4AJIA

Rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
327
Chain Sequence
b'ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
molecule tags Oxidoreductase/inhibitor
source organism Rattus norvegicus
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
total genus 115
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajiA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajiA02
4ZQBA 4F6LA 4EUFA 3GF4A 4O6VA 2EIHA 3DBLA 4RPKA 1N7GA 1DIGA 1Z45A 1HETA 2VWPA 5KIAA 1Q1NA 2AE2A 1Q0LA 3HSKA 4YTEA 3TJRA 3FR7A 3PQFA 4R1TA 4O5OA 3IIEA 1N8KA 4XYEA 1DIHA 2IE0A 2Y93A 4DVJA 3PLNA 3IL2A 2ZYDA 1E7RA 3ZCXA 3ZNOA 3O38A 3FNHA 4NBWA 3U0BA 2B4RO 4RQTA 3UFXA 2VCYA 1H0KA 1HXHA 2WYWA 5B4UA 1QV7A 2VT2A 3PYLA 1H5QA 2GSDA 3CEAA 4CL8A 5MDHA 1GY8A 3WFIA 2NTJA 3W8FA 5CPBA 1EZ4A 2EKLA 3M1AA 1FK8A 3KV3O 3PHHA 2HMTA 2DPGA 2HU2A 4G81A 5ILGA 4A27A 3FPCA 1Z6ZA 3OIDA 4OAQA 5I7EA 3LK7A 4BNFA 4LCEA 2HK9A 3PDUA 2YW9A 2OXIA 3U5TA 1PS9A 4XYGA 3PWKA 4B4WA 3MTGA 3RC1A 4E13A 4AICA 1VSUA 4KMSA 2VHXA 1E6EA 3U4DA 2YV3A 3KLMX 4BNMA 2X23A 3Q9UA 3MZ0A 4YPOA 1PQWA 3OQ1A 5CEJA 1J5PA 4IIVA 1IZ0A 2YHIA 1GCOA 1V3UA 3OIFA 1BGVA 3BHIA 3QJ5A 1PJLA 4J49A 4TRJA 3GT0A 4DPLA 4KTVE 1X0VA 3D3WB 3F5SA 4XQGA 3DAPA 2E48A 5G4KB 1P1IA 4HKTA 3HJAA 2FN7A 4PG4A 1I24A 2Y0CA 2PGJA 2X22A 5CDSA 6ADHA 4JLWA 3RJ9A 3GPDG 3D4PA 5JY1A 4GMFA 1PZEA 2PKRA 3L6DA 5F5LA 3RFVA 1BWSA 2JCVA 2DVMA 1ZK1A 1NFFA 4IQ0A 5A9SA 5ES3A 3RIHA 1IPFA 1Q7BA 4R69A 1H6DA 4BNKA 1T26A 2BGKA 4QFDA 4Z3DA 5KVQA 2D4AA 4BB5A 3DMTC 1ZSYA 1BXZA 3EYWA 3FPLA 3P2YA 3WYBA 3C7AA 3ZH2A 5B4TA 2GPTA 2A94A 1U3TA 1F12A 3AUAA 3HB4X 4Z0HO 1YONA 2PZJA 4CL3A 4RORA 1JW9B 1I0ZA 1K5HA 3KYCB 5L7TA 2GYYA 4PLTA 3I9OA 4Z9XA 1MA0A 3SJUA 5T67A 2ZK7A 2PTGA 1BXGB 1TA4A 2AQKA 2J8ZA 3TL3A 3ONDA 4YB8A 3TRIA 4DTIA 4QFCA 3I4CA 1A7AA 1EQ2A 5IDQA 1LI4A 2AG8A 4JBHA 1GZ6A 3OMLA 3TDKA 4IQGA 1E7WA 3PXXA 1HE2A 3EUWA 3X2FA 3HN2A 3JQ9A 3HHPA 1ENYA 1MV8A 4Q39A 5TJ9A 3TZQA 1FXSA 3GNSA 1C0KA 1HWYA 2CFCA 3CIFA 4H3VA 2P4QA 3BTOA 3VVBA 1ULSA 5THKA 3OEYA 5JDIA 3GFBA 5U1PA 2PV7A 1PJQA 3WIDA 2YV1A 2AG5A 3WIEA 2O4CA 3JYQA 1ISIA 2C0CA 2ZCUA 3BMQA 4DQXA 4II2A 3I6QA 3PZRA 4NJMA 1M6HA 5I7FA 3WGGA 4MINA 3P2OA 3JQBA 4R3WA 5GZ1A 1HDOA 5C7LO 4UVGA 3RBXA 2Y1DA 4L8VA 4HUJA 4HXYA 3BMCA 1E6WA 2H6EA 1U2GA 5I8ZA 1PR9A 5I8WA 4OOEA 4Q3AA 1ZXLA 4BL5A 4TKLA 2PGLA 4B4UA 2I5PO 2Y1CA 3ANMA 3ZW9A 2HJRA 5KJ1A 3UKOA 1HTBA 3NTOA 2C2YA 4GWGA 1XELA 4J0FA 3GUYA 2PZMA 3H4VA 4N5MA 4TMFA 4YDRA 4HFJA 4YR9A 5MGBA 1HE3A 4CM9D 3WR5A 1IYZA 1I10A 4FQ8A 4XRGA 2WJPA 1GPDG 3QY9A 5IZCC 3QHAA 3QP9A 1W8DA 3D5TA 1ZSNA 2J3KA 4JQCA 4P38A 1P44A 4UUNA 2NNLD 3MCVA 3TL2A 3BYZA 3DTTA 4RDHA 5B4VA 5IF3A 1LC0A 1XEAA 4PN3A 3W4IA 2Q45A 1M6WA 4CM4A 2ZJ1A 3JQCA 5DCYA 5LDHA 4J9VA 1U3UA 4MVJF 1CEQA 1L1FA 2YUTA 4GX5A 5G4LA 4RPHA 4BGVA 1ONOA 3C1TA 4IZHA 2VYNA 1F8GA 4BUCA 3JD4A 3AOGA 4RGBA 3HDYA 1GYRA 3V1YA 2E82A 3G0OA 4IGFA 3BHMA 2W2KA 3FWZA 4RLSA 5GY7A 2O3UA 5FYDA 3JQEA 1I3LA 1IE3A 1E7YA 5L45A 4W9NC 2GN8A 4HNHA 1H94A 3DZHA 5G0VA 3RBVA 5T57A 1SOWA 4A73A 1SPXA 1C1XA 4YJHA 2PGDA 5EN4A 2ZATA 3JQDA 3PHLA 4PLFA 4E12A 4DIFA 3SLGA 2I99A 4WJZA 2FP4A 3D3EA 4UUMA 4B8ZA 1BMDA 5JC8A 5AYVA 3NX4A 4GAEA 3JQ7B 5BSEA 3GY0A 2HMVA 3CMCO 5AQ1A 2AQ8A 4MVJA 5JS6A 5TQVA 4LRSB 5K6AC 2GRAA 1XU9A 2E49A 2RIRA 3I5MA 1XA0A 5IDWA 2QYTA 1U7TA 3GMSA 1DDOA 3DMYA 3P5SA 2DPHA 3HQ4O 4W6ZA 5JAMA 2DKNA 3HFGA 3ROQA 4BMNA 4ZJUA 3UF0A 3I3OA 4WLFA 1YBMA 3GMDA 4CUKA 1I32A 3ZWXA 4ZA2A 2FSSA 3PGXA 3E9QA 2GN6A 1Y7TA 1CYDA 1NR1A 3LLVA 4QT0A 4IBOA 2O3SA 1SAYA 3K92A 3FNFA 2HDHA 2CVQA 4YT5A 4JXKA 3H3JA 3CZRA 3U4CA 1PZGA 3H6KA 2Q1WA 1SEVA 3GH3A 4H7PA 3GLQA 4FFOA 3WB9A 2B83A 5BNFA 5HS6A 3ZNQA 2FWMX 1YJQA 3IDSA 3ZWAA 3OJ0A 1E3EA 4BKOA 1HDXA 2ZYGA 1FMCA 4NIMA 4DMLA 1DFIA 2EG9A 1T24A 3ZV5A 1I2ZA 4UULA 4KP7A 5C5IA 2B35A 5HRUA 4CODB 2R00A 3EC7A 4MKRA 1QSGA 3LC2O 2CZCA 3H9UA 2P4HX 1X13A 3LF1A 4BKQA 2PKQO 3WWYA 1DBVO 4GBJA 1HDRA 4DBVO 1G0NA 3GVPA 3VZRA 3FNEA 4BNLA 1K3TA 1NHGA 2B69A 3ZWOA 4BIIA 1XWFA 4CLOA 3RFXA 4BNNA 1P1HA 1XCBA 3F46A 4GGOA 4JJFA 2Q4BA 1NQTA 1H6CA 4D3DA 3E6AA 4K9DA 1JVSA 3A28A 3VZPA 1A9YA 3R0IA 4U0KA 5FFFA 4HADA 4MVJH 4FJ0A 3PJFA 2Q99A 4L73A 4ALJA 1FJHA 4DLBA 3HUDA 4XGNA 3ADPA 1Y8QA 3GFGA 3K5PA 4KTTE 3VH4A 3H9QA 4GVLA 5HA5A 4QEDA 1A72A 3AM3A 1KY5A 1GDHA 1D4FA 3PK0A 4BO5A 4A10A 1ZCJA 4IDBA 5DZSA 3RFTA 3IKTA 5JMPA 3AW9A 1EDOA 3ICPA 4F45A 2VWHA 4AJLA 3MTJA 1YQGA 3OM9A 4Z9FA 3ROMA 2H5LA 4YEDA 2EGGA 5DOVA 1X7GA 4Z6KA 1GD1O 2JAHA 3TZCA 1C3VA 4WOJA 3GG2A 4LGVA 4BO7A 4GPD1 1DJQA 3BMNB 4TKMA 3V2GA 1AXGA 1E5LA 5EIOA 5JCXA 2VHWA 5H83A 4BNHA 4IJUA 2F1KA 4PRKA 1O6ZA 3DZKA 3QVWA 1UXIA 3ITDA 1HE4A 3I83A 3LC1O 1PGQA 4YWJA 4N7RA 3DZFA 3CPSA 4BNIA 3TNLA 1W4ZA 2VZ8A 3F1LA 4CR6A 4B8WA 4AL4A 3DAFA 1DPGA 2DFVA 2UVDA 4NK5A 3DOCA 2X0IA 3OA2A 4WGGA 1LX6A 4BNGA 4NR0A 4YBZA 3BTUA 1DLJA 3A14A 3QE3A 1DEHA 5HBRA 4EDFA 3I9KA 1ZK3A 3EDMA 1UXJA 1WMAA 2I65A 1U4OA 3KB6A 4J6FA 3T7EA 5KVSA 3JQ8A 4OGWA 5CP8A 3S2GA 2GNAA 3PI7A 2GCGA 4BV9A 3BTSA 3KHUA 4OXKA 4A0SA 3NT4A 4MIYA 3H2ZA 2FMUA 4CQMD 5EPOA 4LSWA 2Z1MA 2IYOA 3GRKA 1JWBB 4FJ1A 4IXTA 4DLAA 4YAIA 1E7SA 4I8XA 4NH4A 3H2SA 3WBBA 2VQ3A 1ZMTA 2POQX 2EKPA 3LVFO 3IUSA 3QVTA 3QV1A 1ZSVA 1O5IA 4R68A 1R6DA 2QIOA 1PGPA 3NDJA 4PLZA 2YFHA 3I9LA 4CM7A 3AK4A 1E5QA 1Z73A 2Y99A 3WTCA 3D1LA 2VUTA 1PJ3A 4U5QA 3RC2A 1ORRA 2O48X 2HSDA 3SBOA 5DCWA 4CJXA 1CIVA 2V6GA 2HKIA 1GU7A 1X1EA 1E3WB 1LDNA 4F3YA 2IEBA 3DHYA 2GASA 5B12A 1YE3A 4FJ2A 3RI3A 4D7AA 2J5KA 4K1LA 1P1JA 4DXHA 2WEKA 3W8EA 2VYVA 1Z82A 2X4GA 2ZB8A 4QUKA 4IDAA 3K96A 3JTMA 3MJSA 1NTOA 3UCFA 1OC2A 3OA0A 4OYRA 4HBGA 5TS3A 1GEEA 3PYXA 3TZHA 3E82A 4PLCA 4PZCA 1JAYA 5KJCA 4CMGA 4NBRA 3P19A 5A5FA 1GEGA 2O4UX 2Y66A 5JE8A 3FN4A 4GWKA 1IULA 1JKJA 2B0JA 4MDHA 2W90A 1X7HA 1HDYA 3C7CB 3RUIA 4E4YA 5KTKA 2GGSA 3DL2A 5DDIP 1Y5RA 1N9GB 3TWOA 3LT0A 1E3SA 1E1MA 5AOVA 3CINA 4CMKA 1ZUD1 2Q4EA 4IS2A 2PZKA 2O2YA 4BMVA 1DFGA 4HFNA 4INAA 1UZNA 1EVYA 1U4SA 1H2BA 4L4SA 2QRLA 3INTA 3CTMA 3E9MA 1N2SA 1G0OA 3UUWA 3BMOA 1R0LA 4QTZA 3ZI0A 2CF6A 4ALLA 3GDFA 4ND4A 3ZU5A 1HZZA 3PPIA 3SLKA 4DIOA 3DBRB 1ZFNA 3NT5A 4RV9A 3KSZO 3RSHA 2UUPA 1YQXA 4YJFB 3GA0A 3D64A 2JHFA 1BW9A 3WJAA 3PP8A 1LU9A 4U7WA 1T4BA 1H9BA 4NJMB 3AY3A 1IY8A 1SMKA 4JIGA 2Q1TA 4GI2A 2DQ4A 2X8LA 4R51A 1UAGA 3TFOA 4GX1A 4Q3DA 4BV8A 3UCXA 1KOLA 3R3JA 2NTNA 3UVEA 2TMGA 3SJ7A 1BTOA 1GR0A 3UCEA 1EE2A 4YQZA 1SC6A 2NWQA 5HTOA 3JQ7A 4IINA 2GERA 1CDOA 5DBGA 3O8QA 5TT0A 3FBGA 4ZGWA 4CMIB 5TJHA 1ULUA 1P1KA 3BHJA 3NDRA 2YY7A 4OL9A 5IDXA 5JAZA 1LRJA 2PH3A 4BO4A 3CMMA 1BW9B 4IDEA 1SEPA 4CPDA 1NPDA 1YWGO 4N18A 3IJRA 4XZ3A 2NADA 4PG5A 1R37A 3W4KA 1EBFA 1HT0A 4LW8A 5JDCA 2IXAA 2NVWA 3AM5A 5K0ZA 4RF3A 2B5VA 1Y5MA 2AXQA 1KEPA 3AOEC 1ADBA 3K2BA 2DTXA 3HDJA 1KBZA 2C29D 1TVEA 1QG6A 4MIEA 4BVAA 1KC3A 2OHXA 4XDYA 4OOFA 4GGPA 3PJDA 4IM7A 1UZMA 4LCJA 2YQ4A 1C14A 4RJTA 5CG1A 5AVOA 1T2CA 2UUOA 2W2LD 5ILOA 1UUFA 3QLJA 2X9GA 2ZB7A 3RUHA 3O26A 1EUCA 1HSZA 2VWQA 3QWHA 5KVVA 4WCFC 4YAKA 1OFGA 3T4XA 2QHXA 5JSFA 5KNLA 4BHTA 2PNFA 1LNQA 3VKUA 1SNYA 2BKAA 4CV0A 2AHRA 1DAPA 3ZWNA 1LDGA 4JX8A 1GUZA 3PYMA 3I6IA 4EGFA 3JD3A 4FFLA 4R1SA 3KXDA 3KYDB 4KUEA 4RQUA 3HWRA 1PJ2A 5FEUA 3WNQA 5IXSA 4MVJM 1G1AA 4LVUA 3ZNNA 2Q2VA 4J9UE 1FDSA 1PR3A 3TOXA 2WSBA 2X6TA 4UREA 4D0RA 3NGXA 3E18A 3H5AA 2OZPA 2OOSA 3DFZA 4ZD6A 3AUUA 4GLLA 2OFPA 2A9FA 2RAFA 2PK3A 1QMGA 1VL8A 4AVYA 4XGKA 3DZGA 4WUVA 3ETGA 3L6EA 2NU7A 3ONEA 1OBFO 3WG9A 1CERA 4M49A 1DC4A 4WCDA 1JVBA 5JAIA 1NWCA 2BFAA 2C59A 4Y67A 4UAGA 1M76A 2W4QA 3H5RA 3M1LA 3RUEA 1QP8A 2X86A 4E5NA 2PFGA 4AJ1A 2C82A 2Q1UA 4RLHA 4CR7A 5EERA 1PJBA 1U2DA 2OP1A 1RWBA 2QZ9A 3RROA 3QWFA 4BGUA 3PRJA 3A1NA 5AXAA 2VUUA 4UUPA 3AI1A 3GN2A 4FD3A 5A3JA 1P74A 1AUPA 5GMOA 3COSA 1AHIA 2HRBA 2VN8A 2EF1A 1TT5A 1E3IA 3C1OA 4HX5A 1JKFA 1KETA 4U0JA 3U4HA 3HNPA 3VC7A 3RKUA 1HYGA 2JAPA 3AU9A 1LXCA 3NAQA 4I5GA 3WOHA 5A06A 3EY4A 4BS9A 4CV1A 3A06A 1OC4A 5CDYA 4BGIA 4CM8B 1VE9A 3JQBC 4ID9A 1LDMA 3GQVA 3L6OO 3ZHYA 2FR8A 5KVCA 2GDZA 4N54A 4CM9A 5FI3A 1H93A 1PJTA 2EP5A 4O59O 3NJ4A 3NJ8A 4AJOA 4GL4A 3DBHB 2JD2A 2DBZA 4NHEA 4DRYA 3K9QO 3NEPX 5KOIA 1T25A 5T8KA 1BSVA 3VH1A 4J4HA 4WNIA 4TVBA 4JGBA 4YAEA 2ZQYA 3I4FA 4RPLA 2NVBA 2WYUA 3RQSA 1HL3A 5HS4A 2NSDA 4MVJE 4BQRA 1HEUA 4P4GA 5KKCA 2FPGA 3JQFA 2GN9A 1LDEA 2EW2A 3GZ4A 2W8ZA 2Q1SA 4LN1A 3N7UA 4J2HA 1ADCA 1YL7A 4FPXA 2B5WA 1M75A 1YRLA 3HZZA 3RVDA 3PGJA 4BKUA 3CKYA 4NBVA 4ALMA 3U09A 4K28A 1RPNA 3EZLA 2VYND 4YA6A 3DFUA 1R66A 1GPJA 2PKQP 1U1IA 3KBOA 2IRWA 4MP8A 4PRLA 2VTDA 4XDZA 3WXBA 9LDBA 2HJSA 5CFZA 3DTYA 4AJKA 5HM8A 1PGJA 4PCVA 3HDQA 4CUZA 1PJ4A 2NACA 2C20A 1XU7A 2D59A 1TT7A 4FFRA 4Y8VA 5T64A 3EVTA 1I3KA 2GN4A 2RHCA 4GX0A 4R1UA 4ZQEA 3WWZA 3WLEA 4J1NA 1SZJG 3RC7A 3JQAD 3B1JA 2JD1A 1KVUA 4OSPA 1AXEA 4O1MA 4R5HA 5IFLA 1C0PA 1ML3A 3CXRA 1E7QA 3W6ZA 1UDBA 3GC6A 1M66A 4QO7A 4FR5A 2AEMA 3OQBA 1HF3A 2DTEA 1U3VA 4L75A 3GGPA 4CLHA 4J91A 1EK6A 1LLDA 4K6FA 4OXNA 2EW8A 5K6AA 4EI2A 1LLQA 1KVQA 1VC2A 3D4NA 2NV6A 3ETEA 4KUHA 1Y9EA 3H9GA 1K0UA 2GZ1A 4HY3A 2LDBA 3TF5A 3ANLA 3D0OA 2DUUA 4KOAA 3K2EA 4NPCA 1CQJA 4Q3NA 4QECA 1GCUA 4JN6B 4NFSA 5JCJA 1PQUA 1PSDA 4CQMA 2FOIA 3DB2A 1JAXA 2X58A 2BLLA 3AI2A 1E1KA 1JWAB 2QW8A 1LSOA 1W0CA 3VOSA 1MFPA 3GHHA 1ZXBA 4RVGA 2Y0DA 5JFOA 4I5DA 3M2TA 5FF9A 2R2GA 2J5RA 5L3ZA 3QWBA 1KVSA 1I3NA 3E03A 1HLPA 3JYOA 4OM8A 3FF4A 3RBZA 4Z3KA 1RM3A 1Q7GA 2UDPA 4J3FA 1CJCA 4RVHA 4B3JA 3D4OA 4MVJI 2Y05A 5IN5A 4FFNA 1NYTA 1LLUA 4IZIA 1QYDA 5L4SA 4BGEA 3LLSA 4RZHA 3TZKA 3DAGA 3EK2A 2QYSA 2ZB3A 4WNCA 5A9RA 3ZV6A 3V2UA 1ENPA 3IAHA 2I3GA 1I36A 4CM4B 1UH5A 2D2IA 3GOHA 1F8FA 2JFGA 4FBGA 4QQRA 4DREA 2PR2A 4ROSA 2X5KO 4TRMA 2NQTA 3BZUA 4DYVA 5JBIA 3BA1A 5H81A 2VNSA 4AJNA 2V6FA 1NX6A 1HSOA 2WD7B 4WLVA 1OZAA 4UVHA 3ENKA 2GD1O 3GVHA 1KERA 1EVZA 3O8QB 1NAHA 5CHEA 3RU7A 1YJ8A 3WX0A 5L40A 5JLAA 3DC2A 3GDGA 4OIMA 5JDIC 4E30A 5KJFA 4ZHSA 2JCYA 3MOGA 4GSKA 2DUWA 4M54A 4EYEA 2VWGA 4MKXA 5BNTA 1CWUA 4A7PA 3IQDB 2OO5A 3RC9A 3WGYA 1I2BA 3QVXA 4IDGA 2X9NA 4YRDA 5DCUA 3ROKA 3ON5A 1UXGA 1WP4A 2UV8A 1WDLA 4PZEA 2J3IA 1O0SA 1EE9A 3NRCA 1Y81A 3L9WA 1XIVA 1R16A 3QVSA 5AXBA 3GG9A 4BMSA 4OSOA 2X0RA 5GZ6A 3WQRA 1U7HA 4G65A 3KO8A 1ISMA 1R12A 4YT4A 1Y6JA 3DZIA 3V2HA 2YZ7A 4XWYA 4CM1A 3GZNA 4RCVA 4EJMA 3E5MA 3L4SO 3GAZA 4CV2A 3MJTA 2RH8A 4GKBA 4LK3A 3UH1A 3VH2A 5ITWA 4OJNA 4BNZA 3KRTA 1WVGA 5B1YA 3VVCA 3GRPA 3NV9A 2IXBA 4JNKA 2ZQZA 4CM3A 1H9AA 4EBFA 2GF2A 1DSSG 3OJEA 4CM8A 5TGDA 1LSSA 1MXFA 2A4KA 2HMWA 2D3TA 4L0QA 4MVJD 2PLAA 4PVCA 4LRTB 2P5UA 1GUFA 1N1GA 1PL6A 4BO2A 4AJPA 5F3RA 3NT2A 5T5QA 1DC5A 3JD0A 1PX0A 3DXFA 1KS9A 1PQPA 2P2SA 3P7MA 3DR3A 2IZ0A 3GHYA 3ZWBA 1A5ZA 1Z7EA 4WLNA 2G76A 2FPPA 2G1UA 1ZO8A 2O3QA 4D79A 4RF2A 4GX2A 5A05A 1B8VA 2VTEA 1NBOA 1QR6A 2D1YA 3ETDA 1DB3A 3C85A 3OH8A 1E3JA 1B7GO 1E3WA 1KC1A 3BMNA 3SEFA 1RM0A 3EAGA 4J7CA 2D5CA 4R5MA 4W9NA 4HWKA 8LDHA 2GLXA 5T6BA 2I9PA 3LU1A 2AE1A 4HNGA 3T7CA 7ADHA 2X0NA 1HKUA 4YT2A 1E6UA 3RU9A 4F46A 5JO0A 3RCBA 4OH1A 3U3XA 4RO0A 3VPHA 5F1KA 4JJGA 1Y1PA 4CMAA 1GYQA 1ZK0A 2VOJA 3OJOA 3T4EA 3ZU3A 2IZ1A 1U28A 3N74A 1GYPA 1BXGA 1E3LA 2PD6A 2B4QA 3H3FA 3OIGA 4CMBA 5A04A 4N5NA 3ZHZA 4GH5A 3AFNA 1IOLA 3S2IA 4WCFB 1VI2A 5BSHA 2VYVD 1SO8A 3DQPA 3HADA 3LF2A 3NKLA 4G5HA 4ZVVA 3M2PA 4H16A 3DHEA 4FC6A 1BVRA 2AEJA 4P22A 4Y6RA 1UDCA 1J4AA 3PFWO 3JQ9C 5A03A 3ASUA 5KJ6A 3RUDA 2EERA 5ITVA 4IDDA 3OFSA 3AM4A 1HRDA 3KVOA 4Q9NA 1ISHA 3VH3A 2ZIZA 3WLFA 3WFJA 1B15A 1B16A 1C1DB 1O95A 4AG3A 1YGYA 4FN4A 5CEEA 1TT5B 1QLHA 3FBTA 1P9LA 1NR7A 4EJ0A 3KYCA 1VM6A 3ZV3A 3WGOA 2RHRA 2DLDA 5TX7A 1BVUA 1R4NA 1Q0HA 4J1QA 4UEJA 1I5RA 1VL6A 5DP2A 3NDIA 3ITKA 4PVDA 2FRDA 4D43A 5JPIA 3TSCA 2WDZA 4BKPA 1Q2XA 1XG5A 4D41A 4GQAA 5C3MA 1U9JA 4XB2A 4OHUA 3PEFA 4Y6PA 2BFPA 2CDBA 2VRCA 3I9JA 1QORA 3L0DA 3AJRA 4MVJG 4NU5A 1V8BA 3K73O 4CR8A 4E21A 4BO3A 3K8ZA 4B7XA 1GQQA 4BOYA 3KEOA 4ZICA 5I9LA 5IZCA 1SB9A 3FD8A 1P0FA 1DXYA 3FI9A 1R0SA 3DO5A 4Y98A 3H5NA 2G0TA 3B70A 1VPDA 4WEQA 3TOZA 1E0DA 1Y8QB 2BGLA 3KYBA 3RUFA 5LDGA 4IMPA 1JQBA 3AUSA 3ZGYA 1MGOA 4AJ2A 1S7CA 4NU6A 2G5CA 4M86A 1KY4A 1PEDA 4CM6A 1NFQA 1R4MA 1YDWA 3IMFA 4LMRA 4D3SA 1T2AA 4IJVA 4E33A 3JCZA 5ENVA 1JTVA 1WDKA 2H63A 4XQ9A 3DBHA 3V5NA 4EEZA 3O4RA 2Y67A 3MWEB 2Z5LA 5C7IO 4WOKA 2EV9A 1PU2A 3A9WA 3W6UA 4YJFA 2C54A 3WGZA 3H7AA 2BF7A 3CZMA 3FHLA 3GN1A 4UVEA 3G3EA 3DBLB 3BAZA 2I3AA 3QVOA 3GGOA 4IGEA 4JBGA 3W4JA 4XX0A 1VKOA 5DBIA 4D46A 5IAAA 4RVUA 1LC3A 4CLRA 1LSUA 1RJWA 3JD1A 1YBVA 2Q49A 4M89A 3ENNA 4DQVA 1NFRA 2BI7A 4WKGA 4KZPA 3Q6IA 3OICA 3OSUA 3ZWMA 2DAPA 2E37A 3QSGA 3ZN2A 1UP4A 4DWVA 1DIAA 5IXYA 1A7KA 4DPKA 5IN4A 4CQLA 1JU9A 3O9ZA 4J7UA 3AOEA 3JSAA 1HDZA 2BRUA 3G79A 1R0KA 2DBVO 3H65A 4DC0A 1BDBA 3PJGA 2Y1OA 4M8SA 3SVTA 2OMEA 3IJPA 4U6SA 1YOVA 5H82A 1K6JA 1U5CA 5ICMA 3I9MA 3WGHA 1QKIA 3H8VA 4EUHA 5IZ4A 2VRBA 3ZWVA 2VNAA 4WCFA 1DAOA 3IOYA 4CMJA 3R6DA 2EHDA 1U8FO 2C7GA 2VZ0A 3C8MA 4XIJA 4D42A 4E6PA 2OGUA 1GZ4A 4L74A 5COQA 1DRVA 1D1TA 3ZWCA 3F3SA 1MC4A 3HFSA 1BDMA 2QZZA 4G2NA 3ZV4A 1CF2O 1G6KA 4DC1A 4YJGB 4JP2A 8ADHA 1K2WA 4YXFA 1UJMA 4D45A 4B3IA 5CDUA 4YJGA 2Q2WA 2P9GA 3SC6A 3JYLA 2WE8A 2DM6A 3MOIA 3RD5A 3VDQA 5KKAA 2YDXA 1X14A 2XPCA 5EQFA 1HDCA 4MIOA 4UEKA 5ENDA 4CQMB 1RYDA 2R00C 2FY8A 2ZKLA 4YCAA 4BNWA 1ADFA 2B4TO 1NVTA 1TB4A 1WZIA 3V1TC 1YQDA 4CMEC 3FTPA 3LT1A 4DL9A 1ZZEA 2YHIB 3ULKA 1Q0QA 1YBAA 2TMDA 1U3WA 5EINA 4A2CA 5G2OA 3UGKA 1D7OA 3S55A 3WSVA 3AI3A 3MEQA 4C4OA 2X7HA 2WD7A 1YS4A 4YQYA 1FDWA 2VHZA 1R4NB 1VJTA 1XQ6A 1B8UA 2DC1A 3RJ5A 1EDZA 3PHIA 4AFNA 1T4DA 4KQXA 1T2DA 3IS3A 3EVNA 3K6JA 4DA9A 1F14A 4D44A 3WSWA 4CLRB 4W7HA 1NXQA 4NBTA 3ZWWA 4KUGA 3STHA 2P91A 1I01A 1T2EA 5JYDA 1LQUA 2LDXA 1P33A 1PIWA 2HAEA 3DZJA 3KZVA 4PLGA 5CPFA 3DOOA 2P9EA 3OETA 1X0XA 4FW8A 1XDWA 3B20A 1HYHA 3BTVA 5FWNA 1QYWA 1NPTO 4MVJP 4XJSA 1GADO 4N5LA 4BO1A 4GVXA 4XB1A 1NPYA 5L7WA 2EKQA 1VL0A 3S2FA 3PFFA 3WJ7A 1UP7A 3QA9A 2JCXA 1I8TA 1H2HA 2Q2QA 4BNXA 3O03A 1PZHA 1OI7A 5C7OO 3WMWA 4OMUA 2R6JA 2XOXA 5L9AA 1HLDA 4DBZA 3AY6A 1XQ1A 3NUGA 2Y0EA 3WDSA 4YYZA 3TQHA 1X7DA 1XYGA 4IPTA 1YH3A 2YHUA 2QX7A 1N9GA 4WLUA 5DBFA 4DMMA 3Q11A 3ASVA 2IEDA 4QXMA 2XXBA 3JQFC 2AA3A 5EMHA 4TWRA 4KDEA 4B7CA 1IHXA 2JKVA 4HFMA 2FSVA 1IB6A 1DHRA 4FFMA 3D3WA 2OORA 3E48A 4MP6A 2CNBA 1MX3A 3PWSA 4HFRA 2WM3A 4E2WA 3VTZA 1YB5A 4FC7A 2IYPA 4Q3EA 3FRJA 1WPQA 1GFSA 5JXWA 3GEGA 4KQWA 4S3MA 1JDJA 3Q2KA 4L9RA 2NQ8A 1D1SA 1WDMA 2Q46A 3KUXA 1YKFA 1HDGO 3OECA 1CQIA 3OJFA 3MWDB 4CM5A 4D3FA 1LRLA 5JDCC 3ZDFA 5I9MA 4CQLB 2OBYA 1C1DA 2BD0A 1V3VA 3VZSA 3BMQB 3RUAA 1N5DA 2Z1NA 2FZWA 5TRTA 3TZ6A 3JD2A 1AN9A 3F6YA 4RPGA 1QYXA 3ORFA 2O2SA 1YVEI 2NTVA 4RL6A 2NU6A 5CG2A 4NMHA 2Y68A 1E77A 3DONA 4BO8A 1LJ8A 4XKJA 3G1TA 4E3ZA 3WGIA 2BFMA 1ONNA 3DBVO 2WWRA 3M6IA 4JCOA 5A1TA 1WNTA 2YDYA 2CUKA 3Q9NA 9LDTA 4LMPA 1ADGA 3SXPA 4E0BA 3PQEA 2BHLA 1UXHA 5LCXA 1WLYA 1Q7CA 2O3RA 1OAAA 4BNVA 4CMEA 4CMIA 1K6XA 4WECA 5AXCA 4CMHA 1QRRA 4C7JA 1V9LA 1B2LA 1OOEA 1F17A 2EJWA 3UN1A 1W73A 3FNGA 3PHGA 3VKVA 5ER9A 1AE1A 2C07A 4Q3CA 3JQ6A 2HMUA 2YYYA 1I3MA 3ONFA 4E2XA 1ZK2A 3ZNPA 4ILKA 4MPDA 3Q2IA 4B3HA 1P0CA 1ISFA 3F47A 4W7IA 1GL3A 5COAA 3IC5A 4K6CA 5A9SB 1KIFA 5G0SA 2SCUA 4WPGA 5DP1A 4D0SA 3GVXA 5KJEA 2O3TA 1QYCA 1XSEA 4RVDA 4CLDA 4K26A 2HK7A 4J16A 2B36A 4U6QA 1IUKA 1ZH8A 2I66A 4R9RA 4ESOA 2I67A 4R9SA 2XXJA 4DGSA 6LDHA 4O63O 1EVIA 1DIBA 3VTFA 1UDAA 2W2KB 4BNYA 5U9CA 1EBUA 4J0EA 1YO6A 2F00A 1NVMB 2CD9A 5DT9A 2ZB4A 4TSKA 1I30A 3H9EO 1V6AA 4U8GA 5LC1A 3VPGA 2C5EA 3G17A 4J4TA 4OKIA 4WASA 3QW2A 4FOOA 4IS3A 3DWFA 1I2CA 4GSLA 3WBFA 5ICSA 4LVCA 4DLLA 1ZKMA 4IDCA 1PZFA 3GNTA 2HRZA 1N1EA 5DOZA 1JKIA 4E2YA 4J4BA 3L9XA 1IL0A 1NQ5A 1P1FA 1QYVA 1R4MB 4OQYA 1P77A 5AXDA 5CEFA 1P31A 1XHLA 4AJJA 3PIIA 4ZQGA 4ZRNA 2JL1A 4PLYA 3PVZA 3PWZA 4ZQHA 5BR7A 2W98A 3GUCA 5JC1A 3KTDA 5A3VA 1YB1A 4RVSA 2JD0A 4E2ZA 3JQGA 4FFPA 2GUGA 1DRUA 4W82A 1EEHA 3HG7A 3G49A 1EUZA 3JQAA 3SX2A 4BNTA 3N58A 2V6MA 1PJSA 3BIOA 3B1FA 4I9HA 4HV4A 5ADHA 4UVIA 3VPSA 4R4JA 4W4TA 1EFKA 3D5QA 4IDFA 2CY0A 3OP4A 3H9JA 1WMBA 4OXYA 3W8DA 1A71A 1EMDA 2EP7A 2Y1GA 3GEMA 4IJKA 4XR9A 4S1VA 1MG0A 3L77A 4JK3A 5I7VA 4NI5A 1ISGA 4ZU3A 3QWIA 1NNUA 3PLRA 5IG2A 3OBBA 2BGMA 3I9NA 1BHSA 4H15A 4EITA 5COBA 3PQDA 3F9IA 1P1RA 2GZ3A 4HP8A 2ZJ0A 2RCYA 4ND5A 3JYNA 1H6AA 4L76A 5DULA 3AUTA 1H6BA 3R3SA 3ICCA 3EGOA 1ZJZA 3MJCA 4OQZA 4AJIA 4I9NA 4Q3BA 1ENZA 4RF5A 4EZBA 3ST7A 2PA3A 2Y1EA 1PTJA 2YV2A 4TZKA 5G0UA 5A9TA 3ABIA 1E1LA 1YB4A 1MG5A 4M1QA 5G0TA 3HDHA 3UXYA 2YFQA 1KEUA 2ZYAA 1DC6A 1LUAA 4P4NA 2H9IA 4J90A 3WQQA 5JY6A 3CH6A 2ZTMA 4XGIA 1LA2A 4II3A 1LLCA 4PFJA 3ZHXA 4IIUA 2J3HA 1NM5A 5TNXA 2O23A 3HE3A 4NNJA 1ZW1A 4MP3A 1F0YA 1FDTA 4J1TA 5TSDA 2NU9A 4E5PA 5HWSA 5JO9A 5BQFA 2VUSA 3AFMA 5B37A 4JBIA 5F1PA 3V1UA 3LQFA 2D5AA 4FIZA 3L4BC 1AGNA 4PLPA 3RAJA 3X2EA 3PZBA 1PWXA 1R15A 1B8PA 2OBNA 4E32A 1EK5A 4GLOA 3DMTA 1O8CA 1DIRA 4MJLA 2RH4A 2IDZA 1P45A 4J43A 4TRNA 4XCVA 5EJ2A 1I33A 4BO6A 3GGGA 3IP3A 1DC3A 3KLPX 5CDTA 5DN9A 2IODA 4L4RA 1EUDA 1A9ZA 1L7DA 2OUIA 3LDHA 2X9VA 2EWMA 1WXDA 1SB8A 4RPJA 1J49A 2AQHA 2QG4A 3KOUA 4W99A 1NVGA 2EJVA 1UAYA 4KDFA 1RM4A 3LYLA 4BQPA 3NGLA 1LRKA 2VZ9A 4NDNE 2BH9A 4LISA 1MUUA 4PIVA 4XR4A 3GR6A 3IP1A 1OMOA 3WNVA 1KEWA 2WD8A 1NASA 3PDJA 3UICA 1ZBQA 4CMCA 1WAMA 1UP6A 1U5AA 1UXKA 2HLPA 2Z95A 3I1JA 4WEOA 3ZWPA 1LBEA 4RVFA 4CLOB 5C37A 2HK8A 2AMFA 4PG6A 3JQGB 1A4UA 4XRRA 5I7SA 3I23A 2C5AA 2EEZA 3C3XA 4BO9A 4QO8A 1BRMA 1LTHR 1XLTA 4F6CA 4TZTA 4A26A 1A4IA 1FF9A 1ONPA 1PWZA 3GVIA 1Y9AA 3TN7A 1ID1A 3S2EA 2NM0A 3HB5X 4E31A 2FHSA 5BSGA 4Y9DA 3ZHBA 5JNLA 3ZWYA 1TEHA 1PL7A 4KWHA 3EMKA 3AWDA 1V35A 5L51A 2ZTVA 2JHGA 3B1KA 1QV6A 4RDIA 4XYLA 2NU8A 7MDHA 3OHSX 4PG8A 4ZQFA 3B6ZA 2ZTUA 3F4BA 4PLHA 4UUOA 3LZ6A 3WMXA 1J6UA 2CSUA 3A4VA 2Q50A 4NFYA 3K30A 5JCJD 2O7QA 4E5YA 5JMWA 2HUNA 3WICA 1MLDA 4R1NA 1DO8A 1HYEA 1V0JA 3NTQA 3OJLA 1ENOA 3F1KA 4YJHB 1GQYA 3G1UA 1RM5A 1GV1A 1KYQA 4UEOA 1NQAO 4EW6A 4E5MA 4MOWA 4NZ9A 3KETA 1CRWG 4YT8A 4IY1A 4YVFA 4IXWA 2J3JA 3PHJA 1E7MA 5A02A 3CUKA 1ZMOA 3HN7A 4KWIA 1NAIA 4P8RA 2PY6A 4I5FA 1KVTA 2JFHA 5TT1A 3UOGA 2ZTLA 1NWHA 4O0LA 5JAQA 5CAEA 4I9UA 2ET6A 1A27A 3INGA 2BI8A 2AQIA 1NQOA 1RYEA 3MJVA 4ZRMA 1YDEA 1VLLA 3GZNB 3DDNA 5BSFA 2P5YA 1QXSA 1O94A 4XD2A 5EESA 2DFDA 1T1RA 1C1XB 1BXKA 1JLLA 4R3NA 5KWEA 2FR0A 2V65A 2FR1A 3ADOA 3E1KA 3VZQA 2IZZA 2Y1FA 5I9NA 1ZK4A 2V6BA 3L4BA 3UAGA 2D0IA 2VT3A 3BMOB 4P4LA 2QRJA 1B0AA 4ND1A 2V7PA 3AY7A 2O3JA 1C0LA 1O9BA 2CVZA 2CVOA 2YQ5A 3CSDA 4J1SA 1ZIDA 2HMSA 1MB4A 1RKXA 1N92A 2HO5A 4CLXA 1WZEA 1MFZA 2E4AA 2X5JO 2FPIA 5F21A 4ALKA 5JYEA 4C7KA 4J2OA 1AHHA 4DUPA 3F5QA 4PGFA 2QRKA 3WYCA 1VKNA 2DTDA 4B4OA 3NTRA 1E1NA 4CUJA 2CDCA 2BFOA 3EZYA 1K6IA 1VJ1A 3DEYX 5TC4A 5FI5A 2JJYA 4NJOA 3VAZA 1GUYA 1SCUA 1JN0A 1GZ3A 1XR3A 3C1AA 4XQEA 3W1VA 4A5OA 1LDBA 1M2WA 4UVDA 3U49A 3OF2A 1EVJA 2B37A 1ISJA 4XEHA 3SC4A 1B14A 2WTBA 4XYBA 2E6UX 1J0XO 4R54A 4ALNA 1MC5A 1PS8A 2WE7A 3WTBA 2RBEA 3Q0EA 2GO1A 1LEHA 2X1HA 3GEDA 1FDUA 5EL0A 3RKRA 1DOHA 3FCOA 2G17A 3GNQA 3INRA 3S8MA 4OO3A 4WE3A 3RASA 4Y6SA 3LT2A 4URFA 2J5QA 3QIVA 2A92A 2W2LA 3Q1LA 5L4NA 1KVRA 3I52A 4FOSA 2P9CA 3BMCB 1NHWA 1YL5A 4ITUA 4XJTA 3WGTA 5JW6A 1IZ9A 4XIYA 3E9NA 1E92A 3R1IA 1MP0A 4IQ8A 4B79A 2X0JA 4MKZA 4BNUA 1LQTA 4R16A 4R41A 3WS7A 1EQUA 2WMDA 5T8KC 2DU8A 3VDRA 5TIIA 1F06A 1PGOA 3NYWA 4FGWA 4CV3A 2C2XA 3EHEA 2G82A 3UHAA 4X54A 1SBYA 1T1SA 3QQPA 4YRAA 3DHNA 1GAEO 3C7DB 5F5NA 5TF4A 3ZU4A 1P3DA 1XGKA 1GQ2A 2OL4A 1QLJA 2J6IA 3FSRA 3DOJA 3JQAB 3CE6A 1YL6A 5L53A 1XKQA 2HQ1A 2BMAA 1B26A 2EXXA 4AJ4A 1TLTA 2YJZA 1ZJYA 3ROPA 1DFHA 4QSMA 3PIDA 1U8XX 1SOVA 1N7HA 4YACA 3E8XA 5J23A 1ZVMA 2O50A 4Z9YA 1D3AA 1EFLA 4PG7A 1BG6A 1UZLA 5L7YA 4RZIA 4FB5A 3VPFA 1MXHA 5A5EA 2PD4A 3TFQA 5L4LA 2JFFA 3KEQA 3AU8A 3DBRA 4FS3A 5DF1A 3RWBA 1YOVB 2DBQA 3S1LA 1LDYA 2UYYA 3RUCA 4DQUA 2H1SA 3VHRA 1K89A 2PZLA 2VHYA 4JJIA 2P68A 2UAGA 4PZDA 1WW8A 4MO2A 3ZZNA 1CETA 3LSYA 2FZEA 2I6TA 4BB6A 2NVUA 2NUAA 4IUYA 4XYMA 4TRRA 4B7UA 4TQGA 3LC7O 4PLVA 3VPXA 2WYVA 4NFHA 4IMRA 2PWZA 4YAJA 4GMGA 4Z0TA 4BNJA 3GPIA 4DIBA 1HE5A 2Q3EA 3GAFA 5A4DA 3KM0A 4M87A 3FTNA 5TLSA 3ZU2A 4EEXA 1DLIA 3PJEA 1KEVA 4I08A 1IPEA 4EUEA 1DJNA 1HZJA 4R01A 3MJEA 4ALIA 4NK4A 3ANNA 3ZW8A 4ONEA 2ZCVA 4YRBA 2ILTA 1GTMA 3OQ6A 4IJWA 4TVOA 1PGNA 3WGQA 5L95A 3U9LA 5EQDA 1Z74A 2VHVA 3WQSB 4ND3A 2VRCD 1PJCA 4TROA 5U4QA 4LSMA 1VRWA 1TI7A 2X5OA 3Q3CA 4GKVA 4OKNA 3WYEA 1PL8A 3IKVA 2AW5A 1S6YA 1ARZA 3GDOA 4L4XA 4EJ6A 2GR9A 1Z7BA 3V8BA 2PH5A 1W6UA 1ZEJA 1JA9A 2BELA 5CDGA 3FR8A 2CF5A 3TPCA 5BNIA 3MJ4A 1VSVA 3BXXA 3C24A 2XF8A 4FSHA 4WK6A 4YJDA 3UW3A 4YAGA 1YXMA 3GVCA 3L07A 4XQCA 4Z0PA 5G0WA 1DRWA 2DT5A 1X1TA 3IUPA 1LSJA 1GV0A 2AEFA 3FWNA 3OEWA 4DYDA 2CMDA 5BT9A 5K9ZA 2NVUB 2GZ2A 1Y8RA 3JQ8B 4CLEA 3PTZA 4ND2A 3JV7A 5THQA 1B3RA 2PD3A 3U62A 4BO0A 4I5EA 4B4VA 2CDAA 1X15A 5GZ3A 3F4LA 4JROA 5IJZA 1ZNQO 2A35A 2DBRA 3EW7A 2EGHA 3QRWA 5DNAA 2HCTA 5G4KA 4JP3A 1FDVA 2O7SA 1Z75A 1L7EA 4NBUA 4WLEA 4AJHA 4J7XA 3GK3A 4FGSA 4BKRA 5F1OA 4A03A 1DHTA 1O89A 2C7VA 3JYPA 3KSUA 2NLOA 4I1IA 1T2FA 4E5KA 1UR5A 1Y8RB 4FCCA 1B3BA 4DPMA 3U4IA 1M67A 1TXGA 5KCZA 3E5RA 2QQ5A 5IDYA 4FDAA 2D8AA 3QWAA 1D8AA 2I76A 3K31A 4WLOA 1WWKA 3KSDO 4AJEA 4PLWA 1C0IA 5ER6A 4M55A 1IHYA 1NP3A 1VJ0A 3KYDA 4XA8A 3D7LA 2OP0A 4ZN6A 3DZBA 2XAAA 1PS0A 1V3TA 1ZEMA 4NQZA 4RF4A 4QX6A 3LT4A 4NG5A 2VOEA
chains in the Genus database with same CATH superfamily
2O5CA 1YASA 2EIHA 1JLSA 4L95C 4YALA 4Q47A 5E8RA 5M7EA 1UIRA 5AR1A 3ZIAD 1Z45A 2VO1A 2GJ9A 4FB4A 2JI9A 3P2EA 1W581 3U3RA 3U7QB 1Q1NA 5CFOA 3TJRA 1S3SA 5AK4A 3PQFA 3Q7SA 2I6FA 1MB9A 3DFFA 3MWKA 4R1TA 1AA6A 3IIEA 1YFJA 2BTOA 3PCRB 1DIHA 4KDCA 2IE0A 2Y93A 5FKJA 1QH1A 1OH7A 2ZETA 1ZIOA 3PLNA 1CY7A 3HL0A 3IB3A 1W88B 2ZYDA 3ECSA 1SUIA 2GXSA 5FPPA 1CJMA 3ZCXA 2ZRDA 4O4IF 3ZNOA 5JROA 4F8YA 4OV6B 3GFVA 3NBUA 2IOFK 4R2KA 3IV6A 1HXHA 4R8LA 2ZE7A 5KYXB 3FPEA 3BD7A 1H5QA 4TSFA 3CG4A 3T06B 1KAEA 5MDHA 3NTVA 3GIDA 2VJMA 3F2IA 1W6RA 1Y1RA 4HGZA 4YJ2F 5IHXA 2VDRB 5I45A 1QTNA 3HXPA 3LRXA 4OAQA 4HZGA 3RNLA 1VSTA 4ZAYA 2FZ5A 5FT9A 3WA7A 4HQNA 5ENZA 2GXAA 4KKXB 3L93A 1XB2A 1W0KA 2PUBA 3AKEA 3HTXA 2JFZA 1NUQA 1PS9A 3A1DA 4XYGA 1OLSB 2GCNA 5F33A 2BOVA 2QQ0A 3TIIA 4B4WA 4QGSA 2FTKE 4G85A 3QFSA 5AVSA 1UK8A 4E13A 3QBEA 1LW7A 4ZEMA 1YCGA 2ZWIA 1VSUA 3E8SA 5DNWA 4AICA 4CXMA 1N2HA 4XJVA 4DSNA 4ZAGA 2B2CA 3GLKA 3JPYA 1L4GA 3KLMX 4O4JB 3U4DA 3HR8A 4B7ZA 1J5PA 2YHIA 1TA9A 5EVCA 2Y2UA 3HCCA 3HSYA 3WLRA 4CIVA 1PJLA 1DKPA 1QGZA 1HA3A 1U8YA 5KDLA 2EFHB 2GCEA 3Q2OA 5BMVA 1O6CA 3N2EA 1IVYA 4D8TA 4TUYF 5CUQA 2C98A 3N8KA 5CMLA 4EIWA 3FYTA 4IOLA 3A4IA 5G4KB 2P3OA 1QVVA 4ENVA 1RWOA 1OFUA 3GB9A 1AVTA 1NNI1 3CRQA 3HJAA 4YROA 2ONJA 5KYUB 2FN7A 4UBKA 3SDZA 4DLZA 1ZGAA 3WL8A 2Y0CA 2MIIA 3GBSA 4PHHA 2AZMA 3HEMA 1NVUQ 3ZU6A 4OK6A 2SECE 3F6PA 3HP1A 3REQA 3GPDG 4JXXA 4GMFA 4S2EA 1PZEA 3L6DA 4HAXA 4CT0A 1BWSA 3EIXA 1BCRA 1ZK1A 2QZJA 2W58A 3HBJA 3NGMA 1X8LA 1MW8X 5A9SA 1WUYA 1JYSA 3BSSA 1UDXA 1IPFA 4R69A 2DWPA 1H6DA 2V54A 4BNKA 1J8FA 3AR5A 4QFDA 4Z3DA 5KVQA 2F9MA 2IV2X 2V0GA 3COWA 2H85A 1BXZA 3FPLA 4TQ9A 4EL0A 3C7AA 3VYTB 2GPTA 3W5HA 4MR7B 3R5HA 4HZUA 4KI7A 1UKVY 3DDOA 1F12A 2UZ1B 4AN0A 3AUAA 3QVUA 4BBPA 1X7WA 1KIMA 5C8YA 5CBKA 4RORA 5J47A 2FQ1A 4Q4AA 1I0ZA 1K5HA 1CQZA 3EDRA 4MJXA 3ZCVA 1PNRA 2GPSA 2QLFA 4HNTA 4IOKA 1YF3A 5T67A 1TEZA 3BE4A 1BXGB 3PQ3A 1TA4A 4UU0A 3ONDA 4YB8A 5NLLA 2OLKA 1KU0A 4QFCA 1A7AA 4FOPA 3UAWA 1E66A 2Q7XA 4K6HA 3ZE9A 3VR2A 1DAKA 1BX1A 1LI4A 2JIOA 4BJHB 2QTFA 3ZEIA 3HY4A 3R8FA 1G4UR 4FWBA 4WBNA 4B33A 3DMNA 3GEBA 4D4MA 1HE2A 2HF8A 2OOKA 3T7SA 1SOAA 3X2FA 1V2GA 3HN2A 4D6XA 2ISSD 5F23A 1MV8A 5E6SB 4LV8B 4Q39A 1W29A 3WKDA 2VQFB 2F62A 5TJ9A 3D31A 1ML4A 4QUHA 4ZIRB 4M83A 4OGKA 3GNSA 1C0KA 1E2QA 1HWYA 1VHLA 2KLBA 4P3PA 4PEVA 4RS3A 3W8RA 4B7AA 5JDIA 1ULSA 3C98A 5DYIA 5K8TA 5TGZA 1OWOA 2PV7A 3WIDA 1IG0A 2H29A 2AG5A 3WIEA 1U0GA 2A1TS 2MSWA 4F3RA 5CTAA 2X0KA 1O6FA 4S1NA 5IUNC 4AI6A 2QG6A 3HCNA 1N2XA 2QB5A 4REQA 4R3WA 4B3FX 1W4AA 1HDOA 2WIFA 1Y4AE 2AOTA 2I1LA 2HIMA 3FTQA 3L7MA 1U2TA 2RGUA 4JVMA 4MYCA 1GP2A 3NRBA 2Y1DA 5DT2A 4L8VA 5J4VA 4B3MB 1YDGA 1E6WA 4NYMQ 5HCIA 2OAQ1 4MV0A 2H6EA 1U2GA 3VKWA 2ZUEA 1Y1QA 3RRYA 3E9EA 4OOEA 4D5GA 2PUAA 1CJBA 1G1MA 1Z8NA 4RKWA 4B4UA 3TSZA 1EGHA 2I5PO 1F2UB 1RP7A 2QN7A 2Y1CA 4N0MA 1Q3HA 4NBNA 4WA7A 4L28A 4YRIA 4GWGA 1XELA 5CW2A 1WPGA 5AUPB 5LWHA 1H2FA 3GUYA 2RGYA 3ZI7A 1Z4PX 4FD2A 2CKDA 2VC2B 4N5MA 4N7BA 1TCCA 2V9CA 1DQRA 4HFJA 1BU5A 4TMFA 3CNBA 3IMCA 5CLHA 3VSAA 5MGBA 4CM9D 3WR5A 1LZKA 2WJIA 4XRGA 3K71B 5IYZB 4L5YA 1PG5A 4TQAA 4UXJA 4EUSA 5E38A 1WETA 2ZSAA 4C30A 3QP9A 2ZI7A 4C05A 3DDUA 3EWIA 2J3KA 3ABZA 4WJLA 3B1WA 1P44A 1J0AA 2ZBFA 3MCVA 4US1R 3DTTA 2QTNA 2R1VA 1KYIA 1BMFA 1HORA 4G9EA 3VU1A 1M73E 4RDHA 5B4VA 5IF3A 3L8EA 3GI1A 1ECPA 4MDYA 4Z86A 3W4IA 1SELA 1ND5A 4A8JB 2L42A 4F4FA 1GHTA 3JQCA 4C4PA 3EEIA 4RJ2A 5IUJC 2N3ZA 1L1FA 2YUTA 5CTJA 1KJZA 4GX5A 5G4LA 4RPHA 2IF2A 4BGVA 1T8WA 2V7BA 3DLIA 1OIWA 5J5CA 4BLVA 4Y6GB 4MARA 2COKA 1EP9A 1GYRA 3V1YA 3QF4B 2VF5X 2EATA 3BHMA 2NUBA 1IJEA 4RJJA 3WKAA 4JBYA 4OMDA 2CMFA 5FYDA 1M8KA 2C31A 4EG1A 1NJFA 1IE3A 2QVZX 3Q7QA 1E7YA 1KI2A 1ZD2P 2ZIXB 4HDMB 5L45A 1ECCA 3I4LA 4W9NC 4JD5A 4Q48A 4AYXA 3LYHA 1AM4D 1H94A 5G0VA 3TCKA 5T57A 4NZPA 1P0IA 1KK0A 1C1XA 3PKZA 2OQVA 1Q57A 2HDOA 4JLBA 4PX5A 4ZPJA 3RYIB 4CIXA 1SIBE 1K7FB 2KE5A 3PHLA 3QE0A 1VG0B 4L1KA 4P3NA 4MPTA 3ZGNA 3L8ZA 4DIFA 3ACBA 3T41A 2D06A 4N7JA 1UBSB 1IZ8A 2PXAA 5ALOA 3MERA 4UUMA 3QXCA 2XCOA 4KOEC 3VBCA 5ILQA 3HABA 4PFSA 3BGDA 5JC8A 3W3ZB 4P3KA 5EZSA 4EX7A 3VKHA 3E5HA 3CVWA 4GAEA 4GI3A 4QU0A 1UOOA 2XWJI 5JS6A 1RRFA 5TQVA 3VC1A 2VK1A 3OESA 1FFEA 3DE4X 3I5MA 1XA0A 3CV3A 3ZEAA 1YV9A 4OQMA 5EE0A 3UKJA 2QYTA 3U1VA 3ZX4A 2I8LA 2ZRJA 2XTAA 2VBIA 3HQ4O 3KAQA 1RQLA 1AF7A 2DKNA 1QAMA 4YDSA 4BBJA 1HG1A 5FLEX 3CA8A 2VPWA 3GWGA 4ZJUA 2X14A 5ALVA 1IMJA 2XJ9A 1ZI6A 2XT6A 4H7FA 4O4HF 4CUKA 4NV0A 1VLJA 4M9XA 4W9MC 1MAHA 4HAWA 1RHRA 3EZFA 3FSGD 3FZEA 3JAKB 2HA5A 3EGWA 3M8KA 4PC6A 4UDXX 3E9QA 3SR4A 5AJWA 2OPHA 4DSTA 2UZAA 4KLAA 1CYDA 3E2MA 3GJ3A 4KQ9A 3SHTA 4IBOA 4EW3A 3JZDA 3VFDA 2GJSA 4BQNA 3TG8A 3K92A 1OBVA 3CZ9A 2HDHA 1H1DA 3LIIA 2CVQA 4YT5A 5FAKA 5K0TA 4AURA 4RD2A 4IX1A 5JBNA 3CZRA 4GT1A 2Q1WA 2Z0MA 3MCAA 5HOEA 3D1JA 4H7PA 3KDPA 4BEBA 5A4JA 1TD1A 1YDHA 4XLTA 1M5RA 2B83A 3OD1A 2RKBA 3WJ1A 4LE0A 5BNFA 4ECEA 2CFSA 3KJXA 3L8FA 4F85A 2WU3A 1IZZA 2VZEA 1II8A 1TF7A 3IDSA 3NYRA 1M7GA 3R5JA 4UBJA 2ZUTA 5BUSA 4BB0A 5TB5A 2Y3IA 5BWCA 3TQCA 1HDXA 1DAGA 4JJ8A 2ZYGA 1FMCA 2M1XA 4NIMA 5I3ZA 1XEWX 1T24A 1YACA 4AQYB 4G5QA 2FX3A 3C3MA 5G02A 3ZG6A 4EI9A 1HY3A 1BOOA 2R00A 4G5RA 1MH1A 1S2DA 1PKXA 3H9UA 4BKQA 4YJKA 1D6NA 1SXJE 3CX4A 3LZCA 1S8AA 1X38A 2YWHA 3KFXA 2XMDA 3JRXA 3VDMA 3DMDA 2OGTA 1ZISA 2R7NA 3OZVA 2P4EA 1G0NA 5DRYA 4EL5A 1KY3A 3FNEA 3E61A 4A0GA 3P4YA 3O47A 4QARA 3IAAA 4DM4A 4OJMX 3RARA 4XSHA 4I66A 1P1HA 1XCBA 1VI6A 3P9KA 4JI4B 4JJFA 1SCNE 3CEJA 2Q4BA 3LW8A 3CUYA 4PSDA 5H02A 1JVSA 2P0YA 1Z2DA 1JR3A 3QBTA 4MUNA 4OJYA 4BX8A 4QFMA 4UATA 5HF9A 5LQUA 4IQFA 5EZYA 1N5LA 3GRVA 1C7IA 3KIPA 1POWA 1UBNA 1OI3A 1ST2A 3FSGA 5KREA 1SU6A 3LPAA 3F3YA 4JXJA 3TSYA 4WXYB 2Q99A 4M6WA 1IH8A 5JNVA 2GZRA 1QP0A 4LJSA 2PLFA 1BKSB 3R6TA 5CVTA 4XGNA 4Q4JB 2VATA 4DLWA 4LOIA 1BN6A 5CYPA 4AJ9A 1XFAA 1IJFA 2R65A 3K5PA 1OXKB 4NL4H 3B36A 4Q66C 4AMUA 4GKAA 3A9RA 4W6QA 2QOEA 1I4EB 5HA5A 4ZCMA 1L5VA 1RZRA 3PK0A 2RHOA 4O1HA 3E4DA 4OQPA 3UYLA 1OKKA 1F5SA 4I4CA 1I7QB 1J2JA 5FPSA 1A9TA 3RSQA 3ADCA 1GAQA 4IDBA 5DZSA 3RFTA 4IRMA 5JMPA 3ZE8A 5C1BA 3IKTA 3ICPA 2PBZA 1M0SA 1P73A 2AOUA 5ECGC 3KHTA 2VWHA 5A4AA 3MTJA 3OM9A 1XROA 1X86B 2AMLA 4HNRA 4KIJA 4YEDA 3OE7A 2ZW9A 3VR0A 4P93A 1Q1GA 1XMPA 2BEWA 4HS4A 5KAPA 4EJ2A 2HF2A 1XRPA 3QLTA 2ZIXA 4AULA 2RJNA 4LFBB 2O5RA 1NU6A 4R9NA 5KNBH 4C7OB 2JAUA 4C29A 2VYCA 2NO1A 4WOJA 5LD2C 4GHWA 3GG2A 1UK9A 4LGVA 1A96A 5FB3A 1DJQA 1OREA 1TC1A 3DJYA 4LRUA 1RXYA 3V2GA 2WHPA 1AXGA 3WYNA 4KX3A 2ZG6A 2PCLA 5EIOA 3OCZA 5EZYF 2P5SA 1A88A 4N4AA 5H83A 3V1KA 3ILXA 5TMDA 2ESRA 2F1KA 5J4LA 4HYEA 4G8JA 2DFPA 1O6ZA 4ER3A 5T7BA 1L4KA 2A9PA 1Q77A 3MCWA 1UXIA 2OILA 3QVWA 4OIFA 4ID3A 4NCNA 3IEXA 4D0GA 3ERCA 2XF2A 3RSZA 4EMBA 2XUIA 1SZPA 4KR7A 1O5OA 3F1LA 5K2MA 1IJKA 1P9WA 1JQJC 1AKYA 3RVNA 3DAFA 2V8OA 5ALJA 1JR3D 3TTWA 3S5UA 4GLJA 3MUNA 3VR6A 1MU0A 4QYMA 4LTDA 2X0IA 2R6AA 3L84A 3PQ6A 3BTUA 4KQ2A 1L7VC 3AHHA 3A14A 3M5PA 2IBSA 4QDXA 3SC2A 3QKSB 3EXEA 1ZK3A 3HI6A 3RC8A 1R9GA 1UXJA 4OLJA 2WPNA 3F6BX 3KB6A 1XZNA 4ZKEA 2ZJYA 5HJ2A 3H1PA 3JQ8A 3RIYA 3S2GA 3ZYZA 2DH6A 3ESZA 1AZTA 3KSBC 3K9NA 2BFEA 2PA0A 5BOVA 3RLIA 2W2XA 1GFWA 3PTLA 4G8BA 1WTAA 2XB6A 3FVVA 1BJTA 1TMKA 2FMUA 2Z1MA 1M34A 2IYOA 2WIBA 3E35A 4W9RA 1PFKA 5DWDA 3HY3A 3PEEA 4UHHA 1DG1G 4EW1A 1E7SA 3GARA 4J8PA 1DKRA 3G6WA 3H2SA 3L41A 3LHSA 4JVNA 3EEOA 2G1PA 5FNVB 1YIAA 4DLKA 3QELA 1NW6A 2ODPA 4V0KA 1V9CA 5KTYA 2XE4A 4DADA 2V5UA 2IHBA 2ZR0A 4ILEA 1BDIA 3M5WA 3H0CA 4REMA 2XLBA 1R6DA 2QIOA 4PLZA 2P2LA 4MUGA 1P4RA 2VLBA 3JU3A 4MVXA 1Z73A 2AUTA 1MQAA 1YS2X 2JFVA 3A58B 1S2IA 2X0EA 5F2EA 3L0CA 3DVAA 2IH4A 3H7IA 4NV1A 1PJ3A 2FRXA 1ORRA 2PX2A 3EXIB 4MI6A 3SBOA 4CJXA 1CIVA 4HDNB 2V6GA 2UYCA 2HKIA 3WOVA 4MHTA 1E3WB 1LDNA 3PGKA 4F3YA 2ST1A 3DHYA 1WHSA 2QVLA 3DYIA 2AFRA 2GASA 2JLQA 4KWTA 4C6HA 1EXDA 4W5QA 1YE3A 4ZT5A 5E7IA 1L5NA 3C70A 2VCHA 4D7AA 5DYYA 4DXHA 3R0XA 1GN8A 1U0HC 4UMFA 3MNFA 1RLMA 1Z82A 2VYVA 2X4GA 4KIFA 1G291 1CB0A 1HL7A 1XTJA 3MS7A 4YO8A 4ZVLA 2YWCA 1OH6A 1NTOA 1OC2A 4MZDA 5TDHA 4YRLA 3FMVA 2WUGA 4R98A 2RG1A 3DEFA 4PPNA 1JPUA 3JWIA 2WJHA 4PZCA 3KSRA 2GCPA 4R1QA 5F64A 3ZZTA 2V4UA 1O7JA 5KJCA 4KDRA 1RLIA 1TIBA 3P19A 5LYJB 2O4UX 2Y66A 3CHYA 1GFIA 5G3YA 1IULA 3NALA 1QR2A 4H6WA 2B0JA 2W90A 3C7CB 3RUIA 3WLKX 5KTKA 1RJ9A 4FZJA 1G59A 1BDHA 3SMVA 1L2TA 2NIPA 2IPOA 3RSFA 4D81A 4YLGA 1NJ6A 2AR0A 2WTEA 1JJ7A 4QAJA 4AS1A 4Z2AA 4JKYA 1TL7C 5EAIA 3Q7TA 2O2YA 1ORTA 2XBUA 1G3QA 2D62A 4BMVA 2VQEB 3QX8A 4JXZA 4L2IA 1U4SA 3KQKA 2I71A 1DXHA 3E9MA 3OTQA 4LHYA 3RIXA 2GM9A 3FTEA 1F3LA 1AKMA 3SF0A 2GYWA 1JFVA 3BMOA 3UUWA 1BYUA 1KFKB 2ZJ6A 1OJ7A 1WUKS 3GDFA 4DBLE 2ZIVB 3SLKA 3USES 3CU5A 1GKKA 4LFCB 3KWLA 1YDMA 4NCIA 2AW3A 5JCOA 1SKUA 4PYOA 2UUPA 3T3PB 3THYB 1HURA 3EDOA 1M1YB 2HSZA 3BK1A 4PN7A 5JMTA 2C8JA 5HG0A 5CFMA 1CD5A 4ZEXA 5BORA 4D3YA 1IY8A 2OCKA 3CLHA 4FFSA 2NV0A 4Y0AA 5CVUA 3TG2A 1SIOA 4GPTA 4M37A 2W2QA 3QM1A 4AY3A 1KRWA 2W2TA 3PC4A 2QN6A 4PNHA 1J90A 1U90A 4ZK6A 3EVAA 2PEZA 1Y3FE 5JXHA 4TKUA 1VL5A 3WA6A 4HDKB 4JYPA 4IVQA 2BFEB 1FUYB 5BV1A 5AIBA 3G13A 2JLBA 2OORC 2OV1A 1EE2A 2XMQA 4YQZA 5FQNA 5HTOA 4CF7A 4D26A 5IKOA 4IINA 5C8XA 3R3UA 2X7JA 2Z2JA 3ZDRA 1K88A 4CMIB 3TXXA 1U1GA 2CMKA 1KDTA 3IIKA 3AG6A 5M04A 4LY3A 3R5XA 4HGNA 5BN3A 1FMLA 1BW9B 4IDEA 2C94A 1VRCA 4Q0MA 1VJCA 3T1VA 1NPDA 1H4SA 2JARA 3DKVA 3K09A 5TPZD 2COUA 4AMYA 3V7UA 4AP9A 3A4NA 1X1QA 2VP0A 3FDZB 2R87A 4XZ3A 4PG5A 3W4KA 4EO4A 1CJSA 4QM7A 1EBFA 4WT7A 2IXAA 4YDHB 2JLVA 1KEPA 1L7RA 3AOEC 1XJQA 3DD5A 3DKIA 1Z0SA 3I1YA 1ADBA 3K2BA 3HDJA 2HIAA 1XCGB 3KR2A 3LFHA 4X7MA 1INLA 2EZ4A 3D0KA 5CT9A 1QG6A 5EUCA 4MIEA 4TMWA 4QLBA 4XDYA 3GD7A 1SHUX 3STWA 1G7SA 1UZMA 5ARBA 4LCJA 3D1VA 5CT4A 4EGAA 1E1RD 4ZHQA 1FTGA 5DB4A 1C14A 2BR5A 4PZLA 3HA3A 5AQEA 3PFHA 3RRBA 3ZW9A 4E03A 4FM9A 4I4TA 5CR9A 2PSHA 2UUOA 4YS6A 5JR3A 1PQ4A 2ROQA 3IHKA 3UWKA 4P58A 4YMSA 1IEWA 1EUCA 1X1AA 1YQ9A 4HGOA 4R2MA 4M9QA 4Q1VA 1OFGA 1NDUA 4A8JC 4BJ1A 1GNQA 3O1LA 1H2YA 3HGTA 4RK5A 4UTOA 5JSFA 3LUFA 5KNLA 1CR2A 1KZ6A 2AOVA 2W7TA 2HNBA 4R83A 1CB7A 4XCXA 4BC0A 4D4JA 1KK1A 4DWWA 5LD2B 1MB0A 1O57A 4CV0A 1A8IA 2C3YA 3CKLA 1KAHA 2G9NA 1Z0DA 4JX8A 1GUZA 1QIJA 4DE5A 2RH5A 2WABA 3ESBA 3H86A 3JD3A 2FKNA 2GEKA 3YASA 5C8YF 2MU1A 5KQMA 1JR2A 4U7TB 5H4HA 1NRJB 1PJ2A 4FGUA 1YHZA 5IXSA 1OZFA 4MKIA 1G1AA 2QI9F 3RAFC 2J1LA 4EHBA 1PR3A 1JF8A 1HH4A 2ZYHA 3NGXA 3E18A 2WJJA 5IC4A 4OAPA 3AUUA 4CEIA 2OFPA 2OHJA 2FVXA 2QTCA 3LCRA 4WGFA 4QLAA 4MJ7A 5MGNA 4XGKA 3OLXA 3ETGA 5G53C 3QEAZ 4RE5A 3WG9A 1TNDA 4IHAA 4OMCA 4OY3A 4RPIA 3RRNA 3FCAA 1DC4A 1Z0KA 1JVBA 5I48A 3HVHA 1LI5A 2O07A 2QE7D 1VCMA 2BFAA 3AM1A 4Y67A 4LTMA 2KBFA 2W4QA 1YHNA 2AD1A 5I7HA 4RK0A 1QP8A 2WWTA 3DPSA 4LVOA 3UFXB 3DZCA 3KZXA 3B6JA 3U60B 1VMDA 1CK4A 1SY7A 2P41A 5IWCA 4CKZA 1P9NA 1NMQA 3AEUB 3HBFA 3G0CA 3I2YX 4V3BA 4O8CA 3AI1A 4EJSB 4RS4A 2C78A 2JFNA 5BV7A 1I1OA 2HRBA 2VN8A 1TT5A 3K9LA 5FR2A 3C1OA 5ALLA 4U0JA 3VC7A 4J07A 3NAQA 3TLMA 3C87A 3WOHA 3HMKA 3PQ8A 4PPGA 3MUEA 1MAWA 3L0IB 5CW1A 5I4IA 1SVOA 4MIKA 4Z4IA 4X1OA 10MHA 1FFDA 1XZAA 1NU8A 2FAXA 1EIZA 1CDDA 2MMGA 2HQBA 2Q6OA 4ZCQA 1YA6A 2QRUA 5B64A 5JARA 1QH8B 3I04A 3SVLA 2OCBA 3GQVA 3STVA 3ZHYA 1ZIPA 5KVCA 4N54A 1Z5WA 3QU2A 5FI3A 2L19A 4F9FA 4MR7A 5KOJB 3A26A 5CU7A 3NOOA 1ACMA 4XVCA 3VQTA 1O1YA 1X70A 4PBTA 3NEPX 1TYAE 3T4UA 5T8KA 4DRYA 1KMHA 4J4HA 4YAWA 4WNIA 1VIYA 4QDKA 2ZQYA 4H4DA 4QNRA 4ZOLF 3MB8A 3EULA 2XADA 2YXDA 3RQSA 4QBFA 3P96A 4MVJE 2HCBA 3FDIA 1U0JA 1XUOA 3BKWA 4HQRA 5F4BA 1XLTC 2WSSD 3B3GA 3GZ4A 4GPIB 4MUJA 1Z5VA 1CEXA 3PX2A 4J2HA 2J6HA 5CRIA 1P5HA 2DR3A 5DTRA 2B5WA 3VYWA 2Z58A 2FPIB 4ALMA 3EZLA 2YR0A 2VYND 5AVJA 2HEIA 2WILA 2R6GA 3CUUA 4HNVA 1LWOA 3V6MA 4BMPB 4NULA 2X9QA 5I7OA 3H1FA 5DGCA 3Q7RA 2IRWA 3A7EA 2VTDA 3UWSA 4KR0A 2LCIA 1K97A 2I62A 3EARA 3AUJB 1G3MA 3PFCA 3W8NA 1NG1A 1VDZA 3OZXA 4PCVA 3T38A 1EXVA 3OZFA 3VJRA 5C34B 4HGRA 1XA4A 1D6MA 1ACLA 2IDKA 2YJTD 3KKEA 4G0PA 4FFRA 1KHHA 1E6CA 1GR1A 1TT7A 2D59A 5IKMA 1I3KA 2RHCA 3F49S 5DGTA 5DSTA 4B6SA 3MA0A 2EARA 3KQHA 4R1UA 5GV8A 3GDHA 3LO8A 3WLEA 4N76A 2COEA 4MWCA 1DJLA 3GLHE 5K3CA 4XUGB 2BT4A 4OSPA 4U39A 1AXEA 2WD9A 1V11B 2W2MA 3COPA 1ESCA 4JSRA 4KU4A 5FPYA 1ML3A 3TTVA 8OHMA 4IDPA 4OQDA 3FNRA 1M66A 4KQIA 1K92A 4JKIA 4L0MA 4FR5A 4UNSA 1DKLA 5FLYA 3X0DA 3U16A 1WCWA 2H2IA 4GXTA 4KAXA 1J0EA 1FUEA 4U2DA 2G63A 3SZRA 2CB0A 3SM9A 5A3SA 1SXQA 4I4IA 1ESNA 3WB0A 3L1UA 4YRZA 4RHEA 1K9SA 3DE6X 7ABPA 1TTTA 1Z2OX 4MR8B 5EHNA 1SOMA 4IH9A 4EI2A 1LLQA 2AFIA 1Z08A 2FOLA 3KPVA 4L50A 4LJ4A 3FYHA 3K20A 4V1CA 1E18A 1S4QA 1F8XA 2AN3A 3DXZA 1NUSA 3W2FA 1MMFB 4H0CA 2YL2A 4TXJA 2RC5A 5CB4F 2JGNA 2Z9BA 3K2EA 4BLOA 2HOQA 1CQJA 4QXPA 4UXIA 1GCUA 4YQEA 4NFSA 5JCJA 3O1IC 2RAUA 3AI2A 1EK1A 1W0CA 2H4HA 3GHHA 1H2WA 3VYVA 1FPMA 3K2IA 1K2VN 3M2TA 5FF9A 2J5RA 5JFOA 3V9PA 2NZJA 1TUBA 3Q8KA 3E03A 5EJ4A 1NBME 2FI1A 2CMGA 1RYFA 2I2WA 4I4TB 4BRUA 1ODSA 4WBSA 3G2OA 3MWEA 4Z3KA 1W93A 3S3TA 2J3LA 3DT8A 4J3FA 1LS6A 4LZAA 5DKFA 4B3JA 3WHLA 4ARIA 4OMFG 1HYBA 4EHDA 2UZIR 1JJFA 3BXGA 4Q16A 1OAKA 3WIBA 3WZLA 3N39C 1YCHA 4M8LA 3W6PA 3DQQA 1QYDA 1EG7A 4DDUA 1EFRD 5ARDA 2QJFA 1D4OA 4WNCA 3A1SA 2C2ZA 3CVOA 2QUAA 1ENPA 2Z5FA 3IAHA 1TO2E 4LC1A 2WINI 4MWZA 3WVNA 1XF9A 1FFAA 1FVOA 3GOHA 2WG1A 4PYNA 3VTAA 1UADA 1E99A 1GGVA 4FBGA 2CXUA 4QUGA 5DYGA 3MBIA 3TLXA 2H1OA 2DR0A 2YIVX 3QYFA 5DLYA 5BV2P 5FWAA 3BB3A 4YV0A 1PV1A 1YA8A 4BZXA 4E7PA 2HA4A 3EPKA 4ARBA 3BA1A 3TOSA 5H81A 3TLJA 2VNSA 4CWAA 1Z6YA 3TD9A 3K32A 1NX6A 3M9WA 3PRHA 4N9WA 4RKQA 4WLVA 4PZUA 1GRVA 3ENKA 4E4TA 2Q9UA 3GVHA 4UXHA 5AKKA 3MIIA 4LDNA 3RU7A 3EBPA 5IVPA 3SICE 3N7AA 3T5BA 4DY6A 3DC2A 3V46A 4RPCA 1SVSA 3PI6A 1M3SA 2Z8YA 5KYWA 3UPUA 4E3WA 2O8FA 1KAMA 2CJPA 2JCYA 2XNHA 2F1HA 2I4NA 1JU3A 1Z07A 4TLMB 2HPVA 2PL3A 4L3VA 4RQBA 4GNKA 4L07A 1RRPA 3I5UA 3IQDB 2OO5A 3PENA 3RC9A 1I2BA 4IDGA 3UMGA 2RD2A 4AN1A 3TPZA 2P0AA 2X9NA 4C2AA 3ON5A 2F43A 5CK5A 3VPAA 3HACA 4NSNA 4BFTA 2IH2A 2UV8A 3AINA 2EQAA 4XUCA 2Y0PA 5BQPA 5AVZA 2HCFA 5DNCA 2BFCA 1B8NA 1IRXA 1Y81A 1JS1X 3JVIA 2FP3A 3EIQA 2QORA 3L9WA 1C3OA 3QVSA 4LZJA 5AXBA 3EQ6A 1M1UA 5GZ6A 2CL6X 3CSUA 2ZRBA 3FRHA 1D6SA 3IYLW 1U7HA 4HZIA 3T35A 4URVR 1R12A 5FNVA 3V42A 3DZIA 4ENQA 4XWYA 3JWPA 2XUOA 4EJMA 3CUEF 1DL5A 1IM2A 3DS8A 4IVRA 3GAZA 1BE1A 5IMSA 5L6LB 2XA2A 5E2AA 3FGZA 3L7CA 4UD2A 5JEEA 1BX3A 1WLSA 5CXSA 3KRTA 4Z7QB 2HYDA 4X1IB 2R6FA 3BGIA 5AW3A 2ZRQA 4KXLA 2ZQZA 2ZUDA 1GPMA 1H9AA 2AH5A 4EBFA 4YRMA 3L46A 3CRW1 2PPVA 4DMFA 1KFJB 4YUAA 1R9JA 2PVCA 5TGDA 3TD2A 2GZAA 3V33A 5K3OA 2YFYA 2HMWA 3MWYW 4L8GA 4DSAA 4L0QA 4MVJD 1JU4A 1YB6A 1VPLA 3ZVLA 4AMZA 2O1XA 3QKRB 4GM1A 1ZD5A 4BO2A 3ABOB 1AB5A 1I6LA 4OHPA 1M6VB 5F3RA 4RTRA 1H8HD 2X7XA 1U9YA 3V8EA 2ZUUA 3M6WA 1GM5A 1KS9A 3TDMA 1S1MA 2P2SA 3CNLA 5K8JB 2BGJA 4KYIB 4WLNA 2C83A 2FPPA 3QHPA 2P6OA 1CJTC 1ZO8A 3CJTA 2PMEA 2CYCA 1FSSA 4FX2A 3WWPA 4OB7A 1AQLA 4BUJA 2CLCX 1GUAA 2C7BA 1DB3A 3C85A 3OH8A 1U3FA 2QTVB 1NP6A 1OTHA 3OJWA 3COZA 4NKRA 4QBKA 4W9NA 5HQ3B 1UODA 3HUEA 2VPIA 5I4KA 2HF9A 1FMJA 2I9PA 3I1IA 4HLCA 2AE1A 7ADHA 3U7HB 2YZGA 3MSCA 3TGWA 4H7JA 3EE6A 3PPYA 1D2GA 1E6UA 1HNNA 1GZUA 1E59A 4EWLA 3K9BA 2RAVA 2ENUA 3Q85A 3AESA 3K0AB 3RCBA 1BROA 3AR9A 4FN5A 4KAAA 3ZZMA 1SHTX 1PT5A 2I6UA 3KTFA 3G0BA 4RH1A 1XJ5A 4JJGA 4A5SA 2D8MA 3N2NA 1QTIA 3VO9A 1F8UA 3FY4A 4HBZA 5IJAA 4IQ4A 1VG1A 1UK6A 1J1IA 2CL5A 4N5NA 3O4HA 3I04M 3ZHZA 3NHPA 2CLDX 3G9QA 1NN0A 2YRWA 4URUR 5CURA 1XA3A 3QX7A 1NRWA 1QCZA 2Q41A 4PYKA 4U7PB 4WCFB 4C43A 2QX6A 3LDGA 3LF2A 2NPOA 3HADA 4YRCA 5BSHA 4MB6A 4G0OA 3M2PA 1NXSA 4P4SB 4UEWA 4FC6A 4KYVA 5FX2A 1TZMA 3Q3HA 4JLMA 1UBMS 4O4JA 3FROA 3RVPA 5KJ6A 3ASUA 2JJQA 5ITVA 4IDDA 1SK9A 3OFSA 5F76A 1YRAA 1HRDA 3AM4A 3KVOA 5EXTA 2YJ3A 1SBTA 4EP1A 2FEAA 3Q12A 5LKAA 1PJ8A 3QMMA 3WFJA 3JATB 3DEAA 1C1DB 2CYAA 2OAGA 3D6TB 3UM9A 2Q0QA 4FN4A 5CEEA 3EJ6A 1TT5B 4FYKA 5LWQA 3IIIA 2XUQA 2O0JA 1W75A 2E4YA 3EVZA 3DAHA 4EJ0A 1NF3A 1C2YA 1X7XB 1SURA 1RCFA 4WOPA 2WBLC 3RREA 3ZV3A 3ZE2B 1FP2A 3W6OA 3TGPA 1HR0B 4P54A 4XE5A 1BVUA 4M9UA 1OAOA 3CEHA 4M7PA 2VKQA 2M9MA 4PYIA 4UC0A 4JI5B 1W52X 4F3NA 3O74A 2OBFA 2QPAA 1G4HA 1VL6A 3IERA 5DP2A 1JFFB 3AF6A 3NEAA 3NDIA 2ZRPA 4KPYA 3ITKA 3ITEA 2FRDA 1CVIA 3Q8WA 4GU5A 3UWOA 5FA5A 1MOSA 2CK3D 3MQ2A 5JZSA 2MWMA 4BKPA 1XG5A 4F84A 3ENVA 5FTWA 4BFZA 4QG3A 1A1VA 4AY5A 2QRMA 4Z49A 1M2HA 1R6BX 3IAUA 1BQ3A 1JAZA 1QO0A 1SXHA 1RSZA 3SYTA 3GJSA 4C3VA 4Z3OA 3QNMA 1WZUA 2FR8C 2VRCA 1QORA 3I9JA 3KB2A 4MVJG 2JLWA 5IVHA 5IKPA 3DXYA 2GEDA 4BO3A 1NW8A 1II0A 2Q9CA 3K8ZA 1GQQA 1JLHA 3B3QA 1AU9A 3DCJA 4H6PA 4JJ4A 2ZVDA 3KEOA 3VR3D 4BOYA 4DT1A 4E1VA 5IZCA 1CR6A 4RTSA 3A9UA 3EB9A 2D54A 1P0FA 3FI9A 3PX3A 4P9NA 4TLLB 2XJ4A 1LJLA 2DULA 4Q6BA 4CU2A 4WEQA 4MCAA 1E0DA 3TRDA 4C4SA 3ZJ5A 1MOPA 1N5OX 5TEVA 1BMQA 1E94E 1ELOA 2IUSA 3VUEA 1JQBA 3ZHCA 2J48A 1AMNA 1S7CA 5FPTA 1KSFX 3VNUA 3FDFA 3V7FA 1ESDA 1PEDA 2IX3A 4EVIA 2D7JA 1YDWA 3ECCA 3IMFA 3KAPA 4KXNA 1T2AA 2WF9A 4I1OA 2WJWA 3AR2A 4DAEA 2DXIA 2ZSIA 3UJ6A 2CXPA 3IAEA 1OHHD 4DNOA 1V41E 2LKCA 3V5NA 2LUOA 3QEBZ 1D1PA 2BN4A 2P2CA 3MWEB 4ZCRA 5C7IO 4WFKA 3EH1A 4QT4A 1PU2A 4YJFA 2C54A 5A0FA 3DHVA 3ISVA 4ERNA 3CZMA 4FLFA 4RHYA 5ERYA 1ODTC 3DSRA 2ZM6B 4UUAA 2GOYA 3GN1A 2R0QC 4K86A 1NXOA 2OHHA 3PQ4A 3BAZA 2I3AA 4IGEA 1V11A 5K9ZA 3W4JA 2LWIA 4XX0A 5HEKA 3AILA 4D46A 3G5UA 3JTEA 1LC3A 2BM9A 2Q3DA 2EL9A 4BFVA 3LXUX 4OHBA 1O97D 5HCNA 2M6SA 1KJIA 5JG7A 4OLHA 3KP1A 4DQVA 1ESZA 1GRQA 1NI4B 1NBMD 1YIOA 1XALA 1MRZA 1HFJA 1UJBA 3GLRA 3Q6IA 3OICA 3C3KA 3OSUA 4WKGA 1D4ZA 1NJ8A 4CVNA 2B7BA 1AKQA 2UYOA 1BHJA 3LCVB 4BWVA 1W0JA 4LGCA 4DWVA 4OU5A 1MO6A 1A7KA 2GTHA 3KQLA 4UOEA 4OGFA 4J7UA 2V58A 4XX1A 5FBVB 3NBYC 5CH3A 2WTXA 3JSAA 4MW5A 3G79A 4K3VA 2DBVO 4UM9B 2Y1OA 3P52A 3L6BA 1BO6A 2XWQA 1GT91 3IJPA 4U6SA 5F1YA 5TMEA 3QJGA 4EHIA 4URXR 1QK5A 3H8VA 1E9FA 5IZ4A 2VRBA 4Z1MA 1OYWA 1UEJA 2CLKB 3OOJA 4FYHA 4WCFA 2EJTA 1Q1EA 1KDZA 4E5SA 3UJ8A 1JFTA 5ELXA 3H0KA 2XI4A 3IGFA 4FYPA 3VUFA 2WUFA 4E6PA 2XDYA 4TTIA 2VTVA 4I4NA 1P0MA 4TYQA 4C3OB 1D1TA 1I6WA 4H6XA 4TXMA 4HG2A 1TX4B 2A59A 4WXHA 1RU3A 1DCKA 1X94A 2Q5FA 4O4LA 3ZDYB 3HFSA 1O94D 2P67A 4Q9LA 3UJCA 3MYRA 5FL7A 3DE0X 3OX2A 2J45A 4ND8B 1Z6XA 2RGGA 1VA4A 1GLGA 3BD8A 3MLBA 1XYYA 4PXSA 5DSZA 4KRXA 1KTVA 3C5EA 3BXOA 5CDUA 3CZAA 4MUFA 3ZZ0A 2P9GA 1TM3E 3RS9A 1D0SA 3IBGA 4C6RA 5KZMB 4HLNA 2DM6A 4X3OA 2LIPA 4X8LA 5CJ2A 4OLFA 3VGJA 1CP3A 4MB2A 2NUPA 3VDQA 5KKAA 1X14A 2XPCA 4DV1B 4EH1A 5AKEA 2MSEB 2YYAA 3IKLA 5EQFA 4ZZ0A 4PY2A 4MIOA 1TQ2A 3FX2A 1WZCA 2D3WA 1R88A 2BAGA 3P0IA 5J4YA 5ENDA 4IEIA 4ES6A 1RYDA 2J85A 2PLNA 2GAIA 4S35A 3TTYA 3II6X 4YCAA 4BNWA 4C0AC 1IEQA 1NVTA 3V1TC 3UJNA 3HV2A 1VMKA 1YQDA 2GAJA 4G0MA 3FTPA 2ZE5A 5HZMA 2V7WA 5E8JA 1BD4A 3HB1A 5EMJA 1V1RA 2TMDA 3LL4A 5HFNA 3L0SA 1B23P 1TM1E 1PR6A 1U3WA 1V47A 1VRVA 2QAGC 2YN0A 3GRAA 3MELA 1PBNA 5EINA 4QHSA 4DR1B 3A1UA 3S55A 3ZJ4A 3NEJA 5CFPA 3AI3A 3FVTA 2HRRA 3MEQA 4OSEA 1ZM4A 4C4OA 5DHSA 1KHTA 2WD7A 2GN1A 2WTNA 1WQ3A 2ASEA 1YS4A 3AG5A 3D8SA 3GRRA 4CQNA 3EQ9A 4OLBA 3QBVA 4ZVUA 5BVHB 1XN4A 3B9PA 2P0EA 2PGOA 1FDWA 1R4NB 1VJTA 2DC1A 4GBED 1B8UA 4U6NA 3RJ5A 1EDZA 3OTHA 2UZ4A 1S2MA 2C4TA 4GECA 4AFNA 2OR3A 2D0OB 4JJKA 4XAQA 2FN4A 1QG4A 3RJZA 3B13B 1ISPA 3EVNA 4HDOB 3K6JA 2AUNA 3IOBA 1BRTA 2JGFA 2ARKA 3A32A 1XBTA 3O0TA 3OE7D 4JC5A 4Z9BA 4KR9A 2FEPA 4PO8A 4W7HA