4AJIA

Rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
327
Chain Sequence
b'ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase/inhibitor
total genus 115
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajiA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajiA02
4BNTA 2P9CA 4IJUA 3ZH2A 4UUNA 1GYRA 1A7KA 3QWBA 4GVXA 4EJ0A 2NVBA 5JYDA 4R4JA 3QIVA 3EAGA 1WWKA 4O6VA 3V5NA 2Y68A 4R16A 3L6OO 1E3SA 4B7UA 3W4IA 1P0CA 1P45A 4YAEA 1N92A 4GAEA 4EUHA 1GEGA 4CV1A 1K89A 3CUKA 4CLXA 2FMUA 3DZBA 3FTPA 3KSUA 1HZZA 3VH2A 4HFNA 2AG5A 3WQRA 1YBVA 2OBYA 1ZK3A 2WTBA 3D4NA 3PDUA 5ES3A 1PEDA 4Q3NA 4JJFA 4ZICA 2P91A 3ICPA 3ZV4A 2YV3A 3GRPA 4GH5A 5A9TA 2CSUA 3QA9A 2V6BA 1JAYA 4Q39A 1XQ1A 1CYDA 2NVUA 1I33A 1HDRA 4OMUA 4RVDA 3SC6A 1FDWA 2EIHA 2WYVA 4QUKA 3U62A 3AJRA 4X54A 3QVXA 2Y1FA 2WWRA 5HRUA 4CR7A 1PGJA 5ER9A 4RF4A 4ZJUA 3I23A 4YACA 2AQ8A 3PLRA 3GPIA 1NQ5A 3HNPA 1ISMA 3HFGA 3UAGA 2X7HA 1ISGA 3C1TA 5T57A 2NM0A 5I9NA 4KDEA 3QVOA 4OSOA 5CEFA 4WLEA 3PK0A 5A05A 1DIRA 1MB4A 4JP2A 1UZMA 2VN8A 3C8MA 3NX4A 8LDHA 4BNFA 1Y9EA 4PZEA 3JQCA 4Y67A 6LDHA 1UR5A 1I3KA 4WK6A 5GMOA 2Z5LA 4HFRA 1Y81A 4XGNA 4EGFA 2JKVA 3SVTA 4ND4A 4RVGA 2FP4A 1C0LA 3PJEA 1Q7GA 3SLGA 4C4OA 4BO2A 3GMDA 4IIVA 2JCVA 1M75A 2RHRA 1PJCA 5CDYA 3TQHA 2F00A 4AJ2A 4BNZA 2CFCA 4CQMA 4JROA 4CODB 1IHYA 2VHYA 1U5CA 2VHXA 1Q0HA 3BTOA 1SBYA 1CEQA 3FF4A 3OBBA 1V35A 3OIDA 2XAAA 2HO5A 3LT0A 1T1SA 1PL6A 5DF1A 3DZFA 2VWQA 3HDHA 4GWKA 3JSAA 2JAHA 1O9BA 2NUAA 4YVFA 3QWIA 4JCOA 5MDHA 1V0JA 1XR3A 2Q4EA 2Y1CA 2QRKA 4BO5A 3I9LA 1O89A 1B0AA 1Y6JA 4YQZA 2W2LA 4R1UA 4ND1A 1BGVA 3LK7A 4Z3DA 3RIHA 1FDTA 4IY1A 2Q1UA 3TOXA 1XDWA 2I66A 1K6JA 2W2KA 4PG5A 2NQ8A 4KWIA 3NRCA 3NTQA 1K6IA 2AA3A 2IYOA 4ALKA 4CMGA 3GVCA 3IUSA 3OECA 3ZU4A 1H93A 1U7HA 2NTJA 2I99A 1PS8A 2D0IA 3ZU2A 5ADHA 1I36A 3WSVA 1M66A 3H9JA 4HFJA 3E1KA 1K5HA 1FXSA 3RVDA 4DC1A 2OZPA 1ISJA 1AN9A 2YQ4A 1BXGA 3CINA 3RUCA 5ICSA 4L76A 1YDWA 1JW9B 2NTNA 4FC6A 4KUEA 3I52A 3R6DA 5AXBA 3RU7A 4GX0A 4K1LA 5G0TA 3F4BA 1YXMA 3PHGA 1BVRA 1DPGA 3WWYA 5FI5A 4DUPA 4FQ8A 3DZGA 3ZDFA 4YJHA 5JDIA 3FCOA 3RUHA 3BMCA 4DQXA 4MJLA 2WEKA 1P44A 2V65A 2AE2A 1OC4A 1GPDG 1WLYA 4BKUA 2LDBA 4R1NA 3LC7O 1PJBA 2P5UA 3WOHA 3ZN2A 1R0KA 4JIGA 2P9GA 3DMTC 3ETDA 4LW8A 1SB9A 4PLPA 4O59O 3SC4A 1FDSA 1EUZA 1C3VA 3DR3A 3H4VA 3MJTA 3AUSA 3OJLA 4R54A 3GOHA 1MX3A 5L3ZA 4D3DA 1X7HA 4W99A 4YT5A 1T2FA 4FFOA 4G5HA 4U6QA 4YDRA 1PGNA 4IUYA 1ZSYA 2E48A 4RDHA 2CDAA 3ENKA 1P1RA 3VZSA 4KP7A 4OKNA 1E1KA 4D41A 1XHLA 4NMHA 3TFOA 1JKJA 3WWZA 5HTOA 4O63O 1N7HA 1CERA 3PYLA 4PRLA 1PJQA 4PG4A 1Y8RB 2W4QA 2X5JO 2QRLA 3OMLA 2VRBA 3I6IA 4EW6A 2O3RA 3VC7A 4QEDA 4YB8A 4XYBA 2B36A 3ZWOA 4GKBA 2X9VA 4U5QA 5DBFA 4ZQHA 3JTMA 3JQFC 4ZD6A 4QX6A 1NFFA 2C54A 2EW2A 3AI3A 4I9HA 1GZ3A 4FIZA 3DHYA 1CQJA 4IDFA 1GQ2A 1I32A 3E9QA 1HYHA 4TZTA 2FR8A 5KVCA 4ROSA 5DBIA 2PZMA 3GLQA 2PD3A 1HE4A 1D1SA 1ZMOA 4Q3CA 3V2UA 5IZCA 1ZNQO 2HMTA 3Q3CA 1YB4A 5JY6A 2O7QA 5COAA 4J16A 2NSDA 1DHTA 1IPEA 1SCUA 1R4NB 3WYBA 2EKPA 4GX5A 4DMMA 3WLFA 1SAYA 4QT0A 1HLPA 3BHMA 3OSUA 5KVSA 2D5CA 3EK2A 4DMLA 4TMFA 4NU5A 3QVSA 4JK3A 2EP7A 2E6UX 4GVLA 2G1UA 5G4LA 3WFIA 5JAZA 3F5QA 3PRJA 4NU6A 1GZ4A 2PR2A 1NP3A 1FF9A 2C07A 1MGOA 1FDUA 4DPKA 1W0CA 2VCYA 1LSJA 2PA3A 5KVQA 3WGYA 4RPJA 3AW9A 4J0FA 1GY8A 2DBZA 5K0ZA 2AMFA 3KETA 3IKTA 1IL0A 1RPNA 3GZNA 3CTMA 4OOFA 4YJGB 4E30A 5FEUA 3D1LA 1SOWA 1I10A 3H7AA 3DDNA 1VL8A 3GHYA 1ZKMA 3JQBA 2VYNA 3DEYX 1AE1A 3Q0EA 2ZJ1A 3Q2KA 4PLHA 5IFLA 5L40A 4DXHA 1QKIA 2RAFA 1R0LA 3F4LA 4IMRA 4WLUA 5LDHA 5FWNA 1MV8A 4FW8A 3TJRA 3DOJA 1HT0A 3C24A 3T7EA 3AU8A 2HRBA 5KJ1A 4FFRA 3UVEA 3L77A 2FHSA 2ZKLA 1E7QA 2H1SA 3K73O 3ADPA 4TRJA 4KTTE 3G17A 4XD2A 3O38A 3KLPX 1HYEA 4B4UA 1P33A 3HDQA 2VTEA 3TRIA 3ZHXA 4E2WA 4DRYA 1BHSA 3DO5A 2QZ9A 2V6FA 2GZ2A 3C7DB 3ITKA 4IZIA 4L4XA 5IZ4A 4RVUA 4TSKA 1CJCA 1ARZA 3RUIA 4R5HA 1U4SA 3VPGA 2V6GA 3I83A 4CUZA 2Z1NA 4J7XA 5CG2A 2BELA 5F5NA 4CMKA 1N1EA 1YBMA 3L4SO 4E13A 4LISA 1DJNA 1LU9A 1P1KA 1H6CA 4Z9YA 1YQGA 4WUVA 3GVHA 5G4KA 1EFKA 1AGNA 3GUYA 3T7CA 5C7LO 2W2KB 3AY3A 5KWEA 1PZEA 4PLYA 2CD9A 5DULA 1R6DA 4XQ9A 3LDHA 3GA0A 3H9QA 1ZVMA 3U4HA 1PSDA 4NZ9A 3RUDA 3JQ9C 5U9CA 3EW7A 4MVJP 1GZ6A 3D64A 3H6KA 3WLEA 4MVJI 1HDXA 1PS0A 3OH8A 4FBGA 1RWBA 3D3EA 4IZHA 4Z6KA 5JSFA 4EDFA 1BXGB 1OAAA 5DP2A 3AOEA 2ZTLA 1U2DA 3I9KA 3W4JA 4INAA 2HCTA 1ADCA 2O2SA 5AOVA 1B3BA 4IQ0A 3ZNOA 1I3NA 2J5RA 2X22A 2ZCVA 3BMQB 3NEPX 4MIEA 4O1MA 2Y1OA 4WLVA 3T4EA 5JMWA 1DIHA 1PZFA 1B16A 1NR1A 1ZEMA 4K9DA 3VTZA 5A9SB 1H94A 1J0XO 1EUCA 1GTMA 1SO8A 1UH5A 3OJ0A 3VAZA 1B8PA 2Y0CA 4BGUA 1WXDA 5AXCA 4FFNA 3U09A 1B15A 3EC7A 3D3WA 5A02A 5LC1A 1F17A 1KEUA 4NFSA 5FYDA 4D3FA 4YBZA 4BNGA 4DVJA 4ND5A 1AHIA 2W90A 2DBRA 4XGKA 1RM5A 2EKQA 2JHFA 2X0IA 4N18A 5JS6A 1GQQA 4J1SA 3W8DA 2FR1A 3BIOA 3OA2A 2DVMA 4BMSA 3GQVA 3GVXA 4XYLA 1EVIA 2ZYDA 3DTTA 3RAJA 4A10A 1ML3A 3WYEA 1YDEA 5COQA 3ZWMA 3CKYA 4RJTA 3QJ5A 1E3EA 5I7SA 2BFAA 4R5MA 4A27A 1DIGA 4PFJA 1LLDA 4I9UA 1JVBA 3OQ1A 1BG6A 5H83A 2EP5A 1E1NA 2FWMX 3MWEB 2C7VA 4OAQA 3RC9A 1PJ4A 1PZHA 1U2GA 4E5YA 3OQ6A 3PYXA 5L7TA 1NVTA 4CMEC 3PI7A 4MVJD 4JJGA 4DBVO 2FOIA 3RJ5A 1MC5A 1ZK1A 4UVEA 4FCCA 1I30A 2OP1A 1IOLA 3FWZA 4L4SA 4II3A 1ISHA 4CQLB 3GEMA 3H5NA 2PD6A 2UYYA 3HDJA 5CEEA 3BAZA 3MJEA 4PLCA 4LVCA 4MIYA 3DZIA 4GSLA 3BMNB 1DHRA 1L1FA 2Y93A 4L0QA 3DHEA 3GN1A 1SPXA 4R41A 4BNMA 2J5QA 4NJOA 4NG5A 1XSEA 3M1AA 4JNKA 2DU8A 5EINA 1P77A 4BNNA 1YB5A 4C7KA 2Q45A 3A28A 4J43A 1T4BA 1CDOA 1HDYA 5ITVA 5TLSA 2WD7B 4CM9A 1YVEI 5B1YA 3ANNA 3CSDA 1C1DB 1YS4A 2I76A 4BO6A 2ZIZA 4BV8A 1WP4A 1GAEO 2X9GA 4L4RA 4JXKA 2FR0A 3HDYA 1ZCJA 4J4TA 1MA0A 2EGHA 1B7GO 3CEAA 4R68A 4BB6A 5IXYA 1KVSA 1R4MB 4MPDA 4NJMB 4I5FA 2RIRA 5T6BA 2IDZA 3FI9A 3HUDA 4IPTA 1QLJA 1UP7A 4J1NA 4GI2A 4J1TA 4XYEA 2DKNA 2DFDA 4ZU3A 3U4IA 2J3HA 2VZ0A 1H6DA 5JFOA 3TZ6A 1E1LA 5JO0A 3NYWA 1DLJA 1C0IA 2R00C 2CMDA 2EHDA 1NR7A 3UUWA 3LT2A 4ND2A 3DBHA 4CM4A 1I24A 4BO1A 2OHXA 3AM5A 3GUCA 2EXXA 4IM7A 2HU2A 5KJFA 4LK3A 2IRWA 4U6SA 2C29D 3NGLA 4Y6RA 4W9NA 3WS7A 1QV7A 4XJSA 1HL3A 3QW2A 4IXWA 3AU9A 4G81A 3OIFA 1V3TA 1UXIA 1VI2A 3ONEA 3ABIA 1SEVA 3LSYA 4GX2A 4R1SA 2B5VA 1WMAA 5JC1A 4ZRMA 4MVJF 5TC4A 4NBVA 1BDBA 1B14A 5L95A 4YT2A 4RF2A 1PQWA 3UFXA 4YAJA 4IGEA 5IXSA 3K30A 1Y5MA 1CIVA 3ZU3A 4PLGA 4LRTB 1FK8A 2YV1A 1RM3A 4UEOA 1BW9A 4OQYA 1P31A 3FR7A 3PPIA 4BNJA 2FZWA 3WMXA 3E48A 2JJYA 4Y98A 1DXYA 5EPOA 3L07A 1CWUA 3UHAA 1DO8A 1JQBA 4L73A 3WJAA 1TT7A 2NLOA 1LBEA 3QWHA 4M89A 1YOVB 3U3XA 3UXYA 4ALLA 5CAEA 1KC1A 3ZNQA 3MEQA 1N5DA 1QYVA 2J6IA 4D79A 4NQZA 1KEVA 1EQUA 2QG4A 4B3JA 3H9UA 3ZZNA 4GGOA 3K5PA 1OI7A 4CM6A 1A9YA 1GADO 2X4GA 4FJ0A 3S55A 1QSGA 2PKQO 2XF8A 1TT5B 3ZHYA 3KTDA 3GR6A 3LC1O 1ENOA 3INTA 5DOVA 2OL4A 2ZB3A 1LA2A 3PWZA 1GCOA 2ZCUA 3E5MA 3F1LA 1KETA 2Z95A 1F14A 1TA4A 1WPQA 3RBVA 3PHIA 3WIDA 1PS9A 5EN4A 4UAGA 4XJTA 3OEYA 4LVUA 1UP4A 4DREA 3ZWCA 1G1AA 4IDBA 4E33A 2NV6A 4K26A 5T64A 4CPDA 4RF5A 1YQXA 3ZU5A 4PZDA 3ITDA 5CFZA 2J5KA 3AOGA 5EQDA 4RPHA 3WFJA 1ONOA 1B8UA 1PJLA 4DIOA 3JQEA 2JCXA 2EERA 1YRLA 2V7PA 4TKMA 5L4NA 4Z9XA 4CLHA 1NPDA 3GAZA 3JD2A 1ORRA 1NFQA 5HBRA 5JO9A 4U8GA 1R15A 3G1TA 3PQDA 1HLDA 3UW3A 3ZWWA 4J90A 2IE0A 3NKLA 4DPLA 1SZJG 1NAIA 4D46A 1HE5A 1U8XX 3RC7A 1HXHA 4XQCA 4HKTA 4PRKA 3LZ6A 4R1TA 2I6TA 2JFGA 3HB5X 4A26A 3GDOA 5DCWA 4BO7A 4YRAA 4QQRA 2NU6A 3DFZA 2G0TA 1KEWA 2X0JA 1GV1A 2QX7A 5AXDA 3A1NA 3KVOA 4ZRNA 1EVYA 1EUDA 1JVSA 1DSSG 4S3MA 2YFHA 1E3WB 1HTBA 1Q0LA 4WCFA 4EI2A 3I9NA 3FNEA 2PGJA 4YJFA 4WOKA 4YWJA 3KOUA 4J7CA 3G0OA 1YBAA 2Q49A 8ADHA 3PFFA 2H9IA 1A9ZA 4OKIA 4EJMA 5IF3A 5JW6A 2O3JA 1KIFA 1P9LA 3B1JA 2BGMA 3F9IA 5ENDA 3WGHA 4FFPA 1JU9A 4L75A 1VE9A 1MP0A 3BTSA 5EERA 2OGUA 4WECA 4GPD1 3QWAA 1Y1PA 3RC2A 2P4QA 4GWGA 1Z45A 1BSVA 1DC6A 4NI5A 3X2FA 4KDFA 2V6MA 3DOOA 4TKLA 4CMIA 2C5EA 2E49A 4ALJA 2B4QA 3DBLA 1UAYA 2EW8A 4IXTA 1E7SA 5CP8A 4EZBA 1DB3A 2CNBA 4F46A 5MGBA 3K2EA 1X7DA 2H6EA 3JD3A 1YB1A 5EESA 2DPGA 3IKVA 4PLZA 5K9ZA 2Q99A 2GN6A 4WJZA 4BO0A 2X5KO 1U1IA 1N2SA 4F45A 1LQUA 1KOLA 1K3TA 1A4IA 3IJRA 1ZJYA 4CUJA 3F6YA 1F12A 1I2CA 3MWDB 4DLAA 5A4DA 1V9LA 3GFGA 1H6BA 1K2WA 2JFFA 2PKQP 4BMNA 3S8MA 2AQHA 2O4CA 4FS3A 5GZ6A 2PLAA 4IDDA 4CMJA 2GZ1A 1VKOA 1IYZA 4CLRB 4MDHA 3D0OA 5FFFA 4Z0TA 4RLHA 4AJOA 1ISIA 4J4BA 3WQSB 4DQVA 4E21A 4XQEA 1HDZA 1G0NA 3KB6A 2A4KA 4YA6A 1W4ZA 2DLDA 4EEXA 2VUSA 4H16A 2QHXA 5TGDA 4I9NA 3EYWA 2Q4BA 5F5LA 6ADHA 3DB2A 3KYDB 5AVOA 1E3IA 3ST7A 4UEKA 5JPIA 3FPLA 3QRWA 4CQMD 4CM5A 3LVFO 1M6HA 4Q3DA 1LX6A 3JV7A 1E77A 2P68A 4BNKA 5IDWA 2QYTA 4M8SA 5BNIA 2OOSA 2GPTA 2GYYA 4IDCA 2GSDA 5AYVA 3ROKA 1WVGA 4D43A 2CVOA 4J3FA 5BQFA 4RQTA 1G6KA 4BNYA 4BNVA 4EYEA 1NQTA 4J0EA 4NK5A 3GVIA 3KXDA 1WDMA 4LSMA 2HK8A 4EUFA 3OEWA 1V6AA 1O6ZA 3ASVA 4AICA 1E3JA 4XIJA 2ZTVA 1EMDA 1KVQA 1UXHA 2TMDA 4A73A 4FSHA 5C7IO 2CDCA 2W2LD 1M67A 2Y1EA 3LT1A 3ANMA 4GMFA 4Y6PA 1DC4A 4D0SA 2Q46A 4GKVA 5JAIA 5A3VA 5EMHA 1PGQA 1OFGA 4AL4A 1N8KA 3DBRA 4WEQA 1EDOA 2BH9A 1XYGA 2F1KA 2I65A 1LC3A 4OJNA 4BO9A 2BMAA 3KYCB 1I5RA 3VZPA 2I9PA 4QFCA 3LT4A 5U1PA 3RFXA 1PX0A 2RCYA 1BXZA 1VM6A 2E4AA 4KUHA 2P9EA 1PWXA 5TX7A 4AJNA 3ZV6A 1R37A 1NXQA 2X86A 4J2OA 4OO3A 1R12A 1ZSVA 3SXPA 3B20A 1E0DA 1M6WA 1G0OA 3Q1LA 3AUAA 1ZK4A 1HE3A 4IINA 3BMOB 2C82A 9LDBA 1IY8A 4WOJA 3KV3O 3FNHA 1YKFA 4NFYA 1WW8A 3OJOA 4TRNA 3H3JA 3Q9NA 1RM0A 4F6CA 1UDCA 1NYTA 1J49A 3M2PA 3UKOA 4PG8A 4B79A 2DM6A 2AXQA 2VWPA 2YFQA 1GL3A 2JFHA 4NBWA 3QVWA 1RM4A 2ZQYA 3WIEA 1UJMA 4CR8A 3OIGA 3K9QO 5A04A 3IAHA 3F5SA 2Q1WA 2CDBA 4QO8A 3CXRA 3V1UA 1WDKA 5L53A 4CLEA 1D4FA 2Q50A 3DMTA 3CMMA 3F3SA 3I1JA 1P1JA 5I7EA 2C2YA 1C1XA 2VWGA 5JXWA 4E6PA 5ILOA 1EBFA 5CHEA 5IDYA 1E6WA 1I3MA 4YQYA 3GHHA 3T4XA 3GG9A 4AFNA 3LU1A 3TDKA 5KIAA 1GQYA 3AI1A 3E9MA 1AUPA 4RVHA 4YJFB 3ZW9A 5JC8A 2NVUB 2YDYA 1LLUA 1PQPA 1V3UA 2VHWA 3JD1A 3GDGA 3O9ZA 3QVTA 4E0BA 4P22A 3MOGA 1X1EA 4CMCA 4FGSA 1JAXA 4UEJA 2CF5A 1ZXBA 4CJXA 3ZNNA 4IGFA 5CDUA 1JLLA 4WLFA 1W6UA 3AK4A 1IPFA 2AG8A 4CV2A 3WGZA 1ONPA 1HRDA 2YHUA 3IP1A 4W82A 2VTDA 3UH1A 5JCXA 3NT2A 4YRBA 2HRZA 3JQFA 2IXBA 4LMPA 4YPOA 4NBTA 1LSOA 4E4YA 4UVHA 2D2IA 1DAOA 1JKFA 2CUKA 3RQSA 5L9AA 1T2AA 1H2HA 1LNQA 1CETA 1ENZA 2VNSA 3GNTA 4JP3A 2H63A 3JYLA 5A3JA 4HP8A 1Y8QA 3D4OA 2GERA 4YXFA 2FPIA 4A7PA 3FNFA 1PJSA 5G0SA 1MG5A 4JN6B 4DBZA 1AXEA 1WAMA 3FN4A 1U28A 5TJHA 3WBBA 4CL8A 1R66A 1LUAA 3FWNA 3JQAA 5ICMA 1C14A 2HMWA 3GGOA 1X15A 1PU2A 5CDTA 4CQMB 1JDJA 4P38A 3PVZA 3ZI0A 4BKRA 2HAEA 5JNLA 1B2LA 1QYWA 1MXFA 4B3IA 4F6LA 2QYSA 5FF9A 2X5OA 1ZBQA 2BKAA 4CLOA 3LYLA 3WGIA 1DAPA 4OL9A 1KERA 4KUGA 2VYND 4OH1A 1QLHA 1IE3A 5TJ9A 5ENVA 4EJ6A 3ROQA 1FDVA 3M1LA 2Q2QA 1N9GA 3TNLA 2VQ3A 3S1LA 2G5CA 1EZ4A 3EVTA 2A35A 2NU8A 4MP8A 2I3AA 1BMDA 1B26A 4TROA 4XCVA 3A06A 2B0JA 1NPYA 1U9JA 3IDSA 2NNLD 2AQKA 2NTVA 3LF2A 1AXGA 4BGEA 4J9UE 1EEHA 2O3UA 2XPCA 2B5WA 5K6AC 3TOZA 2O3QA 5ER6A 4BS9A 4NH4A 5B37A 9LDTA 2D3TA 5I7FA 1JWBB 4J7UA 1ZMTA 2CY0A 1E3LA 1X0XA 3MJ4A 5IJZA 1GUYA 4R9RA 3FR8A 3H9EO 3M2TA 3KZVA 3ZNPA 1QR6A 3AM3A 2PFGA 3HADA 5JCJA 1QORA 1I3LA 2Z1MA 1KEPA 3LF1A 3FD8A 5G2OA 4PVDA 4Z0PA 4E3ZA 2YYYA 3GEDA 2O3TA 4URFA 4YJHB 3RASA 3VPFA 3W8FA 5HWSA 3O8QA 2BF7A 3MZ0A 3WGQA 4RVFA 3KUXA 3BMCB 3D5QA 3HZZA 2IEBA 4L9RA 1VJ0A 3JQGA 2HKIA 1M76A 1N7GA 1V3VA 3GH3A 4W4TA 1NVMB 3C85A 5KKAA 3K2BA 1I01A 4FN4A 3RROA 4YJDA 4XDYA 4E2ZA 1I2BA 1F8GA 4JX8A 3JQ9A 4DLBA 3GRKA 3QSGA 1H0KA 7MDHA 1SOVA 3AUUA 3TZKA 3WQQA 1C0KA 1DFIA 4AJLA 3JQ8A 1GUFA 4U7WA 5EQFA 1YO6A 5DP1A 1AHHA 2R6JA 5TSDA 3L6EA 1UDBA 1I0ZA 3KLMX 3RD5A 3IS3A 1E7YA 5I8ZA 4BV9A 1TI7A 5A1TA 2G17A 1UZNA 1OBFO 1Q2XA 3BYZA 3KEQA 4FGWA 3DFUA 2B35A 4YRDA 3NTRA 2DTXA 3I4CA 2WMDA 4IJWA 4NHEA 4IMPA 4P8RA 2YUTA 3MTJA 1VJ1A 3SX2A 3ZWBA 2FSSA 5GZ1A 1ONNA 2IXAA 1KS9A 2X0RA 3ZWNA 1YGYA 3TZQA 4N5NA 5TQVA 4M54A 3OJEA 5ILGA 3TWOA 3KYBA 2CZCA 3OFSA 3FRJA 4BIIA 1EBUA 1CRWG 1UXKA 4B4VA 4DPMA 2VNAA 4UUOA 4RVSA 2HMVA 1LI4A 4LGVA 2WJPA 1XLTA 1BVUA 3SJUA 1GYQA 2GO1A 2D4AA 3BTUA 3WSWA 2DUWA 1J6UA 3DXFA 5DBGA 3I4FA 3C1AA 2PWZA 2Q1TA 3QY9A 5I9LA 5G0UA 3NDIA 4I8XA 4YT4A 3ENNA 2UVDA 4D0RA 4I5GA 4LRSB 1ULSA 2YY7A 3B1KA 4CM7A 4DGSA 1F8FA 1T2DA 1YONA 1NWCA 2E82A 4XIYA 4BMVA 1YH3A 1RKXA 3JYOA 4I08A 4JGBA 2D8AA 3DHNA 4MVJE 2ZB4A 3GZNB 3L4BC 3EZYA 1PJTA 4AJIA 3UCEA 4PG7A 4BB5A 1J4AA 5HA5A 5DCUA 3SBOA 5JYEA 1ZO8A 1Y8QB 4B8WA 4EEZA 4CMEA 1XG5A 3INGA 1PJ3A 5BNFA 1LXCA 1X13A 3B6ZA 1U3WA 3BHJA 4TWRA 1Q7BA 2C20A 3GFBA 3DAPA 4XB1A 1Q7CA 4RORA 1LTHR 1HDGO 2BFOA 4NBRA 5T8KC 3VKVA 3WR5A 5A06A 2G82A 4XRRA 5JAMA 3KM0A 1BRMA 4CM9D 2YZ7A 1E1MA 1L7DA 2IZZA 4CUKA 1QMGA 5GZ3A 3S2FA 3VVCA 3PJGA 3TZCA 1Z82A 4KQXA 1JWAB 3K96A 1LSUA 4IS3A 1LRJA 2VRCA 4BNWA 1PIWA 4LCEA 3UGKA 1MG0A 2P5YA 3C7AA 3NAQA 3NT4A 2XXJA 2E37A 3FBTA 3Q6IA 5IN5A 1NQOA 2NWQA 2DBVO 3ANLA 1LEHA 3GK3A 3VH3A 5IDQA 4Y6SA 1QG6A 1Q0QA 3S2GA 4YYZA 3VDQA 3ZHZA 5CDSA 3BA1A 4CLDA 1JA9A 1RYEA 3CZMA 5G4KB 3PIDA 4IJVA 4KWHA 3JQ7A 4WEOA 5TT0A 3TPCA 4II2A 3GVPA 4NIMA 3SLKA 4JBGA 2RH8A 5KOIA 1VRWA 3FTNA 1V8BA 1OMOA 1NNUA 2NU9A 3DOCA 4A03A 4AJ4A 3AY6A 4WLOA 2O7SA 3PZRA 3PTZA 2O3SA 4HWKA 1Z7BA 1QYXA 1ZH8A 4PLTA 3I6QA 3PLNA 4J9VA 2AEJA 4HNGA 4O0LA 5JDCC 1ZK2A 3EZLA 3HG7A 2R00A 4RGBA 2D1YA 1XA0A 3VTFA 1M2WA 1I2ZA 1XQ6A 3C1OA 1MUUA 4RPLA 3CIFA 2CF6A 3K6JA 3VDRA 2EJVA 2IYPA 1HSZA 4BO4A 1MFPA 3H8VA 3QP9A 4MVJH 2VWHA 3H2SA 2GGSA 4NFHA 1T4DA 3WNQA 2Y1GA 4XRGA 1UDAA 1OC2A 5COBA 1UUFA 4B7CA 3H5RA 5JLAA 2VZ9A 2W98A 1VL0A 3GY0A 4FPXA 4RDIA 4B3HA 4BO3A 4LMRA 2CVZA 4K28A 5HS6A 4OXNA 5F1KA 3IL2A 4AG3A 1U3UA 4QXMA 3EMKA 2UUOA 4DIBA 2BFPA 3LLSA 2VT2A 4Z3KA 2GN9A 3RKUA 3I5MA 3WYCA 3D3WB 3ZWVA 4CM8A 2EKLA 1IZ9A 1EK6A 1VSUA 1GV0A 3W6UA 2JD0A 1NPTO 2O23A 3KSDO 4GSKA 4MVJG 3W8EA 1E92A 1ZXLA 3UICA 4BNHA 3U4CA 4FOOA 2BGKA 5T67A 4XWYA 5THKA 2VHVA 3FPCA 1D1TA 4IDEA 3E8XA 4FC7A 4O5OA 1A4UA 1KYQA 3MTGA 2VUUA 1PL7A 2DFVA 2ZTUA 3DBVO 5DN9A 1GU7A 3WGGA 4HXYA 1YE3A 3HSKA 2J8ZA 4R9SA 2DTDA 4ILKA 4BQPA 4EBFA 3OM9A 3BTVA 1NHGA 1Z75A 1YQDA 4YT8A 3KBOA 2PGLA 3OETA 3Q11A 3H5AA 4DYDA 3QLJA 4HNHA 1YWGO 2ZK7A 2Y99A 3GZ4A 4HBGA 4HY3A 3PGXA 3OQBA 3VZQA 4IIUA 4BGVA 1LDEA 1LDYA 5B4TA 1Y8RA 2WYUA 5F21A 4A0SA 2VZ8A 5TF4A 3NJ4A 4ITUA 1PGPA 4QTZA 3ZGYA 4HV4A 1QRRA 2QZZA 1HSOA 1NQAO 3GEGA 4RQUA 3Q2IA 1VJTA 3CMCO 1T2CA 4OQZA 3WTCA 3DZKA 3DZJA 3B70A 4BGIA 4MOWA 1ZFNA 4NDNE 2NADA 1T26A 4ZGWA 5CPFA 3V1YA 5T5QA 4MKRA 2HDHA 2DBQA 3PIIA 3WB9A 2BGLA 3MJSA 5F1PA 2P2SA 5FI3A 3TFQA 3KO8A 4GQAA 3ZWXA 1Y5RA 1WZEA 3JYQA 3PGJA 4OXYA 4M55A 3RFTA 3WMWA 4BKQA 4OIMA 2BI8A 3VKUA 1LLCA 2GCGA 4ZVVA 3HE3A 2GASA 1C0PA 2EF1A 3HFSA 4IBOA 4MO2A 1R4NA 3LC2O 1WMBA 3FBGA 3L9XA 2JAPA 2Y05A 1RJWA 3E18A 1RYDA 2WDZA 4HFMA 1JKIA 4AJJA 4TVOA 3KRTA 4FFMA 3AFMA 4UVGA 2YHIA 1P74A 5IN4A 3S2IA 3G79A 4JJIA 4JQCA 4L8VA 2ZTMA 2NVWA 4QSMA 3NUGA 4B4WA 3R3SA 4MVJM 4BKPA 1ADFA 4R51A 2GRAA 3PQEA 1P3DA 1DBVO 4WKGA 1LDGA 4ALIA 2ZYAA 3OA0A 1HWYA 5TIIA 4CR6A 2IODA 3GPDG 4U0KA 7ADHA 1NASA 5A03A 2NQTA 4K6CA 5EL0A 4LN1A 4B4OA 4AJPA 4YJGA 2X0NA 4E2YA 1XELA 3GAFA 4DIFA 4H3VA 1Z7EA 2C0CA 5AXAA 1ADBA 1NM5A 2J3IA 3GGPA 5BSHA 3HWRA 5KCZA 4CM4B 3DBHB 5KVVA 3PWSA 4WCDA 1U5AA 3HB4X 5H82A 3DAGA 5A9RA 1DEHA 2G76A 3BHIA 1NFRA 3V8BA 5CDGA 1L7EA 3U4DA 1HDOA 3O4RA 1EE9A 1E5LA 2EG9A 4FDAA 1YL5A 4ND3A 3VPXA 3EGOA 5C7OO 3SJ7A 4D45A 1ID1A 2ZQZA 5TT1A 5TRTA 1VSVA 1GD1O 3GF4A 4FB5A 2BFMA 3ZHBA 3JQ7B 4NK4A 3TZHA 4E31A 4TZKA 1DIAA 1HDCA 1TB4A 3R3JA 4W6ZA 2LDXA 4MKXA 2WD8A 3HN2A 3PHJA 1E5QA 2HK9A 2HK7A 1YJQA 3PJDA 4WLNA 3TN7A 3HN7A 1GFSA 1BW9B 5I9MA 3F1KA 3ROMA 1PR9A 2I3GA 1Q1NA 2JD2A 4ALNA 2Q2WA 5BSEA 3ZCXA 5JDIC 5DOZA 4W7HA 4Y9DA 3AY7A 1X7GA 1LLQA 3PZBA 5L4LA 1NHWA 4FJ2A 3ON5A 3RUFA 2PY6A 3WNVA 2Y0EA 4ZQGA 1Z6ZA 1X14A 3ZV3A 4MKZA 1B8VA 3B1FA 1TEHA 3K8ZA 3L9WA 4GLOA 4N7RA 1EQ2A 3NTOA 3PP8A 3VH1A 4R69A 4OOEA 2BD0A 4G2NA 2GDZA 4IJKA 4YCAA 2RHCA 2ILTA 2X9NA 4OGWA 1OOEA 4PLWA 1YL6A 4ALMA 2RH4A 5KKCA 1T2EA 2HLPA 2UAGA 3ICCA 1B3RA 3CZRA 3OJFA 4D3SA 5JAQA 3H2ZA 1UAGA 5B4VA 4EUEA 2AEMA 3P7MA 2P4HX 3NT5A 5L7WA 3JYPA 3R1IA 5BR7A 4YAGA 1IB6A 3DC2A 3UF0A 1SB8A 4FFLA 2B4RO 4W7IA 4CM8B 2HUNA 1A27A 3JQ6A 3G1UA 1P1IA 2WYWA 5JY1A 4LCJA 2D5AA 3PHLA 3BMQA 1XEAA 1N1GA 3PEFA 4BL5A 1UXGA 2GF2A 3FSRA 1HF3A 5A5EA 3ZW8A 4P4NA 2R2GA 4I1IA 2DUUA 2PZJA 5A9SA 3TF5A 4CMBA 3GNQA 1E6UA 2HJRA 3UOGA 2VUTA 4PLVA 4UVIA 5F3RA 1IUKA 3ETEA 4AJ1A 1O5IA 4CMAA 2A92A 3VHRA 1NVGA 1NX6A 5KTKA 2GUGA 1YJ8A 2HMSA 4XZ3A 2VOJA 1XCBA 5IZCC 3H3FA 1A5ZA 2UV8A 3P2OA 1GPJA 2X8LA 2JD1A 2SCUA 2XXBA 3VOSA 4Z9FA 3G3EA 2OMEA 1A71A 3OICA 3RSHA 3N58A 2PTGA 2YW9A 4CL3A 4IS2A 2FZEA 1IZ0A 4HADA 2OORA 5J23A 4R3NA 1LDBA 3JYNA 4BOYA 4Q3BA 2PK3A 4LSWA 3E6AA 1H2BA 4A2CA 3AWDA 2A9FA 2BHLA 2HSDA 2GD1O 2Q2VA 2OP0A 3CPSA 5F1OA 3ONDA 4ONEA 1A72A 5L45A 2H5LA 2JHGA 3MJVA 1PJ2A 1TLTA 3UN1A 3H9GA 5KNLA 4WCFB 4UREA 3EUWA 4MP3A 5A5FA 4ZHSA 3DL2A 3SEFA 2DC1A 4GMGA 1PWZA 4WNCA 5U4QA 2HMUA 2UUPA 2Y0DA 4OM8A 4UUMA 1KY5A 3W4KA 4D42A 4NPCA 1QYDA 4KTVE 4TVBA 4E5NA 1EE2A 3COSA 4BHTA 3EY4A 3JQBC 5DCYA 2Q3EA 1HEUA 1GCUA 5IDXA 1PQUA 3UCFA 3DZHA 1U3TA 3A14A 2PV7A 3L0DA 4ZQFA 5DDIP 3STHA 4CMIB 2W8ZA 5JMPA 4E5KA 4CQLA 3EVNA 2PGDA 3DBLB 2IZ1A 4DYVA 5IAAA 2YHIB 4FR5A 2O50A 4J49A 1Y7TA 3IMFA 1OZAA 3BMNA 5TS3A 5IG2A 1XU9A 1ISFA 1DRVA 3O26A 4XA8A 1T25A 5EJ2A 2FY8A 3ROPA 5DNAA 1EDZA 4YTEA 3GG2A 4P4GA 2WD7A 3LLVA 3WXBA 1O0SA 3ORFA 1C1DA 3E03A 3HHPA 3TSCA 1MLDA 4BKOA 3BZUA 3X2EA 1KBZA 1KVRA 2OUIA 3K92A 2OFPA 4OSPA 4BUCA 1H6AA 2WE8A 3R0IA 2AHRA 3FNGA 3G49A 3L6DA 3RC1A 3V2GA 4DQUA 4WPGA 1R4MA 5TNXA 3RBXA 4ESOA 4NJMA 4PN3A 2DAPA 2C59A 5BSGA 3GGGA 3PDJA 4QECA 3TL3A 2BLLA 2ZYGA 3PFWO 1DFHA 1KC3A 3EHEA 3JQAD 3TL2A 4GBJA 3NV9A 2PH3A 1O8CA 2X1HA 2GR9A 5KJEA 1D8AA 4AJKA 1QV6A 4Q9NA 1HETA 1FMCA 2VT3A 3N7UA 1ZSNA 5BSFA 2ZB8A 1EVZA 4AVYA 3AOEC 4AJEA 1HYGA 2HJSA 5C5IA 1QYCA 5KJCA 2O48X 4NR0A 2GZ3A 3U9LA 2PKRA 1UZLA 2B83A 5CG1A 2FRDA 2VOEA 1WDLA 3MCVA 1P0FA 2FPPA 1S6YA 3VH4A 1E6EA 4MIOA 4GL4A 1W8DA 4KMSA 2GN8A 1U4OA 2NU7A 2OBNA 3JD4A 3NDJA 4JBIA 2WSBA 4RPKA 3O03A 1DFGA 3IC5A 3PWKA 1XGKA 3ZWAA 3WGTA 1DLIA 2DQ4A 3VVBA 3KHUA 4DWVA 3C3XA 3A9WA 4PVCA 1ENYA 1IHXA 4RLSA 4XX0A 3VPSA 5LDGA 2C7GA 1LSSA 2FPGA 4C7JA 1X0VA 3P5SA 1J5PA 1H9BA 1SC6A 4XR9A 4DC0A 3DBRB 3DWFA 4F3YA 1EVJA 4HUJA 2BRUA 2EEZA 2PD4A 4DLLA 2NACA 3KSZO 3W6ZA 1DRUA 4RZIA 3JQDA 3ASUA 5HS4A 4GGPA 4E5PA 3WDSA 1EK5A 1SNYA 4BNLA 3EDMA 3GNSA 1UXJA 1YOVA 3ETGA 3PXXA 2PZKA 2ZB7A 3E9NA 4FD3A 4BO8A 5KJ6A 1NAHA 4N5MA 1I8TA 3JD0A 1Y9AA 2D59A 3U0BA 5C3MA 5C37A 2EJWA 1PTJA 1HKUA 3IQDB 4IQ8A 5K6AA 3AFNA 1DC5A 1JN0A 4RO0A 4J91A 3QWFA 4P4LA 1MFZA 1LJ8A 5JCJD 2QW8A 4GX1A 3WICA 3RUEA 4M49A 3RI3A 4XEHA 2PH5A 4WE3A 4IQGA 3OP4A 3WX0A 3WBFA 4YAIA 1SEPA 1TT5A 2POQX 3OHSX 4TRMA 5CPBA 3RCBA 2I67A 4D44A 2B4TO 2XOXA 1MXHA 3QV1A 1K0UA 2J3JA 3AM4A 1XU7A 4OHUA 4JBHA 3PJFA 3VZRA 2ZJ0A 4XGIA 1T24A 4PGFA 2BI7A 4B8ZA 3RKRA 4XB2A 4KQWA 4DL9A 3QQPA 2YDXA 4XKJA 4R01A 2GLXA 3D4PA 1KY4A 1ZZEA 2X6TA 1Z73A 1A7AA 4KZPA 5EIOA 4MVJA 5B4UA 1E7WA 1XWFA 3I9MA 4Q3EA 1VL6A 4CM3A 4EITA 1C1XB 1HE2A 2Y67A 4IDGA 4RV9A 2IZ0A 4TRRA 4XYGA 4B7XA 4UULA 3IJPA 2C5AA 3ZWPA 4PIVA 1UP6A 3RBZA 1LQTA 2GNAA 3INRA 1GUZA 3ONFA 3IIEA 5CEJA 1XIVA 1DDOA 5AQ1A 1LRLA 1XKQA 5BT9A 5JBIA 3GT0A 1SMKA 1TVEA 3C7CB 3PYMA 1GEEA 4UUPA 3WG9A 1GR0A 4S1VA 1DIBA 5I8WA 3CE6A 2JL1A 4NBUA 4D7AA 5G0WA 3U5TA 3KEOA 4L74A 1P1HA 4H15A 4BQRA 2ZATA 1LRKA 4CMHA 3I3OA 1NWHA 3DTYA 1ZJZA 1LDMA 2RBEA 2J3KA 1E3WA 1GDHA 1JTVA 2Y1DA 3WTBA 4ZA2A 3NGXA 4DTIA 4G65A 1ZUD1 2AEFA 5L7YA 2EWMA 1O95A 3MJCA 1KVUA 4RCVA 2A94A 4FOSA 2AE1A 2VYVA 2B37A 3IUPA 1ZIDA 4N5LA 1D7OA 3QE3A 3Q9UA 1CQIA 4RL6A 1BXKA 4J1QA 4PCVA 2DT5A 4HX5A 4ZQBA 3K31A 4PZCA 4JLWA 5HM8A 3GMSA 1QXSA 2FN7A 2PZLA 2JCYA 4ID9A 2IEDA 2OO5A 3JQAB 4K6FA 5DT9A 1TXGA 4I5EA 4J4HA 2QRJA 3AI2A 2C2XA 4W9NC 4BNIA 3WJ7A 3E5RA 4MINA 1LC0A 3RU9A 3W1VA 3FHLA 2I5PO 4YEDA 2YV2A 3V1TC 5B12A 5L51A 1ZEJA 1K6XA 2FSVA 3NJ8A 3D5TA 4DA9A 4Y8VA 4J2HA 1D3AA 2CVQA 3CH6A 2QQ5A 1R0SA 3E82A 2VYVD 3RUAA 1ZK0A 4CLOB 4WASA 4PLFA 5GY7A 3AUTA 2Y66A 4A5OA 4YR9A 1BDMA 4XQGA 5BNTA 3BXXA 3DAFA 4OXKA 4XYMA 1ULUA 1WZIA 1F0YA 3L4BA 4RZHA 2WE7A 3HJAA 4R3WA 4QO7A 1N9GB 3IOYA 1CF2O 1VC2A 2PNFA 3GN2A 5L4SA 1H5QA 1Z74A 3V2HA 1P1FA 4UVDA 3P19A 4M87A 4GLLA 1PR3A 5DZSA 1VPDA 3PHHA 3P2YA 1BWSA 1NBOA 1U8FO 2HQ1A 1DJQA 1R16A 1YL7A 4PG6A 1EFLA 4ZQEA 3WGOA 4CLRA 4BNXA 5I7VA 3IP3A 2ET6A 1ZW1A 1VKNA 4XR4A 3I9OA 1ADGA 1VLLA 5T8KA 2AQIA 3N74A 3MOIA 2VRCD 4OYRA 5JE8A 4RPGA 1FJHA 2Q1SA 4NNJA 4RF3A 3UCXA 4AJHA 4WGGA 3KYDA 1PZGA 4CM1A 2TMGA 1BTOA 3F46A 3H65A 1T1RA 1W73A 4E2XA 1O94A 1E7RA 4E32A 3F47A 4XDZA 4E5MA 4M86A 4I5DA 3O8QB 2DPHA 1H9AA 3HQ4O 4ZN6A 2WM3A 3JQGB 3M6IA 3RFVA 3ZWYA 4CV3A 5THQA 3LQFA 2B69A 4KOAA 3I9JA 1WNTA 2O2YA 3NDRA 3QHAA 2O4UX 1DRWA 3A4VA 1HZJA 3S2EA 4H7PA 3DONA 4N54A 4J6FA 1X1TA 3DQPA 4MP6A 1DC3A 4CV0A 1E7MA 1U7TA 1NTOA 5JDCA 2AW5A 4U0JA 2EGGA 3JQ8B 1KVTA 4TQGA 4Q3AA 2YQ5A 1S7CA 3KYCA 3PQFA 3DMYA 2VHZA 3D7LA 3VPHA 3RJ9A 1IULA 5H81A 1ENPA 1QP8A 3ADOA 2EV9A 1LDNA 3ULKA 2YJZA 3GDFA 4QFDA 5LCXA 2X58A 2DTEA 2QIOA 2X23A 4IDAA 1MC4A 1GYPA 2UDPA 4BNUA 4WCFC 2GN4A 4E12A 4FJ1A 3BMOA 4YAKA 2OXIA 1PGOA 4BVAA 3ZV5A 1F06A 1PL8A 3U49A 3JCZA 4Z0HO 5ITWA 4WNIA 3OF2A 1DOHA 3RWBA 5G0VA 1U3VA 3GC6A 4M1QA
chains in the Genus database with same CATH superfamily
3B3JA 4IJUA 3ZH2A 2V74B 3DOIA 1VRVA 4PPFA 5KDOA 4V0NA 1A7KA 2RSLA 2OSBA 4GVXA 5KTYA 4GG1A 4B9EA 1Y3HA 2J0UB 3BOSA 3VPAA 5CH5A 2Y68A 3COVA 2IOYA 1ZOOA 4N9WA 2IDKA 4LHVA 3V5NA 1XQWA 4B7UA 2O20A 1U9YA 1USGA 5T4HA 4MQ4A 1OSNA 4GZMA 4Z7JA 1MIOB 4Z1MD 4EUHA 1ICIA 4GAEA 1UEJA 5BUQA 1VA4A 1FSFA 1GEGA 3AR6A 2VRNA 3PXAA 4P82A 2V5AA 3TGPA 1YOBA 2JGDB 3KSUA 1Q92A 2BHRA 2DPYA 2H8KA 1XHEA 3M4YA 5CD1A 4Z3OA 1H8EA 1RXCA 1ZUHA 5FUMA 1ZK3A 2WTBA 1Z83A 1XTVA 1NW4A 2IGBA 1NYLA 3BULA 3PGVA 5AFSA 4ZICA 3WLLA 2P91A 4Q7EA 1FSGA 3TQTA 2VUHB 2XCIA 3GRPA 2QRMA 5A9TA 1JR4A 3QA9A 1AF7A 1JAYA 1ML4A 4Q39A 2UZAA 3ACDA 4C08A 3DE2X 3K0CC 4XJXA 3HACA 4ESHA 3Q2OA 4OMUA 3N28A 3TB4A 4IMIB 1FDRA 3GEEA 2ZJ2A 2EIHA 4RTSA 4RMJA 4FW9A 4FYPA 4YRZA 2V5VA 1YJXA 4CEJA 2GILA 3C3WA 4KYIB 2Y1FA 5DRTA 3U3OA 2CFIA 2FPOA 4TTJA 5DT2A 1ZRSA 2ZSUA 3OEHD 4HDRB 1FEZA 2QX9A 4OAOA 4P84A 3AINA 1YRBA 3HKCB 2AQ8A 1NQ5A 1H1TA 1NKSA 5L6MB 2ZBQA 3BDIA 3QG1A 4L3OA 4XM2A 3C1TA 2JANA 1NTRA 2MR5A 4KDEA 3QVOA 4PSVA 3AEKA 4OP1A 4TV9F 1EGQA 4G1EB 5IBRA 1OGJA 1QCYA 2AI1A 2VA8A 3PTLA 4HDSA 4RZQA 1DBSA 1RWOA 1ONSA 1S2DA 5A05A 2FWRA 1A88A 3AHIA 2QRVB 3W3AH 3C8MA 3LUCA 4M38A 4ZODA 1CCWA 4BNFA 4EGJA 3QV2A 3MHPA 3S0JA 1ACJA 3QFCA 4PZEA 4YRKA 3OPXA 4MR8B 2IITA 2QZPA 2XADA 4H7IA 1I3KA 4GXQA 4NHOA 4Y9TA 5ENZA 3UATA 3PUZA 4KAJA 4WFIA 1BQ4A 1CIPA 3BSYA 3N39C 4RVGA 4BC1A 4MHTA 1OI3A 1BX0A 2EIXA 3M1YA 4UNNA 3SLGA 2IYUA 4BO2A 4EELA 4D92A 3ELWA 1LFDB 1SA0B 1M75A 4WN3A 4ZCLA 5JJIA 4DJDC 5I4KA 1BRTA 3W5BA 4RYLA 3P0RA 4E4TA 3T7JA 3KQYA 1QGAA 1U5CA 4ZDWA 2C95A 4FN5A 2H7YA 2IXDA 1SBYA 4NNPA 1KORA 4GM0A 3OBBA 1R7RA 1T2NA 1K27A 1ZW6A 4A15A 1R00A 2QSYA 1WB9A 3HVJA 2QTVB 5DF1A 1Y3AA 4XIIA 1VDMA 3ZKAA 2GMWA 3BWYA 3NHKA 3JSAA 4K6OA 4JUBA 4MRNA 4JODA 2QPAA 4JLJA 5MDHA 4V3BA 2Y1CA 4P34A 5DI9A 4EHIA 4R9NA 3IUEA 4CG2A 1RHMA 1V25A 1G3RA 2P77A 2CN1A 3H9BA 3BCSA 1O89A 3K5WA 3KSRA 1B0AA 5A7HA 5B30A 3LGXA 3K71B 2GPJA 5KNCH 1Y6JA 4PV7A 4QM7A 3NHMA 4ZDJA 4R1UA 4B43A 1NUQA 1QAOA 2Y0BA 1BGVA 1QH1A 1QGOA 5CVJA 2I4OA 4TKVA 3RIHA 3Q0TA 2R44A 2Q1UA 3WK9A 4PZPA 4XIGS 4MMZB 2HLHA 3L79A 3NRCA 2IYOA 3NWOA 4KWIA 1IBRA 4NBSA 3CXUA 3GVCA 3GXOA 4L6CA 4OB8A 5JZVA 1U7HA 2AJCA 2NTJA 1IB0A 1T9AA 2ODAA 2XIJA 1Z08A 3KQTA 4D9KA 4RKEA 3LWBA 1ZZGA 4E88A 1I36A 1GZUA 2NPOA 5C2JB 2DR3A 2G9UA 4OB6A 3X1ZA 2K2WA 1EK0A 2YHSA 4WIAA 4G26A 3A4YA 3E1KA 1FXSA 3EXHC 1QE0A 1KY2A 2OZPA 4RD1A 2YQ4A 3QKIA 1BXGA 2VJDA 2V96A 3I4LA 2HT1A 4IHJF 4JI0B 2FEXA 4RC9A 2BFDB 3R3VA 2NSJA 3R6DA 2FXIA 5FNVB 4GX0A 1WF6A 1Q57A 3FZEA 1L7OA 1GG5A 2AMJA 1D6SA 3VKWA 4BDSA 1DPGA 3WWYA 1X74A 1NI4A 1QRDA 2XQFA 3WY9A 10MHA 4EW2A 1J20A 1WXQA 5KTMA 1FMJA 2ODQA 5EHXA 4MTCA 1KE1A 5DCLA 4K8OA 3RUHA 1YTUA 4XM1A 4FOLA 4MJLA 2O8EB 1P44A 1YQEA 2AS0A 1PUJA 2V65A 4KVAA 1GPDG 2I4LA 1K98A 1E2LA 2Q3MA 1SKMA 2I7DA 3WOHA 3AESA 1R0KA 4FI3F 2P9GA 3PF8A 4HPJB 4Q7KA 5FFMA 1L4UA 1R4ZA 3KDPA 5F2NA 4JLBA 5B2EA 3CG0A 2RBGA 3V9PA 3HV2A 2OAEA 4B84A 1FDSA 3IIMA 3CZ5A 1EUZA 1CK4A 1CKEA 1NQUA 1NP7A 2ODBA 2VHQA 3H4VA 3INYA 3OJLA 4G4SO 4ER7A 2C96A 4JI7B 3G6WA 2OC9A 1Z0DA 3DYVA 1N8NA 5ITZA 3AB3A 4G5HA 4RANA 1TU0A 2V55B 4DXDA 4RDHA 2CDAA 2WKRA 3ENKA 3LRPA 4PZYA 3TNDA 3I6BA 4KP7A 1E1KA 2GCPA 2X9LA 3O92A 2GK4A 3ORYA 5D86A 3WWZA 2DCUA 2NZVG 1CERA 2ZJ3A 3PYLA 5YASA 4E5DA 4PG4A 1XDSA 4GYYA 3PKJA 1LNZA 1LCIA 5H4HA 4Q4AA 4EW6A 1VA5A 2B0CA 2O3RA 1TZBA 2I4RA 2QRUA 1SCDA 3H1GA 3P1JA 4QEDA 4XYBA 3ZWOA 2GVDC 4U5QA 4JWKA 5EWLB 3DTNA 4ZQHA 3VNQA 5FJJA 2JDIA 3ZHUA 4F93B 2JH3A 2C54A 3AI3A 5FWXA 1EXVA 2AJTA 4XD7D 5EHQA 2CJWB 5KNDA 1E96A 2OK8A 1M0WA 4YMGA 4RTQA 4YRPA 1GZ3A 4FIZA 2WYHA 3DHYA 1CQJA 4IDFA 3ZXSA 3E9QA 2OYSA 4OQDA 5AW1A 3SBEA 1DJPA 1N2OA 3KTAB 4MS4A 1RKUA 4PSCA 4TZTA 2YBEA 1UBFA 1MN6A 4ROSA 3D7RA 4F3TA 4NOJA 2DZDA 1KGDA 1D1SA 1ZMOA 3N6VA 1XAIA 4XPZA 3Q3CA 4GVPA 4PFSA 4LOHA 3OBIA 5JY6A 1SXJB 4PYJA 4RULA 5COAA 3K8OE 1INLA 1ZJJA 3WYBA 2OCPA 3M6UA 2ZDHA 3IKLA 4BVGA 4GX5A 4DMMA 1STOA 3O3NB 3PPXA 1GSHA 3HDVA 2VTKA 4QG3A 3T1OA 3SQXA 3PEVA 2A88A 2D5CA 4HNAB 3ILXA 1W5EA 4TMFA 1SKBA 3QVSA 2EP7A 2E6UX 5KSWB 3TFWA 4O4HB 1X7ZB 1WG8A 4FMCF 2P8JA 4XVCA 1W2WB 2WZCA 2GPBA 3WFIA 4EZIA 2NP6A 3R77A 2PR2A 3EVFA 2C07A 3VMMA 1MGOA 2MSWA 2H52A 1J06A 2VCYA 2QPLA 3ICOA 4ZV4A 4FMDF 3QPAA 2Y76A 3WGYA 4F12A 4RPJA 3WRYC 4J0FA 1GY8A 2GKGA 3RQIA 1AKTA 1GSAA 1VJRA 1P39A 4A6DA 4OOFA 4E30A 2BTQA 3IPRA 1AS2A 4AIIA 1NYQA 4KH1A 4DLYA 1KQ3A 1IN4A 4CFZA 1FDIA 5D1NA 1H3EA 1VHQA 3A8TA 4PC1A 3RAEC 1L3IA 4I5IA 3QHQA 4YO7A 5AKGA 3GHYA 3Q0EA 2ZSHA 3CH5A 4C6TA 1VLMA 1E9CA 4HK4A 1II8B 4N01A 4ROTA 5FDFA 3PNPA 4CQJA 2ERYA 5FWNA 1RJFA 3L7CA 4FVTA 4M7OA 4M9UA 4GXNA 1OI4A 3C24A 1EBBA 3T7TA 1E63A 1Y9JA 2HRBA 1X80B 2GRUA 4URZR 4Y9RA 3SLRA 4OFZA 5KJ1A 1U0LA 1QZZA 4EZEA 3QLVA 2FHSA 5CHYA 2H1SA 2J9ZB 4IG9A 4XD2A 1EWTA 2GAOA 4YP0A 3KLPX 1Q1QA 3AEXA 1AKYA 2Y6VA 1JG1A 3K7EA 3NM5A 4I66A 4WZAA 3PX3A 4NRDA 3FPGA 2A3NA 1R0CA 5JHGB 4E2WA 1IEWA 2JLXA 1XZCA 4EG7A 2GN1A 2QZ9A 4L8WB 3P2JA 4JB0A 3BGWA 3RRJA 4L4XA 2JEYA 2OAQ1 4G1VA 3W2HA 4DEVA 5K8VA 2C4UA 4DCUA 4UDNA 3RUIA 5KDDA 1R6TA 1PR1A 3VPGA 3OIVA 1MJGA 4LYHA 4LXIA 2V6GA 3WHLA 4D9FA 4G4SP 1C3EA 2Z1NA 1PWHA 3KIPA 4J7XA 3OZCA 2IV7A 2BELA 2NUPB 4HWSA 1N1EA 3TAUA 1F9AA 5F98A 4J2TA 1DJNA 1UQUA 3L4KA 1GCGA 1Y6QA 1W5BA 3DDUA 5REQB 1H6CA 2P6PA 1M74A 4ENUA 2YWFA 3GVHA 4OGKA 1Q22A 1ZOLA 1WDWB 1TM5E 1IJEA 2DPMA 2AUNA 2BGNA 2PUVA 3OOHA 4LS3A 3TQFA 3TYXA 2W2KB 5KWEA 2WJGA 3BBLA 2CD9A 2VDKB 3BZBA 5DULA 3SXUA 2H1VA 3EF1A 5AVUA 5EKXA 1D07A 2Y92A 4XI9A 1CIJA 3ILVA 4ERXA 1F1JA 3O31A 5E1MA 3E3LA 2O5CA 2IXTA 2L17A 2ZSAA 5BSRA 4D0NA 2O2DA 5CMLA 3WYAA 2VSFA 1RXEA 3GW8A 4QBTA 3WLEA 2O0KA 4MVJI 1ESMA 3LDAA 3PNYA 4Z6KA 4IZHA 3D3EA 4I1PA 3IAUA 2IHTA 2Q6KA 2EFCB 4HUQB 5ALYA 3KT3A 5IT9A 2B2NA 3E2IA 2LP4Y 4D4LA 1XO1A 2C2GA 4PCUA 3GI1A 4EYOA 3QU2A 1JLRA 3DMPA 5B3LA 1UM9B 4EJFA 1E2EA 4RXMA 3VR4D 3O9MA 1T8WA 1U0RA 2BKXA 2CXHA 4LY0A 4LY3A 3LUJA 4WLVA 5FUQA 1V16A 1XRLA 1T36B 1T5TA 3LWZA 4UMEA 5JZMA 3DWGA 2PGAA 2Q5HA 5DIFA 2XB2A 3ZDEA 1PZFA 1XMXA 1TIPA 3VOTA 5AUOB 2A9VA 1IXZA 5J2UA 1EM6A 1EAMA 2Q41A 4PIPA 1E1CA 1H94A 2FTKE 4UD6A 1J0XO 3RU2A 3ZGLA 1EUCA 1GTMA 1UH5A 3VAZA 2P2DA 2GEJA 2B8TA 2VZLA 4BGUA 2OT3B 3IQXA 1Z3IX 2ZIXA 3C6ZA 1OKKA 1B15A 6LDHA 1PNTA 3EXFB 1Q12A 5LC1A 1F17A 1U8UA 2XDYA 5CXXA 4NFSA 1EP1B 4IHKA 5AHRA 1JQLB 2SCUB 4L6AA 3DGEC 1U31A 3TCNA 4D9CA 1RRVA 3OMWA 3OCWA 4CCSA 4ND5A 4Z4QA 1U80A 2DBRA 3EVAA 1Z8HA 2Q4DA 5CIQA 4ZJPA 1Z9BA 3BKWA 3I58A 2F1IA 1VBFA 2EKQA 3BIXA 5CLQA 4N18A 2W2QA 3KQOA 2HLDA 4ER3A 5JS6A 3EC2A 3GO4A 3OA2A 1MAVA 2IT1A 1JBEA 4NCHA 4NU0A 3GRRA 3GVXA 3BCUA 1U8AA 3DTTA 2WZQA 3V7YA 5BV1A 2GOYA 3E70C 1UADA 4HYTA 2WSSD 4EQ6A 1ML3A 1QM5A 2GF0A 3ZWMA 3LQ2A 2E4ZA 3F78A 4JR0A 4WXPA 4O29A 4EF6A 2I6FA 1XROA 2MSCB 2V7QA 1VG8A 1DG9A 1FLDA 1PG2A 4HN2A 4X45A 5K0TA 3IERA 4CG3A 1AV7A 1UBLS 2EJTA 5HUQA 4PRZA 1V43A 5EZSA 4C4PA 2WJ6A 3MVEA 1CEYA 4MUGA 3H1TA 1E1NA 3MWEB 3O4FA 4DMRA 2FKAA 1IONA 1U2GA 2GX6A 3KXIA 5I48A 3PYXA 4Y0NA 1PT9A 4OBXA 1P4RA 2FFHA 3PI7A 1U9CA 1W35A 2UVPA 2IYXA 2ZYTX 3AGQA 2WR8A 3JVDA 1YZVA 2FOIA 3A4LA 1KNXA 2VVTA 1TNDA 4XOUA 4ZCMA 1Z63A 1RZRD 1JEQB 2IYLD 4UVEA 4JV5B 4FCCA 4FUQA 2OQRA 3LBHA 1Z2OX 4EYKA 2VAMA 1ISHA 1HFJA 4CQLB 2X13A 4C7OA 3IQEA 3SZ3A 4D9NA 2P9BA 4FNGA 3R4VA 3B60A 1SR8A 4HNRA 4MWGA 2JIBA 5HVNA 4GSLA 3BMNB 1L1FA 4YT2A 3GN1A 4R41A 1SPXA 2VUIB 2PJDA 1GPBA 1ODLA 3HI6A 3H1EA 2IBMA 3FOWA 4IQFA 3M1AA 1E2JA 2GWRA 3VXKA 2JIZD 1VJCA 3G2QA 4BNNA 4K46A 1D5WA 5B1EA 1T4BA 3HBAA 1TM2A 2IY7A 2ZULA 1YBHA 5ITVA 1V9CA 3I5AA 4EG1A 5TLSA 3G2KA 5AW3A 1V4BA 1OY1A 1SUEA 2W2VA 1C1DB 3SF8B 3BEOA 2I76A 4AXXA 3TXYA 1BS1A 2VXYA 4TWJA 4L4RA 3O82A 1WP9A 3CYFA 5CB8A 2Z5FA 4LYEA 4K81B 1Z36A 1MA0A 3BQ9A 3H87A 1DBWA 1R27A 1Z4QA 2WVHA 4R68A 2QIPA 2V7EA 3K09A 4BB6A 2BISA 9ATCA 1KVSA 1V3QE 2ID8A 4LZOA 2RIRA 2IDZA 3O91A 3QTTA 3HUDA 4OBBA 4KAFA 1OGIA 3AJAA 1A2KC 3DDZX 5FBZA 3N9IA 3ZIAA 1IWOA 3N8NA 4J1TA 4UNQA 4XYEA 4EA6A 3MINA 1MR3F 4M76B 2VZ0A 1RLIA 2Z9CA 1M7HA 4GPZA 1E1LA 5IC4A 3BK7A 1WL8A 1KP9A 2BCJQ 1DLJA 5E4FA 3HXOA 2EHDA 4IJMA 4CW7A 3UUWA 3EPJA 4JLDA 2C2OA 3DBHA 1N33B 3RS8A 1I24A 4QXRA 3EGIA 1I7PA 1MA3A 4QUJA 3HXMA 2IRWA 2QROA 4U6SA 4YJKA 1KO7A 4HSEA 1MEOA 3LKZA 2GESA 3FMIA 3LXRA 5I4BA 3CW9A 5KTSA 3IESA 4MHOA 1N5IA 1QV7A 4IVQA 4XJSA 4IXWA 3AU9A 4G81A 1V3TA 1UXIA 1F48A 3NCTA 4JQYA 4MNTA 3MT9A 3DZDA 5LZ9A 2B5VA 2QTLA 2Y27A 4RS3A 3SU8A 4NBVA 1ULZA 4I1RA 2G9QA 4RFVA 2R7MA 3O2SB 4W5QA 3ZBUA 4MS3B 2JZOA 4L57A 1GWNA 1NQVA 2RHMA 3K30A 1Z4IA 1IAVA 4IKPA 4OFXA 2Q7DA 1UKEA 4KU4A 1Y5MA 1IUPA 5BW4A 4K6KA 1EP3B 1GHTA 5DX8A 4F8JA 2OVBA 4KITB 1BW9A 1L7RA 3ENZA 3FR7A 1M34E 2OD2A 4KK3A 4WA8A 5AKIA 2FZWA 4BNJA 3L8FA 3E48A 4G24A 4JWTA 4XFDA 4C9BA 4CT0A 4MWSA 3SOPA 1PYGA 5LQMA 4FDTA 2G67A 4QDJA 2BR5A 2CNWD 3ZTTA 3AHEA 3QELA 3OP1A 4L73A 1NY5A 2Q29A 3HK2A 1YE8A 3QWHA 1XD9A 1QO0A 1Z2NX 1P2FA 1ZQ9A 2HB6A 4WQMA 1EKXA 3PICA 3RTBA 3UK1A 1KI7A 4MAAA 2F3QA 1OX5A 4EM6A 3DEAA 5CTAA 4EF5A 4P81A 3IRVA 2BC9A 3SSNA 4OYLA 3MEQA 4KYUA 1MAUA 1QYVA 3A6EA 3FRHA 4D79A 2OCGA 5ESWA 5GAJA 5IMBA 2DJIA 1BCRA 1C3OB 4Z4CA 4CBVA 1KEVA 3HY4A 3HSYA 2QG4A 2I8AA 3HZHA 4B3JA 2MMGA 1NUSA 2V9ZA 3BS4A 4GGOA 1PVOA 2WMYA 2R97A 2ORWA 3K5PA 1OI7A 4GRDA 1LBIA 4QATA 3TEMA 1Y1RA 1GADO 2DEUA 1ESDA 4FJ0A 3S55A 4BFLA 3LS2A 2I1QA 4G0ZA 5CIWA 1GXSA 1TT5B 3KKNA 1RAIA 1N2HA 2N9UA 3KTDA 5I9SA 2Z6AA 2OL4A 3I53A 2ZB3A 4HLUC 3K0AA 3PWZA 2EHJA 4YLEA 3EGDA 1JFFA 3E5MA 3OU6A 4FYYA 4F9GA 4N76A 3SJAA 3ZI4A 1F14A 4HNTA 4NYJQ 3KR9A 4PGMA 3L1UA 3LMKA 4CE6A 2G40A 2CKDA 4FZRA 3T34A 3A37A 4OU4A 2G6BA 3SP1A 4CF5A 1C2YA 2BDTA 2OGSA 4XJTA 5LZ4A 3U48A 1SBZA 3UJ9A 4LVUA 5ES4B 1Y3DE 3F8WA 4A2PA 2WW8A 3ZYZA 1B93A 4F11A 3ASZA 4IDBA 4E33A 3ZD6A 3B6EA 3OPNA 3PC3A 1YQXA 3HZRA 1RVDA 1CB7A 3O7MA 2IXGA 3QE2A 5DGCA 2JAWA 2OCAA 3NM4A 1G4HA 5AJVB 2F1OA 5EQDA 5JRJA 1ONOA 1PJLA 1ZCAA 5IWAB 3U44B 1M83A 5D5PA 2JCXA 4ZHQA 2EERA 3GDHA 1T0UA 1US8B 3A6FA 4BTVA 3TIFA 3TCKA 1BU5A 1ZNYA 3GAZA 2JJ1D 1R74A 1ORRA 2Q5OA 2KSQA 1JJIA 1LGYA 3HDTA 4U8GA 2J08A 3KUDA 1HLDA 4I1YA 4UBOA 2X40A 2Z04A 2BFEA 4J90A 4OP2A 5DTQA 5HDBB 1ETHA 4TLCA 2K5UA 5KHOC 3DVRX 4RZ3A 2AOVA 3FPEA 4F4UA 3DT9A 3KJHA 3WRXC 5BMVF 5JH7F 421PA 4HKTA 4PRKA 3H11B 2I7VA 1VHTA 1Q1GA 5BN3B 2W6JD 3OC6A 1YZTA 2O57A 4YRAA 4MUBA 1P7ZA 1G5IA 1T8RA 2NU6A 2C8JA 2X6QA 1Z25A 5EP4A 1OLXB 5AKZA 1GNQA 4KR2A 2Q3CA 5LP1A 2JFOA 4FI3C 1ND5A 3EZFA 2P2LA 4HWTA 2YFHA 1OTXA 1E3WB 1F0KA 5ALMA 3AEUB 3PV0A 3T35A 3FNEA 2QLMA 2M6LA 3DKKA 1A5BB 1CQPA 1N6KA 1USUA 2IHKA 2Z4RA 4HAIA 4PF1A 1MX5A 1ODJA 2J7PA 3KOUA 4J7CA 3P0IA 3USCS 4EDHA 3A9CA 2DSTA 7ABPA 3PFFA 1CZLA 2X14A 3A2LA 1CY8A 1EWRA 1X1SA 3W5VA 5JW6A 2O7VA 4AKIA 2ZBRA 4RDCA 2LCIA 3AM1A 1JU9A 4L75A 1UK7A 2LV8A 3JRWA 3FCUB 1P2UA 2VNHA 3OFJA 3ETJA 2YIJA 4KIJA 1M6NA 2H1HA 4OGFA 3C5HA 3K6RA 1Z45A 1SHTX 3OWOA 1PVVA 3X2FA 1SXQA 3LCRA 3HY3A 4YFYA 6REQB 3NEJA 1NJFA 1WTCA 4E2FA 4O2BA 3EB9A 3DBLA 5TF0A 1UAYA 5KSYA 4NATA 5EP3A 2Z8YA 1VL2A 1E7SA 5CP8A 3CF2A 1W581 2FSHA 3JD3A 2FPUA 3DGFC 4N48A 3LUHA 1UJNA 5CB4F 4P58A 1TD9A 3E84A 3WKEA 4TMXA 3R44A 1L4HA 4TZ6A 4NCAA 1CUCA 1JGTA 2PMKA 6GPBA 1N2SA 3PNMA 2G04A 4AUMA 1C30A 3DAOA 2ENWA 2XSZA 3A1WA 4RCZA 3T9CA 2VH2A 3V8RA 4RDXA 2WOOA 2VFAA 2V45A 3LO8A 4CUJA 1ZH0A 1F12A 1I2CA 2BP7A 4LGCA 1FRFS 1V9LA 2FN9A 3GFGA 3VR2A 5AVVA 1H6BA 2ECPA 1WOMA 4ZAZA 3MRVA 3ZVLA 3KZXA 5JVDA 3GP8A 1WUIS 3ELDA 3M82A 1JLSA 3LXUX 2A5DA 2VIIA 4LA4A 2K6GA 4TX1A 3TRDA 5JQGF 1W4RA 3FMOB 3IOMA 4FS3A 4FGZA 5JISA 2ESRA 3HLTA 2PUWA 4HOYA 3P0FA 4QBIA 1UPTA 4OJTA 3S7ZA 5BVHB 3ZJTA 3D0OA 3NBYC 3RBAA 5J5CA 2HTEA 1C29B 1U2EA 3V7NA 2QE6A 4E21A 4DQVA 1QC5B 4XQEA 3QKSA 3OZAA 1EGAA 1HBJA 2PUGA 3M81A 1RR6A 3AB8A 4YA6A 1W4ZA 2DLDA 1YHNA 2CXXA 2QHXA 2YRXA 3EQ9A 3GJ3A 1NMZA 4H16A 4IVNA 4QYMA 5TGDA 3T61A 5K0FA 2DHEA 3M6VA 5AVOA 1E3IA 1P73A 3JAWB 5JPIA 2XTJA 1Z37A 2Z98A 4CQMD 2GO7A 2QM3A 1RD4A 2E4XA 1NUUA 1K4MA 4AWXA 4EPWA 1VE6A 3WAJA 1LX6A 3ZBPA 2D74A 5IDWA 2NXWA 3UMJA 1FTSA 1IMOA 1NLUA 4G0XA 1Z62A 4N82A 3IVMA 4HRAA 2JLUA 4D43A 1IHPA 4D8TA 4OUDA 1XEXA 4J3FA 1G5TA 2OCKA 1XMQB 1E2FA 4AQYB 1S8OA 3EXIA 4BNVA 5LUBA 4UHFA 4FNOA 2YZMA 2P90A 3R5TA 5AKXA 1O5OA 1WDMA 3LSTA 1OV4A 2DG2A 4IEFB 1W30A 4CL0A 1R1DA 2P2GA 3ASVA 4AICA 4XSVA 1NOIA 1E3JA 4ASUD 1E8DA 3AW8A 1KVQA 1UXHA 5C8VA 1QE3A 4FSHA 4HXEB 4V0RA 3ZJ5A 2CDCA 3I0NA 2IPMA 4Y6PA 4GMFA 4CTMA 1DC4A 1KJZA 1NMSA 3C3MA 3P8ZA 4FOPA 2X8JA 2C2KA 5H16A 1PGQA 1U3FA 1ATIA 1ULBA 3B78A 3DV9A 4AY5A 4G86A 3BFKA 2FCAA 1E9DA 2QVBA 1PDVA 4Y7CA 4L2IA 4YDSA 5KQGA 1M0SA 3NO4A 4L3VA 4N0QA 3WBJA 1XYGA 1PR6A 2I65A 2OEPA 2WZBA 4RZ2A 5L51A 3ZVNA 3VHXA 3UMMA 1KTVA 2EYQA 2WU0A 4GHWA 5D85A 4GECA 1N5JA 4FUTA 5IAJA 4H18A 3TOVA 2YINC 3BE6A 4KVGA 5U1PA 3RRFA 1MT0A 1AQLA 3HBNA 2BEVB 3O21A 4OK5A 3TW4A 1O97C 4DW8A 1BXZA 1VM6A 1OH8A 3R41A 4Q18A 4CU5A 3U6BA 4UD2A 4ID3A 1M8GA 1TVKA 1WS6A 2X86A 3B1ZA 5JS1A 1E2KA 1PBTA 2XKAA 1R5NA 3M3PA 5DGDA 5B6IA 2VK8A 2VJNA 1M2VA 1E0DA 1E1RD 5BOVA 3G5AA 1OU0A 3QVMA 2AOUB 3JS5A 2R4QA 3QBJA 3WL4A 3JYHA 3K8QA 4P98A 5EQJB 2PL5A 4JJ8A 9LDBA 3O73A 2AB0A 1NONA 1T1GA 5D3MB 1V5FA 3G7SA 3KEGA 1E5TA 1NIPA 3ZK7A 1H66A 2BBTA 1YKFA 2NSYA 4NFYA 2RD2A 4LZLA 1ZWLA 1P0QA 4TRNA 2KBEA 3L01A 3WDMA 5JSQA 4XWTA 2LCQA 1RZVA 3DEKA 3GLUA 1TYZA 4DLPA 1GPKA 1AQ6A 3W34A 3SJCA 3EOAI 3EH1A 3IB3A 3OOEA 5FPSA 1KEKA 2DM6A 2XCQA 4HQFA 2P3LA 5E9AA 4ZVNA 3PCRB 3QVWA 5JATA 5H68A 3HCCA 1W36D 1B00A 1J00A 4QPNA 5ALUA 3WIEA 4KO2S 1UJMA 3Q5DA 3O8LA 2WAAA 4X95A 3S7TA 2QXYA 4DF3A 2GCEA 4QD3A 1QIMA 3A4NA 3UA4A 4B9AA 3HXQA 2XLCA 3QKRB 1N34B 1KI9A 1IATA 1TO2E 2E5FA 3EXEA 2Q50A 1WD5A 4I14A 3T5MA 3ZS9A 5I7EA 1CJMA 1QKJA 1YNOA 3CLSD 4QXPA 4ITRC 1GKKA 1I3MA 3GHHA 4AFNA 4GMDA 1CVIA 4G4JA 1G59A 1JKMA 3C97A 1IG3A 3P96A 4KWTA 5BRNA 3TDKA 4ARCA 1GQYA 1J99A 4YJFB 3PQ4A 2I34A 1NBMD 3U0VA 1PQPA 1V3UA 1B2RA 1P2VA 1NVEA 1PT7A 1QHEA 1UJBA 4QYIA 4LRUA 1F8YA 5F23A 2A1UB 4DR7B 1QH8A 2PA0A 1V5EA 2ZT7A 4DBLE 1O58A 4UEJA 4D02A 1P5HA 5JXHA 1DAMA 1GZHB 4JUIA 5M29A 2HRQA 5CDUA 1L5RA 5AK0A 5LXTF 3UMBA 3V4LA 3AK4A 1C9MA 1RMTA 4DNQA 5BWNA 4X24A 3WGZA 2RKWA 2YHUA 3NTUA 4LYGA 5AVQA 2GB4A 3C1UA 5E38A 2F62A 5JCXA 4LJ9A 1E98A 3P9CA 3S4YA 4YRBA 1G16A 3HXLA 4ZVTA 1WVMA 2FP3A 3BH0A 3OKPA 3AEKB 4UHHA 5DGHA 1LSOA 4C4YA 2A0XA 2ZYWX 4HDSB 2D2IA 1JHOA 1DAOA 1RFLA 4ZPXA 1U8YA 5L9AA 4JIMA 4L5CA 3A6DA 4MITA 4D0GA 1NGSA 2ROQA 4Y9UA 2NZ8A 3VR5D 5BOSA 2I03A 2WKPA 3C6XA 3F3YA 2ZWAA 1L4EA 3U1VA 5ELLA 3JYLA 5A3JA 4BVEA 2H9AA 4GE0A 3D4OA 3U13A 1CD5A 3TGWA 2B30A 1SBNE 4AIRA 4PE5B 1AXEA 2JLYA 3ACBA 1U28A 4CL8A 2QLTA 3S70A 3Q8MA 2YYSA 5M3BA 2D13A 3U80A 3DTVD 3JVIA 1TTPB 1UK6A 4DLUA 1ESNA 3ZCUA 1FQWA 1JDJA 2IK8A 3PVZA 3IV7A 1JA1A 2JGNA 4BKRA 4G5YA 4OHYA 1QYWA 3WHKA 5K0NA 3H16A 4B3IA 1MD9A 3VYVA 4TPKA 4TN5A 1QP4A 3ZDAA 1BROA 2IVFA 5MF6A 5FPKA 4YS6A 5FF9A 2A14A 2X5OA 1ZUNA 1JJVA 2GA8A 2QM8A 3HP4A 4O1IA 2JK0A 3HYNA 1BD4A 3COPA 3LYLA 4MLPA 5I7WA 1O6BA 3SIWA 4KUGA 3VX3A 4B1FA 5ALPA 1OLSA 4GI7A 2E2WA 1IE3A 4AMBA 2F67A 2JFYA 4PZ0A 3UJBA 1QIKA 2KS6A 1N9GA 2XVAA 3FJOA 4G36A 4PAMA 1EZ4A 4M1MA 3W2FA 4HGNA 3Q8LA 2HGZA 3HZOA 1UJ6A 1I5EA 2XYQA 2NU8A 1HTWA 2RGBA 5IKPA 1TW3A 4MP8A 4RA9A 3RYHA 2AD1A 1FNSA 1NPYA 3SFTA 3DDCA 3FNBA 2NNLD 2PZAA 2VDLB 1SU6A 1W2GA 1CJUC 3DOFA 3QVJA 2NTVA 5EMKA 3T99A 4ZI7F 3DWEX 5MFZA 2O3UA 1SG0A 3DP9A 2YMPA 3TOZA 2CYCA 3GA7A 3NZEA 3CVXA 4M1WA 4DLKA 5B37A 4DHWA 9LDTA 4BMPB 2D3TA 1CXZA 4NCXA 3QW4B 4HYQA 4D74A 1PZNA 2B94A 1OASA 5KREA 1ZMTA 2CY0A 1G5HA 1Q0ZA 4URWR 2XXAA 4KO8A 5FWYA 1H2FA 1OB2A 2GHRA 1SULA 3R7DA 2QR2A 5GPBA 2X0EA 1FYFA 4AZVA 2XMQA 3DE3X 4GOLD 1UZUA 3HADA 2APJA 3R3UA 2WT8A 1XJWA 1KEPA 1SBQA 3OE7D 3CX6A 4IMJB 4KYTA 1NI4B 3KKOA 4YBRA 1XCOA 3GEDA 2O3TA 3RASA 4ARSA 5HWSA 4WKCA 3ZWKA 3FGPA 3VISA 2WHRA 2F8LA 3BT7A 1E4YA 3J80A 4UZSA 3UC5A 1XMJA 2AJBA 1G18A 2Q6VA 3F7OA 3IDFA 3K9WA 3AIIA 3DVAA 1RQPA 3JQGA 4JJZA 5KQSA 3OX1A 1T5OA 3H2IA 1EDBA 3CUTA 4X92A 3AESB 2NZWA 3B7GA 1VJGA 4W4TA 3FFAA 3WMEA 3O4VA 1BWPA 5HZKA 4IJ5A 3THWA 1OV6A 4RSGA 5I4CA 5DIZA 3RROA 4JQSA 2H1LA 1KI4A 1QNLA 4KW7A 2WHQA 5C4IA 5IBPA 4XDYA 4Q9DA 4Z53A 2RAPA 3JQ9A 3CB4A 4EW1A 4YMVA 4CXMA 1H0KA 4PAWA 7MDHA 1P7CA 1SOAA 1LF5A 2EFEB 3BGSA 2OY0A 1IEVA 5EQFA 2DH6A 4CVNA 2LWIA 3O83A 3EXHB 1I0ZA 3KLMX 3L6BA 3E5NA 1FDOA 3IS3A 3V4RA 1SU8A 3WYDA 1TI7A 3LA8A 2IYSA 2V7WA 5AW4A 4KXQA 1OBFO 1Q2XA 1X8LA 4NDZA 4R8RA 2C2BA 4FGWA 4NBKA 3SYKA 2O0JA 2ZRAA 2B35A 5JD3A 2FDCA 2DTXA 2ECOA 2WMDA 2VHJA 3R2JA 4HZGA 1NIJA 2YUTA 3MTJA 2HA0A 1RHQA 4Q4AB 1SC9A 3SX2A 3FCEA 2BFCB 3ZWBA 3AL0C 2IYRA 2OUKA 1VXOA 5GZ1A 5D2CA 3WLRA 3ZE2B 4CEHB 2X0RA 3A2KA 1CLEA 2FDRA 1FP6A 3E4CA 1A1SA 4HEHA 2IOQA 3Q87B 2V54A 4REMA 5FWXB 1JHMA 3I28A 3OM8A 3TZQA 3S5UA 5TQVA 3T9BA 3Q7TA 4M54A 4F5DA 3QPDA 5K2MA 1CQJB 3X0DA 3C16C 4XWGA 4TWZA 4G84A 3PFGA 3PRHA 3GJ6A 1BHQ1 1CRWG 3AKZA 2C78A 4KFRA 4FDVA 4UUOA 3CRVA 4HL6A 1VIAA 5IJAA 4CN8A 4N12A 1BHJA 3B3GA 4P93A 3A4IA 4YONB 4EECA 1LI4A 3NV7A 1JPJA 2JBWA 3QOFA 3ZE9A 3EWSA 2IU4A 3RFFA 4AKEA 2MSLA 1II9A 4M1YA 4QARA 1GYQA 3SJUA 3U61B 1I6KA 5TQ2A 1GTRA 4QDUA 3D02A 3BTUA 1JG3A 2FI1A 5LZ5A 4JFRA 4LBVA 1PHPA 4KZKA 3TUIC 5K0GA 5EJ6A 3DXFA 1J6UA 1JPUA 2ZJOA 3NETA 3T9DA 2ETVA 2GBGA 1J9EA 4CYMA 1B23P 2L82A 4XCXA 2PWZA 4YRSA 3OQHA 3QY9A 5CA1F 4A0GA 1UKZA 2UVDA 4D0RA 1TC2A 1WEKA 4L5JA 1DS6A 5IK2A 2YZGA 1D2CA 2JF0A 1K2VN 1QIEA 1F8FA 3P9NA 1T2DA 2SICE 5FTWA 1XMIA 2BIFA 1Y7PA 1RKXA 4JGBA 1XMPA 3JZMA 4I08A 2D8AA 4AS1A 3CF6R 3EIWA 3G2NA 2I3ZA 3S2ZA 3ZHOA 2VL7A 1EUQA 5LU8A 4BB5A 3RC8A 2OLJA 2YOHA 2QR5A 2VZEA 1E1DA 1DTWA 1EVKA 1RXIA 3EDCA 1C7IA 3BFJA 3C6BA 2V6JA 3JZIA 4FX2A 5DCUA 5FOXA 5HFAA 1ZO8A 1QH9A 2B1JA 3IBCA 2ZRKA 3MTAA 1IN8A 5C53B 3INGA 2AFVA 4YFVA 4C6TB 2ZU6A 1LXCA 1YS9A 1ZUWA 4TSRA 1NW3A 3D3NA 4H60A 3DAPA 3F0TA 2B98A 4Q4DA 2C84A 4NBNA 2O06A 3BDVA 4H7DA 4PHGA 2QPOA 1CZRA 5K09A 4M0CA 2QTHA 5FR1A 2UKDA 5K6TA 4BO6A 1RP1A 3MAAC 4RORA 1LTHR 4ENQA 4ZI2A 2ECQA 5T8KC 3ICQB 1ZI9A 3I04A 1B74A 4F21A 3JARA 1M34A 2YZ7A 3UWOA 3I8SA 4WZAB 3MMSA 1UANA 1L7DA 1ZD9A 2GYVA 4ZREA 4M0LA 5K0SA 2BDEA 3A2NA 3CPJB 3PJGA 2WU3A 2Q0SA 1JWAB 1XRSB 2WF5A 4LE0A 4MUFA 4IS3A 3OZFA 2VRCA 3UGKA 1MG0A 1TOAA 3NAQA 4PYMA 2XXJA 1QG0A 2E37A 3D6HA 3NHPA 3OQVA 4MUNA 2DBVO 4ZCPA 4N8EA 4PX3A 1XRQA 3K94A 1I6MA 4I50A 1Q0QA 1W4BA 4XAQA 1ZM4A 3VU9A 4CF3A 4YYZA 5GJVC 4W5TA 2RGNC 3IPYA 3MGBA 3OZUA 3PIDA 1EINA 3OCJA 1BO6A 5TT0A 1EXWA 2A2ZA 2QMZA 3SQMA 3TSOA 4MV3A 1F20A 4NIMA 4P0QB 2RH8A 1V8BA 1NNUA 1PL0A 2NU9A 3IT0A 1CDDA 3AONB 3AY6A 3FSGA 4YUVA 2O7SA 1A3CA 1GT91 3PTZA 2W6PA 3ONWA 3S29A 3OJWA 4JLPA 4LTMA 1WXWA 4AY6A 3EFOA 3QUCA 4HNGA 3T7KA 4MDFA 4R8KA 1VB5A 3EEQA 3W8RA 1KZ9A 3V7FA 1U0OC 1ZK2A 4IIJF 3T94A 3D8NA 3RYTC 4ZOCA 4DNXA 2WTAA 2R00A 1D4AA 2D1YA 3VTFA 4UTRA 1M2WA 1I2ZA 3I72A 3CC8A 1WCYA 4C30A 2CF6A 3LIPA 5EJ8A 2ODEA 2A9QA 1V41E 2EJVA 1HSZA 1U2RA 5FBWB 2AN3A 1RRCA 4OA5A 3RTGA 5EG5A 1MFPA 4BO4A 3QP9A 1DEAA 1MHPA 2VWHA 3CVVA 3CRQA 3L8HA 1T4DA 3GFRA 3V33A 2P9FA 2R66A 1UUFA 4NDAA 1G291 5IJ9A 5M34A 5FPTA 1Y3CE 3W3AD 4DIDA 1C7QA 3GL9A 3HLKA 1I4OA 4ZMRA 1RQNA 1YKGA 3W90A 4QREA 4RDIA 4QHTA 2YZ2A 4LMRA 1EUCB 1I1HA 2CVZA 3PQCA 3UJ7A 2NO6A 4DLNA 3IRUA 1X6VA 4NCNA 1A4RA 1U3UA 4QXMA 3IDOA 3SN6A 4RM2A 4AS2A 2OKCA 2ZIXB 4BLOA 3P9RA 2IXEA 2VT2A 3DM5A 2ZU0C 4JJKA 4JP8A 2BE9A 4RZUA 1SWWA 4Z3KA 1FNCA 1UMCA