2EJCA 2AJLI 5A3JA 5CVDA 1UPXA 2XQVA 3DLHA 3BBPA 4YJ3B 2WW8A 3OE7D 4TTPA 3E58A 3UH0A 2JGLA 2FF7A 3DBHB 4IGKA 3SAJA 4FMCB 2FLVA 2YY5A 3H9EO 4LE0A 1X8JA 2IEIA 3NBYC 4MLCA 3ZX5A 3KYDA 5AM3A 3HDHA 1SB8A 2ACKA 3G7UA 4IDFA 3O7MA 1GZSA 5DFAA 2IHJA 4DOMA 4S1TA 5T3UA 1I94B 3TL6A 4GXTA 4CNBA 3PXEA 2RIRA 3GGPA 4HDSA 5BW4A 4JEHA 2OILA 3HZOA 4QOIA 2Q62A 4NZ9A 4HJXA 4OGKA 2H8KA 3C8DA 4YJ3F 4DV5B 3TD2A 2GBLA 1BA2A 3DGEC 1E2KA 2H06A 3QPCA 3UTDA 4D8UA 1HE8B 3HL0A 3GDWA 2EJVA 2Q0XA 3EGXB 1EX6A 3N8KA 4FFLA 3SEQA 3BGSA 3LQ2A 4Q7KA 3TAUA 3OBBA 3TQCA 2QUZA 1H1DA 1MNAA 3I64A 2FSFA 5FTMA 3PE6A 2YHBA 1UWKA 2HA5A 4MKFA 1LBTA 3WWYA 4G0MA 1UDAA 4RV9A 5JJLA 1JFRA 3PEWA 5FNVA 1JSZA 1DX9A 4P35A 4Z53A 3ZBTA 1IZZA 1QP4A 4ZO7A 2FMUA 1LDBA 1Z6XA 4QDXA 1KY2A 3UJBA 1HQYE 1KE2A 1M34E 1MB9A 1T2CA 1WO8A 2WIFA 2ZB2A 3BJZA 4UE6A 5EMJA 3RTAA 3UHOA 1CKEA 4DV6B 4KN8A 2PT7A 4O4LB 4HFJA 3FW1A 2EZ9A 2A9RA 1XZBA 5EHXA 1LSJA 3GFPA 5DEOA 4CF3A 1KZ4A 1QMPA 1K8YB 1HE1C 4JKOA 5IAEA 3W9YA 2WFLA 3ZDEA 4BX2A 1I7DA 3STHA 3DL2A 4Y1RA 1PK7A 2JBAA 2ZIXB 2QY6A 3IV6A 1L1FA 5HOEA 1KFBB 3G2HA 4FD3A 4D8XA 3PNVA 2XTAA 3BQNB 2QMYA 4RANA 3DHWC 4UU8A 2EWMA 4XIFA 4E5VA 5BN4A 3IBSA 5CFLA 4DB4A 1MQSA 4V0SA 3ORRA 2XMQA 4PTLA 3U48A 4X54A 5DX8A 1KI7A 3LJKA 1WZNA 1OBHA 3O94A 1TT5B 4G0NA 1Z5ZA 1PBNA 1JJ7A 1IDN1 2ZUTA 3BMXA 1SFRA 1WCXA 2YQZA 3A3NA 1PYGA 2GEUA 3KRTA 1REQA 4IS2A 1W581 5A7GA 1L5NA 3W9BA 4U7DA 4PX2A 3IILA 2QJOA 1QK3A 3GNQA 2H18A 3KLMX 2JBWA 1N0WA 1KO1A 2NV2B 4HSGA 3GRPA 1TADA 3FZEA 1ZH0A 1T5SA 3L0ZA 4N6OA 4FD2A 3DT9A 4MVYA 3V7YA 7YASA 3DE6X 1R0WA 1ISSA 3WXMA 1R15A 4UEKA 1KVQA 2NOAA 1C7JA 1HLFA 2ZYIA 4OJNA 5C4GB 3D6AA 4IIUA 1DIOB 3Q6IA 4G01B 4JLBA 4U02A 2RH8A 3P45A 4YDHB 3WQQA 4EA6A 4ZTUB 5K0BA 1R4ZA 2INGX 1UZUA 4BP1A 4ME6A 1YACA 4J1SA 4RSMA 1R27A 2R5FA 4KSBA 1Q0RA 2YNMC 1J0BA 4P1ZA 4TM8A 3RU3A 2IWHA 1U0HC 1NUQA 3Q9NA 3VH4A 4TYNA 3CLSD 2XNDA 1O94C 2BUCA 2IZ7A 3OO1A 4COOA 5AESA 1GJRA 1QXSA 2A7QA 1W0CA 4PWZA 1NOJA 5A9TA 1UJ5A 4MRAA 4ZQCB 5HQJA 4B32A 1RKBA 1RYBA 1NLZA 3KR2A 4IF4A 1KK0A 4MWCA 4XPIB 1DUVG 2OV6A 4PZAA 5DCLA 2VZEA 3RBZA 4WBNB 3KEOA 5A4FS 4ENVA 4X00A 4RTQA 1ODJA 1V6SA 4RD4A 1BX0A 4MIYA 5C8XA 3A31A 2YV4A 1TFUA 1VMEA 2OGZA 4L5JA 4E2ZA 3ZHXA 1D4ZA 3TM4A 3X1JA 5AKLA 2LDXA 1WULS 2D3TA 4TKZA 3BX1A 3DHNA 2FEWB 4RVHA 3CGGA 3FWYA 5DHSA 1KMHB 3UB3A 1ZONA 5BSHA 3DXXA 1UFKA 1DXYA 3FYHA 1I2DA 1NP7A 2XYVA 3PKZA 1D4FA 5D5QA 4ZAFA 4BVGA 4YUYA 3RVJA 3M81A 3BTUA 5B4TA 3ADDA 1A9YA 5AOAA 3U4IA 4II3A 5ALYA 2I91A 1PWXA 4QYIB 1DJNA 3W6NA 4LYGA 4AKGA 1QIEA 1A96A 3DBIA 3QM1A 5SY6A 3DQZA 1M72A 1UANA 3WIEA 5C5CA 1YJQA 1U6KA 1QQ5A 3IIKA 5M5BA 2BKVA 1JEYA 1M1NA 3DCIA 1R88A 2X42A 1GCIA 4CMEA 1HYHA 2D59A 3AR3A 4PNZA 1KJWA 2W48A 4GYKA 1QVVA 1O95A 1P7CA 4OQEA 3ZBPA 2M6LA 1OOEA 1T5LA 4FLMA 4W99A 4KJZA 2YNMA 3OTGA 3CA8A 3WLEA 4A6EA 1A5ZA 2P69A 5BMOA 3WB2A 3KVVA 2G1PA 3GOHA 1J0AA 1UH5A 4MS4B 4JYBA 4HT3B 1NQTA 2Z3WA 3WLRA 2NG1A 1ZRMA 2PLWA 3HKEB 4D7AA 2FWIA 4G5SA 1YB5A 1QZZA 1AUPA 2YS7A 4YJKA 2FDCA 4B85A 2JGDA 2HA6A 2HSGA 3KZOA 4NZNA 1U0JA 2L82A 3NP7A 1XTKA 4OUKX 3I2HA 3GP5A 3E81A 1VSUA 4R0NA 1XZJA 2ODEA 4UQPA 3JPYA 3W5VA 2P4QA 2QTVB 4BLQA 5KHLB 1PWYE 1ESZA 1U0GA 5CIYA 4QFDA 2V6IA 1S3FA 5HCUA 3U44A 3DEZA 3H87A 1DL5A 3M0EA 1KI3A 2CMGA 3WLOA 5ITVA 4ZHQB 2QPAA 1NONA 2I1QA 5C7LO 1ZOSA 3O5AA 3Q1LA 4YJGA 1GSIA 1TECE 1TTQB 1E59A 4I1OA 1GAEO 2YVAA 3EVCA 2MCFA 4ZYUA 3AEQB 1YUNA 4MAAA 5CVJA 1MABA 5AHWA 3S5JA 4R6XA 1JG7A 1VCMA 4XWGA 1SEPA 2B1IA 1XD2B 3GDOA 1OAOC 2DX7A 4EG3A 2W2KB 1L5VA 2QTLA 1DO8A 4PIMA 1JLSA 3EZ9A 3OX2A 4DRXA 5T64A 2YCLA 3ETLA 5HKOA 3OBIA 1AN0A 2QIOA 5D7BA 5IDQA 3O8CA 1GAXA 1PTKA 1VZ3A 5TMBA 3SF8B 3L0YA 4C5BA 2WILA 1OX4A 4A91A 1U98A 1LA2A 1Q2XA 4KPUB 4F4UA 1I14A 2IYLD 2HU5A 3A6KA 4YCDA 1NVBA 2R62A 2ATVA 1Y8QA 3ICVA 3E5NA 3ZXIA 4O0MA 1IOZA 2WHPA 1K0UA 1RWBA 3FPEA 3RVRA 3J80A 3ZGZA 3VPXA 3H2BA 2XNJA 4PCAA 4X6YA 1C3EA 4BZPA 1NKTA 5J4LA 3IBCA 1QQ6A 4PS0A 2IW1A 3R5SA 3ZCUA 4EO7A 4AROA 4F7WA 3C7DB 2GUGA 2C77A 4IIVA 4Q3OA 3OLWA 1G9XA 4MWOA 3QOYA 2QAIA 4MULA 1BX1A 3NWEA 4FBLA 3NEPX 1DC6A 1G8JA 1PD0A 2P62A 3VMMA 1QH1B 5HMLA 5ICMA 3IB3A 2NUBA 4FHCA 1D3AA 2D1FA 3TRIA 1YU6A 4UARA 4IRMA 3RE1A 2X8LA 4ITUA 4KNYA 4UUMA 2FXIA 4G85A 3HKDB 2WJHA 4EHDA 4JKYA 4Q7LA 2CUNA 4D82A 2P9JA 5DM60 2AXQA 1RU3A 1GUDA 3NRBA 1RYDA 4S1NA 1EE9A 1HH4A 1E32A 1MX9A 2K2QB 3HA2A 4WNCA 5F2KA 2BJVA 3HKCA 5EZYA 5LYJA 4HQKA 4KLNA 1K3UB 1RRFA 1B6GA 3BE4A 2FWNA 3DPUA 2TMGA 1X70A 1GZ3A 3FTNA 3L0IB 3ORSA 2FE1A 3O2JA 3EZGA 4WT7A 1GPBA 3ZGYA 2X5OA 1B7GO 2BM0A 1OWLA 2VDJA 4PWYA 5IC6A 2IXBA 3A1CA 3ND7A 221PA 4F6LA 2YC2C 2V0GA 3KOMA 3E3NA 3A6ZA 4HEHA 3RTGA 1KSJA 3ZHCA 1KPGA 2GN6A 4R2WA 5JYCA 5JYDA 4FINA 4CHGA 1KARA 2GYVA 3WSTA 3ND8A 1ZVQA 4B3BA 1ZD2P 3H3FA 3PXGA 1IB0A 2PXHA 4AZ0B 1UC4B 1K6XA 4Q1AA 3X3HA 4DHEA 5AM2A 1TVCA 1WR8A 1NNI1 3GAAA 4OHBA 5MGNA 5IC5A 2J07A 1O77A 3CVWA 2DXIA 4W1QA 3U40A 5FYQA 2WF8A 2JC3A 4J3FA 4KYIB 1SBYA 4FSDA 1WXWA 4NJEB 1SPBS 2SICE 1I6WA 3MWFA 3INGA 1L5HB 5CVVA 3RANA 3T6KA 4NONA 2QLFA 3M4JA 4EHJA 4Y2RA 5KVSA 1X0XA 5L4SA 2WFZA 1CP3A 4X7PA 1JS1X 2VJKA 5AKKA 3AHHA 2I78A 3C45A 1HOXA 3OZAA 5CLLA 1EWYA 1QIDA 2GJ4A 4ZVUA 3W3AD 4A0FA 4JI1B 1LQ2A 2GSWA 3RFXA 3WK9A 3VDXA 4BVAA 2XCRB 2Y71A 4BNXA 5ICCA 1ZBDA 2AZ4A 3EA4A 4O2BB 5JYBA 4CKWB 2V7WA 3C24A 2NNLD 4I4LA 3EX7C 2QMOA 3N28A 5T67A 1EK5A 1JR3D 5CPFA 5JQGB 1L1RA 1GRVA 1H2EA 2BFNA 2REQB 2Q6KA 1XZEA 3G23A 3OSUA 3RKUA 4TTVA 3VR2D 2C1EA 2ECKA 3LM8A 5BOVA 4O4HB 4DAOA 4RZHA 4QLOA 2C4UA 3V2UA 4RZQA 2IIQA 6PFKA 1QJ4A 1TL7C 4LVOA 2QE6A 3OQBA 4FE7A 4OOEA 2XXAB 3JX9A 3V1TC 3W6PA 4UMDA 4QYXA 2X4GA 3ZTYA 4GECA 2JFWA 1I2MA 1N3YA 1T8PA 2QD5A 4HDAA 4PYNA 4D1YA 4IRUB 1Y4ZA 2FP3A 4R3WA 3ICCA 1P7PA 4WGFA 3F2IA 4BL5A 3N9IA 1JEEA 1PR4A 4LF5B 4RD2A 1YF3A 1GTL1 4HCJA 3K70C 1CEYA 2RJ3A 3CUTA 1DTSA 5A05A 3FF4A 4U2GA 3PF8A 3FNFA 4PGHA 2R8YA 1I33A 2RAPA 2C3UA 4WWHA 1VECA 2OPBA 4FKMA 2O2CA 5AI8A 4X8OA 1NR5A 5BUQA 5LUAA 1PJCA 1NVXQ 5GMOA 2PS0A 2G77B 1LFDB 3GBSA 4ZICA 3CNBA 3NONA 3SZUA 4QTUB 1AS2A 4NMXB 4I66A 3CZ4A 1UP6A 1YMQA 4IQFA 1M0SA 2Q8PA 1XPJA 4R16A 5CLQA 3VBEA 1GSOA 1QHHB 3NATA 4E4YA 4U3JA 4Z7NB 5C81A 4EGFA 3STYA 1IEWA 3QWHA 3QHQA 3DTVA 3CVJA 3EZFA 4JJFA 4RZ3A 1R7RA 4B84A 4EUFA 1NF2A 1OWMA 3DLTA 3DVQX 5ESRA 5L7YA 4DG5A 2PH1A 4XOIA 4XSGA 3TI9A 5HVNA 1EJ0A 1L7BA 1N6LA 3HCCA 5FO1A 3PEYA 4D4HA 5IWAB 1RM5A 1KNXA 2NVOA 3GRFA 4H1WA 5L3RA 4F8JA 2IYSA 3OAAA 3LQKA 4RQUA 3GP3A 5WRFA 1AH2A 1J97A 2UAGA 4U7TB 1WB4A 4YACA 2HYIC 2JIQA 1W75A 1AD2A 5JJ5A 3G0OA 2DHQA 4HLUC 1RXSA 1SKYE 3GJYA 2VDWB 2CUTA 3CXRA 4J8PA 4LRTB 1PYDA 2D8MA 2XUPA 1EHIA 1R1DA 3K5HA 1DKMA 1E2IA 4CKXA 1OUMA 2GKOA 3U2QA 3JV7A 4FCVA 4DBLC 5LJLA 1ODIA 2W0SA 4Z2YA 4O4JA 2XWQA 5H4HA 4Q9DA 1G20A 5JFOA 4D99A 5AVTA 2PIAA 1N1DA 2MYTA 4X6XA 2IYVA 2VJMB 1RYMA 3ZYZA 4WLNA 3AEUB 2H0RA 4NV3A 5AKYA 5E3JA 3KOYA 2G5PA 3ODPA 4H15A 4D2IA 1X7WB 2C03A 4CYMA 1WZUA 1A8UA 2A0FA 3HA7A 1T4CB 2LCQA 3KD3A 1WBJB 3Q7EA 2Z4RA 3GFSA 2B3TA 4AN1A 4W8GA 4LDAA 3RU2A 3VR3D 1G17A 1HYBA 3FUWA 3NHUA 4FXPA 1VHLA 1P73A