3ZR4B

Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis Uncoupling in a Glutamine Amidotransferase Bienzyme by Unblocking the Glutaminase Active Site.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
total genus 59
structure length 200
sequence length 200
chains with identical sequence D, F
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zr4B00
2R1VA 4QYTA 4L8FA 1UCFA 5LIRA 3TTUA 4ENSA 1PE0A 1BXRB 2YWCA 2AD5A 3MIIA 2R1TB 1PDVA 4LRUA 1FYEA 3P9QA 3N7TA 2ZUUA 3PQ5A 4P35A 2GK3A 4S0ZA 1KWGA 4I2NA 4Y1RB 1ONSA 2R1UA 5SYAA 5SY4A 2RK6A 3TTSA 3EJ6A 5SY9A 2W7TA 3FSEA 3NOQA 4E08A 3TTYA 2YWBA 4N0MA 1GGJA 1OY1A 1OX4A 3R74A 3P9SA 4UOZA 3PQ7A 1G2IA 3L3BA 2XF2A 3OT1A 3TTWA 1CE8B 1QDLB 1P81A 4XLLA 1PDWA 4AULA 4AUMA 4HCJA 4OIFA 1QVZA 1KEEB 2R1VB 3NOOA 4ADSG 1I1QB 3SF8B 1KA9H 3UMMA 1Q2UA 3UJNA 3EWNA 4L8WB 4MNTA 2ISSD 2D7JA 3ZJ5A 2YWJA 3BHNA 2VPIA 4Y1GA 1IZZA 1QWSA 1KWKA 4B40A 1GPMA 1VCMA 3EN0A 3SOZA 4BTEA 4QYXA 1QF7A 1VHQA 5BV2P 4WINA 2H2WA 1VCNA 1SOAA 4JQSA 4E5VA 4MGHA 5JZOA 1M6VB 2RK3A 2RK4A 3B3AA 4P5PA 1U9CA 4ENQA 4B7AA 3CY6A 1I7SB 4I46A 1J42A 4P36A 2R1TA 3D54D 3R75A 4B5KA 4ENWA 4GE3A 5SY6A 1WL8A 1GGEA 3L7NA 3SF8A 2OR3A 4AJ9A 4LGYA 5K4AA 3F5DA 5IP5A 1P80A 1K9VF 2VDJA 4MTCA 4RKYA 1SY7A 2LXNA 4UNIA 3ZJ4A 2IUFA 3ZR4B 2WJZB 3PQ6A 4OGFA 3TTVA 4ENPA 4B2YA 4L78A 1O1YA 3KKLA 1N57A 1P7ZA 3F71A 4R7GA 2ZUTA 1CF9A 1CS0B 1VCOA 3RHTA 4AUEA 4ZDKA 1GG9A 4N12A 3CYFA 4OJYA 4ZGGA 2FEXA 1GGKA 3M3PA 4PXYA 4RKWA 2AB0A 2YWDA 4ZDJA 1GGHA 3NOVA 4ZDIA 1OX5A 2NV2B 3CZ9A 1JDBC 1Q7RA 1IPHA 1T36B 5JZMA 1I7QB 3CZAA 1S1MA 1JVNA 2ABWA 3NONA 1C30B 1A9XB 3NORA 1OI4A 4Y1EA 1T0BA 1QVWA 1P7YA 4ENUA 3ER6A 3MGKA 4P34A 2GHRA 4UCFA 4WXYB 4GE0A 1P5FA 4Y1RA 4OFWA 4Y1FA 3PQ2A 3GRAA 3VU3A 3FIJA 1FY2A 2A9VA 1L9XA 2VRNA 4ENTA 3UK7A 1C3OB 3L18A 4BFLA 5DFAA 4D1YA 3CNEA 3EFEA 4P2GA 1OX6A 3UOWA 4L8YA 3TTTA 3TQIA 4Y0NA 1KXJA 3PQ8A 3BWEA 4L95C 4BIMA 3UGJA 2VXOA 3B36A 1IZYA 3B38A 3P9RA 3PQ4A 4OQ4A 1GGFA 4ENVA 4GUDA 4K2HA 3OT1B 3L4EA 2NV0A 4I4NA 4L7QA 4OGGA 4UOQA 1PV2A 3EZGA 2ZUVA 1OX4B 3P9PA 3TTXA 4UZSA 4AUNA 2ZUSA 4B31A 1GPWB 5E9AA 4ENRA 2V4UA 3PQ3A 1R9GA 3R76A 3WFZA 1QVVA 3NVAA 2VKTA 1T3TA 2ZUWA
chains in the Genus database with same CATH superfamily
5F3DA 4RNDB 1ZIOA 4NBSA 4A82A 2OXIA 3D8HA 3DBRB 1RHJA 1VG9B 3CN9A 1XRNA 2ZPUA 2GWHA 3VZRA 1CUBA 4BO1A 2WM2A 1BWPA 4ZAFA 4EGAA 5F77A 3PXXA 3W2EA 1UJCA 4LX0A 4M2LA 4G4SO 1XZPA 2VF7A 3A6LA 2J6CA 4OK6A 1MFZA 4CN9A 2BD0A 4JJFA 1QFZA 2ECFA 2EZ4A 2GZAA 3KQWA 4MW5A 3WRYC 5BNIA 2J4CA 2WV9A 5DO9A 1GGVA 4OH7A 4R2HA 4DCJA 1FK8A 3I1YA 4OI1A 4TL6A 2C7RA 4ZKDA 1VLMA 1UC9A 3OLXA 5LZ9A 2J3HA 2DTDA 4DMKA 3VKFA 1TCUA 1KY2A 2VHJA 3PP8A 1TJPB 3PXDA 1HDCA 2HTFA 1E4YA 4O5AA 1WCV1 3BKXA 1V26A 4LS3A 4ZEVA 2BBOA 1O96B 1YR3A 4OQPA 2NZ8A 3UWDA 1UKBA 2ADMA 4CMIB 4IDBA 5CYPA 1C4WA 5JRJA 4S04A 1TQ2A 1WPRA 3ND8A 4TV8A 1BE0A 5BSUA 3T7IA 2QQ5A 3D6JA 2R6JA 4Y9UA 5FORA 3ENWA 3EXHA 1IM2A 3U56A 2ORYA 4NG4A 5FJIA 1QH1A 3ZWQA 4QOFA 2UVPA 1F2TA 3IOBA 2NU6A 3QI2A 3U3RA 4EBBA 3CZCA 3NBAA 3ASZA 4BEBA 1K3FA 3U19A 3I6IA 3KAPA 5I01A 1YL6A 2X4LA 1AU9A 2TYSB 3JZDA 2I78A 3B3QA 3I5AA 2QLFA 4QPZA 4UXHA 3BMQA 1ZOSA 4UEWA 2B1IA 4ZU3A 1LBEA 4JFAA 2XMPA 3CSUA 1CZNA 4KQJA 4F2DA 4JL8A 2WT9A 3F6BX 1G63A 5IDWA 3W5IA 1IHUA 2YMLA 1BOOA 1XTJA 1KBQA 1E6EA 4BLUA 4HRVA 4K9SA 4OQMA 1R4MB 1ENZA 1I9GA 4Q0MA 4TS1A 1JUDA 2PH5A 3BXHA 3I73A 4NDNE 1GU0A 1N6OA 4AYWA 5LB2A 5A5DA 2OILA 1QRUA 3OCZA 4IO0A 4IXMA 5EJ6A 4OH1A 3GO4A 3HPRA 3QOWA 4HUTA 3PFFA 1T2CA 3ICEA 4A6EA 3TM4A 4QDTA 2GZRA 2IZ0A 1EVQA 3Q3IA 4UCFA 2C2YA 5U4XA 2OYCA 2DLCX 2H4FA 5A4JA 4KR2A 4GM0A 5AW4A 1C0IA 1Y5NA 2GLUA 2WG2A 3H5VA 4F2PA 1MOSA 3QVOA 4H3HB 1WRBA 4KITB 2AG1A 1QHEA 1XTQA 3PR2B 3H8VA 3FDZB 1V47A 2IHJA 3FZQA 2WIBA 3TCNA 1TCCA 3MS4A 4DMRA 5CGZA 4KOAA 4DNPA 4F46A 4ZCLA 3Q9LA 1E8MA 5G4KB 1X14A 3QE9Y 2WLTA 1QO0D 3NDJA 4MVYA 2Q5IA 1HT1E 1W85A 2J6BA 2D13A 2XWPA 3GLVA 3IO5A 3IQFA 4NSNA 4KMMA 1YFZA 1U9JA 2B1QA 4BWGA 1BMTA 2OHVA 3OEED 4H0CA 4OHZA 3OKPA 1N1EA 4MCJA 3WRWA 1LK7A 3Q7SA 1QV9A 4QGBA 2FRDA 1DAIA 1HL3A 4XGQA 4II3A 4MEJA 1T2UA 2FVYA 4XDGA 3TOSA 2O2IA 4B09A 3QE0A 3DOJA 2RHOA 3N5CA 4L07A 2W0SA 1WXDA 3JQFC 2XCTB 1E2MA 1ZCJA 2XCOA 3KAKA 4H7JA 4O0MA 1Z6ZA 1ZIYA 3O9MA 3G17A 3ZXYA 4TL8A 4Q1BA 2GPYA 4OKNA 1ZC4A 2DBYA 1O57A 4R2JA 5IUJC 3D0KA 2J48A 1G2QA 1JMYA 4PZCA 2NUPB 5EP3A 5CA0A 3FWNA 1RPTA 3WK5A 3V8PA 3R4VA 4DLRA 1U2EA 2JGRA 4OIMA 4RANA 3JWPA 3HO1A 3ML1A 2GT1A 3PEEA 4I6JA 3TW8A 2QLNA 3RHFA 1EVZA 4N5IX 4U7DA 1X0VA 3CRMA 3MOIA 1OTHA 4NCIA 2C3PA 1D7AA 1JWBB 2P1RA 1CEXA 3NKLA 2LCQA 1ZZGA 4BN4A 2CXRA 1H8HA 2FAXA 4IEFB 3UYKA 4C7BA 4A6XA 5ICGA 2R00A 4OJKA 1JE1A 1NZDA 3O4IA 1DC8A 1M5RA 4KXWA 5JC1A 3H1GA 4PZAA 1XB2A 2B3TA 3GMSA 4IWXA 1PR5A 3FMFA 2E5FA 4ZIRB 4HXYA 2AFIE 4RDXA 2OQ2A 1JHYA 1I3CA 4KU4A 5INTA 2W9XA 1H4VB 1U4NA 3IP1A 1YK0A 2VO1A 4YJHB 3UH1A 4DS3A 4MQLA 3WBFA 2O8CA 1KDOA 3MT9A 2XYVA 4R9UC 3SJCA 1P77A 1VE1A 5A6SB 5KNDD 4PCUA 1IH8A 2WIFA 5E4YA 1E3EA 2B1JA 2I6XA 1OLSA 2Q0QA 5H16A 4D9IA 2CFRA 4JJAA 1FRZA 1X7DA 2C9MA 3GLUA 1U2TA 5JPCA 3TG2A 2GM5A 5JFOA 3DEFA 1PT7A 1VLZA 1B74A 4FMBB 2MSKA 4GXNA 1AQIA 3LKVA 1X0XA 5FFMA 3AKZA 1ZQ9A 1DWPA 5A6VA 3GLSA 2H16A 1F6DA 2XB4A 5JATA 4BPBA 4IJVA 5KS2A 2DPLA 4GWKA 4HDKA 3KC2A 3A6DA 5KPDA 1E2EA 1NVDA 2VQ3A 4JLDA 1CP3A 1CR2A 1ZUD1 1NAHA 1PQUA 1ETHA 5ALMA 1VE5A 2FPIB 3SHQA 1IN6A 5BSHA 1KMMA 3AUFA 3C39A 3WLRA 2D2XA 3D6NB 1N1GA 3GVCA 3U4QB 3RARA 1FUUA 4RHTA 1K4YA 2FKAA 3R24A 4KO4S 2CBXA 1KYXA 4D4HA 3AJ8A 4Y6RA 2Z83A 3F9CA 3WYCA 4EUFA 3P4UA 5EMHA 1A27A 3SC3A 3FWYA 3M7IA 4MUIA 4ZI7B 4YDQA 1ZMTA 4D6XA 1YH3A 2BFMA 4EJ6A 4F45A 5HEKA 3UMJA 5AW7A 3D3JA 1NG1A 4YAKA 4FHFA 1KOFA 4HADA 1WOMA 1KXJA 1JKIA 4AJJA 3BWEA 5JFGA 3LXMA 3DUWA 4C08A 4PSVA 1MRNA 4NMHA 1UIMA 1W4AA 5K8CA 2ORIA 3L40A 3EEBA 4KREA 4ACAA 2GN0A 1LY1A 5JAZA 2JFUA 5HF8A 1T2AA 2F62A 2RHBA 5EUCA 4B31A 4J7AA 3WA6A 1IQRA 1CLEA 1Y0BA 2WKQA 4Q9IA 2AQ8A 3WGTA 2O19A 5AM0A 2HK9A 2G36A 3OTHA 4WFIA 1EZZA 2C03A 1SZDA 1LTHR 5CIQA 3T0IA 3ECAA 3HU2A 3KZXA 5K0ZA 4B45A 1WW2A 1EAMA 1PLLA 1UMDA 3OD1A 4RHFA 3H1BA 3HO6A 1P61B 1BXRA 3WISA 5L3QB 2ZUUA 2D4AA 1U2GA 5BORA 2C5FA 4G5HA 4QO7A 1WDTA 3WB1A 1E1QA 4G0YA 1DXQA 1LPAB 3QUSA 1FDOA 1W36D 3QVUA 3PL1A 3WI7A 3CLRD 4R54A 1SKUA 1EFPB 2OKGA 4JUFA 1KRHA 1W0JD 1RC1A 2M1ZA 2QHXA 4V39A 2LTAA 5B58T 1AV6A 1DHRA 2IUTA 1Q92A 1RXCA 1ZC3A 3GMDA 4U7HA 2F1IA 2EFDB 4RD4A 3T5CA 1MR3F 5AESA 3AO0B 2REQB 5H4HA 2CD9A 1DQRA 3A4IA 3RUIA 3QX3A 4REOA 4YCSA 4JDPA 1CJVC 4ILEA 1PV4A 1DBVO 2FSVA 5IYZB 3VC2A 1KJYA 2WAAA 3M81A 3W6UA 4DJFC 2I9PA 3MLEA 2WU1A 5CGQB 3VUEA 4HKTA 3ZG6A 1T5TA 1SB9A 3LPNA 1TVMA 1EWQA 2MINA 3MWEB 4B83A 4CPDA 1KVRA 4FWBA 2Q3LA 4JQSA 1RU3A 1NDQA 1W0CA 4UDXX 2E6KA 4RFSB 1II9A 1M2EA 2FFQA 4KAXA 1BCRA 1FJXA 1ARZA 1S89A 1RYBA 4J03A 5TMEA 3GLIE 1F6BA 1XHEA 3M6UA 3GDGA 5AVWA 2HHAA 3F5DA 1R4NA 4INPA 3ADKA 5DM4A 1GVHA 2HM7A 2IOFK 1E1NA 1GQQA 3O9VA 2YZKA 4FYXA 4JYZA 3U0VA 3UNXA 2IH5A 3DE4X 4F5EA 1REQB 1M7GA 3GPIA 1BXGA 4JI1B 1T9GR 4ZYUA 1JNXX 3PCRB 3OQMA 4ZCRA 1DRJA 4YJKA 1G5PA 1PR9A 1WBJB 5IJ0B 2AX3A 4PQGA 3ZWNA 3WL7A 1EGQA 1OI2A 4TT3D 4YQFA 4KQ2A 5CB4F 4MRVA 1SUIA 1L4HA 1M1YA 1RWOA 3NQ41 1PJRA 2GGSA 4OSEA 4F04A 1HFEL 4KWTA 3BT7A 2PFSA 4RD2A 4LPKA 4JGGA 3G2NA 2BEUA 3UGTA 4TSFD 3ZHSA 3K8QA 3BHJA 1JQ3A 5BMVB 1M1NB 2BCGY 2VF5X 5HUQA 3NV7A 1ESMA 2Q3BA 4QHTA 4RADA 1JSZA 2PXCA 5GZ1A 1MW9X 5BR4A 3GLTA 3UWPA 5AVXA 1YA6A 5J5AA 4NOKA 4BMVA 2QLMA 3EAFA 5E1MA 3VDMA 3VHQA 3R5HA 4FR5A 1NQOA 3DGFC 4IRUB 4CMKA 1WR8A 2BFEB 1KKMA 3IALA 4IUBS 4JFRA 4ARBA 1AO3A 1NIPA 2V55B 4PZ0A 3EDQA 3H2YA 4YO7A 3LL7A 1YA8A 3DH0A 1GPWB 3K9WA 1G3RA 1HFJA 3TOXA 5AVYA 1G17A 1CUVA 3A2KA 3A6ZA 5EPOA 5FNVF 1KZ7B 1RI4A 1ISHA 5J43A 4L9AA 5IVHA 5DN9A 4FN5A 3RUEA 4NE9A 1U99A 1HOTA 1R0WA 1OGYA 1FYEA 1Y1RA 1R0ZA 1ZSVA 3VAYA 3X2EA 3P9QA 4EHDA 1GAJA 1PWZA 5G0WA 4CV2A 3OCWA 5JS8A 4Q15A 2F8LA 3OF2A 4MDEA 4FEGA 5F2KA 1D4OA 2NQTA 2DPHA 4JVMA 5LDGA 4AWXA 4C5CA 3EDMA 1XIVA 2QYOA 1U5CA 2OLJA 3ZZ1A 4B4WA 2IW3A 3DW3X 3ESRA 5ALSA 4BFCA 3Q40A 3ROTA 1YFLA 1DQPA 4JT8A 2DPMA 3VR3A 3SHOA 4Z3OA 3G6WA 4XVHA 5LWQA 5HFJA 1L6IA 1MJFA 5JCOC 5FLYA 2G5PA 4MNTA 3RC2A 2QTLA 1R15A 1Z39A 5TS2A 3ZU4A 2GYVA 2XD4A 1XKTA 4P0TA 3FE2A 1SXPA 1ECLA 3K0SA 1JSCA 1ZFNA 4YIHA 3JW8A 2P0AA 5BSRA 4RJKA 4DYDA 1S8NA 5L9AA 1OPXA 2ANBA 1L7AA 2DWQA 3B1YA 2V03A 3C1TA 3GEEA 3LYAA 1I3KA 3ZGXA 1AMOA 4NE2A 2E5LB 2EW8A 2C92A 2WHRA 1PJCA 3IIMA 1M6HA 2PU7A 4MB0A 3PEFA 3DQZA 5DBGA 4EUKA 2RCNA 5HTKA 1LC0A 4G6ZA 4JC0A 2PLFA 1VZ2A 3G2KA 5BVHA 4KI0A 2CHGA 4H4CA 1OTXA 5KQSA 4GX0A 1FSFA 3I6BA 1NWHA 4I6EA 4TL9A 4MR7B 3PEWA 3VZSA 4FD3A 7YASA 4MTCA 3WKEA 1JSLA 3ELBA 4CXMA 3HDYA 1MTOA 2QN6A 3ZWOA 5SYNA 3TOZA 5AXBA 4MRMA 4BB6A 1U2DA 2FETA 3DOHA 5KDOA 3FNHA 2I62A 5JNVA 1VCOA 2Y1CA 1RJFA 1Y4AE 4KO1S 4UTVA 2D8MA 4ZDKA 1TTTA 1AGPA 1KVSA 4H3VA 1GGKA 5IKOA 3IP8A 1BDJA 2XAUA 1ZLYA 4PQFA 4AK9A 2QRUA 3H97A 3PXEA 1MB2A 2FRDC 1T35A 1U3DA 1G42A 1ZEJA 3PFCA 4O4LB 4OQYA 3SBEA 1YQTA 3UA3A 1ZI9A 2O5RA 1A98A 3NORA 2O9JA 2WNIA 1PR4A 4EKIA 3HFRA 2PQ6A 4U39A 2PS9A 3MT0A 3MHTA 3GR6A 4IILA 2P5TB 4CEHA 4PFSA 4A10A 1M33A 1EUCA 1P5RA 1C1DB 2FN8A 4BGIA 5IK2D 2H7YA 2FSUA 1RWMA 3HPQA 3LZCA 3SC4A 2YJZA 4PAWA 4Y2HA 4B4UA 1CB7A 2VCEA 3MW8A 1OSNA 4QOJA 2ZBGA 1RCTE 3TW0A 3ZW9A 4BLPA 5GIPE 1NY5A 1WCWA 4ZDWA 4C6TB 1TGYA 2ERYA 2CFIA 4R2XA 4M9XA 2VUHB 4IQFA 4FNGA 2VSNA 2G6TA 3MS7A 2GO7A 2IIPA 3IQDB 4DKJA 1RABA 3PQ3A 1NBMD 2PL9A 5ETJA 4BFUA 5I7AA 2LR0A 4W7SA 1SBQA 5FOUA 2IZ7A 5KVSA 2CVQA 2P6MA 3DTVA 1W36C 4U9IS 2HO4A 2AC7A 4OLHA 4YNBA 3UT5B 1WEHA 1V6AA 3F46A 2QRGA 3I92A 1GZ5A 1VB3A 1EZ4A 1RI5A 2C07A 2EX0A 2QTRA 3KR2A 1GXSA 3N7TA 3OF3A 4G1BA 2PSSA 1AGRA 1K5PA 3MMZA 5ELLA 2WOJA 4HDCA 3VR2A 5KYTA 2HV8A 3TLGA 1MA0A 1C3VA 1GOTA 3FKJA 4I9NA 5LJLA 2GM4A 4MWZA 2GHTA 1OWNA 4JAVC 2QDXA 4ZANA 4CFYA 1AN9A 4IIHA 3AKDA 1NNEA 1FUYB 3KQSA 4MVJP 2XMGA 3HUDA 2EX4A 1UZMA 4H17A 2AH5A 3I6QA 3A9VA 4LRWA 1Y42X 3NRCA 1QOPB 4S1NA 2YJNA 5AFSA 3UJ9A 3A3NA 4A8JA 4P3KA 4XPIA 1VGRA 5TQ2A 5LR6A 3IBTA 3BB1A 3F8WA 3BIXA 4G0MA 4B87A 2Y1OA 1NNI1 4JENA 2VSQA 3GEHA 3QXXA 2DQYA 2JIBA 4CTMA 3OCCA 2GARA 4C0BA 4F96A 1XU7A 2XEDA 3OOYA 1XD2B 4HB0A 1DBPA 3I9V1 1TU3A 3OOHA 4YRKA 5AUNB 2I4RA 3I72A 2M32A 1SHTX 2DX7A 5C5EA 1IHOA 1AKRA 2WVAA 2RAVA 2OCBA 5JCZA 2HU7A 4PBRA 1ZCAA 3R0JA 1KJZA 1XXHA 2VP9A 3LZDA 3PC8A 4MQ4A 4PR3A 4RFSA 1YUNA 1H2EA 3EBOA 3RNOA 2FQQA 1EGAA 3E3LA 3NW9A 4G24A 3WNBA 1DIBA 5AWFC 4F3CA 3TLGB 3V46A 3QWHA 1NWCA 4UU1A 4LF6B 3PITA 1NXXA 4M1EA 4ZCSA 4WZZA 2NNLD 1H85A 4J90A 3U44A 3AB8A 4LW8A 4GSYA 1YZKA 1YDEA 4JP3A 4HNVA 4YI3A 1XNHA 1PGJA 1QYWA 3CZRA 3H9UA 5HK8A 5KHAA 2PV7A 3ACDA 3R7LA 4OHWA 1Y3CE 1Z17A 3X1YA 1F4PA 4XYGA 3X1WA 2XNDD 3N6VA 5KYGA 1Y5LA 3DE0X 2SICE 4DPKA 2BFDB 4NCNA 2JI6A 4DXAA 3QBTA 4Y1EA 2AEEA 2I2WA 3MRVA 4KEAA 4BO8A 4EHFA 3U13A 1VA4A 2N42A 2YXBA 1KZ6A 4UMEA 5FWAA 5IXJA 3LWBA 4KCGA 3DUFB 2X5NA 4WACA 4DM3A 3MTBA 3W6NA 4M3NA 3FXAA 1KYYA 3KSMA 4L6AA 2WYOA 4F6CA 5BT8A 1J0EA 1GYPA 4R5HA 3ZI4A 3H8WA 5JNLA 2DT5A 1PD1A 1QRDA 3HADA 1BEZA 2PWBA 3KUCA 5TY0A 5EJ7A 2AXNA 4M1WA 1ZN2A 3PQ8A 1YS9A 4HX5A 3B36A 3LXRA 1KOGA 5AVZA 4OQ4A 1WVIA 2BBWA 2FEWB 1VMEA 5A05A 3QNMA 4P7JA 2VDOB 2Z5FA 3VKWA 1AQNA 3ETDA 1TA9A 4UE6A 4XLTA 3F6YA 3MBOA 4LGVA 2VEOA 4OHCA 2WFZA 4TZ0A 3GJZA 4RVGA 5G4KA 2A3RA 3IOMA 1F0NA 1FNSA 1G7RA 1SU4A 3AYXB 1CQJB 2XI4A 3SEQA 1TMGE 1Y1KE 4BNIA 1PL7A 2GKSA 2JGNA 4CM7A 2VVTA 2IVZA 3BA1A 5KWVA 1RQ2A 1PS8A 4MDFA 1UFVA 2X9LA 5DLQC 4I1IA 1QGDA 5DM1A 2NUAA 2REOA 5JBQA 3X43A 1E58A 3L49A 2ID8A 3K9BA 4ER0A 5FAKA 1OUMA 4XVQA 2CHQA 3SS8A 2I03A 4I9UA 4OFZA 4U63A 2FW8A 3NHAA 3NHRA 2Z5VA 5BVHB 5FBWB 1YHNA 3SBXA 2BHNA 3I1IA 4W1RA 4MZDA 2Q7DA 3OT5A 2XSZA 2DY0A 3AR8A 1B6SA 4P2BA 4AMVA 3FJOA 4XARA 4DLBA 5L45A 5DYWA 1CUDA 4G1FA 3BXFA 5I8ZA 3LQYA 3IAM1 1KA9H 1YULA 1Z22A 1DEKA 1N6KA 1YBFA 4Q3OA 4D57A 4EL0A 1F9AA 1NXOA 4O6VA 1SO8A 1BYUA 1X8LA 3ZEIA 4DARA 3WWEA 4UQOA 2A9OA 3I30X 3LVQE 1ZD2P 1T8YA 2W6JD 2V4MA 2VJNA 4EPYA 1DDOA 2J9YB 2Y6UA 2QYTA 3P96A 5F23A 4PPYA 4IOKA 1ORWA 3LWDA 5FWYB 3NP7A 1O95D 1Q3HA 5JS6A 1FFGA 3UHFA 2I7CA 1P19A 2G40A 3A2NA 4ENWA 3ZXIA 1BJTA 3C8MA 1YGYA 1DAFA 1SCDA 3L0DA 1WHSA 4MRPA 3AEYA 1ECFA 3I9V6 4XPZA 5LP6A 1P7CA 3RANA 3I4CA 1NBOA 4KE9A 5C1BA 1XA0A 1N7HA 3N0RA 1DWQA 3D1JA 3IBGA 2ACWA 3RHZA 4V1CI 3GLQA 3L84A 5HS6A 4A8HA 5JG7A 1C3LA 3G82C 1I13A 1P1RA 1SKAA 1XZAA 1PU2A 2OB2A 5I3CA 4BO0A 4GZLA 2P90A 4B3IA 3RT9A 3ZQ4A 1TIPA 4GLOA 4KXFB 5DULA 4C87A 3L05A 1M2VA 1NY6A 1DEAA 1UBUS 3GZJA 4JYPA 3N2GB 1TXGA 5C1PA 3LX5A 1OA0A 3DP7A 2P9ZA 1JHQA 4QREA 3VM6A 2XDQA 4RQUA 4L74A 4QIHA 2YX1A 4H7DA 4N0EA 2ATIA 1ODFA 2D5CA 1L7NA 3HVKA 2DR0A 3DVLA 3LY5A 4IIJA 3W4IA 4AO6A 4DGSA 3HXTA 4M7WA 2WJPA 3ETHA 3F73A 6NULA 2HMVA 1V5EA 3GL9A 3PS9A 4UAJA 5EIFA 4CG1A 5ILOA 2YNMD 3HBLA 2XXJA 1RXSA 3HB1A 3FAKA 1AC5A 1AKEA 4GZ3A 4R2WA 4G89A 5AVTA 2AF4C 5CTAA 2BW0A 1QV7A 1G5HA 1NT2A 2CLEB 2JLCA 2IY9A 1WO8A 2XECA 3HZHA 3V1TC 5K8LA 3H9CA 4QUJA 3TD2A 5KOHB 5BWMA 5DHTA 2BH2A 1EIWA 1R0RE 2I7TA 3H1FA 2HQRA 2W00A 3AQIA 5F9MA 1BMQA 1C9DB 1XRRA 2O2HA 3OMXA 2HA3A 3COPA 4XVRA 3CLTD 1XLUA 3RR2A 4AZ0A 1RPZA 1L4LA 1QFXA 4RIEA 5ALQA 4W6QA 1I2DA 1VCIA 3B52X 3GCDA 4L5CA 5F4ZA 2QAJA 4HMQA 1IN4A 2ZCVA 3EA5A 4L72A 3U60B 1DCKA 2G9ZA 2IZOA 2OOKA 2WA1A 1NXQA 2JJ8A 3PFKA 3MJFA 4C30A 3WQHA 3QEAZ 3PYLA 4HAOA 2WFLA 1Y6GA 1RQ7A 2R1TB 2BGTA 3WE7A 5TDHA 2GAJA 2I66A 3NV9A 2H3EA 2PX6A 4W8HA 4D96A 1PLJA 2TECE 3AJDA 2C4NA 3NT4A 3CRNA 5EMLA 5I3ZA 4D3ZA 2VHWA 3INNA 1YVDA 2WTBA 1TW2A 2F90A 4CGYA 1MOQA 2WMNB 5J4YA 1NUHA 1P8JA 1A04A 1F0PA 2BDUA 1OAAA 2I3BA 7MHTA 1VLHA 3JVIA 5TEVA 3WGQA 4NENA 3PUYA 2D7CA 1ZM4A 2IY7A 1P81A 3K9NA 1E5TA 2W43A 3GAZA 1Z68A 1QFMA 3HI4A 3QKWA 3A37A 4C0QC 4V0KA 1T5IA 4DUZB 4S1VA 4Q24A 3CWZA 3OQPA 2ZUCA 3LKBA 3BMQB 3F49S 3KLPX 4P82A 2XTZA 3M6LA 4FOOA 1PL6A 1Q6ZA 3AEUA 1D4ZA 4MMYB 3DWFA 3FFBA 5DI3B 3LHDA 1V8OA 1J20A 4P5PA 5DNEA 2XCLA 1HLDA 3I0MA 4WZAE 5D5PA 4AROA 1KJWA 2O59A 2WFAA 4GD3Q 1KI9A 2R1TA 4JGIA 3ZYCA 5EG5A 4Q3KA 1DKQA 3JQBA 4MO2A 3PDUA 4MZXA 3VNBA 2IH2A 2HT1A 1ECBA 2MT9A 2EFEB 1UM8A 3L7OA 4WKBA 5JWRA 3ZW7A 5BXYA 2AD1A 4YJ3B 4Z99A 1RXWA 3VX4A 3RUCA 5TC4A 2J3KA 3VNUA 1A3CA 4TROA 1T29A 4QPJC 5A5GA 4UUPA 5FNVB 2OCXA 4N39A 4BX8A 4OHPA 1R9MA 4WV3A 2WOOA 1W0KA 3PXCX 1MPXA 1TYAE 3CPJB 1S01A 3PC8C 3QYAA 1CR4A 4YGYA 3DZKA 1KEPA 2I67A 3FZEA 2GJ4A 3CYFA 4X1IB 5AW1A 1SXIA 4INJA 3H1PA 2FJ0A 4NMMA 2R4TA 3RJMA 5CURA 5C81A 3Q8LA 3DOUA 1AH2A 2NUBA 3NBQA 1GUYA 3J7AC 3DEAA 3ABQB 1HT3A 3I34X 2I2BA 4ZPXA 4RD6A 4FILA 2H2DA 1WB4A 3DDUA 3C3PA 3MCWA 5L51A 3HYSA 1FXWF 3T99A 4F86A 4JI0B 2IP4A 3MM4A 3U26A 2PL3A 1B8PA 3ZZTA 4AIRA 2D3WA 3KUUA 3MBKA 3G0BA 1HH4A 4PLVA 2XDAA 2N1MA 4WPGA 1A5AB 5DTRA 5JT1A 3PYXA 4PIVA 3C43A 3AFOA 4FFWA 3UOGA 3IVRA 4BVAA 4DV1B 4J16C 1F8UA 5ES3A 1VXOA 1RT9A 1Y63A 2XB9A 4QTXA 4YLEA 2ONCA 5E0KB 4HVLA 4P92A 2KE5A 5IX8A 1YONA 2QWXA 5E7MA 1D03A 2DE0X 4QG7A 5A5VA 3U31A 2CXOA 2WF6A 1ZH8A 2OBBA 3T0FA 4LK3A 1JX6A 4L9RA 2VKTA 4EJSB 3TX6A 3NTRA 1VPLA 5B55A 2XGJA 1M1YB 4U2BA 2BUBA 5JRZA 1A9PA 3WSTA 1TYDE 1RWWA 4DRXB 2HK7A 1ETUA 1PDVA 3S1AA 3KZ1E 4LFCB 5DGIA 1YTLA 4HDMB 3AR7A 3JVDA 3LU1A 1F17A 3UJ6A 1EUZA 3AJAA 4GNKA 4I2NA 2YYZA 4DGQA 1QM5A 1RWQA 4YRMA 4UUOA 1VBKA 3KAJA 3P2IA 3FBWA 4BX3A 1CY2A 2XMRA 4I3HA 3Q8WA 3R7AA 4AFNA 5IULC 3V8EA 4WFKA 1WNTA 4IIYA 4Y9TA 1SMKA 1N8NA 2ZITA 1CD5A 2COUA 3E15A 4XWTA 3DP9A 1ES9A 4JI6B 3LBYA 1MH9A 2X3FA 3IEIA 2WI8A 4OHKA 4U6QA 3S1SA 2PQ0A 4BO4A 2Z6UA 1JVBA 1RRCA 3MJEA 5F2NA 3FUUA 3MGBA 1PTJC 3GLRA 2ENUA 4WMLA 3BJZA 5F51A 2RHWA 1IMJA 4A36A 3HCAA 2V1XA 2J09A 3KM0A 4Y2RA 4Z54A 3G1WA 1D3AA 2YICA 2NSLA 1SKYB 2ZE6A 1MO2A 1B15A 5K3OA 3HZRA 3HP7A 5CNJA 2YY5A 1IXZA 2A5LA 2JVIA 3EF1A 1MB0A 5IN4A 4BTLA 5HKLA 3N6XA 1F0KA 1OROA 3DZCA 2I6FA 3W5DA 1Z9BA 5FT9A 2P75A 4XGKA 2QUHA 3AFNA 3CNHA 3FLBA 3ZHCA 2P30A 5C7IO 3T1TA 1Q91A 5A3JA 2B94A 3MPOA 4BN0A 1K9VF 1QRTA 1NFFA 4FI3C 3AERA 3WWYA 1SULA 1YQQA 3R3WA 1ZN9A 3IR5A 1W44A 3UJDA 5JQWA 2GN6A 2ACVA 2XDQB 4BCBA 1MGPA 4KH1A 5FI1B 4BKOA 1NV9A 2ENWA 4E7PA 1TTPB 2HKIA 3BG5A 4E1VA 2W6IA 4DW8A 4PYMA 2YS6A 2EKQA 2IBTA 3P0IA 4PX2A 4B3MB 4YXWD 1E77A 1JH8A 4HWPA 1AK1A 2JLUA 3H9EO 3OEYA 1ZWKA 3Q2KA 4BQSA 3CO5A 1GU7A 2OQIA 3DL4A 1KE1A 4F93B 3VR4H 2D1YA 1ZH0A 3VU3A 1RXVA 4XZ3A 2CWDA 3VXKA 1KI3A 2CLKB 2MR6A 3PRHA 4CL3A 9GPBA 3KQKA 1A1VA 5EUBA 3CKMA 4RZQA 5GOTA 1CDDA 3IXQA 4FFSA 2O7NA 3GRCA 4UOEA 4HVTA 5B7NA 3OE4A 1JFLA 3B5JA 2NZVG 4YMWA 5LYJF 4RZ2A 3TLBA 3RIYA 2HLDA 3ZVNA 5AW6A 1JAZA 1IXSB 4I4NA 3RUHA 2XOKD 3PDWA 2B2CA 2D2EA 3U4DA 3E9CA 2JRLA 1NW3A 1C7RA 1FP4A 2LZ0A 4MJ7A 3OI7A 3UUFA 1Z2DA 2ZLBA 4RO0A 1VSVA 5KCMA 4PR0A 4M88A 1D6MA 1JKJA 5TQJA 3ED5A 4G25A 3GJYA 1QF9A 4K03A 5ALKA 4AKTA 3T5PA 4I2VA 4JA2A 4PTLA 2EHJA 2ZJ8A 2H2HA 1QIHA 3SS7X 3Q7QA 1U31A 1KL7A 2GYYA 1OVGA 3B5EA 3LYUA 3IT3A 3S44A 4GI5A 6AT1A 2ZAOA 3T9EA 4YMGA 1QE0A 2JD2A 4KDCA 4EB8A 5NULA 2VQDA 4KAAA 2EXXA 3ELWA 3I2KA 4EJ2A 1EX1A 4F2WA 3F7NA 3FMPB 1FJGB 4HX9A 1W29A 1FS6A 3MMNA 1Z73A 4BNTA 3L8YA 2Q2QA 2QN8A 3GNTA 1R16A 1AXEA 3LS2A 1ZXLA 3LDGA 4HAUA 3DZFA 1UDCA 1UKYA 4UE3S 5BV1A 4LBZA 1HG0A 2ZWIA 5GPBA 1VHWA 3E81A 3FPBA 1T4DA 4DJAA 3DHEA 1H69A 5D1NA 1KXZA 1RFGE 1ADGA 2AN4A 1PJTA 1WP4A 4E2ZA 1A88A 3DZ8A 1NRJB 2ID4A 2QGZA 4NBKA 3C8DA 4ARZA 1AJEA 5ABPA 2F6RA 2H8GA 1GP2A 2GS9A 2X1VA 1VIVA 1G8MA 3R6DA 1E64A 1DARA 1VMAA 2GI4A 4QO8A 1L8LA 5H3CA 3UC5A 4M76B 4ONEA 3AR2A 4ZQFA 2DBZA 1GT6A 1G291 3D02A 1KAGA 2PR2A 3M4YA 4HK4A 1U28C 3NWOA 1QTRA 2RSLA 1U8YA 3PC3A 4B6QA 3HU1A 4DLYA 3C5HA 2EBHX 3JYLA 5AOAA 4LUCA 3I05A 3C48A 3QG5A 3KSRA 5K3FA 4UCXA 4ZEOA 1E98A 2CUKA 5KSOA 1C7IA 1M72A 2CE2X 3KZMA 3JQ6A 1XVTA 2XGMA 1BZYA 4JMLA 4PLHA 5ISMA 4TS9A 4Y7DA 4EEKA 3UIEA 3LY9A 2GVZC 3R6LA 5EPUA 1GPLA 2VWHA 1RIFA 3PDHA 1VJRA 1WDWB 2Y1GA 4HEQA 4MR9A 2NO5A 4Q1DA 5D7BA 5FF9A 5HILA 5CCDA 3MCAA 5H4GA 4B3GA 1BVHA 2VP6A 4ILKA 2G1PA 1NYTA 5IJAA 3GGJA 3AR9A 3KTOA 2C9ZA 4TTRA 2Q49A 2YN0A 1PD0A 3CIFA 3UQYS 3TMKA 1U2PA 1WPXA 2OAQ1 1HC7A 1IIBA 4QOEA 1KP3A 1T2EA 1KJJA 3PGA1 1OZFA 5K3EA 5KSYA 2WJGA 3OJFA 4LI3X 1XZ8A 2WBLC 5TJ9A 3K0AB 1KK0A 1Z2EA 2L0XA 4Y7CA 4D3DA 4DNQA 3OQOA 1NG9A 2G82A 3SJZA 4I4LA 4XIFA 3UYLA 2ZRAA 3NETA 3LTEA 2Q07A 3E82A 3ZVKA 3H9JA 4BNDA 3ZJTA 2FHSA 1BRMA 1ZA1A 2VAXA 3SJUA 4CBVA 2EJWA 1EVJA 3IUEA 3G68A 1ZK3A 1H94A 4F7WA 3ZKWA 3KEFA 3RAFC 4YJ2B 4JKOA 5TXGA 5EJIA 4UULA 5KZMB 1GKLA 5IC6A 4OO3A 4EPTA 1DU4A 3OTWA 2V6BA 2X0RA 3EJWA 3PXGA 3UPUA 3HDGA 3A1UA 3DFIA 4A2PA 2PV0A 4UHJA 2XVMA 3RBXA 1KYVA 3VGJA 1CRLA 1SUEA 1H6BA 1ZISA 1RCUA 2GX6A 3A4MA 4YRRA 3HDQA 4NFLA 1U98A 3IUNA 1YTUA 5FWDA 4NYIR 4R98A 1KH1A 2JHFA 4MO9A 1V3UA 3ZGLA 4FONA 2YVAA 3N7AA 3SP1A 4KO8A 1G5RA 4OQEA 3RU2A 1CNFA 5BWOA 3VJKA 3O90A 2I2DA 4EMSA 4KG7A 2COEA 4ZEWA 3VOBA 2X5OA 3IA7A 3L4BC 3FOEC 4NPCA 121PA 4S0ZA 2HJ9A 3PRKE 4KOEC 1WABA 2EJUA 2XUZA 1Y8ZA 3GGSA 3WIOA 5SY9A 4LE2A 2ODNA 4UVHA 2ZQ5A 3EUAA 2CLLB 2OVFA 3R7NA 4D3XA 4G86A 2RB5A 4LJ4A 4KXNA 1EPUA 4O4LA 4ZO9A 1N2XA 3MK31 1GNQA 4LDRA 3B7PA 4B81A 1EVEA 1AK9A 4D0RA 3D7RA 1Y7LA 1NW4A 2FLVA 2PSHA 4LMAA 4G8BA 3RC8A 4LQCA 1VG0B 1M2FA 5ALJA 3IEVA 4HN9A 3CLUC 3GPCA 4X20A 1RAFA 2W58A 5EERA 3TOCA 1U0EA 3SNKA 1JG7A 3ZJ5A 3K0CA 4UBOA 1GNRA 4RHEA 1ZL2A 1A2QA 4LZOA 1PDOA 4OL9A 1AS2A 2LE0A 5KTKA 1ZW6A 2QG9A 2VJKA 4R81A 1DX4A 4AUKA 3ZVLA 1CDZA 2A9PA 2ZIFA 3GARA 3R0IA 3TGWA 3U62A 5C32A 1GKIA 3W8RA 1RAHA 4PX5A 3P2MA 3WV4A 1J7JA 1MFPA 3GFQA 1BX0A 5CITA 3CGGA 1Q15A 1XO1A 1FMJA 2K7ZA 4IX9A 4J6FA 4MKXA 4R1UA 4XKJA 1ZQ1A 3RSHA 3RABA 3VO1A 3GLFA 2BM1A 2J3IA 4AP9A 5IABA 4LWPA 1Q12A 3X1MA 3GQVA 1U02A 3H13A 1Y8QA 3Q0TA 4TPKA 3KBOA 1TUBA 2H85A 1N8SA 3FR8A 1XLWA 2SCUA 2CKDA 1VPEA 3L7DA 3PJGA 3RS9A 1VSBA 1JTEA 4FQ7A 3TG8A 4OCZA 2P5YA 4R1SA 5LPNA 3VMMA 2AJDA 4X54A 2DY1A 3W6OA 4NBTA 3MN1A 5HR5A 1HZZA 3WJ7A 5KTOA 1E89A 10MHA 1KEWA 3L1IA 1XQYA 5LWHA 1PEAA 4QPDA 3PSHA 3VZQA 1NRWA 3N74A 3JQDA 4DMFA 5B3KA 2PD6A 5IU6A 3HXMA 4YR7A 2TRSB 1U1EA 1S9DA 2NTVA 1DAEA 3D6HA 3I23A 4GKVA 5DI3A 1S3GA 1QONA 3N2NA 2H00A 2YMPA 2HU5A 4L57A 3S68A 3WYEA 1E92A 2PYIA 4N7RA 4IVPA 5EQFA 2QV0A 4LHWA 4C4AA 1EB9A 2XRZA 1O95C 2KB0A 5THQA 1YB7A 4D4KA 1URPA 3ILVA 3SNHA 2I71A 1AHNA 2JI7A 1MMFB 2Q2VA 2VL7A 3AY3A 3VR2D 3F47A 2JGMA 4IOLA 1QR6A 2O8FB 1DFIA 5A9TA 3WXMA 3QUTA 3WL3A 4DY4A 5BNZA 3OM0A 2YFYA 3FETA 1NRXA 5IF9A 2Y0BA 3RI3A 1I3LA 1SXJB 2AN5A 2DHDA 4GBGA 4GOMD 1PJ4A 1L6RA 3DO6A 5ITVA 1TQ6A 3UJ8A 4BKUA 1W8DA 5F1YA 5L40A 3PNLA 1W5AA 1PQPA 1W49A 4X1KA 1P1BA 4HH1A 5HGJA 2RI6A 2C2HA 2QTCA 2W71A 2XNSA 3EAQA 4OJNA 4ZT2A 3SYRA 3ESAA 1BDHA 3QI7A 3HLKA 5K6TA 2VEDA 4QQ8A 3FHLA 4RXUA 3ABSB 3AC0A 2ZT6A 3LUKA 1Q0ZA 4G8JA 1WQ3A 4AZ3B 2G71A 2FWIA 1THZA 2M6SA 4LF7B 3L7BA 1NN5A 4I5DA 3O1IC 4UM5A 3TD6A 3CT4A 3FFTA 2VSXA 3I04M 3IUPA 4LDNA 4DRXA 1NMZA 3PC4A 5LBIA 5A9RA 3WLMA 4D9BA 1TZMA 1FFWA 4LJSA 3KYCB 5K1ZA 2DOKA 1E0KA 4URZR 4LC9A 2JASA 4BWVA 5A4IS 1OC2A 3PGLA 1ULSA 4X65B 2FQWA 3R5XA 4EJSC 4U0JA 3D8NA 5BN5A 4B3TB 4WA8A 4YUXA 5HZKA 5HYVA 4EL5A 4XVUA 1NVMB 3BE4A 2YWEA 2C98A 4OB6A 1R3UA 4ZD6A 3S2YA 4NS1A 2O8EA 1JIUA 1PNOA 1YB4A 1MPTA 5HJ5A 2W8BB 5TVGA 2ANCA 2REBA 5BRAA 3H0KA 2XZPA 1W9HA 4I1VA 4GRDA 4UUAA 1X3LA 4P81A 1MNQA 5DU2A 2VNKA 4RL6A 4OSPA 1KO8A 3T9AA 4E33A 1NBIA 1IN7A 1SBNE 3LUHA 2FPRA 3M0EA 3G9ZA 1EUDB 4PG7A 3OUZA 3H1TA 3RU7A 2IH4A 5J5VA 1UQUA 3GZ4A 4H0NA 4IV8A 1G8FA 5AH0A 4TXNA 5DLYA 1SKBA 3ESBA 4KQHA 4WCFA 3TDMA 4Z0NA 3MXTA 1YE8A 4RYLA 1TTHA 1ZJZA 4QU8A 2OPHA 1KO5A 1NLZA 4DUGA 3EEFA 2YKGA 3WLJA 2EBUA 4YCCA 3PJFA 4B85A 3MJRA 3N58A 5MGNA 3CW2A 1E2JA 1FDTA 1R8SA 1TEHA 4J1TA 3WFJA 3KEMA 4MPJA 1XJCA 3EVEA 4IMIB 4I8XA 3TLAA 3ESDA 4YAFA 4YV0A 2FR1A 2O1WA 4P84A 1RPJA 3L7KA 2Z2JA 3GMTA 5EIEA 2JAPA 1C4OA 3E7FA 4XX0A 2W6QA 4TYMA 1XLVA 2IEZA 3T0GA 1K6IA 5TX7A 3TJRA 4DG8A 5JVDB 1L5GB 1Y89A 3N8KA 1UXHA 1QHHB 1W4RA 3UCEA 2BCJQ 3NHPA 1M3SA 2O2GA 1BXGB 3FLEA 5LUBA 3ZJYA 2EW2A 4ZYTA 4GMGA 2XODA 2AOUA 2FPWA 4PPQA 3EGXA 5HG0A 1O77A 5EHXA 1T8UA 1NE7A 2AA3A 2QVLA 4DM7A 3QUBA 5CIYA 4BMOB 3COJA 3IGFA 3HY4A 4B73A 4CQLA 3M4ZA 5CD1A 3D6MA 5JQGA 4Y1FA 1BXKA 3VNQA 4AC9A 3EE6A 1WUKS 3VSBA 2DSNA 3L18A 2W2NA 1YQ9A 1Z8DA 2FSFA 2XA9A 4JR0A 2IKSA 5DFAA 5GVSA 2HI0A 3HVRA 1N34B 4LWQA 1NSYA 4B0PA 4AW9A 4TWJA 4L6CA 4JI3B 1TJ4A 1U0GA 3U4QA 1XZBA 1T9DA 4KE7A 3N3AC 2LWIA 1E94E 2V3VA 4RETA 4RNCA 4I5FA 1QGUB 4NU5A 1GRVA 2F8SA 1JA0A 3MYRA 5TF0A 1IY0A 1DIRA 1I4DD 1T6ZA 1X2BA 3MSCA 1GITA 4L6IA 4F7DA 1U4OA 5I4IA 3D6VA 1Q21A 3MA0A 2ZYWX 1JHDA 3NYIA 2AYXA 5FQOA 1WVMA 2LGJA 4KQFA 1OB5A 4J6EA 2XQVA 4EY6A 5I7HA 4FYMA 1BE8A 4KRGA 3TDKA 5HOEA 2JKVA 1E79A 4X24A 2AKAB 5TB5A 3ZY5A 1FVOA 3EAGA 1XDSA 1NVXQ 2W93A 3KQTA 2FF5A 4LXUA 3G9QA 1A7UA 3L04A 5ALRA 4MQ5A 1ML4A 4G4JA 4AZSA 2GCPA 3E5NA 3NCTA 1Q0LA 2NO9A 3HVHA 2YINC 4P80A 4D3FA 5JDIA 3U1BA 1R9JA 3LYLA 5D3MA 3SQNA 2NM0A 1Y8QB 1OU4A 1XAGA 3CEMA 3KU1A 4KQWA 4RD1A 4TV9A 1WEKA 1PIWA 3SEAA 3U09A 4CMCA 3DWEX 3I42A 4DCGA 2SCUB 3JWEA 4M0PA 4PSKA 4HAVA 4Q02A 1DUIA 3S7TA 2DLDA 4DBLE 2CXPA 2Z2IA 4GGPA 1NZFA 5FTJA 1OE0A 2VUUA 3ID6C 3OWXA 1B6TA 4XQGA 3UENA 1T43A 2G76A 5EFOA 2XEXA 4X64B 3ZKAA 5KPJA 5K0CA 5BW8A 2ZJFA 3OTGA 4Y2UA 1JIKA 4DDVA 1ZJYA 1Z2CA 1PZHA 4ATNA 1XSEA 1HDOA 2BJWA 1IONA 2BOVA 2JIQA 2NVWA 3SYTA 4MCIA 1FE8A 3GPDG 4DA7A 6LDHA 5CU7A 1HYEA 1C8BA 2CNWA 4AN1A 3T3NA 2VDPB 2VF8A 3IH5A 1JLSA 2HSJA 3CX7A 3W6ZA 4IIJB 3LA8A 1D07A 3RVJA 4U4AA 2RG7A 4NP6A 5A5FA 3EEOA 1FJ2A 2A1TS 1FDIA 4OXIA 3VNRA 3RUAA 1FVFA 5I4KA 1V45E 5JS1A 2MSLA 1H65A 3BEDA 5TNXA 1K7EB 2HT6A 5KYVA 1YZVA 1II8B 1XCBA 1JJ7A 3KQMA 3L8FA 1SNYA 2DYKA 4FINA 4HT3B 2JIOA 3I39X 4AZ0B 4FFMA 2O5CA 2QRMA 2H18A 4MJLA 5JCPA 2V6MA 4RAQA 1K5DA 4MVJH 1ISRA 1JQ5A 2BC9A 3P52A 4MVJF 3WR5A 3KXKA 2WWFA 1Z5GA 1P72A 3GVIA 3NBXX 3QX7A 4PF1A 3LKDA 1X1RA 4QJBA 6YASA 4JBIA 4Z51A 4WKCA 2HADA 2XIJA 3BRQA 3DL7A 3NONA 2AOXA 1J49A 4NXNB 2C31A 3HABA 3K0HA 2C8LA 3WP1B 1CTQA 3FCUB 5KOIA 4C7VA 3D7NA 2HYIC 5G1OA 3AHIA 1DADA 2B8WA 1JIQA 1KZYC 1O6BA 4M99A 2RHRA 4CMJA 3Q87B 5D8DA 1S0UA 4TM7A 5HW0A 3G0CA 1Z4IA 4B6JA 4BJ6A 5B12A 3LSYA 3TNDA 1NBWB 3BIFA 3F8SA 4ZOLA 1KSHA 3QVVA 3LT1A 4R3WA 5IT9A 5LZ4A 1O58A 2QT9A 2BAGA 4IJQA 4Z7NB 2DHRA 3B7GA 1YD7A 4M9UA 4D9MA 8LDHA 4CKWA 1UKAA 1OXUA 3GEMA 3RYHB 4HWRA 4K2HA 2GD2A 5FOSA 2VNAA 2XLCA 2HV9A 3D1LA 1LZLA 3KR0A 4Q12A 5AM3A 4XUGB 5LD2B 1MJGM 1NRIA 3F67A 2QD3A 1SCQA 4EUSA 5J4HA 4AUNA 3LDFA 1B6RA 3BXEA 3TRHA 3HY3A 1DFHA 3HKEB 1NMQA 4GBMA 3TSOA 5EPEA 4CTOA 4F5DA 4H7FA 1Y4DE 1QCDA 1RZRD 5C8XA 2PZMA 3SEZA 4CMBA 1TJ5A 3BGVA 2H2AA 3AUTA 1P74A 2O05A 1W5TA 2WUVA 3N8IA 3T61A 2Q29A 2AMJA 2QU8A 1FFXA 1JPUA 3IAHA 1V3TA 5C8YA 3EFHA 4AP6A 4GKAA 5BQFA 5CA1A 4LA4A 5DTQA 1PV1A 1E5LA 3U3KA 2RAPA 2PRYA 3JAWB 3KQHA 3DBLB 5CDSA 2Z04A 2HREA 2W7TA 4JCOA 3WZMA 5IANA 3GUVA 3E8MA 2L2QA 1GQFA 4YB8A 4CMHA 1BWRA 4MDYA 5LMCA 3IXLA 3W8FA 3QVSA 4EARA 2VDLB 3DEZA 2G83A 2B83A 4PBTA 2QTBA 2Q3MA 4LKRA 4DOMA 4X71A 3SXPA 2FF7A 3RIXA 4C2BA 1QCCA 3L9WA 4HDSB 5DIZA 1YRLA 4BKPA 2ZIGA 5J4LA 1QGZA 3WHIA 2ALJA 2YVQA 3QTLA 4IQ8A 4L51A 4E21A 2VHYA 4GQBA 2LKDA 1WNFA 3RWBA 4AVYA 1KVQA 1T91A 1U80A 3LIPA 4X91A 2XCQA 4HN4B 3UMCA 3V9AA 1WZNA 2WWXA 1PHRA 3TL3A 1WXGA 1PZNA 2F9LA 5FOVA 5HRUA 4FZRA 2GMWA 2OYSA 3AQ4A 2UAGA 1Y1QA 2A9KA 2QW0X 3DKRA 4BB9A 4BGEA 4GZMA 4WRRA 5J4VA 2JRCA 4E0BA 1AQJA 5ALUA 3SJAA 4ZO7A 2CV0A 3OZDA 3TZKA 4X6YA 4RK7A 4DIMA 3A4YA 4AXXA 3PFWO 1GV1A 1L4EA 4BMXA 1SVMA 3IDQA 2WYWA 2XKAA 5EKSA 3JYHA 5KB3A 3TKYA 1OBVA 4N6OA 1KK1A 4ZQEA 5BOVA 1OLXB 2J5BA 3BS4A 5H82A 4J1QA 4FXOA 5IBCA 1YT5A 2A0WA 1SCNE 1T3ZA 1TUIA 2BFBB 2IF2A 2PHZA 2Q9CA 1F8XA 2QORA 2ZRCA 1KARA 1Y7HA 4V3CA 1KOLA 1AHIA 4ALKA 4YXFA 4ZT3A 4NULA 1PKXA 2W6CX 1DZIA 3EF3A 5CHEA 1ZM2A 5LA6F 1ZAKA 3WFIA 4Q34A 1B3BA 4LDAA 4CIVA 4B48A 4OHUA 3RYCA 4DEVA 1ZD5A 2RHCA 3U80A 5JI2E 1Y80A 8ADHA 2XZTA 2UYHA 4KH0A 4W9NC 3QLUA 3KHKA 3TMYA 2CLDX 4P9NA 4EG6A 3OFND 4PRKA 3KWFA 1KMCA 1TZKA 2P3OA 3P45A 3BFVA 3H9BA 1XQ6A 2YW2A 4ZO8A 5IJZA 1GRNA 1ZI8A 3GJTA 4J0KA 1U28A 1VHTA 4QGFA 1WXEA 4HN2A 1KYQA 2AC2A 3CN7A 2XOXA 5DPMA 2WY2D 2OCYC 4P2GA 2WAYA 2F4NA 5IBRA 5JHHB 3WB2A 5KVAA 2C7OA 1P6XA 3SHTA 1P6UA 3V2GA 3KQOA 1IY1A 5LQRA 3PLNA 5IDXA 5EESA 3WLLA 1UPCA 2OUKA 3PU6A 1JYEA 3FUTA 4OHYA 1SQ6A 1Y9JA 1UJ6A 3D0OA 4A27A 2AKEA 4RY8A 4YROA 5MGBA 2V7PA 3K1AB 4OGWA 3ZWPA 4FIDA 4MPPA 1G20E 1J2UA 1K6EA 5FQNA 2H17A 4Y0VA 3OCJA 1ACJA 1CJUC 1L5KA 1PEYA 2TS1A 2GERA 2X2OA 1T4MA 1YNSA 4BZWA 7GPBA 1YZHA 1YR8A 3GV0A 3ZE7A 3TRKA 3CLRC 2CK3D 4ZGWA 3P0RA 1QO0A 1XZMA 1L9KA 2UDPA 4MUFA 1SJ9A 3RAPR 2NT3A 2J5XA 2EERA 3L06A 3DPSA 3ESQA 1V5WA 1TF2A 2P1DA 1QNLA 2R2AA 3LX4A 1JU4A 4ABTA 4K9QA 5JH7B 2NO1A 3QVXA 2DQZA 3ZLJA 1P9RA 4ZAZA 5B3JC 5MFZA 3GT4A 3A3OA 2HDHA 3D5EA 3CNLA 3DJYA 4UVDA 1XX6A 3W8DA 1GLGA 2GBIA 4KQGA 4DQVA 2MR5A 4ALLA 3EC1A 1FQWA 2W6JA 4GWGA 3C8HA 2RJOA 2QXYA 5E4FA 2OXEA 3G7UA 4PGGA 3S2SA 2PEZA 5ALOA 1TYEB 1U0HC 1IUNA 5FHRA 1AGXA 1KZ4A 2VPIA 4MA4A 1SC4A 1KFBB 1IZZA 1L5SA 1UEXC 2FOLA 2FZEA 2GWRA 2R8BA 3KKZA 1EBUA 4IV0A 4PU0A 1A4UA 3ZBPA 3ZX4A 4JITA 2DQ4A 2Q7XA 3N0VA 2HU8A 5A3VA 1CIJA 4HXGA 4D45A 3L46A 4BEWA 3AW9A 1J0DA 4LE0A 2JC3A 3T06B 4EEZA 4UTRA 5F7OA 3MCZA 3DNPA 3NTUA 2KQUA 4LV8B 1ZK4A 5CLQA 5IC5A 5LP6B 2EGGA 1GFIA 1W76A 3EWAA 1NW6A 1NVAA 3MJ4A 1HF3A 4W8GA 5LQMA 5ARCA 3THRA 1JQAA 1XP8A 3GMIA 3IR6A 4J0JA 2HGZA 4CKBA 5JH7F 3W5VA 4B7CA 5KVVA 2E9SA 4UM9D 3HEMA 5IBPA 4EO9A 2HRZA 1Z6YA 3TZHA 4CMEC 1SY7A 1A8QA 1PF7E 5FNZA 4BLVA 2XW6A 3SFVA 1R5NA 2FZ5A 4D9HA 1QS0A 2O14A 3TQFA 1Y48E 3CURA 1P7ZA 1NW5A 3GF4A 4O1IA 1GNLA 2B7LA 2H2GA 4KQEA 1PT8A 1JA1A 4XPIB 1QG0A 4LWOA 3O9ZA 5TV2A 3O26A 1XRSB 3N86A 3W90A 4CF7A 5AVSA 2RGAA 4DV3B 4D2IA 2Q6TA 3LH5A 3LOUA 1GARA 1AUVA 2AB0A 4YP5A 4US2R 1NBEA 1VL5A 3BILA 3OQ1A 1KAHA 4FYHA 5HE9A 1ONOA 5AKIA 5CAEA 5M29A 3KKMA 5FUXA 4NPHA 2Q45A 3DE2X 3GB9A 2MSCB 2BKAA 3KPVA 4FT2A 3V4VB 3CRZA 4QVKA 2R25B 1KDYA 3O8BA 3UAWA 3WLOA 2JH3A 2JVKA 4HDAA 5AHRA 1UDWA 5LXTA 2O7SA 1H8ED 3TM5A 3L6UA 4F4UA 3N75A 5SICE 1QHIA 3DAFA 3A9WA 3L7AA 1OILA 2P4SA 4QVIA 4TTAA 3N70A 4G84A 4MQMA 4WCFC 4Y9RA 2F1RA 1RLTA 3L1KA 1H93A 4P7BA 1XBTA 4NMXB 4V2IA 2C4TA 5B37A 1SXHA 4CT4B 4AMUA 4MRMB 4I4TA 4KLAA 5HFNA 3V6MA 5JWHA 4CW7A 4CZ2A 4YMLA 2HGSA 1W1WA 4PANA 1TM2A 4WL0A 1C7QA 1G7TA 3R44A 3MUNA 3BMCB 4CKZA 3GRPA 3SJ7A 4C14A 1EDOA 3VI3B 1I5OA 1R0KA 1P0MA 2CLSA 2QNRA 3KOXA 4FDAA 2R0QC 4I1UA 4MI1A 4IP0A 4PONA 4Q37A 1Z08A 3DE7X 5JO0A 1PLKA 4JXXA 1CG6A 3KJIA 2BFAA 3WDLA 4E2YA 2G77B 4JWKA 2BEWA 1V6CA 1XNGA 2FW1A 4IMRA 4ESEA 1CUEA 1A9YA 4CEHB 4X63A 3DFMA 5AXAA 2YH2A 3FZYA 3LL4A 4CLRA 5I7FA 1KFCB 4QOHA 1LH0A 1L5LA 1L4UA 2QTZA 4N5NA 4QDUA 3ME5A 5E7JA 3V1LA 1ENOA 3W3AH 3GP5A 5KQLA 3L7IA 1DLIA 2FWNA 5DX1A 1S3IA 4BTEA 3R74A 4ZHQF 4N9QA 1HURA 4LFBB 3FOCA 4QBKA 1E2LA 1X1AA 2AFIB 4OXYA 4HYTA 3DPIA 4XGNA 4HMOA 1S2LA 5ALPA 3IIKA 3LWNA 3CR3C 3OIVA 4F2HA 1OFHA 3G5LA 1M66A 5BR7A 3UB4A 2P9JA 4RIIA 4YBZA 4E15A 3SYNA 1CPYA 4IM7A 4NJOA 1JEEA 3L4KA 1BE6A 3VR5D 2C4HA 2NZXA 2UZ4A 4WLFA 3DBHB 2X9GA 4BUCA 1SVSA 2FR8C 1LS6A 5EJFA 2XBMA 5T6BA 4R7TA 1FLNA 4NI5A 4NF2A 1X77A 3CH7A 3JQGA 4FE3A 4KE6A 3E2IA 4XB1A 4DA4A 1NPTO 1EXDA 3UGKA 1N0UA 4PAQA 2GJ8A 3KQQA 2Y93A 4C7MA 1RQNA 1JR4A 2I1VB 4U2CA 1IBRA 4IDPA 2I5PO 3L0CA 1IG0A 3RFVA 4MW6A 1C3JA 1B8NA 3KPJA 3Q3CA 2FCRA 4MPRA 3VX3A 4KLCA 2JLSA 4KGXA 1P9OA 4CIXA 1H66A 2WJZB 3DDSA 3G2JA 5JJIA 1XNQB 3ASYA 4TLAA 1V4VA 3M33A 4L22A 3UG7A 3O3NB 5CX1A 3PTLA 3FYCA 1LNZA 5EMMA 3WGNA 3DR3A 2PUEA 5DE3A 4B4KA 4M49A 3EVFA 1QH0A 4AWAA 2N3ZA 1EI9A 2CDNA 3M5CA 4LVUA 5G4LA 4A8JB 3THXB 4DR4B 2FK8A 2YWDA 1Y9DA 3PC2A 2P2LA 2GKOA 2W6OA 1N6IA 3IQHX 1TUEA 2KM1A 3EOZA 1T13A 2YVUA 5EL0A 1TRHA 3WHPA 5EQDA 4IOJA 1GEEA 3E27A 2B0JA 1YV9A 5JSUA 3OSZA 5LC1A 5CLJA 1P5FA 1ZCZA 5DBHX 3NAMA 1ND6A 1WUHS 4MHTA 2HEGA 2CDAA 3KG2A 1WKCA 3SX0A 2W6ID 4ZVMA 1ODKA 4BZXA 5BURA 3C1OA 3DLPX 3LRTA 2JGFA 2IIVA 3NYQA 3ONWA 1IEQA 2XCUA 4KFSA 4OQQA 4EMTA 5AVOA 2PUAA 3EMDA 3RT1A 1F6WA 4UEOA 1QVRA 1LF5A 5C3UA 4QJ4A 1QIEA 4R0VA 4P4GA 1BJKA 3FUVA 1Y6ZA 1R66A 1P2SA 2WJIA 4KDFA 5A03A 1PJZA 2YOHA 3U7QB 3BXPA 1KERA 3IUBA 1O5IA 1NR1A 2ZIEA 4NJMB 1N9KA 2VJBA 3RTDA 2JD1A 1KQ3A 1BXRB 2PRJA 2WM3A 3MQFA 3OURA 1BU8A 2JA1A 2PIAA 5ALGA 5IUKC 3WYGA 1GGMA 3IE0A 4BS9A 4DA8A 1J0AA 4Z7OB 4DJJA 4ZOBA 1R3DA 1LRKA 1AKTA 4G3XA 4GUAA 5GZ6A 4EGCB 3NPAA 3UPTA 1XQXA 1E66A 1O89A 2MINB 3GLKA 1DDIA 3MWEA 4LYEA 2HD4A 4WERA 1TL7C 3I2GA 4Y2JA 3CEAA 2PGDA 3CLKA 4RVNA 1JL3A 3GWGA 3H7AA 4G5XA 2XBLA 1O8CA 1GUAA 1SXGA 4JYBA 3BK1A 4BNZA 3AF5A 3TPZA 2Y4NA 1HQDA 2W48A 3SLRA 2A59A 1C3XA 5LU8A 3BDAA 1G4HA 5I5GA 3C7CB 3UUEA 4D8UA 4U7TB 3E3AA 1NVUQ 2O7RA 3QHAA 5AI8A 3P94A 3BMXA 1BS2A 4KXUA 1SRRA 2CFCA 4NBUA 1U7DA 2OGZA 2IV7A 4LE1A 4OA8A 5CG2A 4HOYA 3OIUA 4REMA 5KAPA 2G4CA 1R12A 3P0HA 1OVMA 4Y9SA 3E7WA 3CU5A 3MMPA 5IAJA 2P3QA 5BPFA 3NM5A 3CEPB 3EOAI 3SR4A 1ML3A 4CKYA 4AKSA 3GHYA 3QMMA 1TVCA 4KXMA 4MUJA 3V42A 1X1BA 1VG8A 1JU9A 1IWBB 1E1RD 4ZV9A 2XT6A 4X93A 4ZT6A 2WC1A 4Q3NA 3EZFA 4QICA 1TLLA 2WLSA 3AONB 5AI6A 1BU5A 4OM8A 4CETA 4YYEA 1SQ5A 2AW3A 5CP8A 3K9GA 3ZHRA 2A9RA 2IV2X 2PKQO 3ZEAA 2B25A 2P11A 3ADPA 3UKDA 2ZS7A 1QNFA 1L7DA 4C4YA 1O94D 2VFAA 2VQ6A 3NB0A 3WHKA 4B47A 2A0XA 2V7TA 1H0HA 1PQWA 2FW6A 3LDAA 1E1CB 3HJUA 3P2YA 1T36A 5EZ6B 1CHNA 3N53A 1EFDN 2WQZA 5EWMA 5EVCA 1E4OA 4CRWB 2HCJB 4ZJZA 3EHDA 3MAJA 1HMYA 3I5YA 3NDRA 2MIIA 3DF7A 2XWSA 5EYPB 4BGUA 4DWWA 4GOLD 5TARA 1J2TA 2ADOA 2GTIA 3JASB 2E4YA 4GECA 4IH1A 4BTVA 1N5IA 3IKJA 1QFYA 3KXPA 5JLAA 3EF0A 2R6AA 3MCVA 3GH1A 5M2QA 4KGZA 1Q7RA 2CEKA 3VMFA 1E1MA 4IZIA 4TYPA 1ULHA 1IZ0A 1SD2A 1EU1A 5KWIA 3IT0A 4OB7A 1U8XX 4BNFA 1HTTA 2OZKA 5H59A 4M1MA 4BDTA 5IXSA 1G3MA 1Y9EA 4CLRB 3OBIA 4DVGA 2ZT8A 4IJ6A 4FUQA 4N3NA 4AB1A 3OE7A 3PNVA 3E9NA 2VF4X 1RKXA 2VT3A 1U11A 2EFGA 1E2UA 4L4XA 2FPOA 1ZG3A 1PFGA 5EIBD 1C9NA 2X7XA 3HNOA 2BDTA 3JQ8B 2EEZA 4YJ3F 1KQPA 3UATA 3G8AA 3PFNA 5FYQA 1V2GA 4MVWA 3O2NA 4DZTA 4Q6BA 1OKKD 4I9HA 4II2A 3T35A 2H08A 3PNSA 4RESA 4TUYB 4MVJI 1Z2AA 3COWA 3A4NA 4MVJM 3OX3A 4EKEA 4BZZA 2NYRA 2GILA 3IRUA 4Q47A 2OENG 1USKA 2X0EA 4DDMA 3UTDA 3JWHA 4TYYA 1JIIA 1JT2A 2UZAA 4MWOA 5TQ0A 1E2NA 5LQJA 4QUGA 1RKUA 2OFFA 1RZVA 3ZDEA 2X0JA 1MABA 3M4JA 1PVVA 5IAGA 3V1UA 4N5MA 2GN4A 4EO4A 1E79D 4JLKA 1MIHA 4J0CA 5K45A 1DKPA 3G0HA 3RRXA 2A4KA 4ZOCA 4G9GA 4AN4A 1BAPA 3ORRA 5DX8A 4W5JA 3U44B 3NTVA 3FJYA 5J4KA 2NSJA 3C0KA 1GAEO 4NHOA 4E6EA 3ZVRA 2ID7A 3IE2A 2MCFA 3EVZA 5AM4A 1ONSA 2WTUA 2PKQP 2YXNA 5KEIA 5JNRA 3DMTA 3L8MA 4F4DA 4EBFA 1ESNA 2ZCUA 2Q2OA 3D1VA 4JOCA 1G60A 5JDCA 1J1UA 4TWAA 1FTQA 3WJ2A 2J5RA 3AMVA 3L9XA 1XG5A 2GEUA 3AJRA 3E3MA 1TDJA 2SNIE 5A4MS 5HP4A 3G2QA 1XKLA 1Y8RB 1GCAA 4Y0AA 5CDYA 5FBVB 2CD7A 4C4TA 1R6BX 2VBIA 4DIBA 3WGUA 1UUFA 4A5OA 3IAXA 4WH0A 2IYQA 1CDEA 1DQZA 1GCOA 4LJ9A 5DYYA 5LL6P 2J1LA 2P6UA 4IUYA 4QVGA 3FMGA 1E7YA 1LLDA 1I32A 2VOJA 2ZPAA 3JD2A 4B76A 5JANA 3DDCA 1SA0B 1YAJA 2O3UA 2PE5A 2D2VA 1E5DA 1MQSA 1ZJJA 3GT7A 2WT8A 2Z4RA 3IQIX 2BHTA 3BFJA 5D1HA 4QGHA 5E4JA 3O1HB 3NKFA 2ZI6A 5J1TB 3MTEA 3P32A 1WQ4A 3RVDA 1XTUA 3ZBUA 1CYDA 3NOXA 4GXQA 1Q1AA 3ORHA 3W1VA 1AB6A 4X41A 3PR1A 1NR5A 2Y9MB 3VYSB 5M34A 2WD7B 3QE4A 1BRTA 2H7CA 1IUPA 3GNLA 4XQEA 1A5TA 4R84A 3H42B 2L42A 3ITEA 1TAHA 4KQIA 4N6NA 3UW3A 4XASA 1DVRA 2CVHA 3WWCA 4G0OA 2VHEA 3IOCA 3OPYI 3GI1A 5JNTA 3BDIA 2ZRJA 521PA 2HCFA 1PFKA 3UXYA 5LNK1 1W87A 5CNIA 3M89A 3S40A 2G67A 3QBVA 5K2OA 4W5QA 3K31A 1IZ9A 5KOHA 3MB8A 1HNNA 1JDPA 1PK9A 4YAWA 2ZTHA 5HBRA 3VOAA 3OZWA 4IUCS 2IEAA 1UOOA 1RHMA 3CVUA 1QYRA 2IC5A 3K6RA 3QFRA 4MR9B 1WXFA 2V59A 1JKXA 2X4IA 1K0UA 3PWTA 3CLVA 4NNJA 3VVLA 1IN1A 2DH6A 2DWUA 3DYVA 3LG2A 4ZV4A 1T6BY 4BO9A 3OM8A 8MHTA 1YCHA 1CQJA 2PMEA 2D0PB 3I0NA 3QJ5A 4OFXA 2GH1A 5IDYA 5CA0B 5IHXA 4Z4FA 1DC6A 4PG8A 5JS7A 1C0LA 1UR5A 2NIPA 2WWHA 4RCYA 3ZN2A 1SVIA 4Y6PA 9LDBA 2CJYA 3TS1A 5AMXA 4IXWA 1KIFA 1GDDA 4UCQA 3CE9A 4IKPA 1D2CA 2ROQA 3TQIA 5CFPA 5B2FA 4OHOA 5L3SA 3LBNA 3UPDA 3QU9A 2PD3A 2W6ZA 2B2NA 1HI9A 2RONA 1M2HA 3EZ9A 4M8IA 1YQWA 2WQ7A 2AEJA 2FMUA 2O50A 3OUTA 2OLEA 3S28A 5FWXA 3OSUA 4OP2A 4RA9A 4ZU1X 5J5CA 4UZSA 4YRZA 3VH3A 5I7OA 3IHWA 1NIJA 1VKHA 1Z0AA 4I4TB 5EC8A 4FOLA 3UJPA 1C9KA 1K4MA 2PSFA 4ZYZA 3HJCA 1QHGA 5D00A 4JQYA 3DCNA 3E03A 1Z26A 3H86A 3QV2A 4GH5A 3W5UA 5LKAA 1MOZA 1ZVMA 3BN3A 1MTZA 3EMBA 4ZV7A 3H0CA 3OC0A 4PLYA 1TO1E 2GCEA 3HR4A 4OBWA 1QQTA 2HWKA 4YAEA 5TGZA 1JB9A 1MH1A 2CY0A 2E4UA 2MU1A 4YLGA 2NXWA 5FBLB 1TUGA 2FWPA 5FI3A 5CK4A 4AO7A 1FZQA 2ZQYA 4A73A 5FKJA 4WN3A 4P58A 6ABPA 2HBRA 4NMWA 4WSOA 4E08A 4QAJA 1V11A 1H5UA 2ICAA 2YQ5A 1PSWA 3SQLA 2W83A 4N5LA 1YDHA 5K09A 1I80A 4A0RA 2G08A 1ID8A 6REQA 1MGOA 3T94A 2ATVA 3KTAA 4GGMX 4ZQCB 3PDIA 3T4UA 4C5AA 3E9RA 3LUBA 2ZKLA 2IOHA 4LY6A 3MJDA 4LVCA 4OI0A 3C3BA 1A71A 2VOEA 4C04A 1GD1O 2G04A 3DNFA 2BMJA 1GCUA 1U6JA 3GT0A 3MUOA 1DPFA 4BJ1A 2HR1A 1FP4B 4ZVVA 3J81k 3B1FA 1O03A 1QWSA 2IDZA 1ISIA 2EATA 3C70A 4PVCA 1CR0A 2Q9BA 1Q84A 1MD9A 2DVMA 2GM9A 4S3MA 4N18A 1JIVA 5KOJB 4J2HA 1FP7A 1KYTA 3ET5A 3C3DA 1MX1A 3VR6H 1MLDA 3DLIA 3K9LA 3TLZA 4UTNA 2V3WA 1CE8A 4XWAA 1I30A 2QJOA 2O48X 3COVA 3MS2A 4R51A 3FUCA 4RK1A 4CM4A 2G8LA 2O2SA 4DIOA 1YJ8A 2DZDA 2VRBA 3PVSA 5SY6A 1X9GA 1P2DA 1GGEA 1RJ9B 2O1XA 1DEOA 1ORRA 3AF1A 5AVVA 2VWQA 4LIPD 3HACA 5HIJA 4RKYA 3OX2A 1V35A 3FBGA 1BGVA 1LSUA 3E9MA 3AXTA 3PFGA 4IV5A 5DBEX 3R7DA 3RS5A 5CEEA 2V7QA 5EWLA 2YASA 2V58A 1T9ZA 5CB4B 3AY7A 2GRJA 2VDWB 1N7GA 4IZOA 5EJ5A 5FLXA 1OGJA 1KZ1A 2H9IA 1AHPA 5MHTA 4RXMA 4PCAA 3CT6A 4WZBA 3RRMA 2VNJA 1A2KC 4UAGA 2CHFA 4Q4JB 3ABOB 3KBBA 4NYJQ 3D7KA 3VISA 2ZM6B 2FG5A 5DM60 3S27A 1DTWA 2QE6A 2NADA 3Q7EA 3NNSA 4K0RA 1RKQA 2MDTA 2XUKA 1R4ZA 4MIEA 4YECA 3WQRA 4Z6KA 5ARBA 2O2CA 2EL9A 3AERB 1QH8A 1S1CA 3G2OA 4ER5A 5JD5A 4H08A 4DY6A 4EENA 2HPVA 1V1MA 3E1KA 2EIHA 5K0EA 4WZBE 1OWOA 4G1UC 1GZ4A 5CDTA 4RU1A 5KDDA 2XKKA 3B2NA 1WIWA 1WQ1R 2J9ZB 4MCAA 4EW1A 3JXEA 4EYSA 4C6TA 2H1LA 5MF6A 3I9NA 2LV8A 4I9FA 4J1SA 1FS5A 1C1YA 1D6NA 2GETA 2GZDA 2BTQB 2VXOA 3FPKA 4I8IA 4YPVA 4ZAWA 5BSWA 1Z0KA 2JFQA 5KYYA 4GMHA 3Q9SA 5JCJA 2Q3EA 4PLGA 4RF5A 3RTEA 5JHGB 3DV0B 3SIXA 5JQGF 2QMZA 4BP9A 2HA4A 1BMFA 4U9UA 4YS6A 3GFPA 2FQ1A 4FVTA 2WVGA 4YA6A 4QXAA 3U6KA 1Z0ZA 3KT3A 2OGUA 1T1IA 1K08A 1M1NA 1S2IA 1OLUB 1UC5B 3ISTA 1B8OA 3LT4A 1EXMA 5CAEB 3R76A 4AIIA 4YRFA 1MO4A 1M0EA 2GHQA 2R1VA 2FDXA 2QLJA 3ZWMA 5F7XA 3TKLA 5HS4A 4UHCA 1Z5ZA 2FSVC 3FRJA 4A23A 4ZYLA 1BDMA 3QBJA 3K1JA 1V5FA 2DMRA 2YZGA 3NHMA 4OBEA 3U3DA 3S29A 2MYUA 2C9YA 3PWZA 2RBEA 3LY8A 4M1OA 5DBOA 4AJPA 4H77A 2EG5A 4KQCA 3RCBA 4E32A 4RSRA 3D4PA 4HDRB 4NDZA 1QP0A 1Y4UA 3MNFA 3PIRA 3L8GA 2W90A 2X41A 1A77A 2HN9A 3ENNA 1YZ3A 3GJ7A 2J0UB 2C4MA 3JD0A 5FTMA 4OHRA 3REFA 1N6NA 5I8PA 5JSZA 5KOJA 1AXRA 4U2FA 5B2ZA 3RHSA 3IKMB 5F1PA 4BU0A 3NDBB 1JLHA 3TBFA 5IH7A 1TD1A 5JBIA 2X13A 1L7PA 3GOHA 3WLNA 2UXBB 2HIHA 5TQ2B 3B6ZA 4Z2AA 3MYYA 4AL4A 2KLHA 3D0QA 3VV3A 4F6RA 5J47A 3I9FA 3AOEA 4H1WA 1PR2A 4TMZA 3FROA 2ZAGA 1YB6A 2FW7A 3O8QA 3MB5A 3O8OB 3P26A 3HRKA 4I1YA 3QUAA 1CRQA 3DEYX 1IEWA 1C1XA 4G23A 3ZWBA 5JV5A 4QECA 3NG1A 4HUQA 2RHGB 1Q0HA 4O08A 4P7GA 2HHJA 1KJ8A 4HGNA 1Z5UA 2ZYDA 1OH7A 3QU5A 1MJNA 2OHGA 1X7YB 4QHSA 3ACBA 4WLUA 1AMUA 3PD1A 3LQ2A 2JCYA 4RQAA 4KSBA 5G0VA 1NR7A 1GZVA 2OL4A 5B3LA 2JB9A 2NQ2C 1E3QA 1E7SA 5LCXA 1SKYE 2QN2A 2ZTMA 2I54A 1BDIA 2YMMA 1N2GA 4NCJA 3I01A 3DGEC 4LXGA 4M8SA 4M9QA 2NUTA 5DBIA 1N4AA 5CFQA 2OORA 1QH8B 3GJ0A 4WOCA 4A8TA 3O5AA 3V9PA 3LC7O 3TQOA 5A3RA 2P27A 1MAWA 1KSJA 1SQSA 2BPOA 4TMKA 2Z8YA 2I6UA 1NYRA 4XGRA 1YJQA 1FMTA 1ENPA 2BEWB 3UKJA 2QN9A 3HSYA 3QPBA 1A97A 2ZRQA 1BEEA 1TCVA 3O7WA 3WK4A 1ZM3A 1EKXA 3TQCA 4LEIA 3ETEA 1ZSNA 2CHEA 2ZR0A 1CULC 4UVEA 5L3QA 2JJ1D 4NCHA 4C76A 1E99A 3CX3A 5LMNB 1UT5A 5B1EA 5E7QA 5IC4A 2GZ2A 3ILXA 5LQCA 1L5WA 2VP5A 1M2JA 4BHTA 1Y8CA 1W35A 3AM5A 2X0NA 3O8CA 3PPIA 3P1JA 2IGTA 4Q05A 4ERXA 2PD4A 1U0JA 3IP6A 4JB3A 2ZYUX 2X3YA 4UD6A 4F2GA 3BB3A 2GPJA 2QVCA 3AY6A 2QNBA 4NK5A 2QVGA 3EY4A 3DHWC 3FCEA 3HWX1 1RBMA 2DPGA 3S55A 3N1UA 4I4CA 1T26A 1FFXB 4CL2A 2SECE 3INRA 1NJ8A 3EZXA 3QEMA 4ES6A 4XFKA 1NLYA 2HF7A 1GLNA 3T7EA 5KKNB 3EGCA 3IRVA 3FCYA 5JDCC 1FLDA 1G0NA 3RQIA 4CIYA 2WWWA 1XTIA 3QYPA 5BR1A 2A8YA 2O0LA 1YBAA 1S8FA 1T5LA 2W2PA 3FSGD 3OTIA 4Q66C 4O2AB 3B1KA 3O8OA 1YKFA 1ZJ5A 4OHBA 1O9HA 5E95A 1SUSA 1PTJA 2CLCX 1XWIA 1E32A 1SB8A 2X8JA 4KAJA 5BVGA 4RMHA 1FIUA 2B36A 3VPBA 1Z5OA 2RKOA 1L7QA 2X8AA 4OHXA 1UJBA 2HRCA 4MHOA 5CBKA 3HBAA 1CJMA 4N41A 1VDZA 3G9TA 3RBAA 4GX2A 5EZ5A 1QHNA 2A1IA 2D0IA 3X3HA 4Z7JA 3OZFA 1U7ZA 4HRYA 3QELA 2FV8A 2OGTA 2QLLA 2VG8A 3CB2A 3DHYA 2CF5A 4M60A 4EB6B 4OX9Y 5CVVA 2Z6QA 4YJ2F 2EZ9A 2PLNA 2FE1A 1Z75A 1HWYA 1ZP6A 4ARIA 3EDYA 3T5BA 3H2HA 4GS5A 1LF0A 3FNEA 4G5QA 1HDGO 1CT9A 1CF4A 1RZ3A 2FP4A 4MKIA 3PD0A 2LPMA 4MLDA 1DNPA 1K5GA 4JR2A 4B6SA 2VYVD 4ODIA 4R8RA 2BM0A 4I9GA 2HJRA 1OZ0A 1TVKB 2Z3ZA 3EFOB 1Q0UA 4TMTA 3ZDZB 3W5CA 1N5MA 4EG8A 1E9AA 1QJCA 5L95A 2F3TA 3FI9A 4D9JA 3F1LA 2VT2A 3PF8A 4W99A 1I7LA 3QY0A 2AXQA 5E9WA 1Z18A 4FPXA 4C0SA 1X1CA 1ORTA 2PRKA 1RLOA 3RWOA 4BX2A 2DBRA 2ZS8A 2JJ2D 2QQEA 2PUJA 1NP7A 5FTWA 1XMPA 1ZK1A 1U6IA 2EGUA 3LY7A 4WKGA 2ZJAA 5MFPA 4IDCA 1I3MA 2C29D 4J1TC 2CLOB 4N01A 3BD7A 1GUBA 2GN2A 3B1VA 4HQRA 3BB4A 3MTDA 4K81B 2CNBA 2G5TA 1V1MB 2CZQA 2IOYA 2BFFB 2J31A 2JK0A 4XM1A 4YCBA 1G6Q1 5FUYA 1A82A 3U7IA 4PHTA 3WIBA 4YP0A 4DDTA 4ARCA 3A1EA 4RELA 2G70A 2B0CA 4ENPA 4BVLA 5T3UA 3TVYA 1ZVVA 4L27A 4N5DA 1I2ZA 4F3KA 1EG2A 3DZDA 1H3FA 4NH4A 3OCVA 4R7GA 1BEUB 3SI7A 2P6RA 3P9KA 3TL6A 4EVQA 2QJWA 1YJ5A 3H16A 3WGVA 2YDXA 1GV0A 1N5OX 4FN4A 4I50B 1NVVR 1U8EA 2VDWA 3ZX5A 1AKNA 2WIJA 3FHOA 1U94A 3EQ6A 1JDBC 1P0QA 4OMFG 4TWZA 4F4FA 3AB7A 2IU4A 1C9EA 4Z1MA 1ZUNB 3LC0A 3WA7A 2CXQA 4V0MA 2CV1A 4L3OA 4CKWB 2UYGA 5ALZA 4LDJA 3PX7A 2RHMA 1J23A 1CUUA 3MMXA 4L2IB 3LT2A 4X1YA 3K6SB 1L9XA 1R6TA 3EZ2A 3WL5A 2IYFA 1P18A 2V96A 1AZLA 1VMIA 2GXUA 2DGDA 4ON9A 4UAVA 4ALNA 2SHKA 1RE1A 4QDKA 1YUBA 2IDJA 1HO3A 1T2VA 4L76A 1HQCA 1J1IA 1SURA 4IDGA 2WWYA 3PKIA 1HNXB 4MW7A 2KYRA 2UU9B 1CQWA 3BCRA 3DEKA 3RSOA 4DIFA 4LSGA 3P9YA 2FCAA 2NO6A 4QOSA 3BL8A 2X6QA 2Q5CA 4GLJA 3IV7A 2B61A 2D2FA 1G38A 1IN5A 1MRZA 3DOFA 3L0YA 1Z4PX 3Q1KA 4JLWA 3CS3A 3DT9A 3ONFA 4IF4A 2X9VA 4Q19A 5DWDA 4JBXA 1PS0A 3GZTB 1EX7A 1GA4A 4WIAA 3VR4D 2PYDA 1PL0A 1D2HA 4IFBA 4NEQA 1LDEA 3ABZA 4JLNA 1RYFA 2VHZA 4CKEB 2VDMB 1XNRB 1UP4A 1ZKDA 3KTAB 3ZI0A 4XI9A 2H1FA 3T41A 5M04A 4K9LA 3I32A 2KBEA 4NONA 1JLLB 1E63A 3DB1A 3DZIA 3MHPA 3NTOA 3RSCA 4DR1B 1X1TA 2AF3C 2OP0A 3AILA 1G5FA 4G2TA 4EA9A 1EJBA 1QB7A 4Q4HA 3ZIAD 3ZV6A 1IBKB 2H6EA 5JC8A 3KKOA 3DF9A 4J16A 2C3MA 2AG0A 3L6BA 4LZJA 5CNKA 1G16A 1OY1A 4ZCTA 2HIAA 4G5YA 1RYYA 2J3LA 1PFVA 1XMXA 4OLFA 4KACA 5AXCA 2WIKA 3UFBA 1OB2A 4WNIA 3IVXA 5LYJA 3LXUX 3O4FA 4QNRA 2PLRA 5DV9A 5A4AA 3FCCA 1II0A 1T8TA 3KCQA 4MLZA 4X00A 4YV1A 1WZ2A 4AMBA 1P2UA 3G2MA 5L4SA 4BNVA