3ZR4B

Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
b'MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
publication title Catalysis Uncoupling in a Glutamine Amidotransferase Bienzyme by Unblocking the Glutaminase Active Site.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 59
structure length 200
sequence length 200
chains with identical sequence D, F
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zr4B00
1OX6A 1BXRB 4L7QA 4ENVA 4MGHA 2V4UA 1J42A 1L9XA 1PDVA 4L8YA 2VDJA 3ZJ5A 4OFWA 3NVAA 1C30B 1KXJA 3VU3A 3NOVA 3B36A 3PQ4A 2XF2A 2ZUUA 5E9AA 2ZUTA 3R76A 4E08A 3NORA 1VHQA 4P35A 1IZZA 2ZUVA 3ER6A 4Y1EA 1GGJA 1I7SB 2RK3A 4ZGGA 3OT1B 4N0MA 4UOQA 4Y1GA 2NV2B 4ADSG 4UCFA 5SY9A 1GPMA 3MIIA 3TTYA 4D1YA 2GK3A 5JZOA 4I2NA 1JVNA 3CZ9A 2ABWA 3CY6A 4LRUA 1OX4A 4L8FA 3KKLA 4B7AA 2D7JA 3EFEA 3EJ6A 1P80A 1QDLB 4P2GA 3L4EA 1T0BA 2R1TB 4QYXA 1T3TA 4B31A 1P5FA 1P7ZA 3PQ8A 3CNEA 1GGFA 2OR3A 4RKWA 4LGYA 1PDWA 1QVWA 1KEEB 2VXOA 3GRAA 4GE3A 4OGGA 1OI4A 3ZJ4A 3OT1A 2ZUWA 1VCOA 1PE0A 4AJ9A 3WFZA 5BV2P 2VRNA 4E5VA 1GGHA 4I4NA 3R74A 2VPIA 2NV0A 4UZSA 1Q2UA 1OY1A 2R1VB 4S0ZA 1FY2A 2W7TA 4GUDA 1GGKA 5SY6A 3NOQA 3SF8B 4AULA 2YWBA 3BHNA 1QVZA 3L18A 3L3BA 4MTCA 5SYAA 4BIMA 5SY4A 5DFAA 4BTEA 1PV2A 2H2WA 2R1TA 3UGJA 5LIRA 1CE8B 4WXYB 1U9CA 3F71A 2AB0A 1WL8A 3PQ2A 4HCJA 1M6VB 4ZDJA 4ENSA 1CF9A 1IZYA 1O1YA 1VCNA 2VKTA 4L95C 2LXNA 1IPHA 3ZR4B 4P34A 4ENRA 1JDBC 4OJYA 4L78A 1N57A 3PQ5A 4UNIA 4Y1RB 1I7QB 4N12A 3UJNA 3F5DA 1OX5A 4AUNA 3D54D 4ENUA 1S1MA 4R7GA 2IUFA 1QWSA 3EZGA 3PQ3A 4I46A 1P7YA 4ENWA 1K9VF 1KA9H 3CZAA 4AUEA 3P9PA 3M3PA 1CS0B 1VCMA 4B40A 1SOAA 3TTUA 3P9QA 1QVVA 4OGFA 4OIFA 1T36B 3FIJA 3NONA 3TQIA 4ENQA 2WJZB 2YWCA 4QYTA 3UOWA 4Y1RA 4Y1FA 2RK6A 3TTVA 3UMMA 4B5KA 3NOOA 1A9XB 1OX4B 1I1QB 3P9SA 3TTTA 2ISSD 3RHTA 4ENTA 1KWKA 1P81A 4K2HA 4XLLA 3TTSA 3UK7A 2R1UA 2YWJA 4ENPA 3MGKA 1GGEA 4AUMA 4Y0NA 3BWEA 1FYEA 1Q7RA 3P9RA 1GPWB 3EN0A 3TTWA 3B38A 4GE0A 2R1VA 4BFLA 3EWNA 3SF8A 1SY7A 3PQ6A 4L8WB 5IP5A 1G2IA 2RK4A 3CYFA 4P5PA 4JQSA 4RKYA 3TTXA 1QF7A 4UOZA 3FSEA 4OQ4A 1C3OB 4MNTA 4PXYA 4P36A 1R9GA 2YWDA 4WINA 4ZDIA 3L7NA 4ZDKA 3R75A 5JZMA 1ONSA 4B2YA 3N7TA 2AD5A 2GHRA 5K4AA 1GG9A 1KWGA 1UCFA 2FEXA 2ZUSA 3SOZA 3B3AA 2A9VA 3PQ7A
chains in the Genus database with same CATH superfamily
5TQ2A 3MQFA 3U3MA 3DAHA 4JA2A 1G2OA 3ECAA 4EVRA 1ZVQA 2BYTA 4GL2A 1ZCZA 3KJFA 1IUPA 4GI5A 2OAQ1 4DR6B 1A9RA 1AO3A 1NZDA 3MRSA 1Z0JA 3R3VA 3ZUPA 2XA2A 1C7JA 4FE4A 1YZQA 1DU4A 3K05A 4DOMA 3UAOA 2J7PD 2W22A 1XRNA 3FDXA 1FTWA 2MYNA 2FLWA 4LYHA 3Q40A 1NVVR 4YBZA 2GBGA 4PSCA 4NJMA 2C8VA 3G8BA 1N4AA 1GPDG 1I7LA 4XI9A 1CY8A 1XNGA 2IBSA 1LI5A 2TMDA 4DPMA 4WGGA 3PQFA 5BWBA 3FTFA 5A5DA 3KZMA 3RVSA 1C8VB 4C0BA 3WB0A 4V0NA 5JSZB 2RGYA 1HYEA 5CFOA 4YI3A 1XLTC 3I1FA 1K5DA 3HO1A 4MWOA 4CBVA 2ZR0A 4PVCA 2BUAA 2OV8A 3CKLA 2ZJOA 3IQWA 3OAAD 1RQPA 2WQ7A 2OKGA 2Q28A 1L8OA 4WRRA 2HXYA 4I1RA 4X84A 3BHMA 3IXMA 1UFOA 1TF2A 1XRPA 2W7TA 1T8WA 4QELA 4WFKA 1COWA 4JBIA 5ADUS 3DEYX 2UUCB 4O6VA 3VTAA 3KRTA 3ZD7A 2BR5A 3UK1A 4BO5A 2WDZA 4LDJA 4CHTA 1X42A 2C82A 5EIBC 1CE8B 1MFZA 1N0WA 2PBFA 1XZMA 3IQIX 4EJ2A 4YP7A 1MW8X 1SA0A 2QD2A 1I3KA 3C6BA 2ZYIA 3THXB 2Z95A 3LYUA 4JJ7A 1W34A 3QKRA 5FA5A 3VR5H 2FHPA 4M9QA 3HCFA 4OH1A 3VGPA 1S02A 4XB6B 1RBQA 3IE0A 4KYVA 3GEEA 3SY8A 1QZXA 3T3OA 1CP2A 3HG7A 3D54D 2IYWA 1ULTA 3I6QA 4L8VA 4ESHA 4MCIA 1ADGA 2JGJA 4ZYWA 1A5SB 3BF7A 4H4DA 4Y6SA 3FDZB 1UPBA 1YDWA 3GGCA 3AI7A 4G65A 3GZNB 2DOKA 1KPIA 2O5CA 1NQOA 4EPYA 1DBPA 4CIYA 2BR4A 4Y6LA 1J2JA 1QVVA 1HDYA 3GLGB 2FV8A 2M9MA 3A4VA 3ACCA 3SDBA 4OXNA 1YQQA 5JVDA 5L3RA 5AVTA 2PMBA 3EUWA 1J9GA 3HK2A 1U7DA 4DS3A 4HUTA 2BEUB 5H68A 4ZV4A 1FP7A 1Z37A 4JYCA 2WPNA 3LG2A 3GL9A 3A06A 4C01A 1OLSA 3VU0A 3TR6A 1PJZA 3UAZA 1U0EA 1GOTA 3P9RA 3FB1A 4US1R 4G8JA 1IWPB 2DUMA 3HJNA 1QIEA 2GJ8A 4ZPJA 2MMCA 2J4DA 4IFBA 4C2TA 2H0AA 4MUMA 1EGVB 1WLSA 2OECA 4OHRA 4ZI2A 3KKZA 3PL5A 5C1IA 2FH5B 1XK7A 4HC4A 2NACA 2Z2JA 3FCAA 1ZLYA 3IYLW 2C2XA 3MERA 1SKYE 3C70A 3C98A 5CVCA 3W5CA 2RE8A 3MWJA 2I22A 1H1DA 1OLXB 4PTZA 4MKGA 4WFJA 3PX3A 4JJEA 2NZJA 4OYHA 5J4LA 4DV3B 5L3ZA 1V9SA 3MCUA 2PUVA 4TVSA 1DRWA 5GZ1A 1CLUA 3ZX5A 1CR6A 2OHJA 1WDLA 1SZPA 4RPHA 3KQTA 3VDRA 1TFUA 2Y1WA 3F96A 3CF4G 5BSMA 2DSTA 1W49A 2WWYA 4OHBA 3WISA 1U7PA 3TBFA 4AUKA 5I45A 1SBZA 1HQDA 2V7WA 3W6OA 5JNUA 1TVMA 5KWSA 2YZMA 1E1MA 2LVBA 2R3SA 3AM3A 3H65A 3JQAB 4R5HA 1Z6TA 1NFFA 1TW3A 4B7ZA 1V1JA 4BLPA 1FB5A 4AY6A 2NVOA 3KJXA 1EYZA 1Q3HA 3T95A 1RQXA 1ST2A 4DLWA 2V7GA 1KZ4A 3WO1A 1AUVA 2BBTA 3NTUA 4M1YA 4CCAA 4BPBA 3B2QA 3K6SA 4O3MA 4F3TA 2QLNA 3T1YB 3WDKA 2GASA 3HE3A 2XMPA 4WUTA 4DQDA 1TTTA 3DL0A 2AOTB 4V02A 1YFLA 3TZQA 1T2VA 1GTSA 1MJHA 5E38A 2XVAA 4EG8A 5BNFA 2RAVA 5JSUA 3WK8A 4RNCA 1T1IA 2W6CX 1QVWA 1U3FA 3ZYCA 5M5BA 5B1DA 2G88A 1L3BA 2PKQO 1WDKA 1PE0A 4KE7A 3SLGA 2VRNA 4QFBA 4BJHB 3CMMA 4YMSA 5JBQA 3DA8A 3GQBA 4YYZA 1AN9A 3X2SA 3DR3A 1DZ3A 1E3WA 1PR6A 2QVXX 4JYZA 4G9EA 2IXEA 1KE1A 5K8TA 1MOQA 1IN1A 3DSRA 2PQ2A 2F9MA 2Q07A 2RI6A 3CX7A 5EQDA 4BN0A 4F3RA 4ZI7F 5JWRA 2PGXA 4HCJA 4JYBA 3GNLA 5JOQA 5KYWB 3NVMB 3BGIA 3V80A 2EJBA 5CA1F 5GV8A 1YFKA 2VTKA 3B12A 2QV7A 4U39A 2QJFA 1OZGA 4N5NA 4WCFC 1QYVA 3MPUA 3VZCA 3NHUA 5FEUA 3OTWA 2JA1A 2CN1A 2UUPA 1JDVA 1S8FA 1ZNZA 5H02A 3FVQA 3TAUA 2FSHA 3EFBA 2OUKA 2DXIA 1OU4A 4IXWA 3M9WA 2P9QA 1CS0B 1CUIA 4OUDB 5CIYA 2PPVA 1UPFA 2J7PA 1ZWLA 4J0KA 4GW3A 3VVLA 4EJ6A 4ZI7B 2AFHB 3WWYA 1YKFA 1X7WB 3Q7EA 3W2FA 4IGFA 5HBRA 2QGFA 1FUYB 1UJBA 4QPPA 5K3FB 3CX6A 4DLXA 2G9ZA 2NSDA 3C39A 4OHOA 4CF7A 3BGOS 4Z86A 2NU7A 4MW6A 4Z0TA 4N4AA 2PSEA 2I3DA 2C84A 3B8HA 1JEOA 4F93B 3ZI7A 2RGCA 4E70A 1NW4A 3N6VA 4MR7B 2J3QA 4BO7A 3DLCA 3NKLA 4EUEA 5C51B 2QRKA 1GPWB 2Y8EA 3AI3A 2ZT6A 4L72A 3ZIDA 5ES4B 1JEEA 3K9WA 3PNBA 4PYOA 1PD1A 1TU3A 3AVUA 4QQKA 1WUTA 1E3MA 3TOVA 3E7XA 4PZDA 5J5VA 2OFPA 4OK6A 5AO9A 5CDFE 3CCCA 4E07A 3PFFA 1OWOA 2JG3A 1Z18A 3RASA 1HDXA 4LI0A 2O2HA 1UXOA 5CEFA 1P5HA 4AC9A 4GQAA 5AW3A 5EP4A 3TX2A 2C2HA 3FIUA 1VYTA 2A5DA 5HXAA 3KG2A 1B93A 2XH8A 4ZGWA 1D2GA 2ZTUA 3FN4A 1R0BA 3KVNA 3U4QA 3FPSA 3KJQA 2Z4SA 1VHJA 4Y2GA 3IIKA 1HDCA 3GDGA 3B2EA 4P38A 4DDVA 4E32A 4WOCA 1YDMA 3RBZA 1SG0A 4MDEA 3WAKA 4Z7OB 3Q3JB 5HKAA 1RADA 4QFDA 1EZ4A 4UNSA 3B36A 4OHZA 3VOTA 3COJA 1DWOA 2GAIA 2ZRIA 3V4ZA 3M1YA 3NDBB 1QANA 1XQXA 3CZ4A 3UMGA 2P6RA 4GPZA 3CUSA 1MC1A 1U2QA 4DLBA 5AM1A 3WIVA 2GGSA 4KL8S 2R9VA 2E4VA 4LRUA 1AZSC 3A04A 3T5CA 1PJ8A 2IGTA 5FO0A 2Y76A 2Q1WA 3DC7A 1QPGA 3MM4A 3QU4A 3T61A 2AX4A 2R97A 4IEFB 4BE9A 5ELXA 1JBKA 2V0CA 1H93A 1KIFA 3E22A 3GUZA 5KQPA 3AL0C 5K0ZA 1B8OA 1K5PA 1INLA 1KR2A 1LFDB 3NHPA 4DIKA 2C4TA 2BGTA 1RZVA 4AMBA 5ILOA 2C92A 3G17A 1UPXA 5KX5A 4C6RA 4NX2A 3A28A 4P08A 1IPFA 2Q5JA 3DDWA 4DSOA 1F7UA 1BE6A 2PZEA 3FLBA 1QGDA 3D4BA 2CB9A 5IH3A 5FIUA 1SULA 4NYIR 1Q7CA 1IN5A 5EUCA 3K2QA 3ZS8A 4AMVA 4WCFB 3MMSA 2ZR9A 1MQ9A 1H6AA 1OKKD 3QMWA 4G8BA 4WEOA 4QECA 3CU5A 4GKVA 3C8DA 1YJQA 4WOKA 1U5BA 2D59A 2G82A 1H2XA 1V26A 2P2NA 3CBQA 2ZOSA 3N9IA 3NRJA 4FJ0A 3DW3X 5HR5A 4H59A 5FYQA 2WM9B 5KSOA 1NUSA 3EH2A 1OH5A 4BQFA 4QOGA 2Z43A 1PGJA 4UNIA 4Y1RB 4AJIA 1QVAA 2V6BA 2OBMA 1K6MA 3PDCA 2HPAA 4ER0A 1P4HA 2WM8A 2HIAA 1WY7A 4HSGA 3QM1A 4OJQA 5EZ6B 1VSBA 1DAKA 1ZCAA 5E7JA 3BKWA 1DARA 4FCWA 3KZKA 3GNTA 5AQ1A 3MWEA 4YQZA 1E60A 3MUNA 2OD2A 2WF9A 1NUAA 2BZ0A 1FUKA 1ZGHA 1BDHA 1U8CB 2JGRA 1F14A 1JQLB 2WF7A 1Z62A 5FXMA 4R2KA 1OLOA 2IGBA 4D26A 2WLTA 3CF2A 3K0FA 3QYPA 1I51A 1RRMA 4AS3A 5CLQA 1NN5A 4OHUA 2GNOA 2OBLA 4WNAB 3ZZ0A 1E96A 1EP9A 4DLPA 3AVXA 3HB5X 3TE6A 2JC3A 2PZAA 5COQA 3RU9A 5BV7A 3GT4A 6NULA 4TMFA 4NYMR 3QTBA 5TVGA 4DV1B 3AVPA 1ACJA 5KWJA 3N2GA 3RC1A 5KCMA 5DW3A 2PKCA 3NKVA 4FIZA 3GP5A 3HNOA 3EXIA 5EJ2A 4RADA 2DT5A 5TMDA 4NU0A 2PGDA 2HV8A 3M49A 4JVOA 5B5SA 2EHDA 3K73O 5FR1A 1YT5A 2AW3A 3BJEA 3FSEA 3WB9A 2SHKA 1GP2A 1XZHA 3ANYB 3VDXA 2WSLA 4UUPA 4ERNA 4WV3A 3SS7X 3PNMA 4F1JA 3ZEAA 5HRCA 4KV7A 4EL0A 1B14A 2H6EA 3PPYA 4RMHA 2YCBA 4FKBA 1XEWY 3HP4A 5LBTA 1YFJA 4OHMA 2WJJA 2J8ZA 4S1VA 5AHOA 5KYTA 1JWLA 3F5FA 3ZU5A 4PFKA 1GA4A 3ZC3A 5E1OA 1R18A 3PXDA 2BFBB 1KQPA 2V54A 2XE8A 2GYWA 2UYGA 2ZRNA 2QE6A 2GJAA 3GCDA 3LVRE 4IGEA 3GARA 3MAGA 3OEWA 2NUPA 4L3WA 3NJ4A 1EWYA 1VHQA 4G37A 1PGNA 3LO8A 4UASA 3U7JA 4AM8A 5DTJA 2FRXA 3GLIB 2C5SA 1CSEE 2VLBA 3DV9A 4MA5A 4PF1A 4QHSA 3ZHBA 1K97A 3HU1A 3LXUX 3N6RA 1DMRA 3HCDA 4NU6A 1SVKA 2FAXA 3ESQA 4HDSA 1DCKA 2H4JA 4AP9A 1EINA 2OC9A 3FDJA 3N0XA 1NI3A 5ALTA 4YIHA 3OA0A 1ZMBA 4D5GA 3IO3A 1N0HA 3BJIC 4DV4B 1SHLA 1FYWA 3DLAA 4IP0A 1NP6A 5DXAA 2BJWA 5DYNA 2R87A 3VZDA 1VPVA 2H29A 3E9ZA 3PD0A 4F71A 1F2TB 2I8AA 3E5HA 1A95A 2SKCA 4RIIA 3OLWA 1II8B 1C9KA 3D8RA 3IDFA 1X7ZB 4UTXA 4DAEA 2Z9DA 1B00A 4I08A 3NH6A 1P9NA 2PKWA 2XECA 1G20A 3I4CA 3JYPA 1EJBA 4I9UA 5DYIA 5SYAA 3S8MA 4C43A 4HVCA 5DFAA 2GJKA 4DPLA 4BX3A 3HLKA 5DCWA 2YYZA 1VG8A 2ZB7A 4PV7A 5BY2A 4DSTA 1U1FA 5A4MS 1NTRA 4AW9A 1WTCA 2PN1A 2B7LA 3DE3X 3Q1LA 1UR5A 4L5JA 1I4DD 2W2KB 4G5QA 5A71A 4F6RA 1KEZA 1JDBC 5AT1A 4MYRA 1BVYF 4A8JA 2JD2A 5SZHB 1QHSA 1X19A 2FW0A 2VT2A 4M0CA 2E5FA 4DMUB 2A5LA 1R50A 4MW2A 3WGQA 5BWCA 1Y4UA 4LYJA 3P9CA 1RFLA 1WOYA 4KYIB 4RL6A 3LLVA 4ZV9A 1FQWA 2RH5A 4MV3A 2BFAA 1PYDA 2CV2A 1VM6A 3DHVA 4Q18A 3Q3EA 4F11A 1E0JA 3SBXA 1T6BY 1D1QA 4AN0A 2ZDGA 4M38A 1XU9A 2NPFA 2QTCA 5IAGA 1XZNA 1EJ0A 4IRXA 4JBNA 1UZNA 5L53A 5L40A 1CB7A 1Z36A 4IPTA 1JXMA 4GR4A 4FOSA 5FWAA 1LGYA 3Q88A 3RDPA 4B79A 3ZVKA 1XD8A 1R6AA 3ENVA 4Z3KA 4PQYA 2WWTA 1MAHA 2CVQA 1UQUA 2IPAB 5MF6A 4WKCA 3ZHUA 3RF7A 2FDXA 5AVZA 1SUFA 2CSXA 4NKRA 1JZTA 1ZMTA 1R6UA 2GDJA 1RIFA 2INGX 3FUWA 3PHHA 4C05A 3J81k 2ORWA 4RQTA 4PAMA 1E6KA 1PJBA 3CRQA 3KK0A 1QGAA 3C6KA 1S8AA 3PS9A 4AICA 4GX2A 4GMDA 4DF3A 4A7PA 5IC5A 3JQFA 3U1VA 5LMNB 2AG0A 1QR6A 1F8FA 4PC3A 3DT8A 1L5LA 5JFOA 3KQLA 1JQ3A 4B2YA 2RCNA 4URXR 2ZSAA 4RVUA 3VPBA 3LIIA 4NQZA 1OFTA 1PF7E 1OKKA 1OOEA 2X1MA 4QEKA 3U44A 2YHBA 1VQ1A 4A16A 1CDZA 1L4FA 2JZCA 3ISVA 2Q5EA 4FILA 4MQ5A 4RIHA 1A76A 4WESB 4RD3A 4Z0HO 5ALVA 1NJ2A 4NZYA 1B2RA 4QICA 4PGMA 3WIEA 3NYIA 2D5AA 3AEKA 4YO8A 2ONCA 2W2VA 3R76A 1Y4AE 3I9NA 4MWBA 4LJ9A 3CH5A 4X61A 3I45A 4A26A 2OBXA 1A5ZA 4DILA 4YRMA 3M6VA 1PJTA 1NUPA 1KVTA 2ZRHA 4JU9A 2OPHA 4EATA 1KL7A 3TBKA 1S5PA 3A26A 3IV7A 1UBUS 5LZ9A 4ZGBA 4ZEVA 1GU7A 1N3LA 1UIRA 2VJLA 3TXXA 4IFTA 3GJTA 3F1KA 3RT1A 4D9MA 1Z7GA 2Q8PA 4EJMA 1QRUA 2DQZA 2F1JA 4WKGA 4GGOA 3OZIA 3PGVA 2WT9A 4ZT5A 5DYGA 3KUKA 2EWMA 4PYQA 4U8HA 1P4JA 2ATEA 2YFHA 2Z2YA 3GRPA 4Y7DA 2BCJQ 4AN1A 4EH1A 1KJZA 1M74A 1VDMA 4BLWA 2NV0A 4V3CA 5CFLA 3G59A 4BNHA 2HF7A 1XTQA 4U3JB 2JCXA 1JILA 2A59A 2GMWA 5I4IA 4WADA 3CLUC 2AXQA 1MVNA 2D7DA 4S1WA 2AZTA 4MO2A 2ZTVA 4RPGA 3FVTA 4OL0A 2F3PA 2GCGA 2W6JD 2AHRA 3OC6A 4J0JA 3ZCRA 1EFVB 5ARCA 5FTKA 3FH0A 3QKTA 4OB7A 4P93A 2SICE 2C2MA 2FZKA 1N2EA 1EQUA 4O5AA 2HJGA 3JQRA 4C7XA 1Z12A 1CFZA 1CT9A 5MN6A 4BJ6A 5KHAA 1RJFA 1N2CA 4MS3A 4PGAA 1OBOA 2H9YA 1LNZA 2Q21A 2DLDA 3A1VA 2H2FA 2ZRFA 1J1UA 1JEAA 1HT1E 5IDWA 3TLEA 3AY0A 4DMCA 4CIBA 1HI9A 1GQ2A 3LA6A 1SKQA 3WR5A 1PUJA 2F2TA 1BW9B 2Y05A 1VLHA 3RTBA 4YMHA 3B1ZA 4MW7A 3R1IA 2QAGA 1TM2A 4XEHA 4RTMA 1AUQA 2OV6A 4KMOA 2O0KA 1PTJC 1WUYA 4I8XA 4N39A 2J30A 4MLPA 2IZOA 3AL3A 3H4IA 4QGBA 5CT5A 1JIUA 1Z4NA 1BC5A 4A8HA 3DMYA 4G97A 4ALNA 4FB5A 4I1IA 2QSJA 4TTQA 4BP9A 4FLFA 1IVSA 2Q0HA 3EBOA 2PTHA 4TQGA 5AVWA 3Q3CA 4G23A 5HF9A 5JD5A 3QPDA 2NXWA 4XVCA 5U4QA 1LJLA 1GKYA 4MHTA 1XTSA 1QYWA 3IURA 4JKYA 4CG3A 2ZRCA 4P3KA 4RHUA 1KQFA 1LVHA 5F76A 4ESOA 2C4KA 3A1WA 3Q87B 1BXGA 3GZTB 1S2LA 3VO9A 4YDQA 3GG9A 4KSYA 1RJ9A 1GRRA 1PR9A 2EIXA 3B6MA 3FSRA 2YXLA 7ADHA 2RHDA 1T3LA 3W0LB 2GNPA 3X43A 2O19A 3BFKA 2P9GA 5GVRA 1T6ZA 2CXNA 1L5SA 4LKRA 2GD6A 4ZO9A 5HGJA 3M3DA 3HM9A 2GBLA 2AN3A 2E5LB 2BEVA 4LHZA 1XMVA 2XY4A 4K9PA 1NT4A 3K92A 1YACA 4OAQA 3LDUA 4Q4DA 3R0VA 3SCZA 3BM5A 4KXFB 1K7SN 1E9VA 1H05A 5G02A 3PUJA 2OUIA 2MR5A 4BBPA 5AVOA 5IJ0A 2H8KA 1A96A 1J25A 5IF9A 2WRZA 3DMNA 3H5IA 4JZKA 2VBIA 2FPOA 4XGKA 1TQ2A 2BLLA 9LDBA 2J07A 4YRAA 2BUCA 5THXA 1N1DA 4DQLA 1UBTS 1PWEA 5HJ7A 5JQWA 1YC5A 4TKMA 4XAQA 2R1TB 2CLCX 2Z6UA 3WYGA 1EAMA 2UAGA 3MLAA 3RIYA 4D46A 4WSOA 2EJCA 4EVIA 4OK5A 3QI2A 1C1DA 5HFJA 4G4JA 3K1AB 3H2ZA 2B35A 2QB5A 3OOHA 4X63A 3FYUA 5A4IS 2FB9A 4I3FA 2QBYA 1BVHA 2X0FA 4WBNF 1JFFB 3WBJA 3DB1A 1LXCA 2YFYA 4JP2A 1QP4A 3UT6A 2ZRMA 3HS3A 4G1FA 5CPBA 1FLAA 5AVRA 3RBVA 1WXEA 1KH2A 3JQGA 3PZRA 4ZPXA 3V48A 5C1BA 5JD6A 2MYTA 3CNLA 4UHBA 4CLHA 5BMVB 1OJ7A 1IBSA 3HKCA 4DA8A 3OQMA 2B78A 2V7TA 2WE8A 3NBKA 4BRWA 4D7AA 1QOQB 5JSYA 1CY4A 3ML1A 3TW6A 2OE2A 2BFOA 4Z4EA 4ND7A 5CTJA 4XX0A 4NS4A 4YRQA 3RYIA 4TVOA 3WL7A 4LF9B 4HLUA 4D4LA 3T7EA 1EU1A 3K5IA 3KHKA 1DC5A 3E7FA 4M1KA 5B3JA 1N3IA 4I0WB 1ZFNA 1F4VA 3T0GA 2HK7A 1F38A 2XOKD 3UB2A 1OTHA 4EAAA 1FFCA 2AZ4A 3A1TA 5T6BA 3CFYA 4AUEA 5BWLA 2ZZMA 4M89A 4XPIA 1X1SA 4K6CA 4KB5A 1P60A 4R1LA 1J09A 2JL1A 2XYGA 4B6GA 2JFZA 2HLHA 3IP6A 4Q9DA 4AX4A 2ZE5A 3RVOA 2AYZA 2VCYA 4LXIA 2EJWA 5T64A 4CDMA 3QE3A 2C3PA 4X94A 3VR6D 2B20A 3HJRA 1SQGA 3EJWA 521PA 5BR1A 4IVPA 3AUUA 1O5IA 1XTJA 3IV6A 1ZL0A 3T7TA 3UAYA 1TM3E 2EJVA 2ZR7A 1CUWA 2D00A 4C30A 5JRJA 2OLEA 4ZOLA 3LK6A 2NXJA 3LOPA 5AKKA 3EHEA 2VTVA 2YRXA 3KWFA 5CFNA 5I7EA 5C5CA 1ATZA 5K9ZA 1RWNA 3HEBA 3OFVA 3LQQA 5IXSA 2V98A 3CSUA 1SEPA 4N41A 3RG8A 1E0DA 4NMXB 4TUYB 2PQ0A 5JAQA 4R16A 3ZCSA 4YRIA 3I9V6 5KTKA 4EHKA 1UK6A 1MFPA 1RFGE 2D0DA 2OVBA 3FGPA 2LRHA 4G0OA 4MIOA 1AXGA 1OV4A 5DSXA 5DNAA 5G1OA 4DNQA 5ARBA 3B9PA 3I6ZA 1DRVA 1FU8A 1YKGA 2N1BA 1LX6A 3SEFA 3UCXA 2ODTX 1U0RA 3JU3A 4WA7A 5D7NA 4F60A 4F8EA 1L5FA 2BUBA 3RYFB 1V16A 2AC2A 2B1JA 2JFUA 4FLMA 5JCZA 2W6JA 3PIDA 4NENA 4C4TA 2QE7D 2JKVA 3G2KA 4IUCS 1SUIA 4G5XA 1GPNA 2QNIA 2R5WA 2X77A 2KJQA 3WJAA 1GYPA 1XD2B 4M88A 3VPDA 3ZK8A 5B4TA 1UM9A 5KYYB 1DUVG 2IPMA 3AJDA 1K75A 3AEUB 3U7HB 3A1CA 1SXGA 2WWHA 3AEQB 2VJMB 3RU2A 5HHTA 3UGTA 1BMFD 3ME5A 1Y6RA 1L4GA 3M4JA 4DXDA 1PLJA 2A9OA 4HEJA 3GFPA 1TQDA 3LVFO 4ETWA 3H3XA 4LYAA 4ZVKA 3VYUB 2A0FA 1JIKA 1K6JA 1UXHA 4KQKA 4RANA 3BXOA 1T43A 1C7IA 2JFFA 3BCUA 3TLKA 4O4LF 1R64A 2QRVB 4MWSA 2E6UX 3MGCA 4OO3A 5ALPA 4QYXA 1FBTA 1JFSA 3QFRA 2GSDA 1O8CA 4N7RA 2H8GA 4GX5A 1HRDA 5GAJA 1R9MA 1Z0FA 2JI7A 5E6RB 3STUA 1D8AA 5F3WB 5K01A 2V55B 2IF0A 1NI5A 1O94C 1XK6A 2O20A 4YGYA 4EHLA 4FXPA 4LWQA 5GONF 5JO0A 4D25A 4V0SA 5A7GA 5FJJA 3ZGLA 1GHTA 4GXTA 3SVZA 1SPXA 2FN7A 1P39A 3WGVA 4HJRA 5K8LA 4QBIA 1SIBE 4L5BA 4O4LB 3ESXA 5JAOA 1JYSA 2P0EA 3QMMA 2TYSB 1U7XA 5CVEA 4AJNA 4B2LA 3H19A 2PL9A 3NOXA 4O2BF 2VAXA 2GDZA 4XX1A 1HMYA 1XMXA 2R7MA 2XCUA 3CLRD 3G2PA 3WL5A 3ROXA 1HETA 2EIHA 1XEXB 1N57A 3GA7A 4NV3A 4ZAGA 5ESDA 3LXXA 1ONBA 3LY5A 3I09A 3VH1A 4NESA 4BWGA 2WB2A 4PGFA 4HDMB 4PZ0A 1RRKA 5ESWA 1OA1A 3MCTA 1Z0UA 2IHUA 3JWHA 4ITVA 3ZWOA 4PN3A 3HC7A 1HFKA 2Z2XA 1GQRA 3BF8A 1SAYA 3KL4A 4LMPA 4YPVA 1LSJA 2XYQA 1E4OA 4QGFA 2GKOA 1A4IA 4O2BB 5CA0B 4QC2A 4IHQA 3GAFA 1U7UA 4KPEC 1AH2A 1IXRC 1LI4A 1JG2A 1XMQB 4RK1A 3TQIA 1GRVA 2L2QA 2PZLA 3DYVA 1CTQA 4Y6QA 3K6RA 1YVDA 3C3DA 3D1LA 1RD4A 2ISSD 3ITEA 4N3GA 1M8GA 3HCOA 3NBMA 4FNMA 4B7UA 3LLUA 2VYND 5AH0A 2H48A 3ZBQA 3GVCA 1WUIS 3CTPA 3PSAA 5FBHA 4G4SO 1SBTA 1SU6A 3FMVA 4A0FA 4C03A 4GF5A 4I1PA 1P77A 5JATA 2RK4A 1JDJA 2H59A 4GP6A 4C89A 1LVGA 4F7DA 4FNOA 3ETHA 3OEHD 1J5EB 3A3NA 1NVKA 1XZCA 3O21A 2YIMA 1V39A 2VSOA 5CEEA 3PIIA 4XUCA 4MYDA 1XX6A 1AB5A 5AW7A 1BJTA 3FPFA 2GBPA 3Q3GE 3CLTD 1NE2A 5ALDA 1K66A 4O0LA 4ZQCB 3TNDA 4L9RA 5JDIA 2VIIA 5LKAA 1QS0B 2DB3A 1U0BB 3FHTA 1BN6A 2K4MA 2J5XA 2QM3A 3T0IA 1VIMA 2PX4A 5A9SA 3DTTA 4GVPA 4ZEWA 3L6EA 1X38A 2V45A 2CFCA 3AC0A 3PXBA 5DHPA 4PPGA 3EDOA 3RIMA 2A5YB 3JZFA 4NE7A 4A5SA 4AKEA 2J9YB 2JI8A 2NU8B 5JQGA 3SZ3A 2ZUVA 1NRIA 1FJXA 4OA5A 2XOKA 2VJYA 1TYAE 1F5NA 2O8EB 1XZAA 2WAXA 4JUDX 4NV0A 3TPCA 2R1ZA 3WGZA 1L9KA 4KKVA 2HJVA 5GVSA 1ZHHA 2N1MA 4JVSB 4KITB 5K0EA 5F21A 4RE6A 1REQB 3VR6A 4N18A 4PXSA 5SZIA 3ZWPA 4DM4A 2NYRA 2BH2A 1GFIA 1ZWKA 1NNI1 1EJ6A 2F4VB 2F90A 4K1LA 4WBNA 2YJZA 1PJSA 3BORA 1OZAA 3SJ7A 3AP3A 1Z5WA 3COSA 3EZXA 2BRUC 5I47A 2X9NA 1H0HA 2X2EA 5FF9A 1G8MA 4RV4A 4G24A 5HQTA 2I4NA 2I1QA 4IQ8A 4NG4A 1ZZGA 2P67A 3DQPA 1A71A 4KWHA 1GGKA 2I3BA 4TM8A 4RH3A 2PH1A 4JC4A 3DE0X 1A27A 5JNRA 3L46A 2HX1A 4ZZ2A 4FS3A 2OORA 3K0HA 4BVAA 2NMVA 4WZ6A 2NLOA 3GD5A 3LKBA 4MSUA 4OF4A 4Y0VA 3VVMA 3UBMA 2J48A 3UO8B 5TQVA 2Q3DA 3BDIA 4UJ3A 4HY3A 5K3AA 1Q1BA 5L3QA 1SBCA 4MS4B 4FX2A 2HNBA 4J7AA 3WWZA 1O0CA 4B33A 4D0GA 3I6IA 1T4CB 4P54A 4ZARA 4XFKA 4ZT2A 2D1SA 1KDYA 1U9ZA 1G7RA 2EKLA 2QE7A 3TQHA 1NBME 3UENA 3AERB 3LF1A 1HNXB 2X5NA 5CM2Z 3SIPA 1H0KA 3VO2A 3PFHA 1PKEA 5EE1A 4FDTA 3KLMX 1KA9H 1RHUA 4ND1A 4S1TA 1Q5PA 3T4EA 4CN8A 1GNVA 5KPJA 2C59A 4FYMA 4QJIA 3BZWA 3HY4A 5FEMA 5AW6A 3P97A 4RHEA 2Z30A 1ULHA 3RSFA 1Z56C 4BFWA 4EG1A 1BMFA 3PX2A 1MCZA 3NYQA 3QFTA 2HY7A 3AJ8A 3OZCA 4HL6A 3L79A 2GZAA 4QODA 1T8PA 4V03A 4F4UA 4YRNA 3BWMA 4LRTB 4KVGA 4YFYA 2A9QA 3ZJTA 1I1QB 5IN5A 4KAAA 1K98A 2ZBFA 1EEXB 2ZRKA 4UU1A 2IYAA 4YWJA 2WMOB 2K2WA 3UK7A 1T8TA 3GRZA 3I2HA 4LJYA 5IULC 3BWEA 1NR1A 2IDMA 1E3JA 2V7VA 4D9EA 3OUTA 4CEHB 3IV9A 3WJ1A 2A58A 2JAOA 4TVBA 1YULA 3K2EA 3L01A 3FRIA 3W04A 5GY7A 2XT0A 1EK2A 1HQYE 3DMHA 3ORFA 5BSVA 1C1XB 2W4IA 5DLQC 1MENA 2UZAA 2R5NA 4RQBA 3GA5A 3IO5A 4E33A 4CDNA 2ZE7A 4EHHA 4J2TA 1PJAA 1QJCA 4C6HA 1CW2B 3NWOA 3PDIA 1YDFA 4OL9A 2H07A 2I8LA 4TRMA 4U6NA 4M6WB 4N0EA 3RAEC 2GD1O 1KQOA 2C29D 3GNSA 1O97C 3OCXA 3EMDA 5A3QA 3A3YA 2FETA 3F0TA 4WE3A 5J63A 1US8A 2PM8A 1M2WA 1U8FO 2I4OA 3G1TA 1U2RA 4A0HA 1UBGA 3ANXA 1ZUD1 1HZJA 2JJYA 3FBWA 3H2BA 4J0DA 4E2YA 5EZ5A 3KIPA 2ZU6A 3HKBB 3UJHA 3FYCA 4DIMA 4DLYA 4JLPA 1NULA 3HMQA 5HPYB 4E31A 4U63A 5TGTA 2YYSA 1DKMA 2GARA 3BIJA 5G2OA 2OAP1 3KDAA 4LF8B 2EJTA 5CIWA 2D1YA 5KHOC 1CY6A 3RYCA 4L9SA 1DGQA 4GXRA 1UT5A 3QOFA 3MCAA 1SVOA 1F6DA 1TC2A 3IDZA 3L05A 3FJ1A 4RTRA 1X13A 3S1SA 1GTJ1 1GZ5A 3EBPA 5EIWA 4LY3A 1U7OA 1JFVA 4N54A 5H4GA 1DL5A 2F43B 3EVZA 3EVNA 2FKNA 2BCEA 4X7MA 4WOBA 5AW0A 1S9DA 1CQPA 3UY4A 2CMGA 1DHTA 2ATIA 1E1NA 2VYNA 3ZWAA 3QKIA 2DRIA 3TGPA 2DHDA 3SXJA 2QQ5A 3L0ZA 4QLBA 3GIDA 1ZI8A 2D5IA 3N3AC 4X6YA 4RK6A 4CCYB 3LZDA 2X5OA 3PIRA 3ZWMA 3OF3A 1KOFA 2NUAA 1A8PA 3IPXA 4O4HF 3DEZA 3AGQA 1KAGA 5IVIA 3C7DB 1CUUA 4R8VA 3EPHA 1PV2A 3L07A 3M6FA 3OEHA 4DCUA 2BEKA 2J5QA 3SBDA 5DN6D 1O6ZA 4UMEA 4ARUA 2VAVA 3ZU3A 5M3BA 3OSUA 1NJ8A 2COKA 2E4ZA 2OHOA 3MMNA 4UNQA 5LP6C 1LF5A 3EMVA 3HB0A 4PX9A 2FG6C 3BL6A 4HNTA 4K1XA 5K99A 4PX2A 3V97A 3UJNA 1PG2A 4LDZA 3UATA 3CZ5A 5TIIA 3AESB 2X0JA 1TK2A 2O8VA 4JLKA 4MKRA 1TD1A 1I4OA 1V5GA 5B7NA 4O4HB 2D3WA 3USCS 1LBQA 5B6IA 1LU9A 2I6SA 1A4UA 3CZAA 1F9AA 2Y1KA 3I1YA 4Z9XA 1GV0A 3M6IA 3SNHA 1MOZA 1KAQA 4O4JA 2O8DB 1DE0A 1GWNA 1RYMA 3WIOA 1U0TA 3MMXA 2CV0A 3T9DA 4MWTA 5K2OA 2UYYA 5JPDA 1D03A 1I6MA 3OUZA 2E6KA 3V1TC 2HA7A 4Q7QA 2IEGA 2R4UA 5ENDA 4EW2A 2ZFUA 3ZWVA 4YCAA 3E9CA 4YRLA 1ZUNA 1JR3D 2J1LA 2XD4A 3QW2A 3VOBA 3K20A 3FPKA 1WKBA 3HVUA 4K9MA 1MJFA 2I55A 5JXHA 4HDKA 3HA7A 2AEEA 5H4HA 2YVUA 4X3CA 5TQ2B 1Y3BE 1ZXLA 4BGDA 3LKDA 4YLEA 4K6OA 3F49S 1E9DA 1TYZA 2E4UA 4X41A 4MAAA 1RVV1 1YL7A 1DEKA 1SCJA 2CW5A 3UC9A 4F1KA 2UXBB 1GNRA 5J2TA 3OPQA 1NZJA 3ZV6A 2R8YA 2QN1A 3MUOA 1PSDA 3MSXA 1FSFA 5K3EA 3JWPA 1XQVA 4OBWA 3B3JA 3E9DA 3JZMA 4ZP1A 1N2GA 4B3RB 4V24A 2VDWA 3V8MA 4CLXA 4HX5A 1PK8A 5DI3A 2H1VA 1GG9A 4NJMB 1OC4A 3LOQA 3LQRA 4PIVA 3P2OA 2V1XA 1ZMXA 5I9SA 3T3EA 5ERGB 1LSOA 1JSLA 1FRVA 4I5FA 3RSQA 4CF6A 4DJTA 4AQ7A 2IXGA 2QMUA 3LLMA 3KT0A 3TZHA 1Z7YA 3UNXA 2ID8A 8AT1A 2OOSA 2FK7A 4R0VA 3U6KA 1E2BA 1K7FB 1FDVA 3ISJA 1OFHA 1YIOA 2Q8QA 4LYEA 1A9OA 1K88A 3LE8A 1NGSA 1UUFA 1V5IA 1BS1A 1XNHA 2JI4A 1GL9B 4Q7MB 1N6LA 3EW7A 2CCGA 1XF1A 1ZP6A 2IU6A 4Q03A 4QTXA 4RF2A 4XGNA 5EHGA 3P4XA 2VH2A 4QT4A 4E21A 3H1PA 1SXQA 2AFRA 1RI4A 3H5NA 4J9UE 2BEWB 1GTZA 4PONA 4N3AA 5F78A 2Q2VA 2FEKA 1NZFA 1KYXA 4GGMX 4D92A 2RGUA 1WU8A 5C7IO 3OIGA 1PQYA 2FEWB 2G5CA 3F6EX 4GMFA 1AKYA 5DNEA 2GESA 1BSVA 1MC8A 1PUIA 4GPBA 3A0RB 1QDLB 3NHBA 5DYYA 2BGLA 2J3KA 4V1CI 1O0BA 1MO6A 1UKCA 1X94A 2RSLA 4EI9A 4HNUA 3CW2A 1M6NA 1SA0B 4F8JA 3BCHA 4NQRA 2JANA 3TDMA 1CNMA 1OBVA 2IOFK 1XRMA 3JZAA 5ER9A 2C7RA 4OI0A 3BIFA 4H7IA 3C3YA 3RC9A 4J0FA 4ONEA 3OVMA 2O9JA 2C58A 2BSXA 5P8WA 1C4XA 4QQ8A 3A7EA 3BXPA 4NPHA 5LP6B 3S2EA 3AOEC 4CLOB 4EUNA 4KBFA 2Q6TA 2XTZA 2YWBA 4X8HA 5AKGA 4DMMA 4OJTA 5AW4A 1RBMA 1ZRSA 3FD8A 2BTEA 3F3MA 4PHHA 2Y0EA 3DJFA 5IXYA 4Q4LA 3K9NA 1TEZA 3SJCA 1XTRA 1NMEA 1U2DC 5FHRA 5CP8A 3GOHA 3OCJA 1KGDA 2BE9A 3PITA 3WGOA 4EI2A 5KJCA 2D2EA 3T3MB 1NP3A 2WJVA 5AP9A 4CM6A 4F91B 3HYSA 1UINA 4LCJA 1DIBA 1N5LA 3P20A 4WMLA 4U9UA 3K1ZA 4X64B 1OI3A 3CS3A 1A7KA 2A0KA 5AM4A 1V35A 3DOHA 1OLSB 2O57A 3RTAA 3NJRA 1OB2A 1IUNA 4DADA 4FI3F 2YOHA 1V3QE 3GJXC 2H7XA 2EGUA 2WMNB 2HW8A 4QUAA 4YECA 1NLUA 3LZCA 1NVTA 1CETA 4ILKA 3BUSA 2AUTA 1DCTA 3EEOA 2NXEA 4PSKA 3NYWA 3D43A 1BX0A 4G81A 3T3GA 1XCLA 1GTVA 2DMRA 3HYNA 2B2CA 4I8IA 4YJ2F 4QJ4A 5ICCA 4KQMA 3T35A 1D5CA 1QFZA 5ADWA 1KJIA 1T2DA 2A9JA 3AUXA 4PFSA 1NBEA 4WUVA 5KYVA 2CL7X 3GGSA 2FR8C 2LE0A 3HVRA 3FFXA 4B8YA 3FI0A 4X3OA 4HOYA 4RSHA 2ADOA 3AW8A 2R6DA 2V97A 1NVUQ 1Y4ZA 2QYOA 1U11A 5EOVA 3UJCA 3P4YA 3DEFA 3OQVA 1SCNE 4DL9A 3QIVA 3P0RA 3D9QX 3HEAA 4ISCA 2C4HA 4MVJD 4S2EA 1CJSA 4O25A 1P1KA 4ZYLA 2BFCA 4OP2A 3EW9A 1NMSA 2ZBQA 5K0TA 1JHPA 1WZNA 4OFBA 2YKGA 1BCSA 4QPZA 2LCFA 3C4JA 1QV6A 2WIBA 4DBZA 4ZCSA 4RACA 5LR6A 2OHXA 2O7NA 5DN6A 3FDFA 1QAMA 2JEZA 4XTRA 4FC7A 1EXVA 4ZAXA 4CMKA 3OWXA 4HJXA 1CP3A 3EG5A 1M1NB 1O5TA 3MJDA 2NZYA 1F0YA 4UNNA 1XTBA 1IMJA 1R5OA 2YW2A 3GCXA 1VPLA 1YQGA 4UMVA 5JMOA 5JXJA 4E03A 1G8PA 3EE6A 1EVZA 3MT9A 4DABA 4Y1GA 4UCFA 4TYYA 1IQ0A 1T4BA 1NX9A 2EBUA 3TWOA 4KQHA 1ZOPA 1QAQA 3BJZA 1EXDA 3AHFA 3UJDA 3WL8A 1OWMA 2Z04A 3GQBB 4PBTA 1SVIA 1E3WB 4GPEA 1OC2A 4RY8A 4Y9SA 4CMEC 1DWQA 1EZ1A 2Z3ZA 3GZJA 5A02A 4FGLA 5KSZA 3JTEA 3WSWA 1XZLA 3G0HA 2AI2A 2A1TR 4Q4JB 2P2YA 4MQFA 2XNSA 1CQIA 1YA4A 3L8YA 2NUTB 1L7BA 1JR3A 4W82A 5AUPB 3ZE7A 1RLOA 5DLEA 3Q1KA 4BO2A 5D5HA 2HK6A 3PRYA 5HM8A 2FMUA 1W19A 4ARZA 4D97A 1G8YA 5E1MA 4E5VA 1N78A 1A69A 4OU5A 1P17A 5K2MA 1FL9A 5LC1A 3E70C 5JRZA 2J5KA 3LGSA 4AF6A 4DFDA 2QMQA 4QBTA 4PC2A 4QQRA 4RLFA 4U7WA 2TMGA 3IAAA 2Z56A 2WYUA 2WWXA 3ZIAA 2GN0A 4BTEA 2ZYVX 5IYZF 3RFUA 1M54A 3O74A 4XJXA 2CYBA 3T7JA 4XWOA 2EV9A 6Q21A 3ZVMA 1YTUA 1QTNA 2XDQA 3KT6A 1WL8A 3OFKA 2XKJE 5CG1A 5L8VA 2ILVA 3CC8A 4BMXA 5JS8A 4JL5A 1JJIA 1HF3A 2RGNC 1MX3A 3EGDA 2H92A 1GUYA 3DFUA 4IDQA 5FWDA 2ZVDA 3RYHA 4BVEA 1B23P 3WWEA 1ZJJA 2YS6A 1HXHA 1J0CA 2PKYX 4G8DA 4PLGA 4G1UC 1SUCA 4HEQA 1U1EA 3SMVA 5BQOA 1TYDE 1F4PA 2GAJA 3TN7A 1C3JA 4DPKA 1QHFA 3SZRA 4M21A 3ZCQA 9GPBA 1GL3A 5GPBA 3SXPA 1DJOA 1XJ0A 4D0NA 5ILGA 4DDHA 2MIIA 3KSBC 1SXJA 4B6SA 4Q1AA 3IOBA 1YMQA 4PIPA 4HADA 3MWLA 4PYRA 1E1LA 3VV3A 1U2EA 2A7XA 3RS3A 3IUEA 3E1KA 3OCCA 3SDZA 2GD2A 3BN3A 2WYIA 1CR2A 5JNLA 5KJFA 3CB4A 1GSHA 3DTVB 2AD1A 3Q2KA 1BWRA 4GPIB 4TZTA 3O7WA 1VI6A 1Y7HA 3ZIUA 3TIXB 4MYHA 5C2JB 3LDGA 5JJCA 4ECAA 1RQNA 1THZA 4TS9A 4HS4A 5LSAA 2P9CA 1KYWA 1Q7RA 2NPIA 3F7TA 4KQGA 3IPLA 4DDTA 3F78A 4XPZA 1DPFA 3ENKA 1QIKA 1QYRA 3ETJA 1W52X 2P4UA 1G8HA 3ETEA 4UDOA 3DNFA 1W4RA 4LVUA 4DIFA 5KEIA 4FNAA 4DMKA 2R8PA 3FXAA 4LK2A 5LDGA 2IUYA 1OZ0A 1Q0ZA 4H6XA 5IVKA 1YQUA 3BOSA 5C3MA 2OESA 3UMFA 1K7EB 4RQUA 2JCVA 2QJOA 5TXGA 4OHFA 1F8GA 4XSGA 5TGDA 1NP7A 3Q3HA 3NZEA 1SBYA 4WZBA 2PMEA 3RB8A 4Z3DA 2CVZA 2HQBA 1C30B 3D6UA 4HLNA 1KHTA 1KK3A 2FR1A 3R7LA 4IIXA 3E22B 3JCZA 4F5ZA 1RKUA 1LB1B 1Z2CA 3GFOA 1XR3A 3HDYA 2BP7A 3LI2A 3ESYA 3AU9A 4G86A 4MRMA 1OXTA 1F7VA 1RYDA 2QR2A 2QUZA 4J7UA 4Z2YA 4EFNA 2JCYA 1BFKA 1JALA 3F98A 3IIJA 3TTYA 1C80A 4CMCA 5LN1A 1SXPA 1AMOA 2YN0A 1EFKA 3CY6A 4BP8A 3RE1A 4IDFA 1GNQA 2JAUA 4P4TA 4YUWA 4CF3A 3WKDA 3NHYA 1V8PA 3B82A 4FOLA 5JXIA 5F5XA 2QX4A 2JF0A 1QRRA 3HBAA 3HLTA 1IXYA 2XYVA 1BQ4A 4HH4A 3QRWA 5B6JA 2R6R1 1FRQA 4CUZA 3CONA 5C8YF 3ZLVA 4QATA 3VR4D 4PRKA 1G6Q1 5JUWA 2VXOA 3VR2D 2ZULA 1VMEA 1Z8NA 3EAGA 2DFLA 1R4ZA 3IMFA 5DOVA 3ONWA 2BGNA 4RVGA 2Q45A 1RAAA 4I4NA 4ATNA 3W2EA 3OY2A 5HF8A 4UBOA 1XNJA 3K70B 1RIIA 1YAJA 2Q6IA 1KXZA 4R31A 2FMTA 3DBRB 3FKSD 4WFQA 1M2OA 1JMKC 2PY6A 1RHJA 5AOBA 3K5HA 4MVJA 4F97A 3L06A 1E1RD 2FEOA 3G0GA 1DNPA 2H2IA 1UBNA 2G72A 3O84A 5KNBD 3H4TA 3QPVA 4FHZA 1IB0A 1LBHA 5KOJA 5E0KB 4YR7A 2PJUA 3K9LA 4OMUA 2PRJA 4NBTA 1D6SA 4OQEA 1OX5A 2BMAA 1U0JA 3OFJA 4JUCA 5DGHA 2OKCA 3ZWWA 2WABA 3FAKA 1W2WB 1XAHA 3N07A 4NEQA 3UPDA 2XI4A 4IIDA 4N49A 2JFGA 5LYJF 1MEJA 1U9IC 2QY6A 3BULA 4BVKA 1RZRA 2R84A 4Y2RA 3N2GB 1CYDA 3JQ9A 1XCPA 2X58A 3WA6A 3EXIB 5KYXB 3SQLA 3TUJC 5JZVA 2JK0A 1KBQA 4I9HA 3PVCA 4R40A 2O5VA 1VE1A 3HGMA 4Z4GA 3F4KA 1OTXA 1R5JA 3P2IA 3PUXA 4ZJYA 1BO6A 5DHQA 4UM7A 2L18A 5GJVC 2YMLA 3DKVA 1ZZEA 5LZ7A 4KE8A 5EZYF 4A4DA 2VSYA 4CMAA 1OXKB 1FTYA 4UPEA 5FBKA 1VCHA 3ZWDA 4QPNA 1LNQA 5FUWA 4JKIA 4QOHA 3FYSA 4LIPD 3RS9A 1JWAB 1YJXA 4D3YA 4LYYA 1Q12A 2YZNA 4WN9A 4QNMA 5G4KA 3RQIA 4RKYA 1RQRA 2V65A 4KE6A 1BDBA 1JEQA 2PGNA 3FZGA 2NUPB 4XOUA 3ZHOA 2QDXA 4XVHA 1GR1A 4RPIA 5KOIA 3D7RA 3IOEA 4OHWA 1Q19A 4CKXA 3I3OA 4M0EA 2G17A 1DWUA 3REQA 5HIAA 4YJ3F 1USVA 3MS7A 3QVXA 5A4FS 3SX0A 1C81A 1E3DA 1QZZA 1EBBA 4B32A 2QL5A 4QJ5A 3GPBA 3KPWA 4FWIB 5ANRB 5FOWA 3U3RA 3SFZA 4CW7A 3GD7A 1QQ6A 2DBYA 3JW8A 3ZHVA 1CUXA 1CZNA 4P33A 3CF0A 3L4BC 3RIGA 3VAYA 4B3IA 4EBBA 1XA0A 4WY5A 1UXIA 2AW5A 1QPBA 1A8QA 3HJCA 4ARBA 4LGCA 4KGXA 2WSIA 1IBMB 1AN0A 3DXFA 1GZ3A 3K8ZA 1V2GA 4QOFA 1WF3A 1Y33E 2PU5A 5JY1A 3VR1A 1WCYA 4KP7A 2P7IA 4OQPA 2IYQA 4P2GA 1UMCA 2W8BB 2CDNA 1EFLA 3SC2A 3HY3A 3DMTC 3O8LA 4KWEA 3S5UA 4BMZA 9MHTA 4AKTA 1NPDA 4Q9AA 4DUYB 4BY9E 1CHDA 4MLZA 3AY3A 3QXCA 1H2WA 1Z5ZA 2FRDC 1LTKA 3ECSA 4W9RA 5EYPB 4DNOA 3RSGA 2KM1A 2HRZA 4ZEOA 3VPHA 1F51E 1UZMA 2UZ1B 4REMA 5CXUA 4MVJH 3UANA 3GH3A 3HYTA 3TQRA 3LM8A 1NC3A 2HREA 3N86A 2I1VB 1YIDA 5AKEA 1U2SA 2WWFA 4R98A 1R8QA 3HXLA 3UGQA 3MJVA 5CFZA 3U7RA 4GSLA 2ZBPA 3A58B 4Q47A 4YY3B 2RB5A 1RWWA 3GLQA 4RCZA 4OP1A 4CDRA 3ASVA 3Q7IA 3WQQA 4G0MA 2HDHA 4KQJA 5K6RA 4JB3A 3PKIA 2P9HA 4MUXA 5BSEA 4BEWA 1UT8A 2E82A 4MEAA 5LA6B 1ACMA 4DJEC 4F2WA 4E2WA 1JNXX 2GX6A 2XUZA 1HX7A 3T9EA 3OU6A 5BN4A 2HJWA 4ID3A 4QVGA 4L6IA 1EB8A 4MRPA 4R7GA 3TPFA 3KM0A 1G5FA 2GFHA 3DOCA 4R9RA 1YHNA 1BOFA 3B51X 4A91A 1UODA 1L6IA 1NKTA 2QAGC 1ITZA 2ZJ8A 1WEHA 3JWEA 2IS4A 2ZWMA 1LC3A 1CXZA 4B80A 5KVSA 4LUCA 4KDEA 3LW8A 4NMHA 2ZBEA 5FTLA 2BM9A 4W4TA 1FE8A 1VE5A 3U7IA 4UEQA 3IEKA 4GVXA 5KYNA 2Y1DA 3UXMA 1JKIA 2J6CA 2ZJFA 4AX8A 3QJYA 1E2MA 4PANA 3R9XB 1SBHA 3GEIA 3U44B 1PGQA 4MCJA 4O33A 1XWWA 2B1GA 4US2R 3ONVA 4JXXA 1M8PA 5ICMA 4IXDA 4UAGA 3VR4A 1M2VA 3G9UA 4ISBA 3R3HA 4QOSA 4ZYTA 3K9CA 3VR2A 1GLGA 3HU3A 5JCOC 5LU8A 4AZ0A 1UK9A 2QPLA 1DKQA 3W5SA 3WOVA 4EGQA 2Z09A 4I1UA 5BW5A 3QEMB 4ZQHA 2P4EA 3H5OA 4C0LA 3GBSA 1V7PC 3QJ5A 1YZNA 2EERA 2ZVQX 1R0KA 2Q8NA 3MTQA 4KZPA 4OA8A 4BGUA 1YFZA 3FKSA 5J2UB 4AN4A 4D42A 3TRIA 1OVGA 1C7EA 3C3MA 3HFRA 4BNKA 2JAPA 3IVCA 5CIQA 3NIWA 3I5MA 3VISA 2NG1A 5EQFA 4GO1A 2Q4TA 4UKDA 3B1JA 3DT6A 4ZC1A 5KNBA 3PTLA 1GGMA 2X9VA 4NOMA 1TOAA 4D9CA 1DV1A 3A4LA 5COBA 2AXNA 1VSUA 5D3QA 4DCCA 1SUBA 3EVFA 5DLYA 4DLKA 1Q0RA 3FWKA 1ODFA 4HPWA 4WY2A 4CKYA 2B9EA 3SD7A 4EDFA 1Y42X 5KJEA 3MJSA 1T3HA 5JXWA 4JVNA 4JI1B 2C3MA 1DLIA 2BI7A 1ZC3A 3WIBA 2CBGA 1JTEA 1LF0A 2AOXA 3AB3A 4J3JA 4ERXA 3NRCA 3KZNA 6ABPA 2WC1A 1FMFA 3TOSA 4GX1A 4NZPA 4XR4A 1KSGA 4WZZA 5IT4A 2WY2D 3WQRA 1XQ1A 1PU2A 2GF0A 4CM4A 3AKEA 4PU0A 3CN9A 3W8NA 3ILSA 1R0LA 3H2KA 1C4WA 1VE3A 4MWCA 1W5BA 3G1WA 2PMFA 2BI4A 4KN5A 5CB4F 4IFIA 5KNLA 3G6KA 1G21A 2WVGA 3QUAA 4U7FA 1Q2UA 1OY1A 4KO8A 3PGMA 3SF8B 4MS3B 1MGOA 2DYKA 3GHHA 2YBEA 5A0FA 4URUR 1WX1A 4DR3B 2A78A 3DFZA 1Y5NA 3K0EA 4FFBA 1FIUA 1P33A 5JT1A 4MWGA 3GA0A 3WGLA 4EF4A 2QAGB 1OASA 2DUUA 5CB4B 3ZK9A 4Q05A 3N2NA 4NMWA 2AK3A 3M4ZA 1NNEA 5BVGB 5MFZA 1RXCA 1YZKA 3TBHA 1N7GA 2DBRA 2WJPA 1MC5A 2VWPA 3H9BA 3CH7A 3A9VA 2X40A 3LFUA 4OXIA 5B57C 2JIZA 3E53A 5DKFA 3UJ6A 2WTMA 5JS7A 2GKGA 1F60A 2N9UA 2QN9A 4GSYA 1KYTA 4IG9A 5EZYA 4EKEA 1Y63A 3CE6A 4PZ9A 3LTEA 1JEDA 2YH2A 4XDHA 1A50B 3WWDA 4WNYA 3FUTA 3T4XA 4WIAA 1BXGB 1HH4A 1X77A 4R7ZA 5BYAA 1YE3A 5IFLA 1RJ9B 3K5PA 3OZTA 5LMUB 3VR4H 2ZI3A 3CEHA 3ZHXA 1AV7A 4JIGA 1CIPA 2QJTA 4JZYA 4MV8A 1T9GR 1ZNYA 3OCVA 1MQSA 2RC6A 3PG5A 1J6UA 2QM8A 3Q6NA 4FR2A 4FHFA 4MQUA 1E5LA 1FDWA 1GO2A 2PKEA 4NFLA 2AH5A 4OCZA 5A5FA 2BEVB 1NRWA 1Y3IA 3CW8X 1E92A 1NPTO 1XG5A 1SMKA 1XRLA 2CGEA 3EQ6A 2OB2A 4FXOA 3AF0A 4JXZA 1G6KA 1MHPA 3KP1A 1NVDA 4PSVA 3HYLA 1DJMA 5JSQA 2ORED 4LXXA 5IJ0B 5KNBH 5K6TA 3E5NA 3HJAA 2YJ4A 5KOHA 1UBFA 3SOZA 1AUOA 1KK0A 2Z2ZA 4YJGB 3RADC 4EUHA 1ZJ6A 2OHFA 3A1EA 2QS9A 1TJYA 2VPWA 4Q9NA 3OG9A 4X95A 4MGHA 2QK4A 1GAWA 4MICA 3EY4A 4J4TA 4LOIA 4IMPA 3WTBA 4D4IA 4KHZA 1NJGA 2VDJA 1T6YA 3NEPX 2QX7A 1CJUC 3LIPA 1V48A 4V2IA 3W9BA 1Y3DE 2HL6A 4JYPA 4UQPA 1G98A 2REOA 4TLBA 2Y93A 1FMCA 3UK2A 4BB9A 5HSGA 2W0MA 4TT3D 4WD3A 2O2CA 3MTIA 1C1DB 3CJTA 3B1FA 3LCUA 4HVTA 3C3WA 3ZPXA 5LCXA 5AVXA 1MABB 1XTPA 1KZ6A 3T7IA 4K81B 4FOOA 4IIBA 3G0IA 1KS2A 4M46A 2QT1A 3UH0A 4LF6B 2BGRA 4MWZA 1NA5A 4PBSA 4YK7A 3GXBA 3E1GA 2H5LA 4LY6A 4B3FX 4DHEA 3A2LA 1UFRA 2J08A 2IA5A 3JQGB 1RXIA 2OA0A 2C0CA 2AOUB 4C2BA 3HDHA 4L73A 1MV8A 2O5RA 4BFUA 4DCJA 3WY9A 5I51A 4I4CA 4GMHA 4ZYVA 3DPUA 4YCNA 5JSKA 1E4YA 5M04A 2B9VA 3ZJ4A 2BMVA 4DEXA 4L0MA 1PFGA 1OTYA 4FHDA 5B3LA 1GGHA 1W75A 1CDOA 4OI2A 1WB4A 3IJEB 3KZVA 2PNJA 4DB4A 2NO1A 1ZA1A 2WF6A 1U2ZA 3SX4A 2XUPA 3VHXA 1QOZA 1FX1A 1XTUA 4BV3A 4YV2A 3D8BA 3WYFA 3PA6A 3PC8A 1FDTA 1R66A 3CVOA 4EYSA 4BVJA 5KINB 3NBUA 3RKUA 1KGSA 2V58A 4IHJF 3PQ2A 4KXXA 3HEMA 3NHMA 4NBVA 2D3TA 1A2BA 1D2CA 4UM5A 4L95C 1ZM9A 4M4SA 4BX0A 5HP4A 5LB2A 3KZCA 1YRBA 4HH3C 1RJGA 4NSNA 1TO1E 5EXXA 3KSAC 5FUYA 2P4HX 4QSHA 1WBJB 4C6SA 2O3JA 4GPAA 2BH9A 2GF2A 3DHNA 4IZOA 5AW8A 2H06A 3LBHA 5TT1A 3EAFA 2JAWA 4DQKA 3A6KA 1EUYA 1JHYA 4DG9A 3RANA 4FFLA 3L1IA 3KYBA 3EZLA 1MRSA 2W42A 3LZ6A 1YWGO 3ABSB 4UXJA 3KU1A 2XRFA 4IHJB 1IU9A 4XYGA 2I2CA 1JGTA 1JQ5A 3ETLA 3FNIA 1JSRA 1RU3A 3GGOA 1A4XA 4XLZA 1WPQA 4I4IA 1W8IA 3CH6A 3DUFA 1P3JA 3WSTA 1JG7A 4TTSA 4GI2A 1UXGA 3SBOA 4ER3A 2EW1A 2X1HA 1DDIA 2KSQA 5KTSA 1LDMA 5LNK1 2CFRA 4JQYA 3FHJA 2NT4A 4GOMD 4JI0B 1LQUA 4YDRA 4KOEC 1EXWA 1UQTA 2X6TA 4DCGA 2J0EA 3DZBA 1SN7A 4YJHB 3VSAA 1WU7A 3PVZA 2FZ4A 1HBJA 1YNSA 3M4YA 1D1PA 3H2SA 5ALQA 4BNXA 2YZ7A 1ODIA 1MB4A 1E3IA 4AY3A 2AUNA 5M34A 1J0BA 2CZCA 4P5DA 4YO7A 1PD0A 5ECYA 4HSEA 1AB6A 4TMKA 4RGQA 1Z29A 1ST3A 3E1SA 4KNWA 1RPZA 2EKDA 3HMKA 2DGDA 3KEGA 2PIDA 2VSFA 4HFJA 3C74A 5ALFA 5IBPA 5KKAA 4PC1A 4B4VA 1G8AA 4AMZA 3L8CA 4HNHA 4IJUA 1QYIA 3BGDA 4LJSA 5IBQA 1C3EA 4MW4A 5KUTA 1ZU4A 1IRIA 2C4MA 5AKZA 3IMGA 4B3MB 2DWOA 2F48A 3TR5A 3S40A 3K0AA 1HT2E 2QZ9A 3H5RA 5FPTA 2BJHA 4WVLA 1JG4A 3GHYA 3QX7A 4G4IA 5GWXA 4MYCA 1EFDN 4HN4B 1HY3A 4B6RA 3AR4A 3LGXA 4JKOA 1LPAB 3KV1A 2I7TA 4LWZA 2QX8A 1O8BA 4ITRC 4S1NA 5DB4A 3PC7A 4RTQA 1WMDA 3V1KA 1T9ZA 1O6FA 4EQZA 1K08A 5AJYA 1U2PA 1R4NB 2CKMA 3ZCUA 3A3KA 5LQMA 1HURA 3HDGA 3HL4A 1WXDA 3HKDB 4RIEA 4RSMA 3DMPA 3I1IA 4GP7A 2XRZA 1KO7A 4EUFA 2G67A 2ZJ0A 2B4RO 3AJ9A 1MNAA 2EFJA 1JFTA 1S4MA 1IXSB 5FTMA 4OP3A 4RQAA 2ZCUA 4D9BA 4JEIA 1OAAA 5BYKA 1RMQA 2Q2WA 4Y2JA 3BREA 3OE4A 1UKBA 5IWAB 3W3ZB 1VKOA 2C2GA 3OIYA 2OORC 2Q3LA 4YBRA 2FP4B 4JB2A 2ZAIA 3A25A 1OXBB 1QYXA 3HCWA 2C9CA 3C5VA 3QFFA 4L57A 3P8ZA 1TPYA 4M1QA 1PHPA 1II0A 1TL7C 4COKA 1V25A 5DEOA 4DM7A 4R8MA 4IZ6A 1M2FA 5BT9A 4CL8A 3SYLA 3PC6A 3RJ5A 5LIRA 1ENZA 2OZVA 4PAGA 2IV2X 2A9RA 3U3JA 3W6ZA 2QJWA 1DFGA 1FDOA 4R1SA 1HYGA 1QUEA 3LRTA 4N0QA 4B3CA 2PD4A 2P65A 2Y9MB 1I9CA 2IU4A 4RS3A 2H7YA 4BMVA 5A9TA 3UQZA 3S2SA 1UC5B 1Z6XA 3FY4A 5E9JA 5KPDA 3GEHA 1RQGA 1PTKA 2Z5GA 3P19A 4NFSA 3GLFA 3B3FA 2XUKA 1U8XX 3VZPA 3LLSA 3PR3A 3OZAA 4M49A 3WIUA 5CDUA 1RRGA 3S28A 4BQSA 2W98A 3ZK7A 1E5QA 1ICIA 3Q41A 3U4IA 5LU9A 4TT3A 3G23A 3NXKA 1JAHA 1A9SA 3IBTA 3U9TA 3EIOA 3LUGA 3WNVA 4AY5A 4CMJA 5A03A 3IALA 1XELA 2C20A 3VH2A 4FQ8A 3RS4A 5A7FA 1Q0QA 3HDQA 4XJTA 3WNBA 4RSRA 4QWWA 2YWHA 2Z83A 2C9DA 3IUMA 2FCRA 2CL0X 3IDQA 3HDJA 4AO6A 2TS1A 4CQLA 3ETCA 3IVRA 2J9FB 4PLZA 1J7KA 3CCFA 1ZHFA 4RIFA 4I55B 4JUBA 4M60A 5J9FA 3D02A 3W5IA 4JYAB 1L4BA 4PFQA 4X3PA 2DECA 1XWFA 5MDHA 4W5NA 1YBFA 1DHRA 4JI6B 3MGGA 3D0QA 3OX1A 2X7JA 4JEUA 4TTVA 4ER6A 3WK4A 2CD7A 4XGIA 5CNJA 2OQVA 1G55A 1ZR2A 1D2NA 3CE9A 5JQGB 1ISPA 1HE5A 3SXUA 4EARA 4D4JA 2VA9A 2BGWA 1DQNA 1FMTA 2GPJA 5HOQA 3G8CA 1PNRA 2CB0A 1DCMA 2PCJA 3HUEA 3K15A 4HXEB 4LRSB 4U7HA 3TLGA 3V3KA 4IVNA 1JAXA 4EY4A 5JCXA 2GAFA 3F2IA 3TFOA 1FFYA 2WTNA 4C4ZA 4A1FA 1JEJA 4H60A 1XDZA 5FOQA 3C3PA 4IZHA 2WKPA 4XDZA 4K6HA 4P58A 3CZMA 2DHQA 3PFBA 1JJAA 3FLMA 4GC9A 1B3BA 5HIKA 1NV9A 3B9QA 4B47A 5E9AA 2HIHA 2F55A 1YCGA 2XX3A 4H0CA 3TLYA 3DVAB 4Q4AA 1ZBQA 2IU0A 1Z4PX 2Y77A 4LPKA 1JQJC 3HBMA 1MJGM 4RDCA 3N2ZB 3ELDA 3QLEA 1T8SA 2C42A 2X3FA 1Z8FA 3OLCX 1MJGA 3Q7PA 2ILTA 2O3TA 3AHJA 3ZW8A 3SFVA 1DKNA 2VFAA 4ZVPA 3ZBTA 3AO0B 2FFRA 1EFPB 1RI1A 1EIWA 3IOCA 4AY2A 5IUJC 2IYUA 1IUOA 1Y4DE 2XJ9A 2GK7A 5G53C 1FNCA 2UZIR 4W6ZA 5B1SA 2OO7A 5T67A 2VG8A 1GCAA 1GSAA 5T8KA 4A2WA 5LP6F 1EX6A 3PX7A 1C8KA 2YN4A 3AR2A 4G56A 2VBGA 5G0TA 5AUOB 2P0AA 1ADCA 4IMJB 1R6DA 3EXHA 1L5WA 4MUNA 6YASA 4XWWA 3THYA 4Z9AA 4H27A 1YOBA 1GV1A 5SY4A 2GN8A 4B09A 3VNQA 4DV5B 3HUDA 3TZBA 3RJZA 3KV3O 4BC0A 3V9AA 3D1JA 1CZKA 3GI1A 1IIBA 2G04A 3GCZA 1ISHA 5AI8A 4WH0A 3EPPA 5TQ0B 4C4OA 2PV0A 2UZ0A 1LDGA 4BQOA 5LJLA 2GLXA 4JI5B 5IU6A 1EHIA 4H16A 5AKHA 4MULA 4R71A 1QOPB 1N7HA 1H3FA 2QG6A 2ZIXA 1NASA 1TMOA 3LHDA 2X2PA 4U2CA 3M4XA 1Q44A 3JQCA 3O6VA 4FSHA 3HDTA 4KJXA 3RRJA 3G2MA 3RUHA 3VX4A 2QN6A 5K6AC 2ZBVA 5BV1A 3FLAA 5FI5A 2VNJA 3CRRA 3ORYA 2A1TS 5JAUA 5KREA 3UKDA 4TSKA 5HIIA 3T1NA 2ZRAA 2PFSA 2QTTA 1E66A 1LI7A 2E9SA 2X1LA 4PWYA 4Q3BA 4KBGA 1KKLA 3ZHSA 3C3CA 4QM6A 1PG0A 2NWQA 2ZS8A 1PL6A 1LSUA 3O93A 4FGUA 5BSFA 3NHFA 5EQTA 5CCBA 3EISA 4IY1A 5D2CA 2POCA 3V8RA 5TS2A 4XTCS 5JYEA 4IIJA 1JZQA 2IEBA 5H82A 5FOVA 1UM8A 4D74A 2I4LA 4ZOQI 5D5QA 1R0RE 3EFOA 4LY9A 2UVPB 3ROKA 1TFRA 4DTIA 2IXTA 5TPWA 3L49A 2VNAA 1BH2A 3MTEA 1XZEA 2H2GA 2IVZA 1JA9A 4PG8A 1K63A 1L7NA 1PS9A 4JU8A 4Q3DA 1MTOA 4LRWA 4XM0A 2NZ8A 4Q1EA 1E9BA 5H1YA 2K2QB 2WILA 3O4JA 4IJ6A 2A4KA 4O29A 1IEQA 4QLOA 5THKA 1S8OA 4JLMA 1GPJA 3JAKA 5F12A 2E55A 2VPZA 2CJFA 3ESRA 5ENVA 4C7KA 5ADVA 4DIOA 3WLFA 3TNLA 1I5OA 3BB3A 3GX1A 1GA1A 4MRAA 3RYCB 2AC7A 4J1QA 2VJDA 2PWPA 4FKMA 4PZYA 3C8UA 2CJYA 1QKJA 4JBGA 1L9XA 2G8LA 2Y1OA 3CCBA 4GZMA 3AR9A 3NVKI 1ISFA 3FJOA 1PS0A 1QSGA 4IDGA 4R54A 1AGPA 2W00A 3FCXA 1NQXA 4XDYA 2I4IA 1QNLA 4Z9BA 4B6OA 2OHHA 3MJFA 5L51A 2O6LA 2GEJA 2E87A 2ODBA 4HBGA 4MEJA 4MVYA 2B1IA 4YVFA 4DM3A 4UTPA 5EWMA 1O77A 4U7DA 1M2EA 3PUHA 3OZBA 4TN5A 3WA7A 3O90A 3O3NB 3RGGA 4DREA 2IYLD 4PO3X 4RZIA 1RM5A 4QYIA 4YMWA 4UAVA 1CR4A 1PZNA 4Z9FA 5F3DA 3CVUA 1RLIA 3U61B 2I4TA 1MG0A 1G9XA 4UHJA 1RC8A 1CZRA 1GQSA 1W4BA 1SCUB 1YXMA 3EFEA 5DGIA 4FT4A 2FSIA 3KTDA 1GM5A 5ALGA 3AQ4A 4JK3A 3ABZA 2OILA 3CR7A 4LJ4A 4PC6A 5BR4A 4H35A 1PFQA 4NONA 3HV0A 5BOVA 2W6OA 3PKZA 1T5BA 1SRQA 2XYRA 2ZTMA 1RCUA 3AY6A 3IUBA 3QA9A 5CVVA 4CJXA 4LWPA 4V2UA 5EN4A 1QG6A 4NCJA 3B2NA 3FPGA 3FFBA 1YZVA 4QJBA 4O4JB 4P4SA 4LEIA 4U7JA 1W4CA 2ADFA 5B7GA 1QV9A 5JROA 3FETA 3DV0A 1KU0A 4M1WA 3AF6A 1G5HA 3DCIA 1V2HE 1GU1A 5DNDA 4QPCA 4YP1A 4ZFNA 3RK0A 1PVVA 4P7JA 1U7ZA 1Y89A 1M2HA 4R81A 5PNTA 3L0OA 3Q98A 4YQFA 3C3JA 3WMGA 1ZUNB 4HZIA 3A3OA 1QO0D 4Q39A 1N6PA 2HXSA 3LK7A 4AWBA 2C83A 1BVRA 2BY4A 2VHXA 3MEQA 1ESEA 4Y2YA 1BHJA 1Z33A 5DGCA 4DJ5X 4WDRA 2B7CA 4KQWA 2ODWA 4QGSA 1JXAA 1XCBA 3KVRA 3GJ8A 5J2TB 2IH4A 3L7BA 3COZA 4KIWA 3GJZA 2D0OB 4RVHA 1NY5A 2A1UA 5TR9A 4BKMA 2ZWOA 3IB3A 4BNTA 1HT3A 3N2EA 2FF5A 1F8UA 4OQLA 1HOTA 5KC9A 4ZVUA 1ZHOA 1JVBA 1JQKA 3ZV5A 4Q01A 5DI3B 1R16A 2HBQA 4B34A 1QGZA 4ZWNA 1RI3A 2HRQA 4EHIA 3MWKA 3IAS1 1OV6A 4J94A 1N1EA 1GA6A 1TVEA 1JU3A 3BWVA 1V1MB 1GPBA 2QQEA 2ZETA 4TV9A 2YC2C 1HL3A 2FPSA 4GXNA 4ZMSA 4B3TB 4N7JA 5AW2A 3ZXYA 3D5QA 1QF7A 1XEAA 3DE4X 1V8OA 3NBXX 4TL6A 4MGKR 2ISCA 4MMXB 1V9LA 5BV8A 3GGGA 2LCQA 2JGDA 3C85A 2ERYA 1RAHA 3JQ7A 2OCKA 3CUWA 3SC6A 2LPMA 1GUAA 1J4AA 1VLLA 1OBFO 3HN6A 4YROA 2BOVA 2EF0A 2H5JA 4DEVA 2W2LD 2ZI4A 3VHRA 1UK7A 4MROA 5KSPA 1D4AA 3BAZA 1OAOA 2ZQZA 2M6KA 1YMVA 1Z82A 3EC7A 2OYSA 2IOFA 3PQ4A 1ENYA 3QFSA 4Q66C 1KC1A 3QKUA 4FMBB 3WZMA 4LQLA 3FHLA 2LP4Y 5JO9A 1UMBA 3LWNA 3VPXA 2GZRA 3PRKE 3FOAA 4YDHB 3KOYA 3PC3A 5AXCA 4UFOA 2BMJA 1F17A 2B5WA 2GFQA 3FZYA 3PJDA 3HUUA 4MV6A 2WT4A 5LZ8A 1L5HA 4B6FA 4GDFA 3RSHA 4X92A 3JRWA 3ROGA 1FJGB 2HRDA 1BRMA 2XEDA 4JJFA 5DTIA 5JJBA 1U8YA 5ALSA 4ZQEA 2CFIA 1ADFA 1KFKB 4GRAA 5ELMA 3WNQA 4GZ3A 1XN1A 4UQLA 1GT6A 4FGZA 1I1NA 3PHLA 2QLJA 5DW0A 4K0KB 4IM7A 3BHIA 1SU8A 3VPGA 5IRCD 1VDZA 4L2IB 3W8DA 1RE0A 2YJ6A 2HD4A 1Q57A 1JKXA 1B8PA 1CQJA 1NBOA 2NV6A 3D3QA 3NBYC 4LBVA 4IDHA 3TDKA 2Q4OA 4BWVA 3GAZA 3UWSA 1OVMA 1RJWA 1YZFA 1BWSA 3FZNA 1ZJ4A 3L0YA 1RYBA 2IUUA 4AZWA 3NYRA 3GLGE 1ODCA 3FNEA 3IJPA 1N9GB 2D5BA 3D4NA 1E18A 2JLCA 3CW9A 3GVXA 4MDHA 1RXWA 2YVAA 4BU1A 2FNAA 2A35A 2G9QA 5A2GA 2E4AA 2IZZA 2QMEA 2DTDA 3IAM1 3V34A 4E0BA 1FJ2A 3F7OA 4MA0A 2OBNA 5LQNA 4D79A 3MB5A 2R86A 1I7QB 1U4OA 4CQMD 3F5DA 4I99A 1HNNA 4JI8B 4DA9A 4RTLA 1OZHA 4MO9A 4XQCA 1RLJA 1SXJC 1SXIA 2QUAA 2IXBA 4Q1VA 2NADA 4LV8B 4QXOA 5JH7A 4BASA 4CEIA 2QD5A 3D3EA 1DTEA 2GBFA 3B85A 1NXTA 1PP4A 3N0RA 1AJEA 4ZREA 1QDUA 3U0VA 4DRZA 3N8GA 2P9ZA 1ZUIA 3RAGA 1SC6A 2YHSA 4B46A 1XVAA 3NO4A 2OZPA 3PLAE 1YQTA 2PMDA 4JOSA 1T10A 2O8NA 1RKQA 2BFCB 3QE0A 4KPUA 3HKEB 4M54A 3R0IA 4FYXA 4H18A 3LU1A 3URKA 1QK4A 3KJZA 3CUUA 3KQNA 3QOXA 4RO0A 1BCSB 3FF4A 1R5BA 3RIEA 4W1SA 3SZGA 4AJEA 1WOMA 1MAVA 1LRJA 1Y81A 5E2AA 1X14A 4Y2TA 4I3GA 3H04A 3INYA 3R41A 2GCEA 3RH0A 4GQBA 3O0DA 3TF5A 4GECA 1R12A 2EKPA 1EWRA 2GD0A 2PRKA 2Y1FA 3GT0A 4IEEA 4A6DA 1KBOA 5BWOA 1DOHA 3O3CA 1WETA 4CNQA 4UREA 3WP0A 5EKDA 1E6UA 1S8NA 1I3OA 3RUDA 1ECFA 4C4PA 4WACA 1IHYA 2C2WA 1W9MA 2IDJA 4KACA 5JTUA 4RWZA 2WUFA 4EG6A 4Q1DA 1TO6A 1GPUA 3BT7A 4WKPA 2EGHA 1X6VA 4J07A 2GZSA 2XUDA 3ZU2A 1YF3A 4JWTA 4X9XA 1IOZA 3WMEA 1VZ2A 3ZD9A 1QBKC 3GDFA 1EK6A 3DHEA 3QXGA 4G07A 5AKXA 3UPUA 1X1BA 3PC4A 1IHDA 4N5HX 4C7VA 1X3SA 3GH1A 4URVR 1H4QA 4HUQA 3MS4A 2B6NA 3FGOA 3O4RA 4OQZA 5FPPA 5LD2B 2XXAA 3ZUGA 2I67A 4ZAVA 2WUDA 4YV1A 1EUDA 4H7PA 2BR3A 2LW7A 3UUGA 5GZ6A 1QO0A 1WXFA 3WBFA 1TECE 4O08A 1CIVA 1NW5A 1KI7A 3GUYA 1B3RA 2FZEA 4UVIA 1IWBB 1N2IA 1VP9A 2OSVA 2Z1MA 2YWXA 5T3YA 2DQKA 4YCJA 6REQB 1AZWA 1KMHB 4HNGA 1ODLA 1PQWA 2WHXA 3GLHE 2RDMA 4X1YA 1ZYUA 4IJVA 1TQ4A 2NAPA 2GYUA 2YUTA 3LX4A 4JOBA 4M0FA 5DJ5A 4FSDA 4TV8F 2GRUA 2FPGA 3MTBA 1AC5A 5SZKB 5IKXA 3VU9A 1ZL2A 1AQLA 4CIAA 2QRMA 2A5FA 1XTZA 1P73A 1G4AE 2NO9A 2A2ZA 4UFNA 4BFYA 1X9GA 2X0IA 1RWOA 1MAAA 2X5KO 2J3DA 1ISIA 3EGDB 4YRGA 1YK1A 5ALUA 3O8OB 1XDDA 1QFYA 4LG1A 3ZE1B 2OENG 4FEEA 3HI6A 5FBRB 1ZICA 2A9FA 3IELA 3VV2A 2ECOA 1YZTA 1CR1A 2C03A 2IXFA 2XLBA 3GY0A 1CUEA 4WK4B 4WNCA 5JWOA 3QUCA 3SEAA 3W5BA 3C7CB 4CCSA 3CXRA 4J6FA 4HR7A 2RGRA 2EEZA 3QOWA 2GJ9A 5IABA 5K3OA 3LA8A 4YAFA 1AY0A 3GW8A 5AIBA 5DCYA 1SXJB 2GHQA 2PT7A 1OYYA 3AM4A 1MQ8B 2VUSA 4MVJG 4IOMA 4GLFA 2DFTA 3OZEA 1RKVA 2WHPA 3UFXA 2VP6A 4GC5A 1UPUA 4YI5A 4F85A 2BV3A 4U4AA 1I2AA 1NHWA 3IDSA 3PFCA 1QK5A 1QNFA 4U2FA 3DE1X 4JX8A 3R9WA 1U04A 3OQIA 2W2LA 2V3VA 3M83A 2PIAA 4KYTA 5HFAA 5AJWA 3WLQA 3IT1A 1SZDA 5DNWA 3VNAA 3NFYA 4CE6A 2Q4EA 3COVA 2FLKA 3EXFA 3QVOA 4OQNA 5FB3A 4F1WA 2V0GA 3HABA 1ZMRA 4IF4A 1CEEA 3SYNA 3A32A 1TEXA 3ZHRA 1KERA 4H1HA 2ZVJA 4U7GA 1ZDMA 4RFVA 2FDCA 3UOWA 3QEKA 3TQFA 1Z4OA 3KPJA 1MEEA 2EQ5A 2CZQA 2VCEA 2V9PA 1TCCA 4IIFA 3DCJA 4F9TA 4XD7D 5EWJA 4EJSA 1SUSA 5HWSA 1HYQA 5F1YA 2XWJI 1BS9A 1IBKB 1IZ0A 2D5LA 1TO2E 4YONB 4BX9A 1TB4A 3A14A 3M0EA 3MLEA 4H3HB 2NVBA 2HHLA 4KRYA 4PO8A 3B48A 3SYMA 1SQFA 1D4ZA 1FXSA 1VSQA 4NPCA 3M2PA 2ZG6A 1BGWA 4EDHA 4R1MA 1OA0A 1XA3A 1YJAA 2I8CA 2JGFA 3DMFA 1T4MA 2ZRBA 1Y0BA 2NSJA 1U0OC 4G0NA 4AZ3B 3QE4A 4AJLA 3NUQA 1ILWA 4MRMB 4MP8A 4E1BA 1JQEA 2ERCA 2QNRA 4LDRA 4Q3AA 1LK0A 2GS9A 3IRVA 4XIGS 2GXUA 4HF7A 4OY3A 5E4FA 3S5JA 4E94A 4RVDA 1GVNB 4FYJA 1GN9A 2D2FA 3CM0A 4NTZA 4UDYX 3T0FA 2QR5A 1CYEA 1S89A 4GOND 3QBEA 3WL4A 1VYHA 1G19A 3CIFA 4M8KA 4EUKA 4CXMA 2FPUA 1KMNA 2QP9X 4CQMA 5LXTA 1TUEA 2PZJA 5D00A 4Q7LA 4ZQBA 3JALA 1BEUB 1W1UA 4PPFA 4TTJA 3ZI0A 2XVMA 3OJFA 4B6JA 1W47A 1Y1TA 1EWTA 4ZGGA 3HB7A 1EVKA 1IQUA 2R6FA 3AWIA 4ZU1X 2NP6A 5B58C 1T5IA 3MINA 4DEYA 1C9EA 4OGWA 5FX2A 3CF6R 1UDCA 1LQTA 1N6HA 1JHOA 1VSVA 2FMXA 2CVHA 1NE7A 4ZEXA 3TL2A 3CEJA 3ZY3A 2EC5A 2QN8A 1T2UA 1JX6A 2YXNA 1HV8A 4Z53A 1E2GA 1MO4A 1H4SA 3H16A 4WEQA 1S0UA 1NW3A 1L7PA 1QRSA 2ZRLA 3DHWC 4G5RA 5EZSA 2WR8A 5G4LA 4N7MA 4OM7A 4R1PA 1L5GB 4MVXA 3H9UA 2VR1A 3S55A 1IVYA 1UBRS 2DBZA 4ND4A 4NDZA 3OOEA 4HAVA 3RLFA 4UATA 5IH7A 3LRPA 1WSWA 3B1WA 4G1CA 4EW6A 2O59A 1QCCA 2DC1A 1KQ3A 2P90A 1UC4B 1Y9AA 2PUDA 2EFGA 4CVNA 3P0JA 3LDAA 3RKSA 4DUZB 1VHWA 1K06A 3GFSA 5KQSA 1QH1A 1EFUA 3ZLBA 1SEVA 4LJ6A 1Q