1FTNA

Crystal structure of the human rhoa/gdp complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA (H12)
publication title Crystal structure of RhoA-GDP and its functional implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proto-oncogene
total genus 61
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1997-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftnA00
2YJTD 3A8TA 2EFGA 4M9XA 1TQ4A 4JJZA 1H8HA 1XPUA 2QP3A 1ZINA 1YR7A 5BXQC 4XVUA 4D4MA 1LNZA 2RGXA 3F5FA 4HDCA 4KVGA 5DLQC 3W90A 1VG1A 1MO3A 4YLGA 5J5CA 3UPUA 1P9NA 3TVDA 1NY5A 3Q5DA 4OJQA 1TX4B 2WBLC 4G5RA 3QXXA 3REFA 1LFDB 4A15A 1E9EA 1F60A 1DS6A 1KMHB 1ZC3A 1EX7A 3CX8A 1UADA 2FPLA 2BWJA 1Z06A 2IHBA 3A1TA 3TVTA 3GEHA 1P2UA 4Q4LA 1FX0A 2A5GA 5AJYA 3AF1A 2BBWA 4TYPA 4RD4A 1DAKA 4DDUA 3LX5A 1QHSA 4IVPA 4HUQA 2OILA 3AF4A 621PA 2J0UB 4TYNA 3K0AA 2OBMA 1KHTA 2FWRA 5C4GB 1OSNA 3AQ4A 2JLUA 2WJJA 1YZTA 1XTQA 4D25A 521PA 3K53A 4AYTA 4I1UA 1Z6GA 1XZQA 4YDSA 3EPKA 3K70B 4C7OB 2WWYA 2KI5A 3MJRA 5FUWA 2LKDA 2F3RA 4RFVA 3LBHA 4R71A 2FDCA 2X2EA 2ORVA 3QJYA 1II8B 1QZXA 4JL5A 2BVNA 2Z6VA 5FBRB 2JJ8A 2QPAA 5DHFA 3KXIA 4X8MA 3DM9B 4AG6A 4DZZA 4LBVA 2NPIA 1U90A 1DELA 1KSFX 1X8LA 2ZYVX 3ASZA 4IW3B 4M22A 4M9SA 3ZVMA 2ZSFA 1XD2A 3GJ6A 3PQCA 3FKSA 2WJGA 1J8YF 2ZROA 3IBYA 4Q4HA 2AFIE 5EE9A 1ZVQA 3IHWA 1GM5A 4TZ6A 3PITA 4EJSA 2GAAA 2IT1A 2P6UA 3SHWA 4NMMA 2ZYUX 3OIYA 2W83A 5KHOC 4ZDIA 1OXSC 1QHHB 4HDOB 2EQBA 3E1SA 2O0JA 3LVRE 5C18A 4C0AC 5TB5A 4ILEA 4HAWA 4UNNA 2CVHA 3EIEA 2ZRMA 3GMTA 4WBSA 2WSSD 1E96A 4MUBA 4ABYA 1XTKA 4P32A 1KO7A 2X1VA 3BOSA 1Q0UA 1E3MA 2F43B 1Z22A 4DXAA 4OI4A 3ZZTA 3CR8A 2QAGC 4M4SA 1E0AA 2DYKA 2VP9A 2WSSA 4KFRA 4IHQA 4I99A 2ZREA 3PXGA 3JVVA 1TNDA 2PZGA 3QPVA 2ODWA 1EXMA 2VSFA 4AY2A 1ZM7A 3AKEA 3SZRA 1E2GA 4ZO4A 1R0WA 2I1VB 4KLNA 3U7HB 4JIMA 4V0NA 1S3SA 2D2EA 1PZNA 4C0KA 2HYIC 5FI0B 3QKUA 3LLUA 2WOOA 2D7CA 1QHGA 2FZ4A 5DNYB 5AUNB 4R7ZA 3X2SA 3B7GA 4B6EA 4G5QA 1TF2A 2HUPA 4P4SA 5GJBA 3N2EA 1G3IA 3T1VA 2O8CA 3ZVNA 3GLHA 1FTSA 1HURA 3HDTA 4I1OA 2QBYA 1IN4A 3W8NA 4DLXA 2OLJA 3CZPA 3B9QA 2AXPA 5JI2E 4A8JA 4US1R 4MH0R 1Z0KA 3NH6A 1N25A 2WWWA 2ZRBA 3BBPA 4I81A 3K9LA 1CIPA 1TU3A 4Q7JB 3RYTC 2AD5A 5D3MB 1KIMA 1ZMXA 2ZITA 3KJEA 4BFTA 1KJYA 3AVTA 2BBOA 3TGPA 1N6OA 1M7HA 4XH9B 1R0ZA 1RJ9B 2C9CA 3W34A 5FOSA 1L8QA 1A2BA 1FZQA 1RW4A 3I73A 2ODEA 4A2PA 4RKFA 1AA9A 2EFEB 3IEVA 1E9SA 4GZLA 1NG1A 5FPSA 4ZKEA 3WYAA 4R2IA 4LHWA 1IOZA 5JS7A 3LQRA 3E70C 1F2UA 2VA8A 3NC0C 3B5JA 2DPXA 3AKYA 2C95A 3LX8A 4RD0A 2MMGA 4JL6A 1GKIA 3NBZC 5C2JB 3ONWA 2R6AA 4LSGA 2QL6A 2V1XA 1Q57A 5CYPA 1ZYUA 1GTVA 4Q1EA 3C8UA 5JS8A 4NH0A 1VPLA 4A6XA 1QVRA 4LJYA 3TAHA 3IBGA 3ZIAD 4C0LA 4LI0A 1E32A 3PV0A 4GMXA 2GEVA 3BWDD 1ZCAA 5TVKA 4QKQA 4PZLA 3WYGA 4Q00A 2R6GA 1N2CE 2JEOA 3GLIA 4JKYA 1WCV1 2GILA 4BUJA 3Q9LA 2I1QA 2W0MA 3KKNA 4PSKA 3IO5A 4A1FA 3U3OA 1GKUB 1S1CA 2QT0A 3CPJB 3KQNA 2FG5A 1CJVC 4Q9IA 5JJLA 1SKYB 3U60B 4D81A 4LBZA 3WNDA 1AZTA 3BAFA 3K0CC 3LXXA 3ZZ0A 3CX6A 2OEPA 3JZMA 4H9GA 3T1TA 3TSOA 4MDEA 4DIDA 1G7RA 3X1DA 2O8FB 2XJ4A 3A36A 3D3QA 3I8XA 1FNMA 3QOFA 5DH9A 1E1RD 2CMKA 4JBYA 1JPJA 2QTHA 2ZJOA 2W0SA 2GZDA 4CZ2A 2ORWA 3ZYCA 3U7GA 1NVUQ 4LHXA 4B2IA 3R9IA 4OL0A 3M0EA 3HJNA 4ASUD 3AM1A 4M1KA 1E1RA 2BBTA 3MWJA 4GMDA 4ACAA 3T5DA 2G83A 5FBQB 1LS6A 2ZI9A 4AK9A 4DSOA 1EFTA 4KFUA 1NNEA 3X1XA 4LK2A 1SZPA 3TJZA 5B2ZA 2A7QA 3WRYC 3EIHA 1VDZA 2G88A 2GEDA 2WZQA 3RHFA 2XTMA 4Q19A 5JWOA 2OZEA 4IDOA 1SVLA 1XMVA 3ZH9B 3A1WA 3TSZA 4M8NE 4IXMA 3GLHE 2ZSDA 4PPFA 1VKJA 4YXWD 1K8RA 3H2YA 2AWNA 1NBMD 1F48A 1GDDA 2IK8A 5KPDA 3D8BA 2J9RA 1YR9A 3V4FA 1SHKA 4UKDA 2WJIA 3OIVA 1N5KA 4MYUA 1XEXA 2KBFA 3TR0A 5HZKA 1ANKA 3P1JA 1GP2A 4KXFB 4FD2A 4YXWA 4N3NA 1G18A 2NMVA 1NBMA 2D74A 1IN6A 4A0RA 1Z29A 1NG9A 2ZAOA 5GJCA 1HUQA 1IXRC 4TT3D 3PEYA 5LB2A 3FFAA 1S9HA 1Z6XA 1J90A 4DIEA 2R9VA 1RRCA 3KKMA 3VFDA 3UIEA 2CJWA 4BZQA 4DSTA 4F93B 3EA0A 1N6PA 1G4AE 1RVDA 4Y0VA 2EYQA 4TT3A 5FOWA 2JLRA 2FU5C 2RB4A 3AP2A 2IYSA 2RGAA 4GFDA 5F2EA 1P61B 2ZRKA 3AVUA 2R44A 2V55B 4LYHA 5H8WA 3TW4A 4BZXA 1OIVA 3T61A 3UATA 3KDSE 1PJRA 4B71A 4IEEA 5L3QA 1JPNA 2FMXA 3BB3A 4LWZA 4DCUA 2FSGA 3NKVA 3AV0B 3VU9B 3IGFA 2IX3A 2JASA 4PHTA 4M1OA 2F3TA 4GI7A 4B3XA 3B6EA 5B30A 3TKLA 1OT3A 1YZLA 4AURA 3U5ZB 3I62A 4IVRA 5J47A 2WPDD 3R8FA 4Q18A 4JVNA 4WXPA 4DDTA 3K09A 5CM9C 1GL6A 2JLWA 4JT2A 4R98A 3THXA 1YR8A 3DO6A 3GLIE 1MKYA 1HH4A 1G6OA 3QKRB 1HQYE 1R2QA 1E2LA 1AGRA 3VNVA 2WPDA 1VECA 4YC7A 4DT1A 2RGGA 5FH9A 1JXMA 2GBLA 1QRAA 1JR3E 1FMJA 1V5WA 1SVKA 2A5DA 2IC5A 2IYYA 2W2TA 4IFEA 4D0LB 4DHEA 1P3JA 2YC4C 4OK3A 1XFAA 4Q03A 4A4DA 1M2OB 1RRGA 1U0LA 3UANA 4BEJA 3BERA 3WHKA 4Z54A 4MGZR 5GJWC 1EWRA 4TMZA 4TZ0A 2ONJA 1XP8A 4JYCA 4A0FA 1Z2CA 2N46A 5C4MA 1N3BA 1KI1A 4JSTA 1JR6A 3C4JA 3CBQA 4KSCA 4DLYA 3D6TB 3GQBA 2RAPA 3U44A 4M1YA 3ADKA 4NCHA 4CVNA 4CEIA 2EFHB 1HE8B 3HR8A 5G3ZA 2IS1A 4FMBB 2VO1A 1XPOA 1LVGA 2HDNB 2X77A 4LV6A 3A1VA 4FCTA 1G4UR 4QNRA 4QC2A 4KO8A 1TQ6A 5FOUA 4HUTA 3T34A 1UM8A 2YWEA 3HPQA 3VR1A 4Q47A 2RMKA 2QP4A 3U6KA 1EX6A 2WM9B 3LD9A 4EAQA 1WP9A 3IEUA 3KL4A 2GNOA 5JSZB 4CEJA 3ZQJA 1BO6A 4IDQA 4RFSB 2JLZA 3CW2A 1XCGB 2NTYC 2FEOA 4RD6A 5F3WB 3P4XA 1N6KA 3KJGA 1TQ2A 1XU4A 4TTQA 1I2MA 5LB4A 2CNWA 3PUVA 4QOSA 4U5XA 1E2NA 2Q9CA 3Q8XB 3B2EA 3NG1A 4PC1A 5TDHA 4B2PA 2AKAB 3CRW1 4B3CA 2ANBA 4GBMA 4F7WA 3MFYA 1XBTA 1NRJB 1MV5A 3PIRA 4KAXA 4F92B 2FZLA 1VCIA 4MQBA 3LWNA 5KSPA 1G16A 3R7WA 4L8GA 4EFLA 3EPHA 121PA 1P75A 4PX9A 4MKHA 1XXHA 4DCSA 5B57C 1N0UA 4TL9A 4C2TA 1CJUC 1Q44A 1US8B 2XZPA 3I4LA 3PG5A 4URYR 2BC9A 2OFXA 1KGDA 1GIAA 3LA6A 1X8JA 2FGKA 3MCAA 2BIFA 4II7A 3IUYA 5E3HA 3KQUA 2FF7A 2V3CC 1X3SA 5AJVB 2E9SA 1XD9A 1QHNA 4LJ5A 3QXJA 1KO4A 5FBWB 1JAIA 3TNFA 1ZD1A 1WE2A 3QKSA 3EXAA 1LS1A 3IPYA 4DSUA 2OV2A 4BGDA 3SQWA 3IKJA 1GKYA 3VHXA 4M1TA 4B6FA 4DSNA 3A4MA 5H1YA 1KY3A 3DPUA 1R8SA 2JJ2D 4JVMA 1ZNZA 4A0GA 2A2ZA 4BE7B 1KY2A 4GSYA 1J99A 2AN9A 2B7BA 1C4OA 1MABB 2D62A 2QMOA 4I1VA 2JATA 3WXMA 3QF4B 2GF9A 2HCBA 3CZQA 3RS3A 3TK1A 2RCNA 1KYIA 1Q22A 3CF2A 1J7KA 2JJ2A 3CM0A 3JZAA 4I4LA 1DPFA 4ZDKA 2PJRA 1FNNA 1SHZA 1G19A 1CR4A 1A1VA 1J70A 4B3DA 4TYYA 2ZI6A 2SHKA 2RH5A 1DO2A 3GCGA 4HAXA 2MSEB 3QVUA 4PTLA 4MRPA 4A0HA 2LCFA 3UMRA 3W6NA 3CH5A 4B3GA 3IHLA 3KTAB 3QPWA 3RNLA 1G17A 2CCGA 4GP6A 1Z3IX 3B13B 5LD2C 3TBKA 4RVCA 2HF8A 3T12A 3RS2A 3PEWA 2FFQA 2QT1A 3T1QA 2IYWA 1P60A 4EPXA 4URVR 4M1MA 1N6RA 2ODBA 3LV8A 1LB1B 5DYGA 1TADA 1OIXA 2RGCA 1ZD8A 4LYFA 4PAOA 3G5UA 1X6VA 2VTKA 4XIGS 2QP9X 3VR2A 1CXZA 1U94A 2C8VA 4Q4JB 4RZ2A 3QSYA 3M4YA 2NZ8A 2MSDB 4P4UA 1IN7A 3MD0A 3MRSA 2VP6A 2BM1A 2AR7A 4TMTA 5DSZA 1IONA 3WP1B 5DHAA 3F3YA 1KDOA 3KQKA 4K8OA 2ZYTX 4MA4A 3RS7A 5G3YA 5F98A 1YE8A 4X8LA 1P2TA 3R20A 1TMKA 5LD2B 4V0OA 4LHYA 2FSIA 3IIJA 4ON9A 1D2NA 1KMQA 2C96A 2VIIA 2ZE8A 4YQFA 4EFMA 4FMCF 3RABA 4YMUA 3I32A 3MLEA 2GXUA 4GL2A 2J46A 1SXJD 1W44A 5KTYA 1B0UA 3LH5A 1W36B 1EGAA 1SQ5A 2FFBA 5EP2A 4ERNA 4BECA 721PA 2R2AA 1II0A 2PX0A 3QEOA 4UNQA 2A9KA 2HYDA 1E9CA 2RGEA 5KU1A 3MWYW 2QGZA 1NJGA 4Q4AB 4KU4A 1JB1A 1YZQA 1YU9A 5IHPA 1SXJA 4WA7A 2Z5FA 1YKSA 2XTNA 1OXXK 1G8FA 3MMPA 1E98A 2OCBA 4KFSA 3QUSA 1TEXA 2H92A 3K70D 2FPKA 1P4SA 4KCGA 3L0IB 4PPNA 2WV9A 1NY6A 5DI3B 4KVAA 1ETUA 1Z0DA 1XXHE 2NO9A 5HKKD 1VCNA 1QG4A 4TWZA 2L0XA 2H16A 3UK6A 4DUGD 2WWIA 1N6LA 5DO9A 3R9XA 1P73A 3FMIA 1N5LA 3QVVA 4PC2A 4W7SA 4QHYA 3FOZA 5E7IA 5FTLA 4LJ8A 5HKKA 4MGYR 4S35A 1ZUHA 3HWSA 3AF2A 1I2DA 3BH7A 1Q1ZA 2YYZA 3HR7A 1G7CA 4YONB 4DUGA 2PH1A 4C0HA 2G9NA 1JXOA 3AVXA 2VHCA 1Q3TA 3SU8A 1Q3HA 2JJ1D 3OF5A 1ZNWA 4B73A 4HB2A 3N2IA 2CE7A 2GXQA 4QJ4A 4GDFA 3WRXC 4Q1BA 3QBVA 3VQTA 3AH8A 4PC6A 3VR6A 3IO3A 1OB2A 4FXPA 4CF7A 4UJ3A 4US2R 5KO2A 2JJ1A 4WIAA 2Q9BA 2NQ2C 4N1AA 3KJIA 1TU4A 1DG1G 3OIUA 1WA5A 1W46A 2OESA 5CM8B 4DDVA 3U4QA 1FUUA 4NYJQ 4IDPA 5EE5B 3A1SA 3AGPA 4AD8A 1D9ZA 4Q7LA 5B64A 1KK3A 3QF7A 5TXGA 1Q12A 4QGFA 2ZIAA 3ADBA 1OE0A 5FFMA 1AJEA 3GLFB 1KJZA 2GK6A 2F43A 1R0YA 4OK6A 2CE2X 3SN6A 3LVQE 4NCNA 4US0R 1C9KA 1W49A 1W5TA 3IQWA 4NPHA 4UXIA 5HCNA 2OCAA 4IOMA 1D9XA 2IYUA 2ZVPX 3PFIA 4CW7A 3K70C 3AVVA 1DVRA 1DAGA 1E2FA 5E7MA 4D0NA 1PUIA 2IYZA 1U0JA 2R6CA 2O8BA 4NP6A 2IS4A 2REBA 2IF2A 3N5CA 1G5RA 2J3EA 1P62B 2WJYA 4B43A 1AN0A 1GL7A 1MT0A 2J7KA 2OUKA 2QTVB 4OJKA 3C5HA 4OQNA 1JNYA 1Z08A 3VNUA 1A82A 1JEDA 4IKEA 4KJZA 4JLPA 3P4YA 1XJQA 2CVFA 4BPBA 4M0LA 1VG8A 4JZKA 3J81k 2IXFA 1JJ7A 2A5FA 1E2HA 4Q66C 1E9FA 4XD7D 4TLBA 4QXAA 5FOVA 1G7TA 1QBKC 3H4MA 4EQ6A 4RKEA 1UFQA 4ZDWA 4ZCLA 4A6PA 2QAGA 5A5GA 3QNUA 4G5GA 3PEUA 1E2KA 1NLYA 3CIOA 4CDGA 4DDWA 5JCZA 4XD7A 3A4LA 2G3YA 5FUYA 4TMWA 5EXSA 3FPAA 1W7AA 3F8TA 5K8IA 3QPUA 3TH5A 1JEEA 5FPKA 3O8RA 5BW8A 1DAEA 2X8AA 1I4DD 1SXJE 2CHQA 3KFXA 4OI1A 3IILA 3TIFA 5A4JA 1G1MA 2QROA 4TMVA 2J45A 5JEDA 1IY0A 1KO1A 3THWA 2OXRA 4GP7A 5ELXA 3S1AA 1W2HA 1E0JA 2DFTA 4BZPA 4TLDA 1CR0A 1VYUA 1AQUA 1EG7A 3FMOB 2P6RA 3ZQ6A 5UKDA 5J4HA 5EXXA 1U8ZA 1M6NA 3X1YA 4B75A 4HLQB 5TV2A 4UQOA 3THOA 1CULC 1TPZA 2PCLA 2WWFA 3AVOA 3ZVRA 4XWAA 1W4AA 1QHIA 2ZI3A 5CIQA 4BWYA 1VG0B 5BQ5A 2PEZA 4Q21A 3AVPA 4AYWA 1AZSC 1ZU4A 1H8ED 1Z0IA 4G5SA 4IOJA 1VHTA 3SJZA 1NI3A 3OAAD 4C0JA 4UNRA 4DC9A 2IWHA 2E1RA 3CNNA 3I61A 4G1UC 4TTRA 2EWVA 1KI9A 1XCMA 1R8QA 4FMCB 3RSOA 1W4CA 4H1VA 2EW1A 1C1YA 1SVIA 2ERXA 3KB2A 3M6AA 2QQEA 3OAAA 2IUUA 2CXXA 4PC7A 4IXNA 4O2LA 5SZIA 1W4RA 1Z6YA 3BIFA 2O0HA 3BS4A 1XRJA 4URWR 3ZDQA 5KSOA 3T15A 2GJKA 4F4CA 2KB0A 5D3QA 4OQXA 4OHZA 4B34A 1I4TD 5F9FA 4PQRA 1D2EA 4HDQB 5HCIA 5DISB 2IW3A 4LJ4A 2B6HA 2NO1A 3L82B 1OH5A 4XSHA 2O8FA 4CIDA 5JFGA 3GD7A 1KI6B 3QKTA 2XNDD 1NLZA 1GAJA 3I72A 1X86B 2H18A 1AS2A 3KKQA 1RRFA 2UVQA 4ESHA 1LF5A 2P5TB 2QM8A 3QXSA 4OBEA 5EE1A 2Q0HA 3LXRA 3CWQA 2XNDA 1PLLA 2BKUA 4Q9LA 4Q9HA 1HT1E 4HAUA 4ZIRA 3NVAA 1HE1C 1UBEA 1MRNA 2WHXA 3U3KA 3W9YA 1UDWA 2YOGA 2GCPA 1KI4A 3NDBB 1E9AA 1E2QA 1TL7C 5CDFA 1FX0B 3O8CA 2BV3A 2CLSA 3TUIC 3KB1A 1CEEA 4HSEA 3K0CA 4P4TA 4HUQB 2BDTA 2FEMA 3K0AB 2KSQA 2ZRFA 2PMDA 1G64A 2EFCB 3EIQA 4FW9A 2IWRA 2KWIA 3FMPB 5C1BA 1VYVA 5JEEA 3SJCA 1L7VC 4D82A 3ND9A 2OLKA 3I8SA 1UBGA 3NIBA 2H1LA 1NSTA 4JKIA 5IRCD 1LF0A 4F38A 2P0EA 3CPHA 5CLQA 1F3OA 2I4IA 2QPTA 2GA8A 5DE3A 3PENA 1ZNYA 4BLQA 2QSZA 4LDJA 2VP5A 4U00A 3A1UA 1N0WA 3UG6A 4V0LA 5F9HA 1XMIA 2DB3A 2ZJAA 4HLUC 5JHHB 3T35A 2BM0A 1XD2B 2RHMA 2DHRA 2WWXA 2ZS8A 1XTRA 2OSBA 3LNCA 1ZW6A 2EFDB 2D2FA 4Q4HB 2XXAA 3AVYA 4EJSB 1IBRA 3EZ7A 2C5LA 4ZCIA 3SJBA 3ZIAA 2J59A 2NGRA 2QENA 4JYBA 4QBHA 1Z2AA 5L3SA 3AF0A 3FHOA 3PUXA 3AEZA 2HT1A 2A3RA 1WQ1R 4Z1MD 3TSWA 1N6NA 2IEZA 4Q48A 2VLIA 3E2IA 3KZ1E 4RD3A 2ZTSA 1BOFA 5C46F 2B92A 4D2IA 1S9DA 3BFVA 1DO0A 1KI2A 2QRZA 5TY0A 4N0EA 4JVLA 4Z1MA 2Z4SA 3EC1A 5H70A 4U7DA 3W8RA 1CRQA 2VHJA 1YZNA 4JL8A 2R65A 4RCYA 4B3BA 5JECA 2QZ4A 1VHLA 1P9RA 3FGNA 3AGQA 1OXUA 2JA1A 2JLQA 1QF9A 5AJWA 5LBIA 2MSCB 3GEEA 2ZJBA 2V7QD 4URUR 1NKTA 3EA5A 3U2QA 5AUOB 2OBLA 1RRPA 1KI8A 2ZUDA 2X19A 4XVRA 3TW8B 1OH7A 4OHVA 1ZM4A 3GJ4A 4M9ZA 4LPSA 2ZJYA 3CB4A 3A58B 2NO0A 4JLMA 4JMPA 4NYMR 1E4YA 4ASUA 3H0KA 2Z43A 2V7QA 4P4SB 4FWTA 4L16A 1X1RA 3G82C 1KNQA 4D0GA 4HATA 3L2OB 5FTMA 3GLHB 1KKLA 1UBCA 3SFVA 4L15A 4L5BA 2QBYB 2JAQA 1E2IA 4OI0A 4V03A 1H65A 2DWOA 3GJXC 2G6BA 5EE0A 3UWOA 4ACBA 1CLUA 1MO6A 2ZRGA 3LDAA 4MKFA 4JLVA 2C9YA 3CNOA 5FOTA 4NYMQ 3VR3A 1MH1A 3CRQA 3LBIA 3U61B 1PV4A 1GNQA 3KQLA 2Z83A 1P7CA 2ZS7A 3ICQB 3CPEA 3MJHA 3WMFA 2XOKD 4PAMA 4A82A 5LDDC 2O8EA 1HQCA 1UDXA 3Q5EA 2CLCX 1XTJA 5CDFE 2YOFA 2YWFA 4P3YA 3KUDA 1MR3F 1UKVY 5EUQB 1ZRHA 2BJVA 2C9OA 4RFSA 5EXTA 1OLOA 4TYQA 2XOKA 1ZD9A 1VIYA 3NWJA 3I92A 4LZZA 1N5IA 1TQDA 3Q7PA 4Z8XA 4HB0A 1Z6AA 3FFBA 3B1YA 1F2UB 4DLSA 5DN6D 1W0KD 2VHQA 4NCIA 3VR4A 2AD1A 3L43A 3SC3A 4DRZA 1NIJA 2UKDA 1CJKC 1E0KA 4GPTA 2HXSA 3PUYA 1FOEB 2RGBA 2QE7D 3HU1A 4LY6A 2Y8EA 5L8VA 4OHYA 2FNAA 4JLKA 3N70A 5DN6A 1NP6A 1F2TA 1W0KA 4HI0E 4ITRC 3SQXA 2HV8A 1SVMA 3K0FA 4AKHA 2JCSA 4QBFA 4TL6A 2F1RA 3T5GA 3REGA 1Q21A 3C41J 2B8WA 3SYNA 3UWKA 2QE7A 2EYUA 4YMWA 3FYHA 3AKDA 5KSYA 3GPLA 2H8KA 4EPTA 3W5JA 4CRWB 2PLFA 4TQAA 2WJHA 1Z0FA 3CRRA 1UEIA 1XCPA 5EZ5A 3AVQA 3GLIB 3B82A 2LWIA 2VL7A 4BEBA 5CB6A 4DBLC 3DMNA 1IN8A 5FPHA 1I4LD 1FQKA 3VKWA 3EZ9A 5FPTA 1NMXA 2Q3HA 4HZIA 4AKIA 5EQTA 5GVRA 4M53A 4MITA 1ELOA 1NF3A 5ANRB 1AS3A 2FFAA 3VMFA 1KK0A 4DWJA 4O25A 1MABA 1N6HA 1T6NA 4LCBA 1GSIA 3QF4A 3OEED 4IRUB 4Q9JA 3B8HA 4NL4H 4Q1FA 2FPMA 2A30A 2DWQA 2XAUA 1R5BA 3BORA 1KSJA 1AKEA 1E79D 3WMGA 3RC8A 1YR6A 1E2PA 1II9A 5GADl 2GJAA 3NBYC 5DIFA 1TEVA 4NTZA 4C0BA 1WF3A 1QVAA 1E79A 3C5CA 1OXVA 2XSZD 3KTAA 4LYJA 5EP1A 4BFYA 2ANCA 3V4RA 2PEYA 4LX0A 4R2HA 3RDPA 3BB1A 2ZRJA 3BE4A 1Z0AA 2QEQA 4JVSB 4O2RA 3WP0A 2ECKA 1XEFA 2D4HA 1VCMA 1F5NA 2JDID 2YHSA 3ETLA 4B2LA 1YJ5A 3FWYA 4ZV4A 2XSZA 4PXAA 3THYA 1OW3B 4TQUS 3GLGA 3SJAA 2ZR0A 1TAGA 3D31A 1W0JD 5FTNA 2QAJA 4UNPA 2JDIA 2J0QA 4LPKA 1LV7A 2CL0X 3DVLA 1T3SA 1M34E 3EWSA 1VYTA 3LBNA 4RCZA 1KI7A 2GCOA 3UG7A 5JBQA 3EASA 1W0JA 4XWKA 4OHXA 3ADDA 3VX4A 4OQMA 1PLKA 4WAUA 1E2MA 3EX7C 4HAYA 5EXPA 1D6JA 2QSYA 1NBME 1CRPA 2WAXA 2AHOA 1IJEA 2O0KA 2ATVA 1MO4A 1P5ZB 5JWRA 3KXKA 3U3MA 3D7MA 2CJWB 3U3JA 1O87A 5IT5A 1FP6A 3VHLB 1RC8A 2VP0A 4WZAE 4HAVA 3OE7D 4JJKA 1ONBA 4DCTA 3PUZA 4C0SA 2PZFA 4XTRA 5L3QB 4RY2A 3WHLA 2ZE5A 1CP2A 3A37A 4QJ3A 3CX7A 1FFHA 1SULA 3HPRA 2OE2A 2QORA 1GZSA 1RZ3A 3OE7A 1NVVR 3EPLA 2Q6TA 4C2UA 3FHTA 2ZVQX 2UZ3A 4QFMA 2BCGY 4F4IA 3B9PA 3ADCA 4K81B 4MDFA 4HEJA 4A2WA 2QA5A 3O47A 2GJSA 3MGCA 5DI3A 2RHDA 4E09A 2PT5A 4WOPA 2GCNA 4URXR 1S1MA 4NE2A 2W2VA 1FTNA 2DWPA 2GF0A 3EZ6A 3ECCA 3THXB 3JVUA 1Z47A 1NVVQ 2OT3B 2W58A 4AG5A 1W2GA 4DLWA 1R10A 1OHHD 5KOYA 3QG5A 4DT1B 4E22A 2WMOB 4C30A 2G77B 4GOXA 1YZGA 3OEHD 3OESA 4PQYA 4DEYA 1GITA 2ERYA 2N1BA 1LY1A 4D4LA 1UAAA 1E2DA 3EPJA 3Q3JB 1RPZA 2IYTA 2CDNA 2PLRA 2XB4A 2YZ2A 1M8PA 1T5LA 3EZ2A 3DZDA 3OEHA 2ZAMA 1W36C 1NIPA 4BRWA 4DJTA 3CNLA 2O5VA 2IHYA 5CB8A 1L4UA 221PA 4LC0A 3U44B 4Q1CA 4QHSA 4CEIB 5FPYA 2ZJ2A 5DI9A 5JJKA 3FE2A 2F1IA 2FE4A 2IYXA 1UKYA 1AM4D 3GJ8A 2OAQ1 3VAAA 1RKBA 1UKEA 4HZUA 1X1SA 5SZJA 1OIWA 2W6JD 4P31A 5AK0A 2GVZC 2IL1A 2XTZA 1G291 1T3HA 4NCJA 1OPXA 1WBBA 6Q21A 3V00A 4FWIB 2ZEJA 1E9RA 4RD2A 4K46A 4AKEA 2FFHA 3WBKA 4L9SA 2W6JA 4DB2A 2CCJA 4DLUA 4I1SA 5HE9A 1GUAA 4LJAA 3GLGE 2DCUA 4BRUA 4KSBA 1DAMA 5J4KA 2CL7X 1OKKD 1Q1EA 4NBSA 2VH5R 3FKQA 4BFXA 1G3QA 4C0QC 4DVGA 2ZYWX 5CLLA 2FSHA 1XEWY 5BN5A 2OCYC 2C77A 2J0VA 2QMEA 1OKKA 2FSFA 1IJFA 1JALA 1GVNB 2CHVA 3CWZA 2QU8A 5G41A 4IEIA 4BASA 1KMHA 1R4AA 1ZNXA 1N6IA 2V6JA 4Q1DA 3R7WB 1OYYA 1KAOA 1KO8A 2HJVA 1S4QA 3DHWC 4KYIB 4MYHA 3ZD6A 4QL3A 1XXHB 5AJXA 1T91A 3BJIC 3C16C 5G40A 821PA 2YV5A 2J0UA 3GJ5A 5E4FA 3UXMA 4QBGB 3KX2A 5FL7D 2GDJA 2RKOA 1CJMA 3BH6A 3T1OA 1R5OA 3KUCA 5KSZA 3CH4B 1XD8A 2DR3A 4JLAA 4DEXA 1ZM9A 2W00A 3PCRB 4C7OA 2YNMA 4ARZB 2G1KA 4DCNA 5BN3A 5H68A 1DBSA 4AC9A 3BFKA 5FL7A 3SBEA 3EC2A 1G8GA 1NMYA 3FTQA 4U02A 2JLYA 2JIZD 1II8A 1GG2A 3X1WA 3RANA 2YOHA 3VTKA 4EFNA 3WY9A 2F7SA 3SEAA 4M2LA 1FMLA 1NN3A 3BRWD 2J7PD 2XJ9A 1M74A 4OKSA 3B85A 4UJ5A 4FINA 3SYKA 1GOTA 1DEKA 3L8YA 2JIZA 4LV8B 2RGNC 4YDHB 2REXB 1T9HA 4MUAA 4PSAA 2HF9A 2J7PA 3QE0A 1RYFA 2GJ8A 1KZ7B 5AJZA 1QHXA 1AIPA 3GFOA 3DDCA 5G53C 2XITA 1U99A 3Q85A 3QG1A 4LOAA 4NZYA 4UXHA 2GZHA 1DE0A 2AX4A 1OYWA 4MYCA 1GNPA 1SVSA 5GJVC 5JJIA 3R9WA 2O8DB 2ZUBA 1QHHA 1FW6A 1GWNA 4PC3A 1OFIA 1RE0A 4FN5A 3C15C 4KI0A 1YQTA 1ZJ6A 4PZZA 2V54A 5FR2A 1KSHA 2C03A 4OQFA 1T0HB 1W1WA 2XB2A 1DAIA 2E87A 1TF7A 1A2KC 2V9PA 2V1UA 1W47A 3B78A 4IOKA 3B1XA 2QUZA 2C98A 1T5IA 2GZAA 3OFND 2JLVA 3I5YA 1JJVA 1KDRA 2JGNA 1NJFA 2GVDC 5AUPB 4IOLA 1B23P 2G1JA 3BXZA 4WW0A 2ZANA 4TYWA 2EVWX 3K0EA 1NL3A 4V0KA 3OFNA 3V9PA 4DCVA 2GAOA 4FCWA 5LPNA 3MWLA 4W5HA 3VKGA 2MMCA 5CJPA 2IA5A 1ZIOA 3C7KA 2OCPA 5CYOA 1RIFA 2YVUA 2BEJA 2YINC 2Q9AA 2GRJA 4AI6A 1KDTA 4TQ9A 4IFBA 3L8ZA 2B8TA 1U81A 5IK2D 4GNKA 4MRVA 3IQXA 4ESVA 2ZRNA 5FUXA 3KKOA 5BYKA 2R6FA 3BFXA 4XJXA 2WAYA 1S3GA 1QHYA 2ZI5A 1HTWA 2ZQ5A 4WZBE 3FMFA 2AXNA 1M7BA 5IK2A 3DEFA 5JWHA 1KNXA 2QNRA 4TMXA 2WJVA 1WXQA 4WXRA 1SXJB 3DZ8A 4QGHA 5D3MA 2VP4A 3P26A 5AR1A 4QM7A 2BCJQ 5J40A 4KBFA 1ZIPA 4JBWA 2A5YB 1KK1A 1RJ9A 2R6DA 2P6NA 3DOFA 3IIKA 3W6OA 2WVJA 1G6HA 1CTQA 3W3AA 1JECA 3PUWA 1Z5ZA 2NG1A 3U6BA 2F6RA 4LJ7A 3FDIA 1YRBA 2CL6X 3G0HA 2OAP1 2ZETA 3CRMA 1GRQA 3FB4A 2AK3A 4PPGA 4B35A 4D26A 3IIMA 5EP4A 1KSGA 2J5XA 1HY3A 4Q7KA 5FI1B 4MRSA 4O3MA 2Q21A 1XNJA 1XZPA 2Z4RA 3FKSD 4JBXA 4BFVA 4FIDA 4ZKDA 4DLTA 2X2FA 2IXGA 2P65A 1E0SA 2PL3A 3AF3A 1P6XA 3P20A 2QN6A 4TN1A 3VKHA 1E2EA 1L4YA 2IS2A 4HB3A 1IXZA 1XDBA 4HYYA 4M1SA 1GRNA 5E95A 2HLDD 4YMSA 2ORIA 4JT4A 2VEDA 1ZU5A 5EZ6B 4OYHA 3OHMA 1FQJA 1H8EA 4NCKA 3BK7A 1ZM3A 2CLDX 1G21E 1DOAA 1TF5A 2VYFA 3Q7QA 1FL9A 3U4QB 2P5SA 1O3YA 2HT6A 1S2MA 2HLDA 2J41A 2BJWA 1Z0JA 3ND8A 2J0SA 4S2EA 5TMPA 1EWQA 1FP7A 1NVXQ 2Q3FA 1CU1A 3DMDA 3K9HA 4M21A 2F9MA 4B74A 1AQYA 3SYLA 2B21A 2BKEA 5P21A 4CYMA 4PSVA 5J4VA 1IM2A 1Y63A 4NHOA 4TSFD 3DOEA 2GETA 1IXSB 1BIFA 1R5NA 2IYRA 4CEHB 2EWWA 1SKQA 2P67A 1UF9A 1OFTA 1P9WA 3BGWA 5HZHA 3GJ0A 2OG2A 3K9NA 4HLUA 4LGMA 4TSFA 2O8BB 4ZDJA 3GJ7A 3KKPA 5HPYB 3GFPA 4Q1AA 1KK2A 1UKZA 2P2LA 3W6PA 3LW7A 3LW8A 3LRPA 2DFNA 3B1ZA 1Y3AA 2AL7A 1U8AA 2ZU6A 4W5JA 2B7CA 1IN5A 2ZRHA 4G0NA 4PO8A 4NKRA 2KJQA 3T06B 2ZPTX 2R62A 4EJSC 4RJLA 2G0TA 3AKCA 2AFHE 1P2SA 2ZR9A 2H17A 3CUEF 1GFIA 4EQ6B 3EG5A 4MRNA 2ZUCA 2ASEA 1V43A 2IBMA 2DY1A 2QAGB 4JLBA 5HE8A 4KLZA 2GXAA 1NLFA 1XTSA 2VQSA 1BMFD 1DARA 4MKIA 5E7JA 3TR5A 5KYKA 1KKMA 2TMKA 4ZPXA 5KUTA 3ZS8A 4E07A 2WMNB 2C2HA 4IDNA 3UMSA 3ASYA 3ZZUA 5BN4A 1BMFA 1RYHA 4ZI3A 3THWB 2FX3A 2N42A 2PX3A 3L0OA 4WVFA 2IUSA 3S1AB 4LC1A 4DKXA 2BMJA 1E2JA 2WTUA 5A0FA 2GXSA 3KFVA 4O0MA 1JQLB 2OHFA 4JSYA 4GRAA 1VMAA 4RZUA 4BFUA 1OH6A 4EUNA 2H57A 3CRVA 3HYTA 3CLVA 1M1YE 1NMZA 5BWMA 2ZE6A 3MSXA 1L2TA 2VF7A 2HJGA 4XTCS 4L4UA 2WKRA 3SE0A 3BD9A 5K8LA 2FA9A 2YKGA 3VU9A 3P27A 3CONA 2F1JA 2J87A 3BC1A 4BQSA 2HCJB 4B3FX 1NVWQ 3K8YA 5M04A 4AWXA 2J1LA 4Y0AA 5JMTA 5K8TA 3WNCA 3ZGXA 2D06A 1TUIA 4A8JC 3DKVA 1JR3D 4LJ9A 1SVWA 1OV4A 3TLXA 5KDDA 2VSXA 3NEJA 4NYIR 2CEAA 2NOAA 4GT1A 4URZR 2IUTA 3HP1A 2ZRCA 4D80A 4QM6A 1CF4A 1JR3A 3QKRA 1E9BA 4EPVA 3PEVA 1ZM2A 8OHMA 1R7RA 4B32A 4E03A 1LW7A 1SKYE 3RRYA 2G0NA 3TE6A 3W5IA 2AWOA 1CKEA 4FCVA 2AK2A 2H5EA 2PMKA 3AP1A 3RLFA 2ZRPA 1JAHA 5HTKA 4Q02A 3HYRA 1WMSA 4NYIQ 4RZXA 2WICA 4HB4A 3TRFA 1AK2A 2RGDA 2O8CB 2ZI7A 3B1VA 2VSOA 1D2MA 2ZU0C 1ZC4A 2OO7A 4A8JB 4PR0A 2QM7A 4G3XA 3RAPR 3X1ZA 4XVQA 2C99A 1GNRA 4AYXA 4BLSA 4JLJA 4DLRA 1E4VA 4ZIRB 1G3UA 4GZMA 4TMKA 1U0HC 4PHFA 4X8HA 3RS4A 4A9AA 2IYVA 4M9QA 1G5PA 4FMDF 2GTPA 2Z0MA 3FVQA 3RC3A 1E6CA 2QMUA 3RSLA 3KJHA 5SZHB 5JSZA 4JLOA 1CBUA 3BH0A 3B60A 4BFWA 4LYAA 1G41A 4D6PA 1XJ0A 2WKQA 3TAUA 4EPYA 2ZSAA 1K5GA 3ZLJA 3UMFA 2IS6A 4TL8A 5FL3A 4XWOA 1T0JB 1Z07A 2AKYA 3B1WA 4IVQA 2C04A 3SBDA 3ZVLA 1D5CA 3QBTA 1Z63A 1EESA 4B47A 1S0UA 2CK3D 4TLEA 1E99A 2ODNA 1UBFA 3CF6R 3PVSA 4MGIR 1DTSA 2IYQA 4KHZA 4GOKA 5J4YA 2IYLD 1NN1A 2VRWA 2CK3A 4FI3C 5JHGB 1OFHA 1EFHA 1XB2A 1US8A 3QXHA 2BMFA 3RRMA 4LBWA 2XXAB 3TQFA 2O52A 2QQ0A 2QRNA 2IEYA 3U7FB 2UZIR 4V0MA 2QG6A 3BB4A 1KDPA 4E5UA 5L3SB 1N0VC 1MO5A 1YHNA 1ZBDA 2QY9A 2QMHA 2HXYA 1P72A 1E1QD 4Q5IA 1J2JA 2BHRA 3WYFA 1KOFA 3CO5A 3IDQA 5L3VA 2ATXA 2NO7A 1CR1A 1XWIA 3SOPA 1FPMA 4QGAA 4POAA 5BYJA 4HLDA 1DADA 1FUKA 1E1QA 4KBGA 1G7SA 2OFOA 4ZI2A 1BS1A 5CITA 3EAQA 4TLAA 4BLPA 1IQPA 1TUEA 2FJUA 4QNMA 1XMJA 2ZS9A 3CF0A 3FHCB 4G01B 4ZCMA 4R9UC 4OQLA 5KNBA 3OEEA 4CT5A 1XTIA 1MRSA 1G8PA 4PO1A 3I3SR 3CR7A 1W4BA 4HAZA 2FV8A 2F55A 2XZLA 1OJLA 3PR1A 4BLOA 1Q20A 2NZJA 2YWHA 2VHUA 2ZRIA 1JI0A 1PLJA 3NBFA 4HLCA 4JLDA 4YMVA 3ICEA 2IXEA 1EFCA 1G8HA 1AS0A 3DM5A 4IDHA 3TQCA 1WBDA 3A6PC 1PVOA 5FR1A 3M1IA 1NN5A 4RZ3A 1A4RA 4PHHA 1YZKA 2PJZA 3AVWA 4AIIA 1ZUIA 5AUQA 3RS5A 3LFUA 3QI2A 3P32A 3ZJYA 2F9LA 3MG9A 4QBIA 5EUMA 5JLJA 3ZD7A 1UEJA 4DLZA 3WBJA 1G3MA 1X8KA 1UPTA 5IF9A 1KAGA 2BEKA 5KDOA 4C9BA 1JBKA 5AWFC 1KI3A 2QPOA 3SS8A 2FOLA 2XGJA 1YZUA 3H84A 2OM2A 4Q4JA 1EFRD 3TMKA 1XEXB 1TTTA 2ZR7A 1GRRA 2BMDA 2VF8A 2ZJ5A 3H1TA 4N0DA 5JI3E 1R0XA 1QG2A 4TL7A 2O8EB 2FN4A 2YWGA 1NSFA 3E5HA 4H1UA 4KFTA 3QEJA 1WRBA 4PFSA 2CNWD 1YVDA 4G5OA 3QXCA 1EFRA 3CKLA 5GVSA 1W36D 1G8YA 2GHIA 2KBEA 3K09C 1ZUNB 3SDZA 4DB4A 1OFUX 2A78A 1VCOA 2DBYA 4Q01A 5B58C 5EJEA 4KV9A 5K8UA 4KITB 5L3RA 2WWHA 1KJWA 3SHFA 1D8TA 1ESMA 1VTKA 4TLCA 1E69A 2PBRA 1G3RA 1K6MA 2GBLC 3NBXX 3F0TA 2YC2C 5KDLA 4XOIA 5KNCA 5CK4A 3SNHA 5FUVA 4Q4AA 2BOVA 2XZOA 2P3SA 4GOJA 1F2TB 2W6ID 3GP8A 1SVOA 4EPRA 3K0FB 1W5SA 3LAWA 1HEIA 3EWAA 1YRAA 1XX6A 1IHUA 1U9IA 3WNBA 1HYQA 2OBNA 2WOJA 3LLMA 3MUFA 1NKSA 3A4NA 2W6IA 1T8UA 1XF9A 2PCJA 3EARA 2VPPA 2OFWA 1DAFA 3DKPA 2VBCA 4V0ME 4ARZA 4F4JA 2WKPA 2CCKA 4FMDB 421PA 4OHWA 1J8MF 4PHGA 3RWMB 4D4KA 1JQJC 3HU2A 1M7GA 2D3WA 2GEUA 3QIAA 1IAQA 1U2RA 3KQHA 4LHVA 3AUYA 5TARA 1G5TA 2F1HA 3NXSA 5FBVB 4PPQA 2PZEA 3AP3A 2K5UA 4B33A 1OHHA 3RS0A 2NIPA 1Z8FA 2FH5B 3SR0A 4F91B 1GL9B 3QENA 3IPXA 1R6BX 3MAAC 4AKGA 3TUZC 4RD1A 1HV8A 4QG7A 1W48A 2XEXA 5IDVA 3GJ3A 4L9WA 4PZYA 2CHGA 1COWD 1F6BA 4JS0A 1N5JA 4KODA 4BFSA 1K5DA 2HEIA 3WMEA 2O8DA 1S96A 3I5XA 5HR5A 2GJ9A 4A92A 3MWKA 4C4PA 4PAQA 1IY1A 2ZRAA 1XJCA 1U9IC 1T8TA 1COWA 4EPWA 3VR5A 2V4ZA 4JLNA 1XEWX 4EIWA 3K0SA 3GLFA 4W9MC 3THYB 4LBYA 4CEJB 3GLGB 3O8BA 1RFLA 1T3LA 1EFUA 3U3RA 4BFZA 1ZP6A 4LHZA 3EZFA 3R8CA 4XSGA 4NONA 2PT7A 3L0SA 1G9XA 2ZM5A 2RGNA 1OF1A 2A5JA 3K1JA 4WZ6A 3VX3A 2FGJA 1WDTA 3RVBA 4IJMA 1VIAA 2CBZA 3OZXA 2GCOB 4MYTA 2GESA 2WIBA 3I1FA 1A7JA 2VHTA 1AGPA 3AUXA 2GWHA 3DL0A 2NO6A 4X8OA 5JZVA 4EDHA 4LUCA 2ZRLA 5DYIA 4BLRA 4J0QA 1KO5A 1ESNA 4KYUA 2D7DA 2VP2A 3SI7A 4OK5A 3QY0A 1UJ2A 2XNSA 1BKDR 3GFTA 4BLTA 3O8DA 3K9GA 1ODFA 3NEYA 3RWOA 1ZAKA 3ZS9A 5DGXA 1CR2A 2ONKA 2Q3MA 1E9DA 1Z83A 2ZJ8A 3U7EB 3W3ZB 4QRHA 4P33A 1BYIA 1IY2A 2WSMA 3NHAA 2ZE7A 4LRWA 4B44A 4CT4B 2V6IA 3QKSB 4DLVA 1Q1BA 1NN0A 4YMTA 3TUJC 1BH2A 4M1WA 2ZXUA 1VG9B 3QQ5A 1U8YA 4RSGA 4LJ6A 3NHBA 4D4JA 1KZGB 5SZKB 2WWGA 4PQFA 1OB5A 2C78A 2IF0A 1GILA 2ZRDA 5JCPA 5JRJA 3LQQA 1G20E 1ZCBA 4MKGA 1LTQA 1E94E 5CIWA 5CJ2A 4A36A 3C14C 2ZJZA 4PO9A 2W2XA 2V8OA 3GEIA 3EW9A 4OI2A 4V02A 1S8FA 4Z8YA 5J4LA 2ZSEA 4A2QA 3NH9A 1DG3A 1Z6TA 2REOA 3H86A 3UKDA 4B48A 1A5TA 2H7VA 4MGKR 4C3ZA 1HT2E 2WIAA 3LO5A 5KNDA 3KXLA 4P0TA 4CGZA 4NYJR 4Z51A 2QGNA 2BBSA 2DFKB 4LV5B 1MOZA 4MRRA 5JRZA 2XX3A 4NU0A 4B76A 3Q72A 1QDEA 2DFLA 2QI9C 3RRNA 5FTJA 4W5WA 5EP3A 4QJ5A 1Z28A 1KTVA 1SGWA 2R8RA 5FBLB 1BYUA 1Q1QA 4UNSA 3LY5A 4Q7MB 3L0PA 1EK0A 4PANA 3PJRA 1XPRA 1DAHA 5EE3A 3HU3A 1P2VA 1T4GA 5FOXA 1CS4C 5KPJA 1HA3A 2ZI4A 2GK7A 1SXJC 2EU8A 3OIWA 4Q9KA 5FTKA 2LKCA 2JLXA 4HZUB 2QTFA 4NDZA 4QGGA 4QHTA 4UXJA 2BMEA 4TTPA 3SFZA 4EKDA 2ZSBA 1CJTC 4CEHA 1H8HD 1AKYA 3NDPA 2GKSA 3NTUA 3GLFE 1XMSA 2OXCA 2JLSA 5CK5A 1WB9A 1KI6A 2KE5A 3RRZA 1OH8A 1PUJA 3NC1C 1U98A 2NPFA 3AB3A 2I3BA 1OXTA
chains in the Genus database with same CATH superfamily
3VH1A 4JWKA 4HC4A 3A8TA 5D6OA 4B3CA 2HZ7A 3K1AB 4M9XA 3PHIA 4JJZA 3AF6A 5T67A 1RRVA 5TQ2B 1ZINA 1XPUA 2OK7A 2D1TA 5BXQC 5BN5B 3BUSA 5DLQC 2PRSA 1U0FA 5CVCA 1Z5UA 2WABA 4X71A 1MO3A 2R8OA 4DPLA 7ABPA 8ABPA 1P9NA 4NAUA 3TVDA 2GFQA 3FGPA 3JVEA 4OJQA 3REFA 8ATCA 3OQJA 4EMSA 1KMHB 2EGGA 2WQ7A 1NYTA 3SXUA 2BWJA 2FPIA 2Q9UA 1XRNA 3A1TA 1VKZA 2AQIA 3NANA 3PFHA 3H1AA 4WBNA 3EOBI 2UYCA 2G5CA 4OLJA 3VVMA 5AJYA 1H3EA 3AF1A 1TRKA 3UHJA 4MCAA 2E7ZA 1YXMA 3N07A 2AN1A 2X86A 2C88A 4RD4A 3LTNC 4BJ6A 5AVRA 1V5IA 621PA 4KRFA 3OOSA 4RTNA 2J0UB 5H3HA 1WNFA 3ZEIA 4Y2VA 1JHRA 1D5WA 5EJ2A 4DWWA 1OSNA 1YOVA 1EBFA 1ZGAA 2WJJA 1OFUA 2BGKA 2C5HA 3TW6A 1O95D 1OYVA 4I1UA 4WK0B 2H48A 4ANFA 2JA2A 4C7OB 2B1QA 2O50A 3NTOA 1ZCJA 3IT0A 4P22A 3FYUC 2CL5A 5JW6A 5JMOA 1E64A 1YI1A 4RFVA 3LBHA 4R71A 4JXJA 3MJDA 5BSEA 2OFFA 3QJYA 1WXIA 1RLIA 3LNTA 4JI7B 1SUIA 5CYGA 3U31A 5DP1A 3S8YA 2QPAA 5DHFA 1PR1A 4JB2A 4TV9A 4BMPB 3B7PA 4AG6A 1NV9A 4K9NA 5I7EA 2G06A 1JAYA 1T8PA 2NPIA 2V96A 2ZBFA 4LBVA 3TTVA 1E3EA 2ZYVX 3T0IA 3SX0A 3R7FA 4R2KA 1GAWA 5DGCA 5KTMA 2LZ0A 3GLKA 2FUKA 2WJGA 1C7QA 2F17A 1WLSA 4DJFC 1B41A 1VJRA 2ZROA 2HFJA 3IBYA 3DULA 4K0RA 5KX5F 2QUHA 2OCDA 3E4CA 3PITA 3OZWA 4QYTA 2P6UA 1GM5A 1YRQA 1DIBA 1GD1O 3CC8A 4WECA 4YQYA 4KVFA 4BP8A 3OLYA 1T0BA 3B1KA 2EQBA 2I54A 2QRUA 2II6A 4UVDA 3GGJA 3CKMA 4YRJA 3N28A 4Z4EA 2O0JA 4E30A 3AHEA 4GHWA 3SC4A 4N5HX 1NC1A 2AMLA 2WFLA 3E7PA 5K3CA 5A0TA 2OV8A 3ZKAA 2Y1EA 1E5LA 2R3SA 4HAWA 4UNIA 2ZRMA 7YASA 5KC9A 1GAEO 1JU9A 1KVUA 1Q17A 2XR1A 2GAJA 2RAUA 1TA4A 1ZDMA 3O0TA 4ABYA 4QTXA 1UPCA 5BV7A 3CVYA 1R6AA 4DIUA 4YIKA 5DBFA 3ZZTA 4BLUA 2QAGC 1DDGA 4DNFA 3PC2A 4KDEA 1P0IA 1WPGA 1A4XA 1DBPA 1P7YA 2WSSA 2ZREA 3H5IA 4I99A 4IHQA 1TNDA 1WPRA 3PXGA 2CXNA 4NE9A 2ODWA 2W70A 1OPRA 3ZJ4A 5FX2A 4AY2A 3E5MA 1ZM7A 1UOEA 1MFZA 1NRXA 3IKVA 5DTJA 1O96A 1Y3FE 2I1VB 5AESA 4UTVA 1LDEA 3T3NA 2D2EA 1SUCA 3TCKA 2HYIC 4RZHA 1VRWA 2CNBA 3LLUA 3EMVA 5E0KB 2D7CA 4ZAWA 5HUQA 5DNYB 1XCOA 2WYWA 3TLZA 2PU5A 1NTOA 3MB5A 3PXBA 1ISPA 4J7AA 4Q4DA 4WK4B 4RHFA 1KRWA 2O2SA 3KYCA 4HXGA 2FZ5A 3FXAA 4EABA 1XRSB 2PH5A 5KSWB 1P19A 1DFHA 1QOQB 1SMKA 1G3IA 3T1VA 4DSZA 5I4CA 3BGSA 1UXIA 2JAXA 3GLHA 1FTSA 2HM7A 3HCRA 1JZSA 2JCBA 3AESA 4OSOA 1HURA 1L5VA 3S99A 4I1OA 4D3FA 1IN4A 3L01A 4ZEMA 2QBYA 1SKBA 4DLXA 5JZOA 4LGCA 3B9QA 1KKUA 2Y1XA 3ST7A 2EBFX 3WTCA 5K3EA 4X44A 4O2BF 1X80B 3TL2A 1JT9A 1ZIYA 5I45A 4EEKA 1CIPA 4BRSA 3N7UA 1Y5LA 2FEPA 1P18A 5D3MB 4IJ6A 4XKJA 5IM4F 2ZITA 3KJEA 5FNVB 1KJYA 3TLKA 4B3JA 2O07A 1IXKA 1YDEA 3SICE 3BF7A 2PD4A 1ZD2P 2CSUA 4KXNA 3T3MB 2I4NA 1DKUA 1RW4A 5IT9A 2Y1FA 4BMVA 3I73A 3FNQA 4O2AF 5C37A 2ODEA 2DAPA 3CGGA 4IUBS 5HM8A 4RMIA 3WE7A 3Q8LA 5BNZA 2EFEB 1JIKA 3WKEA 4G4IA 4R2IA 4E5DA 3ZD8A 1BWPA 1XQ6A 4DXHA 2VZEA 4PNZA 5JS7A 1T8YA 5FF9A 1M8FA 2B25A 3LQRA 3PDCA 3T7IA 1F2UA 3EXFA 3NC0C 3PUIA 3Q7RA 3B5JA 3R7BA 2AW5A 4RJIA 5DEIA 3X2EA 2WTMA 1PN3A 1X92A 3LX8A 4JL6A 3RTAA 5A9SA 1A5SB 4OLHA 5G0WA 3KQVA 4PF1A 4YPFA 1LK0A 2R6AA 3AJEA 3VOAA 2Z2XA 4GO1A 3CN9A 4HQNA 1BAPA 5CYPA 4P86A 4M46A 1VPLA 4WJKB 1QTIA 4IEFB 4E5VA 1TVKB 4FYXA 3IBGA 4S0ZA 3ZIAD 1E32A 3OJLA 3CISA 4LY0A 2R1TA 1E1KA 5JAQA 2FN7A 1EVYA 3BWDD 1CERA 5TVKA 3GBVA 4Z86A 3IH5A 4F2WA 5LL6P 4QKQA 1JKMA 2FG7C 2I6TA 2VDOB 4Q00A 4UVEA 2Q5OA 4WCDA 3DFZA 4YHBA 3OLVA 3REOA 2CNDA 4O1MA 4UCFA 4AJHA 5EUBA 4JKYA 5KJFA 2OQVA 4P3XA 2GILA 1EGHA 3TX6A 3TQOA 4UBLA 2UUAB 2ZYDA 5FQNA 2CJFA 5DSXA 5ENZA 4JWTA 3R3ZA 5K7SA 1S1CA 3NR2A 1UMBA 3KQNA 2FG5A 1CJVC 3EIWA 3QWBA 3W8DA 2WC1A 1HF3A 1SQSA 2CNNA 3OQMA 4G0WA 1YNOA 2G7ZA 3H42B 1JG3A 3G2IA 4KI7A 5TX7A 2OBXA 2REQB 1MT3A 1TMOA 2IPNA 2W5UA 2UYHA 2V6BA 1VIMA 1SPXA 2FQQA 4WCFA 3X1DA 1A9TA 1JTFA 2HIMA 3D5QA 3A36A 4IIHA 3QOFA 1UCFA 3BL8A 4JBYA 3QFSA 1BDBA 2ZJOA 2OORA 1U4SA 3FPFA 1U8UA 2W0SA 3PB3A 3ABOB 4PGFA 1V2GA 2F2TA 4S3MA 4V3CA 3SC2A 3ZYCA 3CX4A 3VYVA 4OGLA 5A6SA 4Y1FA 1AXGA 1DCTA 1SHLA 5ALPA 2CKDA 3O1IC 3AM1A 1TVCA 4GMDA 5CR9A 5ICFA 4AROA 3T5DA 1M75A 3LHFA 1ESDA 1TGVA 1Y4AE 1JPVA 3DDOA 3ISVA 3PKIA 3QW4B 4KFUA 3D43A 5FAXA 4EOGA 1NNEA 4N3BA 3UICA 2B35A 3SY8A 3KKEA 2VP3A 3UQZA 4BBPA 2A7QA 5F78A 1KMIY 2I1LA 3ON5A 4QVIA 4X6LA 1G8KA 3VA7A 5LXTF 3KSBC 3VVCA 5J2UB 3OZ7A 3AILA 4Q19A 4M8IA 5EJAA 4MTCA 1FFCA 2F00A 3L6CA 2BJHA 2PD6A 1FVHA 2FEXA 4IDOA 2R1ZA 1GU1A 1NI4B 1XMVA 2E4ZA 4RY0A 1SA0A 3PS9A 4M1ZA 4LGYA 3PJFA 2LP4Y 4C29A 3V4OA 3C1AA 1VKJA 3OP1A 1K8RA 4LF4B 2B4QA 1XZDA 1RM5A 4YT8A 1CLEA 2ZPUA 1UM9B 5JXWA 5AKHA 3UGQA 2XLBA 4KK4A 5ES4B 1XEXA 2J32A 2NW6A 4ALMA 2VHVA 3P1JA 2VJQA 4ARCA 2Q0XA 2WHQA 4N3NA 1G18A 1CX9B 2MINA 1E1CB 2D74A 1MVOA 2ENUA 2C7BA 3AHJA 5H82A 2JHCA 2ZAOA 1HUQA 1TD1A 4MIEA 3PEYA 1ZGGA 4NQZA 1DC5A 4BNIA 4LNHA 2X15A 2QRLA 3MB8A 1SQGA 2VYND 1AMUA 1ES9A 2EOAA 2NU8B 5IX8A 2D5IA 1Z6XA 5TQJA 1YQDA 3ZYZA 1B8OA 4DIEA 1EG2A 4HFMA 3UIEA 1SELA 1X15A 3URKA 1OLUB 1MXHA 4F2DA 2WJAA 1N6PA 2B34A 1VFPA 4W7HA 4TT3A 2NM0A 3RAEC 4GFDA 2BI4A 2RB4A 1P4RA 1RXIA 2IYSA 3A4TA 3NKFA 4G2NA 4DMCA 1E7YA 2R44A 5REQB 4LYHA 4ZI7F 3W1EA 2HBQA 3V80A 4WADA 3T61A 4YRBA 3KDSE 1WMFA 4IEEA 4D4IA 1N8NA 3ZCTA 2PX4A 1ZG3A 1RFGE 1O8BA 1PJ4A 5GM2A 2JBWA 4LX8A 3AV0B 2BL4A 3OG9A 2J3LA 2PBFA 2QGFA 1ZD5A 2IX3A 1QU2A 3CJRA 1ADCA 3DOJA 2DR2A 4M1OA 1KRXA 2F3TA 2I6XA 4RK0A 1TCUA 5E1MA 1BE0A 1XZLA 4IJ5A 5C7IO 1S2LA 3MT9A 1DEHA 1TA9A 2AEFA 3UB2A 5AW3A 1EU1A 4IVRA 2AHRA 4X3PA 1J7JA 3D2LA 4NJEA 1HDYA 1GGKA 1YB2A 2C8KA 1P31A 2TMGA 3GG9A 1GSAA 1XWFA 1Z5NA 4JT2A 3THXA 1L6RA 1QV9A 4GQIA 2P9ZA 3AZPA 3ZU6A 2YXLA 3M4ZA 5CB4A 1DC6A 1G6OA 1A8IA 2QZ9A 4F1JA 1E3QA 1YK1A 1E5TA 4OA5A 4AY3A 5HILA 3VNVA 1I6MA 1P4AA 3QLTA 1N77A 3NM4A 4MIKA 1UFRA 3L06A 3MLAA 1V11B 2A5DA 2QY6A 2VSNA 3QY9A 1GCUA 4OK3A 4DXDA 1XFAA 2JFOA 3G5TA 1Y0BA 4UVIA 1PJQA 2YXPX 5FPQA 1M2OB 4OU5A 3WL4A 4Z54A 5L7WA 2PDAA 3PTZA 2GM4A 3MERA 3HYCA 3BM5A 3UAWA 4YCNA 1ID8A 3UUGA 3AV3A 4WH0A 4TZ0A 2ONJA 1XP8A 1EP3B 1UQRA 2AZTA 4JYCA 4A0FA 4B84A 2ODTX 4KQIA 4EYGA 6PFKA 2I7TA 1ACLA 3C4JA 4KSCA 1NP3A 3D6TB 4CCWA 2OYCA 1T2FA 1W85A 4L8FA 2IS1A 1WW8A 5TEVA 3HR8A 3K6KA 1LU9A 3SKXA 3O03A 4JMLA 2RKWA 2RK4A 4MRMB 4FCTA 3UAYA 1A5BB 4FFBA 3P0HA 2EZ8A 4QNRA 5AYVA 2QTNA 3F4KA 5K3FA 5FOUA 4BYGA 4HUTA 1EP1B 1UM8A 1U0NA 1VBFA 3HPQA 3VR1A 3U1VA 3HKCB 1QAOA 2ILVA 1PV1A 2X1HA 2QP4A 3U6KA 5ALGA 4RTOA 3I9JA 4MLCA 3RASA 2BW0A 1WXDA 1FNCA 3ZQJA 4Y7CA 4KLRA 3WWYA 4YAGA 1UODA 4GMHA 1GYPA 3CW2A 4P2GA 2RJNA 4RA6B 4YR7A 5F3WB 2YMQA 1T1IA 1U3VA 1CPYA 1G2PA 1N6KA 1TQ2A 3KJGA 3P4XA 4HVCA 3L8FA 5JZSA 2W4MA 3PUVA 1RCFA 4YCAA 3S5JA 3NIDB 5B12A 2AKAB 1A71A 4F7WA 1YUMA 4GBMA 1WEKA 5DNAA 1FW6A 1SD5A 5CFQA 3GP5A 3II6X 3PIRA 4EITA 2FZLA 1BDMA 2FW1A 4E2XA 1GPLA 1X38A 2VG8A 3LWNA 4RTMA 1VLHA 5KSPA 2QW8A 5ECGC 5E6UB 3ZHVA 1T6YA 4FGKA 5JVDA 1QAQA 1G5HA 2YY7A 1SG9A 3I4CA 4PX9A 1VKHA 5MHTA 1NE2A 3NTVA 3P0RA 1MNQA 1AQ6A 1NUTA 3D4NA 1US8B 4GKJB 3FNFA 1ZY2A 4XR9A 5E4TA 1WB4A 4KP7A 1X8JA 5C34B 3TX2A 4AS2A 1A2QA 2GZ2A 1K89A 2FF7A 3ESDA 3RHTA 3EGVA 5AJVB 5AW9A 1HL7A 2ERCA 2PYIA 3G9QA 3LPNA 1HE4A 1IAVA 3QXJA 2FUNB 3D6VA 1D4OA 1GCOA 3GZTB 3N74A 4P38A 4UEWA 5FBWB 3EXAA 1F0NA 1LS1A 3IPYA 5G0SA 3IEXA 5LXTB 2CHEA 2V7TA 4MQMA 1U4NA 3H5RA 3A4MA 1KY3A 5BP7A 1E20A 3NDJA 2YN2A 4JVMA 4B45A 3C5EA 3O75A 2C2BA 4LVOA 2B7BA 3DXXA 4CKWA 2PU7A 3W2EA 2QMYA 4JJAA 4S2UA 3WXMA 1M6VA 2XGSA 3FSGD 4DLLA 1EE2A 3BXFA 4KKXB 4RZSA 4WLEA 4ZV7A 4DY6A 1TYBE 4WV3A 1VGRA 5K1ZA 3VOBA 5IVDA 1PW7A 3AOGA 2FWAA 4TKMA 2GK4A 4B4VA 2ZULA 4L8WB 4PYJA 4MR7A 4BATA 1FZTA 3HGTA 4AAYA 1ZSVA 2WHYA 4LTDA 2PJRA 3AI7A 1IBCA 1F9EA 4ED9A 4AJOA 2JFGA 4B3DA 3MWFA 2X4DA 4RPLA 4EA7A 1USUA 3UEOA 1Z12A 4O1HA 1YQ9A 4C4AA 2BH2A 4KSYA 4MRPA 2C2KA 3OY2A 5AIAA 5EGSA 4E2YA 2FW9A 3G17A 3HH8A 4UAVA 3KTAB 1KZ6A 1ABEA 4KYTA 1FS4A 3B13B 2AZDA 3TBKA 4RVCA 1TYCA 2RHTA 4TRRA 1DKLA 3E15A 1KH3A 5FORA 4XZ3A 1K7SN 3FTNA 5CPFA 5KOHA 3O2JA 3PIDA 5SY4A 2C9ZA 3VR2D 1JKJA 2Q50A 4N7BA 2RH9B 3VC1A 4EPXA 4ZI7B 4HG2A 5D85A 5TEWA 3AW8A 3MOIA 2ODBA 2VAPA 2OB2A 2NLOA 1LVHA 3CLSD 1OIXA 5DYGA 2CFRA 3DVSX 3NWBA 3NZEA 4CR6A 4BMNA 1UJ5A 1YT5A 3EZLA 3FTCA 4LYFA 4OG2A 1R6DA 1WW2A 4XIGS 2NZXA 4MPPA 3VSDA 3QSYA 4EI7A 5BR1A 1EJ6A 3DCJA 3ETCA 2MSDB 3Q3VA 1QFXA 4KRGA 4E7PA 3MRSA 1XRPA 1U3FA 1T34A 1IWBB 3KT0A 2AR7A 5BRNA 4PNHA 4BV8A 4A73A 1FSSA 2MSWA 4R01A 4OMUA 2ZYTX 2VNKA 2YN4A 4MA4A 1PWZA 3TNJA 3NHUA 5IAGA 1K63A 3WIVA 5C3UA 1T36A 3CEJA 3UF0A 5F98A 1W581 1XKTA 4X8LA 1TMKA 2CVZA 1IYZA 1ULSA 3WDSA 2OCGA 1W35A 4LHYA 3IIJA 1D2NA 1KMQA 1B4DA 5D00A 2VIIA 1VPDA 4ZA2A 4YQFA 4CQLB 1FP4A 4FMCF 1K88A 2WAOA 3RABA 3VOTA 4BO3A 5EFZA 2GPSA 2CUTA 5KTYA 4QWWA 721PA 1ZK1A 4UNQA 4DJDC 3F46A 3VO8A 2HYDA 2RGEA 1ESCA 3DVAB 4ARBA 4UTRA 1ACMA 2HTFA 2P2SA 5IZCA 1YZQA 5ELMA 3EZNA 3NDIA 3SIPA 4BN0A 5IFKA 4HYQA 2XTNA 1G8FA 1Z2NX 2R7LA 3K8ZA 1CUCA 2F67A 3FNEA 3Q6NA 5DM0A 5BY2A 1P4SA 3HMQA 4RF4A 4X20B 2XTAA 1G20B 5DI3B 4KR7A 4KVAA 1ETUA 2ECPA 1XXHE 1T9AA 1YZ3A 3HSYA 5ADHA 5JSUA 4RV4A 1QG4A 1G8JA 2OC9A 4TWZA 1D0VA 4NBLA 3UK6A 2XQKA 1QIDA 1P73A 3R9XA 3LBFA 4MWZA 2GPTA 4PC2A 5CCXA 4IH1A 5BWCA 3VH3A 4BAZA 5HKKA 2C0CA 4M89A 4MGYR 5EEHA 4KPUA 1BG6A 3OECA 2QOEA 1TFUA 3OSZA 2JFBA 2R8EA 1QK4A 2Z04A 3AF2A 1Q1ZA 3BH7A 3T1HB 1RYYA 4O4LA 3T3DA 3KTOA 1BX1A 4G67A 3H2KA 4C0HA 1JXOA 2C9DA 1PZFA 1Y1RA 3SU8A 1Q3HA 1E9VA 5BO5A 3CH7A 2IIBA 4GDFA 1CY0A 2CE7A 1PT5A 2O2DA 4QJ4A 4UBIA 4WLFA 3WRXC 4F6LA 4O33A 3OETA 4ND2A 3A9RA 4DR4B 2XE6A 3GY0A 3N8GA 5IMSA 3LGXA 3BL6A 3VR6A 4F3RA 1OB2A 3OMWA 4MVJF 4E32A 1R8XA 4FXPA 4UJ3A 5GZ1A 3I04A 2DXIA 3GGOA 5JDIC 1DKMA 2FZGA 1DX4A 5CP8A 1JSLA 4J76A 2R97A 2FDRA 3HFJA 1TU4A 1DG1G 1PP4A 2V97A 3OIUA 1R9JA 4Y30A 2OESA 1W46A 2VC2B 4ND4A 4DZTA 1XJ5A 4RIGA 4M1QA 2ID7A 5EE5B 3A1SA 3IUBA 1KK3A 3N2KA 4JUCA 5JZ9A 3CVXA 1U2PA 2DHCA 1FX1A 1QH8A 1HOXA 4W99A 2QTGA 1R64A 2D8MA 1J23A 5KQRA 3HDHA 3HCFA 2PNJA 1TOAA 2HDOA 2F43A 1R0YA 2ACVA 3GARA 4F4DA 5JD5A 1X7XB 1ZH8A 1YBFA 1W49A 1YAJA 3RF6A 3IQWA 4N8SA 3LDGA 3C6ZA 3QVWA 1T2VA 4PLGA 2OQIA 3ORHA 2HK6A 3ZE7A 2A7XA 3FCEA 4B3RB 3ZDFA 1DVRA 3HSKA 4GR5A 1D4ZA 1CUGA 1GZ3A 2VUSA 3N59A 5IJAA 4EA6A 4BBAA 2W8BA 4TX1A 3RVMA 1RZRD 3R1IA 1V25A 2Y0DA 3BZWA 4R2JA 1P74A 2C9BA 5TPWB 1G5RA 2J3EA 4M54A 2J67A 3ZXYA 1MW9X 4ZJPA 5F23A 3AVVA 2X40A 1VJGA 4FDMA 4XGQA 5E3JA 4B43A 1GL7A 1LJ8A 1I7NA 3HDVA 3PQ6A 4M36A 1WKVA 4HGQA 4YUVA 3C5HA 3I0MA 2D5BA 3IS3A 1Z08A 1JEDA 2G5GX 4CM7A 4D6XA 1XJQA 3GW8A 3MUOA 1XHFA 5L9AA 1TZKA 2D2VA 1L6IA 3Q9NA 1C3OB 1RPAA 3RT9A 3CMMA 4ZT7A 1NTRA 3J81k 5K8JB 2Z8YA 1VJ5A 5EPOA 5F4BA 1AHHA 2YYAA 1EDBA 3NKLA 3PD0A 4C4RA 6CHYA 4Q66C 3F4LA 3PRHA 4IFIA 5BR7A 1W88B 2QTAA 1Z37A 2XGMA 2EKZA 4QXAA 3TM5A 1QBKC 1OILA 4U8HA 3MHTA 2ZUEA 3G0IA 4OHRA 3HY4A 4P92A 4A8HA 4RKEA 2HY7A 3H75A 4ZDWA 3V3TA 1DDOA 2FZVA 3IUPA 2C1EA 1JDBB 4G5GA 1PJCA 1RQ2A 4GE0A 5FHQA 1NLYA 4DDWA 5LDHA 2NQTA 1V8ZA 4XD7A 1J1UA 5JO9A 2JGJA 3FDJA 4CDNA 5L51A 5FUYA 2QB5A 3CUUA 4QUBA 1J0DA 5H7XA 3U3XA 4RHTA 5LQAA 4PZDA 4QUDA 3F8TA 3TTWA 3WL6A 3QPUA 1UBLS 4QODA 1QH0A 1J56A 1T2CA 5BW8A 1MB0A 1DAEA 2X8AA 3I23A 2CHQA 4OI1A 4DQKA 3IILA 2QVZX 5BUQA 3HB4X 3ZZMA 3UJPA 1JJIA 4ZODA 4TMVA 2XVYA 1IY0A 1WABA 4XGIA 5L4NA 4JJEA 3ZR4B 2HB6A 4FGSA 4FT4A 2PUEA 1E0JA 2AFIB 1IN1A 5B2FA 1AQUA 1D4FA 2JGIA 2P6RA 2X5NA 1RYEA 4DGQA 2A4MA 2H1VA 4IDFA 3WLAA 1M5TA 4JAVC 4HJRA 2YMMA 1U8ZA 4KWHA 4UCQA 4W63A 3WL5A 4B75A 2F4VB 3RK1A 4R68A 1FSZA 3DMRA 3WXBA 3THOA 2WWFA 3E3OA 4FT2A 5IT0A 1YCFA 1XNHA 1MPXA 1PD0A 2D4AA 1GXSB 4KTTE 2G70A 1QHIA 4W5OA 1VG0B 3GA7A 1KL7A 1JKIA 2PEZA 3NASA 4L4YA 2M98A 4Q21A 4IOJA 4AYWA 1Z0IA 2K7ZA 2Y66A 3E82A 4C0JA 3CVUA 4CDRA 1GGMA 4UNRA 4J16C 4KTVE 1BFDA 2E1RA 3I61A 4ZXFA 1XRLA 4CETA 1DLJA 2R6HA 4D8UA 4FMCB 1UPFA 3OBBA 2JGDB 1GL3A 1ZISA 1C1YA 1SVIA 2ERXA 3M6AA 4Q37A 2FPGB 4MO2A 2B3TA 2BHLA 4E2WA 4R2MA 3O1JC 2I03A 5G4LA 2RI0A 4K40A 3ROFA 4IP0A 1QMPA 3ABQB 1W4RA 4AXBA 1CHDA 3ZDQA 2O0HA 2B78A 3VYRB 3T15A 1T0UA 2AG8A 3F96A 5U1PA 2X13A 4OQXA 4ZZIA 1PFQA 4CM4B 5F9FA 2A86A 4PQRA 3P45A 4YRLA 5EIAA 4R6WA 1SCAA 1CDOA 4HDQB 2BGNA 5CVDA 3RRXA 3OTOB 4U6QA 3AUFA 1VIDA 4YJ2F 4I6GA 3NVDA 3L82B 1I6WA 4N12A 2JBAB 3CZ4A 5GM1A 2C83A 5DDIP 1LTHR 3KPWA 4G0QA 5D3KA 4IIXA 5JFGA 4DMMA 5BW5A 2GTIA 1KOJA 2P9YA 1V5FA 2XODA 4JLWA 2PUGA 3U7IA 4YMLA 3PQEA 3FM9A 4TVBA 5I7HA 2BF7A 2EG5A 4DM4A 4P7FA 1EK2A 3BMXA 5B2EA 2P7IA 1RRFA 3ESYA 3QYFA 4O5OA 4I9GA 5JNRA 3CTMA 1LF5A 1KFKB 1OWPA 2QM8A 3QXSA 4EY7A 1KS2A 2V4MA 1NVGA 3HV2A 4GUAA 3LXRA 4L50A 5EIXA 3AR4A 3QYJA 2AFRA 4Q9HA 4V24A 1POXA 3HXPA 2JFXA 3P9RA 4K9PA 5FP0A 3WC4A 4ZIRA 4OO3A 3AETA 1HE1C 3GRFA 1YMQA 3MMZA 3MW8A 4P5EA 4YQZA 5JC1A 3WGMA 4I8IA 4HGZA 4REMA 2GCPA 4XRRA 1YFLA 1HNZB 1NPYA 3O8CA 2ZTLA 1EDZA 1V39A 3TUIC 3KB1A 3LOUA 5DJ5A 2BFPA 4YA6A 1RMYA 5ADVA 1K66A 5C1PA 1RXVA 2BDTA 2YHBA 1KQPA 3DEAA 5AMXA 3K0AB 1RADA 1VL5A 2PMDA 3DZHA 4JGGA 2VF4X 3WRVA 3T4XA 1QU3A 1M1ZA 3DV2A 1P91A 5TSDA 6YASA 5HX7A 3OO0A 2VXOA 2JFNA 3SJCA 4RC9A 3T95A 3TBHA 5FXMA 1U1GA 3WGIA 3SR4A 2OLKA 2R25B 1UBGA 1ZW1A 3AYXB 1NSTA 2WWRA 3DD5A 3LECA 4JKIA 2IUFA 3NBKA 1F3OA 3HJGA 1OI2A 2I4IA 2GA8A 2R85A 3L84A 4KIWA 5TT0A 3WAKA 3ND7A 4TXJA 3W5AA 3KT8A 4JHLA 4QU8A 4ABTA 5JAHA 2HKIA 4RJKA 4U00A 3DDUA 4QVGA 4V0LA 1XMIA 4EYEA 3F1KA 1NOIA 4FTWA 3TOCA 1XD2B 2RHMA 2DHRA 1KWKA 4E5MA 4RL4A 1Y1PA 2VLBA 4L5AA 4J1TC 1N2CB 3PSHA 3V34A 1GHTA 5CM2Z 2D2FA 4Q4HB 4Y2RA 2CV1A 3LIIA 4WKNA 4JLUA 4ZTUB 2A92A 2QSJA 2XT9A 2HO5A 2JGMA 3EZ7A 1RWWA 2C2GA 3FI9A 3LKDA 2J59A 5BVGB 1KYWA 4G0YA 4JYBA 3MRXA 4RZIA 1Z2AA 4CG1A 4E51A 4ZMBA 2R1VB 3PUXA 3HZZA 4BO9A 4DLKA 1R9NA 4RK7A 1C8KA 4MQLA 1CEQA 4GIBA 3KQTA 5EQDA 2AQHA 2VLIA 3KZ1E 4RD3A 4D42A 1ABBA 2G40A 5CW2A 4D2IA 4A0SA 3I9V1 3BFVA 1NW5A 3LX6A 1DO0A 3G3EA 3L7AA 4EUFA 1NQVA 1PR5A 2LE0A 2PRKA 2JIPA 1QGOA 5TY0A 3SWWA 4J0EA 4BNWA 4TV8F 1Z5WA 1UC4B 3EC1A 3FCAA 5DCYA 2C2ZA 1CRQA 3IAFA 4RCYA 5H70A 4JL8A 2C4WA 2R65A 4EHIA 1M2NA 2IBSA 1FK8A 1LH0A 1VHLA 5KJ1A 3AGQA 2SCUA 2EJTA 2GPWA 1C1HA 2WIDA 1D2CA 1DL5A 5EZYA 1QF9A 2SECE 3EMBA 2JRLA 4G5FA 3GEEA 4TUYF 2ZJBA 4ZP1A 1L7PA 1U7TA 2V7QD 4GM0A 3U2QA 3OQNA 2A0KA 4RIHA 4B09A 2ZUDA 1RJGA 2GAFA 2X19A 3C5VA 4MQ4A 4WKCA 4CNQA 1ZM4A 1BX3A 2DTEA 2XCLA 3CB4A 3KYDA 2WWVD 4JMPA 1DQYA 4NYMR 2QVLA 3TEJA 1NATA 3H0KA 2Z43A 1NAIA 2IRWA 2WLSA 4FWTA 1KDYA 5JS6A 3PXEA 5J43A 1EUDA 1KNQA 3C2QA 3EIFA 3EVEA 5FTMA 2P2GA 2AC7A 1KKLA 1UBCA 3LCVB 1GEEA 4L15A 2C7RA 3BMCA 4YROA 4M8LA 3ZHQA 1O97D 2PTGA 2VATA 4H0NA 3TL3A 4JUFA 4DJAA 1UUFA 1WOYA 3QPBA 4V03A 3HC7A 5JCOC 1RABA 5EE0A 5EEGA 1CLUA 4NZPA 2NU7B 3H4VA 4JLVA 3H2JA 2BGUA 3ENWA 5EMHA 4NYMQ 3VR3A 3JQDA 3WYCA 4BS9A 5GIOE 1MH1A 3LBIA 1I13A 1CUFA 4UU7A 3UK2A 3V4PB 4ZICA 1JDNA 2ZB2A 3JRWA 4CM9A 2VPQA 1GKLA 3DE4X 5LMZA 2XOKD 4ISCA 3ZNPA 3NP9A 1HQCA 1IK6A 2PWYA 1RQLA 3P7MA 5I51A 1HG1A 5BUCA 2A0WA 4B6JA 2CLCX 5CDFE 2YWFA 1PRYA 1YRWA 3R5JA 1KHHA 4P3YA 5ED4A 2OZPA 3GIDA 3LKZA 1DSSG 2BJVA 4RFSA 2Z1DA 1OLOA 1TQ8A 4TYQA 4U7GA 3U1TA 2OPHA 1VIYA 3U40A 3NWJA 2YZMA 5EINA 2QLTA 1I9CA 2WIFA 2NSHA 4X91A 4Y2UA 2YHUA 3B1YA 3FFBA 1DQRA 5FA6A 4DLSA 1W0KD 4O4IA 2YN0A 3QVTA 4A7PA 3HVIA 3VR4A 1CZOA 1GPH1 4BWGA 1LI7A 1MJ5A 1VI5A 4DRZA 4E33A 2JLCA 1T4DA 2NV2B 2HXSA 4J4HA 3PUYA 4KAFA 3FVVA 1Z56C 4MV6A 2RGBA 1GNTA 4CTOA 5A7FA 2V8BA 1L7NA 4YRQA 5CFZA 1WZNA 4BL5A 2C54A 2YFQA 4K1LA 4ZO9A 4D46A 1SUWA 2V58A 3P9CA 2Y1OA 3Q2KA 2OZLA 1Y9ZA 2CDBA 2HV8A 1SVMA 3K0FA 3MD9A 3EUEA 3AERB 1DINA 1M2KA 4ZHQF 3TIVA 1Q21A 2PKYX 3UWKA 2QE7A 4Y0NA 1OV6A 3DTVA 4CMCA 4TVSA 3AKDA 1N8KA 4MCHA 3GPLA 1BW9B 3WSVA 4B3MB 3SZGA 4EPTA 2EP7A 1O6BA 3FVWA 1PYGA 3HN7A 3VMMA 2PLFA 1AUOA 3ESAA 4G5YA 5EZ5A 3CSSA 2VDQB 3P9IA 4R31A 5DBIA 4CF4A 3QU5A 5F2KA 3VKWA 2NXWA 4JB3A 2YVLA 3SQLA 4AKIA 1Z74A 1XPJA 5GVRA 4XX0A 1NF3A 5A03A 1AS3A 3SR3A 3VMFA 4YVFA 2XWQA 2P3QA 4GGOA 1ENZA 3BIWA 3UK7A 1PNTA 3S55A 1WCYA 5FA5A 1PD1A 4JK3A 4Q9JA 5T4HA 1CJCA 3L7MA 1QQ5A 2XAUA 3OCJA 4YPVA 1DAOA 4NEHB 5LP6C 5KQPA 3NTLA 4PQGA 5ALMA 4Q6WA 3PNVA 2IDKA 2YXEA 3FMGA 4PLVA 4BNDA 1E2PA 9GPBA 3GH3A 5G02A 3U62A 4P80A 1G9SA 4WDRA 5LOVF 3LT2A 1ZX1A 4POOA 1VZ2A 4AZ3B 1E79A 3EQ6A 3FCCA 2HF2A 3FGOA 1CYDA 1OXVA 2JK0A 2YIVX 1XO1A 2A33A 4O29A 7REQA 3WLPA 2RB5A 3QEBZ 4P82A 1D8AA 3S0JA 3VPSA 4LX0A 5HTOA 3BB1A 3JRXA 2ZRJA 4QDTA 2MU1A 3NCHA 4JVSB 4MVWA 1XEFA 1RMQA 2D4HA 4C4OA 4DW8A 4F97A 1XAIA 5ALSA 4G41A 2FJPA 5ULLA 3I4FA 4BUCA 1L7OA 2NAPA 1TAGA 5LA6A 1TJYA 3RARA 3I04M 2YZNA 4IVNA 3ZWWA 3W5CA 1AHNA 2QAJA 1MGOA 4RPKA 4BTEA 2H1CA 3TCXB 4IL5A 3S8EA 2J0QA 3SN6A 1ZGHA 1LV7A 5FADA 3DOIA 1WG8A 4DR6B 2PUHA 2IDMA 3MRVA 4INOA 3V8PA 1XTVA 3UBMA 3N0TA 3LBNA 2YYSA 3FUVA 3O7WA 1YASA 4N18A 2UXBB 3IQFA 2P1RA 2BFDA 3VX4A 4ND7A 4LN1A 3MIZA 1EGQA 2YWDA 4OQMA 3K0KA 3E3AA 5CDHA 4LWPA 3DMYA 5CVVA 3OWHA 5F12A 4BGIA 4EW3A 4ZT2A 5C32A 5EXPA 3EX7C 2WAAA 2CWWA 3DFKA 1CRPA 2FN9A 3FX2A 1Y1KE 3OCUA 2FWJA 5ALDA 4RJ2A 3ZWPA 4LOJA 1Z45A 4HWPA 1MO4A 3KYJB 2EDAA 1YA8A 3KXKA 3D64A 3U3MA 1VJCA 2VSQA 1O87A 3FCOA 3U3JA 5IT5A 4YI3A 4C4ZA 2OECA 2PO5A 4WZAE 4TUYB 3SX2A 3OE7D 3R0QA 4JJKA 3Q1KA 2AFVA 3AWIA 4WY2A 3SZOA 2WU3A 1NVMB 1RLTA 1TK3A 4LISA 5CH5A 3OX2A 4WRRA 1U2SA 2WD8A 2JANA 4YP1A 2PZFA 3PRJA 4C0SA 3GLSA 4RY2A 2BR4A 1EUQA 3KG2A 4ILKA 2VJCA 3OBIA 1NHGA 4N6NA 3OQOA 5JBIA 2C2YA 4RLFA 1K7FB 5IYZF 1UFVA 5FULA 3MTJA 3FHTA 2Z2IA 2ZVQX 4JXXA 1I2CA 4YQEA 4QFMA 2OL4A 3EULA 3ADCA 1SK9A 4J1NA 1BD3A 3AEUA 5D5PA 4A2WA 4B85A 2XUPA 2Z8YM 2YHIB 4R1TA 3MGCA 3HKDB 1NJ1A 3PWSA 3HCCA 3Q3EA 4HDRA 4C3VA 4DMLA 4WOPA 4D99A 4IR7A 5JO0A 3QUAA 1VMDA 2W2LD 3T3OA 1JIIA 2DKFA 3KPUA 5B1SA 1NVFA 1QV7A 2DWPA 3DBRB 3EZ6A 3MCUA 3NYRA 3OZFA 5TGTA 5BQPA 4WASA 2IYOA 3GWGA 3BEOA 4MI1A 2AOVA 2O2YA 1J97A 3H9EO 5EVJA 1WDKA 3VI4B 5IANA 4TZTA 3FOCA 1H0SA 3QTBA 3QG5A 4DT1B 4ZOLF 2JI4A 4K9MA 2PHZA 2IP2A 3KDAA 1YZGA 1AKNA 3D2BA 3EVAA 3NV9A 5GGXA 3CEMA 2IX9A 1ZWKA 4S1NA 3OEHD 1VFNA 2B1IA 4PQYA 2I29A 2VAXA 1L1FA 1JQDA 2ERYA 1UAYA 2N1BA 3TQQA 1LY1A 1U0BB 1E2DA 1NVEA 1TEHA 5P8WA 3Q3JB 5A3SA 2IYTA 1E4EA 1M8PA 1WF6A 1BXKA 2V9ZA 3DZDA 2YKGA 3G5M