4AJIA

Rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajiA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajiA02
1SEVA 3H2ZA 3E1KA 2GZ1A 1A5ZA 5JYEA 1ZJYA 4DC0A 1KOLA 3DHYA 3RCBA 2HMVA 3KM0A 4YVFA 1N5DA 3CMCO 1AXEA 3OHSX 3LSYA 4WLOA 5F5NA 1L1FA 3DZIA 5C5IA 3O26A 5HBRA 2DQ4A 3I6QA 5AXBA 4IUYA 4B4WA 3DTYA 5DOVA 4HP8A 1AHIA 1L7EA 5IXYA 5EN4A 1MGOA 3Q11A 1T2DA 5T67A 4PG7A 1T24A 4RZIA 4PLGA 3DFZA 2AXQA 3X2FA 3F5QA 3N74A 3JD3A 1UZLA 3KYDA 5G0WA 1NAIA 3QSGA 2FZWA 4XGIA 4XJSA 3RUHA 3F46A 4JN6B 4YRDA 3ZZNA 1U4SA 3DO5A 4EUFA 1YB4A 5DN9A 2BFOA 4CR6A 3JQBC 2A9FA 1ZSVA 1ZIDA 4RV9A 2B36A 4MPDA 1BDMA 1UR5A 4GAEA 1N7GA 1XELA 3B6ZA 3ORFA 4U8GA 2HQ1A 1RM5A 2VRBA 4GH5A 3GGPA 3K2BA 1B15A 1UP4A 2PKRA 2X9GA 4I5GA 4K6FA 2NVBA 1U5CA 3NJ8A 4IXWA 5BNTA 2HRZA 3A14A 4Y98A 2Y1EA 3DBHB 1NFRA 5ITVA 2YV3A 2DTDA 4B3HA 3WR5A 4D42A 4KTTE 3Q3CA 2Z1NA 4OKIA 3SBOA 4OHUA 4FFNA 2CFCA 3GOHA 4FBGA 3ZWYA 3ZI0A 2ZTLA 2HMTA 5ES3A 3VTZA 4AJEA 2LDBA 3B1KA 2VZ9A 3JQFC 1SB8A 1E3WA 2W4QA 1SEPA 3GVXA 4Z6KA 5HWSA 4PLZA 5EPOA 5CG2A 4FB5A 2GASA 4ZA2A 2ZYGA 1ISFA 1Q7GA 3PDUA 4TRNA 4RCVA 4DXHA 2EIHA 2VRCA 3OQBA 3TSCA 1DFGA 2VYND 3DZJA 4IMPA 5H81A 1IB6A 4D43A 3C7AA 2YUTA 3GHHA 1A72A 1VPDA 1C0LA 1M66A 4OXNA 3M2TA 1DIGA 1DC3A 3I9MA 4J2OA 4AVYA 4J0FA 3DBLB 1E3EA 4CQMB 1T1RA 3OA2A 3D3EA 4RJTA 2XXBA 2WJPA 3KBOA 4MIOA 1YS4A 3IJPA 1XCBA 4CUZA 3WTBA 4FW8A 1X14A 2B5WA 3QVOA 4NJMA 4ONEA 4P22A 2VUTA 2GSDA 3I83A 3MJEA 4IS2A 1ULUA 3ZU5A 1HXHA 4WLFA 5JDIC 2WWRA 1HKUA 1ONNA 4FOOA 2ZK7A 1LJ8A 1YDWA 4URFA 4RQTA 3WJAA 1C0PA 3PLRA 2WYVA 1DHTA 2W98A 1VKOA 1DJQA 1DC5A 4YRAA 1ZMOA 4CMGA 1EQUA 1HLPA 4GWKA 1J0XO 4FFRA 1RPNA 1PZEA 1C0IA 3DAPA 1KIFA 3E03A 3WNQA 4CV3A 5BNIA 4CPDA 1W0CA 5FI3A 3FR7A 3RAJA 1M67A 5CAEA 1MFZA 4OSOA 4F45A 1JWBB 1P0FA 3H5RA 5TJ9A 1UDBA 3D4OA 3GUCA 2VHXA 3DWFA 3I4FA 3JQAB 1DLIA 3EUWA 2E48A 1GYQA 1PR9A 1PS0A 4EI2A 1JKFA 2YJZA 3M1AA 5JAMA 4GL4A 1U9JA 3V1YA 1VL8A 4AJHA 4IQGA 3NGLA 3DL2A 1X1TA 2Q1SA 2QRKA 4CMAA 4CQLB 3DAGA 1Q2XA 1PJBA 2VOEA 1GFSA 4CL8A 4YA6A 2DUUA 3MJCA 1Q0LA 3D1LA 4I08A 3ETGA 4JGBA 3Q2KA 4LN1A 3IP3A 2ZJ0A 2BI8A 4OKNA 5CPBA 4KZPA 1MC4A 1QYCA 5COBA 3ZHBA 2D8AA 3JQ9A 5AXCA 1K89A 3WGZA 2P9CA 1U7HA 4J6FA 3UAGA 4MP8A 3T4XA 2P9GA 4LRTB 2VT3A 3GHYA 3HB5X 1U4OA 2I76A 4BQRA 2VYNA 4EJ0A 4J9UE 3GA0A 1LA2A 2BH9A 1SAYA 3JQ8A 3WJ7A 3PJEA 3E9NA 5COQA 2W2LD 1QYVA 2G82A 3GFGA 3EMKA 3MJVA 4PZEA 3E5RA 4I8XA 3WIEA 2YV1A 3PFFA 1XKQA 4R5MA 1ZO8A 4TQGA 2I67A 4HWKA 3GC6A 1EBUA 4E5KA 3KEOA 4OH1A 3GZNB 1VL6A 4K28A 4LCEA 1ADGA 4Y67A 4YQYA 2X22A 1I3NA 4JNKA 1DXYA 1GPJA 1LU9A 2BGMA 4PVCA 1AUPA 4Q9NA 1LQTA 3ZNQA 5I9NA 4XD2A 4TVOA 1GD1O 3ICPA 4R69A 4WKGA 1IHYA 7MDHA 1TT5B 4ITUA 4IMRA 1ONOA 3S2FA 3PRJA 3TZCA 5L7TA 4J43A 3ROKA 3RKUA 1IE3A 4ZICA 2NNLD 2P5UA 2X0IA 3LDHA 3U3XA 3L4BC 1XIVA 3VTFA 4CM4B 4MO2A 1T1SA 4YCAA 4FR5A 4DTIA 2ZCVA 3AU8A 3FF4A 4YXFA 1HSZA 2ZB7A 4BNZA 4NDNE 1H2BA 3PVZA 3H9EO 4WASA 5L7YA 1EK5A 1IPFA 3OH8A 2EGGA 3I9OA 3KLMX 1EUCA 3OBBA 1Y6JA 4RL6A 5TIIA 3KB6A 4IDAA 4Z9YA 3F1LA 3CSDA 1ZK2A 1FDVA 1HZJA 1LDYA 1PJ4A 3K9QO 1I10A 4CQMD 4A27A 3BTOA 1KEWA 2Y1GA 3RUAA 1BW9B 2A35A 4BNHA 1MB4A 3P19A 1E77A 4A0SA 2DU8A 3H2SA 5KKAA 1X13A 5BSHA 1P1KA 3L6EA 1LQUA 2PGJA 4GMFA 1WPQA 4H16A 4JX8A 1EVZA 3GRKA 4ZQEA 4GLLA 4OQYA 4BKOA 4CLXA 4AG3A 4CODB 1HDRA 2PR2A 3D64A 3ZV6A 4RDIA 1B26A 1M76A 3PLNA 5KKCA 3UCEA 4P38A 2P5YA 2IEDA 2PK3A 4FS3A 4UEOA 2AG8A 1U3UA 3E5MA 3EC7A 3WICA 2IDZA 4J16A 1NR7A 2EWMA 5GMOA 3W4JA 2GN9A 2JL1A 5C7LO 2OBYA 3UW3A 2W2LA 4GI2A 2YZ7A 3FN4A 1PX0A 2PKQP 4WCFB 3RIHA 3A28A 3ZWOA 1V0JA 2JFGA 4JJFA 4W7IA 5JXWA 3U4CA 2EW2A 3JQAD 3C8MA 1PGQA 3P5SA 1HDXA 2J5QA 2JFFA 1LDGA 2DC1A 1N2SA 2X7HA 4AFNA 1YBAA 3H9GA 4CJXA 4DIOA 4IXTA 5MGBA 4MINA 3ICCA 1O95A 3DBHA 3WFIA 3LU1A 4FJ0A 4HUJA 1B8UA 3DHNA 4RVHA 3U62A 3HDYA 4MVJD 1TLTA 5CEJA 1N7HA 4XYLA 4NBUA 1BG6A 1LLQA 4F6LA 2D5AA 4NR0A 5TSDA 1LLUA 3LC2O 1QRRA 1LX6A 1QV6A 1EMDA 2GERA 5B4UA 4RQUA 3PHIA 4Z0TA 5BT9A 3H5AA 3U49A 4FD3A 1YVEI 3DC2A 2D1YA 3PFWO 4E2YA 4MKRA 1HYEA 1TA4A 2HDHA 1GYRA 3OSUA 1ZK3A 4S3MA 2VWQA 2EGHA 1UXHA 3WFJA 1FDWA 1I2CA 3SXPA 2JD0A 4TZKA 1KC1A 4FFMA 1CRWG 2H1SA 4GX5A 1YBVA 1NTOA 4Z9XA 3RUEA 1R66A 2GF2A 1LLCA 2C29D 2Q50A 3F4BA 1XQ6A 1UDCA 3PIDA 2EF1A 1ISGA 2C07A 2PGDA 3DBLA 1DIRA 3VHRA 2ZB4A 3ONEA 5DBGA 1Y8RB 1Z45A 4CQMA 4YAIA 1NX6A 2OP1A 3WMWA 3AY3A 5JAZA 2Y68A 5JNLA 3X2EA 3JYNA 1TB4A 1VJ0A 2D0IA 3R6DA 4B4UA 1U2DA 1MA0A 2HK9A 3T7EA 2PNFA 4EJMA 3JQ7B 4U6QA 3VPSA 2VWPA 2C7GA 5JDCA 3TZKA 1GDHA 5KOIA 4UAGA 4Z0HO 1I32A 2O3TA 3CE6A 4GX2A 1XLTA 3SJ7A 2J3HA 3EVNA 4R51A 1E3IA 3Q9NA 1KVRA 3LLSA 1R15A 4WEOA 4HBGA 1CEQA 2EKPA 4U5QA 4MVJI 4BO8A 1DOHA 4ND2A 4D3FA 5CDYA 2ZYAA 3GY0A 3EVTA 3MWDB 5GZ3A 4IDCA 4MVJH 1OAAA 3CIFA 3JQAA 5TLSA 3DTTA 3WX0A 4IS3A 2DBZA 3OF2A 4RLSA 4ZQHA 1PQWA 1VSVA 1ZXLA 2HMSA 2FOIA 4YJDA 3JD4A 3QV1A 5LDHA 1EK6A 5EQDA 1VRWA 4CLDA 3TDKA 5IAAA 3ZGYA 4BKRA 3S1LA 1NQAO 2Q2WA 3L0DA 4RPJA 4CQLA 2V6MA 4P4LA 2CMDA 5IDQA 1DB3A 2IZZA 3R1IA 3R0IA 4MVJA 3H9UA 3NTRA 1QORA 3QVWA 4P4NA 5DULA 4BO7A 4ALJA 3AOEA 3WYCA 3ZDFA 2V7PA 1BRMA 1YJ8A 3JQ9C 3FPLA 5TT1A 2Z5LA 1LLDA 1YBMA 5BSGA 1I2ZA 4J0EA 2DBVO 3WOHA 4R1NA 1ADCA 2VHWA 3JTMA 2D2IA 2JCVA 1G1AA 3ONDA 4DWVA 4G5HA 1BMDA 2X0NA 2IZ1A 5F21A 5TT0A 1L7DA 1Z75A 4CMIB 3BHIA 4YJGB 4N5MA 2NSDA 2NLOA 1YQXA 4QFDA 4XWYA 1P44A 4NZ9A 4GKVA 1YKFA 1OFGA 3DBVO 1V3VA 4UVHA 5ER9A 5ADHA 3WQSB 3AK4A 4IQ0A 1C1DB 1H94A 1LXCA 3C1AA 4MIEA 3IP1A 4PG4A 3V2HA 2ZJ1A 2R6JA 4NNJA 1ZH8A 3DZHA 4E13A 3OJLA 1Y5MA 3PDJA 4D46A 2OUIA 3BZUA 3AM4A 4GVLA 1R12A 1HE5A 4DPLA 3WWYA 4FFOA 3U0BA 5KCZA 4JROA 1DFIA 5K0ZA 3FBTA 5T57A 4HFJA 4BNMA 4BNFA 3GZNA 3OFSA 2O4UX 4BL5A 2C54A 1HEUA 1FF9A 2Y99A 3GMDA 4EITA 2IE0A 1I8TA 2Q49A 3FI9A 2GYYA 1ENOA 3EY4A 4OM8A 3RD5A 4XQEA 4Q3AA 3SC6A 1F06A 1TT5A 3AUTA 3QRWA 4NU5A 3WSWA 2PD4A 3GFBA 4PN3A 3GRPA 3SVTA 2XAAA 3UCXA 2HAEA 3GEMA 3H7AA 1CF2O 4CM4A 4NQZA 4GX1A 4OJNA 1PTJA 5A5FA 1WW8A 1XQ1A 2G17A 4FC6A 4FOSA 3TN7A 1XSEA 5KIAA 3ASUA 1MC5A 1NFFA 4LSMA 5G0SA 2PLAA 1NASA 4KWIA 3NEPX 2FRDA 3FWZA 3H9QA 3TRIA 5KWEA 1CERA 2PZLA 4MP6A 1VL0A 4MP3A 5CDTA 1U8FO 4FIZA 3O4RA 4L74A 1DIHA 3BIOA 1R6DA 1ORRA 2JJYA 3WLEA 4BNYA 1GAEO 4DREA 1Z7EA 4X54A 4DQXA 3HNPA 5ICMA 1PJCA 3SC4A 3E9MA 4D79A 2JD1A 1U1IA 1BW9A 2VWGA 3I52A 3BMNB 3RBVA 4GBJA 4ZRNA 3RUDA 4DIFA 4EYEA 2TMDA 1UXGA 4L4RA 1E7WA 3A1NA 1PGPA 1RKXA 2ZB8A 1EE2A 3PQDA 4RLHA 1BGVA 3K92A 1ZVMA 2WYUA 1U3VA 3WGGA 2PZJA 3KO8A 4E5YA 4L73A 5KVVA 2VNSA 5L40A 3QIVA 1E3SA 5I9MA 2W8ZA 3FBGA 3G3EA 3WNVA 3ZV4A 4TRMA 2POQX 2JAHA 4WCFA 1E6WA 4E6PA 2E49A 4JQCA 4LVCA 3PXXA 1U3WA 4NFSA 4ROSA 5L53A 3EYWA 2CVZA 3NAQA 4B3JA 4WCDA 5CHEA 2NTVA 1PR3A 1ZCJA 3OQ6A 4ESOA 5ITWA 1EDOA 4DMMA 2NU6A 5AYVA 5H83A 3WYEA 1KY5A 1ZXBA 3BYZA 1KC3A 5JAIA 1EVYA 5CEEA 2HLPA 3UKOA 1E7SA 3S2IA 3GT0A 5DBFA 5TGDA 5BR7A 5TQVA 4BIIA 2FZEA 4BB6A 3OJFA 9LDTA 2AG5A 3Q2IA 3GUYA 2HJSA 3KYBA 4ID9A 3WQQA 4GVXA 1GR0A 4D3DA 1DIAA 1E7QA 4CMCA 5MDHA 2EHDA 2X9NA 1PJLA 3AM3A 3K5PA 4NK5A 4PLPA 5C37A 1Y9AA 1DRVA 1F14A 3INRA 4WUVA 3GEDA 1JTVA 3K2EA 5U1PA 2ZYDA 5BSEA 4W9NA 3NYWA 3PHLA 3TF5A 3IAHA 3M6IA 3AOGA 1MG5A 1P9LA 1ONPA 1RWBA 1XU9A 1ZMTA 4ZQBA 5G4KB 4BNNA 5DP1A 5ER6A 1Y8RA 5KVCA 1A4IA 3PEFA 3HADA 1X15A 3NUGA 4DRYA 3N58A 4DA9A 2GCGA 4JIGA 3LT2A 1K0UA 4BVAA 5THQA 1WZEA 2WSBA 2SCUA 4LW8A 1LSJA 1HE2A 1GTMA 4IBOA 5EERA 3JQ7A 3M2PA 1H6DA 2LDXA 1I24A 4Q3CA 3W8FA 2EERA 4NFYA 5L51A 3L77A 4BNTA 4EZBA 3Q9UA 4E0BA 3SJUA 4A10A 5HA5A 3A4VA 4RVSA 2FR0A 2FSVA 4J90A 5K6AA 5L7WA 4HFRA 3BXXA 4I9NA 2CF5A 4R54A 4U0JA 1YGYA 4B8WA 3ZWMA 2NTNA 4RVUA 3E48A 3ZHZA 1ISJA 1V8BA 1E5QA 4N5LA 3WYBA 4PLCA 3LZ6A 4N18A 2OHXA 3OM9A 4CM5A 3MTJA 5C7OO 3AOEC 2Z95A 3AM5A 2PWZA 1FDTA 1WVGA 2Q4EA 2VZ8A 4E4YA 3DZKA 3V5NA 3H6KA 3PJFA 1R0LA 4E5MA 1DO8A 4J4TA 4ND1A 1ZK0A 3RC7A 3EDMA 4Q3BA 4UVGA 4QECA 2PZKA 1MX3A 2CDBA 2Q1TA 1EUZA 2VQ3A 3O8QB 4XYEA 3OP4A 5A9SB 5L4SA 3A9WA 4J4HA 3PGXA 2AEFA 1NM5A 3LYLA 1QR6A 4ZRMA 1UP7A 3IIEA 4M8SA 4CMIA 4UUOA 3GPDG 4YJGA 3WGTA 1AN9A 3BTSA 3GNTA 1GYPA 2B4TO 5L9AA 1XYGA 4IJKA 2X1HA 4IZHA 4IZIA 3TFQA 1MLDA 1ZK4A 4OXKA 4RGBA 3OEWA 3OIDA 1PL8A 1C1DA 3ZU3A 3S2EA 1ISHA 1EFKA 1QYDA 4WJZA 4XCVA 4JJIA 3WGOA 1SB9A 3DQPA 1Q0QA 3QWIA 5CFZA 4HKTA 4DPKA 2WE7A 3D0OA 1R0KA 4DL9A 2VTDA 1X7GA 3DDNA 3ROQA 3ZV5A 1YE3A 1ZBQA 3JQ6A 1P77A 3WGIA 2Q1UA 4GQAA 4ZU3A 1E1NA 3GK3A 3PHGA 2P68A 4NIMA 1ADBA 2OBNA 3GDFA 3H9JA 4MVJG 2IXAA 1GCOA 1VSUA 3BTUA 1DPGA 3M1LA 4AJKA 4D7AA 1BHSA 4ND5A 1N8KA 3KYCB 3DMYA 4XEHA 3WG9A 2QW8A 2J5RA 4HNHA 3VAZA 5JCJD 1V6AA 3MOIA 4BO9A 2X5KO 4OQZA 3VPXA 1HYHA 1K2WA 3HSKA 1ENPA 3MJTA 5TRTA 5IJZA 4E2WA 2Q4BA 3DOCA 2PY6A 1T2FA 1FK8A 4OSPA 3OICA 2NQTA 3RC1A 1XWFA 5KJ1A 2NWQA 2H9IA 1ADFA 3HE3A 3RASA 1BXGB 3DEYX 4I5DA 4IGEA 1GZ6A 4CMJA 4NFHA 3S2GA 5CG1A 3G1UA 1DLJA 3KXDA 3ZNOA 1PJTA 4A7PA 1W8DA 1O8CA 3ADPA 4QFCA 4EEZA 1PL7A 1R4NB 5A3VA 4GLOA 1A4UA 4G81A 3ETEA 1WLYA 4XIJA 4D3SA 1U2GA 2A92A 2Y66A 4Z9FA 4J1QA 1B0AA 2Z1MA 3GVCA 3MZ0A 1YO6A 1V35A 2EEZA 3GNQA 4AJIA 1QMGA 1HTBA 3BMNA 5JC1A 3LF1A 1Y7TA 1BSVA 1SCUA 3HDJA 4MJLA 5DCYA 3GMSA 4XDYA 5KVSA 3V2GA 2GPTA 2O48X 3O03A 2JCXA 3DXFA 4NJOA 3ENNA 3FNHA 5IDXA 4ALMA 4BV9A 5GY7A 4WCFC 3D5TA 1IL0A 3H3FA 1QLHA 3AY6A 4LRSB 3B1FA 2CDAA 2Y05A 1KERA 1W4ZA 4XGKA 4TRJA 2X8LA 2O7SA 1K5HA 1PGOA 1JA9A 2FY8A 2AW5A 2G5CA 1KVQA 2QRJA 1DBVO 5ENVA 5U9CA 2GZ3A 4BO3A 5ILGA 3IS3A 2OXIA 1UZNA 3ON5A 5L95A 2Y1DA 1YRLA 3F1KA 4DLBA 3FNGA 5F1OA 1H9BA 3D3WB 3RI3A 2V65A 3QJ5A 2RCYA 3K96A 5I8ZA 1U7TA 2CF6A 3OJOA 1D7OA 1VE9A 4D41A 4XB1A 1PIWA 3COSA 3RSHA 3ZW8A 1DEHA 3V8BA 3DZBA 5JCJA 4O63O 4YT4A 2UV8A 2EJWA 2AQIA 3L9WA 1IULA 1Y9EA 1AE1A 2E4AA 4Q3NA 5A06A 1JVSA 3BAZA 5JYDA 2DUWA 3PZRA 4M49A 4QO8A 4XQCA 3ZWVA 2DM6A 3K8ZA 1OOEA 4W9NC 3RJ9A 3ST7A 5TNXA 5IFLA 5KJFA 4QXMA 2Y93A 4B4OA 3CZRA 4PFJA 2PD3A 4BO5A 5B37A 2EP5A 4J7CA 4R4JA 4QX6A 4L9RA 1CIVA 1LTHR 2W2KB 1GEEA 4KMSA 2J6IA 3GGOA 2BD0A 4PLHA 2YYYA 3DBRB 3FR8A 4GGOA 3WXBA 5G4KA 3H65A 1I33A 1QXSA 5A1TA 3H8VA 1ARZA 3W6ZA 1F0YA 1EFLA 3C1TA 3EHEA 3DOJA 4J4BA 3UCFA 1LDMA 3QWAA 1WDLA 1HLDA 3GF4A 3E8XA 4LVUA 4YAGA 4KDFA 4N54A 1AGNA 4BKUA 3FSRA 2QX7A 4CLOB 4O5OA 2O3UA 1NHGA 2CVQA 3IUPA 3WBFA 1PL6A 3U9LA 1ZJZA 1C3VA 3B20A 4DQVA 5K6AC 1HF3A 3A06A 1ML3A 1IYZA 1NP3A 3U5TA 3VOSA 2C7VA 5IN4A 3VH3A 3QY9A 5TC4A 1ENYA 1BDBA 3K73O 3WS7A 1JAXA 3DHEA 4AICA 4Y6PA 1A71A 2BMAA 2HCTA 3TWOA 2GN6A 2UDPA 1J49A 3VH2A 4D44A 2Q2VA 3LT0A 3OMLA 4J3FA 4A73A 1ZK1A 3SLKA 2ZCUA 3QWFA 2HO5A 1DC4A 5AXDA 5HS6A 1SNYA 3C85A 1ISMA 2R2GA 3VC7A 4PLWA 2RIRA 1EUDA 3ZW9A 1LBEA 3CTMA 2QYSA 3QVXA 4CLHA 4YJFB 3I9KA 4XDZA 3JYQA 3GEGA 2ZB3A 1K6XA 2BFPA 4XKJA 2HMWA 4IINA 2CSUA 3INGA 5JLAA 3JQDA 1B16A 5I7FA 1SC6A 4Z0PA 2Q46A 2FMUA 3HWRA 1EE9A 2AQ8A 3O8QA 1IPEA 4S1VA 5B4TA 4J1SA 5A9SA 4LCJA 1HDCA 5DZSA 1V3UA 3CUKA 2H5LA 3PJDA 1NR1A 4XRRA 1JQBA 2V6BA 4RF4A 1NBOA 4UUPA 2UVDA 2O2SA 4Q39A 4W6ZA 1Y8QB 4AJJA 3BA1A 1KEUA 1B7GO 3UOGA 1NVTA 1SO8A 1RJWA 2I3GA 2O50A 4PLVA 5F1PA 2VHYA 3ULKA 1MG0A 2X23A 5ENDA 4NMHA 5I7EA 5L4LA 2HMUA 4OYRA 3CKYA 4H3VA 3UHAA 1T26A 3KSUA 4BMSA 4MIYA 4TZTA 1D3AA 5G4LA 1H5QA 3NRCA 4AJNA 5AQ1A 4IIVA 1C0KA 3KLPX 4CMEA 4YQZA 3ZWBA 4II2A 4WOKA 2QHXA 2IYPA 1I36A 3MCVA 4OMUA 4FFLA 1MXHA 1O94A 4YT5A 3ANLA 4KUGA 1T2EA 5HS4A 1NAHA 2BKAA 4OIMA 5T8KA 4J2HA 4PLFA 3PYLA 4B8ZA 5G0VA 1F8GA 2VWHA 3K30A 3KYCA 1W73A 2B35A 3NDJA 5EINA 3TZQA 3PWZA 4UVIA 1Q7BA 1CQJA 4D45A 3F6YA 3RQSA 3KETA 1Z7BA 3E9QA 3R3JA 5DCUA 3NTOA 3AFMA 5JCXA 3U4DA 4G65A 3UH1A 3VVBA 3Q0EA 3RUIA 1BXGA 7ADHA 5C7IO 5G0UA 4ZD6A 1I2BA 4FGWA 2BF7A 2RBEA 4R3WA 5AVOA 2O4CA 4ZQFA 5FI5A 2WMDA 3GGGA 3P2YA 1KYQA 4XQGA 1R4NA 1H6AA 3PP8A 3RU7A 2AE1A 1SPXA 1UP6A 3VH1A 2DAPA 3L6OO 3VPHA 4YPOA 3D4PA 3QHAA 4B7XA 2WM3A 1UAGA 1ZW1A 4CLRB 1GEGA 4NPCA 2IZ0A 2G1UA 2P9EA 3IQDB 2VT2A 3ANNA 1G6KA 3LVFO 4CM8B 2DTEA 5F1KA 3HFGA 4XR4A 1QYXA 1PEDA 1B3RA 4UEJA 3VZQA 2EP7A 2X86A 4OGWA 1LRJA 1E7YA 1HYGA 5EQFA 3ZV3A 3KVOA 1FXSA 1JDJA 1UH5A 3AY7A 5AOVA 1ULSA 4GX0A 4I5EA 2DTXA 5IZCA 4FGSA 4CV0A 2OL4A 2VN8A 4WECA 1O0SA 2C0CA 2BFAA 1HZZA 3PQEA 4YAKA 4C4OA 1MXFA 2I99A 4FC7A 1H93A 3C24A 2C2XA 1KETA 3RBXA 3RU9A 3PHHA 1HE3A 3G0OA 4C7JA 2FWMX 4CV2A 3VKVA 4ZHSA 3JQGB 5JY6A 3PK0A 2YV2A 1RM0A 3GAZA 1JKJA 4KUEA 1GQ2A 4XIYA 3WDSA 2A4KA 2RHRA 3D3WA 3EW7A 3IJRA 1X0VA 2W90A 3ADOA 4ALKA 4R9RA 2NU7A 4CM7A 2AQKA 3GQVA 3LT4A 3IKVA 3PTZA 4XX0A 4CR7A 4EUEA 2B4QA 1E1MA 1P0CA 3FNFA 4YTEA 2NU8A 4FDAA 4R3NA 4ZVVA 2FPGA 1J6UA 1K3TA 2IEBA 5A9RA 1Q0HA 3TZ6A 3TOXA 2J3KA 1E7MA 2O3RA 3OA0A 2X5OA 3ZWWA 2BGKA 1E3JA 1X7HA 1FJHA 1HDGO 1VM6A 4DBZA 4NK4A 3UFXA 2IXBA 2W2KA 3F5SA 3F4LA 4FJ2A 2YHUA 5GZ1A 1ZUD1 2J3IA 1DDOA 1P1HA 2FPIA 2I66A 3ITDA 5CPFA 1A7AA 3DBRA 2UAGA 3TL2A 4DC1A 3RFXA 4B4VA 1KS9A 1PU2A 4G2NA 2Q99A 2P91A 3P2OA 4BNKA 1JAYA 4W99A 2B83A 4Y6RA 4E30A 1SMKA 5DCWA 2WYWA 4BO1A 1ZSNA 1NNUA 4UVEA 2IYOA 4YRBA 4CLOA 3ONFA 1VI2A 2GNAA 1YJQA 2IODA 3DZGA 4FQ8A 1YQDA 3CINA 2BELA 4MKXA 2VNAA 4XYMA 5IN5A 4IPTA 4TVBA 4L75A 1QV7A 3D7LA 3KUXA 5TJHA 1JVBA 4WGGA 1WP4A 1VKNA 5G2OA 5CDGA 2NADA 3UF0A 3FD8A 1NHWA 1LSSA 5A05A 2X9VA 1BXKA 1B8VA 1P1RA 2FR1A 1MFPA 4QUKA 5C3MA 5K9ZA 5ICSA 2VUUA 4DUPA 4DYVA 2I6TA 2B4RO 3UN1A 5BSFA 4QQRA 1WXDA 3TFOA 3VZRA 4YJFA 4II3A 5LDGA 1OZAA 4ZQGA 3GR6A 4UUNA 3B1JA 3DB2A 1NQTA 4IDEA 5CDUA 5EIOA 1PWXA 5BQFA 1N9GB 1KEPA 5FYDA 1OC2A 1DRUA 1WAMA 1GPDG 3KRTA 3EZLA 3GN2A 3WIDA 1RM4A 1HSOA 2JHFA 4BGEA 3GG2A 2R00C 2AMFA 4FN4A 4DQUA 3FRJA 3ENKA 3W8DA 2NQ8A 4YT8A 4LISA 5IG2A 1I30A 4JP3A 4R5HA 4DGSA 1FDUA 1SOWA 1M2WA 3AI1A 4DPMA 2OMEA 4CV1A 3V1UA 3IUSA 4JBGA 4UREA 1Y8QA 2VCYA 1ENZA 1PZFA 3R3SA 1X1EA 3RVDA 4RZHA 5JY1A 3PI7A 2PTGA 4CMEC 4AL4A 4JP2A 4K9DA 2OO5A 1DFHA 3D5QA 4MDHA 1NWHA 3GLQA 1UXJA 5T64A 1GUFA 5CEFA 3GG9A 3P7MA 3WSVA 3FTPA 5TS3A 4DBVO 3C1OA 2DFVA 4IGFA 4M54A 5T8KC 3OETA 4E3ZA 2H63A 3CMMA 1JU9A 1Z82A 3KZVA 5A9TA 3BTVA 3VZPA 2EXXA 1LDBA 4JCOA 4IDBA 2RH4A 4HADA 4INAA 1JN0A 4KUHA 4BV8A 3VDQA 2QRLA 2JAPA 1HWYA 3E82A 5DDIP 3VH4A 3ZNPA 3NT2A 4XYGA 2QZZA 4HY3A 4B3IA 4CLEA 4FPXA 5FF9A 5A3JA 4RF2A 1K6IA 5JAQA 2NVWA 2P4QA 4YJHB 5IZ4A 1C1XA 4YDRA 4D0RA 2I65A 3MOGA 3PJGA 4PLTA 1NFQA 1A27A 2I5PO 2PA3A 1E92A 1OC4A 1XDWA 4O59O 4TROA 1A9ZA 3W4IA 4BNUA 2PH3A 4M1QA 3CEAA 1WNTA 2X6TA 3L9XA 3CPSA 3QQPA 1GU7A 1B2LA 4Y6SA 1T4DA 3ETDA 2O3SA 1I3MA 1M75A 4J91A 4JBIA 4KOAA 4DLAA 1E3LA 2HK8A 3G49A 3ASVA 3GDGA 4UUMA 3UUWA 1UJMA 2CVOA 2D4AA 3V2UA 5DOZA 1ZFNA 5FFFA 1EBFA 5JE8A 1GADO 8ADHA 4CLRA 3O38A 4BNVA 1I5RA 3DMTA 4CM8A 1WZIA 4XGNA 5A03A 3TL3A 5IZCC 4ALLA 1DJNA 3JYLA 2Y0EA 3AI2A 2IRWA 2NVUB 1EDZA 2BFMA 3W4KA 5TF4A 3AW9A 4K1LA 2HJRA 4OOEA 4MVJP 1CYDA 4BGUA 5J23A 1BWSA 1XEAA 3S55A 1PZGA 3EAGA 3HDQA 3HG7A 2WD8A 2X58A 4O1MA 4YT2A 1TXGA 5ILOA 4B7CA 5I9LA 3VZSA 4Z3KA 2B5VA 4BNWA 1D8AA 2ZIZA 3WGYA 4M55A 1PQUA 3ZWXA 4NBTA 5EJ2A 2QZ9A 4WEQA 1WDMA 3JQGA 4QTZA 1NVMB 3B70A 4WE3A 1YQGA 4CM1A 1B14A 2GN4A 2VOJA 4BNXA 4NI5A 3ZH2A 3G1TA 3IC5A 2YFQA 4J7UA 4NBRA 4PCVA 4AJ1A 1WMAA 4B7UA 1ZKMA 2FHSA 4XQ9A 3STHA 4E2ZA 4L4SA 4CMHA 4WNIA 1NPYA 2DFDA 4QEDA 1PGJA 3EZYA 3QWBA 1V3TA 4PZDA 2UYYA 4TRRA 2V6FA 1LUAA 4I9UA 1GQYA 1ZEJA 2GDZA 3O9ZA 5JS6A 2VYVD 3NDRA 3WTCA 1YL7A 1H9AA 1SZJG 2E6UX 4R1UA 4TKLA 4YAJA 3VPGA 3NX4A 4BKQA 5JSFA 2JKVA 1P3DA 2BLLA 5KTKA 4A26A 4J49A 1Z74A 4XR9A 1F17A 4BKPA 3RJ5A 1NPDA 4FJ1A 5KVQA 1EVIA 4OAQA 2AEJA 3OIFA 2AEMA 3PZBA 2VZ0A 4NHEA 3TOZA 1YB1A 2D5CA 2RHCA 2ZATA 3I9NA 1HDOA 4R68A 5F5LA 2WD7B 3GZ4A 1U3TA 2AHRA 1O89A 2X0JA 3W6UA 2YDXA 2CZCA 4C7KA 1O9BA 4KTVE 1Q1NA 2C59A 4EUHA 1I3LA 1RYDA 2YFHA 3DZFA 4UULA 2WE8A 2WTBA 1ZSYA 3AJRA 4NG5A 3GVPA 1P1IA 4BNJA 2EJVA 4TKMA 3HJAA 3AFNA 1E0DA 3BMOA 3MTGA 5BNFA 1BTOA 4CL3A 3NTQA 3AU9A 4BNIA 4WK6A 1JW9B 3QVSA 4BS9A 1QP8A 3PQFA 2AA3A 1LNQA 4HFMA 3L07A 4BHTA 4M86A 3C7DB 3FNEA 4IJUA 2P4HX 4GSLA 4DYDA 4RPGA 4ALNA 9LDBA 4DVJA 3KEQA 2PH5A 4RF3A 1JWAB 1X7DA 3F3SA 4WNCA 1Q7CA 4CUJA 3U4IA 5L4NA 1R16A 4J7XA 3HDHA 4IDDA 5IDYA 5JO9A 1CETA 4O0LA 4U6SA 2XOXA 1PGNA 2EKLA 2YHIB 3RUFA 1H6CA 1X0XA 2Q1WA 4Z3DA 2CD9A 2PD6A 4JLWA 5KNLA 3PYXA 1NWCA 1ZEMA 2NU9A 1KBZA 1N9GA 2NM0A 5H82A 3W8EA 4RPKA 4RVFA 3WGQA 2VYVA 2NV6A 3ROPA 4HV4A 1D1SA 4JK3A 2XF8A 1NVGA 5HTOA 5TX7A 3F9IA 2GRAA 1LDNA 4NU6A 1ZNQO 2FSSA 3UXYA 2OFPA 4GGPA 4Q3EA 1PSDA 3VPFA 3I6IA 1XGKA 1E6EA 2JFHA 2NTJA 1H6BA 1TI7A 5A5EA 4A03A 1G0OA 2FP4A 1XR3A 3LC1O 4BO2A 1GL3A 4ND4A 1P45A 3T4EA 4K6CA 1U5AA 3DONA 3NJ4A 1I0ZA 3CXRA 3JD1A 1PS8A 2VTEA 1Y5RA 4RVDA 3OJ0A 4CMBA 3TNLA 1YDEA 3WQRA 3KHUA 3OECA 3Q6IA 4IDFA 3GDOA 3H4VA 2YQ4A 2VHVA 2Y1OA 4R01A 2Y67A 1TVEA 2BHLA 2C5AA 3HUDA 4N7RA 4PGFA 3UVEA 4EEXA 3GVIA 1TT7A 4JXKA 4LMRA 4BQPA 5FEUA 4Q3DA 1HRDA 3V1TC 4YR9A 2EKQA 4E5NA 3JD0A 5I7SA 3BMQB 1N1GA 3TZHA 2I3AA 3AUUA 5F3RA 3IKTA 1GUZA 1GZ4A 3BHMA 1IZ0A 2AE2A 3GPIA 3SLGA 1NPTO 2D3TA 1HL3A 4IJVA 3RFVA 3S8MA 4BGVA 1W6UA 3JYPA 4NH4A 4DIBA 2GUGA 1YONA 4E12A 3INTA 4Y9DA 1LI4A 4IJWA 4ALIA 4QO7A 5L3ZA 4YJHA 4KDEA 3OJEA 4IQ8A 1OBFO 2D59A 4PVDA 4WLVA 1GUYA 4P8RA 2ZQZA 3EGOA 4YAEA 5DP2A 4EDFA 4U7WA 1FDSA 1I01A 2Q3EA 4PIVA 3ROMA 2JCYA 4IIUA 2PZMA 4D0SA 3GVHA 4Y8VA 1XU7A 1DAOA 3NT5A 1PS9A 4W7HA 1PZHA 4ZJUA 5GZ6A 3DMTC 3CH6A 4BNGA 4M89A 2J8ZA 5A04A 2XPCA 4L0QA 2QYTA 3IL2A 5JBIA 1U8XX 3TQHA 1DIBA 3MJ4A 2BI7A 1NYTA 2ZTMA 3RWBA 3ZNNA 3EK2A 4RPHA 4UVDA 3LQFA 3VKUA 1M6HA 3LT1A 3AUAA 4IY1A 4HX5A 3ZWAA 4L8VA 2A94A 2NVUA 4DLLA 5LCXA 2GZ2A 1R4MB 4GPD1 4M87A 1OI7A 1QKIA 4NBVA 1P74A 3IOYA 2YQ5A 3KTDA 4YBZA 4GSKA 3BMCB 3C7CB 1E7RA 3K31A 1F8FA 4W82A 1P33A 5KJ6A 1HDYA 4MVJM 2Y1FA 1AXGA 3UICA 3I5MA 4OOFA 1PJ2A 1CDOA 1YOVB 2C2YA 3AI3A 3CZMA 1YL6A 1I3KA 4L76A 3QP9A 4I1IA 2OP0A 3GH3A 2R00A 2CDCA 3SX2A 2PKQO 1ID1A 1PJ3A 2QG4A 5CDSA 4E2XA 4ILKA 4TMFA 3VVCA 2C5EA 1LC3A 2OZPA 1F12A 1DRWA 1WDKA 3MJSA 1SOVA 3OEYA 1N92A 3T7CA 5HM8A 4XZ3A 4MVJE 3WLFA 6LDHA 1O5IA 3HFSA 4QT0A 4LMPA 1QG6A 3RUCA 4F6CA 3NGXA 3SEFA 1GV0A 1UDAA 2DKNA 1MUUA 3PHJA 1DC6A 4BO4A 2GO1A 8LDHA 1Y1PA 2YDYA 3IMFA 3PIIA 3HZZA 3JYOA 5KJCA 4E5PA 2CUKA 4ZGWA 3I3OA 3U4HA 1Z6ZA 4EBFA 4F46A 4TSKA 3DOOA 4I9HA 1G0NA 3E18A 5THKA 2Q45A 3KOUA 1U28A 1YXMA 4OL9A 1YB5A 4XJTA 1C1XB 3PPIA 2WD7A 1A9YA 4B79A 4BMNA 1H2HA 1CQIA 2G0TA 4P4GA 3RKRA 4A2CA 3PWKA 1E5LA 2CY0A 4R1TA 5DBIA 3DFUA 5FWNA 1GY8A 2DPGA 2PFGA 1VLLA 2QIOA 1WMBA 5T5QA 3AWDA 4XA8A 4FFPA 4GWGA 1P31A 1R0SA 5DNAA 1KEVA 1IHXA 3JSAA 3ZWPA 4OO3A 3RBZA 1EEHA 1SBYA 2YY7A 1KY4A 4PG8A 2F00A 2GD1O 3G17A 3HHPA 1B3BA 4WLNA 4EGFA 3E6AA 3QE3A 3GN1A 5A02A 1KVTA 2V6GA 3I9LA 4CR8A 2OGUA 1Y81A 1RYEA 1K6JA 1LRKA 4MOWA 3VDRA 1XA0A 3ITKA 3HN2A 4FCCA 1UAYA 2DPHA 3ZWNA 2ZTVA 1S6YA 1Z73A 1BXZA 3QW2A 4XYBA 5I7VA 1XG5A 3Q1LA 3TJRA 3HB4X 4CM9D 2O7QA 3KYDB 4N5NA 1HT0A 3W1VA 3WGHA 4EW6A 5IF3A 2BGLA 4YEDA 3RFTA 1D1TA 2YHIA 5IXSA 3FPCA 2C20A 5EESA 2F1KA 4BO0A 1LC0A 1FMCA 4CM9A 3MWEB 4BMVA 2XXJA 4AJ2A 4H7PA 4PRLA 5JW6A 2GR9A 2B37A 2ZTUA 4W4TA 3H5NA 1IUKA 1DAPA 2B0JA 4MKZA 3WBBA 2O3JA 4K26A 1KVSA 3LLVA 3QLJA 4WOJA 1NXQA 3JQBA 3RC2A 3ZU2A 2ET6A 4R9SA 5CP8A 5IDWA 4QSMA 2FPPA 2EV9A 3GNSA 2GLXA 3FHLA 2H6EA 5HRUA 2VHZA 2NUAA 3KSDO 3OQ1A 2ZKLA 3NKLA 2HUNA 1HDZA 1E6UA 4KQXA 4BUCA 2UUPA 3LF2A 2O3QA 2ILTA 2FR8A 4PZCA 4AJ4A 4YACA 4BOYA 3C3XA 2P2SA 3RC9A 5LC1A 3GAFA 1O6ZA 2UUOA 1VC2A 1E3WB 3ZN2A 1VJTA 4RORA 4A5OA 4LGVA 1LSUA 1T2AA 3TPCA 1M6WA 2Q2QA 3HQ4O 5DT9A 3L4SO 3DR3A 1E1KA 2FN7A 3BMQA 4WLUA 1CJCA 2NACA 3JQFA 3PYMA 1DHRA 4O6VA 2B69A 4WLEA 2DLDA 4I5FA 3LK7A 3JQCA 2VUSA 2X5JO 1IY8A 3I1JA 2ZQYA 2GGSA 1QSGA 1TEHA 2J5KA 2EW8A 1R37A 3NDIA 4AJPA 5EL0A 4BO6A 1IZ9A 1BVUA 1YH3A 4R16A 5JMWA 1WWKA 2DBQA 4IDGA 4IM7A 3F47A 4NJMB 5G0TA 5I8WA 3BMOB 1QLJA 2O23A 4AJOA 4RDHA 2EG9A 3AUSA 4AJLA 1T25A 4EJ6A 3FTNA 4CM6A 1VJ1A 5L45A 1EZ4A 5COAA 2WDZA 2HKIA 4KQWA 1HETA 3NV9A 4MVJF 1S7CA 3JD2A 4NBWA 4RF5A 5DF1A 1DSSG 5B4VA 5JDIA 3PWSA 4E31A 1NQOA 3NT4A 4CMKA 2HSDA 4JBHA 3OIGA 2G76A 4LK3A 4HXYA 1RM3A 2E82A 2HRBA 3WWZA 4E32A 2TMGA 4KWHA 2I9PA 3BHJA 4E33A 3JCZA 1GV1A 5JC8A 2C82A 5A4DA 2BRUA 4RPLA 4ZN6A 1KVUA 4BNLA 4CUKA 6ADHA 1LSOA 2OORA 1V9LA 4J1TA 2QQ5A 1R4MA 4PLYA 2PV7A 4LSWA 4YWJA 3FCOA 3H3JA 4PG5A 4YB8A 3BMCA 3WMXA 5B12A 3G79A 3QVTA 1ZZEA 1PJQA 5JFOA 4RVGA 4R41A 3HN7A 1J5PA 1P1JA 1UXIA 4TWRA 1YOVA 2RAFA 4YYZA 1YL5A 1AHHA 2O2YA 3LC7O 3QA9A 1PJSA 3ABIA 4RO0A 4BGIA 1JKIA 1T2CA 3ZHXA 3I4CA 1LDEA 1LEHA 2YW9A 3JQEA 3U09A 4J9VA 3UGKA 2X4GA 2PGLA 2HU2A 1JLLA 5B1YA 2OOSA 1MV8A 1T4BA 4KP7A 1OMOA 2GN8A 1EQ2A 3KSZO 3JQ8B 2AQHA 4PRKA 4HFNA 1NQ5A 2X0RA 5T6BA 1D4FA 4H15A 1E1LA 4E21A 1UZMA 3ZHYA 3I23A 4FSHA 4HNGA 1EVJA 4F3YA 4WPGA 2CNBA 4GKBA 2DVMA 1GQQA 2E37A 2J3JA 5JO0A 1N1EA 1PWZA 1UUFA 1XHLA 1GZ3A 1C14A 4DMLA 4OXYA 1PQPA 2RH8A 2JD2A 2Y0DA 3DAFA 4JJGA 3PGJA 5U4QA 1ISIA 3QWHA 3RROA 5AXAA 4L4XA 5EMHA 1IOLA 1J4AA 1GCUA 2JHGA 3K6JA 3L6DA 4J1NA 3ZWCA 1B8PA 3JV7A 3I9JA 5JPIA 1P1FA 3KV3O 1CWUA 4PG6A 1LRLA 3WB9A 4R1SA 4U0KA 2DBRA 4ND3A 1H0KA 3MEQA 2Y1CA 1A7KA 2HK7A 4CM3A 1QYWA 1HE4A 5JMPA 4XB2A 2DT5A 1MP0A 4UEKA 1UXKA 5JDCC 3ANMA 3ZU4A 4XRGA 1BVRA 3ZCXA 3N7UA 4BB5A 3D4NA 3L4BA 3FWNA 4GMGA 2VRCD 2Y0CA 3IDSA 1YWGO 5KJEA 2WEKA
chains in the Genus database with same CATH superfamily
1CRLA 2E1RA 2WSIA 4FD2A 2GZ1A 2DQYA 3RGGA 2YWEA 4ZOQI 2UZ0A 4U9IS 5JYEA 4I8IA 1T36A 3IALA 3IXMA 4UTOA 3RV3A 3W2IA 4JVLA 1K7CA 1MA3A 4MUAA 1KOLA 1JSCA 5CK5A 1L7NA 2QAIA 2EL9A 1R8QA 3BCSA 4IJ6A 5C0OE 2WOOA 4FE4A 1T6XA 4HNAB 1G2PA 4YVFA 4G0WA 4TMYA 1OASA 3CMCO 4WLOA 5KSPA 2Q29A 3CF6R 1L1FA 3TD9A 4B83A 4RNCA 1AKEA 1C7EA 2FWRA 3WRYA 4C5CA 3ACCA 4R71A 5C5IA 2Z5FA 4MVYA 3RVLA 3G2OA 1Z4OA 1FIUA 3Q5EA 1A50B 4CQNA 4B4WA 3O93A 5CH8A 3LUPA 2C4MA 2MWMA 2J7PD 4NU8X 3PC8A 1MGOA 1P5RA 4RZIA 2ZFUA 1KWGA 3BT7A 3DFZA 2AXQA 3LLMA 1CUYA 4OBEA 5DGHA 1BJRE 3OTIA 3R3YA 3S1AB 3JD3A 4J7AA 3KYDA 3QSGA 5IYZF 3RUHA 1X1QA 3AYZB 3PBKA 4BNDB 3F46A 5IABA 4PZLA 2VQFB 4XE5A 2YV4A 3DO5A 2WHPA 4QUGA 4B73A 1YB4A 2C95A 2Q4RA 1EK1A 2BFOA 1JLKA 1U7OA 1VCNA 1XKLA 2RARA 2HZBA 3GLTA 4RK7A 4XDGA 1PR6A 5A5GA 4H60A 5EJ7A 2PE5A 3ESCA 1QZ3A 3ANTA 1EFPB 1BDMA 4GAEA 2WICA 5EIXA 2O6HA 1N7GA 1ZICA 4MUXA 4QGGA 4R8VA 4U8GA 3ORFA 4XIFA 1UJCA 1CYEA 1SQSA 2P1DA 1O58A 4P3KA 3K2BA 3I1FA 2X9GA 4K6FA 5I7WA 4RTKA 2IOFA 2H4YA 2A7QA 4DSNA 3RTGA 3RG8A 3NJ8A 1E6LA 4MPPA 1PR1A 1YQUA 4CEHB 3T3EA 2HRZA 4H7KA 4G26A 4RD0A 4Y98A 2I6FA 5CNMA 4FZJA 3K09C 3DBHB 2V54A 1PJAA 5CTAA 2YV3A 2DTDA 4WBNF 4RSHA 4YRRA 2D13A 3WR5A 2GFHA 1QQ7A 3FDJA 3MRVA 3J81k 3Q3CA 4RSRA 1GTVA 2JLQA 3U37A 4LNHA 3D1JA 4BP1A 1U2PA 2R66A 3AJ8A 4OKIA 2CFCA 5LLTA 4FMDB 3H83A 4QBFA 1EG7A 2Q27A 2RDMA 3FA2A 2ZUEA 4GMXA 3Q6MA 3F96A 1T3TA 1QH8A 3PNMA 4MYHA 3BREA 1Z5OA 1O2DA 3GXOA 1SB8A 1E3WA 1WXHA 2RGXA 1AM4D 3U3MA 2D7JA 2PGXA 1KMCA 4PBTA 3IUEA 4NZPA 2GASA 4I46A 1R9GA 1JEAA 1ISFA 1Q7GA 2NT4A 3LPCA 3PDUA 5EQJB 4V1CA 5KTMA 1IOWA 1CK4A 1QHNA 3OQBA 4LI3X 5AK4A 3TSCA 1QHHA 3RAFC 2VYND 3DZJA 4IMPA 4DXDA 1IB6A 2XZLA 2F59A 4FHGA 3BFPA 4KACA 3V4OA 2XMPA 1E4VA 2JGKA 3MA0A 5FTMA 3P9RA 2BEKA 1C0LA 1M66A 1YJCA 2EYQA 4M0LA 3I9MA 5GAJA 3RHTA 4QUAA 2GVDC 4J0FA 5M5BA 2PS9A 1GQRA 4YP9A 4AX4A 2IX3A 3D3EA 4Q4HB 2GN0A 5C8YB 2E18A 1M34B 1ZAYA 1ZNXA 3W3ZB 1XCBA 4BLTA 4P0PB 3WTBA 1B0PA 5CX4A 1X14A 4M1TA 3Q8KA 4JSTA 5F76A 4GE0A 1AKUA 1WMDA 1XA4A 2PXCA 2ZUSA 4IHJF 4JB0A 1FFXA 3UWDA 4BMDA 4I5IA 3BBPA 4LJYA 1LJ8A 1YDWA 2HSJA 4OQNA 2YIMA 2IOQA 4URFA 4Q05A 4RQTA 5EJAA 3PLRA 1OXMA 2F1JA 2JGJA 1VPEA 3QELB 4HUQA 1VKOA 3VOTA 1DJQA 4MROA 1VJRA 3O4VA 1QWSA 1ZMOA 1NQWA 1D5CA 4JMPA 4WY5A 3V2IA 3ZQKA 4CMGA 5LZ9A 4X0EA 1L5KA 1C9JA 1MQSA 1PZEA 2GPWA 3N8HA 3I12A 4ZMRA 3E03A 4JC4A 4ZYWA 5BN4A 4ZEWA 3FR7A 4FDLA 4N01A 2IW3A 1RPAA 3ZQ6A 5CAEA 1U7PA 2G9VA 3G0GA 3RSSA 2CNNA 1EI9A 3G5UA 1DLIA 4RKYA 1AS2A 3X1YA 1R5OA 4B31A 2E48A 4F04A 4C1NA 1GYQA 2QD3A 3W6NA 3VR4D 2VF5X 2AMJA 5JAMA 1PT9A 5D84A 5JYBA 4B47A 1X1AA 2X5NA 3EPPA 4G8BA 3J7AC 4RM3A 1L5OA 3I0MA 4JYCA 1NN3A 4AJHA 1H69A 2HGSA 4MW4A 4C29A 5LXTB 5DYIA 1JE1A 2ZJYA 2CJWB 1Q2XA 2ICAA 4D9JA 4OB8A 3T41A 4CL8A 1BNCA 5KYVA 4NYIR 4JI5B 2KI5A 2P6NA 3ETGA 1TVKA 3ZW7A 4AYTA 4PGHA 1T6NA 3IP3A 3K16A 2ZJ0A 4OKNA 5HIAA 4CF5A 5ALHA 3SHWA 5HF6A 2YBDA 1D7AA 1XALA 2QN8A 2D8AA 3QVUA 4ODIA 2P7HA 2V98A 4IDPA 5E3JA 3SIWA 1DKOA 2D00A 4BV2A 1DE0A 2IPOA 1G8MA 3HB5X 4PW0A 4LYFA 5BWLA 1U4OA 4WDRA 4BQRA 1A8HA 3FVRA 2BH9A 2R8BA 3RIGA 2VPYA 4ESVA 2AC7A 4LY0A 5DXAA 3SK0A 5JD5A 2Z8ZA 2OHFA 1LTKA 4D26A 4LE2A 4JIMA 4PZEA 1A1VA 1ZUNA 4FCVA 4NEQA 1QE0A 1R0XA 4OHKA 2JEYA 2YV1A 1NW6A 1PE0A 1XKQA 3PHCA 4GPIB 4F86A 1GPYA 1KK0A 2QZPA 4ZGGA 2GF9A 5IH7A 3TB4A 2B1RA 2W6JA 4J0DA 3GRVA 1UBOS 4X8MA 2OG2A 2CL5A 4CKCA 4EY4A 1G3RA 4OH1A 4MB0A 4FMPA 1H5NA 4MA5A 4AIRA 4CF6A 1LU9A 3T5AA 3L8HA 5CGQB 1LQTA 4J0GA 5I9NA 2XGSA 4XD2A 4F9FA 1GD1O 2J3LA 4E3WA 4IMRA 3PRJA 5H3LA 3EIUA 3HYLA 4M8LA 4X8LA 3ROKA 4QICA 1FUEA 2VXYA 1XVVA 2X2PA 2I91A 2X0IA 4UNPA 3OVMA 1A5TA 2P67A 5ICFA 3NVDA 2KX7A 4HC4A 2RHMA 1S2NA 1QANA 1UPAA 2P1RA 1T1SA 1F5NA 5D2CA 1WSAA 4YCAA 2H2HA 5FBHA 4BC0A 5LD2C 2BOVA 3IFSA 2ZCVA 1EFVA 2LP4Y 4FR5A 4XASA 4DTIA 2L19A 4BNZA 4YXFA 3DXZA 4NDNE 2M32A 2F43A 1YZLA 1EK5A 1VSBA 2PZBA 3BQNB 3UJDA 4AG5A 1CVLA 1THTA 2EGGA 5BSWA 3KLMX 1FYEA 3N2GA 5JQGF 1GAWA 5K5EA 1YAJA 1Z5NA 3CCFA 4HRXA 2DUNA 1I6LA 3VR6A 1M6EX 1ZK2A 1FDVA 1SCBA 1HZJA 1PJ4A 5F7ZA 3VSAA 3WZLA 4HB0A 1QH0A 4JGIA 3WRYC 5BN1A 3KNZA 3KR9A 2YHBA 2DFTA 4YRPA 1TAUA 2GHIA 3D7SA 3PC8C 3IVXA 1XTPA 1K5DA 5DFAA 4O1IA 1ESDA 2ZREA 1TEXA 3TLJA 3V3TA 2IEGA 2FX3A 1P1KA 2WLTA 3K9BA 1IHPA 3L6EA 4U2FA 4GMFA 4U4AA 2OCYC 3CWQA 3PEWA 3OQHA 4XTCS 3GRKA 4P0QB 1C0EA 3UFBA 2EFHB 4BKOA 2BMWA 3TLAA 1D2AA 4CLXA 1V8FA 1Y1KE 4FHDA 3HBMA 2QNIA 5JWHA 1GSAA 4JHXA 5EKSA 4ZALA 1QAQA 5JJBA 5ITZA 4KR7A 3U61B 2JLCA 3GNLA 1W2GA 3E5MA 4GEKA 3UUEA 4AW9A 5F3WB 4LYJA 2IDZA 4KIFA 1EB8A 5AH0A 1BMFA 5GMOA 2Q0HA 3UW3A 5KU7A 5BUQA 2YZ7A 1B6SA 1MT0A 4WCFB 1QPBA 3AJDA 4KSCA 3VUEA 4JI4B 3ICQB 4Q4DA 3ZWOA 1I7NA 1Q11A 2JFGA 2QXUA 4JJFA 2IHNA 7YASA 3LWZA 4IV5A 3HDVA 3JQAD 1A1SA 3TUZC 2PVSA 1JDBB 3P5SA 1HDXA 2JFFA 4H1UA 4FUQA 1YRBA 3KXIA 1FDRA 4XCQA 1DI0A 3VAYA 5DIFA 2IU0A 3WYNA 3ZCUA 3RYTC 1E2DA 3T15A 1F6WA 4DY4A 3I53A 4F7DA 5ALWA 1KXZA 3LU1A 4FJ0A 3WFIA 3S1SA 3DHNA 1RQ7A 4RVHA 2QVLA 3OQNA 1TLTA 1PL0A 1F8XA 4OK3A 5DHTA 4XYLA 5K4HA 5J2TB 1BG6A 3IODA 4F6LA 1QVRA 2D5AA 4HAZA 5TSDA 1EPUA 2OPBA 4EG7A 4WIAA 1LX6A 5E6SA 4ZJYA 2QRZA 3A6FA 3CZCA 2V45A 4Z0TA 1QX3A 3A1SA 4KQJA 2AOVA 3TCXB 2QPAA 2DETA 1RP1A 3U1VA 2P8JA 2XSZD 1K8QA 3EA4A 1EE1A 1HYEA 1TA4A 4NATA 1EXVA 1EUYA 1AZWA 1ZK3A 4B80A 4HNSA 4BATA 2EGHA 1JIVA 2ZWPA 4OQEA 5IMBA 3V7YA 1N6OA 5CM8B 1CR6A 5JMOA 2GAAA 1CTQA 2Q7DA 5B7GA 1YE8A 1Y3FE 4LHYA 4NAHA 5C8VA 5JSHA 4Z9XA 4WZBE 2ABWA 1BHJA 4PAQA 4CKYA 4PU0A 1EVKA 2Q50A 4FE7A 4LBWA 4TTJA 4ZVKA 2YJGA 1XQ6A 2YWDA 4E1BA 4L95C 3W6PA 3IDFA 2EF1A 3RYFA 1ISGA 2C07A 3UA3A 1YIAA 1DIRA 3IESA 1I6KA 2YRXA 2ZB4A 4P7KA 1Z45A 4AO6A 3IR7A 3JASA 4A16A 1I0LA 1NX6A 1B73A 4U7DA 1EXWA 1L8QA 2HX1A 5JAZA 5JNLA 2PFKA 2XDWA 4C6TA 3UV6A 2XDQA 3EB9A 2JS7A 1VJ0A 3ISVA 3R6DA 4P32A 4R8LA 1U2DA 4M9ZA 3TFWA 1GQSA 2VJNA 3KG2A 4OX9B 1J8QA 2NQ2C 2WKPA 3HUEA 5KMGA 3CX8A 3JQ7B 4PNHA 3F3MA 2KW5A 1YTLA 3ZEAA 5JDCA 4AF6A 2IXFA 3N0WA 1Y3DE 4W6QA 2IXDA 3TZKA 1E32A 1XZQA 1XQ9A 5HJ7A 2L18A 3ECSA 1GKIA 1I32A 1KAQA 3CE6A 1NJ6A 3E27A 5L3SB 2J3HA 5CM9C 1QH9A 1GNPA 1S02A 2OCBA 4WJLA 1IHDA 4LGMA 4S1PA 1F5SA 4Q48A 3Q9NA 3I04M 5E6RA 2OQVA 2OO7A 2GPYA 4FYVA 4RDXA 2IYUA 1KO5A 1OH5A 1OWPA 1UPTA 1ATZA 4D3FA 4EHAA 5CDYA 4M0UA 3PV0A 5EWMB 3W9BA 3MWDB 2AMVA 4IDCA 2E4YA 1R8XA 3DTTA 1P81A 1V8PA 2Q2OA 5C34B 4N41A 5CFNA 2Q6LA 5BURA 2PN1A 4WXEA 2WWIA 4U2BA 2BMJA 5TEVA 4MDEA 4HDSA 4FEAA 2FJ0A 5CIWA 2HMSA 1Z8FA 3UKJA 1N0IA 3JD4A 5JXJA 4HTAA 3SZOA 1U2RA 1O87A 1EK6A 4BKRA 3NDBB 1YDFA 1U0JA 4G9BA 4XPZA 4P4LA 4PNPA 4I9GA 4MVJA 3I62A 4P4NA 3L41A 4FCTA 4BO7A 4K6MA 1BRMA 4D8YA 4MDYA 3A3OA 3FPLA 3OM0A 1ODSA 3Q3GE 1KYTA 1U4NA 3L0OA 1M1ZA 3KVNA 5DX1A 4AN0A 2Z5LA 5IBRA 2AVDA 3VOAA 2V03A 1YCFA 1CSEE 2GJAA 1G5PA 1N1MA 3BKXA 2CVFA 1OLXB 2FPWA 4G4SP 4JLPA 2WIKA 2B8WA 5TT0A 1BMDA 3FDIA 1U3DA 3K1AB 3IJ5A 1L7DA 4G4SO 5F21A 4CMIB 1KYXA 1AIPA 1Y4AE 3NHBA 4H3HB 1VLJA 1Q1QA 1QOZA 2PLWA 2BSXA 1MO5A 2D1RA 4XWYA 3KT3A 2FHPA 1EDDA 2I3BA 2FWJA 2Q4DA 1OFGA 2CLDX 2ZWOA 1G3MA 1KJNA 1W1IA 3KUUA 2O14A 3KQTA 1R3DA 2R1VB 2RGAA 4MIEA 1CPYA 1E8DA 2VR1A 4PG4A 3SR4A 2R1UA 1PWEA 3HUTA 1R4AA 2IQ5A 4DJFC 2L0XA 4M60A 1KU6A 2VJQA 3G89A 3SIXA 5AKYA 5GIOE 2V7QA 3OJLA 4PR3A 4MW9A 3RANA 1P2DA 3AM4A 4GVLA 2MSKA 5BQ3A 3ER9A 1FSPA 3H2JA 4WN9A 2DE0X 2BTOA 1QHFA 4JROA 5CVUA 3SGLA 1U6IA 4GIBA 5ADWA 5AJZA 2HYIC 1FTNA 1H1LA 3CSUA 1NP6A 2AI2A 1MVNA 4L8YA 5HZHA 4MQFB 3GZNA 3TD2A 2QD2A 2O4UX 4NICA 3ZE0B 1HEUA 3E0XA 4WADA 4BL5A 3K6SB 3U1BA 4ARCA 3R5XA 1KDTA 2Q49A 2PX3A 5HOEA 3K0FB 3RD5A 4X92A 2FZVA 2IIPA 4KRXA 2ZYHA 1OI3A 2C9DA 3PPYA 3QRWA 4MEAA 1JAZA 3FNQA 1FS5A 3WSWA 2QD4A 2GHRA 2JIDA 3ZCTA 4DIEA 5EHZA 3QXSA 2BFDB 3TRDA 1OFUX 2RMKA 1QAMA 2XAAA 2JGIA 3ET5A 3UCXA 5HOQA 4A15A 3ETCA 4GLFA 4AI6A 3JQRA 1W76A 2CXSA 1PTJA 4Q1FA 3JAWA 4K03A 1QQBA 3RVNA 2B98A 1SQ0A 2FNAA 3PD0A 1X7YB 2G17A 1TX4B 1KMNA 4N48A 4RK1A 1Y33E 1NFFA 5G0SA 4CG1A 2PLAA 3K70C 4DYHA 4P98A 1RC8A 3JR3A 4R2HA 1IH8A 3NEPX 4TUYB 3H9QA 2AF3C 1C9YA 1CERA 4WHMA 4FNMA 2E5WA 3DP9A 1F51E 2BV3A 2F9MA 2V7UA 4DA8A 2IYVA 1L7QA 4WCVA 2AXEA 4L4ZA 4TX1A 1TCBA 1TE2A 4PINA 3D7MA 3HL4A 1GAEO 2G9QA 3VO8A 5IJ0A 4DQXA 5LQRA 2JLUA 3T3OA 3SC4A 2AUMA 4R1PA 4PCUA 2BMFA 1PW5A 2ZKIA 1YGPA 5ITSA 1TMGE 3K3PA 4DIUA 1ZGHA 2O5VA 3RBVA 2P30A 1BFUA 3RUDA 4IJQA 4L4RA 1B00A 3HXTA 4NOLA 4G25A 1RKXA 1AQLA 5AVKA 4EMSA 4OF4A 1BGVA 1PTKA 2EVWX 3K92A 4OHWA 5EWLA 3WGGA 3SHOA 4TYPA 1TW2A 1ES9A 3QIVA 2HXSA 5E3HA 4TLBA 1T10A 4HDQB 5I9MA 4BAUA 3K0AB 4EKNB 1T13A 2JIQA 5EKDA 2AX4A 3EXFB 4G5GA 4HH3C 4B6RA 1KPHA 1NNSA 1T9HA 5JNUA 1TZJA 4BX8A 2LRHA 4IDHA 2XWSA 1U3WA 2PXAA 5L53A 3EYWA 4M37A 3TQTA 5CHEA 1M6VA 1DEAA 3OX1A 2A5GA 1GPKA 4JWTA 4NY1A 1PR3A 4WA8A 3NG1A 4ZPJA 3M9LA 1C9NA 2NU6A 3LQ2A 4IEFB 2P90A 5B1DA 3H2BA 2GEFA 1YK1A 1T4CB 4ETWA 1KC3A 1XNHA 2FSIA 1NMXA 4KDCA 4HB2A 5A71A 4L7VA 3UKOA 4M9UA 4YRFA 3EIXA 3S2IA 4PYJA 3GT0A 5CU7A 3B1WA 5DXFA 3IA2A 3MCZA 1XQVA 4C6HA 2E5LB 4OHYA 4MWCA 3G8AA 5DLQC 1UK7A 2FZEA 4W63A 4UM8B 1P4AA 3OJFA 3IUNA 9LDTA 2AG5A 3FYSA 5IYZA 4WERA 3KYBA 1XK6A 5TB5A 1XF9A 2N75A 2Y1XA 1GR0A 3AHJA 1KGSA 5EFOA 4P08A 4CN9A 1CUIA 1JF8A 1M2JA 4DLTA 3IA7A 3UKDA 4US2R 4LFCB 1GAQA 3DW3X 4NENA 4G84A 3CEPB 4FGKA 4IIBA 1DRVA 2VLBA 1SVSA 3AVOA 3DDOA 3CNNA 4KO2S 1SHTX 4R2XA 3VNQA 3K2EA 4KLRA 5KNCD 1Z12A 2ZYDA 1LBQA 1S8FA 3GCXA 1NMYA 1QDUA 3H1GA 2Z3VA 2Z6VA 4L0DA 4OK6A 4QUEA 3X1XA 3TF5A 5HDQA 2HDOA 1EIWA 2IV3A 3DTNA 3M6IA 4WOBA 3PEEA 3S5JA 4TT3D 4OQMA 1U2DC 4MWBA 2J4CA 3UXEA 4G0ZA 5G4KB 3ONVA 4QD3A 3QFSA 4U8HA 4WBNA 3G2JA 4J75A 5KVCA 1SXJE 3PEFA 1L6RA 3HADA 1KR2A 1X15A 3NUGA 3Q8XB 4DRYA 4EVIA 1WBDA 3TX6A 3C8DA 3PLAE 1T2VA 3LT2A 1CD5A 4RACA 3MTQA 4DDTA 1F38A 2JGRA 1JP7A 1QVZA 3DGFC 4L6CA 1SXJD 2QN1A 3BJRA 1LSJA 4UZSA 3FZNA 1NT4A 4ZZ0A 3EPRA 3U40A 5EERA 4NBLA 4A5SA 1KHTA 1Q7EA 4N1AA 2OCAA 1H6DA 1WMEA 2A0KA 3LUCA 2QR3A 3IIMA 4DXAA 1Y63A 2NP6A 5L51A 2OFOA 1EWQA 1A98A 4YMUA 2C92A 3CIOA 4E0BA 4YRQA 1S89A 2WDPA 3GT3A 3EFOB 3HDGA 3T99A 4DRXB 3ZKAA 4E5SA 4PSUA 1CZOA 4QC2A 4X93A 1AGPA 2BISA 4ENQA 4KIUA 5KPDA 4ADSG 4AKEA 4J90A 5K6AA 1TZMA 3ICVA 3MCTA 2H4WA 4HFRA 4F91B 1Y4ZA 3DDWA 2J1LA 4I9NA 4KOEC 2CF5A 3D2BA 5JARA 4R54A 5DM2A 1IQ0A 4IAOA 1NJGA 2NTNA 3R7NA 3Q4GA 1SU7A 4Q1AA 3B51X 1P8JA 4RVUA 3ZHZA 4TZ6A 1ISJA 1I0IA 4ICIA 4QJBA 3UK6A 4BLSA 2R6GA 3WYBA 4IHJA 2DY1A 3IIKA 3FYUA 1NG1A 3CGWA 2ETVA 2QQGA 3FI0A 3TIXB 1FDTA 2Q4EA 2WWHA 4QQ8A 2VZ8A 4QLAA 5CRIA 3OZTA 2RG7A 1WSWA 4OYHA 4P7GA 1R0LA 4ND1A 2BJHA 2CLFB 3NFYA 2HQSA 4R83A 3EDMA 4UVGA 3AP2A 2C7BA 3QI2A 1K8XB 4A0RA 4BVFA 2I80A 4BGDA 4O2AF 3JVIA 3OQIA 2VQ3A 4R9VA 4XYEA 3MCUA 1UMCA 4DR2B 3OP4A 5A9SB 4B82A 3PGXA 1DUSA 3T06B 4Z5XA 3UJ9A 4FTWA 4YC7A 2DWPA 3NQ41 3RS0A 2GZSA 2HV8A 1FL9A 1UP7A 4WK2B 3QHPA 1D1QA 1TMKA 3KSRA 2BT4A 1VPVA 1WV0A 2B4TO 1XYGA 1NQVA 4L3OA 3TFQA 2AMLA 4KFCA 5FQOA 3DAYA 1E0KA 4JOQA 4LOAA 1WO8A 3O3NB 3OIDA 4X3PA 1CVRA 1G5HA 5CTJA 4F5YA 4Z49A 1KNXA 1ORTA 4AX8A 1YZHA 4MSUA 4XCVA 3E7XA 1AVTA 1SB9A 2YWHA 5ICGA 4MUNA 1Q0QA 3AFOA 3B1YA 2I1VB 4R6XA 1UDXA 2VPWA 4WXYB 3D0OA 4RKQA 1YS2X 4BWYA 2VTDA 2F7SA 5IJXA 1YMUA 1NRJB 2VYFA 3AUJB 1LVUA 1YE3A 1ZBQA 5AM4A 1CJMA 3WGIA 3HKCB 3ZQJA 3A05A 3HA7A 1XCGB 5EIEA 2J3MA 4G0UA 4ZU3A 4ZCQA 1E1NA 3GK3A 4BQOA 4X41A 5CXXA 2WJ3A 1X9IA 4RKEA 5F3DA 2Z58A 3QF7A 1Q0ZA 4ZYLA 2IXAA 3L01A 1GCOA 3BF8A 1NULA 1VSUA 2IH4A 4AJKA 1BHSA 2Q4TA 2EU8A 4ND5A 5K0CA 1PTJC 4JBNA 2ACVA 2J5RA 3SR3A 1PUIA 2VP3A 1DELA 1Z18A 2QDKA 2ZE7A 3LIIA 1EGHA 2CBGA 3QFFA 2VAWA 3HSKA 3MJTA 4FHZA 2PRKA 3BRCA 2Q4BA 4RABA 2H1IA 2PY6A 5AHWA 3VC3A 3ESZA 2QRHA 1XRJA 4XIGS 3GLGE 2HTFA 3EBPA 1L4EA 3W3AD 4IXNA 3GFQA 3RYCB 4FE3A 4UBJA 5IAGA 4AMBA 3UWSA 2FOLA 2Z57A 4JI0B 3ZK7A 5K0SA 4BFYA 2MTBA 1J33A 4CMJA 1C2YA 2ZIVB 3G1UA 4B44A 1M2GA 3KXDA 3P9KA 3M6XA 4HNVA 5SY6A 3FTEA 1K8ZB 1WUJS 2IC5A 3KP1A 4EEZA 3B5IA 3MF4A 1EX1A 3C48A 1QO0D 3EFEA 2Q7OE 4CKWB 4F8YA 1E2NA 4GLOA 4XIJA 1B6TA 2BEVA 4YH1A 4Z9FA 4BQQA 4BZPA 5I01A 4J1QA 1B0AA 2A9QA 1CP2A 1KJIA 2DQZA 1ZINA 1YO6A 1G4HA 2EEZA 1VIMA 3OPMA 4ARIA 5KTOA 1BFDA 2PS0A 4MUIA 2JGNA 4RTMA 3ZLVA 4FZ3A 3B60A 2J6HA 3GWZA 3LF1A 4G86A 4UCXA 1YB7A 1H85A 1QFXA 3IRUA 3L0SA 1DKRA 1CULC 3ZDXB 5KVSA 3AR3A 1W44A 3GJRA 1W4RA 2VBGA 4G1BA 5SZIA 1S2OA 1RSZA 4NJOA 5JYDA 3L8GA 1EQAA 1ZL0A 1JHMA 2Q5EA 3C14C 3PPWA 4XAQA 3D5TA 4UTNA 4ZP1A 4RE5A 1H4QA 5BW5A 4K3UA 1N36B 1QR2A 5LYYA 5JQGA 2CHEA 3RNOA 1HT3A 1W4ZA 3DYIA 3H9CA 2X8LA 3EVEA 1K5HA 2O7SA 3WVNA 3DMRA 3G1WA 3X2SA 2B7BA 4PF1A 4DOMA 2XUIA 1OGJA 4FLMA 2GZ3A 1GUBA 3D7KA 2VNKA 4BO3A 1CUGA 1E1RD 3IS3A 3GP3A 1YMVA 3V8VA 3B3QA 2C4VA 1S2LA 4JT2A 3N2KA 2P3LA 5ICCA 4DM4A 4RFSB 1YRLA 2EOAA 5FUXA 1DKNA 4MW0A 4IGIA 5F1OA 3N75A 1H9BA 2CNLA 3UMJA 1I1HA 3RI3A 1AMOA 4M2LA 2V65A 1JHPA 1IG3A 2OBBA 3K96A 3WGJA 3G68A 4BMCA 3O90A 4UCWA 1KIAA 1UJ2A 1VE9A 3FWHA 1R9NA 2VXCA 4EENA 4XB1A 2ANCA 5K3CA 5CNJA 3TAXA 4H7DA 1QK3A 3IQEA 2BEWB 5JCJA 2O7RA 1DWQA 3KHSA 3ONWA 4M76B 4O63O 1TL7C 3ZE2B 4YT4A 3PDIA 3AF6A 2FPGB 3FTDA 2PUVA 3ZDZB 1G3QA 4NV1A 5A06A 1JVSA 2AG1A 1PJRA 2ODTX 3PZRA 5BN5A 2DM6A 3O75A 5LMCA 1SELA 1HA3A 3BRWA 3BK2A 5KJFA 4RKWA 1I4DD 2Y93A 4XTRA 1H2XA 2QROA 2TYSB 1EGMB 1VKRA 4JJEA 4EA8A 2PD3A 4BO5A 2VP4A 5C5DA 5B37A 1XTBA 3UFXB 4R4JA 1EDEA 2PSSA 4JP8A 4L9RA 3HZOA 4ZQCB 4F60A 4A2QA 1GEEA 4KMSA 4KQCA 2BD0A 4PLHA 1E2GA 4FYPA 2YYYA 5EI5A 3KQPA 4Z9AA 3DBRB 1GZUA 2J87A 4GGOA 2CEAA 3U4GA 3X0DA 1JFFA 1ZNWA 3EG5A 3TXYA 3O8OA 4PZAA 3CVVA 5DT2A 1WV1A 4G41A 3D6AA 4CE6A 1LQ2A 3GD7A 2ZJ6A 1HLDA 3E8XA 3R9XA 5F35A 1E2UA 4H4DA 2AJLI 3AR6A 3DAHA 1P2SA 1O94D 3NHWA 1F0PA 4N54A 1AGNA 2QMQA 2H57A 3FSRA 2OA0A 4CT4B 2QX7A 3HEAA 4CLOB 3EY9A 2CVQA 1QHSA 3IUPA 2XRZA 3G5AA 4U9UA 3E2IA 1ZJZA 3B20A 1JDPA 1EBBA 5K6AC 4F2DA 3N6XA 3ZJTA 1W5EA 5JCPA 3U5TA 3CEJA 4NEHB 3H8JA 2C7VA 2C1XA 1TM2A 3ICWA 1ZONA 3FCYA 1MQAA 1R9MA 1BDBA 3E61A 1UODA 1ZS9A 3K73O 4IZOA 5D87A 4D3XA 5BWOA 1ECGA 2CJPA 5MHTA 2BMAA 2BBWA 4MS4B 2QE7A 5FWYB 3L8DA 2YBEA 4GI5A 3AF1A 2GN6A 2PIAA 5E9JA 3VGJA 821PA 3VA7A 3QX7A 3PUHA 5FLKA 1MX5A 3NATA 3JQPA 1RHKA 3FYUC 3HCOA 4J3FA 1ZK1A 1APBA 3NANA 1GDTA 1CZHA 2FFJA 1KBQA 2YJ5A 3RSFA 1L7VC 1R5NA 5HS6A 5KYYB 2JI8A 3HM9A 1SNYA 1A95A 1CQPA 2WM2A 2FDCA 4JQZA 4BTEA 2OFFA 3O1LA 1NN5A 1W29A 2OV6A 4E6EA 2NTYC 3DKIA 3UT0A 4M9RA 4KBFA 4YJFB 2AF4C 5FFMA 1Y7HA 4M83A 3E58A 1HLFA 2H3HA 2WT4A 3RSGA 2ZJOA 3GJ3A 5DTIA 4CDGA 3UJBA 1QGUA 3AFIA 1G8AA 2E55A 2YNMD 4KK3A 3WGLA 4QARA 5JUWA 4W5JA 1OE0A 1SC6A 3NPAA 1YJXA 4Z0PA 4YREA 2WAAA 2H16A 4B0PA 1RAFA 3H5IA 3H8WA 5LQDA 4I81A 3GAAA 1EFRA 2QSZA 4S1VA 2VAVA 3F49S 2OZKA 3HY4A 4JMLA 5DZSA 3G9ZA 1TMYA 1V3UA 4YMWA 1Y1LA 3ORQA 1TOAA 3G8BA 3KT8A 1COWD 3PJDA 4XRRA 5ED4A 1DTWB 1YF3A 1NBOA 4HAOA 3L8ZA 3GPBA 1G7SA 3LLCA 5TV2A 3V1LA 4PYQA 1FNNA 1U8UA 1ZIXA 2O2SA 3P9PA 1I6MA 4O8CA 4W6ZA 1Y8QB 3LYAA 5AJXA 5ALQA 1SD1A 1E6KA 4QAQA 2WPDD 3KHKA 5HQTA 1KEUA 1P5HA 5ENZA 2XCOA 1QGDA 2O50A 1RJWA 2I3GA 2XB6A 4PLVA 3ZE9A 2VHYA 4QUJA 1DJLA 3ZJ5A 3HNOA 5BW4A 1MG0A 5ENDA 3B3JA 4ZAGA 3SQDA 5A4AA 3U19A 3J80A 3KVRA 2OB2A 5KNDD 1VE5A 1QK5A 1XV5A 1Z26A 2XRFA 2HMUA 2Y9MB 3O95A 4HVTA 4OYRA 4OJYA 4B5KA 4EHNA 3I6BA 1QH1B 3IOEA 3L82B 4TZTA 1OXBB 2IY9A 2XGOA 4NYIQ 5G4LA 1E9FA 3VHXB 1G41A 2CYAA 4N3CA 2SKEA 2G88A 3PF8A 1D8TA 4QEZA 3KLPX 4CMEA 4BVGA 3UTDA 2WVGA 4EK9A 1PCXA 4ZGBA 3E2PA 1T5BA 1OT5A 3MYRA 3M1YA 1MXHA 1C3XA 2WSSD 4DLXA 2HC9A 1WQ3A 3ANLA 4YMTA 4PWZA 1ESEA 4U02A 4XB6B 1CEEA 3FMIA 1SUCA 3IQFA 4J2HA 2DHEA 4CL2A 3CF2A 2O19A 2RGGA 1G63A 1RJFA 2FEAA 2PXHA 2QAJA 3IUJA 3K30A 3KYCA 2B35A 3OCXA 3TZQA 4EA9A 2IEAA 2FW1A 5E4JA 3HXLA 4P33A 4UFOA 2EFYA 5LIPA 1Y0BA 4B9AA 1Z4MA 3CW2A 1CQJA 1QONA 1EX9A 2FSGA 2PWAA 1Q57A 2VQ6A 3QXHA 3NBMA 3RR2A 3VU3A 3RQSA 3LHIA 4ZT7A 3WC4A 4BP8A 5KINB 1WXQA 1E3DA 1GU0A 5JCXA 2C3MA 4H0CA 4ZT6A 4J3NA 1XDBA 2BGJA 4Q16A 4EH1A 4HNQA 3RUIA 1BXGA 4YLYA 4LJRA 1BKSB 3GIWA 2VPIA 1TUBA 4BZQA 1AJEA 1L8LA 3WKBA 3G0HA 2VNJA 4BLWA 1I13A 4MLPA 5IEBA 4KXVA 4FGWA 3CWCA 3R77A 5EXPA 1IK6A 3FTFA 3P2YA 1U80A 5C31A 1TQHA 1H6AA 2OQ2A 2GOYA 2JCSA 4RIHA 3QUQA 1C3OB 2AE1A 1TKRA 3RYIB 3PNPA 1SPXA 1U0NA 2ZWAA 4M8IA 3RM3A 2XGJA 2XBUA 2HNKA 4RD3A 2YVAA 3VYUB 2CMFA 4NOKA 3U7HB 4B7XA 1A7UA 3EARA 1ZW1A 221PA 4TQ9A 4NPCA 4F5ZA 2P9EA 1AX9A 1W36D 1DEXA 5IKPA 4KAAA 3HJRA 2FQQA 2WMNB 2VYCA 3HFGA 4CM8B 1QYXA 3H75A 3OD1A 2HCRA 3PGLA 2FP3A 4L8WB 1YR9A 2IYLD 4CNQA 2JJ2D 4OGWA 2D8MA 4FZRA 3SYLA 2DB3A 2QTVB 4LDJA 3RIXA 1V5FA 3H1FA 4LDAA 2YVKA 4XFKA 7MHTA 1UH5A 4MQ6A 5K0JA 3AY7A 5HF9A 3VNVA 3FUXA 3V4VB 2Q9AA 3EXAA 1XLVA 2DTXA 4CIYA 1CR1A 5IZCA 2HWUA 4UCFA 3R4VA 1ECFA 4CV0A 4WECA 3ZD7A 1GA1A 1O0SA 4LTDA 4D80A 1DMRA 4Y7CA 1FX0B 1YQEA 4YGYA 3DM9B 3AKZA 1K8YB 1KTVA 2I99A 2Y0BA 3ECCA 3JW8A 1XBTA 1B8NA 3R7FA 2K2WA 2ZULA 3VU1A 1QMPA 1C3JA 1KETA 1SBCA 1ZIYA 2C2XA 2IIBA 2IU6A 2JH9A 3QTBA 3UMMA 3EIQA 5EUMA 1HE3A 2I2CA 5AK3A 4C7JA 2ZSFA 1EVLA 2ZW9A 5DNUA 4NNOA 4X1IA 4KE6A 1QFZA 3F3KA 3FIJA 1CU1A 3HKEB 1KU0A 4ZHQB 3NMUF 3CVUA 1VA4A 2YV2A 3GJXC 2RBGA 3Q1KA 3DEIA 1FUUA 4BBPA 4A0QA 3ORYA 4LNUB 3U7EB 5LWQA 2W90A 4B6PA 1NU8A 4R9RA 3U5ZB 3I1IA 4WKCA 1XZHA 4DLSA 4RZQA 2AQKA 3PTZA 4WZBA 5M7EA 1NBHA 1TC1A 1U99A 1QRUA 3MHTA 1URPA 5CB0A 3PJRA 4JI7B 1ONSA 2BC9A 2OQRA 4PZ0A 4PFKA 2WQ6A 1JDUA 3WDMA 1I7SB 3SVLA 4CU2A 2FPMA 4PX9A 4ZVVA 1OH8A 4HHEA 5C8YF 2B8JA 1K3TA 2R44A 4G4IA 3K71B 3VO1A 2C83A 4UBLA 3QEAZ 1X8JA 3WKCA 4F6RB 1PSWA 1U9CA 3TOXA 1E7MA 2Q9CA 4I1YA 4F1KA 5J4LA 1D5WA 3BX1A 3IRVA 4ER7A 4F93B 3I9FA 3AXTA 2VG8A 4DVGA 1R7RA 1X7HA 1FJHA 1KK2A 2UZIR 1IN6A 1J2UA 1E99A 3V8RA 4DBZA 4Y2SA 4MCAA 1UCFA 2XTMA 3OZEA 3G0BA 4G37A 2W2KA 3F4LA 1G9SA 1QO9A 3F5SA 4A2WA 2H2GA 2YHUA 5BWNA 4I99A 3WDLA 4TYYA 4O4LB 1DDOA 1GZVA 4O3FA 5DKFA 2B0CA 1ZGZA 2ADMA 3RFXA 3B2QA 3O7WA 3DBIA 4EG0A 1R3UA 4B4VA 1PW7A 4N3GA 1KQOA 1BN7A 1SURA 1KS9A 1PU2A 2FFBA 2Q8PA 2Y3IA 2YC2C 3WADA 1ZJJA 4EUSA 4IR7A 5AD1A 4GPTA 5CJ2A 1JAYA 4H1TA 2WMOB 2B83A 4W99A 3RJMA 5I7HA 2BFEB 4MAMA 5LFAA 1SMKA 3BQ9A 4B1FA 4MPJA 5LQMA 3IEUA 1ZD1A 2XECA 1OV4A 1ZDMA 4BO1A 3OLQA 1ZSNA 1NNUA 1Q15A 2SECE 2WZDA 3DVQX 3NC1C 1NLFA 3EGXB 4ZMBA 3P97A 2ZR7A 4TKVB 1L1EA 1VI2A 2GNAA 5CFMA 2V55B 2C2WA 3E35A 2L2QA 5GQSA 3R7BA 5DISB 1YQDA 1LS1A 2W2PA 4IVQA 1VE6A 2CNWA 4C3OB 3IELA 1SK8A 2ES4A 4N7BA 4P35A 1GG8A 2ISQA 2YJTD 4XYMA 3LM8A 1W8IA 1X74A 2QT0A 2V7EA 1Y9DA 2H52A 3KU1A 1QV7A 5DHSA 2JG3A 3WGUA 5DGDA 5TJHA 4EDHA 1R6BX 5HJ2A 1XWWA 1VKNA 2Y6VA 3FIUA 1JXMA 2AB0A 4ZAZA 5FEMA 1NHWA 2I1LA 5CDFE 5A05A 1XZIA 3WMFA 2O9JA 3W5DA 3NO4A 2HMYB 3KVYA 5I9SA 5IVPA 3ER8A 1B8VA 2ODBA 2CXNA 3ESDA 4BKMA 1G64A 4Y18A 4QUKA 3BJMA 5IVDA 5C3MA 2PJDA 3GOQA 2XMCA 2B4RO 3UN1A 1O9HA 4KRYA 2GTPA 1E5VA 4QQRA 1LH0A 3MB8A 1TYBE 1OZGA 4Y2RA 1X7WB 4BEJA 4DCVA 4II3A 4Q66C 1X7ZB 3TFOA 2WRZA 3GJ6A 2C61A 2VSQA 2WIAA 4JL6A 1WS6A 1NQTA 2W8BB 4IDEA 4Q1CA 3NKFA 3CPHA 1OYWA 5EIOA 5IHPA 1PHRA 2NSHA 2HT6A 5BQFA 1IATA 4YI3A 4OUDA 1KEPA 5FL7A 3DYVA 3DDZX 1T5IA 2C5BA 5TMDA 1DRUA 3KRTA 4Z7QB 4UDOA 3WIDA 3EF1A 1RM4A 4BGEA 1JNYA 4M21A 3GG2A 5KYXB 2QX9A 3FPHA 4NG4A 4QASA 3I2JA 5HQ3A 3FRJA 5EMMA 4BDSA 4W5HA 4V3CA 4JP3A 1VHWA 5IANA 1E9EA 1RWPA 1Y4UA 4CEJA 3BCUA 5D3MA 3IVMA 3V1UA 4JBGA 4CV1A 4EI8A 2ZM6B 3DL7A 4ZPXA 5FORA 1ANKA 1XJWA 1T2UA 4DLNA 1PZFA 3R3SA 5L8VA 1QQ5A 2Z1DA 1VYTA 3NC0C 3PI7A 2DJIA 4RZHA 3RVDA 3E70C 1OJLA 4ZAVA 2PTGA 2Q0XA 4BVL