3ZR4B

Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
publication title Catalysis Uncoupling in a Glutamine Amidotransferase Bienzyme by Unblocking the Glutaminase Active Site.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 59
structure length 200
sequence length 200
chains with identical sequence D, F
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zr4B00
1FY2A 2IUFA 3B36A 2NV2B 1GGJA 1QDLB 1OX4A 5SY4A 5SYAA 1QVWA 2ZUUA 3P9SA 1OX5A 1T3TA 3ER6A 3L7NA 2XF2A 3CZ9A 4I2NA 3TTXA 4ENSA 1IZYA 4AUEA 4B2YA 4OJYA 3EWNA 3ZR4B 4B7AA 4L95C 1P5FA 3N7TA 4N12A 3B38A 3PQ6A 4E5VA 3FIJA 2H2WA 4ZGGA 3P9QA 3FSEA 4B5KA 1KA9H 1PV2A 4ENRA 4BIMA 4S0ZA 4LRUA 4N0MA 1GGHA 4P34A 1QVZA 1VCNA 4UOZA 1I1QB 4ZDJA 1GG9A 3BWEA 3KKLA 3TTYA 2RK3A 4E08A 1GPWB 4ZDIA 1QVVA 1VCMA 2R1TA 5LIRA 4ENUA 3NOOA 4B40A 1PE0A 3TTUA 4ENTA 2R1TB 3CNEA 3L3BA 1P80A 2ZUWA 3ZJ5A 5JZOA 4OQ4A 3NORA 3F71A 3PQ3A 4Y1FA 1FYEA 3F5DA 1JDBC 3NOQA 1QWSA 1Q2UA 3UJNA 4OFWA 4RKYA 4I46A 3L4EA 3OT1B 4BTEA 1A9XB 1P7ZA 2R1UA 1OX6A 4L8YA 3RHTA 4P36A 2GHRA 4BFLA 2V4UA 3PQ2A 1JVNA 3CYFA 4UZSA 3SF8A 4JQSA 1CS0B 1S1MA 1VCOA 4Y0NA 5JZMA 3SOZA 1T0BA 3SF8B 3ZJ4A 4ADSG 1C3OB 3R76A 4AUMA 1GGEA 3UGJA 2ZUVA 5IP5A 3UK7A 4ENVA 1T36B 1GPMA 3M3PA 1O1YA 4ENQA 2W7TA 1I7QB 1KWKA 4I4NA 2OR3A 2WJZB 4L7QA 2VRNA 4L8WB 4PXYA 5SY9A 4UCFA 4ENPA 4ZDKA 3TTSA 2NV0A 4GE0A 4P5PA 2YWCA 3UMMA 1K9VF 4WINA 4XLLA 4Y1EA 1ONSA 3NONA 4OGFA 2ABWA 3EN0A 4QYXA 3CZAA 4UOQA 4OIFA 3P9RA 4B31A 3CY6A 4MTCA 2VKTA 3OT1A 4AUNA 1J42A 3EFEA 1VHQA 2AB0A 1KWGA 3TTTA 3PQ8A 1I7SB 3PQ7A 2ZUTA 1OY1A 3D54D 5DFAA 2RK4A 3L18A 5BV2P 5K4AA 4K2HA 4AULA 2ZUSA 4RKWA 1PDWA 1SY7A 2LXNA 1IZZA 1QF7A 2A9VA 3TTVA 3MGKA 4ENWA 5E9AA 4Y1RA 1N57A 1R9GA 1P7YA 1PDVA 3BHNA 3MIIA 3TTWA 4Y1RB 1G2IA 3VU3A 1CF9A 2YWJA 1Q7RA 1OX4B 4QYTA 2ISSD 1GGFA 3PQ5A 3UOWA 4D1YA 1IPHA 3R74A 3NOVA 3GRAA 1KXJA 1WL8A 2VXOA 1SOAA 3NVAA 2YWDA 3R75A 2VPIA 4P2GA 1P81A 3B3AA 2D7JA 3EZGA 4L78A 3TQIA 2VDJA 4HCJA 3WFZA 5SY6A 1U9CA 2FEXA 4GUDA 1OI4A 3P9PA 4MNTA 2YWBA 1CE8B 4OGGA 1BXRB 3EJ6A 4MGHA 2R1VA 4WXYB 2GK3A 3PQ4A 1M6VB 2AD5A 1C30B 4P35A 4Y1GA 2R1VB 4UNIA 4R7GA 4LGYA 4GE3A 1GGKA 1L9XA 4AJ9A 2RK6A 1KEEB 4L8FA 1UCFA
chains in the Genus database with same CATH superfamily
1Z0SA 2Y4NA 1WZNA 3QPUA 1WB4A 4NCKA 3BGOS 2WICA 2O5EA 1MO5A 4BNDA 1N2EA 4B35A 1UEJA 1QZUA 1TCBA 1KJ9A 2G1AA 2QDXA 2R25B 4II3A 3WOVA 3ZLTA 6CHYA 5JSUA 1JHOA 1KKMA 3RD5A 2ARKA 5IC6A 4B7AA 4MUNA 2C59A 2I62A 4IGIA 4Q7KA 5FWXA 2HPVA 3P9KA 3UJ8A 3P9QA 3KLNA 1SQ0A 1Y9AA 2BI7A 3GC6A 3DZFA 3GF4A 5EZ6B 1CR2A 7AT1A 4D92A 4Q34A 3P19A 4X7PA 1LV8A 4J0HA 2AG6A 4EOGA 1FQWA 1C7IA 4CUKA 4R05A 4MVJP 4OY3A 2GCPA 3OJCA 3TZLA 2WHPA 3EMDA 5FQOA 3SZLA 4ZRMA 3HJRA 5T4BA 3T7RA 2QRUA 5AK0A 3RSOA 1ZL0A 1IEXA 4P0TA 2WABA 2I87A 1VE3A 2IRWA 3BRQA 4IV0A 2RGWA 2WZQA 4Q01A 3ZU4A 1D07A 4XWAA 4DLVA 5HJ7A 4RMJA 5E38A 2N1BA 1K27A 4DQKA 1C9KA 2PSDA 4P5DA 5E6UB 4NULA 2ZBVA 1KZGB 3PI7A 4UC0A 3TK1A 1YUMA 5TQ0B 1QYVA 1UK8A 1E7MA 1K5DA 4G09A 4Z1OA 3WV4A 4X61A 1JHDA 3W4KA 2GPWA 2H59A 4WN3A 5HKKA 3QA9A 3IEMA 4BAGA 3FYDA 4YUYA 3JPYA 5TS2A 3S27A 3KOMA 1JFLA 1RP7A 3CTPA 1L5ZA 3QUCA 3QEJA 4KMOA 4X45A 4YJHA 2FAXA 2NV0A 2UVQA 1T5TA 2AMJA 2ZYDA 4OYHA 1DC4A 1MDBA 3I61A 1BNCA 2PFSA 3N8KA 3H9JA 3ZD9A 3K05A 3QENA 2FHPA 5IM5A 1BCSA 1ILWA 4A16A 2G5TA 4J7XA 1E5QA 3R77A 4Y2PA 2HXGA 2C8JA 1B4DA 2YVLA 2Q3LA 2ALJA 1ZH8A 1YR7A 4B8YA 3C87A 3MUFA 3TOSA 5IEBA 2BBOA 2JLCA 1IEQA 2VAWA 3CBQA 3UGTA 3VNAA 3LH5A 4B6PA 1JAZA 3GLUA 3FCOA 4QAQA 2B1JA 4LE1A 3L0SA 5C31A 4X95A 4TKMA 5ALNA 3KTAB 3N8DA 5EJGA 3JSXA 1Y9ZA 2CNNA 3NTLA 1E6CA 2J09A 4MRRA 4CV3A 3D4BA 3HFSA 4EY4A 3HN6A 1FL9A 1P45A 4I66A 3WXBA 1A96A 3SE0A 4Y2QA 2AFIB 2X5OA 3CH6A 1I6LA 3OHSX 1BOOA 1NI5A 1Q7RA 3ACBA 5CTJA 1XPUA 5KDDA 2PUVA 4DMFA 2HREA 3N6VA 1FNSA 3NOVA 2GLUA 4AD8A 2GN2A 3P45A 1JJVA 5DI3B 2PWYA 3K31A 4C4AA 4MR8A 3KTOA 2WM2A 3GLRA 3PCRB 1GPNA 1XRMA 4LMBA 4RD1A 4U4AA 4BX2A 5CFNA 1CUXA 1H1TA 1PG0A 3HJGA 2ZB7A 3LT4A 2E2WA 1RQ2A 4BQRA 3EJ6A 1YQWA 4QQRA 3BIWA 4MTLA 3R6LA 1YIOA 2ZS8A 4R7TA 1ORWA 1WPGA 1E8DA 3NH9A 1E4EB 1TM2A 2H1OA 2JGDA 3TRIA 2GPTA 1GQOA 1DJOA 2Y77A 3CINA 4CKEA 4F3KA 2XHEA 3GAZA 3T9AA 4IS3A 4MHOA 5E6RA 1N92A 1YSCA 2H4HA 4B32A 4KOEC 4XZ3A 3GP5A 3U5TA 1M83A 1XGKA 4RH3A 2VN8A 4D9MA 2AN1A 1JDUA 1DI0A 4QM6A 5DZSA 2QOEA 1VM6A 1H0RA 3ZS9A 1NF9A 1E32A 1CHDA 1SEPA 2HI0A 2NW6A 2WJVA 4JB8A 1KDVA 3T5DA 3X1XA 4CDGA 1G9SA 5D2CA 5A5VA 4QPCA 5KYUB 5KYTA 3FSEA 1ZJWA 2ZK7A 4OP1A 4CTKA 2BI8A 1JU4A 3AHEA 4EG3A 4BGUA 1V6SA 3EXHB 1XVVA 5DCLA 1HLGA 2ZBRA 2QWXA 5FUWA 3D0QA 4XDZA 1K4MA 4L9RA 2WV7A 1Y4DE 3L0BA 4G36A 1J00A 4HB3A 3ZU3A 4BQQA 1WTAA 5JD6A 2BGWA 2OD2A 2VCHA 1E5LA 1HQKA 2RJ3A 3O2SB 3AB3A 4C4SA 2B2NA 5IH3A 2VK1A 1GAQA 2ERYA 3DB2A 2KSQA 2IKQA 2DT8A 1J24A 2M2IA 4LPKA 3RNLA 3B53X 4DRXA 3LOPA 4ENQA 2IF0A 4XJVA 1KQNA 8OHMA 4EJSA 2RJOA 2DP4E 2O4CA 3VZQA 2Y66A 1QQTA 1ZJZA 1IM8A 2H8GA 4ARAA 1V5GA 3HNOA 5EFOA 2BP7A 2C20A 4Y0NA 3WO1A 4IIJA 3G9TA 3OHPA 4ZAVA 3IOBA 3WL8A 3UMJA 3FZYA 4WZAB 1ZJ5A 4UTOA 3UB3A 1A4UA 1PK7A 2NU7A 2WJAA 2O2JA 4N54A 3PCTA 4L07A 4UAUA 4WLUA 3VNRA 4IWXA 2RAUA 2OKCA 1JGTA 1JHPA 1NUHA 4IY1A 2DYKA 1M2HA 3PR2B 5T8KA 4OMDA 4ZDKA 1URPA 5CLFA 5I7RA 1RWVA 3B2NA 1XZGA 3DAOA 1KH2A 4LFBB 1VMKA 1MTOA 2G80A 2B3DA 2UYQA 3AH8A 4PYIA 4XSGA 4TMTA 3UAZA 4D44A 2QMZA 3TB6A 1RW4A 3DDUA 5JOQA 3TCKA 4RTKA 1TU3A 1X92A 3HDQA 1MC1A 1WB6A 1I0LA 2QY9A 3NRCA 1QB7A 3IT3A 1WX1A 2FWBA 3BSWA 5H3CA 1AHHA 1O57A 1O58A 4LF9B 2W2KB 1LTQA 4ZVQA 2UZ4A 1T1IA 3NMUF 1ZOPA 3DTYA 4YCBA 1ID1A 1GR1A 4K9KA 5CM8B 3PC6A 4UUMA 3REQB 1ZM4A 3CEPB 3GL9A 3N0RA 4LW8A 4N0QA 3R6DA 3PNOA 4RF4A 2Q4RA 4ZYTA 4H7EA 5KU7A 4RVOA 2GK4A 1CUAA 3GDGA 1KORA 3GLGA 4ZVTA 4NVRA 2H5EA 3GB9A 4CPDA 2LDBA 2AOUA 3KM0A 5FCDA 4A2QA 1WR8A 3NTUA 2BZGA 3VDXA 3ZBTA 4UFPA 3U1BA 2LIVA 2WOJA 1CDZA 1RWQA 4YASA 3W5JA 2JIRA 1CUBA 5AW1A 1IOVA 3H1BA 4R2XA 4N3CA 1UAGA 5FPYA 4BNLA 4RAOA 3FKJA 3HE3A 2HU2A 3L8DA 4M1OA 4NJMB 1XZCA 4RVDA 5AI0A 5HKAA 4YB8A 3FFXA 4ZKEA 3F8WA 4W7HA 5BN4A 4C7MA 4ZVKA 4BZXA 4ML3A 5BMVF 4ACBA 2RK6A 1N0UA 3TNJA 2DERA 3E81A 4IRUB 1ES9A 2HDWA 3QU4A 4FYVA 5T4HA 5JS8A 3BVPA 2I4IA 1ATZA 2CNWA 5SYAA 4CM8B 1T10A 1YZLA 4HN4B 1KMNA 4GX5A 4LSZA 3RQIA 1NNI1 2AOTA 3X1ZA 4KN8A 4ZRNA 2PANA 3E5HA 4XWOA 4N41A 4UM7A 3KOYA 1VJ5A 2R6HA 2BF7A 4N12A 5FV7A 2VQEB 2VJBA 2P3LA 3EY9A 1JHVA 3Q7QA 4MUEA 3VGJA 2XVZA 4C7VA 3L1HA 2LGJA 5JFGA 3M6XA 1HRDA 3QV2A 1OGJA 1RNLA 1XFAA 1B3BA 4PPNA 5TXGA 2PNJA 5HM8A 2QQ5A 1E9SA 3IAAA 4YJ3A 3RJ9A 3BWEA 2O3SA 4MWCA 2XT0A 4D2IA 4EUKA 4X54A 3PIDA 1Y1TA 1W4RA 4CMHA 5HZMA 1CY1A 4YRLA 3FF4A 5AKZA 4N82A 3WKAA 4DGSA 4IQFA 5CMLA 4RORA 1I36A 1EDBA 1VE5A 3AIKA 4CTJA 2OCGA 1US8A 4PZDA 2TSYB 4QOSA 4KZPA 3PE6A 2N9UA 2C7PA 1U2PA 4O63O 1BEZA 1NQVA 4YO7A 5DISB 3RJTA 5JXGA 2XGSA 2XAUA 4UMEA 2ZE6A 2NAFA 5JVDB 1M2KA 2QRNA 2HHAA 3SIRA 4RA9A 4ILKA 1FJ2A 1DMRA 3KOZA 1E9BA 2XJ9A 2B7BA 3KK0A 3V4FA 1FIUA 3CFYA 2OG1A 2JLUA 2XZLA 1QE5A 2B30A 1GTL1 5DNDA 1A8PA 3MWKA 2VH5R 3L8GA 4MS4B 3GJTA 3KB8A 4QELA 1BWPA 4K2AA 4NAUA 3PNQA 3PTLA 3ZJ4A 2H57A 5JPDA 4I08A 5E1DA 1GL7A 1C4OA 1I7QB 2H31A 3DMDA 3IEXA 2GPYA 4NFLA 3OX1A 2PZ8A 1ZQ1A 3GVIA 3G8YA 5D51S 3GJ6A 1DAFA 4PQFA 3RIMA 3KWLA 4MYTA 2BCEA 1TAQA 2ZXEA 1YGYA 2H92A 3KT6A 4ZI2A 1DDIA 4A1OA 3OZGA 2QW0X 3PGVA 4FOTA 5BT8A 1UZUA 2O8EB 1HQYE 5AKGA 1KOFA 4KUHA 2H7CA 3PHGA 1JHQA 2PH1A 1NURA 2IHKA 2AOWA 2DFLA 1T2UA 4ZHSA 2QMHA 1A2QA 2Q6IA 1VKHA 3OZWA 2OCPA 2O0KA 4RL4A 5K0SA 2OZLA 3OCWA 2C2OA 3TFOA 1MB2A 1TLFA 3RTCA 1DHRA 2GVZC 3I5AA 1I01A 3FPCA 3MOGA 3FHOA 2XOKD 1GRRA 1TO2E 2A6PA 3WTCA 1KYQA 1NMSA 1HO3A 3NBUA 4MDHA 3N2ZB 4PG5A 2P9YA 3PXAA 4A2CA 5JAPA 1A7JA 1J33A 4YBZA 3WGOA 1OT3A 4XR9A 1V7ZA 2OORA 1V35A 4K3UA 1T26A 4LPSA 5DX1A 3UTDA 1C1DB 2V7UA 3DO6A 3V4SA 4AVYA 4TQAA 4ZJUA 4R98A 1R16A 4QPDA 3VR5D 1AA6A 1TQ6A 5FULA 4DWJA 4LRYA 1QC5B 3D4OA 4ARIA 5FAKA 2DWUA 3QNUA 4WY8A 3BH6A 5ALJA 1U9CA 3RS7A 4J4TA 5HTOA 1EZ1A 1BMTA 1QUFA 1DRUA 2QL5A 1BKDR 4RHCA 5LZ7A 4Q1EA 1O77A 2VDOB 5CFQA 2BWJA 4DDMA 1B0PA 2D5BA 1JX6A 3KTAA 4DJ5X 3I64A 3NAZA 3UBMA 3OZ7A 4OJKA 4OXIA 4F3TA 3LA6A 1GRCA 1TECE 1TVKB 2VSXA 4KLZA 3TSYA 2VF8A 4ND4A 4C88A 3T1NA 4BPBA 3O31A 2PYZA 2GUWA 1XALA 3HDGA 2ZRJA 3FFTA 4MARA 3DM9B 2FWAA 1WSWA 5AVXA 1B26A 4I6JA 4MUKA 1JNYA 2Q5FA 4Z4IA 4LQ4A 4D3DA 2BE7A 2J5BA 3L4KA 2PLFA 4QDZA 4EG8A 4HZGA 2NZVG 4LCJA 4BJ1A 2P4UA 3HJCA 2C4HA 2VI5A 4XJTA 3T34A 1YJXA 5DH9A 1YNOA 3LT0A 4RADA 1PTKA 1EFHA 1Q7BA 3JASB 3RUPA 3DBIA 1E4EA 1B6SA 3SR0A 5LD2B 4XUDA 1G6OA 4JASB 3IERA 1S5PA 5LR6A 3E18A 5L3VA 3P2YA 2O07A 1WCV1 4QBFA 3VZPA 2QUBA 3WDMA 3TLYA 1OXVA 2SKEA 5EQFA 2A7QA 3HG7A 1E79D 3VMFA 3IXQA 1TFRA 2QXTA 4NMMA 1E2KA 1GGMA 4K88A 3Q3VA 3KLOA 4LQLA 4OA8A 1X70A 4HPWA 1VCHA 4H6PA 4DCJA 4AK9A 4JLKA 4CCYB 5KYUA 1NXTA 5KTMA 1FFGA 1AK9A 3G89A 4ES6A 5FWYB 3ZQ4A 3IHWA 4M6WA 4QXOA 4LYEA 4G4JA 1N1MA 4K03A 2R66A 1WZEA 3THWB 1XK6A 3ODPA 2AJ8A 3GJ8A 3R5HA 1YJCA 1HUQA 3WK7A 4TUYA 4GRDA 3O95A 1MOQA 2CXPA 1H9CA 4Z0PA 2ZUVA 4ANFA 5HKOA 5JJIA 4DUPA 4Z4GA 5FOXA 1VMAA 3O6VA 2FJ0A 4LF5B 3AW8A 1L3CA 2VWQA 1HZJA 1R6UA 2GZ1A 3JD4A 4FFBA 4ER3A 3COJA 3HXQA 1S8NA 4FU0A 4MUXA 2A3NA 1NSTA 1KMIY 2NZJA 1GQ2A 1J42A 1TPZA 3L7CA 3OZFA 4LY3A 2YRXA 4OP3A 2AB0A 2BUCA 2GFHA 1CT9A 1CV2A 1KP2A 4IDQA 1QG0A 3CX4A 4P38A 1M5TA 3KFLA 1RRGA 1A7AA 3U1TA 4C4RA 2ADOA 4U7HA 1FDVA 4UJ3A 3VR5H 4WZAA 1JSXA 2VOEA 2Q50A 4RQAA 5IYZF 2QAGC 2VTBB 3ZBUA 4B9AA 3OIGA 2AI2A 4KDEA 4NMXB 2PU5A 3JQ9A 4Q4AB 1YBHA 1P7YA 1JHMA 2JLAA 4BWVA 4AAYA 3QE0A 1REQB 2PL9A 4QEDA 4CIVA 2IH4A 2A86A 3WL3A 2ZAMA 3WB0A 1GGFA 4JJIA 3STXA 5DBEX 3UJ3X 4ALIA 3ZHQA 5KVCA 3VU8A 1K98A 5KNDD 2ZUEA 1DV1A 1I9GA 2WFAA 2YJ4A 3IAS6 1M72A 3QNWA 2A58A 2QJFA 3I04M 4NBNA 4EYGA 1VGVA 3AM1A 2FSUA 2FW7A 4LOLA 2FEXA 2OHIA 2JIPA 5KSPA 4U2BA 1SKYB 4L5JA 3HJTA 1SC6A 3FYTA 3NM4A 2WFLB 2CWWA 1JJFA 2I7TA 2GK6A 2XZOA 2AN5A 2WAMA 2FUG1 3EZ7A 4IJMA 4QDOA 2PZEA 2WDPA 4IFTA 3KZVA 3H9BA 3ENWA 2V55B 3OLXA 3JQAD 4PZ9A 1STOA 4X65B 5CD9A 5IMSA 4QGFA 3SHOA 1V3TA 4B3HA 1DS6A 2WSIA 4BEVA 1EVLA 1G6HA 4M0PA 5E2AA 2XQVA 4XH9B 3S5JA 4K9MA 4R9NA 3HYNA 2GCGA 2GZSA 3BMCB 4OJYA 2BGKA 1NNUA 1YKGA 1T8WA 3B5JA 3N2EA 4FFVA 4J0GA 4BO6A 4F85A 5JPCA 4LJ5A 4OMFG 4NJMA 3E4CA 2FEPA 2P2YA 3QY9A 1AHNA 1BE1A 3N70A 1VPDA 1MFZA 2J5KA 1YOVA 3AKDA 3EDOA 2D54A 3M6UA 1FQOA 2TMYA 4HATA 4PGHA 4RQTA 5JSKA 1L6IA 5ALMA 2KB0A 2XI4A 4EIWA 1Q1GA 2FW1A 2IZ1A 3TEFA 2XNDA 4WY5A 3THRA 4FSXA 1KMCA 4CM8A 3ER8A 5I7EA 5TF0A 2BGTA 3LV8A 4GAEA 2BOVA 3QEKA 4KAAA 4ZT6A 4ZEXA 2ZWMA 4XEHA 4YALA 4BNMA 1L8OA 2OAEA 1YD7A 3I9V6 1UJ4A 4ND8A 4UVHA 4B4WA 3CR7A 3V7UA 2QP9X 4YHHB 1E0DA 4DNPA 1L5HB 2ZPAA 2HU5A 2OXFA 4RQUA 4BE7B 1VJGA 3G5AA 1J9GA 2VS1A 5CLGA 3WNCA 1X0VA 2JIQA 3EIEA 3F90A 2QN8A 4DTCA 2QG6A 1F8FA 2BMAA 2JGFA 4RPHA 1X80A 1B15A 1QAOA 2I5PO 5L7YA 2ONJA 1EK5A 1F0YA 4I1OA 4TN5A 4K05A 5BQFA 2QVLA 1PQWA 2J9FB 4FR2A 4MKGA 3IURA 4C76A 3TBKA 3UUFA 3VSEA 5HE9A 1ENYA 1EUCA 2LPMA 1G5FA 5G4LA 3PVCA 3R9KA 3VA7A 2G6TA 2ZSAA 3JYNA 5CBKA 5JVDA 1NM5C 3A4YA 1H8HA 2X6TA 1FSFA 5REQA 1QTQA 5DXFA 4KSBA 1A4XA 2BBWA 2E6KA 3BXHA 4MZDA 3CA8A 5MN4A 3ZY6A 1M6EX 2WB4A 1OA0A 3FZGA 3L18A 4LJAA 2IP1A 2MR5A 5KNDH 4PV7A 3TH5A 1SEVA 1VE6A 1Y1QA 1OAAA 2LVBA 3ITKA 3PFBA 4RAQA 1TT5A 2JIZA 1LJLA 3SEAA 3V32A 3ZGLA 5CVEA 1KK0A 3RLIA 4CM9A 5CH8A 4G4SO 3HZHA 5J9FA 2RHDA 3QU2A 1RU3A 3TW4A 4JJKA 3U3XA 1EXVA 3W3AA 4HRVA 4XOIA 2ZI6A 1ZM3A 2HV8A 2X22A 2ZYAA 1M2VB 2QV0A 3FETA 4LC9A 3V48A 4DLSA 4IEIA 4L78A 5IARA 2C8VA 3W8DA 1C3XA 4CDMA 1J8QA 3LQKA 4OQMA 1LRLA 1ZUNA 1E18A 1MX5A 4IFBA 4HGQA 1K7XB 1SCQA 4O59O 1PD1A 2GXQA 4J9VA 2ZRNA 4GOJA 1ZIYA 1OKKD 4MAMA 1WKBA 2CNDA 3NB0A 1XTZA 1I8TA 2I66A 2WT8A 4ZCPA 1Q83A 4OQDA 2YIDA 3JWJA 3DMHA 1VHLA 4PYMA 1V1JA 2ZKIA 5GJCA 3V2UA 3WMWA 1Z6YA 2PUJA 4BU1A 1VMEA 2XCLA 1EP9A 5AVVA 4TV9B 5DRYA 3SQXA 4C06A 3P4UA 1J8YF 2NX2A 2WOOA 1IZ8A 1TW2A 2FPPB 3UMVA 4PSUA 3KXPA 5EQDA 2WUDA 3TIFA 5M3BA 1R8SA 4B8ZA 3U3MA 5K3EA 3K7EA 5KMGA 3C4QA 3FWYA 3T5CA 4I9HA 5CA1F 2X86A 4LVCA 3RT1A 3PKIA 2QB5A 2FE1A 3WJ1A 3HK2A 2QQ0A 1I1QB 1FFWA 1RCUA 3E53A 2G40A 3A4IA 3AI2A 2BKEA 2WYHA 3K9GA 5AK5A 4G1VA 2ZYIA 4XX0B 1EUQA 3HNPA 3K30A 2NV6A 2B20A 4UEKA 5B1EA 4UZEA 2I1LA 1ECBA 3R6TA 3G8AA 3M7IA 4YMWA 5K51A 4F8JA 3U4QA 4DCTA 5DNYB 1JFSA 4ZDWA 4UM9D 1Y82A 2PBZA 1CUUA 3CRMA 3WLAA 3W5AA 5L3QB 1DX4A 2YY6A 4TL9A 4YJGB 4Q1FA 4UXHA 3O8RA 3GEGA 2JRLA 2IVFA 1E2JA 2QX9A 4JK3A 2HOQA 5K0BA 2C5EA 3RS8A 3R0JA 2QXYA 4YV2A 3M1AA 2Q1YA 2J7PD 3PHCA 3SOPA 3SF8B 3I62A 2EEPA 4YN3A 2BFDA 4BP8A 2MWMA 1TJNA 5K3AA 2HW8A 1ZCBA 4BVAA 3DOHA 1R8QA 4QL3A 4DDHA 3LC7O 3A6EA 1OFTA 2P11A 2EZ9A 3VJLA 5IZCC 3KEQA 4GEGA 5DX8A 3S70A 3ICCA 2JAOA 5IWAB 3JVIA 3ZY5A 1T2CA 5EFZA 1DLJA 3ZK8A 2YHIB 4MDFA 3CZAA 2Q0QA 2Y93A 1UFQA 1UR5A 3BE6A 3DR5A 3GI1A 3CY6A 5CT5A 4CCYA 2VKQA 3BH0A 1RPTA 3UK2A 1N36B 3RT9A 4HH0A 1EHCA 2XUOA 3FUTA 4L8LA 4A0QA 5LXTB 5LZ5A 1PWEA 1XTUA 3D2LA 1YZKA 3ETNA 4MQ6A 4RFLA 4G0ZA 3BL5A 1CY8A 3FVRA 3C6YA 1JHXA 2VYQA 1TK9A 2EQAA 1U7TA 1ZD4A 2TYSB 3AB8A 3E5RA 5ADVA 3LUPA 3QH4A 4MUBA 3EW9A 2VVTA 2I6GA 4EW2A 1PDVA 1I2AA 3BK2A 4ECAA 2QTRA 2VNIA 2E5LB 4QBGB 5DYWA 3I42A 2B4TO 4N1AA 1LWNA 3ZTWA 2QRVB 1BDBA 4TTIA 5JS6A 4YWHA 3OE1A 3EARA 2Y1CA 5KWSA 1IVNA 3RJMA 2CLDX 2W58A 5AXCA 4LDJA 3QE3A 4DPKA 5F5XA 2FGKA 2JGLA 2JH8A 3FJOA 2WZDA 4N39A 5JNUA 2XXJA 2XBMA 4OLAA 5JJLA 2CGEA 1M6WA 4BQOA 1CRWG 4E09A 1XNRB 1IN1A 1JQEA 5EWMB 5TSDA 1IPFA 5KYXA 1UMBB 1X7XB 1P7VA 2BMJA 3L82B 2QSUA 3LVQE 5CPBA 3ZWAA 1DEOA 3USES 4D80A 5CDSA 3FYCA 1K68A 2GBLC 1U7DA 4I3HA 4R2LA 5DNAA 2NAPA 1PK9A 1R9NA 3EIUA 2G09A 5AM1A 2CDNA 5CT9A 3P9SA 1A04A 1LXCA 3CZ9A 2EBHX 4GWKA 3VYRB 2NZ2A 5FPTA 2ZQYA 2XUHA 3D3WA 4TTTS 1ESMA 4L95C 1MOPA 1UZMA 3M6MD 1RJ9B 3FZQA 5AVTA 2R2GA 3ZD7A 1VXRA 1EK1A 3SEZA 1T2DA 4WKBA 3V33A 1XVLA 3CB2A 3A0UA 4H60A 2HMVA 1R18A 3W4IA 5HF5A 1MA3A 1FQKA 2PKQP 5BQ5A 1KDZA 1D4AA 1EH5A 1YK1A 2PKRA 1LPPA 3LCCA 1FTGA 4BFWA 2H1RA 8ABPA 4J03A 3HUUA 5I9MA 3E23A 1L8QA 2BM9A 4I8IA 4MGYR 2ZSBA 3DHVA 4J1TC 3EVBA 3MT7A 4YBRA 2R1TB 4ZOLB 5T3UA 1FTWA 1U8CB 4WZBE 1O54A 1Z6TA 3OQPA 2DJIA 3G2OA 1OZAA 2ZBEA 5ALQA 1WUYA 5BSEA 1Z88A 1JR6A 1EVIA 3RAJA 3FNEA 1WMDA 3AUKA 2RHWA 2BEVA 2R6R1 3LLSA 1Q92A 4F72A 4UUAA 5KOHB 3PUXA 3GZJA 3G59A 4TWAA 3U7RA 2V4UA 3O94A 1QMPA 3DNFA 3DBOB 5B58T 4KQ2A 1T8YA 2QI9C 3QUSA 4QVKA 4DNFA 3AUAA 4NKRA 1EAYA 2P5SA 5TR9A 3ZHCA 2DKFA 2I2FA 3C1AA 4M0FA 1AS2A 1DBWA 5K3BA 2XQJA 2BI4A 1F12A 4EQ6A 3VOAA 5K7SA 1Y8QB 1O6ZA 4I6GA 4R9SA 4I9NA 5C51B 4BBAA 1JA9A 5ETJA 2C04A 2VSNA 3KAJA 2A1IA 4UHJA 3S68A 3A9TA 4CMIA 3MQFA 1JF8A 3DXYA 2IU6A 3EXIA 3MGCA 3AKEA 4UEWA 4X8MA 4GP7A 3SZOA 4JKYA 4LJKA 2YWFA 1AQLA 1YXMA 1O4WA 4KWIA 4F4UA 2CC2A 2HWKA 4NJOA 3RKSA 2FMUA 1XEXB 1O6CA 3LVFO 3OPYI 1XWFA 4EAQA 1I2CA 1K2VN 2XGGA 4RVNA 1OSNA 4AZVA 1CZOA 4AKGA 4R1QA 4C2AA 3TJRA 5ICSA 4KHZA 4EY6A 4YAWA 1RQXA 1ZGGA 2ZWVA 3C8MA 2AD1A 3EA5A 1BCRB 1DO8A 4GI3A 1YONA 1DKMA 3IP9A 2ISSD 1R88A 3JARB 2BY4A 4MUFA 1H2BA 1PWZA 3ICOA 3P9XA 4I3FA 4X6UA 3BERA 4RH0A 2EJCA 5HEKA 2IA5A 1HE2A 4K81B 1YDFA 1RXWA 1XCLA 3K53A 5TLSA 4DMLA 1XAIA 3FOBA 4TYWA 1CE8A 3TLEA 1NW9B 2XOEA 3HWWA 3QVLA 1TC2A 3HDTA 1MFPA 2JJMA 4PY2A 1SQ6A 3UIEA 1OVGA 4MDYA 3VVLA 1F2UB 1XJ0A 3RARA 1YI1A 3UB4A 4I81A 2YHUA 3FOFC 3VSCA 1VKJA 4MIOA 1O2DA 2F1HA 4G8BA 2PXAA 3QKSB 4G63A 4R8KA 4YRDA 3KNZA 5K3OA 4BL5A 4NR0A 1YL7A 1PX2A 1XHLA 2R4UA 5KHOC 5GV8A 4DILA 2IEYA 1UDXA 1L5MA 1R3UA 3CEJA 1UMCA 2XWBF 5FUMA 2YVUA 2FPRA 3MJSA 5HKBA 4O4LF 4QEZA 1NMEA 4KLAA 4W82A 2PY6A 3PFWO 2I3GA 4IOLA 2PLAA 2VDWB 4ICIA 1LVUA 3VU1A 4F0JA 3VC7A 5LA6B 4IUCS 3SVLA 1KZ6A 1UUFA 2VDVE 1OQAA 4RDXA 2O8FB 3IMKA 3PDJA 3KYIB 4IQ0A 4OU5A 1B16A 2R87A 4AF8A 4C7KA 2RHOA 3BGWA 3PRKE 2ZRHA 3A3PA 1W0CA 4ZDIA 5IZ4A 3NBAA 3KX2A 4E1BA 4QBHA 4ETNA 2X2FA 2EOAA 1J8MF 1M5RA 4MA5A 4HQLA 4GH5A 4NYMQ 1TM4E 3UWOA 2JA1A 1NX9A 4LZLA 1E2MA 2QRZA 3P0EA 5DSTA 4CM3A 5C9ZA 1TAHA 3QE2A 3OEHA 3IJEB 2VOJA 2NXWA 4WXRA 1RC8A 4IF6A 4DMKA 1XPOA 1L8XA 2J4FA 2YRWA 2DQZA 3P2OA 1GUYA 2IIBA 5C5IA 2FWIA 4BECA 3GV0A 4J0DA 5JYDA 1QLJA 5HA5A 2UUBB 3DL7A 1YUNA 1NBMD 2P9TA 3HHPA 4XX0A 1ORDA 1JSCA 3NBQA 4MCAA 1QIFA 4DR1B 4ENVA 1DSSG 1GDTA 2X4DA 1GZ7A 1WOMA 5BPHA 3KJHA 5LYJA 2BMFA 5CX4A 1TB4A 1R64A 3EW7A 1OAKA 3SSAA 4RTOA 1B1CA 1G3UA 2CE7A 4C4OA 3HCNA 3Q8MA 3BXXA 1QHIA 4KQIA 4C2UA 5LM3A 6REQB 5ED4A 1NZFA 2X9GA 1JHRA 3ICEA 4KWEA 2BGIA 1TXGA 1DKOA 3R7FA 4YJGA 5EN4A 2EHDA 2GVDC 3QYAA 1GL6A 4UBMA 4WKOA 4BJHB 4YR9A 2J9GA 1LY1A 4BFCA 1WXFA 4PHFA 2V6JA 2WF7A 4GZLA 3UBTA 5HRAA 1T5IA 2QVGA 1UKCA 4GUAA 3PUJA 1KVRA 2DFKB 3TDNA 4RIFA 1I13A 2OB2A 1EFRD 1K6MA 4A5OA 3KQLA 2OXCA 4H27A 1IUKA 3DZ8A 5TS3A 2O52A 4ROSA 2XNKA 5KVSA 1N5LA 3WLJA 3G7SA 4DCPA 1YDWA 5BORA 1H1DA 3Q3JB 3SI7A 1HLFA 4CQMB 2QAGA 3DWGA 4XRRA 2V6IA 1FXWF 2OY0A 4TXHA 3QPDA 4MW2A 4KXFB 2YWDA 4N6OA 1MB0A 4CLRB 4IICA 1M2EA 1LC0A 1O97C 1QGOA 1UDRA 2P0AA 1U3VA 3DC7A 1D09A 2D5CA 3G7UA 4DZTA 2A0FA 3CPSA 1T8UA 5B4VA 5IFLA 3KIPA 5CLQA 1XRPA 5DASA 5CAEA 1GPKA 3LC1O 1QCCA 1G8FA 4P4SB 1VL1A 3HRKA 1XZEA 4LJ9A 4ZT7A 3ZW9A 5HVNA 4M0KA 1A97A 5EHGA 1F17A 1UJ2A 1CQZA 2D7CA 2GEDA 1XRNA 1K7CA 3W5VA 3B36A 3GELA 4YFVA 5F7JA 5I9IA 1KDYA 5KU1A 1RZRD 4Z4QA 1ORVA 2ZIVB 4X24A 3E1GA 1T5BA 4YRNA 2GA9A 1EFUA 1KIFA 2PCLA 1P7PA 3GEBA 4R8RA 3NAGA 3FYUB 5CNKA 1HTWA 1OBFO 3T54A 1A5AB 2HJHA 1H85A 3FNGA 1KYZA 2XNSA 4JI6B 1GYRA 3C8DA 4W99A 2XNCA 1BA2A 1Z2PX 4E5NA 5BQOA 4D8WA 4DADA 5B64A 4HLUA 4GNRA 4MCHA 1CUIA 5KUTA 1RMTA 4OX9B 1QUEA 3LUCA 3Q7TA 2V3VA 4ZOAA 3PX7A 5AVJA 4Q9IA 4IMIB 3SJUA 2FY8A 4C0QC 4H0NA 2RBGA 5EWMA 1U7ZA 3ESQA 1X7XA 2XUAA 3UPDA 1I7PA 1UOOA 4G85A 4P1ZA 1E66A 2F67A 1HRKA 2AMLA 2Q0HA 3FA2A 2VJQA 4W8GA 3ISTA 4MW9A 2YMLA 3PHHA 1NJ5A 3QXHA 1PJRA 4IDGA 4JBIA 2CL0X 3PQ3A 2E6UX 4OM8A 2IPNA 5F76A 1LS6A 4IG4A 3G2MA 2ZRBA 1KU0A 4KH0A 5CM9C 1N32B 4H7KA 2D1RA 2HQSA 4B6FA 1IH8A 2V9PA 1IHPA 5SICE 3MEQA 2XLBA 3INNA 4L8YA 4OXQA 3C5EA 2QT0A 1RTTA 1YJQA 1SD5A 2GFQA 3MINA 4GMGA 1J8DA 3OOEA 1R7RA 2BTOA 3IAEA 4KTVE 4HH1A 2FPIA 1VKRA 1EXNA 1T36B 3V4PB 3FROA 1TVEA 2W7TA 3O9MA 4I9UA 4G9BA 3ZIAA 4QOGA 4BUZA 4RVGA 2FMFA 4L7QA 1ZYUA 1YHNA 4P8RA 5AK3A 3OZAA 2FSVC 1Q1QA 4BVJA 5JADA 1R8YA 1FJGB 4L4SA 4LFAB 4PE5B 1XZJA 2WHEA 4TWIA 3UMYA 3E03A 3DBHA 4X3PA 3BA6A 4XYLA 1X13A 3OFNA 2A9KA 1PT6A 2VT7A 4GZ3A 3EQ8A 2NO5A 2HZ7A 2PAFA 2XYPA 3GCGA 3KYDB 3SPXA 3TO5A 3T5AA 2QNRA 3O26A 4EW6A 2GI4A 4IQGA 2YTZA 4OMCA 4P4NA 3AXSA 1BHQ1 4D9KA 4FUTA 2UYYA 2YVAA 1I1NA 4QYSA 1ACLA 4JX9A 1KFBB 4Y2JA 3UV7A 3RUCA 1JIJA 4HGYA 5DP1A 3SVTA 3C0KA 2H9YA 3MGKA 1F60A 1Y8QA 4FZJA 4KVGA 4RD3A 5E7IA 4BDSA 3ZTTA 4P92A 4WDQA 4F9TA 2W6JD 2VSQA 3MIIA 4YDHB 1EX1A 2XB4A 3HFJA 2XJ4A 1MJNA 2IJGX 3OZTA 3WRXC 1SELA 2POQX 4OFZA 2PS3A 3TI9A 5K0EA 1SC9A 3NYQA 1L4HA 1P0QA 2FZWA 4KXUA 1E1MA 3RRYA 2F9MA 3C2QA 4PGMA 3SQOA 1PUJA 1A3CA 1ZMTA 1WVGA 3I4FA 3P9PA 1A95A 2B0JA 1ANKA 2XH8A 4JT4A 5A4AA 2HQOA 1A4IA 1XEXA 1Q1NA 2A1TR 4ZQEA 3QG5A 2GN0A 3TPZA 2I8LA 4WT7A 2XDAA 3EVCA 1XEWX 1RHUA 1GGKA 5CPFA 1C9YA 2ONZA 1M54A 3G85A 5M7EA 2NU6A 3K8ZA 2H4WA 3A05A 3HB1A 1DIAA 4NFSA 4N7JA 4M1ZA 4FWTA 3OQHA 3VQTA 1RYEA 5EC8A 4D4LA 2RAFA 4F06A 1RXSA 1XG5A 2O6HA 2PX0A 1IWPB 1A9TA 2HPHA 3DZGA 4MP8A 1V9LA 1Z45A 3CX6A 1XMVA 2O3TA 3A4TA 1ZUHA 1JAXA 2CHGA 1MJFA 1GCAA 3E3NA 4LJYA 1QFZA 1PWHA 2H2DA 2EDCA 4WK4B 3QLVA 3B3QA 1OF1A 2KMLA 2GILA 1PZNA 2JJYA 4G37A 4KX5A 4M3NA 1NUQA 3NT4A 5EEGA 3EPPA 1SZDA 1VE9A 3VNUA 5K3SA 2NQ8A 1SOMA 1JMVA 2P1RA 3SS9X 3K15A 2OD9A 4JS0A 1FE8A 1IWOA 1QGYA 1YCDA 2BELA 4Q37A 4L74A 4MPDA 4ARUA 4DCUA 3LL7A 3BREA 1BJTA 3B3GA 1RD4A 3ENKA 5KDLA 4ABTA 2FDCA 1ACJA 3SM3A 1ZVKA 3NRBA 2R47A 4D9GA 3OPNA 4W6QA 5C8ZA 4M9SA 1JG6A 3N7AA 5C52B 2Y1DA 4NCBA 3F71A 3MG9A 4MI1A 2J9RA 3DLTA 3DGEC 2EG9A 4PWZA 3T5GA 3X1DA 1UEXC 2QW1A 4MULA 5SZJA 1DTWA 1THGA 1SULA 3NIWA 3MAGA 1PZXA 2E4VA 4YP1A 3ZYZA 1OZHA 3O83A 4IVPA 1A9XB 2V7GA 3PB3A 5D01A 2KWIA 4E2WA 1YZHA 4HXFB 3W2IA 1I0ZA 4B3FX 3HU2A 1ORHA 3UVEA 4M0CA 5I48A 1XZFA 1RKUA 1XF1A 3H9QA 2HMTA 3S0JA 4E11A 3AYZB 3C43A 2R48A 2OK8A 5D1HA 1W0JD 1C4KA 3QXJA 3QSYA 2ODBA 1XMXA 2JATA 3DT6A 3FTDA 4CM4B 3N2YA 1AS0A 4G56A 1WV1A 1KI6A 1OD6A 4UNSA 3HKCB 3P2JA 3QFFA 3TLBA 2CLKB 4IVRA 3IIKA 1KXZA 2GJKA 3ZC3A 3MXOA 4FP9A 4WK2B 4M53A 2AVNA 4K9DA 5JG7A 2PR2A 3UXEA 2GNAA 4TN1A 3UENA 1W4ZA 5IZCA 1P0PA 4IUYA 3Q1KA 4JITA 1MD9A 2EGHA 3RRNA 3VZSA 4QFMA 2KLHA 3N74A 4EI9A 2GHQA 5ICEA 4KLNA 2D1FA 2V0CA 4NYIR 2RKWA 4N65A 4AG5A 5CUQA 4I4IA 2PMBA 3F3SA 1Z0ZA 2E9SA 2QL6A 2WYOA 2YCBA 3HCCA 4FEYA 4JOQA 4TGLA 2FI1A 4G97A 4C5BA 4GR4A 2A5DA 2Z8ZA 4LBWA 1MR3F 3D4LA 2HWWA 2Z8XA 2DXIA 5HFAA 2ZU6A 5D3MB 1S8FA 5THQA 4R6WA 4CLDA 3D8BA 4X8LA 2FK7A 1IWBB 4UAJA 1SZJG 6REQA 4K28A 4V0NA 2EW8A 1BHJA 4RJJA 1NASA 4POOA 3C1UA 3A32A 5JQGA 1NDHA 2DPYA 1Z37A 3IT2A 1VBFA 3GLVA 2BHSA 2O2XA 2JD1A 3BJMA 4G8DA 2H1LA 4CT0A 1JFRA 4RZXA 2AJDA 4F60A 1X87A 3MVEA 3IP7A 5IPFA 3E8SA 2PLNA 3ZKWA 1I5RA 3G2LA 4FEEA 2IP4A 4IO0A 3FOZA 3L1UA 2VHWA 4JIGA 2X2EA 1NWHA 1U1CA 5F77A 4JODA 2BHTA 2WFZA 4TMYA 4RTRA 1WDTA 3VAZA 1EX9A 4TTPA 2AYXA 1T4GA 3ROTA 3X2SA 3MWEB 4BVLA 5D3KA 3WG9A 4CLRA 2GBLA 3FB4A 1SXJE 1P8JA 3ZR4B 4BVFA 2Q2OA 3ZIUA 2JJQA 2I2DA 5HK8A 1QWOA 3BWXA 3OM8A 4JI1B 3ZW7A 3KOXA 3V8PA 4Z7QB 3UHPA 2HFKA 1WW3A 3GDHA 5C7LO 4QUGA 1Z68A 4X1YB 4P4SA 4DOMA 1U8ZA 1S89A 3RUEA 3J81k 4RLSA 1UADA 2DFNA 4GG1A 3KJNA 4LYJA 2C3PA 3LYLA 1QIEA 1T3ZA 1VIAA 3B12A 3OA2A 2NG1A 4K5QA 1K7EB 4WLFA 5J2UB 4BZZA 2C5SA 3CHYA 4V1CA 4BUJA 1GPLA 4C14A 4KJZA 2IS2A 1SXQA 4B40A 4Q15A 1ABEA 1MH9A 5CCXA 1E58A 3LMKA 3CZ4A 1UC4B 4O4IB 2JZNA 3WS7A 5J5VA 2YQ5A 3JTEA 3L6UA 3N28A 4ODIA 4ZYZA 5DHQA 1ST3A 4RPCA 1UOPA 5JS2A 2QZJA 1LBQA 1UBMS 5KYVA 4W5JA 1N1GA 1T8PA 2JDID 1DKPA 5FTJA 2NUAA 2WSBA 1GJRA 3IKMB 4NSNA 4D6XA 2O7SA 2PLRA 4ID3A 2QIOA 1I32A 2O05A 4L4YA 3FLBA 4V38A 1U2GA 3NU1A 1JDBB 1JIUA 2Q1XA 4LXIA 3PGA1 1EUZA 1E0JA 2E18A 3AB7A 4DLYA 3GGDA 3M3PA 3DFUA 3GDFA 4DUGA 4DSAA 4N76A 4WCDA 3VHLB 3ZKAA 1AMNA 3P9YA 4NDAA 3JZAA 4MW7A 4R1NA 4GR9A 4RK5A 2R6GA 4NBWA 4EITA 1PGPA 2I2BA 4JBLA 4KIFA 2FB9A 4HVLA 1UPUA 1ORRA 2VYCA 4K1XA 1ZMXA 2ANBA 2OPBA 2YXPX 2ZI7A 3P9RA 2FE4A 2XB8A 4LQDA 3G3EA 1QYWA 4GPD1 3HEMA 3TZKA 2ZJ4A 4YI3A 3EASA 4J7AA 2FCAA 4OAPA 2BHLA 5BSGA 1GPUA 2GFIA 1XCPA 2CKDA 4M38A 3DLBA 4CEJB 4JNKA 2A0KA 2C07A 1EUDB 1QHHA 4NNOA 5TGZA 4FKBA 3O1IC 2RI6A 4FCWA 5JLAA 1BMFD 2BFEA 1SKMA 1TYAE 3E2PA 2A9VA 3M6LA 4K26A 2ZJ8A 2Q27A 4QGHA 3P26A 3FFWA 1JPUA 3VOBA 3BWDD 4ZGBA 5A2GA 1VKNA 4WN9B 1IAVA 2H1VA 1WQ3A 3W9UA 3U7IA 3V6LA 3WISA 3EJWA 1G7RA 2XWQA 3HKBB 3C5CA 4NBVA 4RD6A 2Z98A 3PHLA 2JARA 1BX0A 3QVGA 1I3MA 1D6SA 2REQA 3QIVA 4J49A 5ALRA 1Q14A 1I1OA 4IZOA 1BXRA 3R7SA 2KJQA 3LIPA 1W0KD 4MUMA 3FPGA 1UWKA 3MCZA 3O92A 1CC1S 2ZWAA 2VYNA 2IIPA 5C2JB 1ZVVA 3JQFC 2W2NA 1GZVA 1EFAA 5AIAA 1X2BA 2ZE8A 4BMPB 3KVRA 5LMUB 3B6KA 3PZRA 3KPVA 1DTEA 2WK1A 3T3HA 5ALFA 4Q16A 5EJ6A 2NV2B 3RKUA 2WJJA 3A11A 3PS9A 1BX1A 2GXUA 1NLYA 4LK3A 4P98A 4FYKA 1OB2A 4ARZB 4YCNA 3TINA 3JU3A 5E1BA 4TLLB 1TM5E 5I8PA 2H1CA 5T6BA 3ZBQA 4O2AA 4D74A 1P2SA 1JEQA 2WTEA 1DUIA 2GA8A 2YN4A 3TVTA 3ZOZA 4OAQA 2HNKA 1IIBA 2Q62A 2RKOA 1DX9A 5DT2A 2WP0A 5K8JB 3IQDB 2ZFUA 2YS7A 2ZOSA 3V3KA 4O25A 2WM3A 2IEDA 4G0WA 1P19A 3N9IA 4DC1A 3WQBA 5F3WB 4C4TA 4NXMB 2X5JO 3KQMA 4PIPA 1ZGCA 4UTVA 1C0IA 3PNVA 3C16C 4NFHA 5JR3A 2I9KA 5G0VA 4QEKA 2RK3A 4G0OA 1GLNA 4ETMA 3AU8A 3F74A 3SCZA 2HX1A 4DN6A 5EZYB 1BWRA 4BC0A 1QGED 3GX1A 3KZKA 3ADDA 2OSBA 2B8TA 4R54A 4UFNA 4B4KA 4W1QA 3GMIA 3F6BX 4MR7A 2WHQA 4Z2AA 3L7BA 5E3HA 1P4SA 5TQ2B 1TDJA 1BGXT 1H0KA 4LG1A 4TOIA 1FP1D 4Y2RA 5LP6B 3NOQA 1MVLA 5AW2A 2C2KA 1ZU5A 1PR4A 3FXAA 4JSRA 4LDZA 3QVXA 3D4IA 3PBKA 4P3NA 5H82A 3VTKA 3SNKA 3HYSA 1OE0A 4RIGA 1DBPA 5HF6A 1F8YA 2NVUB 1U31A 2EWMA 5EIXA 4RH1A 2RGNC 3ME5A 2KBFA 4LBZA 4BN4A 2IY9A 2G04A 4EHAA 1G20A 2WT9A 2WU4A 4UTZA 1TU0A 1U8EA 2JJ1D 5LJIA 1RM4A 3MHTA 1BEEA 3IR6A 4B76A 4UPEA 1E3QA 2CUZA 1L4NA 1UF9A 3DZKA 2OCLA 5EERA 5BQXA 2XUZA 1CNMA 1QTIA 4PX9A 3CNLA 2GERA 1NRJB 4R51A 3OPYB 2OWDA 2PD6A 2VTVA 4NLLA 3VYUB 1TE2A 3ZHOA 5JCZA 1ISJA 2HN9A 2JEOA 2P75A 3NTOA 1JPVA 4RK4A 2MSEB 3ZU2A 4ESVA 1OHHA 1L7DA 3HL0A 2IGTA 4LHEA 4TMVA 2WIJA 4JUBA 3AHJA 1F5NA 1SU8A 1TF5A 4KUGA 2A5YB 1P17A 4G5SA 2EU8A 5BRJA 3HBMA 1LGYA 3R0QA 4MIKA 3E9NA 5JO9A 1EXWA 1D2CA 4HQFA 5HIAA 2HBZA 4Q9NA 4BNZA 3HXOA 3V4LA 4Q7JB 1WWKA 2LZ0A 3T5PA 1GPDG 4K6MA 5BN5B 3SLKA 3FPKA 3IO5A 4FJ1A 3S1SA 1GA6A 3LY8A 1FLDA 3GLIE 2LRHA 4OBEA 1KFCB 1V1RB 4L15A 1GNTA 3NH6A 3DE6X 3IS3A 2CDRA 1ZMOA 4MWDA 2W70A 4CF6A 3Q0IA 4DBLC 2X4LA 3IELA 1Q6ZA 4FZRA 2I54A 4UEQA 1LDMA 3Q8LA 3GFSA 1DTSA 3L8YA 2XB6A 2OGSA 1GL3A 1L7MA 5DM1A 4B45A 1P6XA 1RR6A 5ALKA 3L5KA 3F5SA 1DBQA 3DOUA 1E2DA 1CIPA 3HV0A 4TSFD 5FHRA 1YDEA 1TAUA 3TZBA 4KE9A 3HABA 4QU9A 2H4FA 4ZPXA 2QW8A 4MS1B 1N9ZA 5MN5A 2IDZA 2YV4A 1DE0A 3Q11A 4P0QB 4OLHA 1RWBA 3GGGA 3ITNA 4Y6RA 3VOSA 5TPWB 4KQXA 4YAFA 4H6VA 3JR7A 2YWGA 2WG0A 3LT1A 4RM3A 3AERB 3B38A 5FFMA 3JYPA 4AQDA 4D8VA 2CNBA 1DXOA 2JASA 3LUAA 4QPPA 3ANXA 3HY4A 3CNHA 3UFXB 4GHWA 4ZXFA 1XB2A 1K3FA 4GMKA 1C41A 4MWZA 2HL6A 1DMSA 1C9DB 3MLAA 4M89A 3C70A 3QUQA 2IH5A 2W6ZA 2JF0A 2NU9B 5AVSA 1U7UA 3IKLA 3JWEA 5LIPA 2PPVA 4ENUA 2MINA 4I5EA 2H17A 4H7FA 1P0CA 5FNVB 2WWRA 1JTFA 3RAFC 1XKXA 3C3PA 5DVZA 3D4PA 4HDOB 3D6TB 4TV9F 5ES3A 3MWEA 3PFFA 1OLUB 3FTNA 2IWHA 2FR0A 1RMQA 3QK7A 5IULC 4MPRA 1XQ9A 2ZAOA 4GDMA 5A71A 1GZ4A 2KE5A 5CYOA 1ISHA 1OTYA 3MWGA 2AZMA 2FGJA 2G7MC 4HR7A 4RKYA 4X93A 2AJLI 2I91A 3IAM6 1G9XA 2G8NA 3ASZA 4JL8A 3UMRA 3PQ2A 3PNPA 2PKYX 4ZHQA 4FIZA 1IJBA 4LV5B 4GM0A 1T43A 3FNFA 1QAMA 1FTQA 2R65A 5KHAA 2F1KA 3PPIA 1C3OB 4UCQA 3UMBA 2Q4BA 2F1IA 4A2PA 3UK7A 3QY0A 3WZMA 3BAZA 4KQCA 4GGPA 5HFNA 2HK6A 3PGMA 1VJ0A 3T7CA 5AKKA 4RVSA 4YNBA 4CG2A 3DAFA 4M0MA 1P1IA 1T9AA 3EY4A 4NS1A 2I1WA 3KB6A 3OG9A 4RDIA 3V4ZA 4KFSA 2GCOB 1QANA 2ABWA 2JGJA 2WU8A 3I6YA 2FUEA 3KL4A 1X8JA 5EZSA 4NP6A 1XK7A 1YR3A 3DBVO 2P4EA 1LNZA 1LLFA 1USGA 4G0MA 1JFVA 1SCUB 3CZMA 2DSNA 2WKPA 3AESB 4HEHA 4WESB 4P9NA 2NT3A 4JOCA 5EWLB 2JW5A 3WE7A 4Q7QA 2OXRA 4I55A 4MPTA 4MUJA 521PA 4F2DA 5I9LA 1F1BA 1TA4A 2HT1A 1BVHA 1QMGA 1QTNA 5F33A 5F4ZA 1G21A 3TL3A 3F9CA 2DR0A 2BFCA 4D0RA 3VZDA 4BNUA 3V1UA 4R9UC 4N9QA 2Y92A 3RWMB 1I7DA 2D3TA 3K1ZA 1X1CA 1DCTA 3HUFA 5A4KA 1KO1A 1XXLA 1ULAA 1YA8A 3CX7A 3GXOA 1GTG1 2EGGA 4AC9A 3D3QA 3DDWA 5CBPA 5JBIA 5C53B 2QD4A 3BTUA 3DJFA 3AR8A 2GPJA 2C9OA 3HP7A 3I2HA 4WBXC 3VKWA 4EHDA 3HBLA 3LLVA 4ZQGA 5LXTF 4EMUA 2A0YA 3MA0A 4QQFA 1E5TA 3D4NA 1R0SA 1NVAA 3A0RB 3JALB 4CR8A 3DBRA 3R41A 1V1MA 4ENRA 4BY9E 2C7QA 5ICFA 2YWBA 3WRXA 4V0ME 1JG4A 1AX9A 5B53A 4TRJA 1H6BA 5JAQA 1XDWA 3QVVA 3AJDA 3I9MA 4II2A 1N2SA 3D3NA 4Z1MD 1QYDA 3AJAA 2J5XA 3C3KA 3HBAA 3HCEA 3D1VA 2I4TA 3PTAA 4FFOA 1Q1ZA 1RXVA 4BMYA 2QGZA 4DY4A 2H11A 1ZS9A 3KZ1E 5E4TA 3MAJA 2AYYA 4CR6A 5L4SA 1I6MA 3HKBA 2Q8QA 3UAGA 2PVCA 5ALLA 4PHCA 3HGQA 1IY8A 1EEXB 3H86A 1P31A 4ZTUB 3CRQA 5MFZA 5FTLA 1VLLA 1WNFA 4KPGA 3UOGA 3O8CA 3FOEC 4R2HA 1XELA 5IKOA 1S2IA 4JMPA 2FQ1A 4YRPA 2A5FA 1Z2NX 1ZH6A 3R40A 2WVHA 3T5BA 1M74A 3X1WA 2H2GA 1J70A 2WG2A 5HRUA 2I6FA 2H0RA 1EXMA 1CJSA 1RJDA 1J5XA 2QAJA 4DSNA 2CJFA 4IW3B 3ZCSA 4OUKX 4DMRA 1M1YB 3L3BA 2G1JA 1PFYA 2FUKA 3EVZA 1SUSA 3AJ9A 5DHTA 3UGKA 1N6RA 4LCEA 2CUTA 3UGJA 1P1KA 3E7WA 2O8BB 3KEMA 1IJKA 4KITB 4EUEA 4CKBA 1RWWA 4YWJA 1ZXLA 1AUQA 2F9LA 5FUBA 4YMSA 1LV7A 3VJMA 1AB5A 4WNIA 2PT9A 4YGXB 2JFFA 2P9ZA 4DUYB 2PIDA 2NYRA 1XPRA 1Y42X 3TQRA 3TJZA 3WRYC 3FMFA 4NDNE 3VR6D 4EY8A 4I3GA 4PPFA 3OWHA 3ZTYA 3PGJA 3FBTA 3TGWA 5BUZA 5K3FB 2GTHA 3K5PA 3DLHA 4HH4A 3OY2A 1Z7GA 2AC2A 2ZWOA 3BMNB 4G67A 4FINA 2EKDA 4PYRA 4ZOLF 4RTJA 4I4CA 4M1KA 4CWAA 3O4JA 3OZSA 1NBEA 3TUZC 5AD1A 1FVOA 1NN3A 1RACA 3Q88A 1IFXA 1UPFA 4HYTA 1EE1A 2HM7A 5FBZA 1DPFA 4ZC8A 3JWIA 2WY2D 4JI7B 4UMVA 5F1KA 1F1JA 1O3YA 3N76A 3UJCA 3U2QA 1ESNA 1KDTA 3LXXA 4JT9A 4MTCA 2JFQA 4MW4A 4REOA 5ER6A 5FD8A 4WJLA 3EPHA 2NN3C 3DTTA 1MN6A 2IYTA 2GOYA 3NBZC 5DCWA 4LJSA 5B55A 5IAEA 1OMOA 3FJ1A 3TFWA 4EPTA 6PFKA 1X7DA 5AP9A 1AGYA 1E3TA 1JQBA 1P1CA 2OZVA 4HNGA 3NAQA 3ENNA 3CW9A 2OFPA 2X15A 3DAHA 4IGAA 3J80A 4L0DA 3CZPA 1DKLA 3H11B 2JFOA 2NVBA 1LJ8A 2J5QA 5AM5A 2GAOA 5HIMA 2H9AA 2D74A 2YWJA 3TBFA 1RIIA 2ZI9A 2WSLA 2A7XA 4W5QA 1TNDA 4CQNA 2GAIA 3UJ6A 4K9SA 5HW0A 1QGZA 4BE9A 3OX3A 3QPWA 4BX9A 4GZ5A 3MGBA 2AFHB 7MHTA 2BDUA 1XO1A 2XGOA 5I7AA 3WFZA 4DKJA 1WB5A 3OTOB 2PN1A 4XGIA 4DCVA 2Z4SA 2OAP1 5GP1A 5HM6A 2JFYA 4JXZA 1Y7HA 2FOXA 2NU8B 2PGLA 2NADA 3Q5GA 1Z35A 4NBUA 4C05A 2V65A 3K72B 3DP9A 4LJ6A 3EGCA 1L3IA 2WE8A 3OKFA 3VHRA 1TKAA 4L8FA 1UZNA 1FTYA 4YCMA 2X9NA 4C04A 3M3DA 3CC8A 1AURA 1ZN2A 1TU4A 2GRUA 1V1RA 3AJEA 1WCXA 3EK2A 4LJ8A 5DLPA 3JRWA 2XY4A 3DDSA 1GZUA 2DHDA 3SM9A 4UJ5A 3IUQA 2FX2A 1G291 4PN3A 5JXIA 1IZYA 3GLHB 3L7JA 3AINA 4ON9A 4TV8B 2X23A 1WDKA 1HDXA 3BT7A 3EWNA 3OZEA 3WMGA 1QRDA 2WD7B 4E5UA 2PZFA 4F11A 1KMMA 1M2GA 4GECA 3SQMA 2ECPA 4UDNA 2I99A 5LQDA 3GLGE 4JC4A 1GTMA 5IK2D 4BBZA 1FFSA 3LKZA 1M2WA 5LZ8A 1H9BA 1P9LA 4ZREA 4MHTA 2FQXA 1FDWA 2ERXA 1N5MA 4YRZA 2C5BA 3LVBA 3N2GA 4FR5A 5JD5A 1CP3A 5CB4B 1YA4A 2C88A 3IKVA 1EGMB 2XAAA 3RIYA 4MS1A 4RVCA 2L18A 1CHNA 1XVIA 2G9ZA 1IOLA 2OZEA 2GBCA 2IYYA 2OM6A 5ESXA 5J63A 1K6IA 1S96A 4D3FA 3VR6H 3CUKA 3ANTA 2C8LA 5F5NA 3JQ7B 1Y7IA 3U7JA 2NTNA 4U3JA 3RANA 2B82A 3NJ8A 5A5DA 3DE4X 2X4IA 3K1TA 3AERA 4NDZA 5LA6F 3JQAB 4QYMA 4IXMA 1EVEA 1JNXX 4I4TB 5K0JA 3NP9A 2VQ6A 3T3OA 4WLNA 4X20B 1KQGA 1N0IA 3SIWA 2Q5OA 3IQHX 1CYDA 4IXWA 1XA0A 4QU0A 4PBTA 2Y0DA 1NE2A 4GMHA 3V1TC 2NU9A 2BSQA 4HPJB 4C29A 1JKJB 2HYIC 3IJRA 4EGSA 4RY8A 3OTHA 4XVQA 3TPCA 4EGFA 5DGHA 1TMKA 4ZV4A 1MAUA 1OLXA 1TEVA 2HRQA 2VK4A 1NF2A 1OLUA 1Q84A 1Y37A 3LWZA 1KGSA 5FBLB 3TVDA 2R6DA 1UFOA 3MHPA 4KACA 4CV1A 2PBFA 2V54A 4JT8A 3CVVA 3MRSA 5HCUA 3MN1A 4KRYA 4PYLA 2P5YA 2ZIEA 5GIPE 2WAXA 4FE3A 1C8LA 1DKUA 1VJCA 2CD7A 1DZIA 4IZHA 3G0HA 2IVZA 2FWMX 3ZBPA 5KYYA 1ECJA 3BC1A 1C3OA 4TXMA 2JIOA 4HEJA 2IOHA 1ECGA 3DGFC 3LQ2A 1H22A 2JBHA 3EPKA 1KJQA 4FYXA 2HLHA 4DWWA 4KRFA 1T91A 1IY0A 4OHFA 1DXYA 4Y1RA 4BFYA 1D6MA 1Y9JA 2VP3A 1E3EA 4KAXA 3BDIA 1BE0A 1E77A 2GQ0A 5BSFA 5DYIA 5KC8A 4XD7A 4Z0HO 4J6EA 3VM6A 2WKRA 1T3HA 4OIMA 3OCZA 4PRLA 4Q7MB 3ZY2A 3TZHA 4M8NE 1ST2A 4ZO7A 2W43A 2F3PA 2NO9A 3CV3A 5DM70 4LRXA 5EWLA 1VLJA 1W19A 5A9TA 3TL2A 3INTA 2VPXA 3D7RA 3GW8A 3E2MA 4CIDA 4KO4S 1R5JA 1UMDB 4MQLA 4OGGA 3GNSA 1L5OA 4L7VA 3C3XA 1MZVA 3U40A 4LF4B 4AURA 4QOEA 4JLAA 4A0FA 5JJCA 5MHTA 2D1QA 1I10A 1RWPA 3QF7A 5SYMA 3O8OB 2PX5A 4OG2A 4D79A 1FX1A 2HEGA 2NM0A 3PFKA 5JISA 1CLUA 4IYJA 2UXCB 2YMQA 1SQSA 4D9FA 3ONWA 2H4XA 2PD3A 2XMSA 1ISSA 3RJ5A 3L7LA 3JQFA 4DB2A 2ONKA 2DMRA 4L73A 3NUGA 1GOTA 2UZ1B 4TLCA 3IUMA 3AWDA 3R0IA 4WSOA 2FSSA 1CUGA 3EGVA 3H13A 4DV7B 5CEFA 1PP4A 2DLNA 1SGWA 3L0IB 3S6JA 3RWBA 4EI7A 4V39A 1JZTA 4FQ7A 4MPJA 4H7PA 4IHQA 4IILA 4Q7EA 2XUQA 5JBNA 3VNBA 2O54A 1NA5A 4PO3X 1U99A 2G5PA 3IDQA 3FHCB 3ILXA 5I7OA 2II6A 3FH0A 4F93B 4ND5A 1QP0A 3AG5A 3MPUA 1A2KC 1CR6A 2Q6OA 2QVBA 3LS2A 3R5JA 1VCMA 2W37A 4M83A 2HA2A 4X00A 5FA8A 3W6PA 4EY7A 1K5HA 2HCJB 2OG2A 4MQ4A 1XTBA 2L42A 4EZBA 1HDIA 3I05A 1ARZA 2H5JA 4Y18A 4E31A 4DXDA 1A82A 1SHJA 1APBA 3SNHA 3DWEX 2Y0PA 3OCUA 1IHXA 3KB1A 1Z4KA 3A6HA 3BWMA 1L4BA 2XOKA 1SJ9A 4L9AA 4LXHA 4WX2B 3G6KA 3WWYA 2G76A 3OAAD 3WYCA 1MJ5A 2Y3IA 1W85A 4HC4A 2YIVX 3LLMA 2N46A 3EGDA 3GVPA 1YO6A 1S4QA 1CB7A 1Z5UA 1N2CB 1T1EA 3F49S 1PSWA 1VE1A 1VSQA 5FOTA 3VR5A 2L69A 2X19A 1ADCA 3OCJA 5DNWA 2B1GA 4WUVA 4RO0A 3ZCPA 2A9FA 1PU2A 2IE0A 5C8YF 3ZG6A 3Q0EA 2RGNA 3DV9A 2ZG6A 5FO0A 3H5WA 3UMMA 1RI4A 2O8BA 3A1WA 3L8CA 2OHJA 2AJBA 3GHYA 1Q74A 1BDHA 3G8BA 1DIGA 1KEPA 4RLHA 4CG0A 1XTIA 3WWOA 1EWRA 1TKBA 3WGYA 4MCIA 1T6BY 1FDSA 1G5RA 4GRAA 1GVHA 2BFBB 2WAOA 4P3OA 2XYRA 4QHTA 2QENA 5FXMA 3E0XA 3ZHSA 1N2IA 1L1EA 1X8LA 2G4CA 4K2HA 5K3FA 1PDWA 4GVXA 3WB2A 2CXQA 2LNDA 1ZK3A 2EWWA 2W6CX 3F7NA 4AJKA 5BWMA 5HZGA 1FFYA 2O8DB 1GAJA 1ZHHA 2UAGA 1KO5A 4KGZA 5E9AA 1SXPA 4FQ5A 3SHWA 3A8TA 3RBXA 4KG7A 4LYDA 1BDIA 3O75A 3G7NA 5JPIA 4DTIA 5AWFC 4JNCA 5F2EA 2DOKA 1LRJA 4KGDA 3AUFA 2ZVJA 3ADCA 1KOGA 2R6CA 2K2WA 1B8UA 1ZMRA 3PGLA 1A8SA 4NK4A 1N8KA 3H87A 1WSAA 1KEVA 1MB4A 2OXTA 5HSGA 2JLXA 1UBFA 1Z4MA 3K0FB 2YMMA 2QX7A 3MYRA 3ZK7A 1B41A 1I2MA 1Q1BA 3SXUA 3DEKA 3A7EA 3BM5A 1E79A 2C3UA 3PGXA 3U0VA 1KJZA 1YFZA 2G07A 3CO0S 3T94A 1F38A 3HUTA 4L3WA 3S2YA 1HL7A 2O9JA 1P7CA 3CUVA 2Q1UA 5KX5B 5F9HA 1JFFA 1T9GR 3H11A 1XLVA 1YNSA 1XYVA 3NETA 3G6WA 5AVWA 4QYWA 2AFRA 2I8AA 3IOCA 3RC9A 3NDBB 5IJ9B 5CDTA 4PAMA 1DLIA 4RNDB 2WLTA 3H3JA 2P9GA 4E5YA 3GCZA 4OAOA 1WF3A 1B2RA 3T7JA 5BNIA 5P21A 3OX2A 4RL6A 4BLWA 1YVDA 4EW3A 2F3QA 1HQCA 2GJ9A 2QXUA 4N3AA 3TRFA 3UYKA 4I9FA 2AFHA 4D4JA 1XWWA 3HI6A 2C1ZA 3QVJA 1T8SA 2ECOA 1HSZA 1DWPA 4EARA 1PV2A 2XUGA 1XZQA 1AZTA 1OU4A 2CNWD 3ONNA 4KZKA 2NU8A 3EAQA 4HDCA 4N0MA 4G5OA 2HO5A 4XLZA 2AG1A 1EB9A 3Q87B 2DF8A 1YU9A 2FV8A 3EYWA 1TCUA 3I9LA 4B6QA 4WNAA 2JGRA 4PU0A 5LIRA 4RMIA 4NYJR 3RFUA 1UBUS 4H3VA 3DW1X 2QJRA 4Q3EA 2FPKA 3TNDA 2QY6A 4RJTA 1AF4A 1WDMA 1IBRA 5FORA 1NYQA 1TZBA 4I8DA 3F67A 3KPJA 4U7PB 2H1FA 4OQLA 3UY4A 2F2TA 1E5XA 1XLTC 5FL3A 3CVXA 4K86A 4RV5A 1NVGA 4RC9A 4Y30A 2XT9A 2AV6A 3T5TA 4HFJA 2BF4A 5FBVB 3DE3X 1WNTA 5KNDA 2GWHA 2C0QA 3P9CA 2FG7C 1MB3A 1FDRA 3SOZA 2ZSKA 1XTTA 3ZE1B 3D8NA 4N18A 1JALA 4JROA 3GBSA 4QARA 1Z38A 2BFMA 3D3JA 1OFUX 3RSLA 4XM1A 4LOKA 4DVGA 1F20A 3QX8A 2AK3A 1WSBA 2OBYA 2OXEA 3T9DA 3OFKA 2QLJA 2IU0A 4EY5A 3EIQA 3NGXA 1M8JA 2FFQA 4QYXA 5DHUA 1O9HA 4UHHA 1R8JA 3GD5A 5CT4A 3RYFA 1WCIB 1SK8A 3ILHA 5KWJA 3JVDA 3JQAA 3FMOB 3N07A 5BNFA 2HA5A 3LGAA 2BDEA 3KQQA 3FIUA 2NT4A 3G88A 2WMDA 4I4TA 4NYJQ 1EMDA 1D1PA 4RSMA 2X8BA 3UJDA 4IJQA 3M4NA 3N6RA 3OP1A 3VPSA 3ZD8A 4CKXA 4A5SA 1XSEA 5DHRA 1ULSA 1DP4A 1F6DA 1T6NA 1JKJA 1YCGA 2W6ID 1NPTO 3MGGA 5CH5A 4DV1B 2XZDA 4NCAA 1OUMA 1GVNB 2VHYA 3WJAA 4MVJI 3W5HA 4C5CA 4BS9A 5GINE 5TVGA 3UF0A 5F7XA 1I3NA 3ELDA 3IP3A 2A1TS 4NBSA 3NW9A 1XXHE 2R96A 1YULA 4D9BA 4ZIRB 4V24A 3U0BA 2OYSA 3O4HA 2BKXA 3INRA 4E6EA 2ODAA 3UKOA 2CXOA 3H4TA 3P32A 3AVTA 1MEOA 4KKVA 4W7IA 1PJTA 4U2FA 4O4JB 1W1IA 2D00A 4IF4A 2R1VA 4POAA 4N0EA 4UPVA 3VSDA 3MTJA 4C2BA 2FWNA 2V7WA 3ELBA 5E0OA 1CUVA 4J0QA 2FP4B 2OWEA 2WTNA 3VU9B 2OQRA 3OM9A 2OYRA 5B6IA 2I22A 3WNVA 2CVOA 1HC7A 4IIDA 4RA6B 3U48A 3AEKB 4LGMA 4HNTA 3IE1A 3NKLA 2W6OA 2V98A 4ZVMA 4NZOA 3S2IA 3ZDRA 4YLYA 4FHGA 3LBHA 1IHOA 4AICA 1SWVA 1HOXA 1N2XA 4YAIA 2OBLA 2PZLA 3JVEA 2PRKA 1MQSA 3HWX1 2GN9A 1JEDA 5KJ1A 1QOZA 3HBFA 4LKOA 4L2IB 3DEFA 1PT7A 2G67A 4YLGA 2RD2A 4OXRA 2DFPA 1POXA 1KAMA 3B82A 3BX1A 3RBAA 4P7BA 4X6XA 2D1TA 3JVUA 2YQZA 2E55A 3OD1A 2O2YA 1EWQA 3M0EA 1N3BA 4OXKA 2IYQA 2BUAA 5FNZA 3Q3EA 1JTEA 1BOFA 1EFKA 1K5PA 1MG0A 1EQAA 2Q6TA 3ANSA 3OCYA 5FBRB 4E32A 4NG4A 5CX1B 2B35A 2ZBPA 4OUDB 5H0IA 3UWDA 1U4NA 2P9FA 2HNBA 2YY7A 2XYHA 3K5HA 1ZW6A 4BFZA 1RXIA 1W93A 5DIZA 4RLQA 2QX8A 3UHOA 4FOLA 2R8RA 3O74A 2P9CA 4X3CA 4FI3F 4B3BA 4KO3S 1R5BA 1NUPA 5BR7A 3PC2A 2YV1A 3KEFA 3QTBA 5IMBA 2CXUA 1X1DA 3B89A 5LPNA 5J2UF 3V8QA 2BN4A 2X40A 3AW9A 4O2BA 4PZPA 4O8ZA 2WWYA 1NC3A 5F98A 2PXCA 3T1VA 3FTFA 1FNNA 1YACA 2A9QA 3TQCA 1A72A 3IEPA 2WJZB 4O4IF 3JQ8B 2YCLA 3PC8C 3K0BA 1H9AA 1LF0A 4LHXA 3NC4A 4YYEA 4P81A 3HWSA 2DBQA 2RB4A 1E1RA 1O94C 3I39X 1U3FA 2G4LA 4MGIR 3VKGA 1OKKA 1CUHA 1NX6A 1JB1A 3KVNA 4G26A 2G9NA 4ZU1X 1CIJA 1MV5A 2FRVA 1S7CA 3H5LA 4OLFA 5ECGC 2F1OA 4CV2A 4XIJA 5GONA 3TTTA 2R4TA 4DCOA 4HB0A 1ODSA 1RP1A 1HE5A 2XV1A 3BGVA 3DDCA 1J39A 3BZUA 3IXMA 3TDKA 5I7WA 4O02B 2P62A 4FILA 2MU1A 2VDRB 1NI3A 2P5TB 3EHDA 4F2GA 5JNSA 2AZTA 4Z4EA 3GNLA 3K8QA 3EZXA 4PSVA 1PQYA 1XU9A 5TQJA 3X0DA 1CS4C 1LKZA 2HIMA 4EA6A 1D2EA 2FW6A 4DA9A 5JY6A 3P9ZA 4BNJA 3AEUB 5EHZA 3CMMA 1MPTA 1PQPA 4Q3LA 5L53A 1XMJA 2AA3A 2C78A 4FOSA 4EF6A 4YIKA 1XE3A 5A6SB 4HD8A 4PLTA 2CLOB 4G1EB 2HHHB 5FADA 5T67A 2GF2A 4O1HA 1DC5A 5CDUA 2ZR0A 3OC6A 3PSAA 4BATA 2ZXUA 5TJ9A 3CWQA 2C4UA 3N2KA 5JCOC 3WDSA 4FWIB 4GXNA 4PF1A 1BG6A 5ARBA 1U6JA 3PNYA 2AW3A 3CLRC 1ZM9A 1EDEA 1SU6A 4PCLA 4G5GA 4LTNA 5HDBB 4DBZA 2ID8A 2W8BB 4M87A 3FVQA 2Q29A 3HO1A 2ID4A 4HMPA 4LXQA 4NOMA 3S2EA 3TGPA 3DZJA 3AIOA 2HJGA 1HE1C 4QO7A 3GUHA 4RE5A 3TLJA 2RH9B 4TKVA 1FP4A 2J7PA 1WVMA 3E4DA 4RTSA 1T3TA 2MYNA 2QUJA 3L93A 3ROGA 4P2BA 1O08A 1JQKA 3LQFA 4ZAFA 1C80A 1C0LA 5KB3A 3Q8XB 2QT9A 1P5FA 2WJGA 4W9NC 4FC6A 2C7GA 3FIJA 5CYFA 2Z9DA 4QKQA 1AKWA 2X6RA 2VATA 4EFLA 2HDNB 2X0NA 1I2ZA 2JA2A 3KPYA 4LAFA 3SEFA 3FRJA 5KREA 1B7GO 1M6YA 1VCNA 1Z2DA 2UZ0A 3EXEA 2E5WA 3VHXA 1GPWB 1XKTA 4AJNA 4D99A 5IJ9A 1L4GA 2AI3A 4MEJA 5FF9A 3AKCA 3CNEA 3LUFA 2V97A 5GQSA 2XX3A 1JJIA 3MT9A 4JQOA 5DM4A 2PUWA 1VKZA 3UXMA 4MI3A 4G84A 2V6GA 4QASA 2G88A 4Y9UA 3ZGZA 3L2OB 3MCAA 2HBQA 4CV0A 2D1SA 4IFEA 3RRMA 3EXFA 4MWOA 4OCZA 3G5UA 3BYZA 1V3QE 3DQZA 4G4GA 5DGTA 1PNRA 3HNRA 1O03A 3I2JA 3OM1A 2Z95A 3GLFB 1RRKA 1ODJA 1XT6A 1NW4A 2QJWA 4Q4HB 5JZMA 3DLAA 1EJ2A 3GRFA 1W6UA 4MV4A 1E1CB 2O5RA 3T3NA 1DQRA 5EZYF 1OTXA 1R0YA 2ODPA 3L1VA 4R8SA 2P6MA 4X90A 2GJ4A 2QSYA 4BEBA 4E5MA 1ZR4A 1ID8A 5EMHA 5JJBA 4ZEMA 1M34B 3KV3O 1UBCA 4MEBA 3T3PB 1Z5GA 1OFHA 1HNXB 1ECCA 2QVCA 4K9LA 1U8UA 5IASA 1GN8A 5JUWA 5LP6F 3H5TA 3BN3A 5DNVA 2NOAA 1KI8A 4R9VA 1KQPA 4IZIA 5LQUA 2PGIA 5FKJA 4DV0B 1QPGA 3BTOA 4PS1A 3L02A 3QQPA 3G5MA 2VZ8A 4Y0AA 1ZJ4A 1JILA 3GH1A 2E37A 1LPBB 2PM8A 3O4GA 4XIYA 1I7SB 1XA3A 1AQIA 4ZQIA 1YRAA 1V4NA 1R6AA 1KAGA 2X7HA 1QF7A 1SUDA 2MDTA 2VPTA 2VRCD 4QXAA 4CG3A 2X58A 4GFDA 4RSGA 2AEFA 2R1ZA 3RR2A 3UJ7A 1KBQA 3GEIA 2AF3C 3MCWA 1G7CA 5TEWA 4N7RA 4DXAA 2XCSB 5LCXA 1C0KA 3A9UA 1U11A 4IDNA 3SS7X 1D7AA 1W4LA 2ZAGA 1Y8CA 1QRSA 3F46A 3HO6A 2QRKA 5MN6A 3TS1A 1JSRA 3H5RA 2G0TA 4Z7JA 4CM9D 3U44A 3MD9A 2A59A 3OJWA 1ZONA 6YASA 1SG9A 2D4AA 2XYQA 4TWBA 1IM5A 3AGQA 1LDEA 4LE0A 2P40A 4ZI7B 1LS1A 2NWQA 1Y3HA 2VCEA 4PTZA 1T13A 4LJRA 1YMVA 1E6UA 1GDDA 1I6KA 3ZXYA 2OILA 2F1JA 4ZO4A 1ZDMA 3O7WA 3SIXA 4EB8A 1NNEA 1WPQA 2QG9A 2J87A 1ILEA 2HC9A 4Q9LA 5KAPA 4ZKDA 1M5UA 5CJ2A 1PRYA 3W7VA 1FJXA 4AWXA 4P7GA 2JAUA 1JDJA 4IQ8A 1VTKA 2CVPA 1KS9A 1MAAA 1RC0A 2GEUA 2O3JA 3IOYA 4OH1A 3ZDZB 3MS4A 1L5YA 4FQ8A 4MIEA 1V37A 3UA3A 3AETA 5IF9A 2HF7A 2PFKA 3ZQJA 3ZI0A 1A5SB 3IQGX 3CVUA 1MJHA 3R6WA 3BA1A 2XCTB 3KE8A 3S2ZA 3VNQA 4GW3A 4CBVA 3FMIA 2Z6QA 2A78A 2ZUCA 4UE6A 4A8PA 4S24A 3QJGA 3RRXA 4C7BA 3VC1A 2AUNA 1KFEB 3CH5A 3BZWA 5EIBD 1XL0A 1RAEA 1QH8A 4H0CA 4IIUA 2CHFA 2ONYA 2V1UA 5AW6A 1G1MA 2ZYGA 4JYPA 1J23A 1JBKA 3C7DB 2NUTB 4CCWA 3NORA 3PP8A 3T7TA 1JXAA 2HU7A 2ENWA 2WF8A 2FMHA 3AEQA 1QNFA 3QPAA 2HO4A 2ZROA 2JCBA 2PO7A 2C97A 3CN9A 2P69A 3WOHA 4JLOA 3WK6A 3RHTA 1DIBA 4FMPA 4ER7A 2OMKA 2GEBA 3ADPA 3G8DA 3A1CA 2C3YA 2F43A 4G1CA 4RHEA 4AJLA 4MKXA 4YP9A 5ICMA 4OFXA 3ROZA 2RH8A 3RBVA 3DE5X 2XHZA 2IHYA 3FDXA 1NG9A 1E20A 4DPMA 4OXXA 1UJ5A 4ZCSA 5FNVF 3USZA 1ZM2A 4L4XA 1KJ8A 2D8MA 3EXG1 4ND7A 5BQ3A 5DN6D 4UQLA 4HLQB 4PXYA 4ZAZA 2VHEA 4LA4A 3W7AA 5A62A 1MRZA 4LMPA 2X1LA 1V25A 3SR3A 1PFUA 1QPBA 1X7YA 4LSGA 4OUDA 4FJ0A 4J3JA 3UCEA 1N34B 2HUPA 6AT1A 1DRWA 3HEAA 3E1KA 2EP5A 3Q3GE 4URYR 2W6PA 1B76A 2C5GA 3OIUA 5DWVA 4K6FA 4MVXA 1TMOA 3PLRA 1VA4A 4CF7A 3ZJUA 3PD1A 5AVKA 1P1RA 4IRXA 4DNXA 5CK5A 1N5JA 1CBUA 3HKEA 4F5DA 4RV4A 1EDZA 2CVFA 5C7YA 4WK6A 4BDTA 4B5LA 3PNMA 1YBMA 2XPCA 4BO3A 1V8FA 2YXEA 5AICA 3IP6A 2J3HA 4KN5A 5EMNA 2REOA 2AK2A 2FW8A 3JQ8A 1M8KA 2Y6VA 1NGSA 5LQMA 4XLTA 3Q3HA 1BKSB 1G2IA 4E5KA 1W9MA 1F14A 1YRWA 1ULZA 1BZYA 1QKJA 1E59A 3ICVA 4AFNA 1NIJA 1NULA 1YS6A 4KI0A 3VDRA 3BWCA 4YONB 2AIRA 1HGXA 2ETVA 2GN1A 2QP3A 5CT6A 4WFKA 1I14A 4L8GA 3W8NA 4PN7A 3DMTA 1UM8A 4E5VA 4FB5A 3DKVA 3RLFA 1N6OA 4IJ5A 1EJ6A 4XVCA 1U5AA 3IAFA 4EF4A 1HDGO 5FOVA 5B4UA 5BURA 1L4UA 2B4KA 2KS6A 1IY1A 2R9VA 3VMMA 2J3EA 1W88B 1JKMA 3RVOA 3QELA 4C30A 3GAAA 2CSUA 1GKIA 4TX1A 4GL2A 5J5AA 7REQA 1NBMA 2W2XA 3GR6A 3H2HA 1J2UA 4MKIA 5E6SA 3SE7A 1ADFA 5A6SA 4NECA 4YYZA 1YBAA 4KQ9A 4AN4A 5IHXA 5A0VA 2Y76A 3ADBA 1UXGA 2FPXA 3MD0A 2JPDA 2H2WA 3VO9A 5H4GA 4FNOA 2VHZA 5EXXA 2IYPA 4P22A 1MIHA 2B98A 2JC3A 2N3ZA 1VI5A 4RW0A 4WA8A 3KPUA 2P9HA 2TMDA 2D13A 4HDSB 4TYPA 4B8WA 2W8BA 4KN6A 1TQ2A 3WZ2A 4E12A 3GFOA 5JC8A 3WGIA 2B7CA 4NICA 2YRFA 2E4AA 4O8CA 3EIWA 5F7ZA 3GMDA 3AF5A 1OBHA 3FRIA 3O0DA 3ZGYA 5U1PA 2ZIGA 3KKKA 1R0ZA 2OB1A 1AS3A 4G23A 2CXXA 4G0XA 3D5EA 1AQ6A 4HDNB 4M2LA 1J97A 4C6SA 1EFRA 1KHTA 1TZCA 1GT6A 5EIAA 5DHAA 3DTVB 4JP2A 1YU6A 4CKYA 2FR1A 2P67A 4KFRA 3IAS1 4JI0B 2R1UA 2DH6A 3GCDA 3IMCA 3Q6IA 2YDYA 4NE9A 1SXJC 1VXOA 1Y9DA 4OGKA 4UU0A 1F0KA 4Q3OA 4DNQA 1XLTA 3MRTA 2BFWA 4KAJA 5JE8A 3OF2A 4E21A 1CX9B 1IJFA 2C95A 2PZJA 2A0UA 3FFAA 1H5NA 3HVUA 4DV5B 3KSUA 2GASA 5CW1A 4E70A 1F6WA 1SD1A 1YIAA 3MQ2A 1QQ5A 5IJXA 4L0CA 2VFAA 1CDOA 3Q12A 4OJTA 1C7RA 1VPVA 3RIXA 1X7WB 3MWLA 1CRZA 2ADFA 4OREX 4UHEA 4A36A 2ATCA 3H1PA 3HP4A 4PQGA 2FZGA 1KJYA 1A9YA 4G25A 4ZT4A 2BFOA 2C1EA 3RK4A 5EA2A 4BN5A 1RZRA 3IAXA 4MWTA 5BUCA 3VPXA 1VPTA 4LZAA 3VX4A<