4AJIA

Rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 115
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajiA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajiA02
4MVJF 1EUCA 4BMNA 1XR3A 2I76A 3O8QB 3OJLA 5JNLA 1Y9EA 4TVBA 1RJWA 3DOJA 3VC7A 4QO8A 3RC2A 5A06A 1UUFA 4LK3A 2VT2A 3JYQA 2Q4EA 5A05A 1VL8A 1CWUA 4D0SA 3OF2A 2QRKA 4O1MA 1S7CA 1VL0A 2DM6A 3QY9A 2DTDA 3EW7A 1MXHA 1Y5RA 3O03A 1M6HA 2AEFA 4NPCA 3QJ5A 1FDUA 2AA3A 4YAEA 2B5VA 5C7LO 3L6EA 4U6SA 2EJWA 4RDIA 4ZQEA 1VKOA 1IY8A 1F17A 1B2LA 1HT0A 4FSHA 1MLDA 4L73A 2VNSA 4MP6A 5G4KA 2PA3A 3TL3A 3MJ4A 4OH1A 5G0SA 4WEQA 4BKPA 3ONEA 1JWAB 2O48X 1ZZEA 2RHCA 1G0NA 4Q3BA 4P8RA 1QV6A 3DZFA 5ER9A 3MCVA 4WLVA 4EJMA 1I36A 2P9EA 1CERA 1KVTA 3AOEA 3D5TA 1SZJG 3F47A 4IXTA 4BNIA 4EITA 1SOWA 2B4TO 2VTEA 1YONA 5TQVA 4YWJA 3K31A 1NWHA 4BNHA 4ALMA 5A5FA 1GEGA 3IMFA 3PHHA 3GUCA 4B3HA 5L4LA 5U9CA 4W9NA 3H5RA 1A71A 3WX0A 4D41A 4DLBA 2ZB4A 5JSFA 1PR3A 3ETGA 4NMHA 3E82A 1ZSVA 3U0BA 4RV9A 3DTTA 4UVEA 4IMRA 1KETA 4CQMB 1XELA 4WOKA 1ADBA 4B4UA 1Q0QA 5IDWA 2P9CA 4XX0A 4J7XA 4HFJA 3B6ZA 3FNFA 5TF4A 2OP0A 4GAEA 1R0KA 2GN9A 3UCFA 3VPGA 3FPLA 4RZHA 4IQGA 2Y93A 3BYZA 4TRRA 4M54A 1VJ1A 4OL9A 4HNGA 4IZIA 1F8GA 2QHXA 4DVJA 3PYLA 1PQUA 4ZQHA 2BFAA 1MA0A 3L9XA 1DRWA 5G0UA 3V2UA 4FFMA 4MOWA 2GNAA 5IJZA 1BGVA 1DIRA 2BFMA 3WQRA 4MJLA 1DEHA 1HDRA 1NHWA 1I3KA 2CD9A 5EPOA 3CEAA 5JPIA 3T4XA 1YB5A 3LC1O 1JKFA 1IPEA 3BZUA 1GTMA 4O59O 1NWCA 1Z7BA 3GDGA 4GSLA 3AM3A 2O3TA 2CF5A 5CDUA 4BO9A 1ORRA 3PHJA 2RBEA 5U1PA 2EKPA 2CY0A 4BMVA 1M75A 9LDBA 2C5AA 3OJ0A 4ZHSA 5ADHA 1LDYA 3NRCA 3PIDA 4R1TA 4XDYA 3Q0EA 4MVJI 3RC9A 5CDTA 3LC2O 5BQFA 1OC4A 3GQVA 5F21A 3KLPX 4RCVA 5A02A 3GDOA 2IRWA 3R3SA 2ZJ0A 3NT5A 4CQMA 2PGLA 3LF1A 4DC0A 3CSDA 4AJJA 4OOEA 1DDOA 1UH5A 4XDZA 5L4SA 1EFLA 3GHHA 1B7GO 1HL3A 1ZFNA 2Z1NA 4CM1A 3R0IA 4EI2A 2NLOA 4HBGA 3I5MA 1X15A 1T2DA 2C2XA 4RORA 1QYVA 4WOJA 3HFSA 3WSVA 5I7SA 5TX7A 3BTUA 4B79A 5L45A 5HA5A 1TT5B 5JS6A 5B12A 3Q9UA 2GGSA 4CLDA 2O23A 1D3AA 3HN7A 2VNAA 1E3JA 1P1RA 3G1TA 3OH8A 4JK3A 2ZQYA 5KKCA 3HG7A 6ADHA 3CKYA 1AXGA 4KUEA 2I3GA 4DIBA 2JCXA 4IINA 4WE3A 4J91A 1Q0LA 1QYCA 4JBHA 4DWVA 4RPGA 1D8AA 3DFZA 1BTOA 2JAHA 4Y6SA 4W7IA 1O89A 3OICA 3VH4A 3AY3A 2JL1A 3LK7A 1MC5A 4DLLA 2IODA 4A0SA 1EDZA 4U7WA 5F1OA 4DC1A 4U0JA 3JQEA 3K30A 1XHLA 3KUXA 2OORA 4WLOA 4XCVA 3W6ZA 3WDSA 3JQDA 1BDMA 2JD0A 1CYDA 4PLCA 3ZV6A 1N7GA 1AXEA 4IIVA 4PLWA 4BO4A 1R12A 5JDIC 3RU7A 4DGSA 1DXYA 4NU6A 1Y8QB 5L7YA 2Q1TA 5KJ6A 4Q3EA 1ZK1A 2VOJA 4YQZA 2P4HX 2XXJA 4P38A 4Q3DA 4I9HA 3JQ8B 1Q0HA 4LRSB 1BSVA 2OGUA 1X7HA 1TT5A 3ZU5A 3DZIA 2ET6A 2AG8A 3F6YA 3GZ4A 4J4BA 4RJTA 1M2WA 1HTBA 3T7EA 4XIJA 1YWGO 5JCJD 4FR5A 4F45A 1K2WA 4MVJM 3EGOA 3CE6A 2H63A 3VDQA 1LA2A 5JBIA 2DBRA 3CTMA 2QZ9A 2YV2A 4FS3A 3QA9A 1BXGB 1H2BA 1LDBA 4HKTA 3L4SO 4J1QA 3DBLB 4ZQFA 4PVDA 3ZGYA 4M87A 2V6GA 1AGNA 1HWYA 1H6BA 5FEUA 4A7PA 1I8TA 1ISJA 1PS8A 2AXQA 3ZZNA 4CM6A 4BNGA 1W6UA 3FNEA 2DTXA 2ZQZA 4PG6A 4EEZA 1KOLA 4E6PA 3I9NA 2X4GA 1CF2O 4ND2A 3KYCB 4LRTB 1KY4A 3V1TC 1P1IA 4IXWA 5JDIA 1O5IA 3JQBC 1I3LA 3EYWA 4I5FA 1PZFA 2AQ8A 5IFLA 1N7HA 3F4BA 5C5IA 2BKAA 2X0IA 5CG2A 1N92A 3I9LA 4P22A 4RPJA 1LQUA 4B7UA 1YE3A 1Q7CA 1Y8QA 1YBAA 5EMHA 1U4SA 2AEMA 2V7PA 1X7GA 1WPQA 4B3JA 4FIZA 3K5PA 3JQ8A 4YAIA 4EYEA 1I3NA 4PLFA 2ZYGA 4MIOA 4BUCA 3PJGA 3LU1A 2X6TA 5G4LA 1C14A 2O3SA 3JTMA 3SC4A 2I65A 2NQ8A 3K9QO 3AUTA 1HF3A 1E7RA 2XXBA 5JYDA 4PLHA 2BRUA 2BD0A 4Q9NA 1ISGA 3JD0A 3NV9A 3K92A 4EBFA 4FW8A 3A14A 4EGFA 2Q49A 3DBLA 3GPDG 1HSOA 1F0YA 5JC1A 3H7AA 5T67A 3SC6A 3OEYA 5A3JA 4BNZA 5AXCA 2GCGA 2NTJA 4NI5A 1R4NB 1N1EA 1WVGA 1XCBA 3KO8A 1JN0A 2JKVA 4O5OA 4XD2A 3JQBA 4XYGA 4CQLB 4R5HA 1P3DA 4MDHA 2DPHA 3GEDA 3NDRA 1ZEJA 3QIVA 3KYCA 1YOVB 4XA8A 3ZV5A 4GGOA 4WLFA 1ADGA 4S3MA 3PZBA 3STHA 4CM8B 2CNBA 1PZEA 1XQ1A 2E37A 2HMVA 2WDZA 1L7EA 5IDYA 3NX4A 3ST7A 5H82A 4J43A 2VZ9A 4XQ9A 2NU9A 4PVCA 2NVUB 1ONPA 3FR8A 3LT0A 3TFQA 4F6CA 2BGLA 4LVUA 1MX3A 2GYYA 2ZYDA 3HZZA 5BT9A 4C7JA 4IS3A 4GI2A 1GAEO 3G0OA 4NDNE 1CEQA 3ONFA 4NBUA 2Y0EA 4XGIA 3RIHA 3JQ6A 1QV7A 4XWYA 4AVYA 1E7YA 2AHRA 4BGIA 5KJ1A 1PGJA 3ZWBA 1BW9B 3ASVA 4GGPA 1HKUA 5AOVA 2E48A 4LISA 4BV9A 3GEGA 1UDAA 3DZGA 3KZVA 2B5WA 1WDLA 4Z6KA 1YXMA 3ONDA 1VRWA 3GHYA 1BRMA 3GMSA 4QXMA 1XLTA 1ZK0A 4BNWA 4JQCA 3C24A 1R4NA 3ULKA 4LVCA 1T1SA 1LX6A 3WFIA 1LUAA 3DOOA 4CQLA 5TLSA 4M89A 2PWZA 4BO5A 1YQGA 1YOVA 4XQEA 5A5EA 4HFMA 4ALKA 2X0RA 1B3RA 2IXBA 4W82A 5FFFA 4YQYA 1OOEA 1E1KA 4CM8A 1LLDA 3L9WA 3VKUA 1DO8A 3WGTA 1A9YA 1ZUD1 2HJRA 5TJHA 4BNUA 3WS7A 2E6UX 2J3JA 1AHHA 4RVGA 1T4BA 3MTJA 1GD1O 2NVUA 1EK6A 2NACA 3V2GA 1ULUA 1ZK3A 3TL2A 3IUSA 4GBJA 5BNIA 4J1SA 5CP8A 2TMDA 4PRLA 1RWBA 1J5PA 5EESA 3DZBA 1JQBA 4RQUA 1PJTA 2PH5A 3V8BA 3GA0A 3CZRA 1U28A 3UAGA 4KOAA 1U2DA 4QO7A 4R1SA 4ZU3A 1YQXA 1BW9A 3PP8A 4QFCA 5COBA 3WGZA 4ESOA 1P31A 5CEFA 4Y98A 2HUNA 2PZLA 4MO2A 3Q3CA 4OJNA 1XA0A 4NZ9A 3BMOB 2FR0A 3A1NA 2WE8A 1P77A 5A9TA 4W6ZA 3UOGA 5IDQA 3QW2A 2A9FA 3W4KA 1JVBA 3TQHA 4JIGA 1P1HA 3UCXA 1NPYA 2H6EA 5T57A 1ZVMA 4EJ6A 3AI1A 3HFGA 1HDZA 4BO6A 3I4FA 3IKTA 2W90A 4MIYA 3H9GA 1NM5A 4CR7A 3RUFA 1WDKA 5EL0A 3EVTA 2JAPA 1ZJYA 1HYGA 3EK2A 2GZ2A 3COSA 1NVGA 4FFPA 2X58A 4R3NA 3QWAA 4Z0HO 3A06A 3S55A 5I9MA 2Q2WA 3GH3A 3FSRA 3O9ZA 5EQDA 1AHIA 3WQQA 1UZNA 5CDGA 5JXWA 1H6AA 1QKIA 2O2SA 1TXGA 2C20A 1EZ4A 2VHVA 2VYVD 1ZSYA 2VUTA 1U4OA 2FRDA 4HY3A 2AW5A 3WGQA 3G49A 4KDEA 1H93A 1BHSA 4N7RA 1QRRA 4BNTA 4K28A 3I9MA 1GV1A 1UZLA 4Z3KA 2VWGA 4AJIA 4ZGWA 3WNVA 4DYDA 1LDGA 1SB9A 5L3ZA 2CFCA 1W8DA 4GX2A 1OBFO 1PTJA 4FGSA 4PLZA 4L0QA 4BO7A 3ADOA 2IDZA 4D42A 4RVUA 1D7OA 3JQAB 3WJ7A 2UUPA 3QQPA 1QYXA 1T2EA 2NU7A 3OA0A 3U49A 1ZJZA 3BMOA 3GMDA 3RROA 3DAFA 5DZSA 2D2IA 4BVAA 5EN4A 2AEJA 2WJPA 3AU8A 3TZCA 4KUGA 1A72A 2DKNA 4LSWA 1A4UA 2VHXA 2WD7B 4DREA 3OETA 4MPDA 2XPCA 4NBVA 2ZTMA 3NEPX 3U3XA 2RH4A 1PL8A 3ZW9A 4CODB 3DHNA 1CRWG 3VH3A 1MUUA 3BAZA 4YXFA 1DIBA 1ML3A 3SX2A 3KSUA 3ZU3A 2OBYA 3U4HA 3FHLA 2JCVA 4Y9DA 5ICMA 4IUYA 4XYMA 3KYDB 4JBIA 1D4FA 3S1LA 1I5RA 1EMDA 3H2ZA 3UKOA 4EUEA 2CZCA 4R41A 2Y66A 3LC7O 3SEFA 5KCZA 1DOHA 1I3MA 2BELA 4J90A 2GZ3A 3T4EA 3ZHXA 4NBTA 1XIVA 1Z6ZA 2YZ7A 3JD1A 4R9RA 4XYLA 1JW9B 1U5AA 3IC5A 3WWZA 5F5NA 5C7IO 1LI4A 3F3SA 4BNVA 3KVOA 4URFA 3EUWA 1EE9A 1O0SA 2HLPA 4IDEA 3A4VA 3HUDA 4WCFB 1PU2A 4TRNA 5CFZA 5HRUA 1Q1NA 3TFOA 3JQAA 4ALJA 1IULA 3NDIA 2YJZA 3ZHZA 1GU7A 2QQ5A 4PCVA 2FPPA 1L7DA 2AMFA 5B4UA 1E1MA 1XG5A 2IZ0A 2G5CA 2VHWA 4H3VA 4XGKA 1GPJA 2QYSA 4K26A 3D64A 5JAQA 1YQDA 2G17A 2O3RA 2HO5A 2WD7A 4MVJP 2CDBA 3UHAA 3MZ0A 3PIIA 1LQTA 3QV1A 1E5LA 3EC7A 3BXXA 4JGBA 3BHJA 1E92A 2EV9A 3OEWA 3WGYA 3BA1A 1FDVA 3K6JA 3UFXA 1VL6A 2VYNA 3ANNA 3S2FA 2QRLA 1EEHA 3U9LA 4EJ0A 1E3IA 2Y0DA 3ENNA 4N54A 4HFRA 4Y67A 1GUYA 2PFGA 4XR4A 3KYDA 2X1HA 3GVCA 3WLEA 2Q4BA 1UXJA 1E6UA 1VSVA 4A10A 1WP4A 1XWFA 1U3WA 2PNFA 3A9WA 4GSKA 4PIVA 3U4IA 3WGHA 5L95A 1ZMTA 2UVDA 4L76A 2ZTUA 2X9NA 3GVHA 3FN4A 4U6QA 4CMHA 1CQIA 4YT2A 1O6ZA 1LU9A 1YJQA 2NU8A 5DP1A 1Y6JA 4A73A 1NTOA 4RQTA 4ZRNA 3L6DA 3GDFA 4FBGA 4WCFA 4E5KA 3NTQA 4R69A 1P0FA 2WTBA 3E03A 2FPGA 2DQ4A 3GOHA 3AM4A 2C54A 3DONA 3X2EA 3P2OA 5B1YA 4WNCA 3VAZA 2FOIA 1HDOA 2PV7A 1LRJA 4U8GA 5ICSA 4BKQA 4MVJG 1V6AA 4L75A 2HMSA 3SJUA 3EDMA 1T2FA 4AJKA 3K96A 3IP1A 3LVFO 4QEDA 2JHFA 1FDWA 2EW2A 3GNQA 2ZYAA 3OIFA 4IGEA 3RBVA 4ZN6A 1QXSA 5CG1A 4MVJE 4O6VA 1VI2A 4O63O 3PZRA 2G0TA 3JQCA 4NFYA 3OBBA 1M66A 4OMUA 1YRLA 5A9RA 2QZZA 4KZPA 2PKQP 4EZBA 1E5QA 1HYEA 4YEDA 1U3TA 4D44A 1R15A 2D1YA 2C7VA 3N58A 5EERA 5JMWA 2GRAA 1NR7A 2NADA 1LSOA 2YV1A 4LCEA 1E6EA 5JO9A 1ZEMA 2A35A 2HMWA 4TWRA 4B8ZA 3HWRA 2CVOA 1ZBQA 5KVQA 4CV1A 5BSGA 1LNQA 2VHZA 1I10A 4W99A 2SCUA 2Q99A 4R54A 2RCYA 3GNSA 1D1SA 2BF7A 4I8XA 4OO3A 3FPCA 4WKGA 1U3VA 4J49A 3WGOA 4BKOA 1HE5A 3L6OO 4JLWA 2YQ4A 5K6AC 4J4TA 3TZHA 2EKQA 2HSDA 3BTVA 1JA9A 1GUFA 2OOSA 1SBYA 4WEOA 1SCUA 1B26A 2O3UA 4E5MA 1H0KA 3O8QA 4RDHA 3VPXA 2IE0A 3DAGA 4GWGA 3VOSA 4DIFA 1IUKA 4IBOA 3V5NA 2P91A 1P1JA 1GYQA 4XJSA 3UW3A 1SO8A 1T4DA 2XAAA 3PK0A 2WSBA 3UCEA 5I9NA 3M1LA 1KEVA 2D3TA 1AUPA 3H65A 4CV2A 2OP1A 2Y1GA 9LDTA 4AJ2A 3PJEA 3MOGA 5JE8A 2OZPA 2X86A 3HDHA 3CXRA 3PHLA 1C0LA 2E82A 1V8BA 3MJTA 4YRDA 2C0CA 5F1KA 5IAAA 2P68A 2X23A 4CLXA 5ILOA 2Z1MA 3EZLA 4CLHA 1D1TA 1OFGA 3GN2A 4OAQA 4WLUA 2FWMX 5CPBA 2ZATA 2IEBA 3V1UA 3WIEA 3G3EA 1ISFA 5I8ZA 1ZK2A 1GL3A 5A04A 3F1LA 1PL6A 1OAAA 3ZNPA 5K6AA 1GCOA 4E2YA 2G76A 1F12A 2IYPA 3VPFA 1UP4A 3P2YA 4IM7A 4DQVA 3HDJA 2PR2A 3RUHA 3VHRA 1Z7EA 4IS2A 1QYDA 1RM4A 3AUAA 3DFUA 4D45A 4RF2A 2YHIB 2EGHA 2O3JA 4L4XA 3MEQA 2X5KO 3QWHA 3WWYA 2UYYA 4OM8A 1PS9A 4WGGA 1UDBA 4FFNA 1I2ZA 4KTTE 5FYDA 2J5QA 2YDXA 1NFRA 4PZCA 1DIGA 4RVFA 4DPKA 4YAKA 3MOIA 1JAXA 4B4VA 5AYVA 5KVSA 4DXHA 4R1NA 4R3WA 4RVDA 2X0JA 3HQ4O 4IJUA 1EVJA 2EHDA 4TKLA 3PJDA 1G1AA 3PQDA 2WEKA 3PQEA 5BSHA 1VSUA 5TNXA 2JFFA 3IOYA 3ORFA 4D43A 1XEAA 3KBOA 3GNTA 1UAGA 3NT2A 4E2XA 1UR5A 4A26A 2UV8A 3DBRB 4CUJA 2OMEA 2Y05A 4YB8A 1A5ZA 1P1KA 4MINA 4FN4A 4XZ3A 3HDQA 4FB5A 1CIVA 1LSUA 5BNFA 1ONOA 1XDWA 1PX0A 1VJTA 3PTZA 3ZH2A 3U4CA 1X14A 1ZCJA 4KP7A 4E12A 2B83A 1PWXA 2VT3A 3FNGA 2Q45A 1VC2A 1ZMOA 1R4MB 4Q39A 1I32A 3OFSA 2YHIA 3EHEA 2O2YA 2IZZA 3F5SA 3L4BC 3MJSA 2O4UX 1IE3A 4YACA 1EE2A 1R6DA 4KDFA 4EDFA 1WWKA 1QLHA 4BKUA 1UDCA 3HN2A 1KIFA 4J0FA 4OXYA 4MP8A 2GF2A 1R66A 3QWFA 2DFDA 1LC3A 3QLJA 4E13A 1K6JA 5AXAA 1B14A 5BSFA 4R01A 3AI3A 3GC6A 2NU6A 2A4KA 2DC1A 3CINA 4IZHA 4BB6A 3ZN2A 4CMAA 3F1KA 1LRLA 4E31A 4K6FA 2PH3A 1C0PA 1NYTA 4CUZA 1R16A 4QT0A 4CM7A 1KVQA 1H5QA 2D5CA 5COAA 5H83A 2P5UA 3DBRA 3ZU4A 2EEZA 1T25A 3FBGA 5JCJA 5L7WA 2HKIA 4R4JA 3JSAA 2ZB7A 2YHUA 4P4NA 1VLLA 2EIHA 4PLPA 3ZWNA 2QRJA 5ILGA 4GPD1 2HJSA 4DPLA 2AE2A 3TWOA 4B4OA 4DIOA 4I9UA 1EQUA 3L4BA 2EW8A 5B4TA 2BGMA 4AL4A 1MP0A 1PGPA 3GLQA 3LT1A 4OXKA 3RJ5A 1R4MA 5TT0A 3EZYA 2J6IA 3LT4A 4RZIA 3S8MA 3SXPA 1CJCA 1VPDA 2J5RA 3C7CB 4FPXA 4HFNA 4Z3DA 3QSGA 4BQPA 5LDHA 2DUWA 2C2YA 1KYQA 4G81A 2I6TA 2HMUA 3P7MA 4UUPA 2HAEA 4DL9A 1MV8A 4ALNA 3PRJA 4D79A 4UVGA 3H2SA 1PJ3A 1GUZA 3UXYA 5DBFA 4ALLA 3INRA 3M2PA 4PGFA 5MGBA 2J3HA 2PGDA 4KMSA 3TZ6A 4XJTA 2NQTA 2VRCD 3QVWA 3W8DA 1Q7BA 3GPIA 3RBXA 4PLYA 1RM0A 4ITUA 3FF4A 2Q1UA 4OHUA 4J16A 2FZEA 4BNNA 1B8VA 3C1TA 2ZJ1A 1BXGA 3RWBA 5AXBA 1RYDA 4RGBA 3H5AA 4A5OA 2R2GA 3E9QA 3PXXA 4E5PA 2DTEA 2FZWA 4MKXA 3UGKA 4EUFA 3GAFA 1NXQA 3I1JA 3QVSA 1Y9AA 5U4QA 1B0AA 2NWQA 2DPGA 3BMQB 1YDEA 2YFQA 4FFRA 4I9NA 5T5QA 1V35A 3D7LA 2FY8A 4PG5A 5A3VA 2DVMA 4NK4A 2C07A 1MB4A 4I5DA 5FWNA 4UUNA 2WYUA 5GZ6A 3ZWYA 3SJ7A 3X2FA 4FQ8A 4YJDA 1V9LA 2D59A 2C29D 3CMMA 5LDGA 1BVUA 3ZWCA 2Q50A 3DB2A 5ENVA 4CUKA 2F00A 4XKJA 3SLGA 4AJPA 3ON5A 4Q3CA 1NP3A 4CLRB 4Y6PA 2A92A 5CEJA 4J2HA 2Y1CA 1ZSNA 4QUKA 1AE1A 1ENPA 3E5MA 4FFOA 4J2OA 3GVXA 5L9AA 4FC7A 2DBZA 4WECA 3GG9A 4GX0A 4J7CA 3RBZA 3A28A 3KSDO 2VOEA 1EVIA 5GZ1A 3GGOA 4E32A 4R9SA 4WCDA 3DQPA 4FJ1A 3QRWA 5F5LA 8LDHA 3H8VA 3HADA 4INAA 2RIRA 2VCYA 4W4TA 3D4NA 1KY5A 3NGXA 3FI9A 1GADO 1E7MA 5JO0A 1PJLA 1NQAO 4ZA2A 1LJ8A 3B70A 3TF5A 4BOYA 5FF9A 1LLUA 1DHTA 1RM5A 3H6KA 3JD3A 4E21A 1T2CA 1TEHA 3RC1A 3BMQA 5F3RA 1KC3A 2DLDA 1DBVO 3S2EA 2ZK7A 3PGXA 4C4OA 1HYHA 4MIEA 3S2GA 2ZB8A 3N74A 1GQQA 4D7AA 4PZEA 5EJ2A 5L7TA 3RKRA 4GKBA 5K0ZA 3LDHA 5DDIP 3RC7A 4CLEA 4IGFA 4G65A 1T1RA 2PLAA 4IJVA 1ARZA 2EKLA 3WB9A 2C7GA 2YW9A 2O4CA 2WM3A 4CLRA 1LSJA 4J7UA 3ROKA 4B8WA 4CMJA 5KJEA 3NDJA 4FOOA 3K8ZA 4I5GA 1NHGA 3U5TA 3SBOA 3F46A 3UN1A 4KWIA 4UEKA 5LC1A 1JU9A 3PYXA 4NU5A 3OIGA 1UP6A 2OFPA 5L53A 1P9LA 4RLSA 1E3WB 3TOZA 3WGGA 1FK8A 1C0KA 1FF9A 3JQ7B 1WDMA 2PKRA 1I0ZA 1UZMA 2OO5A 3PJFA 3E9MA 1O8CA 5JAZA 3H4VA 2Y68A 4MVJD 1Y8RB 1K89A 1E0DA 1DFGA 3H9UA 1RKXA 3KB6A 4BS9A 1UXHA 2AG5A 4HNHA 3OM9A 2OUIA 3JQ9C 5GZ3A 1DAOA 4AFNA 3LLSA 2Q3EA 3F5QA 3WSWA 2GO1A 1YB4A 3PWKA 4AJHA 5C7OO 1WAMA 3ZWMA 2IXAA 3WLFA 1V0JA 1DIHA 1GZ3A 4YRBA 4FGWA 2Q46A 4BO1A 1N8KA 4UUOA 4OSPA 2OBNA 3ZDFA 5CDSA 1DSSG 4TVOA 1MXFA 5DF1A 5HS4A 3GAZA 2Y1FA 3RQSA 1PJSA 1PWZA 1VJ0A 4XGNA 4CJXA 5JFOA 3F9IA 5T6BA 5C3MA 3JCZA 2FSSA 3FTPA 3IQDB 2BMAA 2PGJA 1C3VA 1ADCA 1ISIA 1JTVA 3T7CA 2P4QA 4K1LA 2POQX 4LW8A 1P1FA 5HWSA 3ANLA 3GGGA 2BFOA 1ULSA 3AOGA 2JFGA 1BG6A 4Y6RA 3MWDB 4IPTA 3E8XA 2C5EA 2I9PA 3UUWA 3BTSA 1B8PA 1E3WA 1PR9A 4BGEA 2J5KA 5G0WA 3EAGA 1VM6A 2OXIA 3VTZA 3JQ7A 3AUSA 4UREA 3WYBA 4AJLA 4J9VA 1E7SA 2PK3A 4L4RA 1M6WA 2LDXA 3ASUA 2PZKA 4EUHA 5G0VA 2VYVA 2B37A 1JDJA 4FJ2A 2DBVO 3LLVA 3GVPA 5DCWA 1Y8RA 4XRRA 1KBZA 1Q2XA 4BNJA 1KEWA 2DU8A 4YT5A 1X1TA 5A1TA 3KEQA 3ETEA 4UUMA 1EVZA 3G1UA 3KYBA 5DULA 3QVTA 3MTGA 1K3TA 4BNMA 1J0XO 5JAMA 1SC6A 1PJ2A 2BLLA 2WYVA 2ZKLA 2HRBA 1UXGA 2W2LD 1YBMA 4ILKA 5KOIA 2EP7A 2PD3A 1FXSA 3KETA 1QLJA 1PZHA 4GWKA 1OZAA 4JX8A 5TC4A 3OQ1A 4J3FA 5TRTA 3VPHA 2BHLA 1H2HA 4AJNA 1NASA 4WK6A 3C7DB 4BQRA 3E48A 3B1JA 4XQGA 4J9UE 2Y1EA 5CAEA 1WW8A 2FR1A 1E1NA 2GDZA 4QX6A 1JKJA 3PYMA 3LYLA 4CM5A 4YT4A 1IPFA 2PZMA 3PDJA 3D5QA 3ZI0A 4GVLA 3AU9A 5I8WA 2B4RO 4IDAA 3WNQA 2UUOA 3GEMA 4PLTA 2CMDA 4UVIA 3ZV4A 3L07A 5I7FA 4CMBA 5IN4A 1X13A 3OIDA 3P5SA 3NYWA 4E0BA 3GG2A 3VKVA 1HE2A 1I24A 3RD5A 3WBBA 3ITKA 5MDHA 1K6XA 3BMNB 4YJHB 4BO3A 3JQAD 4GQAA 1E3EA 1NFFA 3EY4A 4NJMB 4PFJA 3VZRA 2GLXA 4OQYA 1TVEA 3GT0A 3VVCA 4XRGA 3CZMA 1AN9A 1NAIA 4CMKA 5EINA 3TNLA 2OHXA 1XU7A 3U62A 2CF6A 3D0OA 1A9ZA 3LSYA 5DOVA 1ONNA 3OP4A 5IF3A 3NT4A 1ID1A 4DPMA 3C8MA 3GK3A 3WQSB 4KUHA 1SMKA 3QVOA 4BHTA 3ZWAA 5T8KC 3D4PA 3HSKA 1ZO8A 1NX6A 4DBVO 2PY6A 4IJKA 4F46A 3H9QA 4NR0A 5EQFA 2W4QA 2ZCVA 4OYRA 1UAYA 2NM0A 4U5QA 1H6CA 2D0IA 3O38A 3OA2A 2AE1A 4LGVA 4Y8VA 3WOHA 4G5HA 4FDAA 4XYEA 1PQPA 1CETA 2X8LA 2X5OA 2FPIA 4Z0TA 2WE7A 3RUIA 1DFHA 5GMOA 5IG2A 3B20A 1R0SA 2RAFA 5KIAA 4DBZA 2D8AA 3ETDA 1YB1A 4GKVA 1LLQA 1Y1PA 2J3IA 4JJIA 2EG9A 3KTDA 1MGOA 5TT1A 2D5AA 4UULA 4GX1A 5JC8A 1NVMB 4CM9D 1HETA 5THKA 2TMGA 3DO5A 3DDNA 1T2AA 4R16A 2NTNA 3BMNA 3I6QA 3TN7A 4YJHA 3EMKA 4ND4A 2X5JO 4NJMA 3M1AA 5CEEA 5HBRA 4UEJA 1TI7A 4AJOA 1GQ2A 3BIOA 3RI3A 4IDGA 1G0OA 3KLMX 4CV3A 4BNYA 3OHSX 2P2SA 3KM0A 4BNXA 5T8KA 3AOEC 5IZ4A 3U09A 3KHUA 5BSEA 2FHSA 4OXNA 1PSDA 3PHGA 1LDMA 2Y67A 1DRUA 4GX5A 4GMGA 4TMFA 4NHEA 4W9NC 4ZQBA 1HE4A 3ZW8A 3FWNA 3R3JA 5AVOA 3OJFA 1KC1A 3AFNA 3OJEA 4LMRA 4N5NA 2B35A 4TRMA 1I2BA 3JQFC 3FNHA 3ZHYA 2Y99A 3Q1LA 4JN6B 3ZWWA 3QP9A 1F8FA 2Q2VA 1GV0A 3KOUA 4RF4A 2O7SA 4W7HA 3TOXA 2EERA 1B15A 2VZ8A 4CV0A 1GY8A 1EBUA 2V6MA 4JBGA 3W4IA 5IXYA 3K73O 1DJQA 4XQCA 3TZQA 4P4LA 2V6BA 4ZVVA 3INTA 4DQUA 1K5HA 1I01A 2RHRA 3C1AA 3G17A 3RSHA 4EW6A 1QMGA 1HEUA 3E9NA 3VTFA 2QW8A 2J3KA 1H9AA 1XU9A 1U7TA 1QYWA 8ADHA 1F06A 2GPTA 4D3DA 3GGPA 2VN8A 4I5EA 3GZNB 1QR6A 3GUYA 3NJ8A 4OSOA 4GL4A 2CVZA 3OECA 4Q3NA 2YYYA 1C0IA 2WD8A 5A9SB 5DNAA 3OMLA 3ZNOA 3VPSA 2DFVA 3W1VA 3JV7A 3ROQA 3VZPA 4D46A 4E4YA 3JQGB 3RKUA 1L1FA 4HV4A 2PZJA 4K9DA 3DBHB 1U2GA 2QG4A 3WBFA 5ENDA 1YDWA 2Q1SA 4ND5A 3IDSA 2NVWA 3AWDA 4IMPA 2V6FA 2Y0CA 4RPKA 4HUJA 5KNLA 4ID9A 4IQ0A 3DMYA 2PKQO 3JQFA 3S2IA 1P74A 3NGLA 4WLEA 3I23A 2VWQA 2Y1DA 5G0TA 4AJ1A 1U9JA 3I52A 3OQ6A 1MC4A 2B0JA 1DC3A 2YUTA 4S1VA 3RCBA 4R5MA 2HQ1A 2DAPA 2GR9A 4C7KA 1PGQA 5JMPA 5TGDA 1X7DA 2E4AA 5A4DA 1YKFA 3Q11A 2HMTA 1LSSA 5T64A 1UXKA 3GF4A 2X9VA 1FDTA 1GCUA 1A4IA 3I83A 4YJFB 3PQFA 3C1OA 1WLYA 3Q6IA 1H94A 4RVHA 1O94A 2EXXA 1BVRA 3E6AA 3VZQA 4NFHA 4E2ZA 1CDOA 3W4JA 4CM4B 3RFTA 2HU2A 1GDHA 1U1IA 1PQWA 2EF1A 2YFHA 3WMWA 1T26A 1KEPA 3I9OA 1YH3A 3FBTA 1G6KA 3JYNA 3WTBA 1EUZA 3E18A 3IKVA 2ZB3A 5JY6A 4CQMD 1CQJA 2W2KB 3GZNA 3HDYA 3OJOA 5L40A 2NV6A 3H3JA 1JKIA 1HZZA 2Y1OA 5GY7A 1UJMA 3HB4X 3DZHA 4M86A 3GR6A 5A9SA 2IYOA 1RM3A 3JQGA 2VQ3A 1WNTA 4J0EA 4MKZA 4X54A 5CPFA 4B7XA 5DP2A 3DBHA 1NPTO 3C7AA 3AK4A 3O4RA 4CM3A 1YL7A 4Z0PA 3RJ9A 4NIMA 1J6UA 1PZGA 1ZIDA 3IJPA 3KXDA 4Z9YA 1H9BA 3WJAA 1QORA 4IDBA 1SOVA 4KWHA 1PEDA 3CH6A 3HNPA 4NJOA 1IHYA 4BGUA 2B4QA 3U4DA 3V2HA 1JVSA 4YRAA 4PG7A 3DZKA 1IHXA 1YS4A 2WWRA 3Q2IA 2CVQA 4YJFA 1I30A 3QWBA 2DUUA 4XB2A 4FC6A 2JJYA 4IIUA 4YCAA 2GERA 4BKRA 4DTIA 4YYZA 1A7KA 1IOLA 4RPHA 4BO0A 3BMCB 3H9JA 2IEDA 2JFHA 1E7QA 2WMDA 1EDOA 4CM4A 3IJRA 4JCOA 1XQ6A 4E5YA 5I7EA 1SPXA 1A27A 3JD4A 1TA4A 4YBZA 2H5LA 3SLKA 1LBEA 1NFQA 1ZKMA 2BGKA 4YT8A 2JCYA 3QHAA 5B4VA 2GN8A 1B8UA 2W2KA 3D4OA 5JYEA 1HLDA 3UH1A 2NTVA 5DBIA 1LDEA 5DOZA 2VWPA 5KVCA 4M8SA 1PL7A 4E3ZA 4BNFA 4IY1A 1WXDA 3BHMA 4H7PA 4JJGA 4RVSA 3ZWVA 1E77A 4ND3A 1E1LA 3OSUA 4LCJA 4YR9A 5KTKA 4D3SA 7MDHA 1A7AA 3ADPA 3FD8A 2QYTA 3KV3O 3WICA 2J8ZA 3KEOA 1DC4A 4L4SA 2PD4A 4PRKA 2AQIA 4ZD6A 3TJRA 3RASA 5JDCC 3NUGA 4XR9A 1EK5A 4KQWA 4BO8A 2GD1O 4DLAA 2C59A 2QIOA 2ZCUA 4JNKA 2YY7A 2W8ZA 1PJ4A 3W8EA 3WMXA 2E49A 1C1DB 1DLJA 2HK7A 5KKAA 4JXKA 1EUDA 1OMOA 1XGKA 2P9GA 5TJ9A 2BH9A 3RU9A 4HXYA 4AJEA 1GYPA 2YDYA 3DHEA 1F14A 4CPDA 1N9GB 3BMCA 4R51A 4O0LA 1VE9A 3GRKA 4TROA 4I1IA 1U8XX 1ZXLA 2BFPA 1EQ2A 3IUPA 3FCOA 2VTDA 1HDXA 3M6IA 2GUGA 4A03A 1W0CA 2EJVA 1ZK4A 1M67A 2XOXA 1Y5MA 2X7HA 5CHEA 4RF5A 1IL0A 2O7QA 4E2WA 3DC2A 4HADA 4XB1A 4TQGA 5JCXA 4BGVA 5FI3A 3RUDA 1P0CA 3I3OA 4I08A 3NJ4A 3B1FA 3AI2A 3R6DA 1HE3A 3IL2A 4NBWA 3GN1A 4H16A 3K2EA 4U0KA 3WR5A 7ADHA 4ONEA 3JYLA 1FDSA 4PG4A 5JDCA 1NVTA 2V65A 4ZICA 4CMEC 1FJHA 5H81A 4FCCA 1T24A 1E7WA 2CUKA 4LSMA 1JLLA 3ZWPA 2FR8A 4QFDA 3AJRA 3I9JA 4YAGA 3PHIA 3UF0A 4ZJUA 1IYZA 4D0RA 2VUUA 1C1DA 1X0XA 5ES3A 3DTYA 4N5LA 4E33A 3D3EA 4R1UA 5C37A 4DQXA 5ER6A 4FD3A 4PG8A 2FMUA 4B3IA 4WUVA 1DLIA 4GLOA 3RUAA 1DFIA 1N9GA 1V3VA 2GASA 2VRCA 4RLHA 1PGNA 1YBVA 3C85A 4ZRMA 4WJZA 4B7CA 1JAYA 2CSUA 3B1KA 4HWKA 5KJFA 3AFMA 1TLTA 2GSDA 4NQZA 3ZNQA 3PFFA 3PWZA 2VUSA 3UVEA 1NQTA 1R0LA 3CPSA 1Z45A 3D1LA 3VH2A 1PJBA 1HXHA 3WYEA 5FI5A 1ISHA 3HE3A 4J1TA 4KQXA 4UVHA 3QWIA 3PWSA 3IS3A 1YO6A 3FR7A 4GLLA 3NTOA 5IXSA 4CMEA 3AW9A 4IJWA 1MG5A 1P33A 2WYWA 4CR8A 3ICPA 3DAPA 3CMCO 3CUKA 4IDDA 3LZ6A 1DIAA 4IDFA 4NBRA 5IZCC 1DB3A 2XF8A 1I2CA 1Y81A 3ZNNA 1EVYA 5KJCA 2JD2A 4MP3A 1BXZA 3HB5X 4F6LA 2VWHA 3PLRA 3ROMA 1XSEA 3JYOA 5G2OA 1P45A 4OOFA 1X0VA 3Q9NA 1ADFA 4PLGA 3TPCA 2OL4A 4ALIA 4DUPA 1N5DA 3PI7A 3ITDA 1ZNQO 4H15A 2Q2QA 3VDRA 3R1IA 3RAJA 3L77A 4DMLA 5KVVA 4D3FA 4EEXA 1PJCA 5ITWA 4ND1A 1ISMA 1B3BA 4OKNA 3UICA 1QG6A 3RUEA 3WYCA 2EP5A 4JROA 2ZTVA 3NAQA 4M49A 4DYVA 1Q7GA 1P44A 1YL6A 2W98A 4XYBA 5THQA 1BWSA 1X1EA 1K0UA 2H9IA 1S6YA 1SEVA 1DAPA 3F4LA 1WMAA 4TKMA 3K2BA 4MKRA 3G79A 3DHYA 3WIDA 3IIEA 3I9KA 1OI7A 4L8VA 4JP2A 4YJGB 3RFXA 3ZWOA 2FP4A 1ENZA 3IP3A 5IDXA 1MFPA 2O50A 3PPIA 2HCTA 2AQKA 1GPDG 2Q1WA 3LF2A 3DBVO 1BMDA 3QE3A 4M1QA 4YAJA 4TZKA 4CL3A 1MFZA 5HS6A 2EWMA 1LTHR 2HDHA 1GEEA 1KVSA 2HK9A 5F1PA 4AJ4A 5IZCA 1ZXBA 2ZIZA 1HDYA 2YV3A 4UEOA 1W73A 1HZJA 2NUAA 2R6JA 4MVJH 4GMFA 3GVIA 4BIIA 3WG9A 3FWZA 1K6IA 3N7UA 3OQBA 3BHIA 4GVXA 1SB8A 5KWEA 1SNYA 1YJ8A 1SAYA 2R00C 1BXKA 1W4ZA 1JWBB 4CMIB 4NH4A 3ICCA 1PJQA 3DL2A 1ENOA 3E1KA 1LXCA 3JYPA 5HTOA 3JD2A 1N2SA 2H1SA 1GZ4A 3MJCA 4AICA 4B4WA 1PS0A 1EBFA 4YDRA 4CMCA 5DCUA 2EGGA 3M2TA 4YTEA 2HRZA 1IB6A 4NFSA 4YJGA 3FTNA 3GRPA 1IZ0A 3H9EO 3DWFA 4PN3A 1LLCA 3BTOA 1DPGA 1WZEA 4YVFA 5BR7A 5L51A 3KRTA 1U7HA 3VH1A 3ZCXA 3PLNA 4MVJA 3AM5A 3VVBA 5AQ1A 3DEYX 2ZTLA 3NKLA 4BNKA 3H3FA 5J23A 1M76A 2DBQA 1Z73A 3MJVA 4ROSA 4P4GA 1LEHA 4IQ8A 1V3TA 4QECA 2GN4A 1U8FO 1DHRA 1Y7TA 5AXDA 4OQZA 3PFWO 5JY1A 5EIOA 1J4AA 3IAHA 3SVTA 3GFBA 2GZ1A 3RUCA 1E3SA 1Z75A 1GZ6A 4WLNA 2FN7A 1LC0A 2G1UA 2R00A 4J1NA 1U3UA 1R37A 2NNLD 3V1YA 4RPLA 4BNLA 1GQYA 3MJEA 4BL5A 1Z74A 4DMMA 2IZ1A 2LDBA 3H5NA 4CMIA 5JW6A 1FMCA 4QSMA 1ZW1A 2HK8A 3W6UA 2NVBA 4KTVE 4M55A 3JQ9A 3NTRA 3TDKA 2B69A 3HHPA 2P5YA 4RL6A 3PDUA 3PEFA 4L9RA 1YL5A 1DC6A 5JLAA 1SEPA 1XYGA 4YPOA 4CL8A 3HJAA 3GY0A 4CLOB 5I9LA 1HDCA 5I7VA 2GN6A 1I33A 1RPNA 1UP7A 3LT2A 4XEHA 4CR6A 1EFKA 2O3QA 3AY6A 3D3WB 1RYEA 5COQA 4AG3A 4WNIA 4JJFA 5JAIA 1YVEI 4UAGA 3ZHBA 4A2CA 2ILTA 4BV8A 1NQOA 2UAGA 4ZQGA 4II2A 5BNTA 4HP8A 1E3LA 1KEUA 1MG0A 1DJNA 4XIYA 1KERA 3EVNA 2VZ0A 1TT7A 1QSGA 5LCXA 3O26A 4Z9XA 3WGIA 3FRJA 4QQRA 3ANMA 2A94A 4NNJA 5DN9A 1C1XB 1YGYA 4F3YA 4UVDA 2CDAA 2W2LA 4GH5A 1KVUA 5A03A 1NNUA 4HX5A 5DBGA 2JHGA 4R68A 5IN5A 2QX7A 4II3A 3CIFA 4FFLA 3Q2KA 2Z5LA 4PLVA 4L74A 2AQHA 1J49A 5TSDA 1HDGO 5ITVA 4J6FA 3WFJA 2BI7A 2Z95A 1TB4A 3DXFA 3AUUA 5B37A 2NSDA 1GYRA 3I4CA 1GFSA 2BI8A 4FJ0A 2I5PO 3C3XA 4A27A 3ZU2A 4TRJA 1H6DA 2PTGA 4CMGA 1V3UA 3DMTC 4TSKA 1NPDA 1VKNA 2G82A 3ROPA 4Q3AA 1WMBA 1QP8A 3L0DA 2PD6A 2YQ5A 4LN1A 4CLOA 4BO2A 1U5CA 2UDPA 4N5MA 3INGA 1PIWA 1KVRA 3D3WA 3PVZA 5TS3A 1IZ9A 3PGJA 5DCYA 4WCFC 2VYND 3ENKA 1NBOA 3E5RA 2I99A 2CDCA 4LMPA 4NG5A 4FOSA 2B36A 1DRVA 3DZJA 3W8FA 3TZKA 5L4NA 1NR1A 3GFGA 1C1XA 1Z82A 4OIMA 1GR0A 4G2NA 3I6IA 5HM8A 2C82A 4RF3A 4WPGA 3RVDA 3ABIA 4OKIA 1HRDA 3DOCA 1B16A 1ENYA 4E5NA 2D4AA 2VHYA 3ZV3A 4YA6A 4JP3A 1PGOA 3WXBA 2I66A 1N1GA 1UXIA 4NK5A 1O9BA 5DT9A 5CDYA 4QTZA 4K6CA 1O95A 5G4KB 3DMTA 1DC5A 3ZWXA 4BMSA 3LQFA 4BB5A 1ZH8A 4PZDA 2X9GA 6LDHA 1LRKA 3AY7A 1NAHA 1OC2A 3WTCA 4E30A 2I3AA 1HSZA 1WZIA 2I67A 4RO0A 1LDNA 3KSZO 3TRIA 2DT5A 4TZTA 1BDBA 3TSCA 3MWEB 1E6WA 2FSVA 3DR3A 2VRBA 4IDCA 4OGWA 2X0NA 3P19A 2JD1A 3VZSA 4DA9A 5K9ZA 4CM9A 4DRYA 2F1KA 3RFVA 1NQ5A 4WASA 4N18A 5TIIA 1HLPA 1KS9A 3QVXA 4J4HA 1XKQA 2X22A 2RH8A 4Z9FA
chains in the Genus database with same CATH superfamily
1XTSA 2JAQA 3IBYA 2JFXA 4ZT6A 3OCVA 3O8QB 3MWKA 3I32A 3QUTA 1RJWA 3BQ9A 5FB3A 3VC7A 2OMKA 1MOPA 3BXPA 3LUKA 3TIFA 3WBJA 4ZK6A 1RZRA 2AFIE 1NLZA 2YWJA 3T9AA 3LLUA 5KS2A 5CTJA 2Q4EA 4BVJA 5JROA 1C9EA 5KNBA 1RCFA 3AUXA 5ALRA 5BSMA 4D74A 1VL0A 4EG3A 3CF0A 3GLGA 2DTDA 1XQYA 2WPNA 3EW7A 2HREA 2OAP1 3O03A 2GCOA 1Z0UA 5CBKA 1FDUA 2AA3A 3HWWA 4YAEA 3IEPA 5F98A 5C7LO 4RSMA 3U7GA 2G08A 3S29A 1IXYA 2RSLA 4H17A 1VKOA 1HT0A 2AEEA 3ET4A 4ZODA 3QHQA 2WPDD 2VNSA 2BV3A 2IUFA 5FH9A 5G0SA 5FOVA 1FTSA 4WEQA 3DD5A 3O92A 3SXJA 4BKPA 5AESA 3WL3A 1MGPA 3AJ8A 3EDYA 4BFLA 3KTOA 4Q3BA 4DDTA 3DZFA 5DWQA 1SUAA 3MCVA 3KBBA 4ICIA 2XCUA 2M6LA 3V7NA 5IYZB 1DUIA 3F47A 4BNIA 4I50A 4UM7A 3BJMA 2VTEA 1YBHA 4TN5A 1YONA 1BX1A 1QAOA 4ZREA 1GDTA 2ROQA 4BQEA 1IN4A 4GG1A 2UXDB 1USIA 5A5FA 3GCDA 3PHHA 1IOVA 5D86A 2PDAA 4JLSA 4X0EA 3HVJA 5EA2A 3O7WA 3A4MA 1HE1C 5GV7A 3WIBA 2ZB4A 4X1OA 3GUZA 4D41A 4DLBA 3MJHA 2WU1A 1GPLA 3E82A 2P1DA 4NMHA 4R2WA 5E1MA 4OAPA 2KBFA 2XUGA 4HDMB 4DARA 4EGAA 2MHCA 3TDNA 5D1HA 3HXPA 3JX9A 4JKOA 5E3JA 4B4UA 3QENA 5CXQA 2P9CA 4Z4HA 4WD3A 2QLNA 4H0NA 1A9PA 4HFJA 1KKUA 2AHOA 3P4XA 1AS0A 3FNFA 4NAHA 4P31A 2PIDA 2WDPA 4TUYA 5AKZA 4GAEA 2PUAA 1PI3A 4U7PB 1F2VA 2I6UA 1EHCA 3EFEA 3PGVA 3U1BA 2BKEA 2PZ8A 5BUCA 2Y93A 3K09C 2PSEA 4DBLC 2R6R1 3BE5A 4HNGA 5E38A 1TF5A 5E6UA 1UJCA 1AZTA 4WMLA 3PYLA 3WWOA 3JZIA 3OPNA 2AN9A 1KMIY 3MXTA 2COKA 2I1LA 2P8SA 2RIPA 5IJZA 2AC2A 1DIRA 2X2EA 4S0ZA 4MJLA 1TPYA 1OFTA 2CZGA 1NHWA 4R81A 3THSA 3WLAA 2EGUA 1JECA 1N3LA 3QVUA 1AN0A 1YA8A 3OLVA 5EPOA 5BWCA 1YB5A 5CNMA 2HT6A 2A5DA 3I2HA 3LC1O 2V45A 2ZS8A 3D2CA 4L5YA 5FCDA 2WHQA 4IO1A 2OWEA 4FONA 1FUKA 3VOTA 2TMYA 5I4IA 4O59O 1JT9A 3GDGA 4XAQA 3V8QA 5J1SB 2O3TA 4C05A 1ZHHA 3JRWA 3VJKA 2RBEA 3IBTA 4URZR 4Y9TA 1DAFA 5I4BA 2ZANA 2FLWA 5EWLA 2G4VA 4P0PB 2C5AA 1N0HA 3I39X 1YF3A 2I1WA 5ADHA 2V3VA 3EVAA 1GFWA 1I6LA 2PU5A 1AKYA 1GR1A 4N49A 4B9EA 1A8UA 3KZCA 2BL4A 2JDID 3DZ8A 5CU7A 3RC9A 4IWNA 5BQFA 2ERXA 3GQVA 4HH0A 3KLPX 3BH0A 2GETA 5J5AA 3LBIA 2WYHA 3OQJA 2ZJ0A 3OCCA 5DWDA 2PGLA 2VP5A 4DC0A 3CSDA 1WEKA 3I01A 4OOEA 4ARSA 5L4SA 2B8EA 3ZCSA 3URMA 4IVNA 1ODCA 2IQIA 4PRZA 3K09A 3DKIA 4I1YA 1ZFNA 2NZJA 3O83A 2QMOA 3R0IA 2NLOA 3GD7A 3I5MA 4AKTA 4ZIRA 1RRCA 5CT8A 4C4AA 2W6QA 3WLPA 2D7CA 4ED9A 1KZ4A 1PJ8A 2B8JA 3CRZA 3PKIA 4I7EA 3ZBUA 5AT1A 1QP4A 4PC3A 3HLYA 3SYRA 3UGJA 5B12A 5BVHB 1AVTA 1DBRA 4M3NA 5D6OA 4RJIA 4CLDA 4I3HA 3RRJA 5JNUA 1QFYA 2GKOA 3PNLA 3G1TA 3RYCA 2RBGA 4UM5A 3TGPA 1FXWA 1QHEA 1XAIA 2ZQYA 2YJ3A 4MPJA 4QICA 3ETJA 3TECE 3M7IA 2QPLA 5AVUA 3KZKA 1Z2DA 4HEA6 4D8UA 3MD0A 1HTWA 3JWJA 1XFDA 4PTLA 1QYCA 3MCUA 3L93A 3UAYA 5CRIA 4DWVA 3VYRB 2FAXA 2RGYA 6NULA 3AVUA 4NXMB 2V58A 4XPIB 1VYHA 5K8JB 2NSHA 4KX5A 4Q1EA 1KO5A 3QEJA 4V0LA 5DRYA 3VH4A 2YN0A 3AY3A 3MTIA 3GJQA 5ALQA 1P2FA 2DERA 1SVKA 2P6MA 4HB4A 4ZCQA 4ES6A 4MICA 2IZOA 1E1RD 1RZ3A 2F3TA 4KVGA 3KG2A 2AGVA 2OYRA 1K5PA 4MHOA 3JQEA 1U98A 5LLTA 1MD9A 2ZIVB 1U5BB 2CKDA 2PGIA 2VR1A 1V45E 3QPCA 5H02A 1WXQA 2O6LA 2RJNA 3G59A 1D07A 3OZFA 3W6ZA 4CQNA 4ABYA 2Q7OE 1N7GA 5B30A 4P0QB 4MZXA 1R12A 3KZXA 1KTVA 1QH1A 1IXRC 1TK9A 2XYQA 3PU6A 4NU6A 5DBHX 3RLIA 1NI4B 3A6LA 3RU7A 2LZ0A 1OXVA 3D3JA 2VDNB 1G9TA 4Q3EA 1ZK1A 5BW8A 1R10A 3ZS9A 4EKGA 4YQZA 5KQMA 1U0BB 3RV4A 3UAWA 4AO7A 3B2QA 3BWVA 3JQ8B 4JOSA 3ADCA 2E55A 2WLTA 2F1IA 1BSVA 2GXQA 1MAAA 3MINA 3DNFA 4OATA 1TU3A 3QOWA 4L07A 2OPHA 1GSAA 1RQXA 2GJAA 1HTBA 4HRVA 3T7EA 4DR5B 4DCTA 4DEXA 4FR5A 2I2XB 4F45A 4MVJM 1ICIA 3CE6A 3EGOA 2H63A 2YW2A 3R5FA 3L8GA 1OYWA 2F9FA 4RBNA 3DLIA 3CN9A 1AB5A 5JBIA 2DBRA 1XV5A 2YV2A 4HDOB 5AW4A 2RGAA 3JARB 4YH1A 4XLZA 4MKIA 1FYEA 1N33B 1GCGA 1J8MF 2AFVA 4J16C 4PVDA 3QU7A 3TZEA 2V6GA 3VU9B 1HWYA 2ZJYA 4KYTA 3T35A 2BFEA 4EX6A 4OGLA 4I50F 4A7PA 1T9ZA 1ZGZA 3ZZNA 4BDTA 4CM6A 4EG7A 4HJRA 3HB0A 4BNGA 1W6UA 2AYXA 5LIRA 1QCCA 1RXEA 3FNEA 4MWEA 1ZM3A 4EEZA 5AJZA 5IPFA 1Q92A 1RQNA 1KOLA 4BBJA 1JEYA 1DUVG 3CUVA 4FYJA 4W1QA 3HKCA 4YCBA 2AJCA 1OAOC 3KYCB 2FMKA 3M81A 1KY4A 1RHMA 4RK4A 5I7AA 3J81k 1JQAA 3P45A 4AT1A 5EIXA 1KJIA 3JQBC 1VLJA 1S3SA 5C5IA 1F3LA 5IFLA 3IT0A 4C22A 5K0FA 4IMIB 3NWOA 1U81A 2IW1A 3I9LA 1TTPB 1XUOA 2ASEA 3LFUA 1WZCA 1X80A 3TOSA 3RC8A 1YE3A 1Q7CA 4HNSA 3DV9A 4JODA 1N5IA 1ZGAA 2BTQB 1W85A 2JKZA 2FUEA 2Z3WA 3DVSX 3N2LA 3QPWA 4TUYF 3PC3A 1JEQB 4PGGA 2V7PA 1RE0A 3K5PA 5DM0A 4BAUA 3EDCA 5IS2A 1I3NA 1UOQA 1T8PA 2D5BA 3D7MA 3ERCA 1Z83A 4UMEA 1NMYA 3HXOA 3T3GA 1H69A 4B0PA 4BUCA 3PJGA 3UY4A 2BFFA 4MAFA 4DLVA 3LXMA 3BWYA 4A0HA 4BQFA 1K9SA 2QDKA 1Z26A 3EC1A 3TLXA 2AJBA 5JYDA 1WCIA 5LUAA 4ASUD 2R4TA 4C7MA 2BD0A 2UUBB 5C8XA 2IKQA 5C53B 1NL3A 3DTVB 3K92A 3NV9A 1GA1A 2BHSA 4FW8A 1W88B 3HMQA 3N2NA 1VCMA 1CJUC 1YHYA 3HJGA 3NBUA 5HDQA 3DBLA 3GPDG 3IT3A 4EGFA 3FDJA 1XP8A 5HX7A 1N3IA 3DDUA 1CUWA 3K4HA 3SC6A 1KIMA 5A3JA 4L6IA 3D5EA 2O1EA 1IXKA 2GCGA 2PXHA 2NTJA 5KSPA 1OAOA 3U7RA 2NUBA 4HYTA 1N5LA 1WVGA 4UASA 4O5OA 4XD2A 1JN0A 3JQBA 4ZI5A 1JPJA 1M5UA 3W79A 5FPTA 3WV4A 2C4WA 1P3DA 1H66A 4MDHA 2GRUA 4RDXA 5IABA 1ZEJA 1C3LA 4QYIA 2C9YA 3CUEF 5LQRA 1J00A 2VNKA 2QXUA 3FVWA 4FX2A 2GAFA 1N6IA 4JI8B 1AHPA 4GGOA 1KI6A 4IJMA 1ADGA 3CS3A 3PZBA 3B89A 4FYKA 5A62A 3STHA 4E11A 3Q3JB 3VR6D 4P7KA 1PZEA 1P2UA 2OTCA 1QWOA 2YH2A 3B1VA 4KFSA 1KA9H 2HMVA 3HZOA 3KHKA 2A1IA 5DBEX 2B25A 2GEUA 4IWXA 5DYTA 3X1YA 3ZDDA 2D7JA 2NO6A 4J43A 4I4NA 4G8JA 3JWGA 4YALA 2P6UA 3C4QA 1VFPA 2OHIA 3ML1A 1KI1A 4QREA 4PVCA 5D85A 2NOAA 3QYFA 5DTIA 1S01A 1ZI6A 2LWIA 3BH7A 3EXFB 2A0WA 3TFQA 1KBQA 1X7ZB 1SIUA 4GHWA 4WFIA 2Q3DA 4OXQA 2YYZA 1DPFA 4W5QA 3JVVA 4WWHA 4NBUA 2AFHB 5BYKA 1MC8A 1RLJA 1OGIA 3BL6A 2JIZA 4WNAA 3UUFA 4BWFB 1QRSA 3RIHA 2CKMA 1QV7A 2JVIA 4XWYA 2AW3A 2NW6A 4JSTA 2Y1KA 1E8NA 3E15A 4CDRA 1FXWF 4BGIA 4DIMA 4EB6B 2PMBA 4EM6A 4KEAA 1M34E 2AJ8A 1PGJA 1HC7A 2V5AA 1BW9B 2Y3IA 1AUQA 1JI3A 1T91A 3ASVA 3PPXA 5LNK6 2IVFA 4BV9A 1R6UA 2Z98A 3GEGA 5DV9A 3DZGA 3TNJA 3WLJA 1XRRA 1JSLA 1UWLA 1GAWA 3DP9A 1JHRA 2PLRA 5JARA 2IS4A 3JAKB 5C0OE 3NATA 4HVCA 3R4VA 1OTHA 3OKCA 3I5XA 4GLFA 1EM8A 4DQ0A 2MYTA 1R4NA 3FFBA 3ULKA 1LX6A 6REQA 2HPVA 4PAMA 2IZ7A 2MCFA 2Z2XA 4MGEA 4W7SA 5TPWA 1TKBA 4GR4A 4CQLA 4M89A 1JIXA 3JVEA 3A05A 1YOVA 2J0SA 2JK1A 4K9OA 1DQPA 1HFJA 3MUNA 3QYJA 4ALKA 5K45A 3QE4A 3TRHA 4QOEA 5AI9A 1XZBA 13PKA 2ZE8A 4W82A 4NQRA 4EI8A 1OOEA 1OYYA 1U04A 3B5IA 5F35A 4FI3F 2WT9A 1VE3A 2AZDA 3VKUA 1NM5C 1HQKA 1SCAA 3EG9A 1A9YA 3HP4A 4MS3A 1ZUD1 1J90A 5TJHA 3CH5A 5GGYA 3WS7A 2GARA 3DV2A 2J3JA 1U99A 1AHHA 3DE1X 4YAOA 4G0VA 1T4BA 3WL5A 3OPYA 1GD1O 2J3DA 3KT6A 2QYHA 2JJ1D 4WESB 2NACA 3GP3A 3D0RA 2PYZA 5BNIA 4KQGA 3LD9A 2XQGA 3T1HB 1ZD9A 5EESA 2A0YA 1N2EA 3G82C 5A0VA 2O2ZA 1UPUA 2VP0A 5H3CA 3U81A 2GVNA 5EKDA 3WK9A 4D3YA 3N2GA 4DLNA 2ZAYA 5HJEA 1HORA 3IAS1 5JAUA 1GPKA 1PF7E 1YQXA 2BY4A 4S35A 4C0XA 4ZEVA 1KMNA 1NW3A 3EPKA 5CEFA 4FT4A 3GX1A 4Y98A 4BQIA 2HUNA 3F4KA 1Z4MA 3I2FA 3NHWA 4DV6B 2NU7B 4NZ9A 1PTJC 2ISSD 1KQ3A 5LD2C 3G2MA 3IP8A 1YZLA 3A1NA 1R8QA 3FXAA 2JGDB 3AERB 3ZE9A 4M8IA 5IDQA 3AXTA 3ASYA 1JXMA 3UCXA 3KVRA 1NPYA 3CO5A 5ALPA 5HOEA 3M6AA 5M34A 5JIBA 3DNMA 2RKBA 3AI1A 4WQMA 1M6EX 1STOA 1OA0A 1OXMA 2X13A 1LQ2A 3ADKA 3GLHE 3TXYA 4LF8B 4QU0A 1NM5A 1MEJA 2JC3A 4P1ZA 5EL0A 3ZC3A 5K0NA 2P7HA 3VX3A 1CR4A 1ZJYA 3EK2A 3OM8A 1RFLA 2FUKA 2X58A 3P4YA 3FMPB 4G85A 1M8JA 1X9HA 3A9VA 1PT8A 3R9IA 1Z0DA 2NG1A 4WUTA 5ALGA 2RE8A 4EGJA 4I6EA 3IR7A 2JZCA 3WQQA 1X1DA 3ZHTA 1A9XA 1T8WA 1ONSA 2O2SA 4OMCA 1B43A 1TXGA 1A8PA 1EZ4A 1RNLA 2VHVA 2VUTA 3ABRB 1RWMA 3GARA 3WGQA 5FAKA 5BSUA 5A4FS 4N7RA 1BHSA 4R40A 1ZL0A 2YXNA 1EB9A 2C9OA 1GRQA 1WXIA 3I9MA 3IMKA 2QRNA 3JVUA 3LWZA 3KYJB 1N4DA 5CA1F 3QVGA 4ZGWA 2RHDA 1NLFA 2YNMA 3G89A 4QHTA 5D7NA 2WB2A 1LDGA 1OLSA 1TAHA 2J3EA 1QCYA 2PPVA 4D1YA 4Y0NA 3WAJA 1RYBA 1MJNA 1PTJA 1UFRA 3GQBB 3N59A 4Q6WA 3ADOA 3L1JA 1KAEA 3OY2A 3QLEA 1D7OA 2F3UA 4G9GA 3WJ7A 3EIEA 3QQPA 2SKDA 2OAQ1 4TLEA 3OA0A 1YS6A 1MO3A 1DP4A 1ZJZA 2G40A 3GMDA 3RYFB 1WMSA 1Z35A 2J7PD 1JL3A 3BWMA 4B3CA 1CLUA 3UJPA 4BVHA 5EN4A 2AEJA 3FOZA 4Y2HA 2PSDA 2NUTA 4ZP1A 2GKGA 2IIBA 2B7BA 2HA6A 2WD7B 4GP7A 2GEVA 1P4AA 3BIFA 4MPDA 2XPCA 2ZTMA 2PCJA 1VTKA 2VXOA 1RFGE 3PDWA 4NESA 2OV4A 3A9SA 5AW8A 1ADJA 2QD4A 1P72A 2XKKA 1OT5A 2ZIXA 4MRMA 5BT8A 3PL1A 1US8A 1K06A 4HWOA 1GL9B 2R1VB 4YXFA 3SX2A 1IQRA 4QASA 4YS6A 2XYRA 3ONNA 2AVDA 1KI4A 3E61A 3HPQA 4IUYA 4IIHA 1E2MA 4Y9DA 4RD3A 5A3SA 4UNNA 3TVYA 2C7BA 3N8IA 1I5RA 4TMZA 4KC0A 5A3RA 3H2ZA 4RAQA 1E5DA 3BB4A 2ST1A 4O4LA 1L0BA 1C3EA 4RVOA 5LOVA 3SEFA 1R9MA 3U4GA 2BELA 7MHTA 3M1IA 1QZZA 1HOTA 2J0UB 3ZHXA 1XIVA 3JD1A 4IV0A 4DV0B 1QQBA 4M0FA 1FSZA 2ZRKA 5C7IO 4K7JA 4GUDA 4BNVA 4MWGA 4TS4A 3K8QA 1X6VA 2ZSBA 2E5WA 2Y8EA 1NRXA 1RI4A 3R6GA 5AHWA 1R74A 4UTPA 1Q0ZA 3HUDA 3VR0A 3EGDB 1ZJWA 3WE7A 1EVKA 2BI4A 2P9FA 2QTWB 1QH8A 2IP2A 1C4WA 5BN3A 1CJBA 5CX1B 1XZPA 2ACWA 4E94A 3RIXA 3SX4A 4GKJB 5HRUA 2H7CA 1Q1NA 4R98A 5E0KB 3HFRA 1M2VB 2P2DA 3AEQA 1PRYA 4Q7LA 4CN9A 3A70A 1HFWA 3OX3A 1RWWA 3LNCA 3C70A 3MLAA 4PQGA 1L7DA 5TMPA 1KWGA 3KL4A 4GLBA 1LZKA 2IZ0A 2VHWA 1RMYA 1VI6A 1RJEA 4NYMR 2IPXA 4KIJA 2QYSA 4RD4A 1EZ1A 4INOA 1Z8FA 3RIGA 4F4DA 1DEXA 3G0IA 3D64A 4R8MA 1RRKA 1RAIA 3DHVA 4WINA 4WJKB 3PIIA 4OVKA 1UMCA 3QV1A 3EC7A 4NABA 1LPBB 1OPRA 1GARA 4TMVA 3BXXA 1JNYA 4N7BA 4ETMA 3NO4A 2QG6A 3PNYA 4IUCS 2PGNA 4NVRA 3X1WA 1T5OA 2GKSA 1UBMS 2BGGA 3ND9A 2EOAA 4QBIA 2RGUA 1T0PA 2C3OA 2C4VA 1U3GA 1CC1S 1OIVA 5I9TA 1GT91 2YC4C 3W06A 3DCYA 4MQUA 1TQHA 2A84A 4JBNA 1DEKA 4NATA 3KYDA 4QYXA 4XR4A 1HYQA 4YONB 5G53C 3R5HA 4OHKA 3T06B 2VDPB 4HYEA 4FR2A 2JIRA 4A10A 2C3YA 4MVYA 3UT5B 3CVOA 3WLIA 3I9V1 3IJEB 4GSKA 3U4IA 3E81A 3L7DA 1QK3A 2YKGA 4X3OA 5TPZD 4TTQA 1YI8A 3WGHA 5L95A 1N77A 1RJGA 3A2MA 1YZKA 1SC3A 2VYQA 3GVHA 2WP0A 3SQXA 1SXIA 3B1ZA 3E7XA 1CQIA 4GU5A 2IYAA 5JJLA 4ME6A 1LU9A 1LVHA 5EHXA 5FR2A 3TQRA 5DSZA 1K63A 3VI3B 1YFLA 1OBOA 3VO8A 1DO0A 4JI2B 3L6DA 4ARUA 1JEEA 3NTQA 3UENA 4KLCA 4YRZA 1NIJA 5I48A 5I7UA 1Y3AA 2Z9BA 1G16A 2HWUA 1Q1ZA 3I3SR 3RNLA 3CVVA 4KQ1A 3S28A 3E4DA 3AM4A 4OQXA 6CHYA 1W1UA 1X74A 1SK8A 2G7ZA 3N28A 2LVBA 2ODNA 3P2OA 4RH1A 5AIAA 2H92A 2JAOA 4PXYA 3RS4A 2IIPA 3KB2A 2ZIUB 4EL0A 5ICSA 3ICWA 2HMSA 3A9TA 1T2FA 3T0FA 2OGWA 3OLCX 1SPBS 4ACBA 1WXXA 2RI6A 4HGOA 1KJWA 3DV0A 2R8XA 4TWJA 4EY6A 3RDPA 2EW2A 3OZEA 3DB1A 4EEKA 2ACKA 2F2TA 4R2MA 5BSWA 3BOSA 1NXVA 4MVJE 4O6VA 4O63O 2OQRA 1C3OB 1L5OA 1RJ9A 4O2RA 4UBMA 1EX1A 3JQCA 2FNAA 4YCDA 4LY3A 5ED4A 4BCCA 1QF7A 4N47A 2XIQA 1YRLA 4MV3A 5IULC 5KTTA 3C3KA 3EVEA 4QQFA 5A9RA 2WOJA 3OE5A 1U3TA 4YREA 5BYJA 2D1YA 2YV1A 1JA1A 2IPOA 5JO9A 3H16A 2WQ6A 5K3BA 3H5VA 2PMKA 1WL8A 3U3JA 3HWRA 3IT2A 1ZBQA 3WLLA 3EMDA 2VHZA 3D3KA 1GN9A 1I10A 2HXYA 2RC6A 2XUJA 4RD0A 4W99A 4B43A 4IAOA 2ZR9A 4HB2A 3RHFA 1W87A 4HC4A 3GNSA 4OI4A 5SICE 1RXCA 1TAGA 4I8XA 4OO3A 3MT8A 3EEYA 4WKGA 5BP7A 1RYYA 2V7TA 2P79A 1XCGB 3ZJVA 2P6NA 3CLUD 3CSSA 2QE6A 4J49A 3GEIA 2WPDA 4GM4A 2YQ4A 2Z4RA 1YFZA 3T1TA 3O1LA 1Y4DE 3FYUA 3KR0A 3PFCA 4J4TA 4RH3A 4X71A 1X7YB 2EKQA 3AR9A 5K6AC 2X76A 1QO0D 3N5KA 1QHNA 1Z3IX 3I58A 1YC2A 3OLYA 5L3QA 8LDHA 4RDHA 1XT6A 3VPXA 2M32A 3MMSA 2P9QA 2QRMA 2ETVA 2ATCA 2ORYA 1P1JA 2NSLA 2BTOA 4P53A 1YMVA 1PCXA 3G7NA 2OHVA 1N2XA 2XAAA 3LQRA 1UBLS 5I9NA 3Q4GA 2HQBA 1DWQA 1AUXA 1R5JA 2D3TA 5LQCA 5U4XA 1U8AA 4CV2A 2YJGA 4JNCA 2Q5HA 2MDTA 4K3UA 2WJZB 3PJEA 4AJ2A 3JPYA 4LYEA 1LWNA 5EMLA 4PZ9A 4AN0A 3CXRA 1OXTA 2ZJOA 3IOEA 3PHLA 1OKKD 2E82A 3MJTA 4JR2A 3OPYI 1G21B 2J59A 3A1TA 2HHJA 4RVCA 3VGPA 3EDQA 1YQ9A 3NBZC 5ESDA 3UHOA 1RACA 2Z1MA 4WLUA 3MRSA 4EB3A 1L7PA 4MNTA 1GILA 4N65A 5LOVF 2WWYA 4O4LF 5G1OA 4RFLA 3WIEA 4DNOA 5KYXA 3R8FA 3G3EA 1X3LA 3ZQ6A 1GL3A 3PCTA 3F1LA 4XGRA 1NN3A 2JASA 5JCPA 1E9RA 2YHAA 4HGNA 2CWDA 1OAAA 1VPVA 2VBFA 2ZSIA 1GCOA 1LK5A 1CUJA 3CNHA 4Q7EA 5B2EA 5K6AA 2G76A 4KFUA 4V0ME 3VPFA 4QUAA 3TUJC 1NF3A 2V0GA 1NKTA 3P2YA 3PF8A 1ZJ4A 3UWSA 4ARZA 2AN3A 1V5GA 4GMKA 1JH9A 3WRYC 4JJ8A 1BGXT 2XOKD 3O2NA 4QPNA 1W1IA 2WIKA 4N3CA 4D4HA 2H06A 2G1AA 3ENWA 1AS3A 3VHRA 1FMFA 3AJAA 2LBPA 2AOXA 4YJ3A 1FRNA 5I3CA 4ZAXA 2HBZA 4JB0A 3AUAA 5BW4A 5BNZA 1G42A 1VCNA 3DUFB 5JQGB 1FTGA 1NVEA 2CLFB 1FQOA 2G4CA 2ODEA 3GBPA 4L4XA 4U2DA 3U2QA 5C51B 3QWHA 2X8AA 4OM8A 1CV2A 1NXSA 2B99A 4WGGA 1OWNA 1UDBA 1WSBA 1FYDA 1JEOA 2I4IA 2NZ8A 4FFNA 4UDXX 1TJ5A 1CDZA 4FXOA 4RVFA 1Z12A 2OEPA 1LFAA 2XY4A 3CLVA 4YAKA 1MOQA 3KPJA 1DXOA 2K2QB 4V0OA 3ECAA 2CMFA 2UKDA 3OLQA 4WDRA 1XKLA 5AYVA 2ZRIA 5KVSA 1SHKA 3VKGA 1YZNA 4X1IB 4R3WA 5JNWA 3EYAA 3GCXA 3OJWA 1CUUA 2O2GA 4ZO6A 2G80A 1C1YA 2RGNC 4DWWA 2IEIA 3HDVA 1FVFA 4B6RA 3TQTA 1G1AA 5D5HA 2WIFA 3ORHA 3MIIA 3B7PA 3NGMA 3NBMA 2KI5A 3PQDA 5DHAA 1VLQA 1VSUA 1NBME 2DPMA 1XJ5A 3GJRA 2JFFA 4NECA 5TNXA 5KTSA 3LOUA 3KBOA 5DW0A 2I1VB 1W5FA 4Y1GA 1UAGA 3REQA 1HT2E 1Z2AA 4HAWA 3HTXA 1G41A 2XECA 4KRXA 1QMPA 4I36A 3DBRB 2HWYA 4CUJA 3WRYA 4D9GA 1ZN7A 2PL5A 2NSJA 4S1TA 3RF6A 1A5ZA 1P1KA 3SI7A 3E23A 2CJYA 4UBNA 1Z4IA 4YY3B 1J0DA 1Q0PA 1TVKB 2HA7A 4JFRA 2PSJA 1CJTC 3AVTA 4JJ7A 4LFAB 2BONA 1EGQA 2EF0A 2RAUA 1ATZA 3M5PA 3U4CA 3PFIA 1A95A 2IPLA 4KP7A 5CLIA 3OT1A 4FYYA 2H48A 2HPZA 2IW3A 3AF0A 4M7OA 4HPJB 1EFAA 3L0IB 1XZNA 2B1GA 3PPWA 1R4MB 3K4PA 2NTEA 1I32A 3DVAB 3K0FA 2WILA 5DGTA 3CCCA 2R7KA 1U6JA 2XQVA 3BD6A 3F5SA 2WF8A 3NHRA 5M5BA 3IX7A 4HQOA 1RXYA 4OU4A 1U3FA 4AMYA 1XNGA 4B1FA 1Y82A 5T3YA 4DV1B 3NHSA 3HNOA 1WWKA 4R6WA 3MHTA 4BE4A 2BISA 3OZ7A 4DLUA 4MAAA 1PZNA 1IHOA 4M7WA 4OP2A 5JSYA 1KIFA 3LY9A 2HD4A 4MP8A 3R6TA 2FSHA 5LQJA 2ID4A 2VH5R 1GGKA 2DFDA 4FMDF 2WWGA 1GG9A 3K3PA 4L28A 4YV1A 3MILA 5KYKA 4U39A 2VTBB 3KSRA 2A14A 2R7AA 4M0KA 1NRIA 2VK2A 3BL5A 2G63A 1K1EA 1Y7LA 3L3BA 5KDLA 1YZQA 4CL0A 5BSFA 4KXWA 5IK2D 3GMIA 4CEHA 1ST2A 4FSDA 1Z7WA 1IRIA 3ZW7A 2DPYA 4OBBA 5FIUA 1RS0A 5AW2A 4KE6A 4BB6A 1YK0A 3N0XA 4WERA 5JZVA 1W93A 1X1RA 3F1KA 3UAOA 2VVTA 1CEEA 4E31A 3SD7A 4K6FA 3COZA 2G88A 4QODA 3GLRA 4CCWA 2UVPB 2VJOA 1JALA 4QT0A 5KYWB 4D57A 2P5UA 3FBGA 2HKIA 4TTRA 1KNQA 1HG0A 4MUYA 5EWJB 2B6HA 3RB8A 4NCAA 1J22A 1DWOA 2WZQA 3ZWNA 2Q9AA 2Z8ZA 4OG2A 3B9RA 2QRJA 3CTPA 5IM4A 2WHYA 2C5SA 4GPD1 5ILGA 2XEDA 2AE2A 3BEDA 3TWOA 3U3MA 4B4OA 1OZHA 2XUKA 1R6AA 3R40A 2BMFA 4ARAA 5B4TA 5KSOA 1K86A 1CS0A 2FW0A 1PGPA 3LT1A 4IIGA 4EG1A 1XHFA 5K0TA 2EX4A 2DHQA 2WJVA 5DNYB 2P40A 4HSEA 1VPDA 1USGA 3M70A 2IEGA 5ILQA 1J2EA 1H2EA 1SKBA 4QQ8A 1DTEA 3LS2A 4DL9A 4DWOA 5HIAA 1V41E 1MV8A 3FOFC 3O75A 3NWEA 3PRJA 1JI0A 1S5PA 4GKAA 1PJ3A 1C2YA 5AJXA 2FWIA 3VA7A 3M2PA 4PGFA 3SR3A 3C45A 4UCQA 1CFJA 2J3HA 3O4HA 5D00A 5DTMA 3VTAA 3MCTA 3DAHA 3KJFA 1KZ7B 3GPIA 1RAAA 4FNGA 1EXWA 1RM0A 4PLYA 4RGVA 3H8SA 2C8LA 1AD2A 1TC2A 2ZFUA 3FF4A 2HHAA 3MGAA 4RXMA 3RGGA 4M6WB 1FJ2A 2FZEA 4BNNA 1B8VA 4YUYA 3C1TA 2BZSA 5AXBA 2VSXA 1RYDA 2OB2A 3E5HA 3F7NA 3BF7A 2JBAB 4RGBA 1TDJA 1V8DA 4ZWNA 3PXXA 2QZPA 2DTEA 1W47A 3ZZUA 2FZWA 1CR2A 1SN7A 1Y1LA 3IVCA 2C4HA 3QV2A 4BXOA 4UNSA 3QVSA 3UA3A 2GDJA 1KOJA 1Y9AA 1OREA 4JI0B 2IFTA 2F1OA 2VK1A 3H1TA 3HVHA 3E3MA 3OU2A 4OHCA 5AKXA 5AVJA 2WWIA 3HN6A 5T5QA 2YFQA 1CDEA 1D5WA 3YASA 4DDMA 4NLLA 3D7LA 2FY8A 2TS1A 4KR7A 2ZI6A 1EAMA 2DVMA 4NK4A 2GN0A 2JFUA 2COEA 1MAUA 1DI0A 2IYXA 1OZ0A 2VEDA 3LDFA 2N42A 3FF1A 4YJ3F 5FWNA 1RPZA 5GZ6A 3OPXA 3PUVA 4TXJA 4IGIA 3SJ7A 4I8DA 3X2FA 5G1NA 2FK8A 3ZWYA 4A8TA 3IHLA 1BD4A 4M1MA 2PKYX 3CMMA 3KE9A 2PX6A 1BVUA 1KOFA 3GPCA 4HWSA 3ZWCA 3DB2A 2XZLA 1XTVA 5ENVA 2BDEA 2F00A 4Q3CA 4MW7A 1XTTA 1TCUA 4L57A 1QGUB 1QK5A 5E6SB 4LUCA 3KEMA 5FOQA 1TA9A 1ENPA 3FPSA 5F1YA 1FYWA 4LNUB 3KCNA 4O2LA 4AZ3B 1V8ZA 3P8ZA 5IVDA 4B09A 1UJ4A 4GX0A 2R0QC 4RY9A 3W5BA 3VR6A 2BGUA 3TEJA 1EVIA 2UXCB 1KEEB 1VHTA 1T35A 5H59A 2O5RA 3UV7A 1X94A 2FJUA 2GM3A 3DBOB 5BN4B 2AWNA 5CLLA 1ICEA 1MH9A 2A9OA 2BEJA 3HADA 4INAA 2NPOA 2RIRA 1OVGA 1TVMA 2VCYA 3DTVD 2X8JA 4L8LA 4QUHA 3WDMA 3UMRA 3FI9A 1HNZB 4BX3A 2DRIA 2J9FB 1JEDA 4HDKB 2GB4A 1A2OA 1E7MA 3Q10A 4JWKA 4L7VA 1LJ8A 4LHYA 2P4EA 4BOYA 5A2QA 2PS1A 1B6GA 4RKWA 5CURA 4O4IF 4DHWA 2QN3A 4E21A 4ZHQA 1E2QA 2ZJFA 1T2CA 4GQIA 2ZWVA 1Q7TA 1Y3DE 3BMQA 3RC1A 5F3RA 4D9EA 4RJLA 3O2SB 3PX7A 1BA2A 1Q57A 5E1OA 2OC9A 3IB3A 1T5BA 3G2IA 3PGXA 4GXQA 4U63A 3NBQA 4E03A 4DJFC 2BGTA 3IERA 4MIEA 3E22A 3JZMA 1ZNXA 5H16A 4D99A 2XITA 4UDNA 1GQQA 3HR4A 3OURA 3SZ3A 1G291 1JIIA 5EJ2A 2QROA 3F98A 3PITA 2C98A 1E9FA 5AKKA 3LDHA 4UUQA 3O3MB 1GL7A 4UHFA 4IGFA 8GPBA 2GJKA 4PHCA 5FADA 1WQ1R 1RZUA 2EKLA 1QH0A 1U0FA 5BWOA 5HP4A 3HDGA 1E9VA 3HSSA 4J7UA 3ROKA 1T6BY 3NDJA 3K8ZA 2FN4A 2ZU0C 4I5GA 1NHGA 1E3TA 2FA9A 2MWMA 3LCVB 1P0PA 4LDPA 5K0GA 2OLKA 4GBED 1N2BA 1BHO1 2XWSA 4KWIA 4WI1A 2GF0A 1BD3A 1RTTA 5F7ZA 4DCJA 2C2WA 4XXHA 2ZR7A 3LGAA 5ESWA 3S6JA 3SG0A 1P9LA 4ZVKA 3O4FA 4IQFA 3UMYA 1JIKA 1C0KA 3HC7A 1FF9A 1HLGA 2JRCA 3JQ7B 1WDMA 2PKRA 1U9YA 2OO5A 3PJFA 4OHVA 3O3NB 4YGYA 4EHBA 2GAOA 1H2AS 3EA4A 1KGDA 1YSCA 5KWIA 3H4VA 1NVBA 1DDGA 2UZIR 1JMVA 4D97A 2FZ4A 4CTOA 3RYIB 1FFXA 1K89A 2KLHA 2IC5A 2VKQA 2H7VA 3EF3A 3KB6A 5H1YA 4GM0A 3TIGA 3V3TA 4AQ7A 1UXHA 2YFKA 4YDSA 3M9LA 4E5DA 4YRGA 1XJCA 1K4MA 4HNHA 3V55A 4TV9B 4RY0A 2Q3EA 3WSWA 2GO1A 4L8GA 2XR1A 5SZKB 3VKWA 1YB4A 1PK9A 2F1JA 2WBLC 3MPOA 4LBVA 5FBLB 1KH3A 2ZRFA 4ZRDA 5JZMA 1L5WA 3WLFA 5JXHA 1DIHA 1GZ3A 7REQB 3AGPA 2XYHA 4MB0A 5LZ7A 5EKXA 3LP8A 2VXCA 2H1VA 3P9ZA 3EXAA 3QOYA 5DMXA 2RB5A 4ZOLA 5ALKA 5DF1A 5GINE 3GAZA 2VDKB 3RQSA 3GYGA 1EX6A 1U31A 2IYTA 2JFNA 3DAYA 3NRJA 4L16A 4PYOA 3F9IA 4U1RA 5T6BA 2AZXA 4KLRA 2HW8A 5JAOA 2YX1A 5B1EA 3C0KA 3T7KA 4KR9A 1C3VA 3ZDAA 1ISIA 5SY9A 3TOVA 5ELLA 3L82B 2P11A 3A11A 1W75A 4K1LA 3P0RA 5HWSA 4XWKA 1B74A 1VKHA 3ANLA 1ULSA 3GGGA 1WRBA 4E51A 4ZYVA 4A23A 1BG6A 2HWWA 1X39A 4IPTA 4DSUA 8AT1A 5KNCH 2XNDD 2I9PA 1KI2A 2R8EA 3PDCA 1YJCA 3HY3A 4YUWA 4BGEA 4MRVA 2Y1WA 4K2AA 2J5KA 2JB9A 1GZ7A 4K6KA 2GFHA 4OH7A 2BZ0A 2R96A 3CUUA 1E7SA 4J9VA 2COUA 4L6AA 2RJ3A 3ASUA 4L4RA 7AT1A 2FWJA 5CB8A 2AI2A 2PZKA 1UBKS 3I04M 4EUHA 1EX7A 5DHUA 4D0NA 1UOEA 2FX5A 2B37A 1YAHA 1V9CA 3OEHA 3MVEA 3ONVA 4JP1A 4QUGA 3TBFA 2Q1XA 1N6LA 2PS9A 4PSDA 3B5EA 4YT5A 4DSZA 1X1TA 1ZUWA 2X2FA 4N5IX 3KEQA 1WETA 4GPAA 4Y2UA 1EVZA 4GIBA 3EGWA 1K8ZB 3KYBA 5DULA 4H35A 2C7QA 2O06A 2JCBA 2O5EA 1LS1A 4BNMA 3QMMA 2ZKLA 2DFTA 5GONA 1UXGA 1ZLYA 1YBMA 5KOIA 4RIHA 3IXLA 4M46A 2EP7A 4KIUA 4O2AA 2B30A 1FXSA 4JU8A 4PHFA 3SPXA 3IQWA 3TR0A 1OZAA 1X7XA 5TC4A 1NE2A 1NVKA 4K8RB 1EBBA 3FMIA 4J3FA 5K3CA 4HR7A 3VPHA 4PC1A 4TX1A 2E89A 5FBZA 2CLMB 1H2HA 1OGJA 2IXTA 2J7PA 3LOPA 4WK6A 1SXGA 3IQZA 4WKNA 2IX9A 1XMVA 5LR6A 4UEWA 3NHBA 1SU4A 3EEBA 4P5DA 3FDZA 3B1XA 3K9FC 4L2IA 4QGHA 4LJYA 2VTVA 3TE6A 1QBKC 1JKJA 3ES9A 1M0SA 3LYLA 4B3XA 4CM5A 4YT4A 3K6SA 2XZOA 2FPIB 3MGGA 4X1YB 3P9IA 3RAEC 1DBPA 4IF6A 2B7CA 2ZRJA 3UG6A 3ZXUB 4YUZA 3AHJA 4RK6A 5ERXA 3GGCA 3M4XA 2F4VB 3TQOA 2UUOA 3GEMA 4JL6A 5FA8A 4F9GA 3PC7A 4X44A 1P7ZA 2BC9A 2JANA 3LPMA 1HOXA 3K9BA 3FNBA 1NT4A 4WFKA 1KSJA 1O9HA 3I73A 2VA8A 3NYWA 3P5SA 4HZUA 4YO8A 4E0BA 3SQWA 5BPHA 4BLUA 3I5YA 5F73A 4MZDA 3VX4A 3CRRA 4IFBA 1YKSA 1W25A 1F4PA 4S1OA 5DWVA 1VPEA 1L1QA 4FOPA 3GLIA 2QT1A 1NFFA 4NJMB 4XRGA 3UJ7A 3VVCA 4AN1A 3DAOA 2O5CA 3KB8A 3CZMA 4I81A 5BRJA 2JW5A 3PUXA 4ENWA 2JJQA 4Z2AA 3HCEA 4IVPA 4ER5A 1S0UA 2WJ4A 5CA0B 1QGOA 3EZGA 2E7ZA 1HTTA 1QHHA 2OHXA 3H2YA 2I6FA 5EINA 4ZHQF 4CEJB 1KYWA 3LSYA 1QAMA 2AN5A 1YV9A 3EA0A 3M6WA 1M1NA 4MQEB 3DOIA 3NT4A 1D2EA 4DPMA 3BWEA 3KUDA 3KKNA 2V7QD 2HJVA 4LHVA 3IAAA 5EHNA 3VBEA 4EMBA 1I0IA 3OAAD 1VKJA 1OF1A 3HSKA 1ESMA 4LJ8A