4FNAA

Structure of unliganded fhud2 from staphylococcus aureus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
278
Chain Sequence
NNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQKVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferric hydroxamate receptor 2
publication title Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 71
structure length 278
sequence length 278
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4fnaA02
5CX1A 4PAGA 1M1NA 1N2ZA 5BVHA 3AEQB 1K75A 4FKMA 1PSZA 4G09A 3TNYA 3ZKAA 1QGUA 1QH8B 4HN9A 1M34B 3PDIB 3U7QB 3MD9A 4HMQA 1QH1A 4TKUA 4MDYA 4XPIA 5BVHB 2MINB 4B8YA 5GGYA 5BVGA 3R5SA 4TKVA 2O1EA 3AEKB 3MWGA 2XUZA 1G21B 2Q8PA 3UJPA 2OGWA 5JPDA 1G20A 2WI8A 1N4DA 4G07A 4H0FA 4PM4A 1N2CB 4WN9B 4LS3A 2OV1A 4IRMA 1K7SN 5KOHA 2XV1A 3AERB 2XY4A 5M29A 2AFIB 1FP4B 3EIWA 3HH8A 4DBLE 1KAHA 4GICA 4WZBA 4INPA 1N4AA 4WNAB 3ZK9A 2OV3A 1H1LB 2X4LA 4FNAA 2PS0A 4K3VA 4ND8A 5CR9A 5JG7A 1ESZA 3G9QA 5CX1B 2XDQA 5HX7A 4NNOA 3AESA 4HMPA 1M1NB 4N01A 4OVKA 1K0FA 3ZK7A 1KARA 1QGUB 1MIOA 3MFQA 3AETA 1L5HA 3LHSA 1QH1B 2XDQB 3MWFA 3AESB 1M1YA 2PHZA 4TKUB 4XPIB 4OXQA 5M34A 5BVGB 3PSAA 4TKVB 3K1AA 3EIXA 2AFHA 4H59A 4INOA 1K2VN 5AFSA 3MINA 1G20B 3GI1A 3LI2A 1TOAA 1M1YB 3PSHA 5JJ5A 5KOHB 4CL2A 4BBPA 2AFHB 5HDQA 2WHYA 4WESA 2OSVA 4WZAA 1XVLA 4WZBB 3HJTA 4FI3F 5KOJA 4HMOA 2R7AA 2ETVA 3TLKA 4ND8B 4FILA 3AEQA 2YNMD 1PQ4A 2Q8QA 2YNMC 4WZAB 3TEFA 4UDOA 4MX8A 4MO9A 1QH8A 4UDNA 1KAEA 3PDIA 3U7QA 4OXRA 1MIOB 3AETB 1L5HB 2MINA 3NU1A 2RG7A 5GGXA 3AEKA 2QI9F 2M6LA 2M6KA 1G21A 4NNPA 3R5TA 3AEUA 4M7OA 5I4KA 3K1AB 2PS9A 5M3BA 5JOQA 1N2CA 3MINB 4WN9A 2XQVA 2PRSA 4LJSA 5FLYA 3AERA 2R79A 3AEUB 2AFIA 1FP4A 4MLZA 3CX3A 2PS3A 4UTOA 3BE5A 3HXPA 4WESB 2XH8A 3BE6A 4WNAA 1EFDN 3ZK8A 5B58T 3ZTTA 1H1LA 1M34A 5KOJB 4UTPA 5M2QA 5KHLB
chains in the Genus database with same CATH superfamily
4X6YA 3IKJA 5F7XA 5C35A 3KSUA 3GOHA 2ZZNA 3GRRA 3P9RA 4W8HA 3KQKA 4YREA 2OYCA 3O9ZA 1CQIB 5H02A 1M34B 3G02A 1PD1A 5JVDA 2P2SA 5J2UB 4XJVA 4Y9RA 3EOZA 4PQGA 3L3BA 4UBMA 4UOEA 4U3JA 1PV4A 4JOQA 2JKZA 2WTBA 3LQ4A 4K9RA 4C7JA 3EFHA 3BHMA 3WLIA 1AQNA 5BVGA 1IOZA 2GKSA 1MV8A 4RGYA 2D1FA 2VWPA 3ESZA 2RCYA 2G4CA 3HWX1 5BWMA 1W85A 4KDEA 4EKNB 4PICA 2QMOA 4H31A 2I2XB 2Y67A 4OB7A 2YRWA 2JVKA 3AUTA 5DRYA 2W00A 3PF8A 4HPWA 3GC6A 3ZXYA 4XWYA 3RRZA 3U61B 4NE7A 4OU5A 3TEJA 4U02A 2PYDA 4TYQA 4YK7A 2OG2A 1ZPDA 1A0OA 5FHQA 4QGHA 1G19A 2BGKA 2HO4A 3DMHA 2GCPA 4TLDA 1YA8A 1M34E 3KAQA 3TCXB 3ZK9A 3DE4X 5DP1A 4BFXA 4HFMA 4EL0A 5TB5A 3TBHA 3C6KA 1D2HA 2C03A 3T7IA 3LSYA 4TMYA 1EJ6A 2X2OA 2AGVA 4KLAA 5ARCA 4NXNB 3KFXA 2EFCB 1RYBA 4K86A 3MD0A 3EPPA 3G5LA 4UQOA 4ZTBA 2YWRA 1E2KA 4DUGD 1OLXB 1L5HA 2OV6A 1VSQA 1EBUA 4QFBA 1PK8A 1OBHA 3KHSA 4RLSA 5A5VA 2LIPA 1HM5A 2Z5VA 3GLQA 3HKDA 1P33A 1MLDA 1HX7A 3LUCA 5T3UA 4HQRA 2GM4A 5DM0A 2D2VA 3SMVA 2HJRA 2EJVA 3CA8A 3DPUA 1KBQA 2OWDA 5JNLA 3MOSA 3ACCA 4M49A 3EW9A 4BMXA 2BMDA 1NVBA 2JA1A 1SUFA 4IDEA 4Z0NA 1VC2A 1WW8A 5JLAA 1PR2A 1NU6A 2QBYB 1VZ3A 2FMKA 1YQDA 1X8JA 3NTXA 2OCKA 4DHWA 2J31A 2WHPB 2BGIA 4CQLA 2IIPA 2F4VB 3UN1A 2DY0A 2EKPA 2OESA 4KAAA 4YRRA 1UOOA 1OX4A 1ZN2A 3MF4A 4DXHA 1U2SA 4OX9Y 3MMPA 4WMLA 4M0FA 4UEWA 1HE5A 4WT7A 2A88A 4PS0A 1Y8QA 1KQNA 3ZWCA 3U6KA 1J09A 1I94B 1GG8A 3GAAA 2YYZA 3HDVA 2E1PA 4UFOA 3AR6A 3Q88A 1E79A 1T0JB 2BKEA 3ZNPA 1KETA 2I8CA 3X2SA 1XDDA 4MYRA 4ZC8A 3WYNA 2CV2A 4IHJA 4V0QA 3OIYA 6PFKA 2X5JO 2OZEA 3OX3A 1KY2A 3F1LA 2CXOA 4K87A 1Y4SA 3DBHB 2HMWA 4PLHA 2OC4A 1HKUA 5JZOA 2RHHA 2G5CA 4OJKA 4Q9KA 1Q0HA 3R3ZA 4XCVA 1EFPA 2G40A 2Q4BA 4XARA 3GY0A 4ERNA 1C80A 4ZALA 4OMCA 4R8MA 4B6JA 3MWDB 3CLRD 4M1EA 1CERA 4QOIA 1VCHA 4WJZA 1P77A 5LZ7A 4NI5A 2XD4A 3DAPA 4CF7A 2HIMA 2VDJA 3CUSA 4OYRA 5DMXA 3E7WA 1MN6A 2DM6A 1C3LA 2HIAA 4KWCA 1ISSA 4QO7A 2NMVA 3BIWA 1X0VA 1QRAA 2P67A 1YTLA 5LDGA 2JLBA 5BMVB 2YZNA 1BDMA 2FWMX 3F6SA 5CVJA 3IT0A 1ZYUA 4J16A 1E96A 5IDQA 5IASA 1Y8CA 1WW2A 2IUUA 2Y1XA 4ASUD 1XNJA 4O2RA 2WSSD 2GEBA 3NX4A 4YNBA 1N2JA 3WWPA 5KQLA 2ZRMA 2DG2A 3WI7A 3HCAA 4UUOA 1E3MA 2P0YA 1C3JA 5GY7A 4KJXA 4Q3OA 1PGQA 4PAWA 4L9WA 2VXYA 3LW8A 3EQ8A 4KQMA 1EM8B 1KFEB 2QZJA 4KMMA 2HQRA 2RGYA 4GKKB 2KLBA 3WRWA 1SBYA 2IPAB 1QE3A 1E2QA 1N0HA 1YQGA 4B4OA 4CKEA 4MLCA 1JKMA 5EMLA 1NIJA 4TTSA 3RYIA 3WB2A 4K9PA 4O33A 1ZAKA 3QGMA 3QE9Y 3PXBA 1IJKA 2NT3A 3G1UA 4GI2A 4DUYB 2QAIA 4KDCA 3QSYA 2G1UA 4ZDJA 1JQJC 4YIHA 1JQ3A 1P1HA 1VE3A 1YKGA 4IQFA 2PN1A 4QODA 2WYUA 2FEPA 3RTBA 2C9YA 2WEKA 3GPBA 4JLJA 2B92A 4A2WA 5JQGF 4EHBA 2FN4A 2XZDA 2ZJBA 1DT3A 1T26A 1J90A 1X1CA 1YBFA 4Y9UA 1ZVJA 2AA3A 3W8DA 4INOA 3ZHBA 1QVAA 2JAHA 3B1VA 2NZ8A 1V5FA 1JPNA 2Q07A 3MGGA 4AIRA 4HVLA 1J2UA 1OWNA 3DOJA 2QRQA 3GFGA 3U49A 5DK6A 3QU9A 1R16A 4MQUA 4BVGA 1ILEA 2D1QA 4R1NA 2JFHA 2WWFA 3Q87B 4QYXA 2WD7A 5IBQA 3PL5A 4GRAA 5SZHB 4U4AA 5GIPE 4X5OA 2YDXA 4R98A 5EP3A 1ZRNA 2PSSA 2W2PA 2FF7A 1W36C 1M2VA 2WUGA 4DC9A 1J8MF 1YQTA 3N07A 5DTMA 5AOBA 3TQRA 2WTAA 4XUEA 1M5UA 2JHAA 5AI8A 4R0NA 3V7NA 3QE3A 5I7FA 3PQ3A 3DGEC 3NWOA 3ZD7A 3AFNA 3BXEA 3OKCA 3QXHA 4I1VA 4PONA 5J3JA 4IGEA 1Z75A 1QJ4A 5HUJA 1AOXA 4WZZA 2P3LA 3HNRA 2AN1A 2DX7A 2W83A 3LXUX 2EIHA 2N3ZA 1X7WB 2J41A 5B1YA 3BMNA 4Q3AA 1S3FA 4BNVA 3LGSA 2IZZA 2ZJ0A 3B13B 4G9GA 3LIIA 5BQ5A 2YJTD 2B8JA 4S05A 2JPDA 2Y93A 1WPRA 3I61A 3SAJA 3GG9A 2GMWA 3ZXIA 2WSLA 1IEXA 4J1QA 3A9CA 3KWJA 5CYOA 3F0TA 3BFVA 5AXAA 1TEZA 4RETA 2EX4A 3AW9A 8AT1A 2O20A 4YXFA 4PTZA 4MDFA 1CRZA 2AEFA 3M6MD 4ZOCA 1HDGO 4UOQA 5SZJA 1GCAA 3H2ZA 5E2IA 2PWPA 3EGEA 3R0VA 4YRQA 5T4FA 2X14A 3N2YA 4EPWA 4F9FA 3BB1A 4DMGA 1AO0A 3GNQA 3UMGA 5L4LA 1A9XA 4GOJA 3DEAA 3RIYA 3A05A 3FYCA 1ICEA 2BHLA 4OGKA 1TYBE 4RHUA 3ZD8A 1Y7PA 3ICOA 1CHNA 2C4HA 1T9KA 1U8FO 1BIFA 5BN3B 2ZIXB 1PV1A 2RC6A 1OWOA 1KY5A 2C2WA 1H6BA 2WLTA 3HFJA 1UZLA 2GBIA 3L0BA 3FMFA 3OOSA 2G1PA 4Q7KA 1IVNA 4YASA 1Y1KE 3WIDA 1PVOA 5JPDA 4TL7A 3RYCB 3K20A 3W5HA 4L9SA 5D3KA 3VPSA 3ZXXA 1R9JA 3WMGA 4A91A 3CLVA 3R8FA 1KU6A 3TTTA 4MVWA 3HN6A 2TYSB 1U1FA 1XRJA 3U9SA 1B1CA 1SVNA 3PQ7A 4X1KB 4EZIA 1I2AA 4JEMA 1CNFA 1NW3A 1NOIA 1QANA 3DE3X 3MJRA 3OM8A 3PRJA 4EP1A 4W7HA 4YRPA 4N03A 3MJ4A 3AO0B 2GEFA 4CMHA 4KAJA 2AD5A 3KM0A 4RMJA 4HH0A 3WHLA 4ZK6A 1Z29A 5ISMA 5BSGA 2B7CA 3IB6A 4RH1A 1MRSA 3OOJA 4DXDA 4YXWD 3OURA 5K8LA 1B0PA 1RXUA 4NYMR 5A1TA 1XCJA 3KJZA 1E8DA 3IDQA 3FD8A 1REQA 4HAVA 4LBZA 1E7QA 1CQJA 3A0RB 1T0PA 1NRJB 3LOPA 4QOEA 1KOGA 4A0RA 4WFKA 4OXQA 4AJ2A 1EFKA 1T5DX 1XAIA 4AURA 2UVQA 5DCYA 4D8TA 1DAPA 1QB8A 2FXIA 2O7NA 2ZWOA 3PE3A 4XUGB 4YP0A 2BCEA 5LFAA 1TYCA 4DLBA 3VKGA 5GINE 1TPZA 3AUFA 2P75A 3DDOA 4LGVA 4IQGA 3WGHA 3RRJA 1FFXA 4CLOB 1FFAA 1H4TA 3OFNA 3SSNA 4HQ0A 5CFNA 1I2MA 1YH3A 3IO3A 5SYMA 1NM5A 1QMPA 2JFBA 1TAGA 2ZBGA 3BGOS 4RACA 2VNJA 3WGLA 1KKLA 1XXHA 3P45A 4UARA 4UU1A 1N6PA 2JJYA 5JAPA 2P4EA 3AEXA 2GEJA 4GM4A 1JG6A 4W1SA 2WJAA 3NHFA 5KSZA 1KI8A 4HMOA 5L45A 3OPQA 3TRHA 1TKCA 3DOEA 1KJNA 5CNMA 4FBLA 4AQDA 5JVDF 1DAEA 5H4GA 1KWGA 3LA6A 1VI6A 1Z35A 3IAHA 4F4CA 2N9UA 4KE8A 4MWGA 1QH8A 5ALJA 2O8EB 2QK4A 1PZMA 2O2IA 3DKRA 4C0LA 2VYCA 4I1IA 4DMUB 4EOGA 5DGXA 1CDEA 3O4FA 2GYUA 5F2KA 4DYHA 4XWOA 2BEVB 3L0OA 1M6EX 5IDVA 1W59A 3GUHA 2G8NA 4EABA 1W1WA 5LQAA 4RHYA 1KP9A 2WWXA 2CFCA 1ZCZA 3RSQA 4ARIA 4CEJA 1CEYA 1KFCB 1I9GA 2C7GA 4DWWA 2ZCUA 1OYWA 2XCOA 2BWJA 1NBIA 1WTAA 1L7EA 3FGPA 1G4AE 1OQAA 2OGTA 1YMUA 4OQLA 3JQFA 5KTNA 3OOHA 3Q3VA 2MYTA 3QJGA 4MJXA 2GXQA 2CVOA 4NBKA 1Z08A 2A0YA 4E6EA 3AEUB 3I9V6 4JCOA 5DO9A 4RJIA 1JQAA 2ODWA 4UD6A 3PE4A 1F0YA 5AHKA 1Q91A 1VIMA 4D9FA 3O3CA 1SM4A 2HBRA 3OP1A 4CM8B 3QUAA 5FNZA 2GCGA 1NVGA 5D2CA 5JJBA 3NBAA 5M04A 1RXSA 2WC1A 1IL0A 4FBGA 5TE9A 3RD5A 5I4IA 1PTJA 2GZRA 1SCUB 3NIWA 1TK3A 1M8GA 1X1BA 2BLLA 2MTBA 3H8WA 1WY5A 4HTAA 4JB3A 5HCIA 3OCJA 2OQIA 4ZI7A 1DAKA 3CRZA 1OHHA 1YFZA 3SVZA 2BM9A 4AO7A 1W0CA 3D8RA 2P62A 3HCRA 3NRCA 1MJ5A 3D0OA 4DSZA 4HAXA 3TRFA 5LQRA 1SOUA 5FO1A 1J9EA 1YVUA 2VJLA 4Z7NB 1ZSYA 3TBKA 2GZAA 4MV4A 5C5CA 3ONWA 1KSHA 2PMFA 4K8OA 2QXTA 1LRJA 3GFQA 1GJRA 3HDTA 3NYWA 2IF0A 1MB2A 4DJTA 3AIOA 5JS8A 2XTAA 1P0MA 5HJ2A 3U44B 5CURA 4JB2A 3RW9A 4ZYLA 1RRMA 1TTHA 1H8EA 5DLQC 1KPHA 1W9HA 4R6WA 1NE7A 2Q27A 4A8JB 4B5LA 4BVEA 3BRSA 2XT9A 4N9QA 3UQZA 3R9XB 2BY4A 2D00A 1ADFA 4LSGA 3K35A 2L0XA 4D02A 2O2CA 2CW5A 4A16A 4V0OA 1P8AA 4KR6A 3DWEX 2PSJA 3CXRA 3OESA 2WMOB 1XU7A 2DT8A 2V7UA 2IKQA 4WKNA 3NHUA 2GVNA 3UIEA 1PUJA 1V8DA 3PGKA 1P6QA 3NBYC 3W1VA 3ZHOA 1XAGA 2JFPA 5KYWB 3KZXA 1Q1AA 2I4IA 1NUUA 2XYRA 2WB4A 1GCUA 2OVFA 4IHJF 4ZVOA 3QRWA 5LP6B 4JXXA 2CZQA 2H1VA 2JANA 3TG8A 4GLOA 5K20A 1A9TA 1Y6FA 2BEWA 4LVUA 4TYYA 1FDTA 2AOUB 2AOWA 4PGHA 1H2AS 1P0CA 2CCJA 2VKTA 1N5RA 2J45A 3HLTA 3I05A 3O92A 3T54A 1LA2A 3O6VA 2QTCA 5FOSA 1T0HB 1R0XA 4I1UA 5KVAA 4BTEA 4J49A 5AJVB 1IBLB 1R9GA 3E6AA 2YW9A 5BUCA 1GT6A 2XKJE 4MA0A 1ZX1A 4B7AA 1JA9A 5LWHA 1VPDA 3E15A 2GKOA 1R8QA 4HVCA 1F8XA 2GTIA 1EP9A 3QFHA 3RUCA 1G2PA 2AN3A 3KEOA 3PWZA 3STVA 4AZ0A 4RTQA 1K27A 3KAKA 3D7MA 4WOCA 3ZY2A 1XTSA 4YLYA 7REQB 1QTIA 2FPUA 4FJ2A 3GEMA 2RC5A 1ZM9A 1T3GA 4M1WA 1HC7A 4JNKA 1P17A 4R31A 2X15A 2XF2A 3DW3X 2HHLA 1JPVA 2HWYA 4MV7A 4R1OA 1J2YA 2JCYA 3KT8A 4FNGA 5FUXA 2NG1A 1LSJA 1EUYA 2OO3A 3ES9A 4B8WA 3TW8A 3JTEA 1FTSA 4MS3B 1ENPA 3L8HA 3T4PA 1TZBA 4GVLA 4WCFA 3GT0A 1GNRA 4UOZA 1NMEA 3EXEA 4MCIA 4BN0A 4RQBA 1MABB 3CLKA 4CTJA 4ABTA 1RE1A 2OO7A 1N5KA 3AF5A 1ZH6A 3V33A 5HW0A 1D6MA 4YBRA 3QIAA 3KJIA 5AD1A 4Q9NA 1EZZA 1X38A 1Z5OA 2G07A 4JELA 4IICA 1KR5A 1UQTA 4CEIB 3OLXA 3WLJA 1P9NA 2EYUA 1LDBA 3GUVA 2HF9A 4J43A 2SNIE 4FT4A 1SXJE 3KQTA 2QQEA 3BBPA 3KOMA 1MFPA 3Q5GA 4MUJA 4D41A 2CDAA 1L7VC 3WB1A 1GAWA 3R77A 3NBXX 1OGIA 2EVWX 5F4BA 1M1NA 4WKBA 2XUGA 2X5OA 2WSBA 2YN2A 4Q6WA 2IFTA 5LB2A 2HO5A 2H2DA 5G0VA 1ZC4A 3D6TB 1ZLYA 3NBKA 3TLJA 4BFTA 3KWLA 1GZ7A 3OE7D 3C3CA 3UWMA 4CKBB 5MGBA 3FPAA 1ZI8A 1YS6A 3WC4A 3AR4A 4B46A 4RANA 1WHTB 3M2TA 2MINB 2JGJA 4ARUA 5BVHB 1RHQA 4YN3A 4IIXA 1LVUA 5E9QA 1SAYA 2CD7A 2QUZA 1RSZA 2X0NA 3UB3A 2HU2A 1LPSA 3KUCA 3HJNA 3PYXA 3E4DA 1KP3A 4NMMA 1KDYA 1NSYA 1YZGA 2EGGA 2PV0A 1XFDA 1X39A 2OFWA 2Q9UA 2R7NA 3HY6A 5E6UB 5EEHA 1CNMA 2P65A 1VRCA 1N6NA 4BJ1A 3RFXA 3CZCA 5FO0A 5EIOA 2F9LA 2QRNA 3OZTA 4NBVA 3A27A 3EODA 3GFSA 3VR4A 5A6VA 4HUQB 5A05A 4BQNA 3KVYA 3BWEA 2VK4A 3FPSA 3THYA 2VBGA 1E1KA 5EKUA 2VR1A 1JEDA 1QDUA 2A35A 2IOQA 4MB0A 3HSKA 4P54A 4XD7D 2L2QA 5EKSA 3BQNB 3WICA 2JB9A 4B40A 1KFBB 5A7GA 1XP8A 2PT9A 4A8JC 5B5SA 1U0OC 2UDPA 4GI7A 2IPMA 5JWOA 5HQ3B 5KMGB 3K0CC 5C81A 3E61A 4PZYA 3P32A 3VR0A 5LQCA 4R6XA 4D0NA 4BE9A 3PDUA 2I1LA 3DZFA 3PEVA 1K06A 1TOAA 1UPAA 3L1JA 4KXUA 2FW7A 3T4UA 3ZC3A 4BVLA 3W05A 5HIAA 4RTMA 1ZQ1A 4OXKA 1W0KD 4ZAWA 4JYPA 2VEDA 4NDAA 4X7RA 3USCS 3IA2A 2WAXA 3BMQA 3N0TA 4G0OA 4M8KA 3ZTYA 2R6AA 4BZXA 4LTDA 1X3LA 2A3RA 2OILA 2XVXA 3LC1O 4G67A 4PLPA 1RMTA 3MELA 1FUYB 3SHTA 2YY6A 4D46A 3EMKA 4UTRA 4C4YA 1L7RA 2WKWA 4R5HA 1UMBA 3D4NA 3HRHA 3SU8A 2VTEA 3FRHA 2Z08A 4JHLA 4MVJA 1MH9A 4IQ4A 1FNSA 2HY7A 4FHCA 1O94D 3D6NB 4WWHA 3AJ8A 3L7MA 1TUGA 4PSCA 4X97A 3RBXA 5DN6D 5K3EA 3D6AA 3N6XA 4JQYA 5FUWA 3ZWOA 3ZCSA 3UFXA 3OCZA 2FH5B 3HFRA 2R62A 5DBEX 1NN3A 3BGVA 3KG2A 2NLOA 4M9UA 1JI0A 3EVBA 3NWJA 5DI3A 2RMKA 2J7PD 1MDBA 4M9CA 3SVTA 4M0CA 3P0JA 3DOHA 2ZQ5A 1R18A 2OUIA 1WKCA 1E3QA 3NEAA 4QWMA 1TAHA 5CJ2A 4LV8B 2QRPA 4BFUA 2XXJA 4CTKA 2E55A 1FU7A 1N2CA 1MQ9A 1UJ6A 3VUEA 3FTFA 1UMKA 1QK4A 5HBRA 3H42B 2WMNB 4LJSA 3KD2A 1GGHA 5AJYA 5J63A 1GZVA 4XCQA 1L1QA 1B74A 4E22A 1VECA 3N05A 3QUQA 1R0CA 1SXJC 4AW9A 5AM2A 3GJZA 4FCWA 4XLLA 1VJDA 2HW8A 3E7XA 5A2QA 5AM5A 1MJGM 4KR2A 4IIEA 2H92A 5DKFA 1E9VA 3H5WA 4IIBA 4LISA 3REQB 4L4SA 4C6TB 4DBZA 4W82A 2YBEA 2XE7A 3WGJA 4NX2A 2IIVA 5D8DA 2K4MA 1BA3A 1RPAA 2C4TA 1UFOA 1KYWA 2QGFA 4TLLB 1XZPA 3N8NA 3I12A 3T1VA 2ZJ6A 3DBOB 3EEFA 1O89A 3D4LA 4CIWA 4INAA 4FGZA 4K28A 3EFBA 3FYUB 2EGHA 2UZ1B 4ZZ0A 1Y3IA 2Q2QA 3GAFA 3T94A 4IHQA 3I76A 4LMRA 1T3LA 3FCOA 1D03A 4DMCA 4DADA 3B3AA 5E4JA 3CV3A 4QQRA 4JR1A 2OENG 1V43A 1E0JA 2A0XA 3BB3A 3ZBQA 4EAAA 3S1AA 1ZIDA 1P72A 4JEIA 2WB2A 3VC2A 4GBGA 5FI0B 3VTZA 2QN3A 1FXWA 2R7KA 3H8SA 4KXFB 4UZEA 1M2NA 1GFSA 1LI4A 3H13A 3TSCA 3D5EA 3NT4A 4N4AA 4PGAA 4RK7A 2XVMA 3ZDQA 2WJIA 4DM3A 3DL4A 5PGMA 1PR0A 1YNOA 3L8FA 4GI1A 1D1QA 4FSHA 4X8MA 2X40A 1Z4JA 2MSLA 1IB6A 3L7CA 3VTKA 3UATA 2IXDA 5EN4A 5JZBA 2QLLA 3B3GA 4MQEA 3DHWC 3DZDA 2CCKA 3BKXA 3IQXA 5IK2A 3QYPA 1MT3A 4MINA 4NZ9A 1RC1A 2UUCB 4IDAA 3F9RA 4EK9A 1SUEA 3LCJA 3STXA 1CRWG 3NHSA 3SICE 1EGVB 4NBRA 5AJXA 1GRRA 1PL0A 3B36A 4HRYA 4PS1A 1Q7TA 1YRLA 4Z7OB 5GJBA 3J7AC 2YV4A 1BMFA 1IHUA 4CN9A 1ZUNB 2Q8NA 2DFVA 3HZOA 2GRJA 4KSCA 3S8MA 3O3OB 1EWRA 3ZCQA 3EWIA 4C78A 4F72A 2E85A 4NCXA 5B2EA 5EMNA 1O3YA 1V4BA 1X1DA 2FOLA 3ZH9B 3DAYA 4E70A 1R4MA 1KPGA 2GZDA 3ZWMA 1ABFA 2HUPA 2C2YA 4EEZA 3H5TA 4NATA 1C4KA 1U0RA 2RH9B 2IE8A 3PFCA 1CKEA 3PUKA 2WMYA 4HS9A 4YX9A 3G0HA 1H4QA 4J0DA 4ZT5A 5CBPB 1R74A 3H5LA 2X0IA 4KXVA 3AEQA 1O96B 4PZUA 5G0WA 4YRSA 1A2QA 2P1ZA 4WLNA 1KDOA 1NXPA 2G7ZA 2PLAA 3IQFA 4IDDA 4BS9A 4P4TA 2IITA 3EVEA 3G7SA 4B31A 1C4OA 3EA0A 3AETB 4Y1RB 5FOTA 5BN5A 4PCAA 3JWIA 4IJQA 4P3KA 4HT3B 1XVUA 4E4TA 5JYCA 5FV7A 3UMYA 4KO1S 2A2ZA 2PU5A 4P1ZA 4CLEA 4BRZA 4ERXA 1JG4A 4AG6A 3UB2A 2DFPA 2FPGA 5EMHA 5AR1A 3M70A 1HEYA 2D1SA 4DCNA 1SB9A 4EFNA 3IXLA 1SCAA 3K16A 1WCIB 4CMEA 4MRRA 3N0WA 3PTAA 2WSIA 5JUWA 3UANA 4N6NA 2ZJZA 1P2UA 4M8LA 1EP1B 1Y3FE 4NFYA 4ZYWA 5C7YA 2GJKA 3H87A 4RZHA 3RRXA 3FI0A 4EENA 1G6Q1 1H1DA 1K6IA 3M6LA 2NO5A 2Z2XA 3PPYA 4ALMA 3KVNA 3BMOA 4C08A 4JXKA 1MOSA 3V2HA 2IEDA 2GOYA 2CF6A 2I1QA 3BHJA 3G2MA 4W7SA 5KC9A 3IVXA 2H85A 1C8BA 3R4VA 1V37A 4Z0TA 1IDN1 3V00A 5EJEA 2ADMA 1PF7E 2EQBA 3IPAA 3MPOA 4OXIA 4QUIA 4RF3A 1H05A 1SC9A 4KPUA 4XWTA 5DEOA 1MPXA 4OD0A 1E2EA 2QD5A 4BOYA 3CF2A 2W0MA 5AT1A 2ZSHA 4RPHA 4RDIA 3EBLA 2HWWA 1O97C 5K8TA 1U65A 5TS3A 4D8UA 5I4BA 1XMQB 1Q15A 3LXRA 1AKWA 3KVRA 1K7SN 2ZJ7A 3MHTA 4XIFA 3L01A 3NW9A 4ZV9A 2VF8A 3HH8A 1YZQA 3JWEA 4B4KA 4OHXA 4ZHQB 3VO2A 4AY5A 5B57C 4FHFA 1AF7A 3CW2A 1KZ7B 3AOEA 3L8MA 4Y6LA 3ZDXB 1EX7A 1F9AA 4RA6B 4A9AA 3W9SA 4Y98A 3P26A 4KFRA 3ZI7A 2BKXA 2QLFA 3FYUC 4L73A 3UMBA 1E2JA 2VDLB 2RAUA 3SZOA 5FLXA 3BK1A 3MM4A 3HDGA 3C7KA 1O57A 4B76A 5CDYA 3D7SA 2GO1A 1CEQA 1VI5A 3L79A 2QR2A 4XLTA 3WK5A 5B4VA 5BOSA 3RLFA 1QH1B 3GLVA 2ZSIA 3ANXA 3NI2A 3OEHD 1L5QA 3TUIC 1IWOA 4XRRA 3C8HA 3UZUA 4HEQA 4HB0A 4CM3A 4K9LA 3K5PA 3ZKWB 4GG1A 5T8KC 1T6BY 2XDAA 4M98A 3MJDA 2GKGA 4F2PA 3JRXA 5E3HA 1NG1A 5GVSA 4KR3A 2WTNA 4QQ8A 5TIIA 4CM6A 3MCVA 2IS2A 5JS1A 3ZCUA 5TQ2A 1QO0A 1R8SA 2WJPA 4X3CA 2LDXA 1FW8A 3K2QA 3WK4A 1TM7E 2WYIA 3IP1A 2A5LA 2EF0A 2Z6QA 1CUBA 2PFSA 3M6XA 1GPUA 2PXHA 4O63O 5JS6A 1KZGB 2YFKA 3COPA 3RYHA 1KWKA 4DW8A 4FEYA 4K5QA 5H5JA 3A6FA 3RJ9A 3LZCA 3R09A 1FMFA 1XK6A 1LFDB 4DRXA 3RPEA 1ONOA 1F38A 3KYBA 2NZ2A 2OHOA 4I4IA 2QN7A 4JJKA 2YQ4A 3ZU2A 2I03A 3SX2A 2AKYA 1CS4C 4IVNA 3O0DA 3ZV3A 1KBZA 4LJKA 3HBJA 3ND7A 3KSMA 4TTJA 2VYND 3WQBA 1H2RS 4GP9A 4XVQA 3AF1A 4QFCA 2BFCA 1UF9A 1N6OA 3R3UA 2A5YB 5JDIC 3K1AB 2MR6A 4EQ6B 1VOTA 2HC9A 1O6FA 2W6MA 5M3BA 4ZU1X 2EKBA 3MRXA 4R2XA 2X3FA 4RIFA 2PE5A 1P2FA 1H85A 2ENUA 5G0SA 1MXFA 1X74A 2XIQA 4Q1DA 1VYTA 1G8HA 2C5AA 3F71A 2PX4A 4C43A 1GZUA 2W7TA 4ALKA 2QYHA 2GN9A 1WXGA 5T5QA 1N9GA 3WLMA 4MGYR 4YUVA 4NMWA 1APBA 2CSUA 2QROA 2AJ8A 4RHCA 3SI7A 4QYMA 5JYBA 3AX6A 4RHEA 5EHZA 1FP1D 3C87A 3RASA 4COOA 1AX9A 3DMTA 3UPTA 3I23A 1B6GA 5LP1A 3R3HA 1N7HA 1GARA 1CSEE 1WV0A 2HMVA 1B8UA 3PDIB 4ALIA 4BX8A 3E9RA 2J4CA 5AH0A 3OZBA 1NMYA 4HWTA 2H4WA 4KSYA 1V1MB 2WZDA 1P31A 1W6RA 1XZCA 1DEHA 3EX7C 1Q3HA 4ER6A 2INGX 1PDOA 1U98A 1V3VA 4EHFA 2WWYA 1G3RA 1EFVA 3CG4A 4B71A 3CKLA 3H3FA 2H2IA 3L05A 4HDCA 1AKUA 3ZZUA 1T5LA 3NHJA 3NC1C 4YUAA 5F3DA 3N2ZB 1IN4A 5K0BA 4NU0A 3LYLA 5THKA 2DJIA 2HLPA 1GZ6A 1HV8A 1SKAA 2J3DA 1WSDA 2HOQA 3IQIX 4MVJF 3T5CA 1C9MA 3L2OB 4AQ7A 4RNCA 4AJKA 1LJ8A 5EGNA 2YH2A 4DJDC 3OSZA 4JLUA 5KSYA 3FFTA 3QPCA 3KTDA 1CE8A 2A30A 3AUAA 4NNJA 5ALOA 5DYYA 3VR5A 3VPXA 2CJPA 5JXHA 3O38A 1RYFA 4GPAA 4K7JA 5KOHA 4OVKA 4HH4A 2Z98A 3RR2A 2DLCX 5DCUA 2AHOA 3DMPA 4JYMA 1TD9A 4AXXA 2O1XA 4H16A 2I76A 3F2VA 2ZI6A 2MYPA 3PVZA 3Q12A 4MAAA 5FWNA 1XC7A 2QGNA 1OYYA 1TADA 5JASA 3TFOA 1I6KA 2F17A 1M1YA 5EUQB 5IVDA 3BZBA 1PZHA 2WV7A 3D5TA 5I9MA 4B3CA 2ZXFA 4N54A 4GOLD 3PXAA 5AOVA 3EWAA 1K2VN 3PXCX 3B5EA 3HR4A 1SZDA 3KOXA 2YVQA 721PA 4EJFA 4I3GA 4F9GA 5IVPA 4DB4A 1IVSA 1SH7A 2GLTA 2B36A 3JRWA 3GFTA 4BHTA 3K5IA 1E4OA 2PANA 4Z6KA 4LYGA 4HDNA 3GGDA 3N2IA 5DNUA 4BFLA 5BSEA 4MVYA 2D74A 4FZ3A 3GEEA 5AW6A 5CBKA 4NDNE 2JEYA 1NF8A 5K2OA 4DV2B 4G5XA 5FOWA 1A9YA 1E3JA 1XI2A 2H8KA 3AJEA 1HTWA 2D0IA 2ZTLA 1GTSA 2ZM5A 3NM6B 4DKXA 3ZDZB 1CC1S 1AKEA 3P20A 4GAEA 4M0EA 1YBVA 2DOKA 1EQAA 1VTKA 3B6EA 3WLKX 4EF6A 5IZCA 1T2AA 4M0DA 4XGQA 4EYKA 2VJCA 4P7GA 1FNBA 1T8RA 4UVDA 4BFWA 3QVTA 1R5NA 1M9NA 5H3LA 2C5FA 4OAQA 4BFYA 3K4PA 2GERA 2QZSA 3PXGA 4OAOA 1BEZA 1I5OA 2BFEB 2EAUA 3EIEA 1QHGA 1W4ZA 3HLYA 4MB2A 2IDZA 2HMSA 2C99A 1YDGA 3DFIA 2VZEA 1QPZA 3UV3A 2VL7A 4CM7A 3HO6A 2NTNA 4PLCA 2A9FA 2XNDD 5L4SA 1FXWF 1ONBA 4JUAA 1T4BA 3HEAA 2YXBA 3UPUA 2G8LA 1E9EA 4KB5A 5JLJA 4LRQA 4BNLA 5CAEA 2IYXA 3E53A 1H0HA 1WSAA 4PC7A 5LUBA 3MJHA 1K8YB 5JRDS 5A02A 1FUKA 2FTKE 2EW1A 3I6ZA 4ZRNA 2BMWA 3G7UA 4C5CA 4BU1A 1SVIA 2GBLA 2GVZC 5M5BA 3DW1X 2HJ9A 4NHEA 1F2DA 3FJOA 1NAIA 3H1TA 3I2JA 4ZYZA 1ST2A 1T13A 2V6JA 4QBFA 2XI4A 3R3SA 2PUGA 1I7NA 4A23A 2XWQA 4IDQA 2GHQA 5G0UA 1MVNA 3PR1A 3ZY4A 5FPHA 3KKMA 3T12A 3W2EA 2LUOA 3OJ0A 1TA9A 2PUVA 2BMEA 2AOTA 2C84A 2J9YB 4KXXA 4O08A 4E51A 4EJSB 1SIBE 1TB4A 3LECA 1AKQA 3SIWA 1G2IA 3VKUA 3BD9A 1XMIA 3DE5X 3NIGB 1LNQA 1PR1A 3V3KA 1GPDG 1LEHA 1EA7A 3GBPA 4HDMB 4LZNA 4U7JA 2HF7A 2R8OA 4HRAA 2PXXA 5EUBA 3MCTA 4JJEA 4LECA 4UBLA 1P80A 2WAYA 1QVRA 4RHXA 4YRAA 2WP0A 4ZOQI 1G41A 2B5WA 1N6HA 3PNOA 4JVLA 4KGDA 1TMYA 2ICAA 1U3DA 1K0UA 2JI4A 4A26A 5AIBA 5ESXA 2X4GA 3GQBB 3C7DB 4AI6A 1IM8A 4DGQA 1IY1A 1EXNA 1JB1A 1KYZA 3Q0EA 2EFDB 3OBBA 3P19A 2R8PA 4AK9A 1TVCA 4BBAA 4RV9A 4YUWA 1IIBA 3EASA 1K4MA 3V46A 4EJ0A 1VL2A 2X0DA 3U3JA 3ITDA 2HRRA 1QAQA 3OU7A 4H1UA 4I5GA 3OLWA 3TKAA 2BTQB 1MX5A 3HKBB 4UBIA 4YMWA 5LQUA 1O95A 1E4VA 3ASUA 5KYYB 2RHCA 2G3YA 1BCSB 1GEGA 2BFBA 1XZIA 1Z07A 3FMIA 3D43A 2BISA 4FDVA 2Z2IA 3OSUA 4R8KA 1WD7A 2WJZB 4F21A 3AL2A 5ERXA 2ZYIA 1E64A 1C30B 1UMCB 4B09A 4F8YA 4DG5A 2H7XA 2IYFA 2LKDA 3PIRA 2J07A 4GQBA 4B3JA 2NXJA 3GFOA 2BF7A 3D8UA 4XYGA 4I5EA 4F71A 3U4QB 3QLUA 1SVUA 2GDJA 4M1OA 1L4KA 1Z22A 2ZT7A 1HA3A 5JO0A 1Q1EA 3PV0A 4GX0A 2NZYA 4P9NA 1U3FA 4GI3A 1XIVA 1F51E 1NW7A 1PYDA 1XVLA 3ZDYB 4AO8A 3IE2A 4TV8B 1RLIA 3ROFA 1X94A 3RHFA 3T5GA 4JITA 1K6MA 4EPVA 1P39A 1RKXA 3OWHA 1UC5B 3LVBA 4UCFA 3GA5A 5FOQA 4FR5A 4MS1B 2H0QA 3VH1A 1U7ZA 1O87A 2FWPA 3ETJA 5C8DA 1MNQA 1TLFA 3T35A 1BKYA 2BR5A 3P96A 3NVDA 3ZUPA 1KEKA 3S2YA 2WAMA 3NYIA 2XLCA 4JMLA 2OPHA 1JFRA 1OASA 4MQBA 1NVEA 4CIXA 2EJTA 1NW8A 1GYQA 2BH2A 1A3CA 1XSEA 1UK6A 1TO2E 4NYJR 3A4VA 2ADFA 2O50A 3EVAA 4Q9DA 3SYKA 1HDOA 2F9FA 2O14A 3LWBA 3TZBA 1GG9A 1U8CB 3CVOA 1G7TA 5DSTA 5YASA 3W6PA 2JLWA 1CBUA 5G3ZA 3THRA 3T1NA 2DWOA 4C7OB 2GCEA 4IS3A 4CN8A 4LJYA 1VBFA 3OU2A 1QGYA 3HZRA 3AHEA 4NJMA 4W5TA 4B48A 2R86A 3ZJVA 3H9QA 4GWLA 3DB2A 4HYQA 1MEEA 3I73A 1F14A 4JQOA 1MW9X 4ZQHA 4IXTA 3SBXA 3IVCA 3EUWA 2OORC 3P9NA 1IB0A 1TX4B 4GKBA 4UE3S 1XLTA 3R75A 3OZVA 4AYTA 1MW8X 1TAUA 5T64A 4X7PA 4AM8A 4PPFA 4W9NC 2VLBA 2X77A 2FW0A 4S24A 4AZ3A 4ALNA 4LTMA 2C54A 4HDKB 4RPJA 4FX5A 3BICA 4NLLA 1C7IA 2XHEA 1QHHA 1AHNA 1UKYA 3MJFA 5EIBC 2FEAA 2G08A 3L02A 1MQAA 1ONPA 4GKAA 4BKPA 1X1EA 3ISJA 4GOXA 4TTVA 4ES6A 2RHTA 1QFXA 4Y2XA 4Q24A 3TDKA 4UCWA 2Q6VA 4QU5A 2WFLB 5A9TA 1ZGJA 3TI9A 2R1TA 1GGMA 2Z3ZA 3NTQA 2PX0A 4MW2A 3T1OA 2IZ1A 1E5TA 2EBUA 1KFJB 3WIOA 4P5PA 7MHTA 1CUYA 4R2MA 2WOOA 2BPOA 1P2DA 3A9UA 4D9IA 3AERB 2WF7A 3EZYA 3Q40A 2Z8YM 1ZH0A 2YW2A 3I6IA 3L4BA 4DE5A 5A5FA 3DL2A 3C5VA 4KG7A 1Z4PX 4RAQA 4Y1FA 2CNWD 3K1ZA 3A4YA 3FNBA 5HTOA 1JBKA 4ZVVA 1U2PA 1RM5A 2IDKA 4EJSC 4MLDA 4BLRA 2X1LA 4DCOA 4WFJA 3SE7A 3Q7TA 1UP6A 3NTVA 4B85A 3PNBA 4ENRA 3K71B 1JYSA 2R6CA 1GP2A 3EJWA 2YYAA 1FMCA 1CDOA 1POWA 4H1HA 4QNNA 2ZI3A 1U8AA 3NC4A 3ND6A 4JL6A 1QZZA 2B82A 3HA7A 2EFJA 2X7XA 1AA6A 5ALPA 1G5QA 4L4YA 5A71A 3HYSA 1NKTA 3SKXA 1AURA 4TKVB 2R1VA 2VPXA 3F8SA 4Z1MD 3I52A 3OX2A 4YQEA 1ZS9A 1M72A 1LDYA 3WK9A 4AMZA 3M1LA 1TZCA 4F12A 1QS0B 2KB0A 4YMGA 2Y6VA 2D4AA 3F6YA 2P79A 4PBRA 5FUBA 2XZLA 1N7JA 1J8FA 2QPAA 4WLUA 1IZ7A 5IWCA 2X1HA 3CF4A 5K03A 2M6RA 1ZJZA 1RZ3A 5FBVB 3ZDAA 1MAUA 3Q3EA 3DULA 1ZGGA 1U2DC 4V3CA 3S99A 1BGXT 1RRPA 5HZMA 5KCMA 2QORA 3PR3A 2NVBA 4XGRA 3TRIA 4CCSA 1NNSA 3GIWA 4RY9A 4YJHB 5AICA 1LTQA 4QT4A 5I51A 3GQVA 3ABZA 2BGWA 3MQ2A 3U17A 2Q4TA 1NLZA 4MJLA 2O06A 2E9SA 1TU3A 2ZS7A 2F1RA 1LK5A 4N0DA 3EBOA 3FDJA 1L4EA 3OHSX 3BX1A 3R41A 2ZR9A 1NP7A 3IULA 2OY0A 1D1SA 3FKSD 1NVAA 3AR5A 5JBQA 1ULSA 5G41A 3FLAA 4E5SA 4FJ0A 4FGUA 2JLVA 3IJ5A 3UK0A 3JALB 4DOMA 3VXKA 4IH4A 1NUAA 3G0OA 4GGMX 3MCAA 2QD4A 3VR3A 2I9KA 3ESAA 2ZJYA 3KOWA 4DF3A 4MTCA 3BRQA 2P9FA 3C24A 4M99A 1VJ1A 4Z9BA 5EYPA 3SKVA 5JSHA 1RWNA 4LOHA 1MO2A 4AJ4A 2OYSA 5JBNA 3EVCA 2VBCA 5CH3A 1SUAA 3K9GA 2I4TA 3IIIA 3EGDB 1VHLA 2IKSA 5IHXA 2H9IA 3HCPA 3O1LA 5KTMA 3DLIA 3IT1A 2AEMA 2OK7A 4IV5A 4N7MA 4MH0R 2WWRA 1LPOA 4MV8A 1NBMD 1E59A 4NZOA 2AUMA 4RK1A 4G97A 3LDAA 4DUGA 2NAFA 1AB5A 1S2IA 1O08A 2OCIA 4DEXA 3CUTA 5DHTA 5FBZA 3PCTA 2D1TA 1FNMA 2XUZA 2REQA 3QFSA 4KU4A 4D57A 3AXSA 3QBEA 5JNVA 1QFZA 3H3JA 1ODKA 4LWQA 3N2KA 4Y30A 4PLTA 1E6EA 1JIVA 2WFZA 3OPYA 3RHTA 1BWSA 1JDBC 1RJ9B 2IUYA 4FXOA 4RZSA 4ZV7A 3TZQA 1OILA 1D1PA 1KMHA 2ONZA 3KP1A 3PD7A 3PCRB 4KQJA 4OIFA 1W35A 3IHKA 3AUJB 2VRCD 4MUHA 5F4ZA 2C58A 3C5EA 4AJEA 1L3IA 1ABBA 2X42A 4A0GA 1Z2DA 3GYGA 3AHDA 4FN4A 3QXXA 4FFSA 1U8YA 4L0CA 1AIPA 2PVPA 4GMGA 1RLTA 4ZANA 1TGYA 5JG7A 3M89A 1UXIA 4BTLA 5AK3A 4MZXA 1PJRA 3PQ6A 3W5BA 1EFUA 1K0FA 2PZJA 1P0QA 4QVKA 5KUTA 1U28C 1QJCA 3G2JA 1DWPA 1SBIA 3R6WA 3UG6A 4D4MA 4MAFA 2WOJA 1C9DB 2XMDA 3BSWA 2GRAA 1CR0A 2C2BA 3THOA 1R6XA 1E58A 2V3VA 2ZR8A 4EUEA 3L82B 3FR8A 2Z6UA 1J0AA 5CM9C 5G4KB 5LXTA 3MWEA 4OQQA 3JAWA 4PX2A 4WKPA 3VH2A 2PO5A 4C4PA 4ZDIA 5AVKA 1EAYA 1R5BA 1SG6A 1UKZA 4FC6A 4R8LA 4LXHA 4XR4A 5JSYA 5AW8A 4DLNA 4JL5A 4AWBA 5BYJA 2B3TA 1GR1A 2Q5LA 2ZB8A 2DVMA 2NO0A 3JARB 4TXHA 3FCEA 1PTKA 3ZI0A 1I36A 1TJPB 2F3QA 3WKCA 1VBNA 3QFCA 5BSRA 1P2SA 2IYZA 4YRJA 1J0BA 4B43A 1HE2A 4QX6A 2XMCA 3S0JA 3UEOA 1FFEA 3SF0A 1GGNA 4CF4A 1NI3A 3HDYA 2XAUA 1DCKA 4XASA 3OM9A 3L0CA 4JBWA 4ZZ1A 1U7HA 1W49A 2CJWA 4M6WA 4NJEA 4RUKA 2Q1XA 1U0NA 3HE3A 5CTJA 2J85A 3R0QA 3DT8A 4J2OA 1QUFA 4Q9AA 1Y6RA 2O2JA 2HMYB 2VNHA 5DNYB 4DV4B 4EO4A 2W98A 3E82A 5ES4B 5FTKA 5EWLA 4C05A 2J5QA 4ZI2A 1BVYF 4YQFA 3GW8A 3STTA 1GCGA 1UWCA 1AK2A 1JDSA 3JQ9A 4FYPA 3B12A 4OUDA 3Q6IA 3TO5A 3TZ6A 4AP9A 3AEZA 3AT1A 1LK7A 4GPEA 4GWKA 4QXOA 3B7GA 5A6SA 5HRCA 3ONVA 1OZ0A 4J2HA 4XSGA 5EZYA 3DKIA 4RESA 3RFCA 4YGXB 1KXJA 2J6CA 3SM9A 5CDSA 3MAAC 1SXJD 4CTNA 1DAHA 1NDUA 3AR9A 4KO4S 5I7SA 5E1BA 3LOQA 3VC1A 3K70B 3TZEA 1PQUA 3GO4A 3NDJA 4C1NA 5HJ5A 3JD1A 2JFQA 2OCYC 1NXOA 2R8RA 4DCTA 4UTPA 3EAGA 3C14C 2K6GA 3WNDA 5KQGA 1G8MA 2PZEA 4UVGA 3CHYA 2O3TA 3D6VA 2Z56A 1Z12A 1KYTA 1OTHA 1QP8A 1RHRA 3GRYA 1FX1A 4B0OA 2YMLA 1GEEA 1W2WB 1G64A 3BPSA 3MD9A 3SJAA 3HXOA 3DXFA 3H2YA 3ORHA 1BSVA 3H0CA 3SHOA 1Q0UA 1BJRE 4MUFA 4XPIA 3SYTA 2O8NA 1LX6A 2QL6A 1GQYA 3SS9X 1YZVA 5F77A 3FYSA 1BGVA 3TSOA 2F8MA 3O8RA 2UZ0A 5JXGA 4X93A 5FPSA 1C3XA 1DC7A 3WRYC 4RU1A 4YFVA 1AS0A 2W2VA 4GUAA 2Y1WA 3FKQA 1QZXA 4X8HA 5TEVA 3PB3A 1B23P 3QYAA 1XZ8A 2JAQA 3TIIA 3WYEA 4EKDA 5JH7A 2EEZA 4O4LB 5JAQA 3U39A 3K0HA 4EPYA 1MC8A 5ED0A 2F6RA 4E2FA 1TRKA 4OI2A 5TF4A 5C8ZA 1NQTA 1HQCA 1FXSA 4NOKA 1GQFA 1PJ4A 2F90A 3I1FA 5BSUA 3SJZA 4LC0A 1A4IA 4DABA 2DFLA 4YRMA 1YOBA 2R6R1 3LK7A 4UMEA 3KKLA 5F9HA 3I8XA 3B9QA 1XMSA 1UL1X 3TMKA 4KFTA 2VT6A 4DV3B 1T0IA 2CE2X 3OTOB 4CDGA 2FEOA 3JD3A 3WSVA 1H2EA 1CUIA 4UUMA 3H2SA 4DV7B 5I4KA 1RJGA 2R6GA 4B4UA 3C1OA 3CR3C 4GR9A 2IYLD 5K9ZA 5FBRB 3GMSA 3JWGA 5T67A 4LBWA 4DB2A 2F55A 2HREA 3HEMA 1DOZA 1N7GA 2B8TA 1NZDA 1SUCA 2FEXA 1LWOA 4RYDA 2O7SA 3SQWA 4G63A 1FJ2A 2EBFX 2XGMA 3H5NA 4PBTA 4IX1A 2H4HA 3HGQA 2WHYA 4MDHA 2ZCVA 1Z4OA 4NL4H 5GIOE 3I9OA 4G5QA 1JZSA 2CXXA 2FRVA 4QPDA 2V6BA 3DCJA 2A59A 3F6RA 2W8ZA 1ZA2A 3KT3A 5E95A 3PGXA 2QTVB 3R24A 4MQLA 4LA4A 3UAOA 4LQ4A 1OFUA 2R4UA 4RZIA 3WFJA 1V4VA 3EMVA 5DYWA 3R23A 5H4HA 2FPOA 3WXMA 3JQ7B 3OOWA 6AT1A 3A6KA 3WL7A 1PFWA 3ANLA 2BV3A 4IQ0A 5AVOA 1MC4A 3HJAA 1PW7A 3QBDA 4LC1A 4DZRA 4BNGA 2ZRIA 3GT3A 5FWYB 4E21A 2H7CA 4ER7A 1JHYA 2V6MA 4F4FA 1CEXA 1IUOA 1ZESA 3LCUA 5LA6A 2NXWA 2ZKLA 4G1CA 4OQ4A 1U2ZA 1DX4A 1UK8A 1VXOA 3MPUA 3OZUA 4TTRA 3O1HB 3S28A 1YR3A 1II8B 3N0XA 3VI4B 1AUOA 2POQX 2WIGA 2GHIA 4OI4A 1T36B 1C2YA 1LU9A 2B20A 3UJDA 4URVR 5CUQA 5TGTA 3ZXUB 2WNIA 3CNEA 3IS3A 2IYQA 1DX9A 4KQIA 4X24A 5KNBD 3O03A 3A1CA 1R3DA 1H42A 4O1IA 1ZGZA 1NMZA 4YRDA 2OHHA 3WISA 4MHTA 3TMYA 16PKA 3G5TA 4JBXA 3G2OA 3OF2A 4UASA 4YP5A 1ZMXA 3RRYA 4LZOA 3DEHA 4YR9A 4BN5A 4YXWA 1Z39A 4F1WA 5SY9A 4JP8A 3DEFA 4NH4A 5L3VA 1US8A 2GXUA 2R84A 3FBWA 4II3A 3SQOA 3ZY3A 4BN4A 3WYDA 4KITB 4GU5A 2ZG6A 3ZTWA 3E9ZA 4G9BA 4ZFNA 1ENYA 2A3NA 4TWIA 3S1LA 2WHRA 2CHFA 5FL3A 1M75A 1KH2A 2AUNA 2YZKA 2QV0A 4J3NA 2BKUA 5JZVA 2EWVA 3FG9A 4M21A 5DLDA 4YI5A 4C2AA 5LZ9A 2VDKB 1YJBA 4EI7A 1J9GA 2ONJA 4V1CA 3Q8WA 2NSLA 1EK2A 4MKRA 4MHSA 2Z6AA 3GRKA 4W6QA 2VJMA 4OK3A 3WTCA 1KAHA 3QVWA 1OIXA 1YHYA 3JQGB 3W7VA 1K2WA 3N3AC 5LIRA 1O9BA 3RBAA 3SC2A 3O4RA 3DTYA 2AV6A 2GNPA 2Q28A 3CRRA 2HWUA 4KPFC 5IYZB 2P3OA 1T6ZA 4ME6A 4J07A 4NZYA 4TWZA 1PUXA 3COZA 2F1JA 1V1JA 2DHQA 3VHRA 4F3RA 1YJAA 1P7CA 3ZVLA 3Q9NA 2ZT5A 3QVGB 1ZG3A 2CYBA 4OFXA 2XVYA 4XIIA 1JJFA 1N3IA 1S89A 2AXEA 2C7VA 3A4LA 2I4LA 3BN3A 1PJQA 3DGFC 2Q5HA 3NWPA 3PQDA 5C8YA 3ZGVA 5IANA 2V5VA 3M6WA 3C1UA 3P9SA 2G0NA 1D7OA 2XQFA 3B1YA 1QOQB 2IYOA 4MW4A 1I4EB 2B7LA 4TXLA 5BNZA 1TYZA 2KBEA 4WSOA 2Q1SA 4MUYA 2ZWPA 1A9QA 2DPGA 3KPUA 3CLUD 1ZWLA 2IU3A 1DADA 4G4SO 1U5BB 1P0PA 3SYNA 1P4GA 1U6JA 4R40A 3UXHA 3VMFA 2XPCA 4GXQA 3Q1KA 3AR7A 1JQKA 4U8HA 1T1IA 8ATCA 2W43A 5LQJA 1V71A 2B21A 1EJ0A 2ZATA 1B4DA 2LIVA 3PIIA 3QI7A 3TS1A 1YO6A 4CMIA 4B75A 3A1DA 3OLZA 3PEEA 1HZZC 2X8JB 1SKQA 1FZTA 3VDRA 1UJ4A 3NOQA 1GNLA 3RROA 5AVYA 3THWA 5EKXA 3IOEA 1ECPA 6REQA 1N3LA 2HQ1A 3UW3A 5B7QA 1TQ6A 1VLJA 1ZQ9A 4O5AA 2AZMA 2I54A 5FL7A 3UHJA 1QR2A 4TYWA 1G1AA 2A1TR 4H4CA 3DHYA 3AF6A 2QI9C 3QJYA 5A0FA 4DN6A 2FX5A 3VAAA 1XHLA 1BU8A 4FYVA 2OBNA 4ZVKA 4LQCA 1HWYA 2VEOA 4LXTA 3LBHA 1Z8NA 2VA8A 2G63A 1FP7A 1NX9A 3QV2A 2RH5A 2DWQA 1AZWA 1V48A 5KJ6A 5B55A 2R5FA 1ZZEA 4OQYA 2ASVA 2GPJA 4J6FA 3MMNA 4YAWA 3LUPA 4QGAA 3CH7A 4IF6A 5B3KA 3VO8A 4FFLA 1ZD8A 1NE2A 2EGUA 1VG1A 2O6HA 1EHYA 2C59A 1A7JA 1V96A 5K8IA 4URFA 1X8LA 4FYXA 3BE5A 2GN1A 2NZJA 2Z8ZA 3JVIA 4GRDA 2Q5CA 4J4BA 5BV1A 3KQQA 1NSTA 2FXVA 5EQJB 3D0QA 3GNTA 3IFSA 3HCOA 3HHPA 5FKJA 3CLSC 5T57A 3R9WA 2ZYAA 3DE6X 3FWKA 1XZLA 4RVSA 1K75A 4WBNA 2EL7A 3PR2B 2EZUA 1JAIA 2NU9B 4PRYA 1Y1RA 3UNXA 5DBGA 4RQTA 3QJ5A 5DU2A 3L06A 5EUMA 5LXTF 1XPJA 1ZNWA 1YGPA 1ZOLA 1WLSA 3U1BA 4YJFB 1R8XA 2WHXA 1E60A 1U2GA 3OJWA 1G21B 3R5HA 1ACJA 2DUUA 2XODA 4FMBB 1XU9A 1GGJA 4HEA1 3O82A 4MW5A 2RJNA 4UEJA 4CLRA 2FFJA 3IRUA 3H1EA 3FJYA 1PN3A 2NIPA 4CF3A 3FMPB 1F8GA 1F4LA 1ODJA 1USVA 1VKRA 2C2HA 1RS0A 3ZGNA 1PUIA 3F7OA 1I2DA 5IN5A 2DCUA 2M32A 3DAFA 4FUTA 3AWDA 4IZ6A 4MI1A 2PLFA 2FSPA 1KE2A 3ZEIA 4ZMSA 5JBIA 4JXZA 2AE1A 4Z7QB 1BU5A 221PA 2CLEB 3BILA 5ALDA 3M4NA 1WWKA 3GLGB 1VCNA 1Z33A 2ZJ8A 1XEXB 3ACBA 4NYMQ 2AZXA 3KQOA 5C5DA 3SX0A 3W6ZA 3HB7A 1F2TB 1I7LA 4L4UA 3TOZA 1E7WA 2NUPA 1V45E 1P7PA 1OAOC 4LHEA 3O4GA 3CS3A 1NR7A 3DD1A 3CNLA 3Q8KA 4ZPXA 1EUCB 4LIPD 1JXOA 1Q92A 5FB3A 3OG9A 1NUTA 2QE7D 2GUGA 3U3RA 1T4CA 2SKDA 1NY5A 4Q4AB 5EZYF 2V7QA 5HMLA 1P4HA 3ND9A 4EO7A 3TE6A 2CXHA 5J43A 3B20A 3QY0A 5KU7A 5AVXA 3ZD6A 1C7QA 2DCMA 3K9LA 2C97A 1KEWA 2V9PA 3EOAI 1WXHA 2GPAA 3NYRA 4HNSA 4AG5A 3TH5A 2QV7A 1RFLA 2FW1A 3B9BA 1CB7A 2P41A 2CJXA 5AHRA 4CKYA 1OLUB 2HFKA 4HFJA 5DNWA 1HH4A 1SQ5A 2F8LA 5BR1A 1OH5A 5ECYA 2IU6A 1MD9A 1WAMA 2BJHA 2D59A 3MTAA 4JI4B 3VBEA 3A3KA 2ZTVA 3MJSA 1QVVA 2J67A 2DQSA 3DAHA 3GFBA 4ZEWA 3I62A 1YACA 1C3OB 1HEUA 1H5UA 2DTXA 3O4VA 2D7DA 2BMAA 3DDHA 4G1VA 3RQIA 5HQTA 2I91A 2QSZA 2CE7A 1MRZA 2NU8B 3UA3A 4B82A 1WE2A 4ARVA 1P6XA 2VNKA 1BHSA 1U90A 3B60A 3N5KA 4OQDA 3SXUB 3RAFC 4TSFD 3EVDA 4UNIA 5DMHA 3CH5A 5JH7F 1KIAA 3B3FA 3MT9A 1G5PA 1WHSA 4R01A 5CNKA 2ZJ1A 4WD3A 2CF5A 2QAGC 3FFBA 4PYMA 3WNQA 3FTEA 3NGMA 3QMPA 1SUIA 1ZBDA 4FCTA 1MMFB 1RWQA 2IXBA 4PRKA 1P44A 1BC5A 4CM4A 1COWD 3BGWA 3E9YA 3K6RA 4KIJA 1EFTA 4JP1A 3HXPA 4UTOA 5ADHA 4UM7A 5FV4A 1NLYA 3BDAA 4FWTA 2LW7A 1JV2B 5AI4A 5M2QA 1NQWA 4MYHA 3MUNA 1G7CA 1ZC3A 3A26A 1BMQA 8ADHA 4G0XA 2YASA 1SOMA 5IT5A 2HJSA 2ZE8A 1V7CA 4Q7MB 5EHNA 2MU1A 3D02A 1LZKA 3ZLVA 3GLIE 5DLEA 4CU5A 4EB6B 3HA3A 4OLBA 2O8BA 3ED1A 2VHCA 1H69A 1I6MA 4IO1A 2H5JA 4XPZA 4OTZA 3UJ8A 4ZGWA 5JNUA 1XLVA 3TCNA 3LF1A 1CD5A 5K0ZA 3IILA 4F97A 2XUQA 4EECA 1FDOA 4AMUA 4R41A 2HHJA 1Y3CE 1ZVVA 1RI5A 3BIXA 1YZHA 1TF5A 1V1RB 2RB4A 2A14A 2VUIB 5EHIA 5EJIA 4AQYB 3IPCA 4MPJA 2HJHA 1E4YA 4R2IA 1BXRB 1KGSA 1FU8A 5DT9A 1EFAA 1W0KA 1CQXA 3IRVA 1A9PA 2H4FA 4WZBA 3UWKA 4A5OA 3NEYA 4OXNA 3GUYA 5HIJA 3WV4A 4CI9A 4ZCLA 2IDMA 3EGOA 2H59A 4MP3A 3L4JA 1GUDA 1LNZA 2B8WA 2RHRA 2ZJ2A 4M1KA 1E5XA 4XDGA 5FTNA 3HVHA 1AN0A 1WXDA 2F9MA 1C7RA 3PJFA 3ZWKA 1DCFA 2D3TA 2PY6A 4IV0A 4KO3S 5C31A 3WQQA 2WTUA 1KP2A 3KXLA 1O94A 3KT6A 1Z2CA 4KQ9A 4HRXA 4Q01A 4BKRA 2Q29A 4JLVA 2VSFA 1KEVA 2YRXA 1S4MA 2I2DA 5LA6F 2QL7A 2IE0A 2EHJA 2PUTA 1Q0LA 5AI6A 4EPTA 4ZQCB 1MB3A 3U4DA 1TU0A 5FWDA 1JDJA 4YP6A 3FTQA 2WHQA 5BWNA 2EZ8A 3EXHC 3ANMA 5LDHA 3M9XA 2CB9A 4PNEA 1CJSA 1XWIA 3OTGA 5JTUA 1PYOA 3VVBA 3LP6A 5C7IO 2CBZA 1WMBA 4DQXA 1XYVA 1D2AA 2F3UA 2L82A 4JASB 3BJIC 3UG7A 4RA9A 1X7GA 1ZKMA 1TE2A 1VL0A 3G2KA 3UMRA 1AGXA 1Y9AA 2GLXA 4FKZA 4HCJA 1U1DA 4P34A 4UU7A 1TM5E 5SYAA 4I1YA 4YV7A 3ZDCA 1KPIA 3QELB 4F8JA 3AQIA 1HDIA 3LKBA 2VHXA 1HQYE 1NBWB 4BVBA 4W4TA 3V8EA 1HDXA 2SCUA 3S2GA 1RR6A 1S4QA 3N76A 2CBGA 2JGIA 3DWGA 1EI9A 2R6DA 1A8QA 1E1CB 1GR0A 1G55A 3WWZA 5ITZB 5ICEA 4CKWB 1U8TA 5F12A 3RSFA 3U7FB 1YTUA 4X66B 2YZGA 2JJ1D 1T8WA 1HYQA 3SEZA 1FLNA 3ZOZA 1P2TA 4GX1A 5IPFA 4XM0A 1MUUA 2I6UA 3HP7A 5L8VA 2Z57A 2H5LA 1ZP6A 3VJKA 2O23A 1EX9A 5A9SA 2DPXA 3C4VA 2V65A 1ETUA 3BUSA 3RFUA 3KOYA 3IMGA 1HRDA 1JXQA 5CXUA 2W4IA 1X7YA 4KE6A 1Y9ZA 5AKIA 1Q74A 2FEMA 3PX7A 3RI3A 2M9MA 2BP7B 4XX0B 3VR2D 4HV4A 3OICA 4UHHA 1BE1A 2XBUA 1T34A 4XB2A 1CP3A 3KTAA 1BROA 2PIAA 4B47A 1SKBA 3MTQA 3SE0A 4G37A 4U2GA 5B1IA 3QFRA 1H1LA 2XW6A 3KUUA 3UB4A 2ZRAA 1CX9B 2WVGA 2YUIA 1OA0A 2VHQA 1JHXA 2VI5A 1ISFA 2WR8A 2FB9A 4P93A 5A7HA 2CT8A 1DRKA 5ALKA 2VAXA 2JHFA 2VIIA 3NHRA 2YJNA 2VP3A 4G89A 3EZXA 4IBOA 4CCYA 4YI3A 1U11A 1UQRA 3K9BA 5C8YF 1ZKDA 4D4GA 4A5SA 4JUCA 1RQ7A 2QM7A 3AI2A 5JTTA 3HL4A 4KAFA 3RS8A 2ZRNA 2I7DA 3JYNA 4MWZA 1T5BA 2CXQA 1ZN9A 5C1BA 2PJRA 1R0ZA 2BFDB 1I0LA 5EJMA 1OMOA 5EIBD 1JX6A 1R3UA 3R5SA 1PT7A 2EG5A 2UVPA 3CRVA 1W0JA 1OBVA 2PRIA 1OAAA 2HA4A 3N74A 4RGBA 5ALWA 4PGFA 3RODA 3VPHA 3A58B 5IRCD 2GF2A 5ILOA 4AJIA 2XADA 5KYUB 2I7TA 3NOVA 3HP1A 4OQMA 1XNRB 4GT1A 3GLFA 4X62B 3BE8A 1O0BA 3K6SB 3VSAA 3LPLA 3ACDA 1JQBA 2EWMA 4UHCA 3K7EA 1B15A 3R3VA 3ZS9A 3KUDA 4CCAA 5I7EA 2E87A 4G0WA 3L8CA 3NVKI 5JEDA 5L4NA 1RM3A 3WL3A 1H0KA 1Q50A 3WMRA 3RIHA 1XL0A 1NQUA 4NXMB 3QH4A 3LO8A 3NS7A 1FQWA 3K2BA 4MR7B 3R9IA 2RGNC 1UPXA 4KP7A 1J20A 2GXSA 3STHA 1P3DA 1J5XA 4RKFA 3AHCA 4OGWA 5KNBH 1LD3A 1LSUA 2DUMA 1CY7A 4M89A 2RGUA 4X60A 3H1GA 3ZCPA 3AI7A 3EPKA 3TOVA 3IC5A 1EXVA 1BN7A 1SRRA 3EFOB 3QKSB 5ENZA 1S2LA 4YJ3B 3WZ2A 2QDKA 4GPBA 2FHSA 1EWVA 1S3IA 2Q1WA 4HGOA 3L49A 4C3OB 5LU9A 5SZIA 3W3AH 1U4NA 2E4ZA 1W9MA 2V0NA 3BD8A 1BXGB 3DXYA 3NNDA 1SU7A 2I5PO 3H84A 4B0PA 4DT1A 2CNNA 4KNYA 4C4TA 4Y67A 2F8TA 1HT1E 4IIJA 5ARBA 5EIAA 2LD4A 2V8BA 4FFBB 4E1VA 1P9OA 3LOUA 1GKKA 3B1XA 1EZ4A 2Z0MA 1ZU4A 1FRNA 3G9TA 5IN4A 4U6QA 4V2IA 4AJPA 2GYVA 1U1CA 3BSFA 3IPLA 4RZUA 4QYSA 2JBWA 3C3PA 1QV9A 3P0RA 2POCA 1O77A 1ULAA 2I62A 4MIEA 3RAJA 2FPKA 4GZ5A 3CX6A 3PEUA 3R6TA 3FZGA 1XA3A 4WBNF 3IUPA 1A5AB 1RWOA 1CY8A 4PZDA 4AZTA 1SOAA 3A3NA 3G23A 4BWFB 3GEPA 2R96A 4GEGA 5F5LA 3CUYA 2C9DA 2O8CA 2QJRA 5CFOA 5FOUA 2QRVB 3DC2A 4FZRA 2JLUA 1K7EB 1NC1A 2QTNA 1VIYA 4MR9A 1D0SA 2CLCX 2BGJA 4FJ1A 1R5JA 1TM2A 1HT2E 1ZD4A 2FP4A 1BDBA 1Q77A 4A0SA 5FUQA 4ENUA 4CLHA 2O2SA 4RSGA 5CLFA 2O19A 2J30A 1YR2A 3HJFA 3BTSA 2JK1A 4TROA 2C7RA 3L7IA 2E5WA 3Q3JB 1X87A 3MINB 4WN9A 3RS5A 2XQVA 2QN6A 4DDKA 1AKTA 4TPKA 4KLCA 1DVRA 1L4HA 1ODCA 2WU8A 2EFEB 3IDSA 4AZWA 4IUDS 4ESEA 4RY0A 1KI4A 2ROQA 5EAIA 3ELDA 4D4KA 4E5VA 3JATA 2YWXA 3JYOA 1WZ2A 1V2GA 1H0SA 5JC8A 4HC4A 5FADA 3SYLA 1H2YA 4BNFA 2XRMA 1JHOA 4ECEA 1IJFA 5LBUA 3NANA 1NW9B 4LXXA 2JA2A 3BXFA 3OWXA 3WVNA 1AXGA 4L5BA 1RKQA 4GYJA 1IEQA 2DFTA 4LZJA 1SCNE 1IMOA 4J1TC 4MJ7A 5AK6A 2D8AA 3I39X 3JSAA 3TPCA 5CHEA 1KZ4A 5EP4A 3ZWWA 4FYMA 2O5EA 3P4UA 2YQZA 3ONEA 2WJ3A 4HTFB 5E38A 3W5DA 1R6VA 1EE2A 4HSGA 3COVA 2GF9A 3OZ7A 4H7FA 3O7MA 2Q8PA 2IZ0A 4ZVUA 3R44A 4PAQA 4OY3A 3VTFA 2VT7A 5CLGA 4ZZ3A 2Q2VA 3HL0A 1AO3A 1T5HX 1C9NA 7ABPA 1XDZA 5BYKA 3OP4A 4XIJA 8LDHA 1Y8RB 4UBOA 5LVAA 2E82A 1MA3A 3B7WA 2Q2NA 4YJGB 2VDPB 1J25A 1GGEA 1P2BA 5EXDA 1L8OA 3SC6A 2HDHA 2H2GA 3F1KA 4LSMA 3FVTA 4CR6A 1OXTA 4BVJA 2P9BA 4X8OA 4B3GA 1OBCA 1JA0A 1G4HA 2PBZA 1VLZA 3TAUA 3FTCA 1M74A 1F3LA 2OBXA 4QXMA 2NPFA 5HK9A 1E3IA 1Q0SA 4UHKA 5JSFA 3DR5A 1BQ4A 3KO8A 4BKOA 1T25A 1Y0BA 4M0UA 4YVFA 1WUYA 2QD1A 3DPSA 2ILVA 3BRWD 3H5AA 3L7NA 3ZE7A 1LBTA 1SC3A 4QZVA 3VI3B 4JBGA 2RGRA 3CYFA 1X9HA 4KPEC 2VYNA 3LFHA 1K9VF 1S9DA 1DFHA 1PE0A 4ZMRA 3B1KA 1SK9A 4MITA 1JFFB 4S1PA 2JRCA 3LO5A 4M9RA 1KK1A 1WRBA 4X8LA 4L02A 4ARAA 4CQMB 4OX9B 1ZJ4A 1SA0A 1W5TA 1DPFA 2QLTA 1LNSA 2PRKA 1H2FA 4NV1A 3QEMA 3GMIA 1FU4A 3BL6A 4UW9A 5I4CA 3B8EA 1CIVA 1ND6A 3I58A 3FWNA 1M73E 1DUIA 1MAHA 3I2KA 2OTCA 5KKAA 4ZD6A 5LQSA 1B6RA 3KETA 1J1UA 5E7MA 2ZRHA 1JDZA 1O1YA 1Z4NA 4P3YA 3TEFA 3RREA 4UDOA 4A73A 4NQRA 4B7UA 4BJ3A 2IGBA 1X7ZB 2Q9AA 3VQTA 4QT0A 3VNBA 3WBBA 1AE1A 1UXOA 2O0KA 2WPDD 3S1SA 3AVVA 3CO5A 1E1NA 2QU8A 2GEDA 4EB3A 3HBMA 4MQMA 3HYNA 4LWZA 2FVXA 3H1BA 3EG5A 1GPKA 3KE9A 4FNMA 1I4DD 4YP7A 4B2LA 1DWQA 4ND6A 3PCXA 3FFAA 3T9EA 1PJBA 2FGKA 3CX8A 3DKVA 1V16B 2QSUA 3CE9A 4JT9A 2H57A 4RZQA 4MYTA 2QM3A 4BEWA 1S2MA 3TIGA 3W77A 3C3JA 4BNHA 4Q48A 4BXOA 4LFAB 1TMOA 3ETDA 1FQKA 3UCEA 2FFQA 1UZNA 4HNAA 1OLSB 1MF7A 2NUTA 3GJ3A 3T4XA 1PAUA 5SY4A 4B9AA 4DLAA 2PXCA 5LR6A 1QAOA 1RXYA 4NZPA 1TVEA 1M34A 3G0BA 1QQBA 1XHEA 3I6BA 1M66A 3BHNA 4RJLA 3MA0A 2XB4A 1KI6A 1B76A 2L18A 3DF9A 1E6WA 1VSBA 3DUFA 4OXXA 1SB8A 3H6HA 1CUFA 4V03A 4DFDA 4L4ZA 1Z0AA 1SUSA 4DLUA 1U8ZA 4G5HA 4P4SA 3AM3A 1V47A 1RKBA 2HT6A 5B2FA 2LPMA 5KNLA 1UANA 4DCGA 1G66A 1OXMA 3CUEF 3KB2A 5CIWA 2FR8C 5L7WA 1DJMA 1DCTA 3CCCA 3C3EA 1RXIA 2WAOA 2ZAOA 2YJ4A 1BTOA 1P19A 1Z0SA 1UK7A 5BT9A 3IR5A 5F98A 1GZ4A 4JGIA 2QDXA 4IO0A 3WNBA 2BDUA 2GD1O 3NP7A 2QVYX 3M8KA 1GQQA 5M29A 3IMCA 1E1DA 3MTEA 4NPHA 4AMVA 2PCLA 3HVUA 1C1YA 1GZ5A 3PUIA 5K5EA 4HO1X 4KDFA 1V11A 4JLAA 4M1QA 4UCQA 1AUPA 3USZA 1TYAE 2JVJA 1BHO1 4Q7QA 5CPBA 5BNWA 3TLXA 4D26A 2QEQA 4AT1A 4HLQB 4XYLA 1G98A 3ESBA 3QF4B 1Q1ZA 2BR3A 3AESB 2XQKA 1SVMA 5LYYA 1PJCA 3LRXA 3E9QA 5BPFA 2ALJA 4ZT7A 4NZMA 4FYIA 1UPTA 2PMBA 1BCRB 3EIXA 4JSYA 4ON9A 4L8LA 1TUBB 1YAHA 3JR7A 2YIMA 1JI3A 5AHWA 5FUVA 2EJUA 1QO9A 1Z18A 2RH8A 3LCMA 5DM4A 4LW8A 4NCKA 4PY2A 1F6BA 3IPYA 3ADDA 2QE6A 2VQEB 1H93A 2XNDA 2HMAA 1EWQA 4M9SA 3BK7A 421PA 3GLHB 1L8QA 5FULA 1F7UA 1C41A 3EXG2 3VPGA 5IJWA 3RFFA 3GB9A 1QIKA 1EK1A 1F12A 1GAEO 3GD5A 1A77A 1QQ5A 4O0MA 4R8SA 1VRWA 3OJXA 2KQUA 2O3RA 1CF2O 1J0DA 3BOSA 3H99A 4FNOA 4BNNA 3AKDA 1H5QA 3A9RA 4F4DA 1NYRA 1U02A 2W6JD 3TTUA 4GP7A 4ND5A 3VSEA 4DEYA 3AJRA 1PS9A 4ZODA 1ECLA 5DIZA 3PC6A 3EA5A 1DPGA 1TTPB 5GADl 1KMQA 3MTBA 3QLJA 4F1KA 2Q5FA 1M2HA 3FFXA 3OCYA 1QQ6A 3O8DA 1N32B 4KFSA 2GAIA 4EKEA 1JR6A 3BC1A 2APJA 2G70A 4WA8A 4CJXA 3LQYA 2FZCA 3VVLA 3BERA 4FKBA 5IABA 5GQSA 4HH1A 4S0XA 3RG8A 4IIDA 3BZUA 4B3FX 5K8JB 1KRWA 3O8BA 4PR0A 5B7PA 1ZR2A 2G5TA 1YKSA 5LOVA 2NT4A 3BGDA 4IIHA 2QTMA 1Y5IA 3LZ6A 5DCWA 3RS7A 4CEHB 2JRLA 4WX2B 4CGZA 3N8DA 1PR9A 1JAYA 2C8LA 4G01B 1NVUQ 3CZ5A 5CYFA 2G71A 3ZIAA 3IOCA 1JG7A 5JYEA 5EHXA 5BSKA 4NH0A 2VZ9A 3CGGA 4QA9A 1P0IA 3D4OA 4KLRA 4D2IA 3UAZA 5CD1A 1PCXA 1FVOA 4G56A 4LYHA 2FNAA 5BMVA 1CP2A 3ZZTA 5B3LA 1BE6A 4RZ2A 4QTYA 2IHNA 2GJ9A 1T8TA 2W48A 2Z8XA 3FHCB 3W5JA 5B53A 2GJSA 3K53A 3V7WA 4JQZA 5FRDA 4EF5A 4CKZA 2BJVA 4IPTA 4IIJF 3TQQA 1IZYA 4K6HA 4IGAA 3OQIA 3RU9A 4X44A 5DBOA 3B48A 3GZ4A 3I5UA 1E5DA 1LPNA 2O1SA 3GLSA 3K70D 4TSRA 3VR1A 3X1YA 2C3MA 1WSBA 1DQSA 5F9MA 2AN5A 5C37A 4HAUA 3NHBA 2B9EA 3P9XA 3VKVA 3CSDA 1ESEA 3FXAA 1LI5A 1T4DA 2EQ5A 2Q5IA 3AFMA 2PX8A 3LYAA 1Z4LA 3NVAA 5KREA 1WXIA 2GK7A 2RGXA 4DM7A 2C2OA 3A2MA 3MT7A 1JILA 4RKRA 3CKYA 4XOUA 4EYGA 4KYVA 3CH4B 3HKEA 3JWHA 4EYQA 2HR1A 5TPWA 3CKMA 4HUJA 3RABA 2AXNA 2JBAB 4KPGA 2CD9A 5CX1B 1OT3A 5IP5A 1DIOB 1XU4A 1PSDA 1DMSA 2XHZA 5KSPA 4YCNA 4F8EA 1W4BA 4P4LA 1RCFA 2OGUA 2R85A 2PD4A 4FFDA 3A3OA 5ALEA 4LOJA 4FDLA 4EUNA 1FYEA 1FPMA 2QZ9A 5D3ZA 3ZCTA 4NBTA 4TKUB 1TUIA 3Q11A 4TN1A 4ZICA 1XJ5A 4BZZA 4G0PA 5G02A 1U5AA 7GPBA 4EJ2A 2OMKA 4BUCA 1V8PA 2QRJA 1QQTA 4Z49A 1KU0A 5L51A 1A27A 2FMXA 3R5XA 1JHQA 1Z17A 3N2NA 3QE0A 4GBJA 3PU6A 1FNCA 1GO2A 1UOPA 4M37A 1KVRA 3UJHA 3VHXA 5J58A 1OPRA 3FBGA 1XA4A 4UNRA 1TW3A 5SICE 5KYXA 3W8NA 5CXSA 2UUAB 1USUA 1WM1A 4FEGA 3I3OA 3HPRA 5MHTA 2G67A 3WL6A 4BO7A 4A10A 1UH5A 4MQ4A 2WICA 4URZR 5FT9A 1Z0UA 2ZQYA 4TOIA 3TI7A 1F3OA 1Y98A 2ZU6A 3F6PA 2W42A 4H7PA 1DIGA 1RKUA 5D5PA 1I0ZA 4KMSA 3TZCA 1MC5A 2D2IA 3AIIA 4HZGA 4X6XA 2VQ6A 1IDOA 5P21A 4TN5A 3SLRA 1SU6A 4E1AA 3O9VA 3IH5A 4EATA 4PG4A 3JD0A 1DLJA 3CEJA 1I4WA 1IK4A 2PUJA 3I0ZA 3ID6C 1CJTC 3W34A 2Y77A 2FG7C 1D6NA 1QGDA 1VHTA 2I3BA 2UZIR 3DO6A 3GEGA 2IK8A 3P0HA 4CUJA 1JIJA 4XQ9A 3OIUA 4IDHA 3NHPA 3K0BA 3IERA 4J0FA 4RCZA 2XH8A 1VRVA 4EB0A 2WM3A 3PNYA 1J00A 2O2HA 2A6PA 2CNWA 5AW4A 1EIZA 3CLSD 1Y6QA 4PAGA 2WSMA 3LFUA 4RV4A 1NRWA 2JFUA 3IESA 4PV7A 1A8SA 3Q7PA 3V8BA 2XA1A 4FKMA 3H83A 4W5NA 3F8TA 2V54A 2G77B 4HAYA 4GMHA 4A1FA 3OH8A 2GB4A 4COKA 3AY0A 1P29A 4N8EA 2PEYA 4WNYA 3TW6A 1L7XA 4W1PA 2OZLA 2GLUA 2PCJA 3T0FA 4PF1A 4BGUA 2NTYC 3AFGA 4IMIB 3NIDB 5TF0A 4X1KA 3V6LA 5JS2A 3AG6A 3E3NA 3I2GA 1Q5PA 4J4HA 4A0QA 4YRKA 2KI5A 2ZJFA 3OJFA 4Z1MA 3WR5A 1M6HA 1PU2A 4LCEA 5JD4A 5JQGB 2LDBA 1EVLA 2BM1A 2WW8A 2ZBVA 2Y0PA 4JLSA 2GZSA 2EX1A 1YB2A 5LZ5A 2I6SA 3TB4A 1FLVA 3T3PB 4ZARA 2ZFUA 4DHEA 5AVTA 1T0UA 1JG1A 2Y0EA 4MGKR 5JJKA 3WYCA 3WBFA 4BMVA 1ZHFA 2HT1A 1EVYA 1U7OA 1FJGB 2BTEA 1O5TA 3QVJA 1XZGA 5E7JA 3KVOA 5JV5A 1IOVA 4F5WA 2G36A 1JEYB 4I19A 4Y0VA 2IDJA 3C6MA 1T9DA 2WQ6A 1L5LA 1RBMA 4PBSA 2H29A 4BLPA 1EDDA 2OK8A 5DWDA 4EUSA 3HUEA 1T8YA 4IJKA 4OBEA 4X41A 2IZOA 1UBHS 2AW3A 4Z3DA 1UM9B 2E4VA 4LNAA 3SZMA 5AQ1A 3OJOA 1UADA 2HGSA 2RK3A 2VOJA 1OI7A 4MRNA 4RTLA 1IOLA 4P7BA 3ZPXA 4MRPA 3D0RA 2NOAA 2YIJA 2YXNA 4TQAA 3VU8A 1Q1NA 3SR3A 4QPZA 3J81A 1J1IA 1IONA 4OU4A 1VIAA 1KGDA 1E6LA 1SKYB 5IJ9A 3PWKA 4Q3LA 3AI3A 4RD2A 1NJ6A 2JKVA 4U7DA 3BKWA 2JLSA 4OHYA 1X7HA 3A1TA 2Q6IA 2A5FA 4QLAA 1CRPA 4OUKX 1RQRA 3I45A 4IIGA 5GWXA 3URMA 2PUFA 1JR3E 4O4JB 4C21A 2YOFA 4KE7A 4QBHA 4NABA 4PXSA 2H3EA 1XVVA 5L7YA 5KQPA 2O8EA 1GPBA 1SG0A 1W88B 3T95A 4C0KA 3HVKA 2BJWA 2GAJA 4KKXB 4R9UC 4RK6A 4WIAA 2BEVA 4JAVC 5TQVA 3W04A 3H9CA 2H2HA 3B1JA 2MSKA 1HDZA 4ACAA 4EX6A 4RLHA 5F3WB 4NULA 4TS4A 1JEAA 5D6OA 1GCOA 3H2GA 5CYPA 5KYTA 1TF7A 2QQ5A 1SKYE 4Z4FA 2C9ZA 3MILA 5KDLA 2YIVX 4NNPA 3E7FA 4NYJQ 2QL9A 3AEUA 4L7VA 1A7UA 1SIUA 3BJMA 3M3PA 3PFBA 4D0GA 4DR1B 2EDCA 3OCUA 4V2UA 3ETEA 4M1YA 1WXEA 1C50A 1YCHA 3I9MA 5B12A 1ORIA 1X7XB 4DM4A 1RZVA 3UH1A 3TSZA 1MHPA 3RF6A 2O7QA 4GF5A 1AC5A 1GL9B 3Q7EA 4G0QA 1YB6A 4YAEA 1JLKA 5DF1A 2VRCA 3W2GA 2CFSA 3JV7A 4QUEA 3BWDD 2FVYA 1KF0A 3KZKA 4AF6A 1ID8A 3C1TA 3SDZA 1S8NA 1EVZA 4V02A 4XW2A 1I51A 4RS4A 5EMKA 4GMDA 1QHYA 3RV3A 4I1SA 4DNPA 4BQPA 4K9NA 2OGZA 3OQBA 3HR8A 1JZQA 3NLLA 3RSCA 3UMSA 4UAUA 2QJTA 3G6KA 1DNPA 3TXYA 1GIAA 5EJ6A 4BNJA 4TMKA 4IOLA 1ZICA 4FHZA 3L77A 4KGZA 1VPTA 4V0KA 1N34B 1VG0B 4PINA 4G86A 4AF8A 2O1EA 2P5TB 4ZYXA 1ZGCA 3L04A 3KJFA 1MDFA 5E2BA 3GJ5A 3RIXA 5ARDA 3K0CA 3UF0A 1XD8A 4ZYUA 1V6AA 1QK3A 2Z95A 3B3JA 2DBRA 2WMDA 3FOFC 4ZVNA 1E9AA 3QYFA 4ITVA 4UU0A 1KE1A 1NN5A 4DLXA 1EQUA 2A9KA 1J97A 2FSGA 2H4YA 3VU3A 1BE0A 3U3ZA 3AINA 1Q2XA 2TRSB 2VPZA 4NZZA 1GLVA 2OCPA 2GZHA 3IELA 2FPLA 1HT3A 2L17A 3EEBA 3FTNA 4ESOA 4WCDA 4HN2A 4Y0AA 2CHVA 4JBHA 5IARA 9GPBA 1EK5A 1PLJA 4RKQA 4YWHA 5C46F 5J23A 1A95A 1IFXA 4HWGA 4NOMA 1FSFA 4NKRA 5IUKC 4A8TA 4JS0A 1G8PA 2RHOA 1MIOA 2AOUA 5EJAA 5IWAB 4OMDA 4TMVA 2YMMA 1YL5A 3BL8A 3X1XA 1ZIYA 3DFMA 4HAOA 1KO5A 3KIPA 1PDVA 4U3JB 4W8OA 2R8EA 3WWDA 5H0IA 4ZAGA 1SZPA 4PTLA 2FETA 3V4RA