1XYYA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, homodimer, oxidised state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 51
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xyyA00
2Q62A 1H69A 3D7NA 1AKVA 2HNBA 3F90A 1DXOA 2BMVA 1JA0A 5NLLA 1CZUA 1T0IA 2GSWA 1CZOA 3OWHA 4C0XA 3NHJA 1RLJA 3TZBA 4GQIA 2V9CA 1CZLA 5LJIA 1B1CA 1J9ZA 3W79A 2QMYA 2X2OA 1KBOA 5FUQA 2X2PA 2D5IA 3ESXA 1FLDA 3NHSA 3JSXA 1I1OA 4HEQA 3GFRA 2XODA 5JROA 1WSWA 1FTGA 5LJLA 3L9WA 4CF6A 3W7AA 4YAWA 3O73A 5EA2A 3N3AC 5LMCA 4GI5A 4PU0A 2MT9A 3OJWA 1ZX1A 1XYVA 5EMNA 1AZLA 3FW1A 4N82A 5ULLA 4C14A 4GR9A 3NHFA 2BZSA 4BMOB 4U7FA 2BPOA 1AKQA 1C7EA 1JA1A 2BN4A 2XOEA 2QX6A 2V5VA 5A4KA 3OVMA 4ZVMA 4YAFA 4H6PA 4U7HA 2Z9CA 1D03A 3KAPA 2FZ5A 1FLNA 1XI2A 1XT6A 2B3DA 1D4AA 5BUCA 5FX2A 2ARKA 4NULA 4S24A 3NHWA 4QOJA 1SQSA 1F4PA 3EYWA 1YCFA 3ZHOA 1RTTA 3FX2A 2R96A 5B3LA 2QMZA 3KLBA 4N9QA 1TIKA 3ES9A 2FDXA 4DILA 2HPVA 5LBTA 4XDHA 4LA4A 1BU5A 4YAUA 3NFRA 1AKRA 2QR2A 3B6JA 4QODA 1FX1A 3UXEA 3NHYA 1RCFA 4QOIA 5F12A 1H66A 5FA6A 5LLDA 1AKWA 5TGZA 6NULA 4DIKA 3G5MA 2MTBA 3P0RA 1QR2A 2M6SA 2Z9BA 2KLBA 2Q9UA 3TE7A 1ZWLA 3NLLA 4ZVLA 1FUEA 4LTDA 3HA2A 3B6MA 4LTNA 1OBVA 4U7GA 4J8PA 3TEMA 3FNIA 3HLYA 2OYSA 1DXQA 1AHNA 2FOXA 1AKUA 4C0WA 3F2VA 3OWXA 3GFSA 4OXXA 2FAXA 4YQEA 2QX8A 3B6IA 3S2YA 1J9GA 4N65A 3F6SA 4BMPB 1YOBA 2RG1A 3RPEA 2MWMA 3U7RA 2FCRA 4Y9UA 2QX9A 4XDGA 1YCGA 3NHPA 4DY4A 3B6KA 2WC1A 1KBQA 2QX4A 4FX2A 5EAIA 3OX1A 2F1OA 1J8QA 4ZVKA 4FGJA 3N39C 4ICIA 2A5LA 3LCMA 3U7IA 4C76A 1QHEA 4NLLA 3NHRA 1DX9A 4PTYA 1NNI1 4ZVNA 1C7FA 4D02A 2AMJA 1WSBA 2FVXA 2MOKA 5F51A 3ESYA 3W77A 2Z98A 3KAQA 1GG5A 1D04A 5LVAA 4QOGA 3N3BC 2KQUA 3ESZA 1RLIA 4CETA 4YAOA 1AG9A 3O2NA 1ZWKA 2FX2A 1E5DA 1AMOA 3OX2A 4QOFA 3F6RA 1XYYA 3L9XA 1CZRA 1SG0A 2FLVA 1YRHA 2OHJA 4LTMA 3OX3A 3GFQA 5NULA 3K20A 2R97A 5LBUA 2OHHA 1OBOA 2QWXA 1OFVA 1QRDA 1CZHA 3NHLA 1FLAA 1VMEA 2OHIA 3K1YA 4H2DA 3R6WA 4QOHA 1YCHA 1AKTA 1QBGA 1TLLA 2Z9DA 3NHKA 4LAFA 4Y7CA 4YALA 1YKGA 2M6RA 2W5UA 4FGKA 3SVLA 3FJOA 3EDOA 4FGLA 1BVYF 5F4BA 3LT5A 2HNAA 3GAMA 2BF4A 3QFCA 3OJXA 1FVXA 1CZNA 4PTZA 4M0CA 2ZKIA 4Y9RA 4F8YA 3QFRA 1T5BA 3KEGA 1J9EA 1V4BA 1YDGA 1X77A 1FLVA 3QE2A 4ESEA 2FZVA 5B3KA 4HS4A 3UXHA 3HR4A 3FVWA 3W78A 2V5UA 2N1MA 3NHUA 4R81A 1CZKA 4QOEA
chains in the Genus database with same CATH superfamily
5AVVA 4DNQA 3P4YA 2GNPA 3IKJA 1H6AA 4B45A 1QHHA 2OO7A 4LVNA 4F9EA 4LK2A 4O3FA 1HYGA 4Y6LA 2ZIXA 5BVGB 2XB2A 2R11A 3EG5A 1IRXA 1IG3A 3E5HA 4HSGA 1H93A 4BUCA 2GARA 2X2FA 3DEJA 3OT1B 1YRAA 3W9SA 4DMGA 1JEYB 1CRWG 2HQSA 4RANA 1DKMA 4N8DA 2X22A 2JHPA 4FYKA 1Y98A 2WF8A 4KIWA 4MJ7A 1MX9A 1K8QA 5JC1A 2IYSA 1VIDA 2GH1A 1TZCA 5EE1A 1WXQA 3BHIA 5K7SA 2C2WA 1W8DA 1KO7A 2CXXA 3OICA 1TK9A 3KV1A 3IVGA 4MO2A 4HQNA 4TV8B 1E2DA 2W6CX 2AQHA 4M86A 5LJIA 4YUVA 1O0CA 2RGGA 2HA7A 2I1QA 3ESRA 4C0BA 2NYUA 2KBEA 3LNCA 4JV5B 1TTQB 4HLDA 1DGQA 4S05A 2VS1A 1PNTA 4UD6A 3B53X 3NKLA 3CF4G 3ERCA 2ZXUA 3OU2A 2H29A 2I9PA 1PG5A 3DCNA 2B7BA 2XY4A 4Q9LA 5B6JA 2JATA 2D5IA 3O1LA 3N2KA 3ROGA 4G37A 2XWQA 4TKMA 1IXKA 3ON5A 1ZKMA 3ORYA 3E81A 5DOZA 4R2LA 1KAGA 1OOEA 3DZGA 2JBAA 1GZVA 4Y2TA 3PFFA 4HEQA 2XRMA 5BQOA 1NW9B 3DL7A 5CH5A 5A4JA 4XVRA 1PFKA 4E2ZA 2W2PA 3CSUA 1WPGA 4MVJG 3RWBA 4BNDA 4EO9A 2YFKA 1DKUA 4HYEA 2UZ0A 3EIEA 1YHYA 4KHPB 3MMZA 3BGWA 1Z4OA 2AJLI 1DNPA 3P97A 2HXGA 5HPYB 1D1SA 2Q3LA 1J21A 3PZRA 2WWIA 4HBZA 2VHEA 5HCUA 3STTA 3HZHA 4CDRA 1FE8A 1GGHA 1XCPA 5E6UB 2OXEA 2O2DA 3N8IA 1ST2A 3H1PA 1JR3E 3BF7A 1PZFA 4POAA 3ZU6A 1DBPA 2EFEB 3E4CA 4UAGA 4ZTZB 4I2NA 5IKXA 3G2JA 2V98A 2C42A 1T5DX 2YASA 4QUGA 2RCYA 3H7IA 1OAAA 3OJLA 2NW6A 3A0UA 3KJFA 3TOCA 1DXYA 1Z6GA 2C97A 2WM2A 1DLIA 1VA5A 4PCVA 2BSXA 1X14A 5K0FA 1TJNA 4JQYA 1Y8CA 4CEHA 1YZVA 3MT0A 1RYBA 3BYZA 5EZ6B 1M6VA 4NCIA 4GLBA 4K6KA 2VYCA 1GZ6A 5LMZA 2F1JA 4Y6SA 1XNQB 1DHTA 4WK4B 4MQFB 3ICVA 2AQIA 2YWFA 4R1PA 2I6FA 3A9TA 4H7PA 3WA6A 2BHLA 3IULA 3LL4A 4JN6B 3WZMA 4KV7A 1IMOA 4OJQA 5EP4A 1ECLA 4KNWA 1ZN8A 4BX2A 1VE3A 2VJKA 4BKMA 3WO1A 5LOVF 1NJ5A 4F21A 1FDVA 5H02A 2YJZA 1Z0JA 3DMRA 3EVBA 1K4KA 4P84A 5E3IA 4N48A 1NLMA 1ZIYA 4MR8B 3JASB 2BFOA 5TRTA 3TSZA 3IJPA 4JJ6A 2QT0A 4N5DA 2UXBB 2ZSKA 3QLEA 4UUMA 1I4OA 3KXKA 3KWJA 4BX8A 1F4VA 3N70A 2X23A 4CKBB 1J5XA 1NE2A 2X58A 1KOJA 2C4TA 1EB8A 1QJCA 4LXHA 2FR0A 3DHNA 4G26A 1DQSA 3I2HA 4D3XA 3FOCA 3QUTA 4F3NA 4HGYA 1GCAA 3PA8A 1I30A 4A91A 1DOAA 3BJMA 2BEKA 5MN6A 1QYDA 3E1SA 1TCBA 2I2CA 2I3DA 1JAZA 4YPFA 4C05A 4CEIA 1LC3A 4MVJI 5KAPA 1OXBB 3QY0A 2R60A 4WGGA 2CJWB 2JI4A 5A9RA 3OSUA 4NV3A 3MLAA 3EHEA 3KB1A 2BFDA 1IZ0A 3CVUA 1U0EA 3R3YA 2O1SA 2YXDA 3L6UA 3M4NA 4FWIB 2WHYA 4TQUS 1OAOA 1RMQA 5K3OA 1QRRA 1AA6A 3FPJA 4RV4A 2C3OA 4BAZA 6ADHA 4LVCA 4AIIA 4UJ3A 3W5UA 1X0XA 1QGOA 3DA8A 3K0AA 2P3LA 3MBOA 1CULC 1TT5B 1SC4A 4ZT3A 5KO2A 2FE1A 3IFSA 1LB1B 1GQFA 3SZMA 3C85A 4KLCA 5EIBC 2F8SA 3W8RA 3WJ1A 1BJRE 4NXMB 3SBEA 1ZW6A 4LDQA 4BFVA 4YUXA 5ALXA 1UBFA 2BGUA 1ADYA 1PJRA 1YR3A 2XWPA 3JYHA 1A5TA 1W35A 2AFHB 2JLRA 3MIZA 5GADl 1PQWA 4CLDA 5JSUA 1FX1A 3GFVA 1JIXA 2QLJA 2YTZA 2VT7A 2QGZA 4YK7A 2F00A 4PAWA 3QEOA 4R69A 4Y9DA 2YV5A 3KXDA 2YWRA 3O8DA 4KGVA 3M81A 3DAGA 4G5RA 1KDTA 3GGPA 1QAQA 3PPIA 4LMPA 4HNTA 5IWCA 2J33A 1T3LA 3MTAA 2NAPA 1P45A 4JNCA 2C0PA 4DUPA 3CBGA 3U7QB 3WB9A 2YH2A 4BVFA 4F4JA 1AVTA 2G7MC 4YDSA 1Q3TA 3V80A 4JX8A 2OORC 5GONF 4IFIA 1TXGA 3QYJA 5JPCA 2HHHB 3LXMA 4TXMA 1L5NA 3DBLA 1Q1BA 2Z09A 3PNYA 4RVDA 4JR0A 1MX1A 2FW6A 2AMVA 3IP3A 1DPGA 1P7ZA 4ZVLA 3W8NA 3EQ7A 4BVAA 1FFDA 4GAEA 4RIHA 2FN7A 5DNUA 4P3YA 1JHPA 4H3SA 1CY6A 4UFPA 3EF3A 3IKMB 5HYVA 5JDIC 4IXDA 3GZTB 4NZYA 1Z4JA 2AOWA 2IX9A 3I6BA 3HDTA 1PP4A 5JD4A 3COZA 1B43A 4QBFA 3ZQ4A 4WBNF 3HWRA 3MT9A 7ABPA 1Q3KA 2BHTA 4F71A 2ZRNA 5EZYA 3V3TA 3IP9A 1E1QD 3CRZA 3P9KA 4D2IA 3DPUA 2GN4A 3LBNA 3C5WP 3HDYA 1JEJA 2Z1MA 5JH7A 1M6YA 1J07A 4IVPA 3L7BA 4DA9A 1P0MA 1JEQA 3V4OA 4C4AA 5AVXA 5KU7A 2NIPA 4MR7B 1OKKA 3WISA 2IV2X 2PA0A 1EXWA 2W2KA 4I8XA 4O1MA 5CNKA 5EXTA 5EMLA 2FQYA 1ECFA 1F0YA 1EE9A 1UJ4A 1ZPDA 3AKDA 3HSKA 4R2KA 5JBQA 2WAYA 3LT4A 1N3LA 4FBMA 3H9UA 2IFTA 4NEGA 1PCXA 4F9TA 1A7AA 2ZSIA 3GD5A 3KJNA 1Q22A 1T6NA 3OIUA 2HW8A 4JBGA 4BNTA 2EATA 3EK2A 4E11A 4HTAA 4IV5A 3W5CA 1ULHA 3U16A 3NI2A 3I0ZA 3ZBPA 1P62B 1DQRA 3UF0A 4UASA 1AF4A 3IT2A 5ECDA 2J1LA 1ZXBA 2ZUWA 3EXG1 3MSCA 4J0FA 1VIAA 2P68A 4E46A 1AGYA 4ENQA 1QO7A 1MOQA 1DB3A 2BV3A 4S35A 2HA3A 1J5PA 3OEYA 1DJMA 2FK8A 3RV4A 1N0VC 1VYHA 3CWCA 1QG4A 5H3HA 3OZTA 1UUFA 2CFIA 4LVOA 3HUFA 4TTQA 1EG7A 5ECWA 1PUIA 2GEKA 4P7GA 4MUNA 5FA5A 1EZ4A 3B6KA 1E5TA 1BKDR 1CHDA 1Q1AA 2QF7A 5EEGA 3ZNPA 3FFAA 2BEVB 4RNDB 4DRYA 1UKEA 1MG5A 2VJPA 4PLYA 2MCFA 1NPDA 1SXIA 4PFSA 4DQUA 4QDUA 2WHQA 3HACA 2E4AA 4LZJA 3WSTA 2Y71A 4V0ME 2EJUA 3RUAA 2VAMA 4C7KA 1SC9A 3Q87B 2NSYA 2PANA 2UZ3A 1VCIA 3J7AC 4ND8A 2O7NA 4X60A 2B8TA 4ZXFA 1LPOA 3VTZA 4URFA 1XJ5A 1NRWA 4GYKA 5IMSA 3HKBA 3ORRA 3GXBA 2AXEA 2BR5A 4U3JB 5LUAA 4IKEA 4B6QA 2D4HA 2ONZA 3Q85A 1J1IA 4BNXA 5KC8A 1DX9A 1R00A 1ORIA 2XRYA 5CGQB 4ZAVA 2JFGA 1TDJA 2H3EA 3CEAA 4BMCA 4D41A 4NABA 2HK6A 1C7FA 2IDZA 1C30A 1WCIA 4M1EA 3STVA 4DRXB 2CV2A 1D2MA 1V96A 2Q2NA 2J3EA 2B5OA 3OY2A 3QFFA 3RSSA 4O4LA 1R0YA 2CXOA 1CRZA 1QHSA 2ZBVA 3HJAA 2NZJA 1CY8A 5J58A 2JI8A 3KL2A 1I2MA 3VPCA 1DCFA 1MT0A 4MVJM 1ELOA 1WNTA 2BKXA 13PKA 1KY2A 3MIIA 2E48A 2E4UA 1ID1A 1MG0A 1V11B 1GUBA 2O3JA 4MV6A 1WPXA 4PLWA 3OAAA 2B4KA 2I99A 1Z39A 4FFLA 1GZDA 2QE6A 3L92A 4KZPA 3MFQA 2J9GA 4YQZA 3ESCA 1CQXA 1W5TA 4HS9A 4HUJA 3SIPA 4Z2AA 2BD0A 1CU1A 1DC4A 1DQYA 2OXRA 4KV9A 3UK7A 4KQEA 3NUGA 5FBZA 4BQPA 2P9GA 1E5DA 2WJ6A 3BRWA 3LX5A 4QUDA 3UT0A 3U39A 3QHQA 1OGYA 3FWKA 3HH8A 4Q1DA 5KKNB 2FVYA 1L7PA 4Q4AB 2XA2A 1I2BA 1MBZA 4L3OA 3EUAA 4J3FA 4P0TA 2ZLBA 2NUPB 1NXOA 1SH7A 4HDCA 3WQRA 4HADA 4CF5A 1GPBA 1HTWA 1OSNA 3B85A 3OQ6A 2NLOA 4JL5A 4BO3A 1T5SA 4HNHA 4IEEA 2C2XA 2NNLD 1R0ZA 1QK3A 3E7WA 3R4CA 3GPCA 5D2CA 2P6OA 1E9SA 1P1KA 3PNKA 3WTCA 4AC9A 4D9IA 2PUDA 2AT1A 2KM1A 4K9KA 4HLNA 4KVZA 1KVTA 1WLYA 1AGXA 1ZGJA 1NDUA 1ZCAA 5TEVA 1J0AA 3Q6IA 3VH2A 1QQTA 2QLLA 3GUVA 4GPZA 4JCCA 3TLBA 1CCWA 4IV0A 4RKQA 4F3KA 3KEFA 3X44A 3P9PA 2GTPA 1VIYA 2N9UA 4BYGA 3KK0A 2DFTA 2QSJA 2Y1DA 2HHLA 1OBOA 3IS3A 4KRXA 4ZI7A 3DEYX 1Q0SA 2V6MA 3SJBA 3CUEF 4EHFA 1HPLA 4P5PA 3GOHA 4A9AA 5TF0A 2PYDA 3DE1X 2QT9A 4UQOA 3KETA 3S29A 2IHBA 2XR1A 4I99A 5GJBA 2ZIWB 2FMTA 2VDVE 4HGNA 3RVPA 5A71A 5CDGA 1X42A 4IIFA 3Q3CA 4LYDA 3WGOA 4DREA 5L6MB 1M0WA 2J5KA 3FBTA 1JHXA 2C2GA 4XOUA 2PZ8A 3WLMA 4LWZA 5IAAA 2FH5B 3IILA 1PWHA 2YHBA 2BGIA 2CVFA 4M9QA 3HBJA 1U3CA 4W5TA 5EC8A 3I3OA 2IQIA 4S1PA 3WDMA 2DPGA 5DNCA 3PL1A 3AHGA 2GCOB 4NCKA 3OM1A 3P94A 4RTLA 1LDEA 3DONA 3WAJA 2ZYVX 1AURA 2O5CA 3QUCA 3KOWA 1T34A 4YALA 5CFZA 3OFKA 5CPFA 3TRDA 3NASA 3O83A 4EW1A 1A97A 2DFLA 5JMTA 1RWWA 2V6FA 3UW3A 4TYPA 1Y9EA 1G8FA 2CMHA 2GB4A 2GAOA 2Q1UA 5KX5F 1RJDA 3BCSA 1JSCA 2HCFA 5HCIA 3BE8A 1LU9A 4QPCA 5IVIA 2XB9A 3ILXA 1XTZA 3G2LA 1Z4PX 3AK4A 4UNQA 4OA8A 1ESNA 4HDRA 2QQ5A 1OYYA 2ZUSA 5E9QA 1H6BA 2X19A 3LT1A 1G98A 2JCVA 4FGLA 3ROKA 4MR9B 4E1AA 1MNQA 4HXYA 1NMYA 4KAJA 4PAOA 2POCA 5TJHA 1U8ZA 1S3FA 1TEHA 2ODEA 2ZRPA 4CI9A 1F8UA 3PGVA 1VSQA 3GAMA 4W5HA 2GYYA 3TNFA 4A2PA 4PQRA 3UMSA 4CL3A 2BYTA 2YN4A 4EPYA 3WO0A 2QLBA 3EGXB 3O0DA 1E6LA 5JXJA 2FW0A 3JAKB 4EAAA 2D2IA 5DM60 5CLFA 5AJWA 4KL8S 3RSCA 4H4CA 3VKVA 3K70D 3UAYA 1WVGA 3D1JA 1VJ5A 3ODGA 4Q9NA 3P96A 4OHOA 3JALA 2JAHA 1VIVA 4FDMA 4FS8A 3CPSA 5K4AA 5CA0F 2W2XA 1NYQA 4NBRA 3SZLA 5GZ3A 3OKCA 4KLRA 4W8GA 5CCEA 1DLJA 1TO1E 4OSPA 1A77A 2PYZA 3ZWCA 5AHRA 1J9EA 1V4BA 1V1RA 3FVTA 5AM4A 2WLSA 4P6VF 1FEZA 5K0CA 3UB3A 4UFOA 1DRWA 1I7NA 4RCYA 1SUAA 4OHVA 3UHPA 1F2UA 3N2ZB 5LYJA 4WBXC 4MJXA 3MCAA 4MITA 2J07A 4PRKA 2QSYA 1TAGA 2CNLA 2OWDA 4K5QA 3SLKA 3VHRA 4DDWA 1J1ZA 2OFPA 5B5SA 5FBVB 4TZ6A 3KCQA 2G67A 1ZIXA 1Y8RB 4B0PA 3DTNA 3T1YB 1RJFA 4G4IA 1KC3A 1B6RA 4WPGA 1P1RA 2RH8A 2V7WA 4KX5A 4PNZA 2QSZA 1HE8B 4UJ5A 5BR8B 3DTVD 1YRYE 1QLJA 2Z8YA 2OZKA 1YWGO 2WJJA 4M1TA 2VK8A 3KQMA 4UUBA 1QFYA 2YUIA 3ZX4A 2FPPA 4ML3A 2WJVA 4R8KA 3KWMA 3ROEA 4O8CA 3LI2A 4GWGA 1R6BX 1OU4A 4WVLA 4Q7QA 2FDRA 1YS2X 3PJEA 4HAIA 2ANCA 1ACMA 4GM0A 821PA 2Y9PB 1Z5VA 1C7QA 1U6KA 1VA4A 2YVUA 2Q6TA 3W2EA 5A5FA 1BDBA 2BGJA 4YRRA 4GF5A 4WDQA 3KKEA 3PLAE 1JA0A 2VHWA 2C31A 4ZCLA 4UUAA 3TX2A 1KI6A 3WLKX 5DNAA 3SC4A 1CUJA 4X45A 1XRPA 4F2HA 5SY9A 4KC0A 3QI7A 4UCWA 4TUYA 4X90A 1X94A 1O54A 1JPVA 2QL6A 2SECE 1JHAA 3CWZA 3M49A 2W2QA 2FPUA 4M4SA 3ZCSA 1SXJD 3EPLA 2J09A 3D4NA 3R5JA 4QYSA 1HOXA 4G86A 3C48A 5EJAA 1KVQA 5J47A 2VQ3A 1NUAA 3ZV6A 1HDXA 3IKVA 3R20A 4MIYA 3NDBB 3SHQA 2JGLA 5BN4B 4RDHA 1AXRA 3Q3HA 1O08A 1PFYA 4I55B 3W2IA 3BMOA 2EXXA 3MJDA 3D5TA 1J2TA 3QTTA 2QHXA 3KNZA 4BNIA 3NHSA 3FR7A 4WV3A 2A9OA 3DFZA 1UZMA 2JJ8A 2BTQA 1CUZA 4FKBA 2RKWA 1PT9A 2CBZA 1QGAA 4JQOA 3BWVA 4OFWA 1UAGA 2PXCA 3KLMX 4HHEA 1STOA 1DG1G 5DI9A 5CFRA 1E9DA 5JU6A 3PXAA 3NC1C 4M9XA 2IHVA 1GRCA 1GRRA 1PWZA 3P9SA 4FDLA 4J4TA 4X85A 3VI4B 2C59A 3SSNA 1F2TA 1MF7A 1QKKA 3GRCA 5EXXA 4YYZA 1R64A 5AW9A 5JROA 4EATA 2D1RA 4NI5A 2GHTA 4OHWA 1DJOA 1X1BA 2ZANA 2FP3A 2XE8A 3BTSA 2GPBA 2C2OA 4XQ0A 1IULA 3E7XA 3M70A 5E2AA 3PKJA 4E6PA 3OZCA 1JJIA 3G5LA 3I2GA 2PLRA 4DVJA 4EQ6A 3ZNNA 3D2BA 5ETJA 1JV2B 2AN5A 1JG7A 3KOZA 3FTEA 3L4KA 5FBHA 4M46A 2FFHA 3V1KA 3FNRA 4DBLC 3M4XA 4TVOA 5T3YA 4LFAB 2DJ5A 4GICA 3PNMA 4A0QA 1E3DA 4X91A 4EY4A 2P9QA 2PUCA 2NYRA 3ZG6A 1E2FA 3VJRA 4OQMA 1L4EA 3VPXA 3N87A 1HA3A 4QQRA 1QGED 2R44A 3CLKA 5B3AA 5DM4A 1WMEA 4F91B 3ONFA 1KSHA 4GPTA 2YZKA 1MDFA 2H8GA 1P7WA 3DM9B 1M7BA 3N5KA 5CYFA 3ROFA 1N77A 2GO1A 1ZAYA 1HDCA 4B7UA 4EJ6A 5FDFA 3V55A 3CEJA 2A3RA 1OPRA 2DETA 3S3TA 3DMGA 3FDFA 2Q5CA 1TM4E 3ISJA 2XOEA 5A0FA 4BJ1A 5L8VA 1K6XA 4IL5A 3ZK8A 4CRWB 2YOFA 1VMDA 2PQ6A 2YVLA 4WASA 1F4LA 4QXRA 3V4ZA 4B3JA 1QGDA 2Q3MA 1RAAA 3JQBA 3JRNA 2OP1A 5LWHA 4H6PA 2Z9CA 5ALNA 3OZBA 3VPHA 1NVVR 3HY6A 1K66A 1N2CE 4C9BA 3RWOA 2SNIE 4CKCA 4DCUA 1N25A 4C0JA 3BMCB 4GM4A 4N3BA 3TTUA 1ORTA 4S1NA 1SBZA 1SKYB 2YV1A 1YIOA 1HE3A 1GTVA 1OIXA 2WWTA 3P9NA 5FL7A 5FNZA 4B73A 4OMCA 3KPVA 3RFXA 5JMPA 3VGPA 1R0RE 4WKNA 5CAEA 1ZXLA 1DAFA 1E2IA 2QLMA 2ZVQX 4AQDA 4GUDA 4J0IA 2HZBA 3GI1A 3H9BA 4LXYA 1GY8A 1YK0A 2FNAA 3AHEA 1X80A 3ICCA 4DUZB 1YRQA 2DPMA 4ENVA 2X9VA 3GJQA 1L6IA 1TB4A 4FUQA 5FNVA 3UFXB 3N7UA 1VLHA 2HF8A 3I04A 3P0FA 1BWQA 3FSJX 2UYQA 3H99A 4INAA 4H15A 4LOLA 3T06B 3ZWDA 1QKJA 4WKOA 4Y6RA 2VH1A 4LUCA 3VU8A 3Q8XB 3E27A 2JC3A 5HK8A 1OLUB 4M88A 4ERXA 2DFKB 4Z0NA 2IV7A 5IJXA 3H75A 4HDOB 4ZV9A 3CR3C 4AY5A 4PCLA 1VZ2A 1ZMOA 3F3KA 3DV0B 3FUTA 4BO5A 2DFDA 2Y8EA 1E20A 1XA0A 1P8JA 3LFTA 1RW4A 2BELA 3I2YX 3HVRA 3S0JA 2RAFA 2WB2A 4QBIA 4Y8VA 3HUTA 4WY8A 4G6ZA 2P4HX 1PD0A 3NVAA 2DUMA 4QODA 1ZK2A 1JB1A 1Z2PX 3EUFA 4G5XA 3KWFA 1TU4A 4B87A 3K1TA 2PIAA 4L76A 3TZCA 2Q0XA 2REBA 3O8QA 5F12A 2NO5A 4QHYA 3V5NA 4C30A 4DCJA 2OL4A 3KQPA 4UE6A 2OPHA 5C1OA 5HKKD 1WUHS 1ETHA 2VWHA 4JP8A 4RPJA 4S1OA 4WZ6A 1Q0RA 4QT0A 3W1VA 1GPLA 4ZK6A 5I48A 1X8LA 3ZK9A 3Q88A 4R9UC 5DGIA 4EA6A 2C8VA 3R3VA 4YP5A 5DM1A 1KOLA 2CLDX 1AQLA 2D7DA 3G5MA 3LOUA 1VJRA 5KYUA 1NR1A 5F5NA 5KJEA 1YT5A 4ZYLA 4L3VA 3TTTA 1XAJA 3D5QA 3UT5A 1ZXXA 4QQ8A 2Y77A 3WRVA 4OATA 1W44A 5T4FA 1U3UA 1GPJA 2Z2KA 3LCCA 4E03A 4MYUA 2MINB 5BWNA 5B1DA 1VPWA 3V7WA 2W58A 5JRJA 2B1GA 1FUEA 2ST1A 2PHZA 1F1BA 3RS7A 4RFSA 4LTDA 1JHUA 2E82A 3F3YA 3HA2A 1MP0A 4PPGA 4X3OA 3OOWA 3ZZNA 1QIEA 3G02A 3W5JA 4UKDA 4G25A 3WS7A 2QE7A 3QVGA 2VZ9A 4V03A 3TTSA 4AUNA 2WF7A 2I8LA 1I5RA 1OXXK 3RT9A 2PLNA 1OYWA 3NEYA 4LISA 1G8MA 1ND5A 2WFZA 2WTBA 1G7CA 1PR5A 3I9LA 2YWGA 2HDHA 4CCYA 4GC9A 2GRAA 4XYBA 4H7IA 3IV9A 4F4IA 5C51B 5EE9A 4ZOBA 1D3AA 4FONA 5HJ2A 2ZE7A 5FFNA 2G28A 3ENKA 3ZDBA 1Z28A 2F9MA 4YJHA 4FCVA 4E4RA 4PLPA 3WQHA 2FN3A 3FOBA 2HDOA 4MK4A 4MGEA 5LA6F 3TIXB 4TTRA 3HBMA 3KYIB 5A2QA 2FDCA 4OHYA 4B2LA 1DJQA 3TBHA 3B1ZA 3A1TA 4HJXA 5ALIA 3HNPA 2LP4Y 1N5DA 2QW1A 2P5UA 3L1UA 5SY4A 1Y6ZA 2A67A 2GLUA 3HCDA 1RJWA 1XZDA 1I2AA 3IBSA 3FPBA 5LQJA 1DC5A 2I2DA 4KXYA 4L4YA 1NX9A 4OKSA 1O94A 1RJEA 1OH5A 1WB4A 3QEMB 3LBIA 4ITUA 4C0WA 4JT2A 2YBEA 2XVMA 5AKZA 4S0XA 4ZK2A 1Y5NA 2O3SA 3AOEA 5ELMA 4CM6A 2J4DA 1H6CA 1NP7A 2C5BA 3QSYA 3UBMA 5TPWA 1G291 1EDZA 2EEZA 1IAVA 2BFNA 2PK3A 3A58B 3RBXA 1J23A 3O3NB 3OIVA 1TO2E 1EVLA 4KNVA 1YJQA 4Y1FA 1DTWB 1ZD4A 2O2ZA 4JLMA 4R0NA 3ZGLA 4JI8B 4J0QA 1JN0A 3G7NA 4UDXX 1J8MF 2BOVA 4RNCA 1ZVJA 1PDVA 2HSZA 3GXOA 4LY9A 2FQXA 2AKEA 1EPUA 3HV0A 4F06A 1FFCA 4QBGB 1NXWA 3K09A 4JJ8A 1LDGA 4LY6A 3RUIA 5LZ5A 1Y0BA 3NNDA 3O38A 4XH9B 5H0IA 3DEHA 3DO5A 1XNHA 3TZQA 3O8NA 1IB0A 2BM0A 4UM9D 5FORA 2A58A 2QW8A 2Q2WA 3QX9A 4P9NA 2NU8B 4OLHA 1BMDA 2ODTX 2RGNA 1G42A 1LSJA 4NICA 3TXXA 5I7RA 1S7GA 3COWA 3EZNA 1Q7RA 4NLLA 1XU7A 3AW9A 3RYCB 3ZCUA 1WIWA 1XL1A 2R25B 1JHVA 3SEQA 1C3LA 5EJIA 3HN6A 5JCPA 1OUMA 2JZNA 2Y2UA 5ARCA 5G40A 1MZVA 3ZLUA 2DY1A 1R37A 3GIWA 3O93A 2ZWPA 3PKZA 1E77A 4TS4A 3ELWA 1AQUA 1TM3E 3QPCA 1WSBA 1RJ9A 4QM7A 1U94A 1XMSA 1DTSA 1EXNA 2QQEA 3KO8A 2Z58A 4LX0A 1DQZA 2JIPA 1CFZA 3W77A 3P4UA 4WFQA 1KZ9A 5IC5A 1TKAA 3DKKA 2Z98A 5F3DA 1SXHA 1AKYA 4Y2JA 1AA9A 1BAPA 1GT6A 4K1LA 3MT8A 1Y4DE 4ODIA 4NYMQ 3VC7A 3TZKA 1IM5A 3EQ8A 3CWQA 3N3BC 2VSQA 1RXUA 2KQUA 3G13A 4N5NA 5K2MA 2IXAA 2W93A 4I9UA 5DCUA 3ZE8A 3T9FA 1GA1A 4MRPA 2FWMX 2JI6A 3GLFE 1B14A 1Z5PA 4JL8A 4EYQA 3JQGA 5T3UA 5JNVA 4G5HA 2BRUC 4ATNA 1LBQA 1DAOA 5AM2A 2VQFB 1L8OA 2DSTA 4NJMB 2O14A 1E3JA 5E9WA 3VO2A 5GONB 2WV7A 1P5HA 2BHNA 3PHGA 3QXJA 2PFGA 3GLHB 1NGSA 1SIWA 1XNJA 4FXPA 2ZCVA 4R8SA 2W2OA 2TS1A 2VC2B 3MPUA 4YJ3B 2HKIA 5CT4A 5IFLA 2VDMB 4H7EA 1H05A 4K88A 2YFQA 3H9JA 4U9UA 3DKVA 4PC7A 4EI9A 1B8OA 1MGPA 3A8TA 1MAHA 2V6IA 1HZZA 1EHIA 3DWGA 3VZPA 4J7XA 2D7JA 2OQVA 1AS0A 4YAGA 5ITZB 1E1LA 2IS1A 4DDMA 3H16A 4GVPA 4PO3X 2PT7A 3HVKA 3P5SA 3E9RA 4WBNB 4H9GA 5FOVA 5FR1A 1UJ2A 2JGDA 2LKDA 3IO3A 1ORDA 3HCPA 4WY2A 3M5DA 4KQ6A 3LECA 4V1CA 3W5BA 1C7ZA 3HUDA 4ZREA 4DLPA 3WNVA 1MAWA 1GPMA 3MMPA 4MTLA 4PHCA 4XGRA 1JBEA 4HGRA 1RQGA 2CJPA 1RACA 2P9JA 2WJYA 3KTDA 4RX1A 1GYQA 3NT2A 3QE9Y 1XA4A 3S4YA 2G07A 3C7AA 2EWWA 3AUKA 1U5CA 4M7WA 3K9HA 4OHBA 4PPNA 4F97A 3PFHA 3KZNA 4RPGA 4AX4A 3PC4A 5JBNA 3PIRA 3A25A 3IIIA 4YJ2A 1GNTA 3U0BA 3D4BA 2GN1A 4KAAA 1T9BA 2V9PA 4TTJA 5H16A 3WSWA 4DARA 4YCSA 9ATCA 1Q83A 4TZKA 2QN3A 3JSAA 1BXRB 2J3JA 1CD5A 5CRIA 3RAPR 3VR2D 3NC0C 5C8XA 5CB6A 3PFNA 1FY2A 5AUQA 1ZVMA 5I7UA 5KDDA 4YS6A 3RVDA 1B8NA 1IXZA 1LBTA 3O03A 3SDSA 3AIMA 3D8NA 1JSRA 2MYNA 2IZ0A 2W11A 1AK2A 1JJBA 5DIFA 5JAHA 3WWDA 2BMFA 5ENDA 4DAEA 1QCDA 3KJHA 3W1EA 1C1XA 3AI7A 3HABA 4Y7CA 3ZW8A 3WXMA 2QUHA 4PWYA 2NX2A 3LTEA 1NC3A 4MCAA 4IVNA 4MUJA 4RZUA 4Q9IA 1ZK1A 3KQYA 4FGKA 3GUUA 2X9NA 4JLWA 3L1HA 2QTWB 4QL3A 3RDPA 1JQAA 2G17A 3AERA 5EIFA 3FCCA 2R8ZA 2VP3A 3F67A 3O4RA 1WY5A 4ZTBA 5A1TA 3DZCA 2VDNB 3V2GA 1X2BA 4LZZA 2Z95A 2WTUA 1Y80A 1NF3A 4PSVA 1ECBA 3ETGA 1R0LA 4RHXA 3AWIA 1D1TA 1SZDA 4Z8YA 2GN6A 2HK9A 4PG7A 1OR8A 4CM5A 1SBHA 3EEQA 1IBRA 4FZVA 3T9EA 3GJXC 2O5EA 1GIAA 1WZUA 3T9AA 4FQ5A 4KO3S 2OA0A 1NW8A 3D3WA 4LW8A 4MA4A 1W46A 3A3NA 2D54A 1N2HA 3K5IA 4QVGA 1CZNA 3L8CA 2QMQA 3D0OA 3O3OB 3OF5A 1PV1A 2XUJA 4R1NA 3A6FA 2O54A 1BDJA 2R00A 2VG8A 4M9UA 1E5QA 2HIHA 3LDGA 1EFDN 1EVKA 3EWIA 4MMZB 5DLQC 4A2QA 3A1VA 2IIBA 3DFKA 4ETNA 3N8HA 3AKCA 1Z2NX 4ZAWA 1XD2B 4K9PA 4U5QA 3SF0A 3QRWA 3TMYA 3M83A 1PWYE 2AFIA 2WF5A 2WQZA 3II6X 1R9MA 3LLMA 5HMLA 3U3KA 3I6YA 4L95C 4ZRNA 1FMFA 5DYNA 3L3BA 2JLSA 4HX2A 3DHVA 1PZGA 4C7OB 4EFLA 2NACA 3PGKA 1T29A 3MJVA 5LB2A 1SCKA 2BE9A 3UHAA 2CWWA 1YTUA 1GUZA 1CV2A 4J0HA 1BXGA 1NQOA 3SKVA 2DTEA 1KH3A 1T3SA 3VPFA 3F1KA 5BNZA 5BXQC 2G9VA 4MUGA 4N01A 3T7JA 1Z63A 1I3MA 4MIKA 2FQQA 2VYVD 1KQOA 1T9HA 3SS9X 4REMA 2W0MA 2EHJA 2EP8A 2ZW9A 3A0RB 3BFVA 3KX2A 3Q3IA 1UJMA 3CUUA 1PRYA 2GA9A 1PJ8A 1XZLA 4IQ0A 3T5GA 5JOQA 2CV1A 5EZQA 5KQPA 2FWJA 2D2FA 3KOMA 4EFDA 1U9YA 2V4ZA 4JOBA 2YHIB 2OCLA 2PKWA 2ZB3A 1EMDA 3WKDA 1L7OA 1KMIY 2FMUA 2VTDA 5CDTA 1L3BA 1HC7A 3D7NA 2H4JA 4K0KB 5I9TA 1X7XB 2X4DA 2PVCA 4YV1A 4F92B 3F90A 4IDNA 4IIYA 4TQ9A 1U2GC 4DR2B 1DDIA 2JGMA 1JYSA 3OOSA 4GQBA 3F5DA 2ORVA 1G21E 2WSSD 4MRSA 2H51A 3DM5A 5ES3A 1HORA 2JBHA 1A5AB 4C7XA 2RCNA 2DG2A 2UZAA 3PDWA 4FYVA 1S02A 3OWHA 1H94A 1W36C 1OWPA 3UA4A 1NXVA 1IN5A 2HCTA 1T8SA 4L7VA 4WZAE 1FX0A 3A1EA 1TC1A 4EDFA 2VBGA 2PN1A 3R77A 4GRIA 2NU9A 3PDUA 3HKCB 4BP1A 8AT1A 3AB3A 4WZBA 2HCBA 2XZPA 1U0NA 5EE3A 5SV2A 1SCJA 2ZE8A 4FS3A 3C8HA 4LXXA 4I1YA 4KH1A 1EVJA 3ICWA 4JB2A 3T35A 1QPGA 1C0LA 521PA 4IKPA 3D4LA 2O5RA 1Y63A 2JIDA 4YRCA 2QTLA 3U9LA 3VBEA 4DEXA 5AJXA 3IVCA 3UWOA 4AJLA 3ETCA 4C89A 3SLGA 2R3SA 4F5ZA 3GT7A 5CM2Z 4EQZA 2Q4RA 3KE9A 2FMXA 2E21A 1B6GA 2QTZA 3OO1A 3NANA 1M1YB 4YT2A 2VYFA 1WDLA 2A78A 4KREA 2IHJA 5E7JA 5D3ZA 5FBQB 4OL0A 4Z1MA 5AXCA 5H8WA 4EG8A 3FD8A 1U7DA 3EVDA 3MAGA 4O59O 3REGA 3OZAA 1N6PA 2IK8A 1N5OX 4C1NA 2CGEA 5U4XA 4DQKA 4HPXB 4AMGA 3H9EO 1E3SA 3IB6A 3K1ZA 5E0OA 3E22B 4NFHA 4QJBA 1YBFA 4DBLE 5C81A 4EJ0A 3TYXA 5J40A 3AU8A 2ACEA 4HDSB 1U8AA 4PYKA 4WGFA 3JAWB 5KX5B 1OF1A 2XDYA 1M1NB 1RKQA 1HLGA 1YS7A 2NU6B 3K0FA 2H2HA 3V3KA 4LOKA 5L6LB 2POQX 3SZ3A 4MWCA 4NMHA 1C9KA 5EMNA 2B25A 5IUJC 1JAXA 5D84A 4Q7MB 1B0UA 2PJUA 4HT3B 1AMUA 4JWKA 5B53A 5FOSA 3ENWA 2VBCA 4OHZA 3SSMA 4Z3DA 4W1PA 1O57A 3NEAA 2PUAA 1QIDA 4QPPA 2VSYA 2CEKA 3DEFA 1K3TA 4DLAA 3OCJA 3MD9A 4BKQA 2BZSA 4FEGA 3QVMA 4FHFA 4YMTA 3UKOA 4B3RB 4BNZA 1BOFA 5HF6A 3FF4A 3IJ5A 1IQPA 1ZMTA 3PCXA 1MJHA 2H4FA 2JCYA 4XWYA 2VKTA 1XU9A 1CQWA 1FW8A 2A7XA 4YT4A 5CA0B 5F3WB 1P9NA 4ZCRA 1R3DA 1YD7A 3FUVA 1H22A 2AG6A 1Y9ZA 4I1RA 2XD4A 1NI3A 4AJNA 2OC4A 1HRDA 3H11B 4J9VA 5GAJA 4B3XA 2FOLA 1C4KA 1AY0A 3B38A 3FCYA 4TSFA 1TTPB 4M22A 1WBDA 3A1WA 4YAFA 1ATIA 5KC9A 2RHCA 4JVSB 1JRLA 1XAIA 2C3PA 3JQFC 3KAPA 2NPFA 4DAOA 4QFMA 4A8PA 3IMFA 3RFUA 2IHNA 3SYNA 3HG7A 1LH0A 3TTWA 2ZJ5A 2EBHX 2HBZA 4QAJA 4UBOA 1TGVA 2Q9CA 4RPCA 5SICE 1PR1A 3F97A 1BMTA 5D01A 1EZZA 3VZBA 2WJ3A 1UWLA 2PWAA 3DKRA 3KB6A 4QX6A 4X93A 3T7RA 3NHWA 2XMQA 3H6GA 3HN7A 3G6WA 1G3UA 3TW4A 5KNLA 4WK6A 5LUBA 1NWCA 4ISBA 3T5BA 3WB2A 4CV1A 1ECPA 5C34B 2CL7X 2DKOA 4RCVA 3G9TA 5JS1A 1F12A 1SUCA 2IA5A 2RB5A 3L46A 2X1VA 1ZGCA 4V0OA 2OV3A 3R7WA 3KT6A 2HLNA 5FLKA 2QRJA 1G7SA 3MFYA 4HH1A 2B6NA 4WOKA 3UXYA 3VSBA 5DGDA 2ZBUA 1KJIA 1QHFA 3ZHXA 4FYWA 1YQ9A 2QVZX 3RC7A 3QJ5A 3ZWYA 1RM3A 1ZZEA 1HBJA 2MHCA 1W1WA 3RU9A 1R6DA 1LRKA 1NMEA 4HH4A 1SVOA 1U3WA 3AHDA 3HADA 1DVRA 3SVZA 2QUBA 1XQYA 3OEHD 4BX0A 1UKYA 1GPAA 2FUNB 4G1VA 1K92A 1Z13A 4D9EA 4FFRA 3P2YA 1YS9A 5JWRA 4R16A 3F46A 1U99A 3OAAD 1OGJA 2A0WA 4FN5A 4KQMA 2AV6A 1B3BA 3NHYA 3RAFC 1P7YA 3UJ9A 4LC1A 5KYNA 2CEAA 1RLMA 4K6CA 2BJWA 2BM8A 2IYEA 4OA5A 2ZRJA 3N8GA 4NOMA 1NRXA 1MB0A 4O8ZA 5EIOA 4LHZA 3HJHA 4CG1A 4ZKDA 3U60B 3H0CA 5DU2A 1M2HA 3C5VA 3I09A 3QI2A 1XDDA 5H68A 1WCV1 3HEAA 3JAMA 2ZSDA 1NYTA 5JZBA 1PQUA 4B84A 4ZGGA 1R66A 4DIKA 3BSWA 3QYPA 5MFZA 4GVLA 2GHQA 3DDHA 1OHHA 1ODTC 4JMPA 1E2MA 4IVRA 3N0RA 2ATEA 4L85A 1SBYA 1W25A 2IHTA 2OK7A 4K6HA 4A6PA 1RQ7A 1JLMA 1KK0A 3AF4A 2M98A 2HJWA 4QU5A 1Z7EA 2XGGA 2A7QA 3V1MA 4QQFA 3MGGA 1K6IA 1KVRA 4BDSA 5IJZA 1I5OA 3MWEA 4JOSA 4R1UA 1YR6A 2J5XA 1BVHA 3Q2KA 2H5LA 3F7MA 4ZGWA 3LIIA 1OLSB 1VKRA 2CXHA 4FC7A 4DANA 4FE7A 4YCDA 2ZTMA 2JIZA 5AKGA 3L0DA 5GMOA 3AKEA 2NPOA 3E9MA 4MW1A 2VF8A 3VUEA 3X1MA 1LTQA 3FFWA 3H2ZA 1WEKA 2P8SA 3AY3A 3CLUD 1E60A 1C3EA 1EB9A 3HE3A 2C7QA 1FPMA 3R24A 4UBMA 2IXTA 4PY2A 2ZUFA 4F96A 5FWDA 1ZS9A 3BWMA 5K2OA 4Q03A 1Z6ZA 3JQ7B 4S3MA 2OCAA 3X1XA 2OCGA 3PEYA 1W30A 1RM5A 1XLTC 2YN2A 2Y0EA 3V2HA 1ETUA 2H1IA 2IDMA 3D7LA 4G0MA 1YIAA 4OAOA 3RAEC 3CF0A 5C46F 4RTOA 2FAXA 2BE7A 4JJKA 4KQXA 4FB4A 4WXEA 4MS3A 2XQKA 4P98A 5ALLA 5E6SA 5DPMA 4BMDA 2NXNA 1N8KA 2V0CA 2OD7A 4HRYA 2R6FA 2VK1A 4FHZA 1U28A 2I76A 4RPIA 4BQQA 3TTVA 3H13A 1F6WA 4O08A 2QYSA 3V97A 1VBFA 2FJPA 4EO7A 4BMPB 1XMOB 2HFJA 1VI6A 1YJ5A 3LA6A 5EWMB 2J6HA 1DTEA 3LX6A 4I36A 4BO6A 1X7YA 2EJCA 2V4UA 4I14A 4MVWA 4C1BA 1ZR4A 3P45A 4JVMA 2OKCA 5JC8A 2XB8A 3OJCA 5HJ7A 4R1OA 5A62A 3KDPA 5F1KA 1QIHA 3OCWA 5KCZA 4DIBA 1FSSA 3HZOA 5HJEA 3WGVA 5JAPA 4U63A 2QGFA 2Y67A 5F78A 2G1PA 2QG6A 2ZJOA 4EUEA 1B6TA 4RKYA 4U8GA 4NDZA 5HF5A 3BXZA 3UAOA 1SQ0A 4O33A 5CYOA 1QWSA 1SWVA 2QX4A 2VATA 3WBKA 1BE8A 4UARA 1F17A 4D8UA 4IW3B 5JAMA 1R9JA 3FAZA 1DQNA 4X8OA 2ZYGA 4OLBA 1E7YA 2A8YA 3HPQA 2LCFA 1PFGA 1EFUA 2AZDA 2VF4X 4BV2A 1VL2A 4QPJC 4WKPA 5EY5B 2RH5A 2JLYA 3CLSD 3X1YA 4N8EA 4QM6A 4PIVA 1KPIA 4YC7A 2YYZA 4Y9TA 2B1RA 4BXOB 3QLVC 4QGGA 3F5QA 2D00A 1GZUA 1USIA 1V7ZA 4PNPA 2IH2A 1RYHA 1KO8A 2PXXA 3S2ZA 1DO0A 2PT6A 5G3ZA 2DLNA 2GUGA 1FQWA 3A6HA 1NNI1 2VRCA 1MO5A 5L53A 1RBQA 2JGIA 2P30A 3JATA 5KJ6A 5KU1A 4X65B 4MV1A 1UBEA 3CUTA 1BWPA 1VKJA 3BDAA 3VHXB 2W00A 4RPHA 5IF3A 1HZJA 2JJYA 1AQNA 3VNUA 1UMDA 2BFCB 1WY7A 1ECCA 3SNKA 1OLOA 3UJPA 3ZDFA 1G8SA 2AW5A 2QTBA 3OOYA 3Q9UA 1NF2A 1BO6A 1T15A 1GNPA 1ZHFA 4XSVA 2JAOA 3S8YA 4I3HA 3MLEA 1B26A 2ZEJA 3ZTTA 5ICGA 3KHSA 2OVFA 1QMGA 2ZUEA 4DVGA 3GRVA 4X6XA 4F1KA 2HU2A 2X6RA 3H2BA 3Q7QA 4YHHB 3NAGA 2B99A 2PGOA 3G7SA 4EJSA 4AY3A 3ESZA 5JJCA 3HKEB 1ZJJA 1JXOA 2A57A 4N7BA 1RRKA 2PR2A 1O6CA 2VNKA 3BTOA 2YJTD 3EVGA 3L0ZA 4KXXA 1SRRA 4N39A 3W4KA 5L7WA 3BWBA 3KKMA 1PK9A 1AMOA 4ZVRA 2HLDD 4YP9A 4WN9A 4ZHQB 4D8TA 1E61A 5FUXA 2COEA 5CNJA 4MGKR 9GPBA 2QJTA 2AW3A 1A5BB 3LDHA 1LTHR 1UJ5A 3EVTA 1BDMA 4BJHB 3EAFA 3IEIA 4ERNA 4LF9B 3B9BA 1KEZA 5I7HA 2NZ8A 5HIIA 1XAHA 2OBBA 4ZQEA 1P0PA 1M2FA 1SG0A 3PTZA 1ZOPA 4IDAA 4D4IA 5DMHA 1FS4A 3ESBA 3ONDA 2ZXFA 1GEEA 4IJ5A 1XZBA 3MWKA 5I7SA 1QQ7A 2OO5C 1CE8B 1J8YF 5C1BA 5JQGB 1SCIA 4CTMA 1IOVA 2CUNA 1KP9A 1LPSA 1WQ3A 1ZJZA 2IYRA 4LDJA 3RIMA 1PAUA 3WAKA 1IY8A 1N57A 1Z0ZA 2QRVA 2RSLA 2X9LA 2XF8A 4OFXA 3WQSB 4ZPXA 4JELA 5JAQA 3N76A 1SXQA 1Z34A 1Z26A 3AKZA 2H7CA 2O05A 3G8YA 3O4IA 4HK4A 3TI9A 5LBUA 4CQMB 2A5GA 3FHLA 2MSWA 3LVFO 3OQBA 3WLIA 1ZNZA 4WOPA 1MFZA 1OFVA 1PL7A 1Y1SA 4QRIA 3U13A 3WMGA 4HN2A 3DF9A 4E21A 2Q5EA 4E5PA 5B7NA 1L4UA 5EHNA 4C6TB 2WAMA 1A4XA 2F3RA 1E9EA 2YMLA 4GX0A 4MJ3A 3EYAA 1JIQA 4BAUA 3IR6A 3L4EA 1JG6A 1ZD5A 2PKEA 5I7WA 5JS7A 3WYFA 4Y2RA 1R0KA 5KYWA 4B6PA 1IEWA 4KE9A 1H8HA 6LDHA 2CVOA 1GM5A 1EUCB 2Y0CA 4G1BA 2I55A 2Q6IA 4RSRA 3HDQA 4DABA 1PFQA 2EJVA 3ILYA 3E48A 3NHKA 3D0RA 4U2FA 1OTXA 2ZYAA 3AVOA 3C3XA 5KTMA 1Y5RA 3RWMB 2NM0A 3UCXA 3G9UA 4R3UC 3S55A 5DN6D 3C15C 2FY8A 3AY0A 1AXGA 3RB8A 4EI8A 4R2MA 1YDEA 1R5OA 4LYYA 4DDTA 3BK2A 3EXIB 1SZPA 1NM5C 4X8HA 3RODA 5A4FS 4BFZA 3AHJA 4M99A 4A3SA 3SVLA 3O47A 1NVTA 1OZGA 4BGIA 4PZLA 5FWXB 3MJHA 1QGYA 3EDOA 4OUKX 3CVYA 3CE6A 3FMFA 1G5RA 2HSGA 1EQUA 3DMHA 3B8EA 1A3CA 1LDNA 3LQ4A 1W2WB 2LBPA 4QULA 4X92A 5KYVA 3SFZA 1C7RA 5JCJD 2VHJA 3LDUA 1SA0A 2QKYA 3R0XA 5F4BA 2INGX 1WSAA 3G2QA 2R1VA 3K9BA 4YXFA 5A0TA 1VI5A 4AG5A 2D5CA 3ER8A 2HYIC 5IRCD 2Z56A 2C03A 2O2IA 4NDNE 4PGAA 5F5LA 4QBHA 3CONA 4J94A 4HFJA 3T4EA 4EFMA 2JHGA 3KFXA 5KZMB 4W5NA 3URMA 5C0OE 2A0XA 5AESA 5LQNA 3RRYA 5CD9A 4BO0A 2CL6X 3IX7A 5B57C 4TYYA 3E61A 4DPKA 2IELA 4QBTA 2XEXA 3QKWA 5E1MA 1PDOA 5CU7A 2Z08A 4R71A 2I0FA 1T2NA 4RY8A 3UGKA 1G5HA 4KQHA 1RPZA 3BAFA 1LWNA 4DJJA 2Y1KA 3EIXA 3K2EA 1NVXQ 1JHRA 2C8KA 3K0SA 1KSGA 3EGVA 2PD4A 1ZN7A 2ZZKA 2C9CA 1MB4A 1M10A 2WZCA 1P1FA 5JH7F 3UJNA 3OE7D 2H7XA 2FZVA 4GOMD 1O95D 1J20A 4Q3DA 2HOQA 1K5HA 3S68A 2IDJA 1G8AA 2Z4RA 4HS4A 5DP1A 4DHEA 3FPFA 4GR4A 2AOVA 3QLUA 1J24A 4D1YA 1XKTA 1X19A 2QZPA 4FZ3A 2O8VA 1MVLA 1M7HA 1YB2A 4HAVA 1WF3A 3GBVA 4N49A 3KB8A 1DP4A 1OFUX 5DBGA 4UTPA 3JD0A 2EFYA 4KQFA 2GZ3A 1WMFA 4XGNA 4DLLA 4YT5A 2Q1SA 1XKQA 2ZVJA 4EHKA 4Z4QA 4A10A 2DTDA 4KUGA 1G7RA 2Y99A 1V4NA 1KMMA 3MEQA 1SVMA 5ARDA 4FYMA 3M3DA 3PC8C 3U1BA 1E1RA 1JZTA 2H4XA 2Q07A 1NBIA 1BW9B 1DZIA 1YQTA 2YMPA 3I4FA 3W8FA 2ID4A 3H17A 1ONNA 2H1RA 5KNBH 1XR3A 1X1TA 4TROA 5HXAA 1GQOA 3JZIA 2BGMA 1JDZA 5BYAA 5LU8A 4PYLA 4TT3A 1U9IC 1WXHA 4GLFA 5ERGB 3P0EA 1J49A 2GA8A 3ZBUA 4C0XA 4V02A 2IEAA 4DFDA 2H59A 4N5LA 3TR6A 3SP1A 4C3VA 3DOCA 3FM9A 5BNIA 4AVYA 1MQSA 2ZYSA 3NETA 3NXKA 4CKZA 5U9CA 4RD1A 2Y05A 3UAXA 4F3RA 1GRVA 1ZIOA 3G1WA 3H4MA 1IDN1 4LC9A 1EDDA 3D1VA 4LFBB 1XDSA 1BFUA 3ABSB 4KWCA 3WI7A 3LFUA 2Z2IA 1IY1A 3AHHA 1I7PA 1P17A 1W59A 1QIMA 5LQCA 1CJVC 2JFZA 1XZCA 3T94A 3V8QA 3B13B 5LNK6 2GS9A 2XNDD 4XKJA 2ZS8A 1Y3FE 3ZEAA 2YN0A 4WKBA 1IZZA 3AYXB 5IASA 1PV2A 2GK6A 4D9FA 2VPWA 4QGSA 4DV0B 3AR4A 3EMBA 3OFNA 1PW5A 4CXMA 1RYYA 3I39X 5LQMA 4LHYA 3IUPA 4X66B 1MTOA 1EFKA 3KD3A 1CQPA 4RZIA 3PNPA 1IK6A 1C81A 4ZT4A 4WD3A 4C4PA 3HGTA 2QE7D 4UXHA 1S96A 3T0GA 3T3MB 4MR8A 5B12A 3JASA 1K6JA 1HWYA 1TKRA 3IEUA 1JEDA 4UFNA 3VSDA 4DCCA 5CD1A 1QTQA 3KALA 1ZUD1 2R4TA 2GD6A 4KK3A 4O4LF 3G79A 4DCMA 5KQSA 2Y4NA 3OA2A 4CR8A 4PAMA 2PBLA 4E30A 5IZ4A 4KO1S 3H2SA 4D0NA 3N2GA 3TLZA 3BE4A 4KOAA 2W6ID 3FKSD 4YP0A 1NNSA 1JYEA 3B1KA 4GI5A 3SQLA 2IP1A 2A84A 2ID8A 1GKUB 1EE2A 1NBHA 2JVIA 3OJWA 4NG4A 4O6VA 3JQCA 4R2HA 4FMCF 3RVNA 4JA2A 1GR1A 3TFWA 4CV0A 1PK7A 1C9YA 1SOWA 1YS4A 2ZB8A 3GRPA 2C0QA 1RT9A 3G0BA 2XUGA 2DWUA 5CP8A 4RPLA 2GAIA 1NNLA 1ZI8A 2JDIA 4M9CA 5JAOA 4GT1A 4IH9A 1TAUA 1VPEA 3IR5A 1QIFA 3KSZO 5EUCA 1O6ZA 4RFLA 4D79A 6REQB 1W48A 4YLGA 2XDAA 2CFTA 3DE3X 4BDTA 2ZDGA 1NAIA 4N82A 5DWQA 3EWAA 4TSRA 1LV8A 5J1TB 3WZLA 3PD1A 4Y98A 1CJSA 1R8SA 4RQUA 6ABPA 4KTVE 2ODWA 1LW6E 2IEIA 2XMSA 4URYR 4X1IB 1TT5A 4I9HA 4C4TA 1UPUA 2XZDA 2QYHA 2GXAA 4FB5A 4E5UA 1A8PA 4PINA 3DSRA 2BONA 2DZDA 2ECKA 1QVWA 5K3SA 2JK1A 4WA8A 1ZINA 5K3BA 1EBFA 3MTIA 1MMFB 1Y9JA 3B2QA 5FTJA 1JIIA 3WNZA 3F4BA 2PNJA 3OVMA 2YY6A 4EMBA 3PUKA 4HEJA 4LXQA 3VTFA 4C3ZA 3AVQA 3GNLA 3UMBA 2FZ5A 2ZJ1A 4Y6QA 4YUAA 3QUSA 1X1QA 4B74A 1WKBA 2BF7A 3L6EA 3ELYA 1ZK4A 3M7IA 3UV7A 2CWDA 5BUCA 2WOJA 3QKUA 4X6UA 3DEKA 1DG3A 3TAHA 2DFVA 4AJEA 3IE1A 4JT4A 4GSKA 3D7SA 2PKXA 3KQTA 4RZHA 3U7QA 5TNXA 4A7PA 2DY0A 2XEDA 2VTBB 2CK3A 1Z6PA 3QEAZ 1LSOA 2GF9A 4HNSA 4AJOA 1MAAA 4CR7A 2E4YA 2FXVA 3QX8A 2WJPA 3CQ9A 1SQSA 4EW6A 4OYHA 2B82A 4M1ZA 2YNMA 1T2EA 3H97A 3HU2A 4C20A 1LPNA 4YMGA 4MVYA 1H65A 1AS2A 1GCOA 1T36A 1H8EA 3PNBA 1W34A 1TF2A 1G63A 1XP5A 4F3CA 2IZ1A 1RYNA 1KIAA 5CDYA 2J0SA 2PZFA 2YIJA 2QMZA 3K94A 1Z0UA 3BREA 3OZIA 3E9ZA 4IJ6A 2BMAA 1JALA 1XTPA 3GLTA 3HB9A 5TVGA 2YVQA 3TQCA 5BV7A 3DF7A 3RNLA 1SCNE 4YAIA 3U31A 1CRPA 5CG1A 3N2IA 2ZUUA 4EKIA 4Q15A 2DHEA 2HPHA 2OB2A 2PKYX 4U6SA 4HI0E 4KODA 5HDQA 4O02B 4D99A 4DJ5X 5KTOA 1EUYA 2I9KA 1BE6A 4AN1A 3A05A 3LK7A 5EI5A 3OOHA 4MRMB 5CW1A 4G5SA 4FMDF 3DPIA 3TVDA 1FC0A 1FSFA 3NTLA 1KPHA 4IHQA 4OV6B 5BW6B 3SSOA 3U3DA 2MJLA 4EBFA 2IGTA 5DHUA 4MR7A 4RM3A 1N5KA 5E6RB 1C80A 4FCTA 1B23P 2NT4A 3PPYA 2CLHB 3U9TA 5K3EA 2AD1A 3MHTA 3BJIC 1UFOA 2AS0A 3S99A 3FN4A 2O0KA 3L0CA 4GYJA 5AM3A 1NVGA 2ZRBA 4PSKA 2BKUA 1GL3A 4QYTA 2YZGA 1OIVA 1RI2A 3H5OA 4PSUA 4DSAA 1SPBS 5EUBA 1FSPA 3VR5A 1QR2A 5A0VA 1FP4B 2VCHA 1BEUB 3NGXA 3TIIA 1CUEA 2WPDA 2J0UB 4JB3A 1TT7A 4J7AA 5AI9A 1ZWLA 2W0SA 4MAAA 1YBVA 3EXHC 4MLZA 4EHHA 3LHSA 1P4GA 4FNOA 3G85A 5LYJF 1CRLA 1I5EA 4E14A 1QJ4A 1IQRA 4XYGA 4LWQA 4YAJA 4J6EA 2WG0A 1AV7A 1LJ8A 4QYXA 3ITKA 1N6OA 4I6EA 4U7JA 3HYTA 3FHJA 4CW7A 1GILA 1P73A 3BXFA 3H5IA 4MKHA 1NN5A 4OEHA 4CEJB 1IN1A 2KPOA 4KP7A 3PUIA 1NW4A 1T6XA 4EUNA 2P78A 2CL5A 2GXUA 3R76A 3EJWA 4KMSA 3OF2A 3HU5A 2PY6A 5BRAA 3TBKA 2FOXA 3GBSA 4OREX 2B4TO 2COKA 3E9CA 2AG5A 2BEVA 2CHGA 3WRYA 1FU7A 2XKBA 4UBLA 1PTKA 1UC5B 2YS6A 1PD1A 3CLRD 3EC2A 4RVSA 4V38A 1T4CB 3PQ7A 5F77A 1QV7A 3WLNA 3ZNQA 1PJTA 1SN7A 2P0AA 4B0OA 3PVZA 2JVKA 3ZWNA 1BJKA 3NVMB 3R7FA 3DDCA 1DJNA 5KNDA 4F38A 1GLNA 1M2JA 1RP1A 3QPBA 3AFNA 4IKOA 1TM1E 1VSTA 4INZA 3U1VA 1KZ7B 2IP4A 2QN1A 2I87A 2J9ZB 5GGYA 4YQEA 1SCQA 1C3OB 3N8NA 3RUCA 4E2YA 2EKBA 2O1EA 4RMNA 5JNLA 5A1JA 2RH9B 4MRRA 4Q9JA 1SKBA 1XX6A 2ZBRA 3TXAA 4RZ2A 3DXZA 4IWYA 4TUYF 4YV7A 1NSYA 2JVJA 5DRYA 4BNLA 1YRWA 3TH5A 5LKRA 2VHZA 1KJZA 2ZIZA 4PX9A 1XZAA 4POOA 3CTMA 4FW9A 1YULA 4KEAA 1TJPB 2QVXX 2GXQA 1JR2A 4XDGA 4XQEA 3TUIC 1IZ8A 5MFPA 1GLVA 2M32A 2RGYA 5B1SA 5T8KA 2X4LA 2XUZA 2JJMA 1RAGA 3CEMA 2X0DA 3SHOA 3COPA 1MORA 3WC4A 4C29A 4LMBA 1XHLA 2Q5HA 4Q05A 3ROZA 2M1XA 4AP9A 3WMEA 1BZYA 1EM8A 2CL0X 4B34A 2Q46A 3WLSA 3ABZA 4FLMA 1J42A 4FVTA 1T6ZA 2FZGA 4JGBA 1U6IA 1L4GA 2W8ZA 3DR3A 1ULSA 1CIVA 4PQGA 1EWKA 2J3MA 5DDIP 3UMJA 5G0UA 1NBMD 2WD8A 3BN3A 1J8QA 1NW5A 1NU6A 4Q4AA 5K0GA 4ICIA 4QWMA 1MRNA 2UVPA 4G07A 4CG3A 2I4OA 4EFKA 1K5GA 4IHJA 1XNGA 4G0YA 4A5SA 2JBWA 3OZEA 1KQNA 1MC8A 1XMPA 4FZRA 1J56A 4P4GA 3PNLA 1U8FO 3O75A 1C3JA 2FG7C 1M2EA 2CVQA 3ETJA 2IPMA 3GYBA 2YV3A 3QUBA 4FGWA 3E05A 4TWZA 1C1YA 5HOEA 1NI4B 1JFSA 1MO6A 1P5RA 2MU1A 1L4FA 1V5WA 1V8DA 3V33A 1KZYC 2RBGA 1ZYUA 2ZR7A 3RCBA 4ZJPA 3R7SA 3MWDB 3I4LA 2IBSA 3IT1A 4P8RA 1Y34E 5EYPB 2ZSBA 1CQZA 1YVRA 3LQ2A 4ZAZA 3OMXA 4BRZA 2XWSA 3A6EA 4OHCA 3D43A 3DJFA 2VIIA 3SQNA 3UOWA 3WKEA 4EH1A 3KTAA 4EVSA 1PJQA 2IHZA 4RZXA 4CDNA 1G8GA 2CDAA 2E4WA 2IZOA 3ORQA 4M8NE 5JHHB 5AVQA 2D1QA 3DP9A 2EKDA 3B5EA 5M5BA 4PLZA 1XFAA 1WL8A 4M1YA 5AXDA 2ZQZA 1S01A 1BC5A 4GFDA 1II0A 5TPZA 1NY5A 4JKIA 3OY7A 1SHUX 2PWZA 2O52A 2QVYX 2ZJ0A 3H4IA 1XMXA 3AR8A 4O2AB 9LDBA 8GPBA 2FYTA 2NSJA 3ROQA 3KJXA 4XR4A 4PYMA 2CYCA 3EPPA 1N78A 4C08A 2N75A 2MYPA 4XWWA 4LKOA 5BUSA 3P32A 3GY0A 1OC2A 5H81A 2G6TA 3UWDA 4PYJA 3INRA 4IYRA 2UUAB 5K0JA 2I7CA 4B3SB 4L6AA 5K3FB 1MB9A 2GCNA 1K7FB 2PX6A 3SJAA 1XJCA 3M5WA 1XZKA 2O7QA 1MLDA 1UKZA 2JIQA 1JLHA 3NTUA 3GJ5A 5AHXA 3TRIA 3W06A 3B78A 3K20A 4RHTA 1X70A 5SZHB 5IDWA 5KNCA 3AG5A 4Z6KA 4MR9A 1HT2E 3K70C 4B09A 1GAQA 3C3MA 4GBED 4LYGA 5LXTF 3SX2A 1WPQA 4DIFA 1QRDA 3LQ1A 3R4VA 4KWEA 5G0TA 4L6IA 4C87A 3VU3A 4MWTA 1NNUA 1FLAA 1YUBA 1LRLA 1P1JA 2W48A 2YCBA 4DA6A 1B15A 2F8MA 3EGXA 3PSHA 5I3ZA 5HKLA 2Y1XA 3LCVB 1IG0A 2ZIXB 1JG4A 5FF9A 2CC2A 3N0TA 2PZMA 4LKRA 1DAMA 4CIWA 5JARA 1P0IA 2VHCA 3WTBA 2IHYA 3MD0A 2FHPA 4QGHA 2G1JA 3HXLA 4ID3A 4MS4B 3GDHA 3SR3A 4IVQA 1PR2A 2DUJA 2FEXA 1R18A 4RF2A 4BFWA 1Z18A 4LF8B 1XXHE 4KHZA 2Y92A 4N7MA 1VL6A 1QPZA 2ISSD 1B0PA 4I4TF 4LBVA 1GAWA 1DT5A 3JQAD 3WYAA 4OI1A 1UBCA 4LCBA 1UBKS 3O4VA 5BSEA 2A1UB 4RSHA 2YX1A 1ILEA 2UU9B 4JJ4A 1HYHA 3HLTA 3B70A 4YRQA 3ZY2A 4ZVTA 4WLFA 4IDPA 1QQBA 3AZQA 3SC6A 4JJEA 1LZKA 2QRZA 1FU4A 2VTEA 5CNIA 3AUYA 4WECA 4KQWA 4IUYA 1V5GA 3N2KB 3VJLA 2R9VA 1SU6A 2JAPA 3VYSB 2OQIA 4IIJB 1Z4IA 3SYRA 1QG0A 3CJTA 3OJOA 5KVCA 4LQ4A 2JBAB 3OZUA 3ZI7A 3LC1O 4NG5A 3MRSA 1O9GA 4WNCA 5ALSA 3M89A 3V7NA 4QNNA 3SYTA 4DJAA 3DTTA 4BNDB 1RPJA 3RLFA 5F1OA 3JVVA 3FCUB 4IIGA 5HRUA 3FIJA 5A3QA 1SXJC 2VRWA 3Q7RA 1SD1A 1CTQA 3T5PA 3QQPA 1YI1A 3I5MA 1PJ2A 4JZYA 4WNAA 1IN7A 1ZGZA 1YR1A 1IE3A 2EWMA 2FPXA 3KEGA 1PWEA 1E79D 1S1MA 2Q5OA 4UTOA 3ZKWA 5IWAB 4ZVSA 5AVUA 5DBEX 5GOTA 1OJLA 3ORHA 4G3XA 5FUWA 1YDGA 5BWMA 4Q1BA 1ZGBA 1TCVA 1GG2A 1WDKA 1L7NA 1J2JA 1VKNA 3U3RA 4FD3A 1L5RA 1KJYA 4QHTA 5CDFE 4N3CA 1JR3A 3BJEA 3RQSA 2IWRA 3HC7A 3T3HA 4P92A 4EAQA 4XEHA 2ZI5A 3E2MA 2ZRHA 4L5CA 4CEHB 5HR5A 2FSHA 3HR4A 4FMPA 1KEEB 1M6VB 1Q0PA 1T2FA 5BN4A 4PGMA 4OJMX 5EWLA 4I55A 3STUA 4K0RA 3RS4A 3D8BA 4IZHA 5CDHA 5HW0A 3DWEX 3GVCA 1LEHA 3Q2IA 5K3CA 2NV2B 3W2FA 2D0OB 1OBFO 1WS6A 1I6KA 1C8BA 2DVMA 4Y2UA 5DI3B 1VJTA 5B7PA 1J0CA 1Z74A 1XKLA 1A50B 1T2VA 2GBLC 1EFPB 4HLCA 2R87A 1CBUA 3PRKE 4FYXA 5LQSA 3SIXA 3VPGA 2V3CC 5ENVA 3I9V6 4DLRA 1P2UA 2W6JA 1ISMA 3FF1A 1EEHA 3USZA 2HNBA 4F86A 2PUEA 2XAUA 3SKXA 1CUYA 1FUIA 2LTAA 2QG9A 3CNNA 2JW5A 1ZUIA 2E49A 1HG0A 2WUDA 3DDWA 2JGFA 3R6TA 3CZ4A 3ML1A 2CUTA 3BC1A 3DD5A 4I50F 1WHTB 3HO8A 5TR9A 4B1FA 2WIKA 4FFBA 3UHJA 1R8YA 2ZS9A 1XQWA 1L1RA 4JLKA 4DSNA 1UMCB 1KE1A 4F4FA 4BNKA 4A15A 5L7TA 4RGBA 2WFLB 1RLJA 3AJAA 4H1VA 1GVNB 4WXRA 3QA9A 3KQSA 1EEXB 2NP7A 3LOPA 2FGKA 1XRRA 1S2DA 2OHVA 3K0CA 1K8RA 3BHJA 4Q0MA 2F1KA 2I1WA 5FR2A 5GQSA 4Q6WA 4DMKA 5CITA 4KGZA 2GRUA 4CIXA 1AGRA 2J59A 1NJFA 1YFJA 3QNUA 3FZNA 2HO4A 1MV5A 4RA6B 1KKMA 4Y6GB 5CPBA 4DA8A 1NF9A 1DCMA 3IXMA 1VBNA 4OB6A 4BNFA 1G2PA 4PC6A 3C8DA 4MHOA 1RQXA 5C18A 3EGCA 1L4HA 3ELDA 1BCRA 4S1TA 3TAXA 2WOOA 2ZRCA 4IXTA 5L7YA 4WACA 2EC5A 1DELA 4GPEA 2OXIA 5BNWA 4GBMA 2PSJA 1Z8FA 1KR5A 4YRSA 4WJKB 1P60A 1PGQA 1Z2CA 2FPGB 3B48A 3DOHA 3FGZA 2I91A 3RJ5A 5JRDS 4MCHA 2A9JA 3SGLA 2J5RA 5EHQA 4CUJA 3PQDA 3C39A 2GTIA 2ZAYA 4OGWA 4D0LB 3R6GA 1TM7E 3H5RA 3JQPA 2A86A 3GUCA 1T2AA 1N7HA 2IP2A 2J8ZA 3JZDA 4TLCA 4BIIA 2CKMA 1ODSA 1FRFS 1BGVA 3GFOA 4L4ZA 4DGQA 5GY7A 3T6KA 3FWHA 1Z12A 1F6BA 2F1HA 4L15A 1NL3A 1I4DD 4YAWA 4CUZA 3WBBA 2G1UA 4CYMA 1H9BA 3O73A 4Y6OA 2WP0A 5KQLA 2O2YA 3DJYA 1CR6A 4CMEA 1KETA 2WA1A 1BH6A 2O23A 5CM9C 2VF2A 3THOA 3BMCA 3RUEA 2AFRA 4PR3A 2Z6AA 5FUYA 4YBRA 2PBZA 5ADVA 1U80A 2ONKA 5AW6A 2NWQA 1U3DA 3V6MA 4CIBA 1RPAA 3IQFA 1GRNA 1P0CA 2IU4A 2UUBB 5FBKA 1Q1EA 1YBHA 2OBNA 3OM8A 4MVJD 5EP3A 3ADCA 1GPKA 3ZVMA 3A9CA 1RQ2A 3EIOA 1WXIA 3RS2A 3R41A 3DOUA 3RUDA 4CV2A 1H2YA 2QIOA 1QCYA 3DBLB 1UKCA 3SC2B 5ICCA 3ZOZA 1FXWA 3MT7A 4L5IA 4RXUA 4HFNA 3U1TA 3N0WA 4XR9A 1LS1A 3KKOA 3QLTA 3ZJUA 4C4ZA 4XCQA 3O2JA 2JJ2A 2OD2A 2QL7A 4NTZA 4CN9A 1O9BA 2IGBA 1OLUA 2Z6QA 1P3Y1 3QU7A 5DCWA 4D3SA 4JI0B 4BATA 5BYJA 4BGUA 4YAKA 3DV0A 1RI3A 4G81A 1D6MA 5KTSA 2AN4A 2DUNA 4J2OA 2KE5A 1FP2A 1Z9BA 1E9VA 1P4HA 1FRVA 1GU7A 3I5XA 4V3BA 3DBVO 3QZUA 2B20A 2VQ6A 3W90A 2FZLA 3KSBC 1QVVA 1ZRNA 1KP3A 1LJUA 3O31A 1SO8A 4I8IA 5EXPA 1OZAA 2BBSA 1XT6A 5KWVA 4OP3A 2QRLA 1D4AA 2JPDA 2VPTA 1SZCA 1JEQB 3PWZA 2ZTLA 1E2PA 2A0KA 4YJ2F 2YQ5A 4HBGA 5L45A 2UDPA 4QLAA 3Q5GA 3BWXA 1M8JA 3SWWA 3S5UA 4N6GA 4RKWA 1G4AE 1K8ZB 1QQ5A 3RRZA 1Z22A 2B8NA 4S24A 5CH3A 2EG5A 4GKAA 2I6XA 4CHTA 3ZGXA 1KEKA 1F4PA 1LVHA 1XFDA 5B55A 3IQWA 1L5ZA 1E6KA 1VFNA 3CW9A 5B64A 3H9CA 1V3UA 3CUWA 3AM4A 4DA4A 1JP7A 1CG6A 4W1RA 3SJUA 2MINA 4I3FA 1XZJA 3QVXA 2VXBA 3MUFA 4LRTB 4RKFA 3JQ9C 2IUSA 3EXAA 4ZD6A 5CVTA 7GPBA 4R8LA 2H00A 4D4JA 3EJ6A 3W3ZB 2HR1A 3IQXA 2NZXA 1WNFA 4HOYA 2JNWA 3V1UA 4EX6A 3WLEA 4FDUA 5HFAA 3TLCA 1U1FA 1HE4A 4G09A 4KSBA 5EKXA 4YAUA 3DAFA 3DCYA 2VZLA 3UH0A 1KQPA 3SJCA 2J3IA 5DT2A 2PT9A 2AA3A 3D4PA 1ULAA 3R3SA 3OF3A 3B52X 1Q15A 4EVRA 3KJIA 1WCWA 3A6JA 1QGUA 2OZVA 4GGMX 3TB4A 1M34E 3LGAA 4B80A 1IJBA 4L0QA 4QGFA 2H1LA 4KDEA 2V03A 2VN8A 3KKPA 4F1JA 1JVNA 2C88A 2IEBA 4B2YA 5CFOA 2IE0A 1RHUA 2REQB 4YX9A 1AUOA 3M8KA 4J1QA 4ND8B 4Z0TA 4F7WA 4CL2A 4RUKA 4LYFA 3VH3A 1QRSA 2C0CA 1O6GA 3PEUA 2EFHB 2Q21A 2NTYC 2P0EA 3HKBB 4OHRA 4V0MA 1E3TA 5GV7A 1DJLA 5DE3A 4NV1A 3OBIA 3WGIA 3KLOA 3OJEA 2AVDA 4JYZA 4MGHA 3PLNA 3C3YA 1DWPA 1IVSA 5C7LO 2O6LA 1C30B 2HMUA 2PAAA 4KQ2A 1REQA 3WGZA 3PF9A 4PQFA 3D0KA 1NKVA 4KXQA 3ZWOA 2IYVA 4LBWA 4DKJA 1WO8A 4MARA 4O4LB 4YP1A 2PKRA 1T9DA 4C2UA 3F47A 1JJAA 4HAXA 1C7IA 3WL4A 5HUQA 2VNSA 4LWPA 1SBCA 3AVVA 3E23A 3EQ6A 4QE3A 4U7GA 1DTWA 2VBIA 1N9GA 4JEUA 2PMKA 4K9LA 5EN4A 2HV8A 1NG9A 4FHDA 2HJSA 1H5UA 2UKDA 1YL6A 3ISVA 1C9EA 1ANKA 2P4SA 3ZHRA 4BRSA 1EIZA 7REQB 5K8IA 4RIIA 1OX4B 3STYA 4CV3A 1NQ5A 4BWYA 4Q48A 2A5DA 4G1UC 4DW8A 1FNMA 4MUYA 5D7BA 4QNRA 4R84A 4ZU6X 2RHHA 1V47A 3UPUA 3SS8A 2WKPA 2G5TA 2V74B 4HNVA 1AK9A 2OEPA 3NKFA 3RSOA 1C7JA 3KE8A 1K8XB 1ODKA 5KHAA 2QVCA 1ZLYA 2VHTA 4P3KA 4QYIB 5BSUA 4YV2A 4BGDA 3HQ4O 1A88A 2AX3A 3WMRA 4DCTA 1KAEA 1YNOA 1N32B 2UUOA 1Y7LA 4OJTA 4LNUB 1DHRA 3M2TA 2PEYA 4BN4A 1FSGA 4MGIR 2VDLB 5FJJA 4IJWA 3ZGVA 3PUZA 4F12A 5HIKA 4Y9SA 3VR6H 5HTKA 1OYOA 2QPOA 3DFMA 2G09A 1SVSA 3IAM6 3KCNA 4C2BA 4WBSA 2AMFA 2PZGA 3TJZA 5IHPA 2WYOA 2X8LA 4BY9E 3RHSA 3ZQ6A 2IYQA 2QDXA 3EIQA 1C9DB 1LX7A 3L0PA 4MCJA 2MSLA 3LQQA 4KWTA 1Z82A 1Y8QB 1VP3A 2AUNA 1PYGA 1I01A 4HZGA 2CZQA 3KUXA 5FOWA 2P11A 4R8MA 1G20E 4KR9A 3QELA 3TNDA 4ER3A 3TFQA 2WMOB 1AO3A 1UXOA 5JZOA 3LCJA 4DMUB 3AV3A 3V8PA 4DYVA 2CNOA 1BVUA 4NU6A 1K7SN 1OIWA 4CVNA 1Q57A 1NVBA 4RVGA 1LS6A 3K0BA 5CVEA 4I3GA 4DG9A 4EUHA 4BKUA 3N39C 3U4QA 1KE2A 1Y1LA 4J1SA 4EEZA 1R50A 2PU7A 1ZUHA 1Y4ZA 1JDNA 4YJ3A 3GGDA 5I4CA 2CJXA 1A69A 2PVSA 4DWOA 4JBIA 2LRHA 3FGNA 5DBOA 4KN6A 1RZRD 3C70A 4HB0A 3B2NA 3C8MA 5EKSA 1RWVA 3T1OA 5BN3A 1JJVA 2C9DA 1FP1D 3WB0A 1YC5A 4GDFA 1UM9B 2EYUA 4NFYA 1Z08A 3CSSA 3G1TA 4JBXA 4PC1A 1ZU5A 3HL0A 1UDAA 4YN3A 1F5NA 1XC7A 1IATA 2IPOA 4HDRB 1TQ2A 3PQ2A 4OK5A 2AE1A 1W5SA 2FR8A 3AFGA 4XARA 4BNJA 4G56A 1F8FA 3V8BA 1ESCA 2BCJQ 2OCXA 2ZYRA 4X6LA 2LCQA 3VR3D 3WK7A 1WU7A 4FMDB 4U2CA 5C31A 4LRSB 3LY5A 2QT1A 1V7QA 4EO4A 4RACA 5LVAA 2HUNA 4DQVA 4D56A 1IC6A 4UNPA 3TQTA 3ZU5A 2ATVA 3GJSA 1EK2A 1E1RD 1YB1A 3UJ3X 1BRMA 3ZHTA 4FE4A 2D1TA 4DQDA 1MO3A 2E5FA 1BXRA 4K87A 4PYNA 4UHEA 5CT9A 5EJ7A 2YKGA 3DD1A 3F6RA 2H2WA 1RBMA 5T64A 1S7CA 4I4NA 5J1SB 4MQMA 3R3WA 3SZOA 1JZSA 3OQ1A 2FFBA 5BMVB 1E5LA 3B9RA 1QH9A 5HM6A 5IN4A 4HMOA 2D5AA 3G0IA 4LDRA 1V1RB 1KAMA 5IBPA 2FLVA 1OD6A 3IQHX 4OBBA 4QA9A 3IDQA 1V6CA 1W87A 1GP2A 3TRKA 2E3JA 3DXYA 4E22A 5LYJB 1J0BA 4E3WA 2NPIA 3F7NA 2OM6A 3NBXX 1NOJA 3NYRA 5AFSA 3GJTA 4JLPA 1PFUA 4D43A 4BO9A 3QEKA 1SD2A 3ER6A 3I9MA 4HJRA 1YRLA 3ANTA 3I73A 2AYYA 1YF3A 5DYTA 1UAAA 3ZLTA 4FEAA 2F59A 1QH8A 1FYWA 3D7KA 4JH0A 2BDTA 3U61B 4ARBA 1IN8A 8ADHA 1MFPA 4UD2A 5HF9A 3GB9A 4UDOA 1TVEA 1JSXA 4PXSA 1JS1X 3OFND 4KMMA 5KTRA 3NHLA 3HA5A 1W1UA 3G89A 3GF4A 3K1YA 3LUDA 4OUDB 2QTVA 2YRFA 3F6BX 4EY8A 4UEWA 3EY4A 5COAA 2CJFA 1Y7TA 2Q8PA 4Z4GA 2DUUA 4DTCA 1M2NA 3LOQA 1E2LA 1HE1C 3DLAA 4CLXA 1IY9A 3S2GA 4PZAA 5FI0B 3QBEA 1Y3DE 3JWPA 4LSGA 5D5PA 3VU1A 3LX8A 2Z9DA 3O9MA 3RIGA 4W9MC 2BUBA 4GDMA 2HWYA 2PRZA 4E15A 4JC0A 5IHXA 2ZU6A 4I5FA 1ACJA 2Q3JA 3JWEA 4PO8A 1HYEA 1R2QA 2PH5A 1OAOC 2BI4A 2N47A 2X8JB 3G2PA 2RAUA 3GJ4A 3TINA 2EKZA 1HG1A 4C7VA 4ROSA 1ODCA 1FMCA 5LNK1 3E5NA 4J0EA 2M6RA 2W5UA 4X84A 5KNBA 1XVAA 3GT0A 1G7TA 3RSQA 5CEEA 5DASA 5DX0A 1K88A 1PR9A 4UBNA 1EUQA 4YBZA 3BJZA 2I22A 1H2EA 1WDMA 2K5UA 1XD9A 2C92A 4BO2A 3IV6A 1T1GA 4M0LA 3BMOB 3OQNA 5ICFA 1U0JA 2BEUB 3EXFA 1SXJE 4MKGA 3VR0A 1SUSA 2DBVO 5ADWA 3EB9A 2BTQB 5JNSA 2VT3A 3D2CA 4QBKA 3OIDA 3C4JA 3N2LA 3OJXA 1TRKA 5F7ZA 1VE6A 3BFXA 1XK6A 5A6SB 1X7XA 2I2BA 4FSDA 1SOMA 3LPCA 1CUVA 2XDQA 3KFLA 5TV2A 3S1AA 1K98A 3GRFA 4YYEA 2PL9A 5E95A 3NVDA 4IJQA 1CUSA 4PPYA 1VB5A 5KSYA 1N33B 4HNQA 4EELA 4UNNA 5I47A 3F4LA 1HE2A 4Y2XA 1GFWA 2ZG6A 1O9HA 3FNQA 3RBZA 4DA0A 5BV8A 5HSGA 4RULA 1IY0A 2C7VA 1RYZA 1ZW1A 3DMTC 3HWSA 3KZXA 4TOIA 3SCZA 1XMQB 5AJHA 1YQEA 1X77A 1RWXA 1HY3A 2EGGA 3IVXA 5DIZA 5G02A 3ZDQA 3KUUA 3HKCA 2JHCA 5HOQA 2YYSA 4FQ7A 1FFBA 1TF7A 5LM3A 1X15A 4MWEA 1L8AA 3WJ2A 1QDUA 1GGVA 2X0EA 3DAHA 3O84A 3RU3A 3E7PA 4TPKA 1YB4A 2C2BA 5HG0A 5K8UA 3DKPA 4L4SA 5JTTA 5CFQA 4GBGA 4WZZA 1BFKA 1YE3A 3GDGA 3LQYA 4B40A 5IK2D 1SVUA 2HU5A 4LJ4A 1T1EA 2QRGA 2V5UA 1VL1A 3QFSA 4WNYA 5IKOA 1H8ED 1ZEJA 2ZGVA 1A4IA 1M1YA 3U7EB 1UBJS 1H69A 1E7QA 1GT91 2OBFA 5F1YA 3ASYA 3U7GA 4B83A 4WX2B 2HRCA 3N58A 3IUJA 4JVLA 2XTAA 1JEAA 1YGPA 1DXOA 5LQAA 4MIOA 3X2FA 4PYIA 4CF4A 1W4LA 4F72A 1CZUA 1YFKA 1EESA 4FFPA 3STHA 4FYHA 1U1DA 3UAGA 3M33A 1M5RA 3L84A 1V37A 3O1HB 1F3OA 2FFJA 3NHJA 4CKCB 1RFLA 3E3OA 4URXR 3LLVA 1J99A 4X3CA