3ABRB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl (substrate-free form)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
252
structure length
252
Chain Sequence
b'ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
molecule tags Lyase
source organism Escherichia coli
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
total genus 83
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3abrB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3abrB02
3ANYB 3ABOB 3ABRB 3ABSB 3ABQB 3AO0B
chains in the Genus database with same CATH superfamily
2IIQA 4PGHA 3EWNA 4DLTA 2QSZA 3TQOA 4AIIA 4GP7A 1Z08A 1NYRA 2W2KA 3MWFA 5D5PA 2OXFA 3K0FA 5KC9A 1FMCA 3NIBA 3OM1A 2NSDA 2XUJA 1EPUA 1T10A 1P60A 3DP7A 3E5MA 3PC2A 2OXIA 2NPFA 1GYPA 2ZYIA 2FB9A 3F49S 4HQ6A 4RHXA 4WAUA 5JISA 4W5QA 2OA0A 2G4LA 2RAFA 1E3MA 4KI7A 5F52A 4CVNA 2PXAA 3LK6A 2XZLA 3GLFA 1G42A 2Q9BA 5IVKA 1T5IA 2XRMA 5J3JA 1FPQA 3LKBA 2WAAA 3RTEA 4CBVA 4LV8B 4YDQA 1KPHA 1EM8A 4CMEA 1DOHA 5BRNA 3RSZA 1EVYA 2XDQB 3ZU2A 4CKBB 3QVUA 1IG3A 5HZKA 4OM7A 4YAEA 1SU8A 4Y7DA 2GI4A 1N2GA 4AQDA 3U3KA 5EMHA 4YYEA 5T3UA 2WD9A 2O0HA 1CY8A 1Z9BA 3KSUA 2OAEA 4LJYA 1ISPA 1O3YA 3AF2A 1DB3A 3DZJA 3DMTA 2IE0A 4L74A 4NENA 4C01A 4I9FA 1TM1E 3U1VA 1FP2A 3ZPXA 1PGQA 4G2TA 4YJGA 1GUDA 4ENQA 3C2QA 2HJGA 3H8SA 5CLLA 2PUEA 2YZ2A 4HRAA 3ZXXA 2ODTX 1GSHA 1E9VA 3JQFC 1FFDA 3RFUA 3VPFA 4AJLA 3O1LA 1MHTA 2L42A 1O4WA 2KMLA 3UHFA 1C80A 3F67A 3I5AA 2DULA 3OZAA 5GGYA 3G2OA 3HB0A 3R0QA 4X91A 1LBEA 3O47A 4ZT2A 3DCIA 4PFKA 3MSXA 5HGXA 4HXEB 4DW8A 1T43A 3ZV5A 2TRSB 4LJKA 1TQDA 4PZEA 4YDSA 1K4MA 1S96A 5I4CA 4C04A 1N78A 3JQ9C 5D01A 3AY7A 2AN9A 2CL5A 2CMGA 1PDWA 3V6MA 4B3CA 2H06A 4MV3A 2W8BA 3U4IA 3TIIA 4ZI7F 4C2AA 2CNLA 3ER6A 1MV5A 4N3AA 3UGKA 1XJ0A 1QYIA 3SIRA 3UKOA 3WKEA 1GR0A 5I45A 1E6UA 3KQWA 3LLMA 4FE3A 3AY3A 1T8RA 3G0OA 621PA 5JCZA 3ND8A 1UPXA 4PSCA 2ZU0C 3GZTB 3GFPA 2QPLA 3BWXA 4FPXA 4U0JA 4YBZA 3MTJA 1CP2A 1Y98A 3MN1A 2WSLA 1HBJA 2V6GA 3T1NA 3KFLA 4YT4A 3ND5A 2KQUA 4JLOA 2NVBA 2Z1NA 3DYVA 5NULA 2LNDA 3KYDB 1NJ2A 2IDKA 3SC2B 2ZLBA 2H3HA 4JQSA 5LA6B 4IGEA 1K1EA 1FSGA 2DFDA 3CUTA 4AZ0A 4YJGB 3IHTA 2IYAA 2FSFA 4P2BA 3OF3A 1AKTA 3HUEA 2D00A 3NOVA 3UOWA 3H9EO 3LY5A 1Q1BA 2CJWB 3LC7O 3N5CA 4C1NA 3R75A 5EMLA 2AN4A 2Y0DA 3EA0A 1YBVA 1UWCA 4B3BA 3A05A 1ORVA 2X5OA 1IY1A 3EAGA 1R6BX 5AKGA 4RA6B 2WIJA 4WESB 2YJ5A 4EMSA 4UTPA 3OP1A 4FFOA 4E46A 2OKCA 3K9WA 4Q37A 1XN1A 5ER6A 1U81A 4P7JA 5TX7A 2ZQ5A 4WGGA 1GAEO 2W4MA 2EERA 4P6VF 3QVLA 4O4IA 1GNLA 1NW3A 1B00A 2PKWA 4TMZA 4AXXA 4CCWA 1JQKA 3U6KA 1O94D 1VXRA 3I39X 2FW7A 4ISCA 3GJXC 1X9GA 1W5EA 4KW7A 4B6GA 1ZUIA 3AI2A 1YCHA 4G1BA 4INPA 1YC5A 3QFTA 2V7TA 3PE4A 4HHEA 3FAKA 4IIJB 4DXDA 1Z47A 3EPPA 1LY1A 2GCPA 2V96A 3WXMA 3DWGA 1QIIA 1HURA 4MKXA 4MWDA 1AQJA 3LX6A 4OJKA 5CJJA 2XWJI 3AGQA 2VDQB 1P7CA 4FP9A 5B57C 3C48A 2YCBA 2I4TA 2ZVPX 1DX9A 2W48A 4ZAGA 3CZMA 4C2UA 3AHJA 1DWUA 1LPAB 3VO1A 2VDVE 4Q6WA 5FQNA 1S8AA 4OJYA 5DLYA 2QN1A 1FS6A 2L17A 2E4AA 1CU1A 4RQUA 4S2UA 4C4TA 1ZK2A 3AFNA 2HHLA 4QQKA 4HB2A 1GNTA 4M7RA 4FGWA 5CBPB 1P4HA 2HPHA 2MTBA 3HV2A 2PMFA 2X9NA 4Q9HA 3C8DA 4RJJA 3ZR4B 3ZOZA 2AW5A 3QKUA 5FBHA 2AOXA 2HMUA 1USUA 2YVUA 2GZKA 3ROMA 2YWDA 1MOPA 1ZJ5A 1QGUB 3UMJA 5A3JA 2V6BA 3AG5A 3U61B 3KJZA 1JDPA 2RBGA 3LWBA 3V97A 1XLTA 3SEQA 1YHZA 1SWVA 3HGQA 1QHNA 1GTL1 1GPKA 3UXEA 3P52A 2A3RA 1MJGM 2RGWA 4RAQA 1O1YA 3B9BA 2EX4A 2OOSA 2EBUA 2XVXA 2NG1A 2VP2A 2GEVA 5IH7A 1B6RA 4CMCA 4PBTA 5EZQA 3WDLA 2DQKA 4RPJA 2FMXA 2OFOA 4A2QA 3R6LA 3MUNA 1RYEA 1JJ7A 4OHVA 3I4LA 3GA0A 121PA 1YULA 2P0EA 2VYQA 2WF9A 1EFPA 4FGZA 4R1UA 1X80B 2CL7X 3TBFA 5K9ZA 5A0TA 4WSOA 3JQ8B 1GPLA 3S28A 4P08A 3HDHA 2Y3IA 3CT4A 3DE7X 4MPJA 3VAYA 5JALA 1AUVA 3RNLA 3N2GA 4NPHA 4D45A 4QGBA 3S5UA 4MI1A 2ZPAA 3P2MA 3ESDA 3W5IA 4B6JA 5IT5A 5L51A 3NORA 4PICA 5DNYB 1PYGA 1A0OA 3LE8A 4QOJA 3B82A 4F84A 2PLNA 1X9HA 3PFCA 3ZHCA 4GSKA 4DC9A 1GZVA 5CFQA 4RW0A 4O4IF 3R8FA 4ZIRB 5MF6A 5JO9A 1SHJA 5AVSA 2CUZA 4GMDA 2EX0A 2V7WA 2H4JA 3WSTA 1E9FA 1Q22A 3C74A 3K9LA 2WG0A 2JS7A 2AA3A 4JP3A 4Q93A 4DLLA 2JLWA 1JJVA 5E4YA 1JSLA 4H77A 1QBGA 2EFJA 5BSTA 2HSEA 5IC5A 4MP3A 1LDGA 3ZN2A 1NRWA 4GKAA 4JR1A 1DCFA 3CN7A 4PBRA 4ZO9A 1U2ZA 5DNWA 3IPLA 1GPUA 2OOKA 4ZV4A 4JA2A 3J7TA 2F8MA 3BWVA 3P9ZA 3C16C 3GLGA 4AUMA 4F2PA 1WXHA 2HTEA 3RH0A 3GPLA 1J1ZA 1B8VA 2DBQA 4H2DA 5JTUA 4LTNA 2FN8A 3W9SA 4G86A 2IU0A 1VL1A 2C97A 5KWSA 2VHWA 1QJ4A 1OAKA 2VDWB 4WMLA 3SF0A 4R51A 1AH2A 3H5NA 5KNBD 4RDHA 3V4VB 4A73A 4EI9A 5L3QA 3T5BA 3QITA 3VU8A 3SE7A 4CQNA 3AP3A 2CHGA 1SOMA 3N2GB 5AK0A 4CMBA 3RUHA 4J75A 3F8WA 3PCTA 2CHUA 1RC0A 1JX6A 3C7TA 2HOQA 1T35A 3BGOS 2SCUB 2RE8A 3WLPA 4F8EA 4YCCA 3NYQA 4JQYA 3AHEA 1QF7A 5JSKA 3DAHA 4HNAA 1NVFA 4ZYXA 3CX4A 1OLUB 3DGFC 4RFSA 3OT5A 4HOYA 4RCYA 4AJJA 3I2KA 1Q3TA 2AK2A 4IGFA 2C5FA 3STUA 4JYAB 1PJBA 3GWZA 1O6ZA 1M9NA 2ZBUA 3VYTB 3ZLUA 3L01A 1JPNA 4G1VA 3WWCA 3QVGA 1L8ZA 1Z6AA 3TI7A 1CQPA 3CGGA 5DYYA 4B48A 3NJ8A 1E66A 1E7SA 1T2NA 4WFQA 1TD9A 2JAWA 4FIZA 5KCMA 3JTMA 2Q07A 2ALJA 4FJ1A 1W0KA 1QB8A 5BYAA 3AKDA 1SBIA 3PFGA 3RFFA 3HB5X 2HA6A 4N82A 4EUSA 3BYZA 4FWTA 1KEWA 3NOOA 5TPZD 1TVKA 3REQB 4DLYA 3FI0A 3KEMA 1NAIA 5JMOA 4AM8A 3IDQA 1E9BA 1XEAA 3EF1A 1AG9A 3QVKA 4LE1A 1Z6QA 3ZH9B 3ZK9A 1N1MA 5A5GA 1IPEA 4D9BA 4RE5A 2YJ6A 1JTFA 2FZCA 2BGUA 2R8YA 3LVRE 3BE6A 3QV2A 3AUUA 1FDUA 4HDRA 1N5LA 4XM1A 4HGRA 4QYWA 4YRPA 1NRIA 4R71A 2FPWA 4B7AA 2VHXA 1OLOA 5IZ4A 4K05A 1ETUA 2CHEA 3W3ZB 4L57A 3CLRC 1PG2A 1C0LA 4W5WA 4B32A 3E6AA 5KWIA 1HEIA 2R8EA 2HW8A 1LWNA 3GAAA 1C0IA 1NF8A 1PNVA 2AYYA 2QT0A 1MO6A 2XNDA 2HSWA 2ODWA 3EGDA 2QS9A 3ES9A 3G0CA 4GVLA 1VHTA 2HY7A 4X85A 4MJLA 3OZTA 4KXNA 4EFKA 4UEWA 4CMIA 1BMFA 1CUSA 1UKYA 1Z74A 1U8XX 2R6HA 1FJHA 3JV7A 2EFEB 4YA6A 2B92A 3MNFA 4HYEA 1B8NA 4ARIA 1E4OA 5K8IA 3BZBA 3HM2A 1KK0A 4QBFA 4M6WB 1VE9A 5HG0A 4YJ3B 3AB7A 1ECPA 1TEZA 3CN9A 4KI0A 3ZCQA 3P0FA 4AIRA 3UGTA 4CODB 4YMVA 5I7UA 3V34A 1PNTA 3DVLA 5DXAA 1FP4B 3W9BA 2P75A 2GEDA 3L07A 3PLNA 4GM1A 1D1PA 1JN0A 3X2EA 4L73A 4WNCA 4W9NA 4AN4A 3L0PA 2H11A 1ZUNB 2DWCA 3IMKA 16PKA 1X1CA 2DQZA 1GZ6A 3UIEA 2EZUA 3T9FA 4O4HB 1E1CB 1IMOA 2OGTA 4MB6A 2COEA 4RJ2A 3OAAA 4FZRA 1NHNA 5ILOA 1PVDA 2UZ1A 2GYWA 4N5HX 5G40A 3TB4A 2G1AA 5IWCA 2IOYA 1GVHA 2OG1A 4I9HA 4PAQA 3LXMA 4O1MA 5DM2A 5TPZA 4PZAA 4UUMA 3O0TA 4UPEA 1BX0A 3LC1O 4UCXA 4U7HA 1JILA 4BP3A 2IP4A 3MWDB 1IHUA 1X8JA 1KXZA 5DWQA 3EC1A 4ZC1A 4BRZA 1G5RA 5FTLA 5JNWA 1C8KA 3KTOA 3HRKA 4FMCB 4CLEA 5KO2A 1ISFA 5LIRA 5FLEX 4X62B 1KDRA 3TR5A 4LSZA 3U3OA 2XQJA 3HU3A 4Z0PA 1R0WA 1RI3A 4ALMA 3WDKA 4ZALA 2YOHA 4BKRA 2M9MA 3M7IA 1WF6A 4FI3F 2XYGA 3PNVA 3RVJA 4DYDA 3T3IA 2VNJA 5JSFA 3JQAB 5LZ9A 1BHQ1 1JG6A 2O8BA 4LWOA 4G0QA 3GLSA 3Q6NA 3A27A 1VLQA 3BG5A 3F8SA 4J9UE 4TTQA 4TV9B 2WDZA 3VYRB 2W6IA 3ZWQA 3A3NA 1XTPA 2Q8PA 1P3DA 3EA4A 3HB4X 1GVNB 2RGCA 3LUKA 5IC6A 5JI2E 4BO3A 4D43A 3OJOA 1TU3A 1MRNA 1FK8A 2KBFA 4HNGA 4JGBA 3U7QA 1JXAA 3F3MA 1F20A 3LRTA 1XMOB 3D7SA 4R1LA 2H2GA 2PH7A 3I1JA 4LNUA 1B8OA 2PRJA 2D2IA 1IBCA 2O52A 3GPBA 5L8VA 4XM2A 2JGRA 3FOBA 4KNWA 1GPNA 5K09A 2QRKA 4M0KA 2JF0A 3QOXA 4TV8B 4HVCA 1TADA 4LZJA 2CFRA 1GL6A 3VPCA 5EHXA 4IYJA 5K0EA 3SY8A 3R4VA 5J5CA 3NPAA 3RJMA 4EHAA 4D6PA 1GA4A 1ZJZA 1SUEA 4GX2A 4RV9A 2GD0A 1KPGA 2WOJA 2RH8A 4ND2A 4KR2A 1WMAA 4I7EA 4Q3AA 4AL4A 4C2TA 2QQFA 4A8JB 5ED0A 1EM8B 3D8NA 3IAM6 4ZDWA 4GRAA 4QL3A 4F3YA 3VC3A 2VWPA 4GPBA 3RBAA 3UPUA 5F4ZA 5FUBA 3CH5A 1T8TA 4LZNA 4RVOA 4AJHA 3PT9A 2EHJA 3IBYA 5BQ3A 2CXSA 2QSJA 3VU9A 4B4UA 4CMEC 4GR5A 2QIPA 1PX2A 3SX0A 1TYAE 4AYTA 5JVDB 3TTSA 4BZQA 4BECA 3EFOB 1H0RA 3N87A 3QMVA 2FMHA 4OB7A 1M2WA 3WMEA 1E1DA 3H1BA 3EISA 1G21E 2BFDB 2Z2IA 1VPDA 2BH2A 4AQYB 1E7JA 3U80A 2CTOA 1U0TA 2B8JA 2R47A 3NHBA 3W5SA 1GUAA 5L3VA 5LDDC 2NYVA 5FUVA 3M83A 2D6FA 1HF3A 4BGEA 3LCJA 3NCHA 1J1UA 5CX1B 3NOXA 4BKQA 1DQPA 3F5SA 3PDWA 1A8SA 3T9DA 4QTYA 2OBFA 4H18A 1S3IA 3LMKA 1IZ8A 1W36B 1XKTA 1A4IA 1CUCA 2JHAA 3FDZB 5CAEB 2WM9B 2WUFA 2WIBA 4RVDA 4B31A 4CM9D 4P7FA 2G1UA 2QP3A 3PGA1 5IYZB 5IAOA 1SQFA 2WAMA 4E5KA 3E27A 4CXMA 1TM3E 4GAEA 2IHVA 3L8GA 2VKTA 1L1QA 3G8BA 2PE5A 4JUCA 4TLEA 1J9EA 4RSRA 4YH1A 1SVMA 1SR8A 1DJNA 1TFRA 3P4UA 4KQ2A 4ZCQA 1KTIA 4QUEA 2X2EA 4BQPA 2WYIA 5LP6A 3MK31 3DFZA 5DX0A 4LHEA 4F8YA 4FFRA 3OWOA 4BDSA 3RFVA 3HJRA 4AF6A 1ABBA 3IPCA 2AJLI 4QUAA 2G76A 5FORA 4LYGA 3T7IA 1O0BA 4L02A 3NUQA 3UJ3X 5KSZA 3O2SB 4NFYA 4F6LA 1FDOA 3W6UA 1JTEA 3H05A 2Z0MA 4RS4A 2RHLA 2F8TA 4C87A 2IIBA 4M8KA 4BV2A 2X9QA 3R24A 4OO3A 1QDUA 1F8UA 2CK3A 1PJ3A 1CZNA 2XA2A 5LMUB 3JQDA 4R6XA 2WU0A 4PFQA 5CTJA 1Z83A 3LL4A 1KI6A 1P5JA 4NBVA 3AU8A 4ND8A 1JLSA 2CDRA 1PKXA 3LUFA 4L9SA 2W2LD 2AXPA 2A8YA 2X8LA 2QY9A 1TD1A 4WESA 1UFQA 3LCRA 3MD0A 3GD7A 2HCJB 2P79A 3DHVA 3VTZA 1TT7A 2APJA 1DS6A 4P3PA 4RACA 3MQ4A 2IXTA 4OHMA 2H7XA 3UWOA 1WPQA 4YHBA 1GUBA 4UHHA 5DP2A 4ENPA 1AXRA 4OGWA 2ORVA 5AKXA 4CHTA 2QN6A 5C7IO 4YGYA 1EFDN 3K71B 2WJWA 4NAUA 1E89A 4B3MB 4HFNA 2C9BA 5EWMA 4E15A 1XE3A 4ZYLA 4DRZA 4ZZ1A 4NXNB 2YHIA 4C07A 5T67A 1U0NA 1BCSA 4AZWA 2IEBA 2W2MA 1BD4A 1JR2A 3TZLA 2H7CA 2CBXA 3T1HB 1GG8A 2FI1A 2CD7A 1YR8A 1E9CA 2YFYA 4XJVA 4TTRA 1E3IA 4IS2A 2UYHA 3EGXB 2OR3A 1YQUA 2V8BA 4X64B 3ROGA 4PZ9A 4BNLA 2YWBA 1XXHA 4ME6A 3SZUA 5J59A 3SM3A 2YUTA 1UIRA 3Q0TA 4XGKA 4C6TB 1JEQA 1DIBA 4NS4A 5I9BA 2ANCA 3WGOA 2A7XA 4A2CA 1KORA 4DMCA 5BYBA 1XPRA 1CUZA 3HZHA 3RS8A 5HCUA 2I2CA 3I61A 1FXWF 4F93B 5J4HA 1SBCA 2GM5A 1JFSA 4DQUA 5B36A 2GD2A 2R4UA 4IXMA 1ORHA 2ZPUA 1FFEA 5ARDA 5IDYA 4HUQB 4UD6A 4BZPA 3TOSA 3LNCA 2QN8A 3T7EA 4N9QA 1U8EA 3KPWA 3UB2A 1PJ4A 4MO9A 1OX4B 1UDAA 3RJ5A 2E9SA 3HUTA 4UAVA 1VMIA 4QDZA 4OI1A 3L5OA 4LXHA 4Q9AA 4QTTB 3WK9A 2G04A 4DEYA 2RHOA 2BIFA 4OLFA 5ITZB 1NUTA 1N8NA 3OU6A 4EITA 1ULUA 2XTAA 4I3FA 5LP6F 1RAEA 1OZFA 4J0GA 1ODFA 1TW3A 1EX6A 2J4DA 1DWQA 3FVRA 3K16A 2R11A 3GJYA 4JBNA 3TCXB 1EK6A 3THRA 4CYMA 4DJFC 1L6IA 1JLKA 3C4VA 4R41A 4ZVOA 5BR8B 4AY6A 1PEDA 4I2VA 1BKDR 2FFHA 4WACA 5EFZA 4BJ3A 1YK0A 3B52X 1CP3A 4FHDA 3AB8A 3H2SA 1KDTA 1ADBA 1CJCA 1UPTA 1VE3A 1YRLA 3P2EA 1LDEA 4LGCA 4M83A 4IZ6A 4F5YA 3WOHA 1UOPA 1DOAA 4H0FA 3BK2A 3N1UA 3AUSA 2JLZA 3LT1A 5FA6A 2CF6A 3CLHA 3IMCA 3JWGA 1W59A 1I3MA 1SBHA 4PZ0A 3PLRA 5EKDA 3S0JA 3K0HA 3MBOA 2EKPA 3U40A 1WXIA 2ISSD 5F7ZA 5SYNA 4PVCA 3GT3A 4RKRA 1QR2A 4YGXB 1JT9A 2JIRA 4LNAA 4MVYA 5ECDA 3RYCA 3FWNA 4GU5A 2JCYA 1T6YA 1U3GA 4AW9A 4Y6LA 1RRPA 1VIVA 1QH8B 3FVVA 3DDCA 5EEHA 5BVGB 1SOWA 2X6TA 1NY5A 3BXFA 1RJWA 2C4TA 2NO7A 2QRMA 3E70C 4JVOA 2ZZKA 1PUJA 4CQJA 4HT3B 2QD5A 5LU8A 3LBHA 1UMCA 3CUSA 4OXRA 4TMKA 5ELXA 1YS1X 3G8DA 4AZ0B 4ZICA 3OEHD 2YV4A 3D8TA 1TTTA 2HWWA 4PO3X 3GX1A 3MCUA 3RUCA 4D02A 5LJIA 1U0JA 3TAXA 2R0QC 3LT0A 3M0EA 1WUYA 4NHEA 2WFAA 4PG7A 4M7WA 1RZUA 3LLSA 2K5UA 3A1DA 2HUPA 3E9MA 3U9SA 5FLYA 1AHIA 1KI8A 6AT1A 2ZBRA 3LG2A 6LDHA 1BWSA 3KDSE 1JDTA 1G21B 2XZDA 3VM6A 3K9NA 2FWJA 4ZOLF 1UJ5A 3BXOA 3BT7A 1NGSA 3SEAA 1QHHB 1VLJA 2OZKA 1B6TA 1HE2A 3PSHA 1IK6A 1ZK1A 2B4KA 2N1BA 2VXCA 3TKLA 2SHKA 2FPPB 2JI8A 4OPMA 5FAXA 2Z83A 3KR2A 3T0FA 1N6RA 1ST2A 5DLDA 1IY0A 4K6FA 3ICEA 4HNSA 1O9HA 3F7TA 3SJUA 2JEYA 2OCPA 4DMFA 2A9QA 2YUKA 1RDFA 2XJ9A 4MUAA 5LFAA 3RSFA 2XCRB 5FLXA 2VVTA 1DG9A 1Y3IA 3L92A 3L7DA 3PIIA 5HBGA 3IP7A 4BNDA 3C4JA 3JQAA 3SFVA 1Z63A 4DR7B 4D9EA 2FDRA 3MJCA 2PYZA 2PX0A 3DNMA 3SNKA 3V4SA 4JIMA 2NLOA 2V7UA 3OCJA 4KGZA 5AIAA 1CPYA 3JQFA 3BZWA 1J23A 3E7FA 4O4JF 4JI0B 4WD3A 2X58A 1KA9H 4FS3A 2VAPA 3BRQA 5GONB 1EXDA 1UMKA 2MR5A 2ZJ0A 1UP6A 5A5FA 4Y1GA 2RGAA 3MLBA 2G1PA 1A9SA 1QWSA 4N47A 1PWEA 2PZLA 3SIPA 5DBOA 4B47A 1VP9A 1JEJA 5JEEA 1K75A 3G0HA 4G25A 1NQWA 3HP1A 3SHQA 2JGDB 3AL2A 3OY7A 4MKIA 2WFLB 2J0UA 3OETA 3PENA 4KTTE 2EV9A 3BFKA 2HWYA 1ONOA 1QYCA 2EFDB 3OPVA 2PVPA 3OEED 4TWIA 1DCMA 3UK1A 3I5MA 2M98A 2R8OA 4MR7A 3A14A 3RAGA 2NAPA 2WE7A 1MQ8B 1CEEA 3V5NA 4RQBA 2VAVA 5E6SA 1N2IA 3P0JA 3GHYA 3BXEA 5HF9A 4ZCMA 1ZOLA 5KYKA 2X4DA 5LMZA 3LZDA 2HCBA 3MTAA 4OXIA 2OXRA 4XX0B 1DKUA 1SXJC 3SG0A 1RPTA 1QGAA 2AZDA 1GL7A 5AI9A 5C7OO 1H9BA 2TMYA 3IE0A 5B58T 3GLGE 5HP4A 1KZHA 1SMKA 4K9KA 4BTEA 3GLUA 1JIIA 1L3BA 4DQKA 4KR0A 2XOKA 5AM5A 1V8FA 4LEIA 1L3CA 2BFFA 4L5BA 3MTGA 4Q7QA 1J25A 3QE3A 1G1MA 1SD5A 5K8CA 2Q9CA 3D0KA 3DDHA 3A06A 1VSQA 3CEPB 4B73A 4ZMBA 5DW3A 2DUNA 4BEWA 3HB7A 4GLOA 1FDTA 1SBYA 3OEWA 1IWOA 2GXUA 3OIGA 5C31A 3ZQKA 5IKEA 1B23P 3HSYA 4HLDA 6ADHA 4BYMA 2Z9CA 5JT1A 3OMLA 2Q1TA 4JLUA 4HAOA 1Z7GA 4XVUA 2AJ8A 3BMQA 2OCBA 4YAWA 2ZS9A 1RQ2A 1RJEA 1TU0A 3G5LA 2RB4A 1EH5A 4FGUA 2GERA 3OLXA 3UT5B 3CEMA 3ZXIA 1JAXA 5BT9A 4E1AA 3VNRA 4ES6A 3ZGZA 1KEZA 2JBAA 5BR1A 4XPZA 1SKQA 5AHWA 4JHLA 4B4VA 5K8LA 2B9VA 1E1CA 5G2OA 4RIFA 1Z0UA 1YZLA 1TM7E 1NY6A 4E13A 4IG4A 1L4EA 4RENA 1E3DA 2WWVD 1PT7A 5LCXA 2IHKA 1H8HA 1PJTA 1S2DA 2HA4A 3KZ1E 3Q2OA 4IWNA 3HM9A 1PFGA 1QOQB 4ARZA 4TMVA 4A26A 3A0RB 3L04A 5HCNA 4AG3A 1DQSA 1MAAA 1Q1GA 2VP5A 3NATA 4F5EA 3Q9UA 4EUKA 4JGIA 3AOEC 1NN0A 1NLYA 4TROA 4R8RA 4HB0A 1YONA 2C95A 3DTVB 5FPYA 2OUKA 4DV0B 1YBAA 3QVOA 5CD1A 5EZSA 2X5NA 3A1TA 3PVZA 1XZ8A 1YVDA 4R2WA 4FFNA 3TIVA 4JROA 3IE2A 3GZNB 2WIFA 4IW3B 4JFAA 4AJIA 4C78A 1Q5PA 1TCVA 2EBWA 3GN2A 4J6EA 3M9WA 4IVPA 3W2GA 3ZD8A 3I9NA 4R68A 5FOWA 3O90A 3SVZA 3FUTA 4EDHA 5ITVA 4EX6A 2LR0A 1C3JA 4QA9A 3W9YA 2GTPA 3LX8A 5DHQA 4AZ3B 5L4SA 1GR1A 3M3PA 3ZKAA 4PO9A 4LMPA 1KH3A 1KOLA 3HCAA 3N28A 1TUBB 3MWGA 3WXBA 2N3ZA 1Y9EA 3KUXA 1AMUA 4H3VA 3IV6A 4R9SA 4WCDA 5JCJA 3TR0A 5TQVA 2QUJA 3RRZA 4Z7NB 3ZLJA 2IEAA 3ZVNA 3BIFA 4LMBA 1UIMA 2KX7A 4WLFA 4ZOQI 2GCOB 3WLOA 3UO8B 2WWXA 6GPBA 1CCWA 2VEDA 3KXPA 2G67A 4DLXA 2PRYA 1D0SA 3JSXA 2C57A 1C50A 4R98A 4I55F 3RARA 1A9PA 5E4FA 4D0LB 1HG1A 2YN2A 4OREX 3A7EA 4H6PA 4BNKA 2ZRDA 3AP1A 5GIPE 3AP2A 1J2RA 2ADFA 1F3OA 2GKSA 3B2EA 4S12A 3OTQA 4X7PA 4MS3B 1PSDA 1A7UA 4NCNA 3UENA 2DBZA 4DBZA 4BQFA 3OUUA 4HAXA 3JD3A 4Q9JA 5AESA 3KKNA 5D7NA 3CSSA 1MZVA 3HZRA 3VR6A 3O4GA 4EO9A 1ODCA 1VRWA 3BMOA 3EXFA 4IQ0A 2YW9A 3RV3A 4NONA 3PJRA 5LLDA 3PUZA 2Z2ZA 2BT4A 2YXEA 4MQBA 3S2FA 1IM5A 2PV0A 3PUJA 3CF2A 1J39A 4S1PA 2F4NA 4EF4A 1IC6A 4X6LA 1TUBA 1IE3A 2PXHA 3HJCA 4MX8A 1I9CA 1ZUHA 4MRRA 2I4IA 1QIDA 1E9RA 3E53A 4P35A 5JAOA 2VDKB 1YH3A 4MW0A 2WYUA 3ODGA 3WJ1A 1DWOA 2DP4E 5JOQA 2JBWA 4DUPA 1X42A 4XYGA 5CU7A 4PNEA 3PRYA 4B3TB 2YV1A 3C7AA 5KSWB 1M10A 5BV8A 2VQEB 3A10A 1AUQA 1AF4A 4ZI5A 1TCBA 4WJLA 3FWHA 3PICA 3PQ6A 2I7VA 1RC1A 3KVRA 2ZSHA 4D0RA 1KOFA 4E4YA 1ZHOA 1DXOA 1XQWA 2V5AA 1NHMA 3WLEA 2Z5VA 1BROA 2PKQO 1DI0A 4OP3A 1EHIA 3IUEA 3VKWA 2XNDD 1RS0A 3FDIA 2EKBA 4RGQA 2ZJ6A 1PR2A 3IQDB 4XLZA 3UUWA 4CIXA 4YALA 4WOCA 3L84A 3VOBA 3G9TA 5KOIA 3DMTC 5KYWB 3OQMA 4KRGA 1N36B 1KGDA 2J09A 2ZIXA 3T7TA 3ZCUA 1I13A 1NJGA 1PZEA 5L7WA 2GJ8A 2CV2A 3ZDDA 4YLYA 5FV7A 3C0KA 3DV0B 2P1RA 4PWYA 2YJZA 1QRTA 1RMTA 1M1YB 2PX8A 3AIMA 2I8AA 2GXSA 3PQ8A 5H70A 1EXNA 2IBMA 2Z3WA 4WPGA 3JZMA 3OTIA 2FZKA 3DG9A 3L8CA 4EW6A 5EA2A 1VPVA 1WOMA 3E3MA 1JVNA 3IS3A 4NBRA 1X2EA 2I2FA 1P2VA 4C0WA 1SHKA 5EHZA 1RP7A 4RZHA 1LLUA 4MICA 1XRJA 3IT1A 4HVAA 5DTQA 3RDPA 3WB0A 2JJ1D 4MUIA 4OXKA 5F2OA 3UJBA 4S2QD 4RD0A 1GKYA 5P21A 3PTZA 4BEVA 4CQMB 3SHOA 2QLNA 1A2BA 2GA9A 4JVNA 4MUEA 4BLPA 3NBQA 1UEJA 3SLRA 1PZXA 1SIUA 3GY0A 5JAHA 4G1CA 2X2FA 4LF9B 3PJFA 3WMGA 2PZMA 1Y8RA 4EA7A 1JHPA 3H5AA 5FPTA 3OC0A 4HD8A 1UMBA 1YOVB 2R6CA 4M36A 1W1IA 2UZ0A 1XTSA 1E3TA 1T24A 3I01A 3AKEA 3O8QB 5B1EA 3AUJB 1JLRA 1Z2PX 3EVNA 1V3TA 3V2UA 4H31A 4JSTA 4IFEA 4R0MA 2ZIXB 4GP9A 1RE1A 3AETB 4AZVA 5JV5A 3F9IA 2WNSA 1FDSA 1Y4AE 1VLVA 1KYVA 3IALA 4KXMA 3K0CC 5BNWA 1P18A 4J29A 1ENOA 5HJ5A 5H80A 4HEA6 1UMBB 1YOVA 2HLDD 2Q0XA 2WC1A 1SELA 3HLKA 3WHLA 4UM5A 2WSSD 1LVHA 2A5LA 4ESEA 1N8TA 3O8QA 1K7YA 1JW9B 3EMBA 2D5LA 2I6SA 2PS0A 3BB4A 3GCXA 3ODPA 5CBPA 2FW9A 3WGHA 4EJSA 4YQFA 5A9TA 1NG1A 2H2IA 1DAEA 2C96A 3E2MA 3EFEA 3NOQA 4Y6PA 5GJCA 1KFEB 4O2BA 1XMSA 1YVEI 3NLLA 4NYMR 4H7JA 1ZMOA 3MS7A 4M2LA 5AQ1A 1JIKA 1OGYA 3F2VA 1Q3KA 2FZLA 2AT1A 1J0EA 3UJCA 5DX1A 5K6RA 3MM4A 1FS4A 1C1DB 1Y5IA 4PYIA 2GCGA 4GBGA 2GT1A 4XSHA 3ZE6A 1M7BA 5F51A 2MJLA 2VAXA 2VPWA 4JENA 2B34A 4NZYA 4BFUA 1UBGA 3DFIA 4JS0A 3B5IA 4TT8A 1A9QA 2C7GA 2X0KA 4X1IB 1IULA 5C8YF 4HN2A 4ZTUB 3NWBA 2ZYDA 2YICA 4LOIA 4KO3S 1NVBA 1ZGCA 3NFYA 3WFIA 1WBBA 2QRJA 2XWBF 4KQ9A 2NXWA 2CEKA 3STYA 4P4LA 1A2QA 4GZ5A 3OESA 5AI4A 4NEHB 5FO0A 2Q7DA 3QWIA 1J7KA 1GILA 4ZHQF 5MN4A 4GD3Q 2X4LA 4KWHA 721PA 4PY2A 5LQJA 5BSEA 2RK6A 4J43A 4ARCA 1K8YB 3SLGA 1KKUA 4YPOA 1XVIA 4BTVA 3AC0A 4TWAA 4BLVA 4YUAA 5KYWA 1WXWA 3FFAA 3HLYA 4JN6B 4LRWA 4EQ6A 3ECAA 5ELMA 3WKAA 1JG4A 5DOVA 4ZIRA 2CF5A 4GMFA 1WUTA 5JQGF 1C0KA 4PLFA 4UBJA 3VTKA 4TVBA 4UE3S 3N8KA 2RH4A 5BOSA 3LRPA 2JAOA 1Q7TA 2PH1A 1FSPA 2RAUA 3FG9A 1Q77A 1C8VB 4TTAA 1D6NA 3STTA 5HRUA 2A0FA 5B1IA 2UU9B 4KHPB 3KV3O 5C34B 1U2GC 1WV1A 2YOFA 5CR9A 3ULKA 3ED1A 4ZWNA 2ZRPA 3FPCA 1H85A 2CUKA 1TVCA 2YXNA 3F8TA 4TQAA 4Q1BA 4V0RA 3RTDA 3UJPA 3NHAA 4PYRA 2RCYA 4CEIA 3Q12A 5G53C 2ZSBA 3PXEA 1H8ED 1IZYA 3E5RA 3OJLA 1XKXA 1UBEA 4PWZA 2YJ3A 2GHQA 1V71A 3GNLA 2OV2A 3TDMA 2ID4A 1RP1A 1SVKA 2AD1A 1XWIA 4E1VA 1SXQA 5DGXA 1DL5A 3WGUA 3C5CA 1J47A 3OBBA 1MG5A 1V6AA 4G5HA 3DKPA 3UV7A 3CG0A 3JQQA 4YMLA 3OWHA 3ECCA 2AQ8A 3LTEA 1VLZA 3HPQA 4JXKA 3UNXA 2GZHA 4ARZB 2ZWAA 3RUFA 2ENUA 3RSGA 4FW9A 2PSEA 4TUYA 1QHHA 3S5JA 2XQFA 2VJKA 1JLHA 1D1TA 3PXAA 1EQ2A 3A26A 2Z98A 1EDEA 1GXSB 2GN9A 2V97A 2ZR0A 2GHRA 1KRHA 3DC7A 3KSDO 4W5OA 1U80A 1XTTA 3LECA 1KJIA 5DBHX 3TXAA 1M5TA 4KQCA 2CD9A 3JVVA 3EEIA 3OT1A 4R69A 1XZDA 1IG0A 2FUCA 1AA6A 4OV6B 1PO7A 5L9AA 1YL6A 4BV3A 4WOJA 2HWUA 1YUNA 1X7ZB 5KTTA 3T3NA 4AJ9A 4ZVRA 3TSZA 2Y0CA 2G8LA 2X7JA 4IXTA 3DUFA 4OQZA 2DLCX 2VLBA 3GRPA 2AH5A 4LSWA 4PNZA 5DHUA 1DMRA 2GPWA 2O0LA 3BXXA 3KKLA 5C8YA 4TXHA 5CEJA 1DG3A 2AG1A 3AEKA 4I6GA 1SEVA 4RK5A 1TAUA 1SG0A 3GGOA 3WB2A 1TZBA 2QM7A 3L0DA 3N76A 4NR0A 3ZDZB 1H4TA 1QPGA 3ESCA 2WW8A 1E4EA 4OK5A 2QLTA 5AHXA 4NHOA 1ND6A 1LVUA 1O2DA 1SCKA 1X14A 3BTOA 3L2OB 2E4YA 2A9VA 1OLXB 3S27A 3L18A 2PMDA 2MOKA 2BMWA 3DL7A 5ABPA 5FI0B 1PR9A 1XVVA 3GVIA 1WXGA 2FWNA 3HPRA 3BAFA 4W5TA 5JE8A 3V9PA 3WGQA 3MQFA 1FTQA 3QUCA 1ZESA 2DR3A 1XNJA 4IIUA 3ND7A 1UP7A 1UEXC 4GOKA 5FV4A 1C7IA 3HCWA 4OGGA 5FL3A 5JQGA 3I9V1 3AR6A 3HP7A 3W90A 1IH8A 1X13A 4GW3A 2HNKA 2OFPA 3EY4A 3NTXA 1U3UA 3WLFA 6Q21A 5BUCA 5HKAA 5CYOA 1XDUA 1IQ0A 1ZNZA 1C1YA 2FSGA 4Q1DA 5LZ5A 2NV6A 3CNHA 4ZVTA 4BFWA 4FFMA 4IO0A 3O3CA 2EWVA 2R60A 3H2HA 2H8GA 3GR6A 4M87A 3WWZA 1IBKB 2B1JA 3OKCA 3EHEA 2VWGA 5DLQC 4YT8A 4DV1B 3FBGA 4KO1S 1S2MA 4WFKA 1YVPA 4L72A 3B20A 3WQHA 2P3LA 1P61B 2NO9A 3TNYA 2JGJA 1VECA 2WJ4A 1I3LA 1DUSA 2ODNA 2XAAA 4S1TA 4XQEA 4Y2PA 4A9AA 1E4EB 5CNKA 1CDEA 1CR0A 1SU4A 3OFNA 2PZAA 4YWHA 5KREA 1H2AS 1N9GA 2HU2A 2J3LA 3OM8A 2PQMA 4XVQA 1TF7A 3BH7A 4QYMA 3UKJA 1LC0A 1MJHA 3LQ4A 4ARUA 4LVNA 1GAQA 4P84A 5K0TA 4WEOA 4CF7A 2VNAA 3IQHX 1NBMD 2X42A 2Y9PB 2YC4C 3E8XA 2JGDA 3IHLA 2WJPA 3QE0A 2QLMA 1S4QA 3K20A 1ABFA 1E3WB 2CJFA 5LBUA 5ALSA 1M34B 2JZNA 2JCGA 5JFGA 1WCIA 4ZHSA 1OBFO 2IYTA 1WY7A 1ZPDA 1N9GB 3ZI7A 4Z49A 1ZR2A 3QLVC 2ZUBA 4BO6A 3ZWXA 4B33A 4D0NA 5KNCA 1CUXA 4QU9A 1REQA 3FD8A 1N3IA 1WKCA 1XTKA 4DLUA 1HYGA 4BAGA 1T6ZA 2E18A 3DZFA 1KAHA 5BWCA 2JGKA 4YO8A 4QPCA 3R9WA 1ZIOA 2VJYA 4UBMA 2JATA 4KTVE 1D0IA 2VTBB 1J0CA 3AZOA 2HK9A 2I29A 2TS1A 3QUSA 4RCVA 3GEHA 1ADFA 4LZZA 3VVLA 2NSHA 5KQGA 2AYZA 4XJTA 4IGAA 4Y2TA 3WIEA 3VPGA 5L3ZA 5FO1A 1AKRA 4YRQA 1GRCA 1FDIA 2JBHA 3IOCA 4M0EA 4OIFA 2O6LA 1OTXA 3NVMB 4ITUA 4QTUB 4ZV9A 4MQEA 5CDHA 3A6KA 3OCYA 2DSTA 2TMKA 1II0A 4MQFA 3VSDA 1IHOA 1JFLA 1YB4A 2VT7A 2WU4A 3AY6A 3QPBA 1CY6A 4GS5A 4OLAA 2GVZC 4P36A 1J22A 1XVLA 3IT3A 4GR9A 4GWKA 5C5CA 3KQTA 3AESB 1XX6A 1A7JA 3SPXA 4ZJYA 4LFBB 1CX9B 1TLTA 1ACLA 3S8YA 4LBWA 1R9NA 3DF7A 1TXGA 3TWOA 2A6PA 5DMXA 2W2NA 2XY4A 4JLJA 1PGJA 2O2GA 1QTNA 1Z4MA 1DEOA 3NYRA 1SC3A 4H1HA 3D3EA 1ZK4A 4M1EA 4XRRA 3T7AA 3T3DA 3OE5A 1DAGA 1F51E 2P65A 3PXDA 4JJ6A 2BONA 4NECA 2XD9A 3KJFA 1V7CA 3NBYC 1MXHA 1M54A 2AWNA 3H1TA 1D6MA 3O7WA 4RZ2A 2ONYA 2WJYA 2F17A 2JFWA 2PBFA 4RVNA 3V33A 1BD3A 4EB3A 3ESRA 1QK4A 2XLCA 3OX4A 1SC9A 2IDJA 5ERGB 2FG6C 1LPPA 2PCLA 4XIYA 2ZSEA 4GWGA 2CDAA 5DBEX 4BVFA 2IGTA 3U4MA 3ZDYB 2C3PA 3LPLA 4OMCA 2A33A 3BD6A 3KOZA 4FINA 3DM9B 5C1PA 4QBIA 1MW9X 4D8UA 1MO3A 3IAS6 1RRVA 2J87A 3UAZA 2AC2A 4ER6A 1COWA 2X3UA 3DBVO 1WDTA 4B4KA 2IPOA 1JWAB 2QTWB 1XCMA 3B5JA 2BUBA 3KU1A 1J2TA 4AWXA 1PEYA 1DJPA 4WCFC 5IWAB 4Z4HA 4WK6A 5IARA 2Z4TA 2L2QA 4B4DA 5D3MA 4QGGA 4HUTA 4YMIA 4FUQA 4CKYA 1XA4A 3EH2A 3PDUA 3TPZA 4IIJA 2YWRA 2C5SA 4MLPA 1SK8A 1QKKA 2UV8A 3BFJA 4DIEA 1N5KA 1UZAA 4CDNA 3CLSD 3RROA 3QXJA 3CNEA 1SWWA 2QMZA 3KX2A 2BFCA 3HO6A 3SQLA 3I53A 2XA1A 1OAOC 1LBSA 1DJMA 1X7XA 5HMMA 1NUAA 4KHZA 2O7QA 2WSBA 4RXTA 1T6XA 3IXLA 1CRLA 3NWOA 2GAAA 1T5SA 5IW8A 4XIGS 2XOKD 2PFSA 4OP2A 4I3HA 5FAKA 3NC4A 3FYHA 2NZUG 2IHTA 1Z0AA 3ZD6A 5KHAA 4E2WA 3Q11A 4ASUA 1JGTA 5HEKA 3OE7A 4HFRA 4OI2A 4Z8XA 3TLGA 4W8HA 4BJ1A 4WK4B 4O2RA 1KEPA 3OUZA 4ARVA 1T36B 4FWBA 1RXYA 3H9CA 3G2PA 2FY8A 2AHOA 1V64A 4G01B 1SY7A 2RC5A 3K72B 5CVCA 1XU9A 1SRQA 4D9CA 3TTXA 2IWHA 4XASA 1JE1A 1FYWA 3TXXA 4BMZA 3KZKA 1JZQA 2H07A 3F6PA 3LSTA 2QD3A 1LVGA 2GQ0A 4J16A 1ANKA 4MW5A 4NV1A 4DPLA 5K05A 3TFWA 3DTTA 1VKZA 4OD0A 4YO7A 2BFEA 4GQAA 2NUAA 2OLJA 1WSAA 2XF8A 3IVMA 1X8KA 3HB9A 2ZOSA 3IVXA 4NBSA 4XUEA 3SLKA 4BQIA 1EMDA 4MIOA 1KY3A 4C3ZA 1L5KA 1GCOA 3NUGA 3KR1A 4L7QA 2FPIB 4RDCA 1L8LA 3Q9NA 1EXWA 1X1TA 1N6PA 3Q72A 5JYCA 4C7KA 3M6LA 2FP4B 2DFLA 2ZDGA 4BVBA 1TPZA 1SB9A 3MTIA 1QS0B 5CG1A 5EJEA 3OPQA 2RG1A 1R4ZA 1RWMA 2J85A 4AN0A 2GHIA 1W85A 4FTWA 4W99A 4Y98A 3X1WA 1KH2A 1Y1TA 3D4IA 2BM0A 2QSUA 1VYVA 4HG2A 5CXSA 4LRSB 4GPTA 5EHQA 2Z1DA 4Z53A 3OI7A 4ZT7A 3U17A 2D5BA 2QLBA 3B2QA 1JEYB 5EP2A 1PJLA 1RRGA 4DWJA 4XI9A 1NT2A 3HVHA 4NARA 3I6MA 2CNOA 4Y7CA 1YTLA 1JI3A 1H1TA 1YMQA 1HTBA 3DDOA 3SYTA 1Y89A 4A8TA 5IM5A 2ONKA 3AUKA 2NZXA 4NMXB 4OBXA 3O4VA 1U0HC 2F43A 2J9XB 1H5QA 1GIAA 2QHXA 5CPBA 4UFPA 5AI5A 4LBZA 4DY4A 1LI5A 4NLLA 4QAJA 3HN2A 3BMCA 3BN3A 4K2HA 5BV7A 3AZQA 1ODLA 1T15A 3DZGA 3IDZA 4KR6A 3P0HA 3WYFA 4YCJA 3STHA 5DHFA 1Y3CE 3QKIA 4RK0A 3EMVA 1C8BA 3EBPA 3VR3A 4P7KA 5H4GA 4HPWA 3IPYA 3AOGA 1OZ0A 1UWKA 4I5EA 3FNIA 4LG1A 1NC3A 3P97A 3R0VA 4B3GA 4UMEA 1PSWA 3ELWA 1DIGA 1B0PA 5EUQB 4PLWA 3KPUA 3VR2A 1CQJA 5A3SA 2QV7A 3K6SB 3X1ZA 3KKEA 4OEHA 1R0LA 4X1IA 3GDWA 3UH1A 1GAJA 1YJ8A 5MGNA 3FOWA 3OM0A 3D3QA 3FWYA 3HS3A 1GLGA 5AT1A 4TLAA 4L6IA 4EUFA 1SXIA 6REQB 2GVDC 4QXRA 3MS2A 1DCKA 1PW7A 2YFKA 4EZIA 2LCFA 3IUPA 5FUXA 1PI3A 1Z8NA 3F2IA 3V00A 1X2BA 5C3MA 1N6LA 5JWOA 4IQGA 4UFNA 3FYTA 3DXFA 1GU7A 1XQ1A 2I4LA 2PZ8A 3CTPA 4G6ZA 1T1IA 1CZKA 2DR0A 2PX6A 4U2FA 2MSEB 3AERA 3LIIA 2FZVA 1ZI8A 3ZKWA 1KYIA 1XCGB 1XN4A 1HE4A 4IP0A 4LJ9A 4U39A 3STWA 4LGYA 4FNOA 2J59A 1VJRA 2Q4DA 1M72A 4JU8A 1IN4A 1KR2A 1EUDA 3GEGA 3JQRA 4HQKA 4MQ5A 5BXYA 3GEMA 1IJFA 4BAZA 2GN8A 4RCZA 1YKGA 4ZGBA 1ZNWA 5JSQA 2AOUA 1G5FA 2Y1XA 1W52X 3T5MA 3D4NA 1VSUA 1C1XB 3JAKA 4MA4A 3ZYCA 5KJ1A 2OXEA 3NPMA 2ZTLA 5DM60 4FFWA 2O3SA 4GPZA 4QFMA 3K92A 4JY7A 3GJRA 5FI1B 4TKLA 2BE9A 1P1BA 1T9DA 2I3AA 2K87A 3JYOA 3RJ9A 2PGNA 4CHGA 1ZZEA 5I7FA 2DGDA 3N3AC 1CZOA 1S01A 3QVJA 3V4FA 1TQ8A 1XP5A 2W8ZA 2IPXA 3CVWA 5EZYF 3F5MA 1YRWA 3U4AA 2C20A 2Z30A 2HMSA 4QWWA 4ENTA 1TJ4A 5D84A 1Y8AA 3AHCA 5ITWA 3EGCA 1UT8A 3AW8A 3B78A 4JOQA 2F59A 2J30A 3ONEA 1SUPA 4RLFA 4XCQA 3VV3A 4MVJM 4HAVA 3K1JA 3WMRA 4AY4A 1Y37A 3CXRA 2XNSA 2OAQ1 1B1AA 4JUIA 2QN7A 4QXPA 3NEYA 3IMGA 3KZXA 4L5IA 5FL7D 4C3VA 4FI3C 2JI6A 4ZKDA 1SBZA 1UK8A 3PQEA 1FFGA 4OHYA 2C92A 3E9ZA 3NWEA 3FFBA 1CUVA 2Z8XA 2NYRA 2RGGA 2YIMA 2I03A 3KOUA 3B7GA 5FTKA 4FNAA 1IXKA 3NVKI 2OHHA 2H48A 3I72A 4Y2JA 3EEYA 3G2NA 3FOCA 4G1MB 4HDRB 3G5UA 1G8GA 1ZJJA 2QR5A 4N3CA 3DYIA 2X19A 5JYDA 3O9MA 4UMFA 3ESXA 2QRPA 4Q3CA 1PFWA 1SULA 3PU6A 4WN9A 1YJXA 1WRBA 1Q44A 2XGSA 3NEJA 4D9HA 2XTNA 3GK3A 1T25A 1F1BA 2R5FA 2WBLC 2ZTVA 4NMWA 3T5TA 3TOCA 4C4XA 4L0QA 3WRYA 3AJDA 3AHFA 1NF3A 3E2PA 1TZ2A 1FFXB 1ICEA 1OU0A 4PRLA 5EZYB 4Z54A 2OFFA 5AJUA 1P75A 1P2DA 2PYDA 4RD3A 1T9BA 3PC8C 3W1EA 4EI2A 1UBSB 2IOHA 2PLAA 5FTNA 4ZD6A 3R74A 3ZE0B 3DZDA 3FR7A 5JQWA 2C9OA 2RARA 1JDJA 3ACDA 4G41A 4IXNA 1G98A 3K1AA 3PHCA 1YIAA 4GKVA 3QKRB 3CTMA 1FP4A 4S24A 5K6AC 3R7BA 1JQAA 2Y92A 4N8EA 1KE2A 3A32A 1HA3A 1VJ5A 4BYGA 3V8VA 3I12A 4KBYA 4P53A 3LKDA 3WGIA 3E82A 3AM1A 3EXHA 5AW3A 3HJAA 2Y1LA 3A6LA 3EZXA 4PHFA 5FWNA 1BYUA 1FY2A 2IH2A 3N8HA 1PWHA 5JJIA 4EFMA 3MFQA 2UVQA 4YXWD 4DGQA 1JIXA 1PZGA 2QZ4A 5FJJA 2BWJA 4UNPA 3M81A 4BNXA 3KQMA 1J2UA 4P5DA 1HZJA 3DV9A 4HX9A 4XR4A 4PINA 2GUWA 1Y6JA 3NM9A 2DWUA 3D3WB 4FDTA 1DRWA 5H1YA 1PHPA 2ZGVA 4UDNA 3TRDA 3VKUA 1Z45A 5LQUA 1YUBA 4A8JC 4BKMA 5EWJA 4DQXA 5AKHA 3GFBA 1ZNYA 4XB1A 3RC1A 2QEQA 3FIUA 5ALUA 1PIWA 3WK4A 5AUOB 2H85A 4C0SA 5MHTA 5BVGA 1EVKA 5EZYA 3ZHYA 4YCAA 4YJ2F 1PR5A 1BOOA 1SCAA 2NO4A 3T4XA 4BKUA 4G67A 5JS6A 3U44A 3V8NA 1XDWA 3TX2A 1NQTA 1EI9A 2IZ5A 2JIBA 3BEDA 4QDKA 4CDMA 1IUNA 2ET6A 5CVTA 3TW0A 1C41A 2BBOA 5A4KA 3O8LA 1F2DA 4IF6A 5LM3A 1M6HA 5C1OA 3EEBA 1FUYB 1VJTA 2XMSA 4X9XA 1Z68A 3C3MA 2WWFA 3OU7A 4KJXA 2MSKA 5LB2A 3SF8B 4IPTA 3TTTA 3J81A 3AKYA 3R3VA 4FWIB 2ZSFA 3RRXA 1J4AA 1KIFA 1VLHA 1Y7IA 2ZUWA 5I6DA 2HX1A 1H66A 1GL9B 2C2XA 4ZTBA 3UWMA 4D3FA 5JPIA 2JC3A 5BURA 4WDQA 3RU3A 4HB4A 3WQRA 2F55A 3CW8X 3IAUA 1WVIA 1J5XA 2KSQA 1VHJA 2NQ8A 2JIZA 3GLQA 1NR1A 3OBIA 1F5SA 4LMRA 3ZBPA 3FUWA 1NXOA 1E59A 3VU9B 1H3EA 2AQHA 1NDUA 4NZZA 4IR7A 1I7QB 4I0WB 3CYFA 1E1MA 2IHYA 1TAGA 2B7BA 1C9MA 3A04A 3AIIA 3OP4A 1VMKA 2AZ4A 4JJ4A 3R7AA 4AG6A 3WGJA 3I45A 1V11A 2D74A 3QF4B 4OMDA 4YONB 1M2KA 2ZSIA 3GRYA 2HIAA 1RYZA 4Q3DA 2HA3A 3B1XA 4NOLA 1ID8A 3FHLA 3AWDA 3JD0A 4MS1A 2WABA 3T5GA 3R3HA 4CV0A 2QJRA 2JPDA 2JKVA 1D9ZA 3GRCA 3DKIA 3WQSB 3THXA 2P1ZA 1WXEA 2QG9A 2TMDA 1O6GA 2DC1A 3TQ6A 2C0CA 3B1ZA 3G5AA 3N75A 4ZQFA 3UGJA 2FOXA 4JSYA 1ILWA 3KUDA 2O2YA 3LF2A 2EIHA 2B2NA 3MRVA 3ETNA 3G49A 2QGZA 5FPHA 3QELB 1ZQ1A 4OVKA 3ZU6A 1K99A 5LPNA 2QN3A 5AOCA 3KYDA 1T3HA 2J48A 4UBOA 1ONSA 5K0BA 3CKKA 4Y2QA 4EKDA 4F91B 2IX9A 3VR5A 4JUAA 3Q85A 3TBHA 5HRAA 2ZEJA 1W47A 1P2UA 3W78A 3UAOA 3ELBA 1W4LA 2GJKA 2IOFA 1DKMA 3NVDA 2BR5A 2XTMA 2E5LB 4NKRA 1HEUA 2A9PA 2C2WA 1R6AA 1L7EA 4UM9B 3HBMA 2YWXA 2EZ8A 3DOCA 2BVNA 4M9ZA 3UATA 3JVEA 4M37A 5EC8A 1WV0A 4OBEA 4YJ2A 2HGZA 2IS6A 5GJVC 4C7XA 4ZQEA 5JH7F 3E1SA 4CU2A 2QVXX 4D9FA 4AZTA 2BEWB 3V8QA 4FK8A 4OMFG 1UBJS 3SJBA 3EZFA 4L4SA 1Y1LA 1FJ2A 4DN6A 3HO8A 5A4FS 3A1WA 4UHCA 2QOEA 2ZT6A 3LVQE 2Q5OA 2NQTA 4LRXA 2A5JA 3M1LA 4HGOA 1CFZA 4UBIA 4ZDKA 2IP2A 4B5LA 1LRKA 4U63A 4HWKA 1VA4A 4KV7A 2V7QA 1N5IA 1R88A 1UQRA 3CUWA 3WLIA 1VPEA 2XGOA 4R16A 1A1SA 4HEA1 3OZ7A 3IMFA 4YVFA 5EWMB 3ZWBA 1IL0A 3NONA 2ZJ7A 2ACWA 5BQOA 2E1PA 3EYAA 4JUFA 4F46A 4I2NA 4MWEA 1VI5A 2YINC 4I08A 2OC4A 1KXJA 4OU4A 1H2YA 1JPVA 5DWVA 3GGJA 5C0OE 3U2BC 3FAZA 4N5LA 3ZBQA 2AJDA 2IELA 3QEMA 4P3YA 5GOTA 4JOBA 1GGMA 1UKBA 3I1FA 4PC1A 4PXSA 4EF5A 1GT0D 1K2WA 3LQQA 2RAVA 3SHWA 1Q0TA 2IHBA 2EGGA 4MIEA 2VF8A 4MUBA 2NTEA 5JASA 2IEIA 4RZIA 4DA4A 1V41E 1KVTA 2NO1A 5DVZA 5JH7B 2HSJA 2IEYA 1EUYA 4AAYA 1OFHA 3L7BA 4ZC8A 3S1LA 4ZT6A 2O1WA 1XQVA 3KHSA 1AK9A 1MH1A 3OU2A 3JW8A 3P71T 3FNGA 4QZVA 3U39A 4TVKA 4O33A 1OWNA 2V5VA 3QMWA 4DMRA 1YVRA 2JJ2A 3Q15C 1JSRA 2WTXA 3GP3A 4MUFA 3CPHA 4TS3A 3RVBA 3L6DA 5SV2A 3BE4A 1PD0A 1GDHA 2CXRA 3E4DA 1PP4A 2IPMA 4L1KA 4NNJA 3AEUA 2ECQA 4WBXC 3VDXA 1KJ8A 2G06A 1XFAA 3KJEA 3VPXA 4ZCPA 1LTHR 1OYVA 4P58A 3EVTA 1K5DA 5IANA 4YUWA 4HN9A 2YDXA 3AF3A 4P32A 2DETA 4REMA 3O3OB 4YJDA 4Z0NA 1JLLB 3KBBA 4ABTA 4QLAA 1WETA 4R8VA 2RKBA 2VLIA 3NB0A 3D31A 4MJ7A 4MV7A 3NHKA 2OAGA 4PX3A 3CRZA 2PLRA 1CUIA 3AF6A 1Q1AA 3MTEA 5B7QA 1G2PA 3VU0A 1KMMA 1KJZA 3IHWA 4YAUA 4URVR 3RS7A 3ZXSA 1P62B 4MQEB 2OXCA 5BN5A 3TE7A 4KFTA 5IXYA 3ORYA 3FGNA 3SBXA 2C59A 2G77B 1HFWA 1TO6A 1X8LA 3HR8A 4MQFB 3I5XA 2P9CA 3AEKB 4KVFA 3JARA 3DHWC 3F4KA 5M7EA 3HXLA 2EFYA 3RAFC 1R0CA 2R65A 2YNMC 3RK0A 1SHUX 4GDMA 3D7RA 1GQ2A 4CEJB 1F2UB 5I5EA 3WLJA 3FPGA 4PGGA 3VO8A 4AF8A 2ZWVA 1Y7PA 1EX1A 4X90A 1P2SA 4QDTA 4CL3A 1M3SA 4NC9A 3P2YA 3N74A 2BF7A 3OCWA 3UANA 1EVQA 2QE7A 1NJ6A 1FRZA 7ADHA 3ZH2A 4QQNA 2XYRA 1UKEA 3JY6A 2JAXA 1AO3A 1SOUA 3BGDA 4FYPA 4N8SA 4OQDA 5AM0A 3N6XA 2W6JA 3AKZA 5KNBA 1DEKA 3NH9A 1TZMA 4FUTA 4KMOA 1KVQA 4M1QA 1IXSB 1JEAA 4R9UC 4MVJF 5SY9A 5IF3A 3DXXA 1NFQA 3K9BA 4PLVA 3QE4A 4PYMA 4A6PA 1THZA 3TNDA 1DBSA 4J4HA 1QORA 3KJXA 3BD7A 3UBTA 2QRVA 4KR7A 3NAZA 4BNNA 4FLEA 4MW2A 1E5QA 3KB6A 3B70A 4XWAA 2O06A 4IJKA 4UM8B 4UNIA 2IH5A 4UOZA 3EDRA 4PANA 4FJ2A 7REQA 1Q6ZA 3D6HA 1OIWA 2XKKA 1UKAA 2XCLA 1TM4E 3R7WB 1ZHFA 3HH8A 3W2IA 3WK5A 3EMDA 1CW2B 2JIQA 4IH1A 3D9QX 3VSEA 3BMNA 4RWZA 3ZGYA 1KRWA 3D6AA 3PPVA 5B64A 1EUZA 5MN6A 1C9EA 1Z2OX 1J5EB 3EF3A 1I5EA 2NIPA 1LW7A 4CGZA 4OQQA 2P3OA 3VDNB 4GR4A 2O8DA 1THGA 1XVTA 1WB9A 5ESRA 1ZD8A 3OQPA 5HUHA 3RC7A 3HL4A 2OZVA 3ESZA 2J9GA 4JLSA 5H3CA 1K4KA 3Q9SA 1K27A 2DBVO 2HHCA 1ZICA 2OB2A 3CX7A 3K0AA 2DUUA 2QZPA 3JWIA 3WO1A 1ZP6A 2D2EA 4IAOA 5E4JA 4B43A 1E60A 1LSJA 3VU1A 4PQEA 1DC3A 5FNVF 3E5NA 4TYQA 2LZ0A 4TZKA 2NM0A 3KJNA 1X0VA 3R77A 4LY6A 3RIYA 4QFBA 5DTIA 3W06A 4NAHA 3DL0A 1YCDA 2QW1A 1RIIA 3HVKA 3OFSA 4ZGGA 5ISMA 5LR6A 4L5AA 3K0AB 3SSMA 4TS4A 5HR5A 3OEHA 3P8ZA 3QVXA 2UVPB 5KJ6A 2VDMB 3H16A 3RS2A 1JU9A 2OCYC 3C8HA 1W96A 1G5QA 3T3PB 5FBVB 1T3LA 3F6SA 4Z0HO 4JMPA 1ZA2A 3P9IA 4KUGA 4E03A 1A8IA 4B3HA 4I4LA 2FPUA 1QDEA 2J0VA 2VPZA 4RL4A 3A4IA 5DULA 4NV3A 3NWJA 1DXYA 4OJTA 2ZBPA 2XRZA 1RR6A 2I2AA 3PFNA 4WOPA 4DM4A 3SC6A 1XELA 4E21A 1P80A 2I7TA 2AB0A 1GPDG 3R0ZA 4XQ9A 3TL3A 2CVPA 4NDNE 3N39C 2PMEA 3D6UA 3I9FA 1BDIA 4P33A 4R1TA 2YTZA 4HQLA 3DT9A 4I99A 1OLUA 1P8JA 1ULZA 3I23A 3OZUA 4TWZA 3WGTA 1IWBB 3TYXA 5LXTA 2JLYA 5CM8B 2R8BA 3WWPA 5C18A 4JR0A 3A0UA 4IKEA 4PZCA 3X2SA 3PSAA 2AUNA 4MRMB 4DQVA 5FUQA 5DNUA 3T3EA 2V9CA 2AEJA 2H0RA 3BHNA 3NNSA 3QUTA 4HH0A 5FH9A 4H1WA 1O6FA 5IG2A 4JP1A 5JBIA 1O58A 3K70C 2XUFA 1IBLB 5K3OA 1U8UA 2CFTA 4K9NA 4BBPA 4D4LA 2A9KA 3UV6A 2AG5A 2QGNA 1TA4A 3M9XA 3GOHA 3Q5GA 3DT6A 4MVJP 4GG1A 4CPDA 2XHEA 5CDYA 3U4DA 1I0IA 4W1RA 4INAA 1GT6A 1Q6YA 1WTCA 2VUHB 2EATA 2O6HA 4XA8A 1ST3A 4ZYYA 4OHWA 3UJDA 1QQAA 4XOIA 1PWZA 2C1EA 1HYBA 1QGYA 4X3PA 5E95A 5G0SA 3VO2A 1DAPA 4YRGA 3D59A 1Z38A 3PRHA 3RHTA 4U0KA 3EXIA 5A02A 4XDZA 1TC1A 4ZVSA 3HYNA 2MDTA 4FDUA 4I55A 1K5GA 3H5LA 4UNQA 1R3DA 1T2FA 3ZNNA 5BMVF 5E8JA 3T5AA 1LDMA 1OREA 1PKEA 4JVLA 1RWNA 3H0CA 2EFGA 3MTDA 4PO8A 1XZNA 1ZLXA 4MQUA 4UW9A 3GJ0A 5ALMA 4RTJA 2OGUA 3UT0A 4CI0B 1NQAO 5JZOA 4NQRA 2JK0A 2WSSA 1V48A 2W22A 2CLDX 3VPSA 5KWJA 4L07A 3WTBA 4ZZ2A 2Q50A 3IVCA 3TLKA 3OOHA 4H1VA 1WZUA 1X39A 4HQ0A 1J9GA 1RRKA 1GZSA 2G0AA 3CINA 3ZW8A 1Z75A 3GIWA 3VR3D 1LD3A 4B85A 2HK6A 1H8EA 1SVNA 2GB4A 1JFFA 1JG1A 1G7RA 4LNUB 4X1KB 3X1JA 4FB4A 5BWLA 1AX9A 3DVAB 2UYYA 3EUFA 1TB4A 3CM0A 3EG5A 4Q9DA 1CV2A 4OQFA 1Z06A 1JHDA 1FQKA 3OA0A 2PMWB 3CC8A 3FTNA 2DCUA 4C3OB 5I7HA 3QUBA 3GYGA 4X61A 1IJKA 2AJTA 1N5DA 2PU7A 3KLBA 1P0PA 3ZHSA 2I71A 1SC1A 3K30A 4FB5A 1YR1A 2I4RA 4BY9E 2PUBA 1T2CA 4QEDA 1U98A 3LPMA 4KL8S 3TLJA 5J58A 1JEQB 4BMVA 5A5EA 5E7MA 4JDUA 4EF6A 4QQ8A 1YR7A 2VSXA 2Z6QA 3L9WA 2DFNA 2ZXFA 4OHCA 3H75A 1QCDA 2FPRA 1KYQA 4K0RA 4IIHA 2ORWA 4GE0A 4KK4A 2WP0A 1JTVA 2I3DA 1ULTA 3BEOA 2B5WA 4P4NA 4QRDA 1CUYA 1N5OX 1QHIA 5D5HA 1DXHA 4HWTA 5TPWB 3EVFA 1EA7A 5FHRA 1L5HB 1P1CA 2GEKA 2WWGA 3GP8A 1GKLA 1AU9A 1I11A 1QF9A 3HUDA 5JSHA 5FCDA 3DJFA 4V39A 2BZSA 4HTFA 2C2MA 4M0LA 3GL9A 3M70A 1UDWA 1K9VF 3RFCA 5KNDA 1XPUA 3WY9A 5LVAA 3QY9A 1QLHA 4MUJA 5DCWA 4DNQA 4CTOA 5CT8A 3U13A 5IT9A 3AQ4A 2ODQA 3KJHA 3MWKA 4YN3A 3TLMA 2EJVA 4LK2A 1F2TA 2I87A 2XUPA 2ZFUA 4OBWA 3L5KA 1WKBA 4Y6OA 5IBRA 5K3FA 1L8OA 5AVTA 3UMGA 5DSZA 5EJ8A 4TKZA 2Q5FA 3FLMA 3Q3VA 3I32A 1K06A 3NAGA 2A4MA 3ACCA 4DIOA 3GC6A 3D7KA 1OW3B 4TS1A 2ATEA 4Z7QB 1Y82A 1DC6A 4BLTA 1NUSA 2DHEA 2XUZA 1MJNA 2ZUDA 3LO5A 3LFHA 1F0NA 4JWTA 1BCSB 3V6LA 4Q4LA 1F2TB 1T5BA 3E9DA 1NLZA 3EZ9A 5J40A 1NBMA 1F1JA 2AX4A 4KBFA 2GNOA 1JKFA 1YR6A 3WNBA 1N3YA 5M34A 3JARB 3PITA 4QUJA 5GTDA 3O82A 2JLAA 4JKOA 5DM0A 5LZ8A 3MCTA 5CB4F 5JAIA 2EZ4A 4U9HS 2LE4A 2H31A 3ZY2A 5I4IA 2WWTA 1G8HA 1YBMA 4L08A 4L4UA 3VHQA 3PF8A 4IKPA 3ZWMA 1ZAYA 2OVFA 4FZ5A 4GO1A 4N0QA 4B74A 3GBPA 3IR6A 2OAP1 5DXJA 2R25B 1I0LA 1CQWA 1SKBA 3BWMA 3LCMA 1BN6A 1UBUS 4B0OA 3H04A 3E8SA 2AKEA 1R00A 4PC6A 1HDEA 3QU5A 3WGZA 4DDTA 4D6XA 4F9EA 4JGGA 2IE8A 3N8NA 2OD9A 4IG9A 1F48A 2PGLA 2PK3A 2RHWA 5B7GA 3VJRA 1VP3A 1Z26A 4C7VA 4L8VA 1RZVA 4LY3A 4RHEA 5K03A 5BRJA 5DDIP 2B37A 5CCDA 3F74A 4K3UA 3PJGA 3TPCA 2IX3A 5KCZA 1M8PA 3D0QA 5EJAA 3KAQA 1JA0A 2VP3A 3EUWA 3H4IA 3TO5A 5IHPA 4M8SA 1W6RA 2BZGA 2G83A 4QDOA 1ENZA 2YIJA 3LDAA 1HO3A 3D0RA 1VIAA 1XT6A 3TTWA 1LNZA 5K7SA 3THXB 2Z57A 1AKEA 1G0OA 1OTHA 1Y3AA 5JNVA 5I9MA 1VM6A 3A6DA 1ESEA 3L7LA 5JCOC 2SECE 4IWXA 5C4MA 5IMSA 2UUCB 1E3LA 2WVAA 4UXIA 5HKLA 4YRZA 4I4TA 3DFKA 4E6EA 3RSHA 2CY0A 5AFSA 5LOVA 3QEJA 2O8FA 3T7JA 2VRCA 2IYQA 1RBZA 3C3BA 5AJYA 2CDCA 3ZZMA 4M60A 5CFRA 1RMYA 3RWOA 1J00A 3DO6A 4FONA 1QGUA 1KZ4A 2XBUA 3HI6A 1C1XA 3JAKB 2EQBA 4IIGA 5DNVA 1F0PA 3RRJA 3CLUC 3TJMA 4DVGA 2VDNB 2BR4A 4OQXA 4D9GA 4RQAA 1NKSA 1O94C 2PKXA 4M55A 4PYOA 1NTOA 1V26A 2ZI5A 3VH1A 3DEYX 3P0RA 4V0NA 3WK8A 5KTYA 4XX1A 3C4QA 1MB3A 4TLDA 3UGQA 5CG2A 3CE6A 4C20A 1E3JA 3WKCA 2VI5A 2FPGB 4J94A 4WKPA 2BFDA 3NTVA 3DXYA 4I5DA 5LOVF 5IHXA 4N6NA 2HADA 5G1OA 1VE5A 1JQ5A 4QJ3A 2M2IA 3KAKA 3LBNA 4Z9YA 1F5NA 2ZJOA 3LQ1A 4RIIA 3RWMB 3H65A 1QVAA 3BD8A 1H4QA 1BE6A 5T3YA 5LYJF 4PM4A 3ZNPA 1RTTA 2KLBA 1MC5A 2DFPA 4C21A 1J5PA 1Z33A 1J46A 1ZH2A 1U1EA 1BHJA 1UOOA 3VHLB 3FDFA 2C7VA 5E7QA 1CD5A 1P9WA 4P38A 1KOGA 2EU8A 3ZHUA 3IODA 1TIPA 1XTBA 4ZQBA 2HIGA 1H94A 2AZTA 5CB8A 1E2UA 4E11A 4Z99A 3BQ9A 4JEUA 1XMVA 1KDZA 2R62A 4MWOA 4FJ0A 4RVHA 2QR3A 1N8KA 1ZIDA 2R84A 1U9IA 4Z7JA 2REQA 3DMRA 5TNXA 2CXQA 3U3ZA 2C54A 1COWD 3ABZA 1KAGA 3GDFA 4IFBA 4MCHA 4RZ3A 3TIFA 3ZUGA 4RTOA 3QELA 2WMNB 3ET4A 3CCBA 1TI7A 3H97A 3CNNA 1KYWA 1QH1B 1ZM9A 2C9YA 3UB3A 3NI2A 4LXGA 1OWOA 4YMSA 1T4GA 3EASA 5EXSA 2JA2A 3DMNA 3SQMA 3TMKA 3L8MA 1TUEA 4Z2AA 3DEFA 2DTEA 1Q0LA 1G2OA 1V5EA 3B53X 3D0OA 2ARKA 4NFHA 3OQHA 2F43B 1LX6A 4G0NA 3HWSA 3P5BA 1IM8A 3PPWA 1A82A 4DSUA 4QVKA 1I4TD 2NQ2C 2POCA 1Y1RA 4XFJA 2WTUA 4FFSA 2QRGA 1G20E 3IP3A 4DBLE 2N47A 4Q9LA 4TPKA 1GQFA 5THKA 3U49A 4DCUA 2AR9A 4UPVA 2HRQA 4XCXA 2FN7A 3NZEA 5C5DA 1IZ0A 3DE5X 3EH1A 3W79A 1NULA 2IYZA 1I8TA 2Z9BA 2ZE6A 3P19A 3FPFA 4ARAA 5LBTA 4YK7A 2DUJA 4U3JB 5FPSA 4C7OB 2BGNA 4K40A 2IXGA 4QEKA 4ESHA 1YE5A 3MMZA 4MUMA 1KZ9A 4ZT4A 3ELUA 1NUQA 1QE5A 1PN3A 1GU1A 2W90A 3LCUA 4V0SA 4WH0A 5KTMA 2B1QA 4WY5A 4YMTA 2P90A 4XX0A 5EE0A 3W3AH 1Q12A 3OTWA 2Y4NA 4UVEA 3AUXA 8GPBA 1RZRD 2O54A 1M2OA 2ZJ4A 4UTXA 4WZAE 4HVLA 5KVCA 1YJQA 2ID8A 1RWQA 2VUSA 4CF5A 2VXYA 4HEQA 5KAMA 5H81A 4CT4B 1OA0A 1ZXLA 1QZ3A 4LZWA 3OQNA 1K0FA 2A9OA 1H6BA 2UUPA 3TFQA 1U9IC 2Q27A 2OCLA 2WTEA 1M1YE 2Q3FA 3IKVA 4PZUA 4QO8A 4IVNA 3AVVA 2C5LA 1NMYA 2ERCA 3MJEA 2XCUA 4UUOA 5FOUA 1KE1A 1X3SA 2X23A 3PUIA 2CVHA 2LBPA 3EDOA 1YS2X 2FCRA 8OHMA 1ZIPA 4XLLA 4XYBA 1KC1A 3C41J 3DF9A 1X7DA 4E7PA 4A6EA 2IW3A 4HNRA 3VVBA 1W30A 4BO8A 1PJQA 5AOVA 1GCUA 5G1NA 1L8YA 2BFBB 1FMFA 4UVIA 1K88A 1TX4B 4JB0A 1RWWA 1Q1QA 2XDWA 1B0ZA 1H1LA 4IUYA 4E30A 1TE2A 4J0CA 4FDLA 2AOUB 1FNNA 5I7VA 6ABPA 4DV4B 1HG0A 1MIOA 3U4CA 3SR3A 3DAFA 4BJ5A 1LX7A 3VHXA 4OG2A 2R6GA 2JZOA 5F98A 2W6ZA 3N2EA 4TN1A 2PD6A 3JQ9A 1QYWA 2AI1A 3GJ5A 1T29A 3ITEA 1PDOA 4WUVA 1HOXA 2KPOA 1WF3A 3I52A 5IKXA 8AT1A 3FPLA 1FNDA 4CLRA 2G9RA 1MNAA 4KVZA 4A0GA 2D62A 3EPRA 3HLTA 1RLJA 5FKJA 4DADA 3AHDA 4LHXA 3DR3A 3F46A 3QWHA 3LRXA 1DBWA 3HO1A 2RHTA 1JJFA 2ZB4A 5LKRA 2EBFX 3CX8A 4P4UA 3HR4A 4JOSA 1LLFA 5KNCH 1CVLA 3VH3A 2QTVA 2RONA 1W0CA 1C30A 5F78A 3NV9A 4H9GA 2AC7A 4IO1A 4ETMA 2V3CC 1KQFA 4L4YA 2JEOA 2GHTA 2EWWA 1JAIA 1OXUA 3ROEA 1M8KA 1A8QA 2BKXA 3RAPR 2F8LA 3TBKA 1ATZA 1SIBE 2PFGA 2WY2D 1CDOA 1WSBA 5TRTA 5HM8A 5JBNA 4N41A 4NCJA 1Z7BA 5TDHA 4AUEA 1E3SA 2H5LA 4RWEA 3THOA 1Z3CA 2I66A 2C2GA 1ZCBA 2JFFA 3C6YA 5JD6A 5B58C 1A1VA 2I6UA 1AKMA 1RNLA 3VSCA 1ML4A 4PG6A 1E1QD 3COVA 2J0UB 4F3NA 2VOJA 3FYCA 5BYKA 2B8EA 4G07A 1OZGA 3DLBA 5AKEA 1FEZA 3T06B 1GPBA 4OQLA 2G9NA 1MORA 7GPBA 3CB2A 1PS9A 2EW2A 1XXLA 3BKXA 3E4CA 1ZONA 2A57A 4BP1A 1J70A 2CE7A 4GEKA 1KF0A 4CIAA 1MLDA 3QG1A 4KXWA 3JYQA 2AVNA 10MHA 3NG1A 5L40A 1HTWA 3U3XA 1KQOA 2AI3A 2CV0A 4MR9B 3GYBA 4HAZA 3FGOA 4D9MA 1YI0A 1DIHA 1SXJD 4PPYA 4AZ3A 1ZCJA 5FUYA 4HJXA 3AF5A 3OIWA 1KRXA 3W3AD 5EJ2A 3ENNA 4UU7A 5E3IA 4U4AA 1ZKDA 4YUVA 1G7TA 2VSQA 2DQSA 4DA7A 2QVZX 3Q8XB 4ZMSA 4DDHA 1TCAA 2PUHA 1E5TA 3BGSA 4P5PA 4YUYA 3RANA 3NKVA 1XFDA 1F9AA 3OFVA 2N46A 1GGHA 5BW6B 4MUNA 5JVDF 4FT4A 4OQPA 4JEMA 3WIOA 1N3BA 1ZEJA 2C4NA 2NUPB 3B51X 4PQGA 3NQ41 4J0HA 1KBOA 3EIXA 2HQBA 1L5GB 1XIVA 1P0CA 1J90A 1RYDA 2CXNA 3F47A 2GO7A 1N75A 1APBA 1FYEA 3AZPA 3TW8B 1D8AA 1R10A 1SBQA 4QKQA 4ZA2A 3UMRA 4E5PA 2DF8A 2FJPA 1K7EB 1L8AA 2B7CA 3Q4GA 4WBNF 1GG5A 4QVIA 1ISIA 2B20A 4JT8A 3NBKA 4KB5A 5ALWA 5L7TA 2ETVA 1WVMA 3FKSD 3FUUA 3I6BA 1Z6TA 3QKTA 5BW5A 2FUNB 3ZQUA 3OIUA 3A9UA 3EFOA 1DWPA 2JANA 4FR5A 1FYXA 4E22A 3FYUA 2YVKA 2Q6TA 3MAGA 4M3NA 1L2TA 4IRMA 2HDOA 1L5OA 1Z0JA 2PYIA 2WUDA 2GM4A 4KK3A 4FBLA 2XCOA 5H9VA 3MJDA 3Q0IA 4M9UA 3DE3X 1UBOS 4E94A 1RXEA 2ECOA 3AQIA 3GAFA 3TM5A 2AE1A 3Q7EA 3UMBA 1UKVY 1Y8QB 5B1YA 1Z07A 1AKWA 2R8PA 1G0NA 2HN9A 2PSHA 3HCEA 3QV1A 4A16A 1V4BA 2NUBA 5JIBA 4PVDA 1AZLA 2J5QA 3HEAA 1ZH0A 4LDRA 4UVGA 4YP5A 2BFNA 1GSOA 2CHQA 2QMQA 2UXCB 4XVHA 1E7QA 1BH2A 2CFSA 5TMEA 5FWYB 1ZU4A 5KU7A 3QTBA 2C3MA 1ITZA 5JNLA 4IXDA 4C6SA 2C8VA 2IC5A 1E98A 4MYTA 4M4SA 1WEKA 1GQYA 2IV7A 2JCVA 1ZK3A 2VPPA 3C24A 3O5AA 2AG8A 1N0UA 1ZGAA 3DAGA 4JZYA 4TV8A 3IV9A 4U2EA 4QATA 1BRMA 3EIWA 3U9TA 1GGEA 1HL7A 3KYIB 3GJSA 5TEWA 3STXA 1U2EA 4PN7A 3PTAA 1FBNA 2J0SA 3IESA 4C6TA 5CX4A 1XO1A 3ISTA 4HZGA 4JJGA 2W6CX 5U9CA 1NXWA 1PJSA 4TUYF 3HXPA 5B6JA 2CV1A 4DR3B 1W7AA 3UJ6A 1PTJA 4NSNA 2OQVA 4H0CA 1A77A 1IDOA 4EJFA 4US1R 4P3KA 3KAPA 1CR4A 1S1CA 3N6VA 1TO2E 1KI6B 4G1FA 3BF7A 2Q6IA 1CUHA 3SK0A 4KEAA 1ZVKA 4R01A 4Z1MA 3MWEB 1T8YA 4I1OA 5E9WA 4COOA 1XCPA 3PI6A 3TQIA 4BNUA 2IV2X 1PBNA 2XMRA 3ZYZA 4ZDIA 1MQSA 4TXMA 1JPUA 3MS4A 3ZVRA 2O5CA 3THYB 2QUBA 2QT9A 1QHFA 3M6MD 1IEQA 3RU7A 5EQJB 1ZVVA 3SVLA 2ISCA 4JBHA 4ER7A 1A7AA 1YFJA 3S2EA 3CNQS 4BQOA 1V25A 4LHYA 3UTCA 2P9EA 2YY5A 1W46A 5A6VA 3FHCB 3IUJA 2EC5A 4L50A 4RF2A 4WBNA 2ATXA 1DKOA 1FMJA 1Z12A 5H5JA 3VOSA 1ZMTA 2GDZA 4J0JA 1U5CA 4O59O 4OB8A 3AFGA 2ECKA 4XE5A 1N5RA 1S8OA 3Q7PA 4XDHA 1KK2A 1T91A 1U1GA 3QPUA 4HAWA 4TUYB 2WMOB 5FWXB 2JW5A 2OV8A 4JD5A 5IAJA 1MOSA 1XQYA 1FNCA 1TF5A 2WVJA 4L3WA 3RKUA 1ZW6A 4E08A 4YAFA 4CCSA 1BXGA 2B30A 3SZOA 4PV7A 4HAUA 2HI0A 3EZYA 2LW7A 3JD1A 4MKRA 4ONEA 1TZKA 1YS7A 2AUTA 3G6WA 3W7BA 4E2ZA 3GROA 5LP6B 4FMDF 2JLSA 3BQNB 3FCUB 1KFBB 1FP1D 3PWSA 4R7GA 1BU5A 2J7PD 5HJEA 2C5GA 3RUIA 4Q9KA 1CUBA 4XSVA 4BQNA 4AJNA 4DR4B 3I83A 1SXJB 1Y0BA 2IKQA 3O4JA 3OKPA 1X7WA 2KBEA 1CRZA 2WEKA 1NMSA 3PHJA 1QLJA 5EUMA 5EJMA 4XVCA 3WWEA 4YP6A 1HDXA 1XR3A 1CJMA 1G2QA 4F9GA 3LQRA 4NULA 5FWAA 4EENA 3K15A 1CIJA 4FEAA 4IDAA 3K2BA 2DLDA 1G41A 1JDBB 3B60A 4XB6B 5DT2A 4MMXB 4BJ6A 4RHUA 1KEVA 2FAXA 1N9KA 1ZSNA 1OLXA 3ABOB 3OPYB 3F78A 3T38A 1TEXA 3N7AA 5DRTA 2WOOA 2I3ZA 4B79A 1J99A 1R16A 4GMXA 4IQFA 1ZHHA 1BX1A 3ABIA 3AI1A 3IB3A 3AEUB 5EPEA 5KDLA 2BGRA 1RCFA 3KSZO 4KCGA 5K0NA 2A5DA 2FG7C 2WHPA 1LSUA 1ZD9A 3CFYA 2I80A 2PG3A 3LW7A 5IDQA 2B8NA 4HGQA 2QTBA 2QF7A 4Q0MA 4TKUB 5CVDA 3SZRA 2QBYA 4BLQA 4XARA 4QPPA 4OXQA 4U7JA 4JBIA 4PIPA 1WHTB 2HHAA 1T13A 4Q3NA 4B8WA 5CLIA 2PPLA 3PXGA 2PT5A 3NANA 4R1MA 3PX2A 3KYJB 3LLVA 3SXUA 2P0YA 5AVOA 4WOBA 4QPDA 1HLDA 3A9CA 3D1JA 4MEJA 1EM6A 1KMHA 5LUAA 3OQVA 4OA5A 4CMKA 4LC1A 1QOPB 3JWHA 1VCIA 3CUVA 1WU7A 1JQLB 3LFTA 3KHTA 2J9FA 4FGKA 2JJMA 1WQ3A 2GBFA 3OT1B 5JLAA 1IQPA 1WHSA 3WV5A 4AICA 2HD4A 5I8WA 3REOA 2JIZD 2R7AA 2Z8YA 5YASA 3H0EA 1JDSA 2QAJA 3HMQA 5AH0A 3W7AA 4QDUA 5CHEA 5ECWA 3URKA 3I34X 4OQNA 5DN6A 4TZ6A 2HJSA 2J0QA 4WZBB 3CF4G 3GA7A 2JIPA 1PJCA 1YKSA 3FWKA 2JH8A 1NP7A 1FTSA 1DFGA 3WV4A 1CQJB 1Q57A 3O31A 2A88A 4PR3A 4DTIA 1ODIA 5A06A 3L7JA 1Y4UA 1YE3A 4QGAA 3MPOA 4Y1RA 2REOA 3TS1A 4EM6A 4CQMD 4WXRA 4MW7A 4WE3A 3HKBA 1X8XA 3NDRA 1VHDA 4ITRC 3PC7A 3HZZA 3T1YB 5DBFA 4OSOA 5FT9A 3FBWA 2LHJA 1IZ7A 3IXMA 3LDUA 3L4BC 2CHFA 4O4JB 4C6HA 3A9VA 5LMNB 3BH0A 3C3WA 3ACBA 3MSCA 4ZZIA 2WF7A 4LXUA 5J43A 4DNFA 2P40A 1SCUA 3GPDG 1QAOA 2NO5A 4UBKA 5ALEA 3DFMA 3ZIAA 1LS6A 3MGCA 4BZXA 4X41A 4NOMA 4IUDS 3P2OA 5EHIA 3TRHA 2B1RA 3MJFA 1YDHA 2HDWA 2X14A 4L7VA 4Y6GB 4JIGA 4KLRA 4RV5A 3DLHA 4UUNA 3VMMA 2IS2A 1NJ5A 2P9QA 1EFUA 3EDMA 4MI3A 5L3QB 2COUA 2PDAA 2ZIAA 3CHYA 3KC2A 3QVVA 3RS0A 1V7QA 2Z95A 3ZI4A 1U6IA 4DL9A 3VDQA 1DV1A 2NX2A 1XYGA 4P81A 2GF2A 1RM0A 1XU4A 2G82A 2R97A 5DNAA 4E5YA 4EEZA 5KYYA 4X20A 3I2YX 2OYCA 1U9JA 2YWJA 3IP5A 3IVRA 2Q7OE 4D92A 3CUYA 1UJNA 3QWAA 1DPGA 4REQA 3JQCA 5A7GA 5HTKA 1NHGA 5KS2A 2QZ9A 3DW1X 4KQWA 5A6SB 3ZVMA