1FTNA

Crystal structure of the human rhoa/gdp complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proto-oncogene
molecule keywords TRANSFORMING PROTEIN RHOA (H12)
publication title Crystal structure of RhoA-GDP and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1997-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftnA00
1HUQA 3M6AA 2A5JA 1NMYA 2IUSA 3QE0A 1W1WA 4JMPA 1XZQA 2WWGA 2XZPA 1JPJA 2PZGA 2WMOB 3FMFA 5AJVB 4JYBA 5GJVC 3VFDA 4E07A 3EPHA 1ZD9A 2A5FA 1VECA 2ZAMA 1Y3AA 1E6CA 1FUKA 2XOKA 3N5CA 4FMCF 5EP2A 1ZIOA 5FOTA 4HLCA 4EQ6A 2JJ2A 2P3SA 1IOZA 1S1CA 2REBA 3EIHA 1WQ1R 2J7KA 3U60B 2JJ8A 2XX3A 1TUIA 2V4ZA 1Q3HA 1XD2A 4US0R 4ERNA 5LB2A 3RNLA 4V0MA 4YMUA 1U98A 3U3KA 3TSWA 1RIFA 2GF9A 1JBKA 2FWRA 1ZNWA 1OKKD 4KFSA 2N46A 4L16A 4PPFA 4LBVA 2GJ9A 1NJGA 3X1ZA 3DM9B 1GL6A 2IYUA 2TMKA 4ON9A 5CIQA 1FQKA 3X1DA 1DADA 2AFHE 1CXZA 1X1SA 3TVTA 3C8UA 4RD6A 4QGAA 4US2R 4DUGD 3TLXA 2QA5A 2YOFA 3MRSA 4BE7B 4P3YA 4RZ2A 4LYJA 2PZEA 3Q7QA 3DZDA 4OK6A 2QQ0A 4LBYA 1O87A 3OEEA 2PEYA 2QBYB 3CW2A 2ONKA 3DVLA 5DISB 3SFZA 4HLUC 3HPQA 3SC3A 2J5XA 5F98A 2XGJA 5DI3A 4MUBA 3R9XA 1JJVA 1SVSA 3IO3A 2FSFA 5A5GA 1NN5A 4KHZA 3QPVA 4EKDA 2GEVA 1IAQA 4P4SB 2O8FA 3P1JA 1I4DD 1KDRA 4EJSA 4G0NA 2VHCA 2HUPA 2ZSFA 5IK2D 3HPRA 3OAAA 5AJZA 1G20E 2CCJA 1YR6A 1ZVQA 2PH1A 2QT1A 1IJEA 2WJYA 1OXUA 1RPZA 1JR3D 5D3QA 3CUEF 2A2ZA 3K9LA 1N3BA 3PUVA 4TWZA 5LD2C 3EAQA 3ZVNA 2BMJA 2FN4A 3K0FA 4PAMA 4GDFA 1IN4A 1JEDA 3K70D 1DG1G 3CLVA 3H1TA 1R8QA 1R4AA 1YZLA 2R9VA 3UK6A 3THYB 2VP4A 5BQ5A 1Z0KA 3EA0A 4JKYA 2QMHA 1F48A 1JAHA 3AKEA 3DHWC 1PJRA 4TL8A 4D0GA 3HP1A 4YMWA 1ZINA 2ZR9A 2CE7A 1DARA 1KJYA 4IVPA 2ZQ5A 4O25A 4BASA 3GLFA 1N6KA 1R0YA 3SE0A 1T0HB 4ZI3A 2JJ1D 3ZH9B 4B74A 1AKYA 2VTKA 1XU4A 2IUTA 3BFVA 4PHFA 2FFBA 2YKGA 3VU9B 3P20A 3GJ5A 4LSGA 3WP1B 2CDNA 4OI1A 1ETUA 4QRHA 2GJSA 4KLZA 3LBHA 3QEJA 2J87A 2IXFA 2GBLC 5TB5A 4DDTA 2F9MA 3EPLA 1E2IA 3FHTA 4IDQA 3RRZA 4TQ9A 2CVHA 5C1BA 3ADDA 4LV8B 2NO6A 2A5GA 1G3UA 4G5SA 4L9WA 5KNDA 2JATA 4JL8A 1W7AA 1VDZA 2Q6TA 4RD1A 3SJAA 1WCV1 3IPXA 2H5EA 3I4LA 3X1XA 3BS4A 4DLXA 4G5QA 4UXJA 1NN3A 2ZJ5A 1ZM7A 1A2BA 3T06B 1UBFA 2IYRA 1Z0FA 4CEIA 2OBMA 2ZI5A 3W5IA 3NDBB 2QRNA 4F93B 1IONA 1ZU5A 3F0TA 1EK0A 3L0SA 4LJ7A 1DPFA 1ZD8A 5CB8A 1Z6AA 3C16C 3DPUA 4OQXA 4ZPXA 3EG5A 2WBLC 4UJ5A 4R98A 2ERYA 5EUMA 4DSOA 4QBGB 1W4CA 1CF4A 3NC1C 1OXXK 1OE0A 3VR6A 3PXGA 1II9A 4CEHA 4ACAA 1II8A 4Q4AB 4Q1CA 4P32A 4B3CA 2QZ4A 5J4YA 1YR8A 2XXAB 4RFSB 3I8SA 3S1AA 4MDFA 3T15A 621PA 4TMKA 2NMVA 3DOEA 2NZ8A 4O2LA 2EFGA 1ANKA 4WIAA 2A5YB 4E03A 3NH9A 4X8LA 4P31A 1HA3A 4GL2A 2OXRA 4B3FX 1U9IA 2ZYVX 4JVSB 2O8BB 2ZM5A 2D4HA 4Q4HB 2CK3A 1EFCA 3ND8A 2KWIA 5KOYA 1X6VA 1MKYA 3NHBA 1OFHA 1P60A 3BAFA 1BH2A 1CJTC 2ZJOA 5J5CA 1SGWA 3RS0A 2W6IA 1KTVA 2J1LA 2QAGA 4Z8XA 2QL6A 1MO6A 2FU5C 3Q85A 1FFHA 4AYTA 2IX3A 1TF7A 2RGCA 2B8TA 3L8ZA 4OK5A 4II7A 2CJWB 3QY0A 5CJ2A 2RAPA 3SI7A 2ZSAA 2IYSA 2H8KA 1ELOA 2XJ9A 4Q47A 4HUQA 1H8ED 1H8HA 3D3QA 1AGRA 2GCOA 1HT1E 2ZSBA 2DWPA 5SZIA 2OV2A 5AUQA 4KV9A 4PC3A 1KI7A 2F3TA 3GLHB 1UKZA 4WXRA 1OH8A 2AD5A 1S9HA 2XSZD 4U00A 5JJLA 1G5RA 1NVVR 1KO1A 3ZZ0A 1XJCA 4HAXA 4A4DA 2Q3FA 5JHHB 4O2RA 2IK8A 2IC5A 4EPRA 1E2GA 1YZUA 2PCJA 4V0LA 1RYHA 3QKSB 4PSVA 4C0LA 3O8RA 2NIPA 2YOGA 5FL3A 4LX0A 5JI3E 3U6KA 1FMJA 4BLPA 1CLUA 3I5XA 4LV5B 1MABB 3SNHA 4BUJA 3L43A 2GCPA 4YXWA 3U44B 2ZJYA 1E2EA 4JLPA 2OFXA 4PFSA 1Z0JA 2QMOA 2VH5R 3BRWD 2VSFA 4BZXA 1VYVA 1Z6XA 3SQXA 3MWKA 1SXJA 2FV8A 5DGXA 4HB2A 4RKEA 4IKEA 5C4MA 1CR0A 3LX8A 3AF3A 2QQEA 5L3SB 1E3MA 3OE7A 1AZTA 1VG8A 1LS1A 3LFUA 3GLFE 1KAOA 3GFTA 4QNRA 5H70A 1CJVC 4XTRA 2IWHA 5HR5A 3P32A 4Q9JA 4WW0A 2GK7A 1LY1A 3AB3A 4XD7A 3THXA 1OIVA 3QVVA 1T3SA 1VYUA 4D2IA 1P62B 5JRZA 5CM8B 3VAAA 4B34A 4CW7A 2V7QD 2O8EB 3CX6A 1OB5A 3QF4B 2X19A 5DN6D 1E2JA 2OUKA 3LRPA 4MDEA 4N1AA 2RMKA 5EE9A 3K53A 3RS2A 1YJ5A 5HE8A 2NPIA 1D6JA 1TUEA 3WP0A 3RAPR 3MMPA 2MMGA 4FMBB 2ZYUX 5CM9C 2VSOA 2ZEJA 5JLJA 4K8OA 1A7JA 2J7PA 3OEHD 4LJ6A 1T8UA 3IGFA 1KNQA 2MSDB 2ZRBA 3CWQA 1KAGA 4ARZA 4RCYA 1ZP6A 1NVWQ 2VHJA 5FPKA 2ZJBA 4G3XA 1NBMD 4UXHA 5ANRB 1KSGA 3P4XA 4IHQA 2YWEA 3W3ZB 1LF0A 2EWWA 1M7HA 1U0HC 4TTRA 4DEYA 1OV4A 4NDZA 3R8FA 3IEVA 4DKXA 3M1IA 4BPBA 1KO7A 3CNOA 2B8WA 2E9SA 3SHWA 4B6FA 5IF9A 4K81B 4OHWA 4EUNA 2IBMA 4RZ3A 1JALA 2BJVA 4A1FA 5J4LA 4C0BA 4ZCIA 2FNAA 1UKYA 5FL7D 2J46A 1FMLA 4WVFA 1OFUX 1E2PA 1M1YE 5J4VA 1Q1ZA 3EIQA 2DHRA 4DLRA 5JWRA 4JLKA 5EE5B 2ZRMA 4US1R 2F3RA 4KAXA 5M04A 3AKDA 2XNDA 5DHFA 2EVWX 2QORA 4Q1FA 2WPDA 1ESMA 2Z6VA 4B47A 4TL7A 2REOA 2WWXA 4A2WA 3UG6A 1JJ7A 5DE3A 1EWRA 1XWIA 4J0QA 4KYUA 1YQTA 1F2TB 4BLQA 4URVR 1PUJA 2YOHA 4DDVA 2H7VA 2HEIA 1Z2AA 4YLGA 2OLKA 3ICEA 3Q3JB 2B92A 4B35A 4Q4JA 1GFIA 3QJYA 2OE2A 2XNSA 1EFRA 4QOSA 2JLZA 1PLKA 3A1TA 5C2JB 2ZANA 3DO6A 3VNUA 3P26A 2R6CA 1XEWY 3SYKA 3A1SA 2WKRA 1DO0A 2ZI7A 2F1IA 4DLYA 2DYKA 4MYHA 2AD1A 3DL0A 3W90A 2OBLA 4MKFA 3WMGA 1BOFA 1DAGA 5SZHB 3VHLB 4A15A 1Q22A 1XCMA 2ZI4A 3K0AA 1P72A 2BKUA 2GHIA 4XOIA 1KDPA 1KOFA 4M4SA 1CJUC 3TNFA 3THWA 3AF2A 4ZCLA 5B64A 1T5IA 4PO1A 2XEXA 1NI3A 4TMWA 5EXTA 2HF8A 2Q3HA 4CT5A 2IYYA 4NYMR 1ZRHA 3QQ5A 1ZM2A 1W36D 3QXCA 4PR0A 1S0UA 4EAQA 2NO7A 3TUIC 2D7DA 1Q21A 1WRBA 2C96A 2GXQA 1L4UA 2IYZA 2WKQA 3JVUA 5E7IA 4ZDIA 2IS1A 2YINC 4P4UA 1E9RA 2PEZA 2V1XA 1UEIA 1TQDA 4QGGA 2JLRA 4AG6A 1M8PA 2F43B 1JQLB 1GG2A 2OCBA 3CKLA 4XWAA 3KFVA 2WWFA 1RVDA 4C0SA 3SBEA 2R65A 5KO2A 3GEIA 1SXJE 4HAVA 3R7WA 1TEVA 2JA1A 1KK0A 3UATA 3ADBA 3GJ3A 4D25A 1KSFX 5EXXA 4TYWA 1NY5A 3AVQA 4LPSA 4QHSA 2LKDA 1E1RA 4LC1A 4Q9KA 3QOFA 3RYTC 2NGRA 4Q9LA 1VG9B 2RGNC 1L7VC 4PQFA 4QC2A 2IEYA 3A37A 5DYGA 4TYYA 1GRNA 3VQTA 2G88A 2GTPA 4AY2A 5HE9A 3KB1A 5FOWA 5G3YA 5FTKA 2DPXA 1R7RA 1QBKC 1XD8A 4UNNA 4WA7A 3U3MA 2CHVA 4GT1A 4DLTA 2WJHA 2ZSEA 4M9ZA 3LLMA 3LW7A 4C7OA 2VHTA 1FX0A 2BBWA 4XTCS 2HF9A 4I4LA 2C8VA 4L8GA 5BN5A 4CYMA 4XVUA 1R6BX 4D80A 4IOKA 4HLUA 4CEJB 1IN7A 1JB1A 2ZRCA 1XZPA 2QY9A 4E09A 3GEEA 1QHXA 1ZIPA 3ZZTA 4BEJA 3TQFA 2Q21A 3KQHA 4C4PA 1AS2A 2HXSA 4RJLA 4NYJR 5CLQA 4LYFA 4IW3B 2FFHA 5CIWA 1SKQA 1VIAA 5JS8A 1BO6A 1R0XA 2IYQA 4TYPA 2R62A 1X1RA 1VCNA 4QXAA 3K70B 2H16A 2BIFA 2PMDA 4JSYA 2F1HA 2NOAA 2P2LA 1FOEB 1S96A 3TAUA 3VR5A 1FNNA 3TVDA 1BMFD 1HEIA 1Q12A 5G53C 5L3VA 1OYYA 2OILA 4H1VA 4X8HA 4JIMA 5DLQC 3ZS8A 2VQSA 2ZAOA 5BN4A 5GVRA 3FHOA 4Q7KA 1FW6A 2FG5A 2OCAA 2RHDA 2B6HA 1E2HA 5CYOA 4PZLA 1JEEA 1Y63A 2CLSA 1E4VA 2HT6A 3BIFA 4CGZA 2C9OA 4B76A 4DXAA 2GJKA 1Z06A 1OF1A 3QKRA 3EWSA 2UKDA 1IXSB 1G1MA 1XFAA 2BOVA 2GILA 2G1KA 4MQBA 2YJTD 1Z47A 1T3HA 3PVSA 4HAZA 5KDDA 4TZ6A 3QG1A 1ZC3A 1SVKA 4BFUA 1NY6A 1VMAA 2JLXA 1QHGA 3T5GA 3PENA 1XEXA 4TLAA 3IQWA 1W0JD 4ITRC 4N0EA 3MWYW 2P67A 4URYR 5H1YA 2WV9A 2A3RA 1SKYE 3KKOA 3LVQE 2BBTA 5HTKA 2QSYA 1Z63A 3GLIB 2HT1A 4WZBE 2BBSA 5F2EA 5AJYA 4PHHA 3BXZA 2WJVA 4KLNA 2BV3A 4PAOA 1JR6A 5G41A 5AJWA 1W46A 4LCBA 4DC9A 2J3EA 1KK1A 1DBSA 3LX5A 4PPGA 3AV0B 5FTMA 3J81k 1GVNB 5EP3A 4LYAA 1OH5A 1JR3E 4CVNA 4OQNA 4DIDA 4YDHB 1E9SA 3H0KA 1GDDA 4TT3A 4HLQB 3UG7A 1GTVA 1P2TA 1ZNZA 3Q8XB 1P7CA 1QVAA 4WXPA 4TLEA 1XTKA 5K8LA 2A9KA 2HYDA 4GOJA 4EPXA 2J0UB 4ZKDA 3FKQA 4LV6A 5KU1A 4MYTA 1RRPA 1NP6A 2AX4A 1E9DA 4TMXA 5G40A 3RS7A 2E1RA 1M34E 5KNCA 1KIMA 4A6PA 3CZPA 3E5HA 2EFHB 2RH5A 3I32A 4KBGA 5FPSA 3UKDA 4D4MA 5DO9A 3ASZA 1ZM4A 4NE2A 1AZSC 4KI0A 4KYIB 2FF7A 3O8BA 2PBRA 2GNOA 5IDVA 1A1VA 4HDQB 2VF7A 1S2MA 2ZI3A 2AK2A 1LS6A 3IBGA 5AUPB 2ZRPA 1FL9A 1G19A 3EC1A 2XAUA 4FW9A 2DWQA 4I1VA 4OKSA 4FINA 4NHOA 1G8HA 1NKTA 2GEDA 3RHFA 4ASUD 3K70C 4XJXA 1K5GA 4Z1MD 1OW3B 2KSQA 2FJUA 4HATA 1QG4A 3EXAA 4IOMA 4HB3A 4U5XA 3LBNA 1DAMA 1UPTA 2GKSA 3LBIA 3RC3A 3ZD7A 1IN5A 2RHMA 1OB2A 1VKJA 1U8ZA 2VP6A 1VHLA 2W58A 3TK1A 3VR3A 3EZFA 1C9KA 3T5DA 3ZJYA 1G8YA 1G3QA 1P6XA 3EA5A 3FWYA 2QMEA 1AM4D 2W2TA 4JJKA 3ONWA 5EJEA 3VR1A 2ODWA 2RGXA 3TW4A 3C7KA 3TH5A 2IWRA 5CYPA 2ZI9A 4AURA 2P6NA 1A4RA 3MG9A 1VCIA 5AR1A 1KDOA 3KFXA 4GI7A 1KI6B 4ESHA 2AXPA 1T8TA 1GP2A 4M9SA 5KPDA 1T91A 3HJNA 2ZS7A 1V5WA 1NG9A 4DVGA 2ZRGA 2PT7A 2ZVQX 1E2KA 4JLVA 2D06A 1XJ0A 3AGQA 3TQCA 3VU9A 4AI6A 3BD9A 1FTNA 4GP7A 1CULC 3L0IB 1DELA 4GNKA 1XEWX 2H92A 3CO5A 5DI9A 3A6PC 1EG7A 4DDUA 3K8YA 3UPUA 2HCBA 3QEOA 1DTSA 3AM1A 5JZVA 1BIFA 1X8KA 4AKIA 4ZDJA 3HWSA 3Q5DA 3PUZA 1G6OA 2WVJA 3AUYA 2A30A 1E32A 4QG7A 2NPFA 3ZS9A 1I4TD 1QG2A 1G3IA 5B2ZA 5E7MA 1M7BA 3C14C 1XTJA 1J8MF 3FYHA 1TU4A 2ZREA 5KYKA 5BXQC 1YZTA 1TQ2A 5JMTA 5IHPA 1J2JA 3UANA 3WBKA 2D2EA 4JVMA 5HKKD 1X3SA 4NP6A 2RKOA 4PHTA 2F1RA 1XXHB 1AKEA 2OFOA 1FNMA 3U4QB 1HTWA 4OQMA 3ZVMA 1TF2A 3QUSA 5C18A 3F8TA 2CL0X 1NL3A 3FKSA 4I1SA 3TSZA 2GAOA 2ODEA 1F2UA 1MRNA 1G41A 2JLYA 3PFIA 2OT3B 2QP3A 2O0HA 1J7KA 3IUYA 3K09C 2OAP1 4UNPA 3H86A 1HY3A 1DAKA 3U5ZB 1J90A 3BH0A 2EU8A 2GVZC 4Q4AA 2IXEA 1S3SA 2XXAA 2EYUA 4RFSA 2C98A 4ZDKA 4Q7MB 1CR4A 5KSOA 4PC1A 1AS3A 1S3GA 4C0AC 5JWHA 2CNWD 3WYGA 3K0CA 4PXAA 3ZIAD 4A9AA 4AG5A 2QGNA 3MJRA 4FMDB 1U8YA 2LCFA 5FUVA 4D4JA 1DAEA 1S8FA 2JGNA 4BZQA 1TQ4A 1Z5ZA 4Q00A 5A4JA 4DWJA 3PJRA 4PC6A 4HZUB 4Q4HA 2J41A 2CL7X 4NCKA 3SBDA 4Q9HA 1K5DA 1Z6YA 1GRQA 4FCTA 2W00A 4NONA 4KITB 1N0UA 4BFXA 3QBTA 4URZR 5FI1B 2AK3A 3EPKA 4AKGA 2JCSA 2CJWA 2WAXA 3U7EB 4B3BA 1KJWA 5K8IA 5EQTA 2QP4A 2IUUA 1KGDA 2CXXA 2ASEA 5DH9A 2OESA 2QMUA 4OQLA 3KQUA 1S1MA 3CRVA 4MRPA 5KDLA 2FDCA 2ZPTX 4Z8YA 1UFQA 1YKSA 2W2XA 3GLHA 3SZRA 1ZC4A 1G8FA 1ZMXA 4EQ6B 2Z0MA 3EASA 1M2OB 1DS6A 5JSZB 4TLCA 1XD2B 3KUCA 821PA 1W0KD 2FPKA 1E98A 3IIJA 3OIVA 5IT5A 5JI2E 3GPLA 3PEWA 5TVKA 2QSZA 4C2TA 3FMPB 3T1VA 3IILA 4BFTA 4W9MC 1WDTA 2DR3A 3CIOA 1ONBA 2FPLA 1OHHD 4DDWA 1DVRA 1COWD 3CR8A 4JLJA 4B3GA 4N3NA 1UKEA 2DB3A 3NEJA 3GJ0A 3BERA 2IT1A 4GPTA 3SFVA 1KMHA 2AL7A 2JASA 3KKQA 4GOKA 1XBTA 4KCGA 4TSFD 3KUDA 3NIBA 1UADA 1JI0A 1WF3A 4KFRA 2CVFA 1KMQA 2P0EA 1D9XA 2ZRNA 1G3MA 3JZAA 1FUUA 3A4MA 5L3SA 2CCGA 4A36A 4ZIRA 2R6AA 1C4OA 3TBKA 1E2FA 1G9XA 1OYWA 4RD3A 1P75A 3KKPA 1AK2A 1UKVY 3U2QA 1W36B 1XMJA 1I4LD 3LWNA 1KDTA 3IIMA 1W44A 1ZNXA 2OG2A 3C41J 3PIRA 2JDID 5FPYA 4MRSA 5F3WB 2W0SA 521PA 2WWYA 1QF9A 2R6FA 2NTYC 2NG1A 1N6PA 2NO9A 3Q7PA 3RRNA 2ZS8A 2BC9A 2NZJA 2VIIA 3CRRA 4NKRA 3B85A 3TGPA 3QF4A 3B60A 3FGNA 3QXJA 3K0FB 1E79A 4LHXA 1U8AA 4JKIA 2YWGA 2ZXUA 1JECA 4LJ5A 4Q66C 3O8DA 2K5UA 1ZBDA 3TR0A 2XB4A 3FFBA 3B1ZA 3RC8A 3CRMA 3LQQA 4YC7A 3P27A 3QSYA 4A0GA 2HLDA 3K9GA 4JT2A 4URWR 1KKMA 1NLZA 2OSBA 2ZYWX 1A82A 4GZMA 2VLIA 2QI9C 4QBFA 3LO5A 3LV8A 2QPOA 1KO5A 1US8A 2RGNA 2ODNA 2WSSD 4DSTA 4TQAA 1CJMA 2N1BA 4A6XA 2G6BA 4FD2A 2B7BA 2HXYA 2F1JA 1XEFA 1AQYA 1DAHA 1D9ZA 4DT1A 4DCSA 5FBWB 2WIAA 1WMSA 1ZUHA 3KTAB 3SQWA 4O3MA 1ZUNB 2IW3A 4DSUA 4RCZA 1E0KA 2IYXA 2ZE7A 4YONB 3MCAA 2Q0HA 3TJZA 4HDCA 4LDJA 4QGHA 5EZ6B 3K9NA 3NEYA 4S2EA 5EXSA 5EXPA 4QJ4A 4GBMA 3QPUA 3B9PA 3I3SR 3UIEA 3V9PA 5FUWA 4ESVA 1NN1A 1XX6A 1G16A 1Q20A 1P73A 4JSTA 4UKDA 3CB4A 1YZNA 4D0LB 2ZRIA 4AC9A 1AA9A 4E22A 4NYIR 3T1QA 5TY0A 4OI4A 1N5LA 4MA4A 3AVVA 2QE7A 4TL6A 4QGFA 3SHFA 1E1QD 4L4UA 2PL3A 3D6TB 1T3LA 3U61B 3WRYC 4DEXA 3T1TA 2W6JD 1Z3IX 2BM1A 3DKPA 3ZQ6A 1TTTA 2HJGA 3VKGA 3JZMA 2GAAA 4D6PA 1CBUA 2DFKB 1F5NA 3OZXA 5AUNB 3PQCA 5B58C 2GJAA 2VHUA 5JS7A 3RLFA 1G291 2QUZA 3OFND 2QTHA 3CNLA 3SJZA 2ZVPX 5JRJA 3GLHE 2I1QA 3EW9A 3HU1A 3SYLA 3NH6A 4M53A 4Q19A 5FI0B 1GM5A 4EIWA 2NQ2C 4BEBA 1W36C 2BEJA 1B0UA 5FBLB 1QHHA 4PO9A 1XRJA 4ABYA 1Q0UA 4UXIA 5H68A 4DIEA 4M0LA 4H1UA 4C30A 4AWXA 3GJ4A 3R8CA 2FFAA 1BYIA 2IA5A 2RGEA 2WSMA 3DDCA 1KI2A 1A2KC 3HR8A 2QENA 4MH0R 1A5TA 1OJLA 3W3AA 4V02A 2ZJAA 1RKBA 2G83A 1PLLA 2IS2A 3T35A 2F43A 5F9HA 2GVDC 1DE0A 4FCWA 3B78A 1X86B 2ATVA 1LB1B 2BKEA 1Q3TA 2GCOB 2JEOA 3KXLA 4IDNA 1RZ3A 4LJ4A 4PX9A 4FMDF 3SJBA 4TL9A 2QROA 1Z0IA 3HU3A 2X1VA 3BC1A 3NG1A 1QDEA 4AYXA 3KXKA 2ZRFA 5FUXA 1OKKA 3V00A 3QXHA 5BWMA 4DB2A 4BLTA 2XOKD 2GEUA 1CR2A 2DWOA 4IEEA 5FOUA 3KQLA 2D3WA 4PQRA 4C0KA 4FN5A 5C4GB 2JJ2D 4B2LA 2HJVA 1XMIA 1G5TA 4DUGA 1I2DA 1T9HA 1E2NA 1XPUA 4N0DA 4Q1DA 2C04A 1OFTA 4TQUS 1OXVA 1N6HA 3CH5A 2XTMA 3RANA 3FMIA 3FVQA 4KSCA 2QU8A 3KKNA 2OAQ1 2ZUBA 4XWOA 4YMSA 5K8UA 2B7CA 1SVLA 1AGPA 2OXCA 3D7MA 4BECA 1UJ2A 1XTQA 4LJYA 3V4FA 2FSIA 1E0AA 3FTQA 5EUQB 4C2UA 5TDHA 3FMOB 2AWOA 3AVXA 2RCNA 4UNRA 1UBGA 2HV8A 4CIDA 1R0WA 2D7CA 5IK2A 2V1UA 1KI3A 2YYZA 1RYFA 3THXB 2BCGY 1JR3A 3OEED 1R2QA 5C46F 4C0HA 2EWVA 2H1LA 3C4JA 1XTSA 4A2QA 1LNZA 4D4LA 3IQXA 4HSEA 4F4CA 1N25A 2UZ3A 5CJPA 3SDZA 4KFUA 4ZV4A 4YDSA 5JEEA 3BJIC 1YE8A 1FP6A 1QHNA 1KI4A 3B1VA 3H84A 4MITA 3VHXA 1N6OA 1IY1A 1GNPA 3UWKA 3OAAD 1M74A 1K6MA 4UNSA 5CLLA 1RRCA 5TXGA 1TF5A 2ZJZA 2JJ1A 1HYQA 1O3YA 2BM0A 1GKUB 3ETLA 4CT4B 2VRWA 3MFYA 3O8CA 1II0A 4S35A 1MT0A 3W6OA 2SHKA 3A58B 2P5SA 1U9IC 1LW7A 1GOTA 3X2SA 5DYIA 3TR5A 4B2PA 1VHTA 3GLGB 2RGAA 2G9NA 2O5VA 1HE8B 2VF8A 3G5UA 5EZ5A 2XZOA 1XNJA 4LYHA 1OLOA 2WIBA 4CDGA 2LWIA 1G6HA 3EWAA 2ZJ2A 2O8DA 4KODA 1TNDA 3UMSA 1E9FA 2V9PA 1R5OA 1JPNA 1HE1C 1VCOA 3AF1A 3NBXX 1Z0AA 1IXZA 1OSNA 1U81A 2ZS9A 2G3YA 3BORA 1L2TA 3IBYA 1W47A 2PZFA 4TTQA 3GLIA 3KL4A 4M8NE 2XZLA 4GSYA 2JAQA 3OIWA 1Q1BA 3BGWA 2QPTA 1W2GA 3NHAA 3W6PA 2PX0A 2OLJA 3DZ8A 1Z0DA 3L0PA 2R2AA 5FTLA 2CE2X 5JEDA 4A82A 5DHAA 4M1OA 3RS4A 2V6IA 5GJBA 3OHMA 1E4YA 4CRWB 1U99A 2C2HA 5B30A 1J70A 3ASYA 4MKIA 3T34A 4EPVA 5KPJA 1NNEA 1N0VC 3A36A 3KX2A 2JLVA 3NC0C 2GXUA 3HYRA 4DB4A 1ZM3A 1G7RA 4QHYA 4LUCA 3TE6A 4IFEA 1GILA 3ADKA 3GJ8A 4B48A 1JXMA 1D2MA 3NVAA 2RGBA 4I1OA 4OJQA 4P0TA 4Q4JB 4OHZA 3D31A 1NLYA 4F91B 1UF9A 4EFLA 3CH4B 5D3MB 3K0SA 5J40A 1MO5A 4HLDA 3TW8B 1YZKA 2FOLA 4WOPA 1WXQA 1G8PA 4Z51A 4HAWA 2QEQA 2W83A 3PR1A 3Q9LA 1EFTA 1W49A 3I72A 2YC2C 3C5HA 2V6JA 4ACBA 1GKIA 4BRWA 4Q7LA 1NJFA 3B13B 2C03A 2FH5B 4FCVA 4XVRA 2FEMA 1GNRA 3K0AB 4B3DA 2Q3MA 4HZIA 1KY2A 4W7SA 1SQ5A 2I4IA 2VO1A 1NIPA 2H18A 2G0NA 3RS5A 2CLDX 4EFMA 2QNRA 2WTUA 3QPWA 5FTNA 2C99A 2PCLA 1VG0B 2Y8EA 3A1WA 2V55B 3FB4A 1E9EA 3GD7A 2RGGA 4AKEA 1G7CA 1N5JA 1ZM9A 2IYLD 1H8EA 1GITA 3AVPA 5JJKA 2CK3D 2CMKA 3ZGXA 2GBLA 4NTZA 4RY2A 4M22A 4JT4A 5DIFA 1HT2E 2ERXA 1Q57A 2XSZA 1W5SA 4A0HA 2O8CB 2W6ID 1CIPA 1XF9A 2MMCA 4G1UC 5DNYB 3TUJC 2AFIE 3FPAA 3GMTA 4MRRA 4BFSA 4MUAA 3RSOA 2RGDA 1ZW6A 2DCUA 2WHXA 1HQCA 4OYHA 2WJIA 4BQSA 1CRPA 1ZU4A 1E9CA 1H8HD 3U3JA 3G0HA 1AN0A 4Y0AA 3OIUA 4IDHA 2X8AA 3GEHA 4JZKA 4MGIR 2KE5A 5KSPA 3LXXA 3ZD6A 5CK5A 1FP7A 2QTFA 3JVVA 3L2OB 4MGYR 3CX7A 1KI8A 2GZAA 2OCYC 2IYWA 3CF6R 4XH9B 4C9BA 1RRGA 2OZEA 2QP9X 2G77B 2L0XA 4H9GA 1E0JA 2WZQA 2GF0A 4LHZA 3CR7A 2FZLA 3K1JA 1XPOA 4C7OB 3QG5A 1FX0B 4Q02A 2VP2A 5FR1A 1TX4B 4LPKA 2JLWA 1LVGA 2HDNB 5JJIA 3U7HB 1U0LA 4PC2A 1YR9A 2V3CC 3B1YA 4YXWD 4GMDA 4M1KA 1QHYA 3MLEA 5JWOA 2XJ4A 3FE2A 4ZKEA 3N2EA 2QBYA 1XXHA 1FTSA 3PG5A 4MKHA 1JXOA 1SXJD 1E2MA 1UBCA 4B3XA 4Q5IA 2C95A 5EP1A 1NVVQ 2V7QA 3LDAA 4LOAA 3CPJB 3VX3A 1YZQA 2ECKA 3BH7A 1UEJA 3OE7D 4P4SA 1KSJA 5DN6A 3PV0A 1CJKC 1E94E 2Q9AA 4HB4A 3QXXA 1Q1EA 5LB4A 2WJJA 1T0JB 4RSGA 2HYIC 1KZ7B 2EFDB 2BDTA 2W2VA 4QBHA 4XD7D 4M1WA 4EDHA 4MYUA 4GFDA 2Q9BA 3EARA 4HAUA 1L4YA 3GLIE 2O0JA 3GFPA 3IIKA 3WHLA 2DBYA 4Q18A 4W5JA 3OEHA 4NCHA 1X8JA 4Q9IA 3W8RA 1B23P 3KDSE 3C5CA 4F7WA 4QFMA 3THYA 2ANBA 1R8SA 1T6NA 1QRAA 1KYIA 2A5DA 2FSHA 3KJGA 1H65A 1OXSC 2QM8A 2OEPA 1N6LA 1NBMA 2PJRA 1JNYA 1DAFA 3AVUA 3REFA 1KI1A 3FDIA 3LXRA 1R5BA 4HZUA 4HUTA 3NKVA 3SYNA 3GQBA 5JECA 4DLVA 2VHQA 3N70A 4QKQA 2J7PD 2Z83A 4JBYA 4FWIB 5FL7A 1IBRA 4JLNA 1G21E 2ZTSA 2FA9A 5L3QB 4TTPA 3BE4A 1XEXB 3ZLJA 3B7GA 2FX3A 4YMTA 3F5FA 3AQ4A 5G3ZA 4JJZA 1MH1A 3AP1A 4DCTA 2WOOA 2G0TA 1IN8A 1KO4A 2ZU0C 1ZNYA 4GMXA 4YMVA 721PA 1R10A 5FBVB 1YU9A 3CRW1 1VTKA 3QENA 5FH9A 3V4RA 4ZI2A 1E96A 4YQFA 3A8TA 5ELXA 3WMEA 1XMSA 2FMXA 4E5UA 5DSZA 5FOVA 5JSZA 2C78A 2P6UA 2BMDA 3LAWA 4PZZA 2ATXA 3WRXC 1DO2A 3CONA 2GK6A 2W0MA 1VPLA 3AKYA 5CITA 2CCKA 4JL5A 2XNDD 4A8JB 5BYKA 1XPRA 4LJ8A 2WPDD 3IO5A 4I99A 1E2LA 2ZRLA 5AJXA 4F38A 1IQPA 2BBOA 2ORWA 1K8RA 3QXSA 3ZYCA 4NL4H 4DLWA 4LHYA 3LQRA 3LA6A 3BFXA 1RJ9B 4OHVA 3LNCA 4PC7A 5AUOB 1OIWA 1GZSA 1EGAA 4MRVA 3NDPA 1N0WA 2VP0A 1XTIA 1NG1A 2IYVA 3U7GA 3A4LA 4NMMA 2VBCA 4B71A 2PT5A 1R5NA 4BLSA 3AVOA 1EFRD 4IRUB 4D81A 2JLQA 2J59A 4WBSA 5JCZA 2JLSA 1AS0A 4GOXA 5CDFA 4DBLC 3OF5A 4BGDA 2ZU6A 3KZ1E 2C9CA 4JYCA 2QPAA 2J0QA 2REXB 5FOSA 1XMVA 1KHTA 3DKVA 1W4RA 4TZ0A 2O8BA 2P65A 2OBNA 3W9YA 3RRYA 5AWFC 4M1SA 2OFWA 5L3RA 3AUXA 1GSIA 5HCNA 5GADl 1Z83A 1OH6A 1QHIA 2YWFA 2BWJA 1T4GA 4POAA 1F3OA 5CK4A 3X1WA 1D2EA 2BHRA 3RWMB 5J47A 4TMZA 3CF0A 1G17A 2ZRJA 2J0SA 1Q1QA 3I5YA 2FZ4A 4KJZA 4KO8A 5UKDA 3TAHA 3EZ2A 3U3OA 5FUYA 5TMPA 5GJWC 1GIAA 2CHQA 1D2NA 1HH4A 3T1OA 2EW1A 4NCNA 4QL3A 3G82C 4PSKA 1XXHE 1XCPA 4PHGA 2AN9A 3KJIA 2VP9A 4PSAA 5J4HA 1TADA 1IHUA 3AGPA 1QVRA 2CLCX 2I1VB 2VPPA 4IVQA 4RVCA 3DMNA 4EPTA 2AHOA 3QI2A 3E70C 1ZAKA 2G1JA 4RD2A 3L8YA 8OHMA 4NYMQ 1CRQA 1J8YF 1E1RD 3QKSA 4Q1AA 4DHEA 2AXNA 4FWTA 3B8HA 2XB2A 3HR7A 3PUXA 3T61A 3CF2A 3FHCB 4TLBA 3KTAA 3WNCA 2ZETA 4MGKR 1E99A 4LRWA 1MABA 4IOLA 2IL1A 1SHZA 1E69A 3GJXC 1N5IA 3BWDD 3U44A 4QHTA 5AK0A 1QHSA 2BMFA 1TU3A 4KBFA 5FTJA 4PZYA 4JVLA 4LK2A 4R2HA 3PUYA 3F3YA 4B32A 3L82B 1LF5A 1Z6TA 3L0OA 3X1YA 1KJZA 1GKYA 2EYQA 4TN1A 1NBME 4D26A 2KBFA 1GUAA 2BJWA 3T12A 1V43A 4IJMA 3W34A 3NBFA 1AQUA 3PEUA 4X8MA 1WBBA 2OO7A 5DI3B 2IHYA 1EWQA 3TSOA 1GNQA 4A8JC 5BN3A 1VG1A 5LBIA 3PCRB 4RKFA 4WAUA 1D8TA 2WMNB 1F2UB 1XD9A 2YWHA 1BMFA 1IY2A 2YHSA 4NH0A 4DCUA 4O0MA 2O8FB 1YR7A 4DLZA 2J45A 4EJSB 1KY3A 2GXAA 121PA 5HPYB 3AVYA 1EX7A 2EFEB 1W4BA 4BFZA 3KJHA 4DLUA 3WBJA 1Z07A 4PPNA 1XJQA 2Z5FA 3D8BA 2AR7A 1WP9A 5E95A 3KKMA 2O8EA 1VYTA 1E2QA 3VTKA 3VNVA 2H57A 4JBWA 2O52A 3B1XA 3TRFA 1Z08A 4Q1BA 2PJZA 2QTVB 4RFVA 4A92A 1YHNA 5LDDC 1PV4A 3MJHA 2NO1A 4BWYA 1TMKA 2YVUA 4XSHA 2F9LA 2QG6A 3RVBA 3KQKA 4OHYA 4B6EA 4KFTA 3R9IA 2GXSA 3SJCA 4KVGA 4JS0A 3I62A 4ZDWA 2AWNA 4P4TA 3GFOA 2R8RA 3GLFB 4M1YA 3BB1A 2ANCA 2XITA 4V0ME 3B6EA 5HZKA 1WE2A 1YRAA 2R6GA 2JIZA 4RD0A 5E4FA 1W0JA 2YNMA 1NRJB 3GCGA 1TAGA 1JQJC 4DSNA 1Z28A 1NVUQ 1PUIA 1RW4A 2WKPA 3QVUA 4NYJQ 4A0FA 2J9RA 2IS4A 1S4QA 2ZSDA 4BFYA 3QF7A 4QJ5A 2QGZA 1RRFA 2ZUDA 4M2LA 4DLSA 2FSGA 4AD8A 3MWLA 1QZXA 4HDOB 1FPMA 2WM9B 3AKCA 4IFBA 2IHBA 5GVSA 2VSXA 1FZQA 2F7SA 3U6BA 3CWZA 3FOZA 3RSLA 5EP4A 4IEIA 3EPJA 3ADCA 2RB4A 4OBEA 3ZZUA 1UBEA 1Z6GA 3SN6A 4GRAA 4NU0A 5EE0A 1MO3A 5CDFE 3UXMA 2QAJA 2CEAA 1NSFA 4HI0E 5JHGB 3AF4A 4CEIB 1U0JA 3IHWA 1L8QA 4LY6A 3R20A 2B21A 3NTUA 1GL9B 4NZYA 5TV2A 3WY9A 1F2TA 4QNMA 1D5CA 3MWJA 4FIDA 1N5KA 2N42A 3UWOA 5J4KA 4QM6A 3Q72A 1KNXA 4TT3D 1XP8A 1NIJA 1KMHB 3IEUA 3KXIA 1G4UR 3DM5A 2AKYA 3IPYA 1MO4A 4HB0A 4DRZA 4RZXA 4RD4A 3AEZA 3CZQA 5P21A 1Q44A 4CEHB 2ZE8A 1II8B 1ZD1A 3FFAA 4D82A 5KUTA 1HQYE 1EFUA 3NXSA 1SZPA 1GAJA 3BOSA 3THOA 3S1AB 3MUFA 4W5HA 5L8VA 4WZ6A 4ZIRB 4LZZA 1OPXA 4ASUA 2NO0A 1EESA 2ZRKA 4Z1MA 2ZI6A 3PEYA 1TL7C 4PTLA 3RWOA 4K46A 2E87A 1ODFA 4IXMA 5JFGA 4URXR 2D2FA 1TPZA 4EJSC 1PLJA 2DFTA 1HURA 4R9UC 4TYNA 2IF2A 2FGJA 4UQOA 4LBZA 2BEKA 3CX8A 3GJ7A 5A0FA 2GJ8A 4U02A 3UMFA 3WNDA 4AYWA 4BFVA 2A78A 2GDJA 2QAGB 3LLUA 2ZIAA 3WXMA 4HYYA 1Z2CA 1JAIA 4OJKA 2FPMA 3NWJA 1DAIA 3K0CC 4JLMA 1SVIA 1CKEA 2GESA 1OFIA 2C77A 4LHVA 4HUQB 1PVOA 4M9QA 5FFMA 3ZQJA 4IVRA 1X8LA 2ZUCA 4TMTA 1IN6A 4F4JA 4QJ3A 1ZCBA 1ZJ6A 2CBZA 3GLGA 5FBQB 1OH7A 1W5TA 1ESNA 2MSCB 2WWHA 5FR2A 1CP2A 3AH8A 3ZVRA 3QIAA 1XB2A 1P9NA 2DY1A 2ORIA 2GZDA 1MRSA 1US8B 4A2PA 5CB6A 2F55A 2Q9CA 5KHOC 2P6RA 3GJ6A 2P5TB 3N2IA 4IOJA 1RFLA 3RRMA 3EZ6A 2FEOA 2ZRAA 3SOPA 2PLFA 2R44A 1AJEA 3LD9A 4DT1B 2KB0A 3VR4A 4PO8A 5HKKA 1G7SA 3EZ7A 2D62A 5EE1A 5KSYA 1EX6A 2J0VA 2H17A 2V54A 1GL7A 4JLAA 2GA8A 2AKAB 3BFKA 1SXJB 3WHKA 1UM8A 2R6DA 4NBSA 3AP2A 3ECCA 4URUR 4Z54A 3AP3A 4MKGA 3P4YA 2C5LA 4CEJA 4M1TA 3A4NA 4KXFB 4A0RA 3CNNA 1R0ZA 4C3ZA 1GWNA 1W2HA 1YZGA 3VMFA 4F92B 3I1FA 4DZZA 2UZIR 1U2RA 4B44A 3H4MA 3QNUA 2VA8A 1IM2A 3U7FB 4R7ZA 4ILEA 4DJTA 2IS6A 5D3MA 4D0NA 1NMXA 3FKSD 2ZROA 2CNWA 3ZIAA 1ZYUA 2MSEB 3RDPA 4OHXA 1M6NA 2WJGA 1Z22A 3WNBA 1IXRC 4V0KA 2VYFA 4TYQA 5HCIA 3B82A 1P3JA 1OXTA 4NPHA 4JBXA 2UVQA 1WA5A 5E7JA 1E2DA 5KNBA 4X8OA 2IYTA 3TIFA 4LGMA 3B9QA 4P33A 4LHWA 1QHHB 1BS1A 4FMCB 3I92A 3IHLA 4ARZB 4LWZA 3QKTA 3PEVA 1TQ6A 3SEAA 4B73A 3BK7A 1UAAA 4LBWA 1G4AE 5JBQA 4I1UA 4OQFA 4C0JA 3VKWA 1DOAA 3A1VA 2QAGC 4JVNA 3HDTA 4BLRA 4U7DA 1NSTA 1UDXA 1IJFA 1P2UA 3DEFA 3OIYA 3LVRE 1N6RA 1J99A 1T5LA 4B2IA 2ZRHA 4TLDA 5IRCD 2CL6X 1KK3A 2O8CA 2X2EA 4L9SA 5F9FA 3KJEA 4Q03A 3U3RA 1C1YA 1HV8A 3DOFA 5LPNA 1ZUIA 1W0KA 3K9HA 2IEZA 4XWKA 4JLBA 1G7TA 1VCMA 2QM7A 4ZCMA 4BFWA 4Q1EA 3Q5EA 1CTQA 4OL0A 3EC2A 1LV7A 3EIEA 1OHHA 3B5JA 1COWA 1KK2A 2PLRA 1EXMA 2GETA 1DG3A 1E0SA 4PANA 1XDBA 4UNQA 4BRUA 3ZDQA 3KB2A 3R9WA 3VR2A 4Q48A 4V0NA 5BYJA 3NBZC 1KZGB 4CZ2A 4MYCA 4CF7A 4TSFA 3LW8A 1XCGB 4NCJA 1CU1A 1G18A 4KU4A 2WICA 2J0UA 3CBQA 2WAYA 4R71A 5HZHA 1AIPA 1KSHA 1SKYB 3K09A 3CPEA 4B75A 2OM2A 1G3RA 4LJ9A 2WWIA 2D74A 2ZE5A 2ZJ8A 3C15C 4MRNA 1MV5A 2KJQA 1SXJC 3K0EA 2IF0A 3I61A 2ZR7A 2ZYTX 2PX3A 4M1MA 4Q7JB 3DMDA 1UDWA 2JDIA 2A7QA 2GRJA 3BBPA 1MOZA 2IXGA 3GLGE 2DFLA 1TEXA 3CPHA 3VKHA 3PITA 4LI0A 3RS3A 6Q21A 1FQJA 1P5ZB 2ZRDA 3W8NA 4PQYA 4Q01A 2YC4C 3BH6A 3THWB 1SVWA 2PMKA 2O0KA 4HEJA 4W5WA 2LKCA 4EFNA 5H8WA 2WWWA 4R2IA 4B33A 5FPTA 1YRBA 2GZHA 3IDQA 4D4KA 3ZVLA 3NBYC 2X77A 1VIYA 4RZUA 2Z4RA 2HCJB 1LTQA 4F4IA 2I3BA 5JCPA 5EE3A 5E3HA 1W4AA 4I81A 5TARA 4G5OA 2WOJA 3GP8A 1P9WA 3IKJA 4G5RA 2KBEA 4AK9A 5FOXA 4EPYA 3A1UA 1N2CE 1E79D 3M0EA 5FPHA 4BLOA 3AVWA 2OHFA 3R7WB 4OI0A 2WSSA 1WBDA 5SZJA 1G8GA 3E2IA 1KI6A 3M4YA 1NVXQ 4JLDA 4OI2A 3LH5A 3VX4A 2EQBA 4PAQA 2C9YA 4MGZR 2BVNA 4GP6A 1ZCAA 3MGCA 2O8DB 4OK3A 1U90A 3LY5A 1P9RA 2HLDD 3ICQB 2QT0A 3SR0A 3SS8A 3HU2A 5L3QA 4QM7A 1I2MA 3W6NA 2JIZD 4AIIA 1G64A 4L15A 1EFHA 2ZE6A 1GRRA 3EZ9A 4B43A 4V0OA 5K8TA 1SHKA 1KO8A 3CM0A 2Z4SA 2FE4A 2OCPA 4Y0VA 4XIGS 3MD0A 2GWHA 1RE0A 4LJAA 3AF0A 3QKUA 4UJ3A 1SVOA 3SU8A 3WMFA 1MR3F 4G5GA 2QN6A 2BMEA 5FBRB 4IDOA 4PPQA 421PA 3O47A 2ZITA 3BB4A 1P2VA 3TMKA 3I73A 4M9XA 1G5PA 4IDPA 3EX7C 5KTYA 2FGKA 2ZR0A 1CEEA 1OIXA 2VEDA 2EFCB 1RC8A 1F60A 1E1QA 2FFQA 2YZ2A 1WB9A 2V8OA 5B57C 1KKLA 1XTRA 4FI3C 3B2EA 3PUWA 4XSGA 4A8JA 3KQNA 3U4QA 2W6JA 4GZLA 1U94A 4Q4LA 1LFDB 2VL7A 4WZAE 4V03A 1F6BA 1CR1A 2ODBA 2VP5A 5SZKB 4BZPA 4NCIA 1SVMA 1NLFA 4EPWA 5KSZA 3W5JA 1M7GA 2YV5A 4KVAA 4QBIA 2Z43A 1OT3A 5BW8A 1RJ9A 3B1WA 4KSBA 1P61B 3OFNA 2QE7D 1BKDR 3I8XA 3QBVA 3OESA 2CHGA 4JLOA 5LD2B 4LC0A 3RABA 5GJCA 2ONJA 1IY0A 4ZO4A 4C0QC 3TKLA 2XTZA 1CS4C 1N6IA 1P4SA 3MAAC 4FXPA 1E9AA 1NF3A 2GCNA 221PA 3ND9A 2XTNA 1E9BA 3WYAA 5KDOA 1Z8FA 2JLUA 3REGA 2ORVA 4AKHA 4HAYA 1YVDA 4JL6A 3MSXA 2F6RA 1SULA 3AVTA 3QKRB 1DEKA 2X2FA 4TMVA 2BCJQ 2DFNA 4G01B 4IXNA 4M21A 1S9DA 4L5BA 1KI9A 2KI5A 4NYIQ 4Q21A 1PZNA 3CRQA 1N6NA 3H2YA 3TUZC 1BYUA 1W48A 2QRZA 3E1SA 3UMRA 4XVQA 1NN0A 1NMZA 1NKSA 1Z29A 4DCNA 1P2SA 4DCVA 3WYFA 3BB3A 3HYTA
chains in the Genus database with same CATH superfamily
3M6AA 2E4YA 2RHRA 1R3DA 3WSWA 2BGNA 1U2GC 1FJXA 3AR6A 3LWZA 3ZWDA 1W1WA 3SMQA 4W8HA 1UXGA 2OD7A 3GCXA 3W3AD 2WWGA 2XZPA 1U4OA 2PZGA 2JLAA 3FMFA 3UTCA 4NECA 4QVKA 3VZSA 1NZFA 2ZAMA 1E6CA 1FUKA 3L05A 4LNHA 1UDRA 5FOQA 4HWTA 4OLFA 5E4YA 3HQ4O 1VB5A 2I67A 4YCMA 3O4VA 1T9ZA 1JR2A 1FMCA 2OHVA 3EIHA 4FYJA 1ZK1A 1SCUB 3D9QX 2XX3A 2VZ8A 3IXQA 3Q87B 2V4ZA 4ERNA 3RNLA 4JI4B 2OENG 3TSWA 4DEVA 1IUOA 1EP3B 1JBKA 2GF9A 3D02A 4IUYA 2F8SA 8MHTA 1ZNWA 4L16A 2GJ9A 1NJGA 2VZ0A 5ALMA 3F47A 5CIQA 5DYYA 2EJTA 3FYTA 1FQKA 1RLUA 2DKNA 2WAAA 4HLQB 4YQZA 4TS4A 4ZVMA 4DV7B 5IJWA 4OQ4A 1CXZA 1X1SA 4US2R 3C8UA 3MWEA 5IYZF 3T7JA 4HWGA 4KWCA 2PANA 2ZB4A 2M2IA 5CX1A 1WDKA 1K6IA 3N05A 3HKEB 2QA5A 4D6YA 4DUGD 4EA9A 4OMFG 4TRJA 2M9MA 2RHBA 4J7XA 4BE7B 1MW9X 4P3YA 2RDMA 2EJWA 4YFVA 2RKWA 4PF1A 3LZDA 1DRWA 4XM1A 5CGQB 1LDGA 2UV8A 4AJIA 5CA1B 1MZPA 1O87A 1XDZA 1XCJA 2RG7A 4I9UA 3DDUA 4LOIA 2QBYB 3CW2A 5EMNA 2WJZB 3SFZA 3QWAA 1AU9A 2B69A 4MKZA 4B79A 2B98A 1QGYA 1T2EA 3JD2A 4EWLA 4ZJZA 3HCRA 3R9XA 4FI3F 5CT4A 5A7HA 4NZOA 3L79A 1E1NA 1NN5A 2DSTA 2W22A 3HWRA 1XNRB 2PQ0A 1ZH6A 3QPVA 4DJJA 1MUUA 3RT7A 1QOZA 1Z2DA 5EXEA 3DUWA 2OXFA 5BRNA 4IO1A 3UHFA 2VHCA 5AOVA 3K92A 1H0KA 3E8SA 5EKTA 2GPNA 3R5XA 1VPDA 3HPRA 4GEKA 1G20E 5F1PA 3ZEIA 3B5IA 1ZVQA 4MJ7A 3N9IA 5M34A 1ZKMA 4I55F 5BOSA 4D0RA 1RPZA 2BT4A 1JR3D 5IAOA 3CRNA 3L8EA 5C1IA 2A2ZA 3NHSA 2KYRA 3TIXB 4OXIA 3UMVA 3WLMA 1BDBA 3IP8A 3VO9A 1HDRA 3PIDA 1IN4A 1N2GA 4GDFA 3CLVA 3DDNA 3H1TA 2WF6A 4MW7A 1NZJA 2VP4A 5BQ5A 3M34A 3ZWKA 3I0ZA 2QTVA 3AKEA 1N9GA 3N8HA 3SOZA 3GGOA 1ZAYA 3D8SA 5ICEA 1IU9A 2CE7A 5AICA 3VU3A 1K6EA 4ZV7A 1T2VA 3CC8A 3GEBA 4O25A 4BASA 1GLGA 4BDTA 1SD2A 1SUEA 1T0HB 4EA6A 2G09A 1ISSA 3WNQA 3ZH9B 4H17A 3T7CA 3REQA 1WOMA 1PJBA 1PZXA 3RVLA 3WHPA 3G8AA 4IMPA 1WXHA 3BE6A 3GVCA 4V3CA 1XAHA 4PHFA 4N03A 2VYCA 4KAJA 3VU9B 3P20A 2GPSA 4R81A 4JQZA 2HMWA 2BKLA 5U4QA 1UIMA 1C9YA 1ZD2P 1LTHR 3IIEA 3PSHA 2J09A 3IQEA 3TLGA 5E1DA 2VYVA 2XOXA 2I2BA 4R6WA 1E2IA 1ZJZA 4EX6A 3TG2A 3RRZA 3DVQX 1T5BA 2CVHA 5C1BA 1B6GA 1JE1A 3KPUA 3KEQA 1XF1A 2A5GA 2D3TA 3PPWA 4PYOA 3ZYZA 4G5SA 3S99A 1UXKA 2O50A 5ESDA 5CB4F 4LJLA 1QO0A 1B23P 1G6KA 3I6MA 3QMMA 2WE8A 1W7AA 3SJAA 4RD1A 1WCV1 3NVKI 1LPAB 3IPXA 4TLMB 3BS4A 3GJSA 4A6EA 5LLSA 4DLXA 4U2BA 3KAQA 3NHJA 4DGSA 1HLGA 2NPOA 1A2BA 3T06B 1UBFA 3JD4A 3CXUA 1XR3A 3W5IA 2ZSKA 3MLAA 3D6MA 2NADA 1MG5A 2DWCA 2JAOA 2RIPA 4LJ7A 1T13A 1DPFA 1WZNA 1ZD8A 2BISA 4FN4A 1Z6AA 4HWPA 4Q7QA 1VL1A 1FP4B 1HTBA 3H75A 4PZEA 5IC6A 2XQGA 3A31A 3LBAA 5JBIA 2WBLC 3PE4A 1G8SA 5E3IA 4UJ5A 3RAEC 3WL4A 5EJGA 3R0ZA 2RHWA 4QBGB 1XQ1A 2G4LA 1WHTA 3FLMA 1A8SA 1L1QA 2O20A 3IMFA 3INNA 1HE4A 3OZFA 4TPKA 5CT6A 4ACAA 4BV8A 2JIQA 3RSSA 4I5FA 4QATA 5J4YA 4MS4B 1WPQA 3L7YA 4J1NA 2FUEA 3EVFA 4R1UA 2AN5A 3I8SA 3D7KA 3EW7A 3S1AA 4MDFA 2X9VA 4MVYA 4TMKA 2PO5A 2NMVA 1CY1A 3OOEA 2NZ8A 5J2TB 1I7DA 3RH0A 3HDVA 1S7CA 1ANKA 2I5PO 1VE3A 3PS9A 1Z5VA 4NQRA 1OWMA 5BV1A 4E03A 5BSFA 2VYND 4P3NA 3RF7A 3NYQA 4X8LA 3VDQA 1VL2A 2AHRA 2BMWA 2XT0A 4OGFA 3TI9A 4LE1A 4HC4A 3WGZA 1L4BA 3ZG6A 2O8BB 1N78A 2RD2A 2ZM5A 3SF0A 2D4HA 4YAGA 2CK3A 5I48A 3ND8A 4BCCA 1EVYA 1KZ4A 4DAOA 1X6VA 1B4DA 1RI3A 1UJMA 1JEAA 5KBYA 5BSGA 3OZIA 1E7YA 1SGWA 1NJ1A 1KTVA 2J1LA 3CIFA 3FY4A 4TXJA 2IBTA 3LKBA 2PUBA 3E6AA 1SQ6A 4N8DA 1NUAA 4JT9A 2IHKA 1O95D 4JNKA 2C3UA 4AYTA 2B8TA 3CN7A 2ON6A 3EQ2A 1GQSA 3HUEA 4YP1A 2RAUA 4V0SA 1KZHA 2CDAA 3QY0A 5LNK1 2HK6A 2Y1OA 3R0XA 2ZSAA 3K7EA 5EXDA 4J0CA 4HUQA 1HG1A 4G1FA 5EIEA 1AGRA 1QGUA 2WZDA 1GKKA 2HRBA 2A0KA 5SZIA 5AUQA 1F06A 1N7GA 1RAFA 5BNWA 5A5DA 4YRPA 3KEGA 2F3TA 2I91A 1RRVA 5K3AA 2AD5A 3HB7A 4FNOA 2P0AA 4U00A 4HR7A 1BTOA 1K27A 2W7TA 5KTRA 2GAJA 2CEKA 2W2OA 1ZBQA 3DNMA 1G5RA 2BMVA 4AUNA 5FPPA 1KO1A 3LX6A 3ZZ0A 3ZXUB 5AW4A 3E9QA 3U4DA 3UJDA 4A8PA 1JFFB 3ON5A 3AOGA 4EPRA 3P9IA 5HKOA 5KMGB 3U09A 4BKOA 1JDZA 1KORA 4JBGA 3PC8C 3N0WA 1E3WB 2YJGA 7GPBA 2GCGA 4JBIA 3O8RA 3ZWCA 4M86A 1U2QA 4NIMA 4LX0A 5JIBA 3FTEA 3U6KA 1CUWA 3FRHA 1MEJA 4RGYA 3OTOB 2FEPA 4Q3LA 1KPHA 3BCUA 4U7FA 2Q7DA 3W4IA 3W7VA 2I4RA 4BUJA 3KU1A 2WIDA 5EJFA 1GN8A 4JLPA 1ULAA 2YUIA 4R4JA 3BM5A 2NVUB 4B4DA 4K0KB 5L6LB 4CQLA 1HE3A 4CFZA 4ENPA 3I39X 5KWJA 4FWBA 3O84A 1FRNA 2B3DA 4U9HS 2OCKA 3L7OA 3R3UA 3PBKA 4B84A 2V7PA 1HRDA 1FNDA 4PAGA 4PLZA 4RVUA 1QYVA 3OE7A 3ZD9A 3AI1A 1PSZA 3DEKA 1TFRA 3ID6C 1ZK0A 3L0DA 4QNRA 2I6GA 4R1LA 3S0JA 4MX8A 1V4NA 3VOSA 4Q9JA 1KR5A 3MK31 2GK7A 4WW0A 1TW2A 4Y18A 1UMCA 1MX3A 2V7WA 4MQ4A 3AOEA 4XM2A 1ML4A 4RVOA 5B6JA 2D13A 1R6XA 1WU8A 2YN0A 3PIIA 2OOSA 6YASA 5IC4A 2YJZA 3FVWA 3KEFA 5CH3A 1M0TA 1VYUA 3MWDB 5JV5A 5KSWB 3T52A 3P9ZA 4CMAA 3VAAA 4UPEA 1FJGB 1I2BA 1U4NA 4CW7A 4QRDA 4KDEA 4XIFA 1OB5A 2BR3A 3QF4B 4FGKA 1YH3A 1VP9A 1E2JA 1FTQA 2JGMA 4PICA 1MA0A 3ZUPA 4F96A 4N1AA 1Y82A 4XWTA 5CA1F 1KKUA 2HO4A 4IDAA 1Y3FE 5EE9A 3PNKA 1M6VA 2H59A 1PZGA 2RFLA 5HE8A 2NPIA 1EUCB 3WP0A 4GKKB 3QELA 4G8CA 1N2IA 2VCHA 4MW1A 5CM9C 2X14A 2VSOA 3UJ7A 2FN7A 3GFRA 2J7PA 4LJ6A 2LD4A 3ROZA 1Y6JA 2Z98A 2WFLB 3IYLW 4OX9Y 2AN1A 1PIWA 1C14A 5E0KB 1UBMS 4PG6A 2CXRA 2ZRBA 3M5CA 1ZP6A 2O2IA 1A04A 1GZ4A 2HSGA 2VHJA 4UBIA 5FTWA 1EK1A 5FWAA 3P2EA 4QUDA 4YB8A 3ETNA 1RYYA 4IHQA 3W3ZB 3ZGZA 4FPXA 1CDOA 4TTRA 2ILVA 5H02A 1OV4A 1DJLA 3ROEA 3M1IA 1PJSA 3D0QA 4IDCA 4M54A 4X5OA 4I1PA 1ORTA 2OZKA 5DTEA 2FNAA 1Z4KA 1YDFA 2ZSHA 4WVFA 3R2JA 2YUTA 4O33A 3VM6A 5J4VA 1EK2A 1JHAA 1K7YA 3MYRA 5LUAA 4PCUA 1Y5RA 3C6YA 3AHJA 3PQ8A 4JHXA 4YJ3B 5CVCA 5JWRA 4JLKA 1DV2A 1V16B 2OYCA 3G8DA 3LPLA 4NS4A 3V8PA 2XB6A 4W5QA 5D87A 3E3AA 4KAXA 2D2IA 1JEYA 3SC6A 3FPEA 5JMWA 2VR1A 1TC1A 2PMWB 5DHFA 2EVWX 1V45E 3C3WA 2WPDA 1ESMA 3RCBA 4DC0A 1VI6A 4G0QA 3IULA 1E61A 3NB0A 4YRNA 2WWXA 2JCYA 2YBDA 3B7PA 4A2WA 1SCQA 4KPUA 5DT9A 4FDMA 1Z4NA 1KC3A 4UMEA 5DE3A 1XWIA 3IUPA 4J0QA 4KYUA 1DC5A 4BLQA 4URVR 4DDVA 1HYHA 3ELYA 2XYRA 2H7VA 2HEIA 3CUUA 3AHHA 2P1RA 3CG4A 2ZYAA 3UYKA 5BRAA 3ICEA 3OLZA 1V11A 4RF5A 4EG3A 3WQQA 4OVKA 2XNSA 2MIIA 1JXQA 2AEEA 3CNHA 1MB0A 4URFA 2WC1A 3DO6A 5EZYA 3WWPA 3ZI0A 4CJXA 4EH1A 5HKAA 3P26A 2CZQA 1QK5A 1UDAA 5G1OA 1SUCA 4AW9A 3PHHA 3GNQA 4DNPA 1T4MA 1IEWA 2CUNA 1DO0A 4L4ZA 4AWBA 3LHSA 4LISA 3UFXA 1JPVA 4MYHA 3W90A 3DL0A 4YWJA 1U2PA 3WMGA 2J6IA 2C1EA 3TFOA 2AOXA 1FUIA 1XCMA 3THRA 1NR5A 4KQCA 2B30A 2QN9A 1YRYE 3M4NA 3OLXA 4JSRA 2GZSA 5JR3A 3TNFA 2DEUA 4PG7A 3AF2A 2HHAA 1CZKA 4B3TB 4A1OA 5EXTA 3G2MA 2HF8A 4CT5A 3E0QA 1JQBA 1GEEA 5DCWA 3TL2A 3QXCA 1N1MA 4PR0A 3KPJA 5ALKA 4EAQA 4F8YA 3BMXA 4G1VA 1VB3A 2C96A 3NVMB 3OLVA 2J6HA 4UOEA 4GI2A 4RPGA 4FYWA 1UEIA 3ZY6A 1TQDA 1A7KA 4QGGA 3EF1A 2PX2A 2QZ9A 5J2TF 2WUEA 2F3UA 3SM9A 3W78A 3A10A 3QU7A 3PICA 2Q0XA 1JQLB 1GG2A 3FHJA 3Q7EA 4UU8A 1MVOA 3F4KA 1LBTA 4JH0A 1RVDA 1L5WA 5JISA 5JNSA 1SG0A 4LY0A 1LZKA 3FOAA 1ACMA 3QBEA 4HQLA 5MN5A 5A5EA 3GEIA 3EFOA 2CYBA 7MDHA 3UATA 1U6KA 1NPDA 3ZKWA 1USVA 1WJGA 2DQYA 3DZBA 3H2KA 1U1FA 3IMCA 4WEQA 5BWBA 5CCEA 5H4GA 2HK8A 1NY5A 1EZ4A 1T1GA 2DPYA 2QUHA 3FA2A 3NETA 4KMMA 3O8NA 4QHSA 5L6MB 2FN9A 3Q7SA 1VG9B 3TRIA 2RGNC 2BSXA 3V7FA 1P4HA 1L7VC 4OMUA 4QC2A 4UVIA 3VVBA 2IEYA 3WRXA 3ZTTA 1CV2A 3HY4A 2KPOA 1JU9A 4RZHA 4F3CA 2Y1KA 4E4RA 4Q4CA 2XI4A 3NRBA 3KOWA 2CXSA 1ONOA 3PC4A 5H3HA 3T7TA 4QDUA 3CLRD 3ETJA 3IJEB 5D8DA 4AY2A 2C2MA 5EVJA 3IUJA 1BHQ1 1NXSA 5FTKA 3BTOA 4K9RA 4AFNA 3FPBA 2HWUA 4YRDA 4DLTA 2WJHA 1EQUA 4H7EA 5HGJA 5AVYA 5LP6B 4GOLD 3LW7A 4AXBA 4C7OA 1QANA 2ILTA 3H1FA 3HYNA 5AI5A 3HZZA 2ONYA 3DO8A 4JQSA 4N01A 2D1FA 5BPHA 1SVNA 2KX7A 1CB7A 4HVCA 4NFLA 5BN5A 1HDCA 4GRDA 4HRAA 4E3WA 4HL6A 5AM0A 1THTA 2NXJA 3D0OA 3TDNA 4LOKA 5HCUA 3B70A 3AL2A 1W76A 4W4TA 3W5BA 5BO5A 3BAZA 3DVRX 4MR9B 4ZXPA 4DR3B 3AFIA 1O4VA 1IBMB 1ZIPA 2JB9A 2J3QA 2PGLA 3MBKA 3PVCA 4MWOA 4ZQEA 3SZOA 3ZPXA 1TUBA 4YJHB 1IRXA 4NYJR 1SFRA 1JAXA 1UZAA 4LYFA 5HOEA 3A0RB 4DCPA 4TRNA 4FOSA 4JJEA 1L4FA 3ZXYA 4TYPA 1DIGA 4C20A 5C4IA 3ZGLA 3PDJA 4LRXA 4MW9A 5DTIA 3LMKA 4JSYA 2NOAA 1HBJA 1FOEB 1S96A 3EY9A 4LECA 4ONEA 2FPIB 4WNYA 2NXWA 3VDNB 4CM3A 3K6RA 4MV9A 5KC9A 1EE2A 1HEIA 2HPVA 2PWPA 3KOUA 3R5TA 5G53C 4H1VA 2YWBA 1QKIA 5AI9A 1W1IA 5KINB 3GG2A 4JIMA 1QK3A 3DTVD 4NOJA 3MAJA 3R09A 3LGXA 2MWMA 4HN4B 2JHAA 1FW6A 1DSSG 2PV0A 3W0LB 2PKYX 2ZIEA 5DLDA 3FRJA 1XCOA 4WERA 5FXMA 1E4VA 3C1TA 3DZFA 3ZC3A 3I9MA 2C9OA 4GM1A 2TSYB 2GJKA 1OXKB 1IUNA 1OF1A 1VE9A 2HN9A 2B3TA 3AEUA 3BXFA 4IV0A 1G1MA 1XFAA 4PBRA 4REOA 2GILA 5KTKA 1K89A 3G1TA 4MQBA 2YJTD 5FHQA 3VYRB 3PVSA 3A9VA 3L1HA 1NFFA 4HAZA 2GEFA 4Y2SA 5FJIA 3ZBTA 1Q16A 3A9UA 4Z7OB 1VMAA 2HU5A 3I9NA 2P79A 4OM7A 3T5GA 2ZKLA 3PENA 4TLAA 3GPCA 2C9MA 3GJQA 3IQWA 2O2HA 4N0EA 3RKUA 2XF2A 2WV9A 3KKOA 4BGUA 3K31A 4Y2QA 1BJKA 2OWEA 5HTKA 3GDGA 5ITSA 4QOGA 3IQHX 2WEKA 2E82A 2J3IA 4ROSA 3C7TA 5F2EA 4XUGB 5AVRA 5JNLA 3BL6A 5AJYA 4PHHA 1BRTA 1G2QA 2NVWA 2OMKA 3A6EA 5T8KC 1LSOA 1Q92A 2BV3A 1YRHA 1GUFA 3I3OA 3K3PA 3MRVA 1RZVA 4KXMA 4MICA 5AJWA 4LCBA 4DC9A 4LWPA 1ZI6A 1LV8A 3DBIA 4L8LA 2UYCA 5HK9A 1MX5A 3J81k 1GVNB 1QRTA 1JR3E 3IEPA 3EVAA 2WJWA 5G0VA 5THQA 4DIDA 5EHIA 1GDDA 3GVXA 4TT3A 5CGZA 1TAUA 2IZ0A 1P2TA 1NQUA 1VFNA 1JHXA 3G7UA 1TGYA 2PVSA 5EG5A 3RUPA 1A5ZA 1JSZA 4FLEA 3BK2A 2HGZA 3OQ1A 3SY8A 5K8LA 3IAM1 4TLEA 3DMGA 3LQ4A 3N2GA 5DHQA 5AW9A 3TQRA 4GOJA 5ETJA 3OUUA 2J0UB 2GN6A 3DYBA 3E4CA 1YD7A 3O1JC 1TE2A 2ASVA 3TCNA 2HCRA 1LGYA 1YI8A 4RIIA 2Y0EA 4MYTA 1C41A 2VPWA 1TT5A 2JFZA 2VEOA 4TMXA 4YJ3F 5G40A 5LP6C 3GX1A 3RAGA 1DINA 3IHKA 1M34E 2P30A 3Q40A 4IHJA 4UMDA 4HPXB 5KNCA 5JYEA 2G5TA 3O9ZA 2EFHB 3I32A 1FFGA 4KBGA 1WG8A 3OQIB 2QJTA 3KK0A 3UKDA 1NFRA 1N7HA 4WSOA 5EVCA 1I9CA 3ZXXA 2XMSA 3NT4A 1AZSC 5FAKA 1GLVA 3JWEA 4RGVA 4W1RA 2XNJA 5E1MA 3V80A 1SPBS 5IVPA 3BSSA 4FW8A 2P5UA 2GNOA 3BHNA 5IDVA 2OUIA 2VF7A 5DBOA 4GLLA 4D7AA 2V03A 5CD1A 4G41A 5ECDA 5AUPB 3KQQA 4QQFA 1L4GA 4FW9A 2DWQA 4J0DA 4FINA 4NHOA 1G8HA 4MWTA 4R2MA 2AUMA 3RHFA 4ASUD 5AOAA 3LC0A 3GL9A 3IHTA 4TM8A 3ZOKA 1RP1A 4HATA 4OXRA 5HIMA 4NBWA 4C2BA 1R64A 3KKKA 2V7TA 2V0GA 2GKSA 1JAYA 1O03A 2Q62A 1HLFA 2O23A 3QE4A 4GECA 2B78A 5EUBA 2R1TA 2NLOA 3ZD7A 1UL1X 1R88A 1J2EA 2PH5A 2PX8A 3JQAD 3QYJA 3T3DA 3VR3A 2IXTA 3T5DA 1EIWA 1T3ZA 1KY5A 2ONCA 5CFNA 1G3QA 1P6XA 2B36A 2FVYA 3EA5A 1AM4D 1JKJB 2LPMA 4EMUA 5I01A 3VR1A 2BI4A 3TFQA 2OYSA 1T6YA 1UWCA 4RNCA 3CMMA 1KDOA 1OWNA 4O4IF 4ESHA 2AXPA 1LX6A 1GP2A 1YAJA 2VA9A 3EXFA 3KPVA 4MWSA 4AY3A 3HJNA 5CT5A 2ZRQA 2ZS7A 3C87A 3KEOA 4ENWA 4DVGA 2CD7A 2ZVQX 3M1AA 4OBWA 4RK6A 3KT6A 3OHPA 2Z8YM 4ABTA 1GYQA 2PRSA 4FGJA 4FYPA 5KC8A 4JXXA 1LW6E 2GDZA 4EKYA 1N8TA 1R8XA 4GNKA 2QTLA 3DOCA 4BKPA 1EG7A 5IKOA 3MT8A 2V3WA 3K8YA 4DCMA 3Q1LA 2VQDA 3UPUA 4UHKA 2HCBA 3ODPA 2VQEB 4ZWNA 3AM1A 3QIVA 2AX3A 1XTUA 4AKIA 4ETNA 1DQZA 3Q5DA 4OCZA 3PUZA 4N8EA 3AUYA 1RWPA 1E32A 3BX1A 5CLHA 4EHKA 3IQFA 1G3IA 2I1LA 5FORA 2YJ6A 3WB1A 1XJ5A 1XTJA 1SU8A 3H04A 4I5GA 3EJ6A 3DAFA 1TU4A 2I8AA 1U65A 1SBHA 5K03A 3ELUA 3PKJA 3FPJA 4K9SA 2AMVA 4Q9AA 3UANA 1SHUX 3VR4D 3WKDA 4F4DA 4KE9A 1X3SA 3UEOA 1P1FA 1ZN9A 1SCKA 5GM2A 2RBEA 1L6RA 3DNPA 2W4QA 1E7QA 3T4EA 1AKEA 2AYZA 3K2EA 3F8TA 5JANA 1NL3A 2XH8A 1F9AA 4EF5A 1BH6A 1DTEA 3Q41A 1J5PA 4BJ6A 1G41A 5KJ6A 3OC0A 3PFIA 4WLOA 3FWKA 2OT3B 1M5UA 1O58A 3I6IA 2WKSA 4I5EA 5CX4A 3J7AC 1BX0A 3ELWA 2OAP1 1MJFA 1J0DA 1MAWA 4QTUB 2EARA 1HY3A 2C4VA 5C3UA 1QAQA 1VLLA 1RXSA 4QIHA 4YO8A 5C3MA 2ZSJA 5GM1A 5I9MA 3QMPA 1NQTA 2EU8A 2IXEA 1TM5E 1S3SA 2OQVA 1MOPA 4RFSA 3CKMA 1HE5A 1CR4A 2YW2A 3FUUA 5BVGB 4HK4A 2IEGA 4PC1A 4WQMA 1ZOPA 2CVZA 2CLHB 4C0AC 4H0CA 5JASA 4ZTZB 1V8ZA 5AVZA 2HJ9A 4PXAA 3ZHCA 1T2DA 2QGNA 3MJRA 3HB1A 3OX3A 2LCFA 5FUVA 3Q2KA 4ZJYA 3VO8A 5IULC 2XV1A 2L69A 4LAFA 2PZKA 4EVQA 4PC6A 2L2QA 3AL3A 4HZUB 2J41A 4PEVA 4NCKA 2QVYX 3SBDA 3SC2B 4D45A 4Q9HA 2EKLA 3FSEA 3UGJA 4ZANA 2YTZA 4NONA 1TCUA 4KITB 1HZZA 3I76A 3BF8A 4X6UA 5LQNA 4GVXA 2PUGA 1VLJA 1MG0A 2E4XA 2XGMA 3R4CA 1L7DA 5JAIA 3EPKA 1Z8NA 4GE0A 1M2VA 3A1CA 2WAXA 3SVTA 3WL5A 1E4EB 1HEUA 1T0BA 1U1IA 2ZBVA 2CXXA 3VI3B 5DH9A 2AG8A 2O2EA 3WX0A 1BDJA 3H8VA 1XVTA 4RL6A 1EUDA 1N5OX 1QO9A 3I9JA 3QFCA 1SKAA 2C5GA 2AG5A 2G07A 1ZC4A 2WIGA 3BN3A 3D5TA 3GLHA 1XDGA 4BBJA 1IJBA 4YR7A 1SU6A 3DFIA 1PR0A 4WNAA 4Y6SA 5KHLB 4XM0A 2VZ9A 2P4UA 4NHEA 4TLCA 3KUCA 3RTBA 4EUSA 1W0KD 2X1HA 3QVOA 2Y1EA 4N7JA 1I0ZA 1A76A 3D3WA 3IR6A 1TMGE 2I6XA 3OIVA 4OMCA 4PLGA 4UUMA 1F17A 3ECSA 4FBLA 1PT5A 4PCVA 1TYZA 3LIIA 2P6PA 4NF2A 1EVLA 5IH7A 4G0YA 4JITA 1JA9A 1CSEE 1TUGA 4DDWA 4KGZA 1EGVB 1OHHD 4JLJA 1K9VF 1OQAA 2E4UA 2NN3C 5JAZA 2DB3A 1D6NA 2XCUA 3N7UA 3Q7RA 1GPAA 4TXNA 1J2RA 1SCIA 2CDBA 5C34B 4BAUA 2I7DA 4GPTA 3SFVA 4GOKA 5AKJA 5BURA 1QO7A 2M1XA 4AJHA 3KUDA 5AP9A 4X20A 4ZVRA 2V45A 2VAXA 4YDQA 2CVFA 4LYYA 4N4AA 3EPRA 1QIJA 2ECFA 2NU6B 3AUFA 4JYPA 4MZXA 2GASA 3LM8A 5ER6A 3F1LA 2CCGA 4ND3A 4ZIRA 1C4OA 1MB9A 1RMTA 4MQEB 1G8AA 3ROFA 1AB6A 3OZRA 2H9YA 4BWYA 3G9XA 4C01A 1UKVY 4E21A 3WLTA 3V1MA 2HIHA 1KJ8A 1F14A 1WCXA 1WXFA 3ONNA 3IIMA 1MJNA 1ZNXA 3G6WA 5FPYA 5GOTA 1JP7A 1YE3A 3RVNA 2W0SA 2WWYA 4EL5A 1QB7A 2NVBA 4AUMA 1D1PA 4QEDA 3RRNA 5LOVB 1L5QA 3HZOA 4KP7A 3H1BA 4D92A 1ENPA 5IJZA 1SK9A 4B85A 5J23A 2F8TA 4N5MA 1SCDA 3WJ2A 1OGIA 3HNOA 5JVDB 1GTG1 3K0FB 1E79A 3QXJA 3AERB 4LHXA 4XQEA 5FT9A 4AULA 1KWGA 1GG9A 2YWGA 3D43A 4G1EB 4IZIA 4OQZA 1SBYA 3T4UA 2HA3A 4ITVA 3UKOA 1J24A 3KVYA 3O8DA 3EF3A 5F73A 2K5UA 2R8ZA 3F5MA 1AQJA 2K7FA 1LSUA 1TJ3A 1SIBE 3INYA 1SUFA 4ZT7A 4X62B 3EXEA 3HN2A 3LQQA 5IH3A 1C0LA 1PK8A 3T6KA 3KHUA 1K63A 4N5NA 3QSYA 2D0DA 4TUYB 1MU0A 1X14A 3GLTA 4QU9A 3SGLA 4MDHA 1O0BA 1HNZB 4JK3A 1BMQA 4URWR 4FP9A 3TZHA 1KKMA 2ABWA 2OSBA 3O8QA 1UK9A 1R6VA 3C39A 4QT0A 1U11A 2VLIA 4NG5A 2IH5A 3IP3A 1L7RA 2HA6A 3R7NA 1H9AA 3LV8A 3U4GA 4RL4A 4DV3B 1KO5A 3C6KA 1JW9B 1T25A 4DSTA 1CLEA 2Z08A 1Q11A 2E1PA 1NOIA 4R1PA 5A3RA 2O0MA 1CJMA 3JWPA 1GT91 3IR7A 4DG8A 2N1BA 4XA8A 1UFRA 4FD2A 4CIBA 3FCUB 3OTQA 5AM3A 3P9SA 5C5DA 3HFSA 3ZHUA 4KTVE 1DAHA 1RACA 2HJSA 1EZZA 2NWQA 4MQ5A 3ZK9A 4DCSA 3M5WA 3OBIA 1RI1A 3SQWA 4LVOA 2IW3A 4G9GA 1RYMA 2OCXA 3KSAC 2Q0HA 3RR2A 4BMYA 4G9BA 2DE0X 3TJZA 1OWLA 1FUYB 2SKCA 4QGHA 1CHDA 2Q99A 3K20A 3K9NA 5EZ6B 1PJ2A 3H7AA 2P9BA 1XTVA 4OLAA 2CZCA 2R00C 3VXKA 4YEDA 3TQHA 4ZOLB 2B2NA 1E66A 3QPUA 4UREA 3A2MA 3B9PA 3I3SR 3UIEA 2ETVA 1NYLA 2B35A 1QUEA 3LUDA 1NN1A 1WEKA 1XX6A 2DFPA 2SECE 3CJQA 3NOVA 4EHLA 1U2EA 4MV4A 2BUCA 1YZNA 1F4PA 1MH9A 2VXBA 4HDRB 5AT1A 3U26A 1CNFA 2F3SA 3F3MA 4UBLA 2Q4RA 3VSEA 3X1KA 5BN3B 4W5RA 1Q3KA 2IPNA 1GA4A 3A3PA 1Y3IA 4OI4A 1XZBA 2QE7A 3M2PA 4UFNA 1JH9A 4BO9A 2EJBA 3GROA 3G9UA 4L4UA 1T3LA 3Q0IA 5AQ1A 1G66A 4TM7A 4HFRA 2EV9A 2PRJA 4FYYA 4ND7A 1M1UA 1RKVA 2W6JD 4PW0A 4U7TB 2VAVA 1IK4A 2BM1A 4CMHA 1KIAA 6REQA 1BE6A 4FDUA 1ONSA 2VJNA 3VKGA 3GH3A 3JZMA 1QG0A 3RV4A 4PZAA 1K6XA 3RLIA 4D6PA 4WKPA 3VC2A 5AUNB 1BZYA 1F0NA 2H29A 2HU8A 4I4NA 4OHMA 4NFSA 2NU8B 1GT6A 4BX2A 2ECQA 2PX4A 5I7HA 5IM4A 4TKLA 1DKQA 3A2NA 5HMMA 3SJZA 1RLMA 3CNLA 5JRJA 2I9PA 2D2VA 2I1QA 3RK4A 5K3BA 2B5WA 3EXHB 3OA0A 2RIRA 3SYLA 3WMRA 5BUZA 5FI0B 2IELA 4JEUA 3V7WA 2P5YA 4B82A 4EIWA 3BGSA 3ZU4A 1B0UA 2QD3A 5FBLB 4DUPA 1L5MA 3BVPA 2XUPA 5BMVF 2EL7A 1MAHA 4YRJA 2PGJA 4U0KA 1KVQA 4C6HA 1J8DA 1QV9A 3GOHA 1CUHA 1LRKA 1L7AA 3ACCA 4EGFA 5B53A 2RGEA 4C4YA 1XA0A 3QEAZ 3DDCA 3ROGA 4M36A 1QIIA 4G24A 3JQ9C 2QENA 4P54A 4TV8A 3TD9A 2IBSA 3LT4A 3SHQA 2DR2A 4F2PA 5IVHA 4XR4A 3RSZA 3CLUD 3G0DA 4MVJG 5GZ3A 5JXIA 3VZDA 1QVVA 4FT4A 5ES4B 3DC7A 3FSRA 2IS2A 3GY0A 4EEZA 2JD0A 3T35A 1RPTA 2BGMA 2X1MA 2MSKA 1TDJA 3B78A 1OCEA 1LB1B 2DBQA 1Q3TA 2GCOB 4PX9A 2VPTA 1M1XB 1RZ3A 3B6JA 1PR1A 2HA2A 5TQ0B 4WDQA 2DT5A 2QROA 2AC4A 5KCMA 1Z0IA 2FUNB 5LQSA 3CLSC 4IP0A 5CTAA 4AX8A 2HLPA 4FYHA 4GXTA 2RAFA 3TS1A 4FLFA 1CUZA 2RHTA 2BGJA 3ACBA 1TKAA 4C0XA 1OKKA 3VC3A 3PNVA 1SXIA 4R05A 2O19A 5ILGA 3DXZA 3N1UA 2HR1A 1L0BA 5BWMA 3AEQB 2XE4A 5TPWA 2P2DA 2GEUA 3E2MA 3KLNA 4GXQA 1U8TA 5FOUA 5KYGA 3WAJA 4C0KA 4W63A 4Y9RA 5KNCH 4B2LA 1XMIA 1G5TA 4CCYA 1I2DA 3V7YA 2H1CA 1LJUA 4CTKA 4J90A 3CH5A 2FPPB 3FMIA 2E6KA 4KSCA 4X7PA 3VAZA 1IM8A 1MT3A 4X1IA 2LRHA 4B6JA 1GPKA 1ZG3A 4Q24A 2B7CA 4GP9A 3IAFA 3I2HA 4MW6A 2ZBPA 4I5IA 4WZBA 3D7MA 4BECA 2W6CX 3GLSA 1UJ2A 2FSIA 3HRHA 4DHWA 3E1GA 3Q1KA 3I2KA 2YZNA 3JARA 5EUQB 4C2UA 4RQUA 3AVXA 3TLMA 1MCZA 5JCJA 3WMXA 3X2FA 4K03A 3HE3A 2ZDQA 2HV8A 4HG2A 2ZDGA 1GHTA 2OCIA 4LMBA 4RVSA 2HWWA 1D1SA 2YYZA 3PQ7A 5FBKA 4DMKA 2D5LA 1QDLB 3HVUA 3NTXA 3OEED 3C2QA 2PGAA 2VXCA 3E53A 3ZHXA 1O6ZA 2EWVA 2D0IA 2VH1A 1XTSA 3M6MD 4C0HA 1JSRA 4ZVPA 4A2QA 3W06A 1I8TA 4KLRA 4D4LA 1HNWB 3KVOA 1MXFA 1VGQA 4F4CA 3GRKA 1WOYA 2QZZA 2QYHA 4DNFA 2V7GA 5IU6A 1RQ2A 2JEZA 1K98A 3BWXA 1KI4A 5TJ9A 4XPIA 1HMYA 2C1XA 1IY1A 1GNPA 4ZC8A 4IH1A 5IDXA 3B1KA 3IKTA 3CKKA 3FUXA 1RRCA 2GZ3A 3VU1A 4M60A 4OLBA 1YS9A 5I47A 4HFMA 2JJ1A 1DC7A 2ZYHA 4PLYA 3QOXA 1EB8A 1U2GA 3EXHC 2XUKA 3T1HB 2DUNA 1BD3A 1YL5A 2KLBA 2SHKA 3CLKA 5AKZA 1H6AA 4JR1A 5CFQA 2C7BA 5CB4A 4B2PA 3WZLA 1X13A 2G9NA 5FEUA 1HE8B 1S3IA 1N2SA 4R0NA 5EZ5A 4LYHA 1U7WA 2EC5A 3FW1A 4CDGA 2YNMC 5LOVF 4RV4A 4L6CA 2FYTA 1E59A 3KKZA 3EEYA 3FJOA 4MB0A 4KODA 1RXWA 2H7XA 1CK4A 2VFAA 4GWGA 2X8WA 4OO3A 4F2DA 3MQ4A 5DRTA 5LU8A 3T94A 1AA6A 2GA9A 5LC1A 2I6FA 3GVHA 4ICIA 2UUAB 1BWQA 4WZZA 2J3DA 1CY2A 3JVIA 4CKXA 4TWRA 1Y81A 1D2AA 5FWXB 1YJCA 1GTZA 4OAQA 3SICE 4J0JA 4TTQA 1W47A 2PZFA 2VUUA 4HJXA 5B55A 3S2FA 3GLIA 4M8NE 3CVWA 3OIWA 3NBQA 1R6TA 1BA3A 2NQTA 1EJ0A 3KP1A 4Z0TA 3DZ8A 3L0PA 4TUYF 2R2AA 2WYIA 5AW7A 3UK0A 3AF5A 2CE2X 2NZXA 5JEDA 3KSZO 1N4AA 3NV9A 4HEQA 1KARA 2ZB8A 5GJBA 4KN5A 3QFFA 3OHMA 1Z0SA 5B7QA 1U99A 2XDQA 5KEIA 6NULA 5KNDD 3HEMA 3ASYA 4KDFA 1F1BA 4C89A 4EPVA 2A88A 2VPIA 4BCDA 1TT7A 4XI9A 4CIWA 5C8YA 5KPJA 3K9CA 5LKRA 3JQDA 4HXEB 4DZTA 1EWVA 3D7NA 4GLBA 1C0EA 4I4TA 4R8MA 4GH5A 1G7RA 2CNOA 4YNBA 1G21A 5D5QA 4DBZA 1KJNA 3TE6A 3W5HA 2JIRA 4DIFA 5IN4A 1WXGA 2QYSA 2IU4A 3SSNA 1DNPA 1G55A 2PGNA 4X44A 1D2MA 4B48A 5LMNB 3F6SA 4P0TA 2EKZA 3D31A 1SO8A 3L5OA 4F91B 4XR9A 4PBSA 5EYPB 4EFLA 1DKPA 2FCRA 5I7SA 2F4NA 5JT1A 1PJQA 1UQUA 4MRMB 4NSNA