1FTNA

Crystal structure of the human rhoa/gdp complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA (H12)
publication title Crystal structure of RhoA-GDP and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proto-oncogene
total genus 61
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1997-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftnA00
4B73A 2R6DA 1OH8A 3SR0A 1R5OA 4BZXA 1DAEA 2F1RA 2YWFA 4B6EA 2HLDD 4TT3D 5FTMA 3CIOA 2V3CC 2VBCA 3CRMA 2WAYA 1JJVA 3FB4A 2PEYA 1FNNA 1Z22A 2BKUA 1AKEA 4OK5A 3V4RA 3EARA 4TLDA 1RRFA 4OJKA 3GP8A 2BMDA 4OHWA 5C2JB 4FWTA 4NYIR 3FMFA 5FTKA 4RZUA 3AVXA 2IC5A 4LV5B 3B78A 4JZKA 3W6OA 4R7ZA 4L9WA 4MGKR 1NNEA 5EQTA 4OHYA 3ASZA 2WHXA 2F6RA 3Q7QA 1XD8A 1NBME 3SS8A 3FKSA 2QI9C 2JLWA 1S96A 3FGNA 1Z6TA 1XDBA 2X19A 4G5SA 4KAXA 2FJUA 1PV4A 1F48A 4IRUB 3EA5A 4QRHA 2YKGA 1OKKA 3RVBA 1X1RA 1W44A 3GJXC 3HJNA 2R2AA 4HLDA 5GJWC 1YR6A 4EPTA 1FFHA 4FMBB 1WE2A 3I1FA 3GLGA 4A8JB 4Z54A 2EVWX 2OCPA 5G3YA 3K0AA 1NN0A 5EP2A 1KI2A 4WW0A 4DXAA 2IF2A 3LO5A 4MKIA 2WPDA 4URUR 1NSTA 3TR5A 4ASUD 4DCTA 2QG6A 3NKVA 3NVAA 2H57A 1XBTA 4EJSA 3LAWA 1T5IA 1G8YA 2VHJA 2WV9A 4HB0A 4OQXA 3RS4A 4NPHA 1GTVA 2GETA 1JR6A 4RJLA 1LFDB 2VEDA 1SKQA 3CH5A 3EWAA 2QENA 3ADDA 1CR0A 3B1YA 4KI0A 1N6IA 4Q4JB 3X1YA 4D4LA 3QIAA 4JL6A 1NG9A 2G6BA 5GVRA 4DB2A 2GCOA 3U6KA 4CEJB 4C4PA 3RRMA 1Z83A 2ZJOA 2IYWA 3GJ6A 1X1SA 2JLRA 2RHMA 3IO5A 3LXXA 2H8KA 3L0PA 3ZS8A 1ZD9A 4UJ3A 1DS6A 4LYAA 3FFBA 3UWOA 2FZ4A 3MAAC 3WYFA 4EPRA 1PLKA 4WVFA 2IYUA 4JKIA 3P4YA 4C0SA 2V6IA 3X1DA 2A78A 2GZDA 2QE7D 2EWWA 2PT7A 1NL3A 2C5LA 2JGNA 3PUYA 3WHKA 3ND9A 5C18A 1CF4A 2ONKA 4YMTA 3L2OB 5G40A 1W5TA 1WP9A 2NO0A 3I8SA 4Q19A 3BK7A 1U9IA 4B3FX 4O2RA 1YRAA 2QN6A 3ADBA 2HEIA 4TL9A 3U6BA 2ZSAA 4R2HA 1CLUA 4DRZA 3DZ8A 1TF2A 1GL7A 4AK9A 4URWR 4PXAA 1NLFA 1R2QA 3BAFA 3WXMA 1U0HC 3VKGA 3LLUA 4R9UC 3I4LA 5JWOA 2HYDA 1AGRA 2YWHA 5HTKA 4CGZA 5B58C 2F43A 5JS8A 5DNYB 4YMUA 4CEIA 4BLTA 1P73A 1NJGA 1RZ3A 1F2TA 1Z2AA 2ZITA 3QQ5A 4DSOA 4I81A 1U0JA 1W49A 5CM8B 5KYKA 4D81A 5JCPA 121PA 2XGJA 1KY3A 3KX2A 1IN8A 5IT5A 4C2UA 2HT6A 1IBRA 1ZU5A 2FV8A 4MRRA 3M4YA 3MWJA 1G8HA 4NE2A 3THWA 3H1TA 4F38A 1BO6A 1E2LA 2CLCX 4URZR 5E7MA 5DN6A 3OAAA 2JDID 2HYIC 4P4SA 4NCKA 1TTTA 4KJZA 4PQFA 1NLZA 3QXXA 1KDOA 2RMKA 3F0TA 3ZD7A 1CR2A 3ECCA 4GI7A 4OQFA 3DKPA 3SDZA 2OXCA 3W8NA 3EWSA 4EQ6A 2BMJA 2RGDA 2JASA 3PG5A 1DE0A 4RCZA 4A6XA 2JJ2A 3IEUA 4HLCA 3ADCA 4YDSA 1TPZA 2KSQA 1DOAA 2BBWA 3A1UA 4PR0A 2WSSD 5L3SA 5FBLB 4HDOB 4BFYA 3LFUA 3SBEA 4KLNA 1CJMA 4G1UC 1Q21A 4JYBA 3TH5A 3ZVNA 1TF5A 4HEJA 1RIFA 5C4GB 4DCSA 2PMDA 4BZPA 2Z5FA 4X8MA 5FI1B 4QM7A 4M1OA 5TY0A 2BBTA 2ZVPX 3X1WA 3SEAA 3KXIA 1KSGA 5AJYA 1HA3A 3AF4A 4GNKA 3PIRA 2B92A 1NN1A 1XD2B 1JEDA 4V02A 4W9MC 1M7GA 3BOSA 1ZM9A 4DJTA 2JJ1D 4D80A 1HT1E 1GSIA 2JAQA 2IXGA 1DG1G 1ZNWA 4DLSA 2FH5B 1J70A 4BE7B 3EPKA 2ZE8A 3ZVLA 2CL7X 5SZHB 1G3RA 2R6FA 4RVCA 3EPJA 3R7WB 1R5BA 4MGIR 2QUZA 4PSAA 2B6HA 4GRAA 1WA5A 1KO1A 4KFSA 3JZAA 4MKGA 4D6PA 3P4XA 4FI3C 1K6MA 1OHHD 4EPXA 3SJCA 4Q4AB 1E9BA 3T12A 3BIFA 2Q9BA 4EFLA 3EASA 2HJVA 4LOAA 4TTRA 3CX6A 1XMVA 3I3SR 2UZIR 3REGA 1E2GA 1GKUB 2FX3A 3BS4A 3FOZA 1E2FA 1E99A 2A30A 3LRPA 1ZNYA 4GP7A 3KQUA 1EFRA 2NMVA 1E6CA 1N5IA 4ARZB 3W3ZB 2V4ZA 5E95A 3AF0A 2PZGA 4K8OA 2GCNA 1FQKA 1I4LD 1W4AA 4U5XA 1JR3E 3K53A 1GNRA 4M9QA 1HUQA 2Q3FA 1VCNA 1BYIA 2FPMA 4HZUB 4Z1MD 2FDCA 2GILA 3MJHA 4NZYA 3BGWA 1KSJA 2ZR7A 1II9A 3RS7A 3L43A 5LBIA 5KPDA 2Q0HA 3AKEA 1KAOA 1T9HA 4DLRA 2O8EB 4OI0A 1LV7A 5TB5A 1CJVC 2NGRA 3DDCA 3AVUA 2XB4A 3EG5A 3LXRA 3OHMA 1SVKA 2XNDD 4O2LA 2D2EA 4QBFA 3TE6A 2GJKA 4FCWA 1SKYB 3FHOA 2GAOA 3NH6A 1CJUC 2IXEA 2KJQA 3T35A 2OHFA 1IN7A 3A1SA 4A8JA 1KO5A 1G7RA 4F92B 5IK2D 4GFDA 4KODA 2ZPTX 4WXPA 4FINA 3CWQA 3CBQA 3WNBA 1N25A 4N0EA 3OIVA 1MABB 2EFDB 2QAGB 2C04A 5EJEA 2CVFA 4ZCIA 1NVUQ 1EGAA 2GJ9A 1EESA 2WWHA 1N6LA 4LYFA 1N2CE 1XZQA 2OO7A 4GOXA 1LF0A 1SXJC 2EU8A 2VSXA 1IN4A 4MGYR 1UEJA 1X6VA 2VO1A 5K8IA 4BFTA 4D0GA 1E2PA 3OZXA 2ZI3A 1G3MA 4HYYA 4Q4JA 4NCIA 1U94A 4HDCA 4AWXA 3RS0A 2NZJA 4URVR 4CEJA 3TW4A 1BKDR 2ZYUX 4CW7A 3LBIA 1XEWX 4LJ8A 1T8TA 4C0BA 4JMPA 4DZZA 1SXJD 2BIFA 2J0VA 4FMCF 4LJ5A 2BOVA 2OEPA 3K1JA 1U98A 1UDWA 3B1ZA 2ERYA 4UNSA 1T91A 1Z8FA 3K70B 2FN4A 2G83A 4ZV4A 2GBLC 3ICQB 4IVQA 3AUXA 4KSCA 4IKEA 3HR8A 1D9ZA 4NHOA 4IOKA 4IDNA 5K8UA 1TQ4A 1RRCA 2DY1A 3GQBA 4IDQA 4LK2A 1NLYA 4B2PA 1G18A 1DAGA 3BERA 1OXXK 4DHEA 2OBNA 1TU3A 1XU4A 1Z6AA 4ILEA 1XD9A 4OKSA 1AK2A 1KZGB 4YC7A 5CYOA 2ZREA 1R0XA 1TADA 5AJVB 3AH8A 5DISB 4B3DA 4P3YA 1DAIA 1O3YA 2WVJA 4LV6A 3IPXA 5F3WB 2YOHA 5AWFC 1JPNA 2JCSA 1GWNA 1HE8B 2QPTA 3OEEA 3UMSA 4ZIRB 1W0JD 4I1SA 3U60B 4EAQA 1LF5A 3I72A 4DEYA 4X8OA 2VH5R 4Q9LA 2IYYA 4CVNA 3GLGE 4NYMR 1KSHA 5HZHA 4AYWA 1H8HA 1KK0A 1E9AA 1VYVA 3WP0A 5AJWA 1YQTA 4PAOA 5HE8A 5EP4A 1HY3A 2B7BA 4E09A 4JLNA 1T5LA 4JBXA 3ONWA 2WBLC 1EG7A 2G0NA 4LBWA 4TMXA 2HXYA 1YR8A 1Z63A 2D7DA 3EZ7A 1UKEA 3JVVA 3VHLB 1WBDA 2O8DB 2UKDA 3OF5A 4C0LA 3MUFA 3WMGA 1YVDA 1ZUNB 2GEVA 1IOZA 1T0HB 3BFVA 1SHZA 2FFBA 3AGQA 4B3BA 4PC6A 2IX3A 4X8LA 1IY2A 1T4GA 4TQUS 2XJ9A 5DE3A 4G0NA 1F60A 4TZ0A 3HU3A 3U7EB 1KJZA 2ZANA 5JJIA 4RFSB 2IUTA 2AK2A 3LBHA 5FL7A 3RS2A 1QHHB 3RSOA 3GLIB 1E1RA 5KPJA 4XH9B 4ZKEA 3ETLA 4KFTA 1F2UB 1YHNA 2BM0A 3K0SA 2CEAA 2CBZA 2MSCB 4LYJA 1ZYUA 3I5YA 4I1UA 2HCBA 4CRWB 2QGNA 521PA 1FTNA 1V43A 1IAQA 1F3OA 1YZLA 5JEDA 3I73A 4ESVA 2O5VA 621PA 2VHUA 2ZI7A 4NTZA 4JSTA 4KFUA 3X1ZA 3EX7C 1H8ED 1XRJA 2W83A 2WWFA 4I1VA 3ZQJA 1RW4A 5HCNA 4PAQA 3EC2A 5L3VA 1XD2A 4Q9JA 4UJ5A 4OQMA 1S8FA 2X2EA 4D82A 2YINC 4V0ME 1QG2A 2NO1A 2VHQA 4YQFA 3C4JA 4OBEA 2QL6A 1ESNA 2YOFA 3CF0A 4Q47A 1EWQA 1P62B 1HH4A 1HQCA 3SFVA 4A6PA 5JI2E 3R7WA 4DSTA 4JLAA 1QVRA 1OT3A 2RGBA 1OPXA 3ZH9B 2X77A 1S3GA 2K5UA 2IL1A 2QGZA 1AQUA 4O0MA 4Q4AA 4BLSA 4DEXA 2XTMA 1XXHB 4M9SA 2LKDA 2C9CA 2O0HA 3U5ZB 2OM2A 3ZD6A 1D2MA 4BLQA 1BH2A 4POAA 4C0QC 4PZYA 2N46A 1M2OB 2ZE7A 4QGFA 4B3CA 3U7FB 3FYHA 4ARZA 3WNDA 1CULC 4G5RA 1HYQA 2ZUDA 2W2VA 3W3AA 1TEXA 3QXHA 2DYKA 1G16A 2FEMA 1LS6A 2HDNB 5FTNA 2EFCB 1GRNA 4PZZA 1BS1A 4HZUA 4B43A 1P61B 4C9BA 1HTWA 1I4TD 4YMWA 3EZ2A 2O8EA 3MGCA 1ZIPA 2ANBA 2WMNB 3D3QA 3OE7A 2IYXA 4DB4A 2IS2A 3RC8A 2R6CA 2QM7A 3QENA 4Q66C 4A4DA 2GZAA 2FSGA 3TMKA 4DLZA 4DVGA 5FOTA 4M1SA 2IYQA 1R4AA 2NQ2C 3BB1A 4PPFA 2BKEA 2HF9A 3TVTA 1N0UA 4DWJA 4TYWA 4WIAA 1KI8A 1MABA 2DPXA 2QAGA 2RCNA 3DEFA 1ZAKA 4MRVA 3O47A 5L3QB 4UQOA 1XTQA 221PA 4RD1A 3DPUA 2J3EA 1LW7A 2J41A 2UZ3A 5KDLA 2CK3A 3H86A 1UADA 2N42A 4DLXA 3TNFA 1C9KA 4XVRA 1OH7A 2V54A 1XB2A 3ND8A 4GZLA 4L9SA 3ZGXA 2GK7A 1ZU4A 3P27A 4BFXA 2CHGA 4B2LA 4US0R 5SZKB 2RGXA 3O8BA 5AJZA 1IN6A 4E5UA 3UXMA 3MWLA 4JJKA 4P31A 1VKJA 3J81k 3WHLA 1W5SA 3TKLA 4G3XA 3OEHA 4IOMA 3T5DA 1NVVQ 3EZ6A 1EX6A 4PC7A 4BRUA 1OYYA 2WWXA 4IHQA 5KSYA 3R8CA 3K09A 3CZPA 3DOFA 5BN4A 4IDHA 4QGAA 2GJAA 3JZMA 3I61A 1E79D 1KKLA 3N2EA 2FU5C 3C15C 4Y0AA 2FA9A 4EPYA 3B13B 4NDZA 4B48A 1S0UA 2AN9A 3UG6A 3NXSA 4LV8B 1RRGA 1SVIA 3TVDA 4AURA 3ICEA 4A2WA 1RYFA 2A5YB 1FPMA 1VYTA 3DKVA 3PFIA 4AYTA 2OV2A 1E0SA 3PEUA 2Z6VA 5DIFA 3AEZA 4MUBA 4B32A 1E9FA 1LTQA 1CP2A 2FSIA 2BCJQ 4ZIRA 4FCTA 1WCV1 3C14C 1Z07A 2V8OA 1FOEB 5BYJA 5F9HA 2QRZA 1IXZA 4C2TA 5JRJA 1GKYA 3OFND 3LDAA 2WM9B 3OIWA 2AD5A 4NH0A 2J0QA 1E4VA 2NZ8A 1OJLA 2NO9A 2V7QD 1J90A 3W90A 1Z47A 4LY6A 5TDHA 1UEIA 5BYKA 1N6NA 2N1BA 1KIMA 2QT0A 2J59A 4ACAA 1DADA 5CB8A 2F7SA 1KI6B 4UNRA 1OIWA 4PSKA 1F5NA 4LHYA 5EP1A 1Q44A 4DIEA 4DDVA 2O8DA 1IN5A 1G5RA 2BBSA 1EFHA 3B1WA 5CB6A 5IHPA 3SZRA 3SJBA 1KK1A 1VCMA 2HLDA 3M1IA 4TT3A 5CJPA 1E2HA 4BLOA 4HZIA 1K8RA 4Z8YA 1DO2A 2E1RA 2FE4A 2JIZD 2XZPA 1S9HA 3K8YA 2QTHA 5CYPA 1Z0FA 2Z83A 2XX3A 4RFSA 2AX4A 1ODFA 1SQ5A 2VP2A 4Z8XA 1QHHA 2F1JA 3GLIA 3RS5A 1E0KA 3EA0A 3IIJA 3FTQA 1F2UA 3QKTA 2CCGA 2F1IA 1Q1QA 4TMKA 1E2KA 1KNQA 5JI3E 3SQXA 3K9LA 1QZXA 2MMCA 2OAQ1 4GPTA 1KDPA 2OFWA 3BORA 4MRPA 5G53C 3QF7A 2Y8EA 1OXUA 3G82C 4Q7LA 4E22A 3AKDA 3NBFA 3QXSA 1Q0UA 2CNWD 3DOEA 4NYJQ 2V1XA 4AKGA 1P9RA 1VIAA 3BBPA 1E2NA 4A2QA 4IJMA 2ZRKA 2REBA 3PEYA 1UBGA 2IWRA 5J4LA 2ZRDA 2AXPA 1CEEA 5TMPA 3B85A 1GP2A 3MMPA 4AIIA 3AVOA 5HPYB 3DVLA 3KKNA 4ASUA 4HB3A 4L16A 4KXFB 4S35A 5KOYA 5KSPA 5B64A 1WXQA 5JHHB 2QROA 3UMRA 4B35A 3CONA 3HU2A 5EP3A 2BM1A 1YZKA 2EYUA 4NP6A 2OSBA 4ZI3A 2WWIA 4KYUA 1W7AA 4GOJA 4TL6A 3TBKA 2JLQA 2W58A 1NVXQ 1XXHA 5FOSA 4MA4A 2ORVA 5P21A 2NTYC 1IXRC 1JXOA 2X2FA 4JLJA 2O8BB 3C16C 4PHGA 3ZVRA 4Q03A 5BWMA 1UKVY 4PANA 1SXJB 4NCHA 3KDSE 1DAHA 2ZVQX 1BOFA 1TQ2A 3IGFA 4F93B 1NIPA 4BPBA 1VYUA 4GSYA 3IIMA 1D2EA 2FMXA 5GJBA 1N5KA 4HSEA 2ZXUA 2PZEA 2JLVA 2WOOA 1CRPA 3RRYA 1DAKA 3I5XA 1OLOA 2PLFA 4FMDB 3AKYA 3FKQA 4LC1A 5FFMA 1JNYA 5EE9A 3T15A 2QE7A 2ZE5A 2FNAA 2D62A 1MO5A 1N6KA 3IHLA 2R65A 1HURA 3PVSA 5GADl 1ZUIA 4GL2A 1XTJA 4WXRA 1XFAA 4W5JA 1E9EA 2GF9A 2ZJ2A 1US8B 3UPUA 1BMFD 1P2VA 5FBWB 4QC2A 4NONA 4DLTA 3TIFA 2AL7A 4JT4A 5FOWA 3KZ1E 1J7KA 2C96A 2DHRA 2XEXA 3FFAA 3RDPA 2E87A 1YZNA 2AR7A 3LBNA 4Q5IA 4GMXA 1VHLA 4F4CA 5HKKD 4JLPA 5KU1A 5L3QA 1U0LA 4XWKA 2H92A 2XXAA 5A4JA 4A2PA 3QI2A 2MSDB 4JKYA 1JAIA 1ZMXA 2OBMA 1Z5ZA 4IOJA 4LPSA 2IUUA 4UXIA 1RVDA 2EFEB 2WTUA 2F55A 2H5EA 4F4JA 1CKEA 2Z43A 4XIGS 4JIMA 4AC9A 1NVWQ 1GL9B 4A9AA 5J4KA 3PEVA 5UKDA 1DO0A 2IEZA 2XSZD 2KB0A 1LB1B 4MYCA 2VYFA 3WBKA 2A5DA 4BLRA 5J47A 5KNCA 1M1YE 2BDTA 1FZQA 4LJYA 4ZDJA 2DCUA 4Q7MB 1HE1C 2QTVB 1XEXB 4IDOA 4RD6A 2JDIA 2VF8A 4V0MA 1X8LA 2ODBA 4DT1B 1PZNA 2EWVA 4RD0A 1KZ7B 3NH9A 1XJQA 2I3BA 2IXFA 5FPYA 2VP4A 1TMKA 3X1XA 2FWRA 5G41A 2CLDX 4B76A 1FX0B 1OXTA 1Z3IX 2LKCA 3RS3A 2FEOA 2IUSA 1QHSA 2R9VA 5D3QA 1MRNA 4JL5A 4FWIB 2WSSA 4D0LB 4PQYA 4DUGD 4QOSA 1MV5A 2IHBA 2C77A 4KBGA 2FZLA 1G17A 1SULA 2VSFA 4ZPXA 1U90A 4JSYA 4WZAE 5J4HA 2YZ2A 1U8YA 5EUQB 4PHFA 4A15A 2QMOA 4AY2A 1CTQA 2O8CB 5FPHA 3SYNA 3P1JA 2Q3HA 2ZAOA 2GESA 3QEOA 1SKYE 3U3KA 4M53A 1XMJA 2QMEA 2JJ1A 1NF3A 2GJSA 5FUXA 8OHMA 5FOUA 2YHSA 1GITA 3MWKA 4RSGA 5BXQC 1QHGA 3IBGA 2QSZA 1R5NA 3RYTC 2WKRA 1CR4A 1KI6A 3SU8A 1QHYA 2OAP1 1CXZA 1NKSA 2QSYA 4LZZA 1OHHA 4PZLA 3B6EA 1G8PA 2HUPA 4OQNA 3H0KA 4OHVA 1CRQA 3IQWA 1CIPA 2VPPA 2H16A 4BFUA 4KITB 3M6AA 1L7VC 4N3NA 3CR7A 1S1CA 4M1YA 2DWQA 4ABYA 3B82A 4OQLA 2G9NA 4ZI2A 3B9PA 4WAUA 5TVKA 4MQBA 3K0CC 3PUVA 2YV5A 2VL7A 2TMKA 4D4KA 4C3ZA 1H65A 4KVAA 3ZDQA 5KSOA 5M04A 4RZ2A 3VR1A 4HB2A 1UFQA 2FSHA 1ZD1A 4Z1MA 3KTAB 3EPHA 3KB2A 2IYLD 2YWGA 3BRWD 4B3GA 1I2DA 5EE5B 3I32A 3W5IA 2G88A 4Q1FA 4Z51A 1Y3AA 2WIBA 4IXMA 3VAAA 1ZNXA 2ZROA 2AXNA 3LA6A 4FN5A 4HB4A 1XJCA 5JZVA 1TX4B 1P72A 1YZTA 4NL4H 2XNDA 3H84A 4AD8A 4EFNA 4HATA 2ZRGA 3B5JA 4NCNA 3U2QA 3GJ3A 3A4LA 1T8UA 2F9MA 3TUZC 1MO3A 2A5FA 1NI3A 2OT3B 4XOIA 5IK2A 4JLVA 2REOA 2W6ID 3TUIC 2CHVA 1FW6A 3QBVA 2VP9A 1L2TA 3GJ8A 4PPGA 3W6NA 4LJ9A 1UJ2A 1ZP6A 4QGHA 2ZR0A 2ZJBA 3DM9B 3QPVA 3V4FA 3WYAA 4HAVA 4G5GA 3GFTA 2QA5A 5EE1A 2QMHA 3GCGA 2EFHB 3TGPA 2YVUA 1XP8A 2YOGA 3QEJA 2IF0A 4HLUA 4C30A 5FPTA 1DG3A 2SHKA 1GIAA 2Z4SA 4Q7JB 3N70A 2D2FA 4TMZA 1VECA 4DSUA 5FL3A 2DB3A 2Z4RA 4LWZA 5GVSA 2ZYTX 1AM4D 4B47A 1VPLA 5FH9A 4MYHA 1E9CA 5BW8A 1SXJA 2E9SA 3KJEA 2FFQA 3SN6A 2FFAA 2GEUA 2QORA 2BVNA 2GF0A 1Z0JA 4M4SA 4NKRA 2Q3MA 3ZLJA 1K5GA 1ZBDA 2ZRJA 3BD9A 1E2DA 1PJRA 2GWHA 3BFKA 2J7KA 4DLVA 1E9SA 1MO4A 3A58B 4Q01A 4PPNA 4XWOA 2IS1A 5DSZA 2XZOA 2WJGA 4NCJA 2BWJA 1TEVA 3IO3A 4LBVA 3GLIE 3VR6A 3L8ZA 5CJ2A 3GEEA 2H7VA 3UIEA 2ATXA 3QSYA 5H68A 3U44B 1ELOA 1ZW6A 3TAHA 1N6OA 4Q1EA 4DLYA 3RWMB 4LDJA 2GBLA 1J2JA 1HV8A 2RH5A 1CU1A 1FP6A 4Y0VA 1ANKA 1US8A 2REXB 4B33A 3LVRE 1E9DA 4A0RA 1N6PA 3TSWA 4RKFA 1D2NA 1Z28A 2W2XA 1W0JA 4V0KA 2R6GA 5CLLA 3NDPA 1W46A 3GLFB 4IW3B 4UNPA 1GAJA 4AKEA 3QKSB 1W1WA 4PTLA 1KDTA 2QAJA 5FTJA 2RGGA 4MITA 2GJ8A 2ZU0C 1TUEA 2GDJA 4OK6A 2ZS9A 1G19A 5ELXA 4QKQA 3CX8A 3NHBA 3K9GA 4MKHA 1NKTA 4V0NA 3REFA 4YXWD 1PLJA 3EXAA 2ZI9A 5DHFA 2IWHA 4M21A 4US1R 3ZIAD 1CS4C 4GZMA 4DSNA 3PUZA 4LGMA 1VCOA 4HLQB 1A5TA 4M1KA 1EXMA 3IBYA 4MH0R 4QJ4A 3SOPA 3MWYW 4F91B 1OXVA 4KBFA 1W2GA 3Q5DA 1XEXA 1JB1A 1GILA 3CNOA 4IFBA 1XXHE 2BJWA 1AQYA 1T0JB 3KQHA 2WWYA 3VU9B 3WY9A 3HU1A 1UM8A 4DT1A 1BIFA 4QL3A 2C98A 4YLGA 3R9WA 2DFLA 1UF9A 3TUJC 1X8JA 4FCVA 1G291 3FMOB 3W5JA 4EPVA 4TL7A 3C7KA 3QNUA 1GRQA 3NIBA 1FX0A 4O3MA 421PA 2PX0A 3LWNA 4B75A 1QHIA 2WJJA 3H4MA 5LPNA 1M6NA 3T1OA 3L0OA 1UBCA 2D06A 3ZZUA 5JS7A 3T1TA 1XCMA 3D31A 3TK1A 2QP3A 4NBSA 2WJYA 5AUQA 4OHZA 3D8BA 2P67A 2XTZA 6Q21A 3K0FB 4XD7D 3ZZ0A 4Q21A 2J7PD 3QUSA 1TU4A 3WYGA 4D4JA 4LC0A 4DBLC 1JI0A 3IEVA 1M7BA 2QPOA 4H1VA 2ANCA 2WJIA 3LNCA 1H8EA 2LCFA 3RRNA 2ZEJA 5JMTA 4AYXA 2NIPA 4PO8A 4CYMA 5EE3A 4JYCA 3O8RA 3KJGA 2GKSA 1RFLA 3VTKA 1W0KA 3PENA 1WDTA 3K9NA 4TSFD 1XCGB 3NWJA 4B3XA 1OB2A 4A0HA 5L3RA 1KYIA 4MRSA 1XEWY 2MMGA 4FW9A 1Z6XA 1SVOA 4YDHB 2DBYA 1E4YA 2O8FB 5F9FA 4HAYA 2OG2A 2DWOA 4I4LA 4PC2A 1TF7A 3MCAA 4PHTA 2JJ8A 1Z08A 2EFGA 3VR2A 5KNBA 5E3HA 3K70D 4N1AA 2VQSA 4WOPA 2OLJA 3KFVA 2PCJA 3GEHA 2AKYA 4PSVA 2P6NA 2FOLA 4G01B 4D25A 4LJ4A 4Q18A 2CCKA 5EZ6B 3VX4A 4GBMA 3W8RA 2R62A 2ZUCA 4HAZA 1NBMD 4ON9A 1WMSA 1VCIA 3IKJA 4A92A 1ZCAA 4M1WA 1E3MA 3UG7A 2RAPA 1JBKA 3D7MA 5FOVA 3E5HA 1JQJC 4R2IA 3CUEF 1QHXA 5BN5A 2HXSA 3MJRA 3KTAA 2ZIAA 1KO4A 1GM5A 4MYUA 2ZJ8A 4AKIA 2LWIA 2ZJZA 4Q7KA 4QM6A 5A5GA 1G9XA 1N0VC 1SZPA 2OCBA 3LVQE 3T1QA 5KDOA 2I1QA 4QHSA 1AZSC 2BEKA 4X8HA 3V9PA 1P75A 2ZU6A 2ZSEA 4JJZA 3B1XA 1COWD 3KUCA 3SQWA 3CRRA 3WNCA 1LS1A 3KXKA 1S2MA 3E2IA 2C99A 1HEIA 1W2HA 1ZM7A 2GVZC 2OLKA 4M8NE 4PAMA 3UWKA 3X2SA 1Z2CA 4RCYA 2B8TA 4HAUA 3VX3A 3ZQ6A 1OH6A 2PBRA 1SHKA 1AS3A 2W00A 1W47A 2ZRIA 2RGNC 2JA1A 3EAQA 1ZJ6A 4URYR 3SJZA 1ZM3A 1R8QA 4W7SA 4BFZA 1X8KA 2VTKA 1S9DA 1OYWA 1ZIOA 1EWRA 3VKHA 4QG7A 3KXLA 1WF3A 1DEKA 5FBQB 1DELA 4FMDF 3MLEA 3GJ5A 3SYKA 3E70C 3GFPA 3HYRA 1KI7A 2NO6A 2ZR9A 4OYHA 1E69A 4Q4HB 3CWZA 1IHUA 2QP4A 4F4IA 2GRJA 5H1YA 5HE9A 2XTNA 1FQJA 2W0MA 1NVVR 4N0DA 1CR1A 4UXJA 3L8YA 2ZSBA 3DMDA 1IONA 4M2LA 3AP1A 2C95A 4LCBA 2V1UA 4C0JA 2ZRAA 3AQ4A 4TYPA 3KQKA 3B7GA 5J4VA 1E79A 3QJYA 4QBGB 1WB9A 1Q3HA 2ZRPA 3QY0A 1SVLA 2B21A 1AZTA 3L0SA 2GVDC 3RC3A 3MG9A 3K0EA 2GCPA 2WAXA 1Q57A 4G5OA 1Z0DA 2Q6TA 3OIYA 4Q4LA 3QKRB 3AVVA 3U44A 2C03A 2OESA 2ZRBA 4E03A 4EDHA 1LVGA 2JLYA 3TQFA 4PX9A 3TJZA 1P3JA 5FBRB 1D8TA 4HAXA 2F3RA 2FF7A 5AUPB 2XOKD 1VDZA 1S4QA 4BASA 2A7QA 5JHGB 1GG2A 4KFRA 1DPFA 1NP6A 2ODWA 3GLFA 2WWWA 3QKSA 3DO6A 2IBMA 5DLQC 1R0WA 2A5JA 2ZUBA 4PFSA 3OFNA 4OI2A 4QJ5A 5JBQA 1R0YA 3GEIA 2V7QA 1ZNZA 3BE4A 3CPEA 2FG5A 2ZRCA 3GJ0A 1G4AE 2HF8A 2IYVA 4OL0A 3SYLA 2GXQA 3B8HA 3SNHA 4M0LA 1VTKA 4M22A 2VP5A 2ZSDA 2FGKA 3M0EA 2OILA 4KYIB 3V00A 2ONJA 4U02A 1M7HA 5F98A 3C41J 1MR3F 5JRZA 5B57C 4LBYA 4HUTA 3TW8B 1U81A 5KUTA 3Q9LA 3U7GA 2C9OA 3VU9A 2ODEA 2GA8A 1XPOA 4URXR 1RPZA 2IYZA 1XMSA 3RSLA 1F2TB 5DO9A 3W9YA 1IM2A 1QG4A 3P20A 1Z6YA 1SXJE 3BB4A 1OXSC 1VG0B 1G5TA 1VG9B 5JJLA 1M34E 1MOZA 1KK2A 2XXAB 2PCLA 4FXPA 1GDDA 4BEJA 1OV4A 2VHCA 2X1VA 3LH5A 1YE8A 5FR1A 1KO7A 4B34A 2W6JD 5D3MB 2OFOA 1P4SA 3JVUA 4KO8A 4A0FA 1KJWA 3SJAA 2ERXA 3K0FA 3ZS9A 3FE2A 2IT1A 4V03A 1FMLA 4KV9A 2PLRA 2ZE6A 1L8QA 1KKMA 4NYJR 2CNWA 4K46A 3KFXA 5JEEA 1P5ZB 2A3RA 5KSZA 4MDEA 1KMHB 2WKPA 4U7DA 1JALA 4BRWA 3WRYC 2OUKA 2VHTA 2ZRNA 5B2ZA 1A82A 3CPHA 5KDDA 1UAAA 5LD2C 4TZ6A 1ZC4A 2P5SA 4QJ3A 2CL6X 2OBLA 1L4UA 1P60A 5FR2A 1YKSA 3QXCA 3F8TA 2YYZA 2G1JA 2QMUA 4LJ6A 5SZIA 4PC1A 4JBWA 4B2IA 5CITA 5FUWA 1LY1A 4B74A 2DFTA 4PO1A 4GMDA 3EIQA 2IS4A 3PR1A 5H8WA 5A0FA 3R9IA 3SHWA 4M1TA 2O8FA 4DIDA 1II8B 2FFHA 4M9ZA 2JATA 1SVWA 4OI4A 2AWOA 4QGGA 2D3WA 4JVNA 4NMMA 5TXGA 5GJVC 2BMFA 2JLXA 3W6PA 1VHTA 1JR3D 1XZPA 2ZRFA 1KGDA 2ZRLA 2ZJ5A 2PT5A 4DCUA 1OIVA 1P6XA 5CIWA 4IXNA 1YZQA 1CJKC 4KCGA 3A8TA 4DCVA 2BHRA 3QVVA 3BH6A 2AD1A 1KI1A 3VQTA 1R7RA 1VG8A 2OE2A 3EW9A 1PUJA 1ZM2A 1E32A 4DC9A 4ITRC 4KLZA 4R71A 2FPLA 3NBXX 2P2LA 3CKLA 2AFHE 3EZ9A 3ADKA 5DYIA 3QG1A 1GL6A 3K9HA 1SGWA 2JEOA 4MUAA 2BC9A 1XPUA 2VRWA 1E1QD 1DAMA 1RYHA 2IYTA 4Q00A 4P4UA 4D4MA 3BWDD 2ASEA 2O0KA 3F5FA 1BMFA 4TL8A 1E2IA 4L8GA 1G1MA 2CJWB 1XMIA 1Q22A 4OHXA 2GXUA 2DFNA 3QG5A 5HKKA 1T3LA 1JAHA 3KB1A 1ZM4A 2QPAA 4GDFA 1D9XA 4LSGA 1FMJA 1GVNB 2VF7A 2ORWA 1A2BA 3A4NA 3IILA 4EPWA 5L8VA 2JLUA 2J1LA 2PL3A 3SC3A 1AS0A 1JECA 2ZRHA 3B1VA 3B2EA 5DYGA 4CT5A 5TARA 1IY0A 1UDXA 3AUYA 3Q85A 1P2UA 3R9XA 2JLZA 1GUAA 2NOAA 2XSZA 2CVHA 3NTUA 1A4RA 3QF4B 1R8SA 4FD2A 4CT4B 2VLIA 4Q4HA 5FPSA 1GNPA 5FUYA 4ESHA 2G0TA 3B60A 4U00A 3GJ7A 2A5GA 5CLQA 3B9QA 1PVOA 1XTRA 2GK6A 2A9KA 2KWIA 4JVSB 2CCJA 4L4UA 1ZCBA 1R6BX 2X8AA 3AVQA 4NYIQ 2OCYC 2IYSA 4GP6A 2EW1A 1KOFA 4JLKA 5C4MA 4L15A 4LRWA 4JLDA 3UANA 3KKOA 1OSNA 3FKSD 1BYUA 5DH9A 2RKOA 1P7CA 2RGCA 4DUGA 2QQEA 1MT0A 1OKKD 3QKRA 4TMWA 4EJSC 5K8TA 1XTIA 3A36A 4MYTA 2CMKA 3MD0A 4PC3A 2HV8A 4TQAA 1E0AA 4JVMA 3O8CA 1AJEA 1J99A 2H18A 4YMSA 5AUOB 4LJAA 1XJ0A 4TQ9A 3SI7A 3OIUA 4AKHA 2BEJA 1Q1BA 3FMIA 5FPKA 1PUIA 1WBBA 2P5TB 1NY5A 2WPDD 4W5WA 4RFVA 3QE0A 1VMAA 4P33A 1N6HA 1Z0AA 3SFZA 1T3HA 2CHQA 2WJVA 4I99A 1NY6A 2H17A 3NEJA 3PITA 3I62A 1FUKA 1X3SA 4BECA 2AHOA 2L0XA 1Q1ZA 2ZI4A 4UXHA 2AWNA 4BUJA 1JQLB 4ZDIA 3LQRA 4Q1DA 4YMVA 3PUWA 2CLSA 1Q3TA 3KQNA 2UVQA 4BFWA 4MDFA 2IW3A 1WQ1R 3ZZTA 4NU0A 4LHVA 1FL9A 4J0QA 3CNLA 4XVQA 2NG1A 3VFDA 5FUVA 2BBOA 4H9GA 2J0UB 3CRVA 5LB2A 2QBYB 2PEZA 3MSXA 1G3IA 3L0IB 3HPQA 2KE5A 1KJYA 5BN3A 2C8VA 1KTVA 1KSFX 3U4QB 2ODNA 3ZYCA 1U9IC 2BMEA 3FVQA 4H1UA 1EFCA 2D7CA 4HI0E 4JLMA 4P32A 2WICA 3S1AB 5TV2A 1MH1A 3PCRB 1UKYA 2J5XA 2PZFA 2QM8A 2O52A 3E1SA 3KL4A 3QOFA 3RABA 4IVPA 4BFVA 5JSZB 3U61B 3PV0A 1ONBA 5EXSA 1ZVQA 4KVGA 3R20A 3K0CA 5JECA 3I8XA 2YWEA 3O8DA 5D3MA 4PPQA 1VIYA 1QDEA 1G64A 1W36C 2JLSA 3Q72A 4EIWA 2KBEA 1DARA 1JJ7A 1OB5A 1VG1A 4ZCMA 1GFIA 1RJ9B 2O8BA 4L5BA 3NG1A 1KMHA 2QNRA 3FWYA 2PJZA 2ECKA 4P4TA 2V6JA 2WZQA 1OFTA 4B6FA 4LUCA 4XSGA 1W36D 2R44A 3CW2A 4QFMA 2ZRMA 3TSZA 2W6IA 1T6NA 5E7IA 2GXSA 3KKMA 2OFXA 4TLEA 5GJCA 3GJ4A 3AF3A 3GLFE 4US2R 2Q9CA 4Q9HA 3HYTA 1W4RA 3QKUA 2WJHA 3AKCA 1J8MF 3SBDA 3BH0A 2XNSA 4TTPA 3IUYA 4IFEA 2ZJAA 4KSBA 3THOA 1FUUA 1UBFA 1II8A 1N5JA 1KI9A 3DZDA 4LX0A 4JL8A 1SVMA 4WA7A 3WMFA 2ZQ5A 5DN6D 3OAAD 4LHXA 4A1FA 4C7OB 2WKQA 1EK0A 2WSMA 1JEEA 1GNQA 1NRJB 1G8GA 2J9RA 2V9PA 1DTSA 3IIKA 4TYQA 5HR5A 1OFHA 1ZUHA 3CB4A 1XEFA 2ZI6A 5BQ5A 1MRSA 2XB2A 2I1VB 1E2EA 3DM5A 3CO5A 4B44A 1N0WA 3AV0B 2JJ2D 5C46F 4TYYA 2GEDA 2BJVA 3UMFA 4BQSA 2ZYWX 1NMXA 4ZO4A 3T06B 3THYB 1TL7C 5JWHA 3C5CA 1GKIA 3GD7A 1DBSA 1G7CA 1QBKC 1CBUA 5J40A 3TR0A 1HQYE 3U3MA 3R8FA 4EKDA 5CDFE 4TMVA 1PLLA 1AN0A 3BC1A 1JPJA 5KHOC 2A2ZA 1G4UR 1G5PA 2C78A 2NPIA 2ZETA 2B7CA 1YRBA 2QRNA 3GLHE 1DVRA 2BCGY 3HP1A 3T61A 2CJWA 3AM1A 4DKXA 4TYNA 4AG6A 4P0TA 1GZSA 1U99A 2QEQA 2YC2C 4HUQB 2KI5A 2IEYA 2HCJB 2CXXA 3BJIC 2AKAB 2J45A 1AKYA 1NMYA 2D74A 4DLUA 1Z0IA 3AP3A 1XCPA 1KDRA 4K81B 4E07A 1IY1A 3KKPA 3DMNA 2GHIA 4YXWA 4II7A 2W0SA 721PA 1KI4A 3THXB 3ZIAA 1Q20A 1GOTA 5DI3B 2GXAA 2J46A 3QF4A 2O0JA 1EFUA 4HDQB 1M8PA 2PMKA 1NN5A 4RD3A 4XJXA 5HCIA 3TLXA 3NEYA 5KO2A 3A1TA 1EFRD 3IHWA 1W48A 4JLOA 4D26A 3P32A 5EUMA 4HLUC 1B0UA 3BFXA 5JLJA 1AIPA 3FDIA 3NBYC 3VNUA 1E2MA 3PXGA 3UKDA 3LX5A 5IF9A 4A8JC 2P65A 2ZTSA 1YR7A 3CX7A 5LDDC 4D2IA 1G7SA 5F2EA 2ZM5A 5JCZA 4Q1BA 4A36A 2AK3A 1Y63A 4G5QA 3VKWA 3WP1B 4PHHA 2XITA 3VR5A 3PQCA 1J8YF 3RHFA 4V0OA 1D5CA 1MKYA 3LLMA 3U3OA 1I2MA 4XD7A 3AB3A 2J7PA 1A2KC 1P9WA 3EIEA 4I1OA 2RGAA 2ZS8A 4HAWA 4CDGA 3FHTA 2ZI5A 1QVAA 3BXZA 1S3SA 2GTPA 1YZUA 5CK5A 4QHTA 4QNMA 1Z0KA 2EYQA 2CDNA 3A1WA 3SE0A 2I4IA 1E94E 1UKZA 2FPKA 4TLCA 1UPTA 2KBFA 4TSFA 2IHYA 5ANRB 4ZCLA 3LW7A 3CLVA 2OZEA 2HT1A 2PX3A 1KNXA 5FI0B 1E2QA 1P9NA 3VR4A 4DDWA 2YJTD 4QBHA 4XTRA 1GRRA 1U8ZA 3CM0A 3NHAA 2PJRA 5AUNB 5LD2B 4WBSA 4ACBA 1AGPA 2VP0A 5EXXA 1D6JA 4RZXA 1II0A 3GLHB 3RWOA 2J0UA 2QBYA 1E96A 1ZRHA 3C8UA 1S1MA 3EC1A 4KHZA 1KI3A 3QBTA 2QQ0A 2B8WA 4IEIA 4YONB 2Q21A 4UKDA 2O8CA 4C0AC 3GFOA 3U4QA 4D0NA 1AS2A 1ZINA 3F3YA 1NBMA 1EFTA 3WBJA 4TTQA 1DAFA 1NMZA 1T3SA 1XTKA 3S1AA 2P6RA 5EXPA 1M74A 4BWYA 3A6PC 2J87A 3T5GA 1ZC3A 4TLBA 5E4FA 1NG1A 2GNOA 5JSZA 4CEHB 1YZGA 3QVUA 2DFKB 1G8FA 3RLFA 1O87A 1Z06A 2YC4C 2NO7A 3CF6R 4O25A 1V5WA 2F3TA 4BZQA 2C9YA 2WWGA 3I92A 4ZDKA 3OEED 2BV3A 4JBYA 4MRNA 4AI6A 1RJ9A 1KAGA 4AG5A 2OXRA 1ETUA 1COWA 4JT2A 4BFSA 5JJKA 1W4CA 5CK4A 3A4MA 5CM9C 4Q1CA 1G3UA 1NSFA 1CJTC 2H1LA 3ZVMA 3Q3JB 4NYMQ 4XTCS 5DGXA 1H8HD 3KJHA 5CIQA 4GT1A 3UK6A 4R98A 2WMOB 2W2TA 4LBZA 4S2EA 2ORIA 3OESA 2IA5A 2V55B 2QU8A 2R8RA 2YNMA 2P3SA 4ZDWA 3TSOA 3GMTA 1P2SA 5FTLA 3RAPR 2QY9A 4QNRA 1SVSA 5JWRA 3RNLA 3FMPB 3KKQA 3WRXC 4XSHA 5AJXA 3ZJYA 2R6AA 4C7OA 3RRZA 2CE2X 1KMQA 3AVWA 1A7JA 2IYRA 4QBIA 4Q02A 1OFUX 4CF7A 2RGNA 1XX6A 4Q9IA 3LW8A 2MSEB 1Z29A 1W0KD 4IOLA 1G6OA 2WIAA 4WZ6A 4C0HA 4F7WA 5B30A 4LHWA 5FL7D 1F6BA 1G7TA 2HJGA 3DL0A 3VHXA 4XVUA 3RANA 1E1RD 1N3BA 4JVLA 3AF2A 4BLPA 5AR1A 2DR3A 3TRFA 4Q48A 1OE0A 3THYA 1Q12A 3AVPA 3IPYA 4B71A 1IJEA 1E98A 1IQPA 3CH4B 5EE0A 4TN1A 2PH1A 1OF1A 2AFIE 2C2HA 2VA8A 4QXAA 3U3RA 4Q1AA 1TAGA 4IEEA 3NBZC 4A82A 5HZKA 1G6HA 1XF9A 4WZBE 1G3QA 1KK3A 3KQLA 3CZQA 1YU9A 3U3JA 3FPAA 3GLGB 4UNNA 2DWPA 2XOKA 4BGDA 1U8AA 3K0AB 2IS6A 4QHYA 3HPRA 3LD9A 3CPJB 3MFYA 1TUIA 4M1MA 1K5DA 3LY5A 1E2JA 4EJSB 821PA 4HUQA 3P26A 3EZFA 2QP9X 1FTSA 4RD4A 2RHDA 4RD2A 3DHWC 5FBVB 4OJQA 3T1VA 5KTYA 3SHFA 3CRW1 3MRSA 5IDVA 1OIXA 1B23P 2XAUA 2CL0X 1FP7A 1P2TA 2ATVA 4MKFA 1E0JA 5DI9A 3THXA 1NIJA 3GPLA 2QZ4A 5DI3A 2GCOB 3QPWA 4XWAA 1X86B 1KHTA 3IQXA 3FHCB 5H70A 3G0HA 4EUNA 2RB4A 2F9LA 1RRPA 4IVRA 1R10A 3CF2A 2G3YA 2ZSFA 1OH5A 1QF9A 4RKEA 1YR9A 3NDBB 1AA9A 1KO8A 4C0KA 4JLBA 5C1BA 3CRQA 4OI1A 5IRCD 1W4BA 2D4HA 4FIDA 3Q5EA 1QRAA 3PJRA 5DHAA 4V0LA 2NPFA 2QT1A 4LHZA 1U2RA 3KUDA 3N2IA 2FGJA 3TAUA 2QAGC 1R0ZA 3OE7D 4MGZR 4TWZA 3VR3A 3AVYA 4FMCB 2ZJYA 1Z6GA 1IXSB 4LYHA 3Q7PA 2W6JA 3AP2A 1OFIA 1ESMA 3Q8XB 2ZYVX 3VMFA 4ZKDA 3NC1C 5SZJA 2CE7A 2F1HA 1L4YA 1RC8A 1RE0A 4LPKA 5FOXA 3D6TB 1OW3B 3PUXA 4UNQA 4JS0A 4LI0A 2OCAA 4DDTA 3PEWA 4Q9KA 3A37A 3W34A 3AVTA 1IJFA 2F43B 2Z0MA 1JXMA 4KU4A 4CEIB 3LV8A 1C1YA 2FSFA 2JIZA 4TLAA 3C5HA 5J5CA 2CK3D 5EZ5A 1W36B 1UBEA 5K8LA 5KNDA 1XWIA 3U7HB 1G21E 2VIIA 1QHNA 3BH7A 3K09C 3IDQA 5CDFA 3ASYA 2IK8A 3K70C 2QTFA 3WMEA 4DDUA 2P6UA 4BEBA 2VP6A 2Q9AA 1TQDA 3QPUA 4CZ2A 3THWB 4DCNA 3NC0C 3OEHD 1G41A 4PQRA 3AGPA 3VNVA 3GLHA 2J0SA 1MO6A 4P4SB 3CNNA 5AK0A 1Q1EA 1JR3A 1ZD8A 5JFGA 3CR8A 2RGEA 3BB3A 1NJFA 2GAAA 3HWSA 3LQQA 2VSOA 3QXJA 5G3ZA 5J4YA 3L82B 4EQ6B 1XTSA 1RKBA 3HDTA 4ERNA 2XJ4A 1EX7A 1WRBA 2EQBA 2ZAMA 3N5CA 1HT2E 4PO9A 3KJIA 3EIHA 5L3SB 4CEHA 1N6RA 1TNDA 5E7JA 4RZ3A 3H2YA 4RY2A 2WOJA 2G1KA 1KY2A 3G5UA 4OK3A 1XNJA 1YJ5A 4GOKA 3TQCA 4IDPA 1E1QA 4CIDA 4M9XA 1N5LA 4TMTA 4DLWA 1G20E 4W5HA 3UATA 4EFMA 1XPRA 1FNMA 3EPLA 5LB4A 1NN3A 2ZS7A 3HR7A 1LNZA 1TQ6A 3LX8A 3T34A 2P0EA 3AF1A 1E9RA 3A1VA 2G77B 2XZLA 2GZHA 1I4DD 1C4OA 4A0GA 1A1VA 5EXTA 4LJ7A
chains in the Genus database with same CATH superfamily
2R6DA 5DIZA 2HU5A 4C7BA 4R4JA 4QX6A 4EMSA 1QFSA 1YQQA 4IH4A 4K9NA 4JEIA 3SR0A 3SYRA 2GJ4A 1NHGA 1R5OA 2Q1YA 4AO8A 3H9EO 2Z6AA 4X00A 1QYXA 3M6VA 2TYSB 4TGLA 4X71A 3D3EA 4BMCA 2Y1LA 1UUFA 4K9LA 1N3YA 2XTJA 4G0QA 4KOAA 4NFLA 1ULZA 3CIOA 4TXHA 2VBCA 4HWKA 5IJAA 2WAYA 3I1IA 5K2MA 3ZDYB 3HB0A 4K0RA 1FNNA 3WGYA 1ENYA 1Y8QA 3G8CA 4YJGB 3BXGA 3K4QA 4OJKA 1DAOA 1VXOA 2QW0X 4OHWA 3NKFA 4LE1A 5C2JB 4NYIR 3WL8A 1SJ9A 3O1HB 5AVSA 3AVXA 1X2BA 5IFLA 1FTGA 1H1DA 3W6OA 3B78A 2RI1A 3OEYA 1BH6A 1CY4A 4EGAA 4M6WB 2HR1A 3Q7QA 1J8QA 2C7GA 3OA2A 1G1AA 4LE0A 4P86A 3SS8A 3FKSA 1VSVA 3PXCX 5IVKA 3ZK8A 5CD1A 2JAOA 2H1CA 3RJZA 4CMIA 2R8YA 2FWPA 3AIOA 5EN4A 1NONA 2VWPA 3ZUPA 4EHKA 3EA5A 4R2JA 3S8EA 4EI7A 1OKKA 2FZWA 3RVBA 2Q29A 3M4NA 4PYMA 3TTSA 5F7XA 2FWNA 3GIDA 5IABA 4J3NA 3VPSA 5I4CA 2UVPA 1VHDA 4FSXA 4R05A 3ZCTA 3OQIA 4BWGA 4KXVA 4JGGA 3GLGA 2OZKA 3EIOA 2OCPA 3IE0A 2JHPA 4X20B 3VJKA 1N4DA 5DNVA 4MUHA 5IT0A 1KI2A 3W7BA 2CVPA 2W43A 1V1MA 4BNJA 2V6MA 1NSTA 1SK8A 3K2BA 1GPNA 1KH3A 1AKTA 1XBTA 2I1WA 2XQIA 3D4LA 3NGXA 1GEEA 1G8YA 4N5LA 4WLNA 4XYGA 5CH5A 1U0GA 4LE2A 5CA1B 5LM3A 1GLVA 4M1ZA 3NTVA 4HB0A 3THRA 5TPWA 5FPPA 1K6JA 1G60A 1Q50A 1RKQA 3D4PA 3VUFA 3RIGA 4IS2A 3CH5A 3EWAA 1F2DA 1NUSA 3MPUA 5BV8A 5A04A 3VZCA 2MCFA 1OTYA 2Q27A 2I4TA 1VLJA 5C1IA 1N6IA 3RRXA 5E8RA 2IZ0A 3QIAA 4JL6A 4MJXA 1FDIA 2I6FA 4CEJB 2GARA 4AB1A 3KEQA 3SJUA 4MVJG 3RRMA 2I3GA 5ADHA 2JFPA 3KYBA 7ABPA 5IC4A 2IYWA 3GJ6A 1USGA 1CQWA 3FNFA 3L02A 1L4FA 1WUTA 4EG1A 2RHMA 1XZAA 3JV7A 3FCSB 3L0PA 2PX4A 3VGJA 1DS6A 1DAPA 4QXQA 2HBZA 3GJQA 5EWLA 1H93A 3ENZA 4FR2A 1YNOA 2AF4C 3FTDA 3MAAC 4YJHB 5EINA 4QO7A 4MW7A 3UJPA 1VL8A 5E8JA 2Q46A 3T7KA 3D6AA 3P4YA 4C0WA 4ALNA 2A9RA 2ZSKA 3MOGA 3ZE2B 4WESA 5FORA 4KR2A 3X1DA 2QE7D 5GOTA 2PT7A 3HLYA 1W19A 2JGNA 3PUYA 4KC0A 4F45A 1H2YA 5C18A 1CF4A 1DKLA 2ONKA 4EW1A 2LE0A 2ECOA 3E7DA 3H6KA 3L2OB 1V25A 4OXXA 1ZVMA 4UZFA 1WP9A 3E3OA 4Q19A 3LT2A 1YDEA 3WZLA 1A4UA 3BXXA 1NV8A 2HEIA 2IIPA 3UMJA 1A97A 3H2HA 4P3PA 1CLUA 2A9PA 4R2HA 4Z3DA 4DRZA 1YCGA 5CB4F 1ZKDA 1R2QA 2NSDA 4FHFA 4H0NA 3IB6A 4YYEA 3I4LA 4CLEA 4QG3A 1VFPA 5JWOA 4JI8B 5IEBA 3TO5A 4CGZA 1MB2A 1DQYA 1U65A 2VDKB 2EJTA 1OMOA 1QGYA 2F43A 3P4UA 3PFKA 4LNAA 4YMUA 1DQRA 5JS8A 1RAIA 4YRLA 3TG2A 5DNYB 2A0WA 4X94A 1Z2AA 2H4JA 1B2LA 4YI3A 1QPGA 4BV2A 3QQ5A 4DSOA 1X38A 4CKEA 2P5UA 5LA6F 1AA6A 4JUFA 5KKAA 1QK4A 1JVBA 4PQGA 5CM8B 2I7VA 4R1MA 1NFFA 3TSCA 1ISJA 1HPLA 4H1WA 2XGJA 3GBVA 3KX2A 2XADA 4MV4A 5ALZA 1IBRA 1M2HA 3K35A 4HNRA 1F0YA 2PSDA 2VZLA 3DE1X 1NP7A 3KSMA 4YLEA 3WGQA 5REQA 3V1MA 2JHGA 3WK8A 3THWA 1JEYB 4NAVA 4X7PA 1BO6A 1IPHA 3T7AA 3OZRA 3PLRA 2HYIC 4BNKA 4AJNA 3TGLA 4MR9B 5JAMA 1C7JA 3PYXA 4E5MA 3ECCA 5FXMA 1SC3A 4R0NA 3LCJA 4NATA 4K0KB 4EQ6A 2A59A 1X9HA 2RGDA 1R74A 1H2ZA 1MX1A 1IOLA 5EPEA 2O1XA 4RCZA 4A6XA 2E4VA 1U2DC 2QN8A 4R68A 2NPOA 2K6GA 2VHZA 3QU5A 3ADCA 1D09A 1KU6A 3B1FA 4PR0A 2M32A 2WSSD 1K5HA 4HDOB 5DM1A 4ECEA 4IJUA 5KTSA 4N7BA 1GGHA 4YRCA 3UJ6A 4RVHA 4BO3A 2BFBA 2AR9A 1GRVA 2GYVA 5C4GB 3V2HA 1CNMA 3L6OO 3IP6A 1IYZA 4QM7A 1GTZA 2BBTA 3ENWA 2BTEA 3K71B 3IURA 1SUDA 3MMZA 3AF4A 1R0KA 3FBGA 4GNKA 4PZAA 3T3GA 4YYZA 1XD2B 4V02A 2HMAA 5KYGA 3WO0A 1RADA 1PT9A 1ZM9A 3COZA 1ZKMA 4UMDA 3H2KA 2VHEA 1ZNWA 3RYCB 1J70A 1L7AA 1YH3A 1ZZGA 2FUKA 3W5VA 4WFKA 1EUYA 2F2TA 2P6OA 4D9CA 2BFEB 5SZHB 1ISPA 2R6FA 3AHDA 3R7WB 4GAEA 3I2YX 4RIIA 1Y1PA 1KO1A 1YVPA 4D6PA 4D9EA 4XGNA 1E59A 2B1IA 1M6VB 1JX6A 1J25A 1MW9X 3K8QA 1I3OA 4RCVA 2OGZA 3ZY5A 3JQ8B 2XF8A 4GM4A 4CIBA 1QYVA 4KIGA 3I8OA 3KLPX 4TTRA 5K6AA 1FVXA 2UZIR 2QRHA 1GARA 2FX3A 3BS4A 3A9WA 1P77A 1E2FA 2VAMA 5JNTA 2A30A 1EVQA 1Y6JA 3KQUA 2NMVA 4I3GA 7ADHA 4ZCPA 3NPMA 2UXBB 4KQKA 3ACDA 4OXQA 1T0PA 3KQSA 5KWIA 2HF2A 2V4ZA 1CPYA 1IPFA 1LV8A 5E95A 2QHXA 1SKBA 3W5DA 1YRLA 1UC5B 1YUNA 3QLJA 3B6ZA 4C05A 1SOVA 1I4LD 2BAGA 1U2EA 3FOFC 1JEQB 3N74A 3O73A 4IDDA 4UE6A 4HDNA 4A6EA 1VCNA 4HNGA 2FPMA 2EV9A 4BEVA 1A8IA 5DHUA 2OECA 3N9IA 3MOIA 3SYMA 1W76A 2F8SA 1KSJA 2ZR7A 1II9A 4XEHA 5ALIA 2Q0HA 1KAOA 1T9HA 4EITA 4OI0A 6ADHA 1XZMA 2NGRA 4AKSA 3EG5A 3H3FA 3K0BA 4RVSA 4F9FA 1KAQA 2WD9A 1HYGA 1QG6A 2X5XA 3AB8A 1TT5B 3KQYA 3AMVA 3H7AA 3R4VA 4QBFA 4I4TB 3TE6A 1SKYB 4IWXA 4BMNA 1CJCA 2G7MC 4WKOA 4EKEA 3CJRA 2KJQA 5I01A 1NKVA 3IKVA 1KO5A 4PVCA 1NM5C 3I0MA 3UW1A 3L06A 3ZE8A 3EHEA 2ZPTX 4WXPA 4FINA 3PPXA 3CBQA 5ICSA 3ROMA 1M5UA 1N25A 5DTEA 3OIVA 5JVDF 2C7RA 1MABB 3OBIA 2HMWA 3WS7A 1W87A 1XTTA 2CVFA 1T5BA 3WQRA 4L5JA 4EG5A 2GJ9A 1JHMA 1P3DA 1N6LA 2WWHA 2YJ3A 1ULAA 2L82A 4HMPA 5EKSA 1XZQA 2GERA 4D9KA 5L6MB 2PMCA 3IQEA 1IUNA 2H2FA 3TQRA 1OC2A 4Q9DA 3REOA 2OA0A 3S5UA 1XZFA 1PAUA 3Q2IA 3TE7A 1L1RA 3U49A 4R3WA 4D0GA 4X1YA 4DANA 3ZJ5A 4NCIA 1MNQA 3DAYA 3EVAA 4EF5A 3X2EA 1JT2A 3PP8A 2DBVO 2FKNA 3HACA 3R6GA 3KB8A 3ZDZB 1BKDR 2FE1A 4QLAA 2NTNA 1T8SA 1YIAA 3T1HB 2XQVA 4QXOA 4LJ8A 1QR2A 1SXJD 4FK8A 3MYRA 5FA6A 3VTFA 5C9ZA 2FEWB 3IL2A 3LDGA 3RVLA 1RSZA 1ECFA 2GN0A 2XE6A 3EXFB 4AZSA 4AJJA 1H42A 2HMUA 1Z8FA 4ZVLA 3GGCA 4OXIA 1WOYA 3K70B 5EZYB 2XW6A 1GSHA 3JQPA 3ROKA 4AZ0A 5BOVA 3OQPA 2OP1A 1DQZA 1NJ6A 2WFAA 3HR8A 3NOVA 3IVAA 4HNAB 3DP7A 3NAQA 3S2GA 4TPKA 2OVBA 3HM2A 3GQBA 4HY3A 4IDQA 1L7PA 1NLYA 1CZOA 3MJEA 5LQKA 2GLUA 1PZGA 3NHZA 5JD6A 2OBNA 1XU4A 3FZQA 5JW6A 3OC6A 1KZGB 3IC5A 2JS7A 1R0XA 5AJVB 1YHZA 4X6YA 5DISB 4MRMA 4P3YA 3DF9A 1DAIA 3DHVA 1T1SA 2GHTA 1DU4A 4XJSA 4L4YA 1D8AA 1Y37A 1YB2A 2JCSA 2WNHA 4H3KB 4UAJA 4YJFB 3TQIA 3VJLA 4E5VA 1U28C 4UBNA 2WYVA 3SQOA 4E46A 5A6SB 4DEYA 3UFBA 1A5SB 2W37A 1SCJA 2VH5R 3OE5A 5FADA 2IYYA 3NZEA 2H07A 2JGMA 2MIIA 1BVRA 1UJCA 4I5GA 4NYMR 2HHAA 1V11B 5A6VA 1ZRNA 4AYWA 1YQWA 2SECE 1KK0A 1E9AA 2P62A 3EQZA 5CVUA 3AONB 2P9BA 2FW6A 4GSKA 1MD9A 3SHVA 1MBZA 2B7BA 2ZCJA 3FHLA 5GZ1A 4UFOA 1U2TA 4JLNA 4JBXA 3B89A 4LY9A 3SIPA 5LQRA 4S0XA 1UDBA 1KQGA 4JI5B 4BNMA 4DGSA 2D7DA 1GDHA 2ZJ0A 2EQ5A 3JVVA 3VHLB 5L53A 1RMTA 4ETWA 3BL6A 3OF5A 3P2KA 4C0LA 1ZUNB 3ZGLA 3UMYA 1IOZA 3ZIUA 3H11B 5DYNA 1ZH0A 2VATA 1LQ2A 2I9PA 2V7TA 2P9JA 3P19A 1YC5A 4Y2RA 4W7HA 1NBEA 5EQJB 2IX3A 2ZUWA 2VN8A 3A0UA 4TQUS 1EVYA 2XJ9A 4G0NA 3SCZA 4CKYA 2HB6A 4QXPA 2DETA 4PS1A 3AIMA 3HU3A 4OD0A 2ZFUA 1YIDA 1J1ZA 4RLQA 5K9ZA 3BIJA 1O1YA 1EGMB 2IUTA 5H9VA 1ADFA 2JD0A 4X41A 3RSOA 3LVBA 3GLIB 5L6LB 3BIWA 1N77A 2SCUA 1JSRA 3UC9A 1J8DA 1Y7PA 3ETLA 1YHNA 1EM8B 2QV0A 2XOEA 2X3UA 3A70A 3CCCA 2VJBA 3EEBA 1ZYUA 3GAMA 4LYJA 2QF7A 1MJFA 2HCBA 3IOYA 2QGNA 3Q2KA 4IZHA 3EW7A 3RYIA 2QSJA 3L6UA 4JY7A 4MO9A 3I64A 3WIEA 5JNUA 1JU4A 4NZPA 2DAPA 2VHUA 3W5AA 3BTVA 5EZSA 2ZBUA 3DHEA 1H8ED 5C53B 4KNYA 3IBFA 2WWFA 3E48A 5I4BA 2X7HA 3H5TA 1ZI9A 1RI3A 3MJDA 2I3DA 2VZ8A 4ESOA 2YZMA 3P9SA 4TUYF 5CVEA 1AQJA 3SD7A 1BGWA 2VHQA 3L1JA 2Q4DA 2AYXA 2TRSB 3BWXA 4OSOA 4EW3A 4FR0A 2IOFA 2PKYX 2CYBA 1ZOLA 2FRDA 2YOFA 2HWKA 2OD7A 3H8SA 4O2AF 4ZV9A 3RT9A 2IEBA 5B6IA 4WBNA 3VPAA 4DSTA 3M7IA 4TV8F 3DJYA 1NQUA 1QVRA 4HGYA 3MGKA 5EMHA 2PVPA 1U02A 2LRHA 1M1YA 2X77A 5D7BA 4RHXA 5IDXA 2QGZA 3OP1A 3VR2D 1XHFA 5KSWB 3DOUA 3IVRA 1RI5A 4Q4AA 1NDUA 1YB7A 1V9CA 2EIHA 2Q6LA 1XXHB 2XTMA 1E89A 3GI1A 3HYLA 4RESA 2RG1A 3LP8A 4X5OA 1XRNA 3TTTA 2F59A 1FFEA 3U5ZB 3P5SA 4Z0TA 4C0QC 3OLYA 4POAA 4PZYA 5KX5A 1RHRA 3GJZA 1M2OB 2NADA 2Q9UA 1U8XX 2PBFA 1TRKA 2NU9A 1M67A 3L7CA 4ARZA 3BN3A 3C7DB 4G5RA 3NM5A 4IO0A 3W7AA 1PSDA 5JDIA 3H8WA 3VI4B 4INAA 1TEXA 3QXHA 1I2CA 3O75A 5JAQA 4NPCA 5AVQA 4QOIA 2CFIA 2EX0A 3F8SA 1EA5A 2HDNB 4GWKA 2EFCB 4NK4A 5T3YA 2QTGA 1GRNA 2NNLD 4IXWA 1M0EA 3DDHA 4V1CB 4C9BA 4YMGA 2CHFA 1HTWA 1EP1B 4QEZA 3IRUA 2W11A 4D3FA 4NZNA 3UBTA 1QTIA 3PPYA 2WU3A 1QH1B 1SU7A 4L4SA 3V46A 4FCCA 3TZHA 1FDOA 1TTHA 2WMNB 2VDQB 4N76A 4ZQEA 1TM3E 5IYZA 1DFIA 3LUJA 5JARA 4UTRA 2EX4A 5CURA 1XLVA 1QM5A 1E5QA 3E2PA 4NVRA 3E61A 1L6IA 3S55A 3ZIDA 1NXTA 1PT7A 4DLZA 1QZUA 1P5JA 3C45A 4I66A 5JFOA 4D97A 3DBOB 4QAQA 3HC7A 2IV7A 1QCCA 2X76A 2I2WA 2OO5C 2VXYA 3R6TA 3TVTA 4OU5A 4Z3KA 1KI8A 4RK7A 2DPXA 2CD9A 4PINA 1MAUA 1YZFA 1YQEA 2UUBB 1YJAA 5A4FS 1XTQA 3O8NA 4RD1A 3DPUA 3EG9B 4I2VA 2VQ6A 2J41A 1CIVA 4FT2A 5JQGA 5F7ZA 2QYTA 3RH0A 1UADA 1U0FA 3T9BA 3I2FA 3TSYA 1TLFA 4DMUB 3HA7A 1VE6A 1Z7EA 4HJXA 4RA9A 3RC1A 4DLXA 4EHAA 5CFMA 1C9KA 4HLNA 3IEIA 4MA5A 1TOAA 4GZLA 1XB2A 6REQA 1U0EA 1APBA 3DUWA 2XE8A 2ZDHA 1RCFA 3C24A 2XUFA 4B2LA 2J3JA 4RJ2A 3F4KA 1LBIA 5SZKB 3SLKA 2RGXA 3O8BA 3LQYA 1KU0A 4L27A 4GPZA 1D0SA 2HIAA 5CNMA 2O6LA 3P9RA 5IC5A 3F3KA 4PIVA 3R6WA 1NVBA 4MICA 3OEHA 2DR2A 1NVVQ 3T7CA 3EZ6A 2GAFA 5TRTA 3PSAA 1ULBA 3ITEA 2WHPA 1AK1A 1OYYA 1QLHA 3Q7TA 5TS2A 1BJTA 4ERXA 4AS2A 5J2UA 1KARA 1B8NA 1QO9A 2E3JA 2XLBA 1WHSB 3FJYA 2PRIA 3PXUA 4FYPA 1O97D 1U7DA 2ZUSA 4IDHA 5BN4A 5LYJB 4O59O 5BP7A 2GJAA 2Z5LA 3KVOA 4CM3A 2JFFA 3VDRA 4EB3A 2D1RA 2YW9A 3ZTWA 3V8MA 5JAZA 3T5CA 1YKFA 3HYCA 4KYTA 3RVNA 1E9VA 2Y6VA 2ZTVA 2IYFA 4B40A 1TYCA 2MSLA 4LVCA 2AG6A 2PZBA 3SJ7A 3KZKA 2W2KB 5MFZA 2OKCA 1RRGA 3N2YA 3FAZA 3MF4A 4AURA 4KXNA 3I6QA 1DGQA 4GGMX 4YJ3F 2CMHA 3DKVA 4YRPA 3U37A 4GMGA 3ZU6A 3J80A 3D2AA 4XIFA 5IXSA 4MDYA 3AEZA 4MKRA 4MUBA 5DYGA 1AUOA 1LTQA 1CP2A 3ZCVA 1Q0HA 2UUOA 1JMVA 1P0MA 4ZIRA 1EXDA 3RVJA 3R7SA 1Z07A 1PJ3A 2V8OA 3FRIA 3L7KA 4QXMA 5BYJA 3LTNC 3OQJA 1JQ3A 3X44A 5F9HA 4D5EA 2VCHA 5AW1A 3FCOA 1QORA 4YHBA 4JR0A 1GKYA 3ZD9A 5JRJA 4NV1A 4CN8A 2EKBA 1QCZA 4RSRA 2J0QA 1WPRA 3AZPA 5BVGB 3V2IA 1OJLA 1NFRA 3N8NA 2YV1A 1KQFA 4LY6A 4G2TA 3PNLA 2IELA 4B17A 4O4IF 1XZ8A 1R6AA 5F5XA 1WUIS 1DADA 4MIKA 4TVOA 3WWCA 1P44A 1OAAA 4UNRA 4X7RA 2W4QA 5DGTA 1EB9A 1OY1A 2FSUA 1CUCA 2GASA 2Q3CA 3KPYA 1PL0A 2CXQA 1IN5A 1TB4A 5I45A 1WDMA 4IHAA 1ULHA 2PKXA 2X8JA 1Z0SA 3EXHB 3OHSX 3E22B 3SMQA 3SZRA 3A6ZA 4XIIA 2D5CA 3EGDB 3EOBI 2HLDA 1NW3A 2GPBA 2ZIXB 1ZRSA 3JD0A 4OLAA 4WXMA 2OXFA 1HNWB 4EGJA 2GZ2A 2FE4A 2JIZD 2AOWA 2PVSA 2XB6A 3ZNOA 2ZTLA 3BWYA 3WDSA 1S9HA 1BU8A 4Q7QA 1Z0FA 2Z83A 4D4IA 4ZGGA 3HA2A 4RFSA 3N2GA 1PEDA 3KZVA 3OWXA 2QTMA 2JFVA 4RV4A 4XYMA 3PBKA 1NGSA 3FZEA 5DDIP 3IIJA 3FTQA 1F2UA 2P91A 4JQCA 2V45A 4EYSA 4TMKA 2WIKA 1WB5A 2H1RA 2H9YA 1KDPA 2AEEA 4GPTA 2Q07A 1AK9A 2OFWA 2P2ZA 1JIUA 4E22A 3EN0A 4G1FA 1QUEA 1PJCA 1Q0UA 3MOSA 2V1XA 3SICE 4NE9A 4D9MA 3MT0A 1N5RA 1N34B 1TD9A 3BBPA 2DMRA 3AM3A 2D5BA 4JYMA 1O03A 4XD2A 5KHAA 3CQ9A 2Z6QA 2EGHA 3PEYA 1PK8A 1UBGA 2QY6A 2HA0A 2IWRA 4FB4A 4DQUA 5J4LA 1CK4A 2AXPA 4IM7A 3EIXA 3HN2A 1FTWA 1QIIA 1U1GA 2QMQA 3EAGA 2BZ0A 3BSFA 3I01M 3EEYA 1BVUA 3DVLA 1DXQA 1CQJB 4PYKA 5IM5A 5L3ZA 4EB6A 4QYSA 2NLOA 4B81A 5B64A 2WUDA 3F71A 1WXQA 4HXFB 3USES 5LJIA 3HCBA 4DDKA 1F8YA 4GI3A 3PTAA 4NXMB 1FFYA 1KRWA 1ND6A 2BM1A 1B8OA 1MAAA 2ZQYA 2EYUA 3QFSA 4NP6A 5KYWB 1B1AA 2AEMA 2B8NA 3AJRA 1YTUA 4J0CA 2AG0A 2QD2A 3G7SA 4F1JA 2IUEA 2JLQA 1NVXQ 4MA4A 2C3YA 2ORVA 4J1TC 1IXRC 1JXOA 2O20A 4L1KA 2DFDA 1NUHA 4KNVA 4M87A 3C16C 4PHGA 4WLOA 5CHYA 2IY9A 1U6JA 5EMJA 4Q03A 4DA9A 4FDMA 4HDMA 4PANA 4D45A 4NCHA 3KDSE 4FS8A 3A1NA 1BOFA 1L9XA 3R3SA 1JJFA 3W4JA 2J9ZB 1NIPA 1T2UA 3A6JA 5A7GA 4CLOB 5KIAA 2ODQA 4GGPA 4JQZA 2AC2A 3CF4A 3IIMA 1FRVA 3G85A 3AESB 2EF1A 4TMFA 5LKRA 1Y4UA 3M9LA 5AK4A 3LF2A 2C0CA 3U13A 3RRYA 1DAKA 3PWKA 4TVSA 4J2HA 4MX8A 3AKYA 5BMVF 1JNYA 4QOFA 2OZLB 3C3PA 3VBCA 3JQFA 1T9CA 2ZE5A 3DDWA 3BA6A 3NX4A 1Y6QA 4F21A 4YX9A 3RKRA 3ONEA 2ZWVA 4FHEA 3T9DA 5KYUB 4RXMA 3T9AA 1NW7A 1OBVA 1HURA 2R65A 3HGQA 3PVSA 4GR5A 1LPNA 4MWZA 5KOIA 1ZUIA 1XQXA 1TM7E 1B42A 2VHXA 3DWGA 2ZJ7A 2CLEB 4WXRA 4CNBA 3OJXA 2O3RA 1JIXA 2AJTA 3UHAA 5FBWB 2P0AA 4MVJA 1ZJWA 1YDFA 4TROA 5LOVA 1RQ2A 1SOUA 1N2EA 3HBJA 1C50A 2XEXA 1QE5A 1WDWB 3PK0A 3CX3A 3K4HA 1YZNA 1X74A 3N8KA 3QFTA 4GMXA 4Q5IA 1TZJA 4RSHA 2YS6A 3DFMA 3QVGA 4F3TA 3C6ZA 2GO7A 4XWKA 2H5JA 1QO7A 5EGNA 4A2PA 3LK7A 3QYAA 1ZMXA 1DJMA 1Z5ZA 1NXXA 5CVJA 2WTUA 2E5LB 3IEPA 1QLWA 1Y33E 2YV3A 3LFTA 3NJ4A 4AC9A 4YUWA 1GL9B 5CDSA 2IEZA 1MIHA 5E4YA 1LB1B 2WSIA 4ZOQI 3OQOA 1JKXA 1P1JA 4EABA 4MV7A 2C57A 1Z16A 2DCUA 3QY9A 4PSUA 1IHOA 3FPCA 2GAIA 3KNZA 1K66A 1NJ8A 4IDOA 4RD6A 2JDIA 2VF8A 3G6KA 4IYRA 2E85A 5IDQA 1PGJA 4JLUA 4E70A 1X9IA 1PWEA 1XEAA 4QTUB 1PQ4A 2PBZA 2V58A 1PZNA 3I45A 1EGQA 3PUKA 3WKEA 1KZ7B 3PA8A 3NH9A 4MVJM 4BO8A 5CNIA 2IFTA 4XI9A 1IG3A 2VP4A 3ZDEA 1I3LA 3DF7A 1FFAA 1NT2A 4LMAA 2I4LA 1ZMTA 5FEMA 5G41A 1KOLA 4B76A 1KFBB 4PXSA 2FSSA 5JDCA 2C5AA 1NWCA 1PQUA 1RD4A 2HRBA 1P0FA 1R18A 4ME6A 5D3QA 5E9QA 3U4HA 5BNIA 4FWIB 4MGEA 4E5PA 2WYHA 4PQYA 1SPXA 4J6EA 3AR8A 3KLBA 4QOSA 1S2GA 1M2VA 1MV5A 4RDIA 5CVVA 2IHBA 3SHOA 3LLSA 4XM1A 3SQNA 4E32A 3IUQA 4ZQIA 3UUWA 2FZLA 4EMUA 1MIOB 1G17A 1NI5A 1XLWA 1Q7BA 2VSFA 4ZPXA 5LNK1 1EFKA 3KEGA 2W42A 2EIXA 4JSYA 3L05A 1UMBA 4E11A 1KZ9A 3GAFA 5CCDA 3TNJA 2XLCA 4AY2A 2QMOA 1UPFA 3H1AA 1CTQA 1KEZA 2O8CB 4G8DA 4UEJA 3SYNA 2Q3HA 1BFUA 3GNQA 3B1KA 3ZU5A 4K6HA 1SKYE 1XTPA 2G76A 4HDRB 4KOEC 3QJGA 4C76A 4IV8A 4OATA 4EO4A 1X1BA 2WUGA 4MVJP 1QVWA 2W2LD 1JNXX 2VXOA 3L93A 4LJKA 1PUXA 3QE4A 4YIHA 2IYAA 1VOTA 3FM9A 5ARBA 2C7PA 4XB1A 4G0ZA 1L7BA 3F46A 3SVTA 5BXQC 1QHGA 5AVUA 2QSZA 3NNNA 1TVEA 1Y82A 3RYTC 3USZA 2G72A 1M10A 3IKLA 4G4GA 5DLEA 2ID9A 5EQDA 1SHLA 1KI6A 4RTOA 4Q3NA 3CZ5A 4TKVB 5C8YB 1CXZA 1DIGA 1OUMA 3KZCA 2HH9A 1OHHA 2HUNA 3N2ZB 3B6EA 1G8PA 3DZFA 4HBGA 3A4VA 3LYUA 4BFUA 1CIPA 1ZL0A 3FJOA 4AN4A 1IN1A 4EHJA 4N3NA 3CR7A 1UANA 2DWQA 2DT5A 4EJ0A 4YAOA 4XUEA 3AHGA 4ZI2A 3HNOA 5TVKA 3STTA 4N6NA 4OBBA 1RAGA 2ZOSA 2J07A 2ZZNA 1BU5A 4JU9A 2RKBA 1IE3A 3A10A 4DADA 2XD9A 1JH9A 1H65A 3DQPA 3Q12A 3ZDQA 1WW2A 4DWWA 3VR1A 4QEDA 4RMNA 5BOSA 4HB2A 3JASA 3NHYA 3OIDA 3EZNA 1SEVA 1Z5NA 2FSHA 3MC1A 3M5PA 5I48A 3R5KA 5L3SA 3H9BA 4RIEA 5BT8A 4PWYA 3EFOB 4Z1MA 3EPHA 3FAKA 3KB2A 1KBOA 2YWGA 4BEWA 2WB2A 4B3GA 1I2DA 2ZXFA 5EE5B 1CD5A 4A2CA 3HQ4O 5ABPA 2OXTA 3E1GA 3O4IA 3B6MA 2WIBA 2B61A 2N3ZA 2PGJA 2ZROA 2AXNA 3LA6A 4S1PA 2UYHA 2AN3A 1CY6A 1P72A 1Z8HA 1YZTA 3UCFA 5JRDS 1P5FA 1RPTA 1T9GS 1U3CA 4AD8A 3OPYA 4HATA 2ZRGA 1ES9A 3RD5A 1NTRA 3B5JA 3H18A 3E27A 4NCNA 3CZRA 5ALSA 4BNHA 3U2QA 4L8WB 1TZBA 4DCJA 1G0OA 1BNCA 1YJ8A 1EHIA 1MO3A 1O94A 2A5FA 3DE2X 5AOBA 4NOLA 5EIOA 3TUZC 4JLVA 5G0WA 3G49A 3AFMA 2REOA 4JWKA 2PUFA 2IOHA 1QTRA 2RGRA 5KYTA 4P81A 2WHEA 1FW6A 3NQ41 2VP9A 1L2TA 2A1UB 3PDHA 4K5QA 4G56A 4PPGA 5KCMA 3TZLA 1Z7WA 2QLNA 3NHLA 3U7JA 3A3NA 1RLJA 3W1WA 2C3MA 1A7AA 4QREA 3A6EA 4ZEWA 5KBYA 4G4JA 5I5EA 3SE7A 2GZ3A 3UB3A 3BMXA 1YI1A 4OGFA 3G89A 4LFAB 4MUMA 4HLUA 1DG3A 2SHKA 2X4IA 2Z4SA 1QCYA 1IOVA 4IP0A 5A3QA 1N0IA 4KDRA 3ZE0B 1VECA 4KXQA 2Z4RA 3SX0A 1AM4D 2B1QA 2VAVA 1EDEA 1PZMA 5DCYA 5FH9A 1E9CA 5K8VA 1HNZB 4OUDA 3KJEA 3TRDA 2QJOA 3DT9A 3HJBA 1GAWA 5ALFA 1J2YA 4DR7B 1J1UA 4PW0A 3S70A 1JIJA 4M4SA 4NKRA 2Q3MA 3DSRA 4DIKA 3BD9A 2NO5A 3LLCA 3T5AA 1L4KA 4LG1A 3B3FA 3SK0A 1MO4A 1FFXA 2WTNA 3ELYA 4IR7A 4MQFA 2I76A 4Q01A 4ZGBA 1JEAA 3BE5A 4Z3OA 5MGNA 3PFBA 4NCJA 3ZWAA 3V1UA 1PQYA 1CDEA 1YE3A 2YCLA 3CT4A 5C7IO 1RP7A 1QUFA 3PNYA 4UBMA 4C7JA 4JAVC 1DUIA 2ATXA 4FEAA 1WTCA 3ZDCA 1YZHA 3N5KA 3PR3A 4CM8B 2FXIA 4Q1EA 1SUIA 2DVMA 5BQ3A 3G2MA 2K87A 1HV8A 2WD8A 4L6AA 4LYEA 3PKIA 2BE7A 3IESA 1VJGA 3LVRE 5DLDA 3H83A 3TSWA 5BSGA 4RKFA 4RS3A 1T9KA 1D2NA 4HV4A 3TN7A 3NRBA 3R09A 1W46A 2FHSA 1CFJA 1HRDA 4UNPA 4AKEA 3QKSB 1W1WA 2X9GA 3AR6A 3BX1A 1ZGAA 1MB9A 2ZU0C 4FZRA 1NJ1A 2GDJA 2OQRA 1STOA 2MWMA 1ZQ1A 4QKQA 3IKTA 3C74A 2IGBA 1GUDA 2JGDB 1B8VA 2PN1A 1JFRA 1T2DA 1LSOA 1FUYB 1NKTA 3FOWA 3KJNA 4V0NA 3NT4A 1PK7A 1PR6A 3OWHA 3W77A 4YXWD 4UAUA 1C80A 2ZI9A 3EUEA 3D8NA 3VPGA 3KSDO 4TLMB 4ZJPA 2FZ5A 3RF7A 1CUZA 1Z5OA 4LGMA 2AA3A 4HQNA 1ONOA 4ICIA 1EXMA 2AJBA 4UATA 4YBRA 5EHIA 1K8YB 1WQ4A 3FCCA 4KBFA 3JQBC 2BFWA 2NUTA 2BSQA 3VH2A 3I4CA 2BHNA 2P4QA 1XEXA 4ABTA 1GILA 3CNOA 3GUUA 1XXHE 4REMA 3SKYA 4AZ3B 3KQHA 4B09A 3ODGA 2ON6A 2J8ZA 1UM8A 3HU1A 3L84A 1LZKA 2YVQA 3OZVA 2WJ6A 1UJ5A 2JI7A 4YLGA 4OQPA 5I9NA 3R9WA 2VHVA 4W1QA 4DMMA 4EPVA 3FMOB 4TL7A 1Q5PA 2A3NA 3DOCA 3QNUA 1GRQA 3NIBA 3HXTA 4FUQA 3CU5A 2O3UA 1QHIA 2AFHA 2F00A 2IXDA 3A31A 3FWNA 3J7AC 1LEHA 2XDAA 1UBCA 2G17A 3K1AA 3AHEA 2CNKA 3TK1A 4XAQA 6NULA 2P41A 2GEJA 3PDIB 4NBSA 2R84A 1MB3A 2YW2A 1Z7GA 1YONA 2CXUA 2F48A 3DE7X 3FCEA 1NPYA 3TNDA 1P6QA 1AQIA 1CZNA 1VSTA 2DOKA 4Q21A 1TU4A 4RA6A 1PG2A 5ULLA 4Y2SA 2GOYA 2QPOA 1GSOA 4RF5A 2FZCA 1R4ZA 1FFGA 3ZOZA 1RYBA 2H06A 4C7MA 3RRNA 2ZEJA 2MHCA 2PNJA 2XHEA 1RPNA 3DW1X 5JMTA 5EPUA 2JZCA 1QGZA 2NIPA 3IQZA 4AYXA 4V1CI 5EE3A 4LQCA 1KIFA 2FR8A 3H2ZA 5CX1B 3TI9A 4TSRA 3HCOA 1UZAA 3I2JA 3NWJA 4FSHA 3RUEA 2FKAA 1GZ3A 4A0HA 3E3NA 3IERA 1F8XA 2HWXA 1KYIA 2AW3A 1JLRA 2VUIB 3MUNA 1E3IA 1CQXA 3OCVA 4GD3Q 3V7UA 4MRSA 5HUJA 2MMGA 2QUKA 4NU6A 2C84A 1Z6XA 3CXUA 4YDHB 1CJSA 3FWPA 4YASA 3W2FA 3BMCB 3I28A 2VF4X 2WUVA 4H17A 5E6UA 3EIFA 5KTRA 5KNBA 1PFYA 1VE3A 2J4FA 1JXQA 2VQSA 4EUEA 4WOPA 3FZYA 4CCYA 3WADA 4BPRA 2WSBA 4Q9AA 1O96A 2AKYA 4BV3A 2IE8A 3V1LA 1RYMA 4WNIA 4LJ4A 1C2TA 2XUIA 4LGCA 5K1ZA 1QGUB 1EVZA 1Q83A 2QTTA 4OHOA 4WL0A 5M3BA 3V8VA 3KLOA 2QG9A 3LGXA 3N53A 5I4IA 4ON9A 3CY6A 2H00A 4RPIA 3QEMB 1GCUA 1HYHA 1I4WA 1ZCAA 1E3MA 3UG7A 2BLNA 3WISA 3D7MA 4JJGA 4IIBA 1U1EA 3TJMA 3KR1A 4OHKA 1LX7A 1O2DA 2HXSA 2XT0A 4UUMA 5K0NA 2VP3A 4EEKA 2ZIAA 2FN8A 2G25A 4L07A 4FKMA 1H2AS 2Y1KA 4P5DA 4Q82A 2PA0A 4Q7KA 2GD6A 1Y8RB 1L0BA 1GGEA 2C4NA 1N0VC 1S5PA 3LC7O 3O94A 3T1QA 2IZ5A 5A5GA 5KDOA 4X8HA 3V9PA 3VOTA 3TCKA 5ER6A 3WLNA 1P75A 3KKZA 4PGMA 1FSFA 2ZSEA 4JJZA 2C9DA 3QTLA 1U2SA 1W88A 1O5OA 4MPJA 3NP9A 2CUKA 2PUHA 13PKA 1H9CA 3VH4A 2PH7A 3K31A 1U1CA 3E2IA 4NFSA 4YPOA 2E2WA 1FDTA 1F17A 4O1MA 1Z4MA 2OLKA 4M8NE 4O29A 3V2UA 4C43A 4MJLA 5ICFA 1M75A 4PAMA 1OZ0A 4MKZA 3X2SA 2PXXA 4EJFA 5LWQA 4OFXA 1BG6A 2B8TA 3ND5A 4HAUA 4HN4B 4CL2A 3IVMA 1PVDA 1RRKA 4I0WB 1E1LA 1E4EB 3DBRA 2BHLA 1KJNA 2ZRIA 3OQHA 2JA1A 4KN5A 2EFJA 4V24A 5LQMA 3LBAA 1PNOA 3U16A 1ZQ9A 1D1QA 5LDHA 1UZUA 1RQLA 3F6SA 2VYND 3B9RA 4CCWA 1OYWA 1E3TA 1ZIOA 3OLWA 4KGDA 1EAYA 1SUCA 1R27A 1V96A 1DELA 4FMDF 3X43A 5EFOA 4WZAA 4D99A 4K1XA 3C1OA 3E70C 3SYKA 1OLSA 4DMKA 3R9XB 4M7OA 3V4ZA 3ZCXA 2ZR9A 3QPBA 4Q4HB 3FETA 4C4AA 3CWZA 3HH8A 4C7XA 4FM9A 1YS4A 2R8ZA 2ISCA 4GE3