3E81A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
molecule keywords Acylneuraminate cytidylyltransferase
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e81A00
3W5BA 2BDUA 3M1YA 1RLTA 2Q4RA 2FDRA 4KX3A 5AKZA 1ZJJA 3ZWDA 2OYCA 1KYTA 1RLMA 3I6BA 3KZXA 1Z4IA 3RFUA 2CFRA 1SU4A 1JUDA 3SKXA 1U7PA 3L7YA 1RDFA 2B0CA 2HCFA 4YCLA 2I33A 3OCXA 5ALYA 2G1AA 1Z4NA 2ZBGA 1EK2A 2RARA 1NF2A 1WR8A 1XPJA 4Y3UA 5ALTA 4YH1A 3MN1A 1O08A 5ALVA 2JGAA 3I1YA 3KDPA 5ALWA 5AM3A 1WPGA 4UMDA 4IG4A 5A3SA 2WHEA 3ZVMA 2GHQA 4MUMA 3N1UA 1TJ4A 2RBKA 5AVUA 3ESQA 4H1WA 1RMTA 2FUCA 3WK6A 4HGRA 4Y2QA 2P69A 4UU0A 3FPSA 2R8XA 3GYGA 3WK8A 3QUBA 5ALPA 2B30A 3QU5A 3PDWA 5AKEA 4ZEWA 4JB3A 4GIBA 3QUCA 3WKCA 5AHXA 2WF9A 4RETA 3MMZA 2ZG6A 4ZEVA 4OD0A 3ESRA 1F5SA 2AH5A 2WM8A 3KD3A 1QQ5A 2MU1A 2I34A 2FPRA 4CF3A 5AVXA 1YDFA 1T5SA 1J97A 1QYIA 4KNWA 2YMQA 5AK5A 4AS3A 1VJ5A 3L0BA 3QUQA 5ALZA 1QH9A 3L1VA 4CF5A 4RESA 3AR9A 3E8MA 5IT4A 3AR5A 1AQ6A 3ZI4A 4OFZA 4FE3A 3AR8A 4HAIA 3NANA 3DV9A 1RKVA 1L7NA 3VAYA 5AIAA 2X4DA 2B8JA 4Y2SA 5T41A 3CZ4A 4KNVA 2IA5A 2W4MA 4DCCA 1YV9A 1K1EA 3WK9A 5IS2A 3WKAA 1ZD2P 4JDPA 4HGQA 2FPSA 4YIHA 2FUEA 3U7GA 3E84A 1Z4PX 3ET5A 3E58A 1WVIA 1U2TA 2YJ6A 3QYPA 3ZU6A 4XQ0A 3QU9A 4QJBA 4E88A 5AK6A 5ALSA 5E0OA 4EZEA 3ONNA 1ZD5A 3M9LA 3SHQA 3ZTWA 1L6RA 2C88A 1RLOA 2OM6A 4I9GA 2D2VA 3L8FA 5ALRA 3ED5A 4NAVA 3UMCA 4Y2TA 4NFLA 5ALFA 5AI8A 4BYGA 2NO5A 2ZBFA 1RMYA 1Z4OA 4XPZA 3MC1A 5AKKA 4I9FA 3N8GA 2MSNA 1RKUA 1RQLA 1FEZA 2YJ3A 1XVIA 3BWVA 5AVSA 1VFPA 3IRUA 2I7DA 2AMYA 2HO4A 4BX0A 2ZBDA 5AKHA 3P96A 4BBJA 5AVQA 2YBDA 1U7OA 3KOOA 1S2OA 3FPBA 4BKMA 4CF4A 2IYEA 5AM5A 1RQNA 2C8LA 3SD7A 4YCMA 3E81A 1YMQA 3PCTA 5AM1A 3CNHA 5AICA 1CQZA 4UAUA 2HHLA 4NV0A 1EK1A 3ZWKA 3RF6A 4OHFA 1O03A 4KN8A 4BNDA 5ALDA 1YJ5A 1L7MA 5FP0A 2CFSA 5AW9A 1YS9A 2EATA 3MPOA 3BA6A 1Y8AA 5AW8A 5AI9A 1Z4KA 5AW0A 5AI6A 1U2SA 3OCUA 2GFHA 2YN4A 2NYVA 3IJ5A 2GO7A 3W5DA 3UM9A 5AI4A 3WGVA 4B6JA 4L57A 2IOFA 5AKJA 2HF7A 2G09A 5AW4A 5AKGA 2FPUA 4Y2UA 2RB5A 4UASA 2HSZA 4Y2RA 1YNSA 3OCVA 3QU2A 1Z5GA 3K1ZA 1TJ3A 4F71A 4GXTA 4HGOA 3B9BA 5AKXA 4C4RA 3OCZA 2IOFK 5ALJA 3SF0A 4UM7A 5ALIA 1LTQA 3L1UA 1RKQA 4MWOA 3WKEA 5AKIA 5AIBA 3NALA 2HX1A 5AVZA 2FPXA 1TE2A 2C9MA 4BX2A 2CFTA 2R8ZA 1Q91A 2IOHA 2G0AA 3ZX5A 1SWVA 1MH9A 2EARA 4J03A 4QQFA 3NUQA 1Z4QA 3W5AA 4UATA 2B1QA 5AW1A 4DW8A 3HYCA 2YJ5A 2B1RA 3AR6A 2G07A 2Q5EA 3EPRA 3N28A 4XOUA 5ALOA 1ZD4A 2PQ0A 5AKYA 3U7FB 3QX7A 1XP5A 1Q92A 4DWOA 3WKBA 2OA0A 3ZW7A 2WF5A 4BNDB 3WGUA 1ZRMA 2FPWA 1T9ZA 2EAUA 3AR3A 2PR7A 3L8GA 1Z4JA 5ALNA 3SLRA 1LVHA 2O2XA 3ZTYA 2Q4TA 2BY4A 2HEGA 2WF7A 3A3YA 3FM9A 4NWIA 4EENA 2QYHA 3QU4A 4XE5A 4L6CA 2AGVA 4G63A 3WK4A 4C4TA 2OBBA 1ZS9A 4UMEA 4Y2JA 3ZUPA 5AESA 3EF0A 3ZVNA 2YFYA 1ZOLA 5ALKA 4PNHA 4UARA 2P9JA 3A1CA 2AUTA 3J7TA 1PW5A 3EF1A 2R8YA 4CNQA 3AR7A 2CN1A 3EWIA 4L6AA 1L8LA 3QXGA 2RAVA 4FFDA 3DNPA 4ZEXA 1ZD3A 4YGYA 2ZBEA 5ALUA 5AK4A 3QGMA 1L7OA 2PKEA 2ZXEA 4FYPA 5A3QA 5AVYA 5IT0A 2ODAA 3A1EA 2YMPA 1RPZA 2NO4A 4HYTA 4F72A 1QQ6A 4UU1A 5ALHA 3DAOA 3OCWA 1TJ5A 2HDOA 3DDHA 1N8NA 1WZCA 2YJ4A 3NIWA 3AR2A 2O9JA 1RC8A 2HF2A 1Z4LA 2ZOSA 2YY6A 3L5KA 1J8DA 3ZVLA 2I54A 3QLEA 3R9KA 4J2TA 3U19A 4EELA 2JAUA 4IFTA 4Y2XA 4Y2VA 1NRWA 3R4CA 2G08A 3QNMA 5ALLA 3L8EA 4C4SA 5JJBA 5AVWA 4AS2A 2FI1A 3FGOA 3NASA 4YIKA 3L0YA 4KYTA 2B82A 5AM2A 2HI0A 2JAWA 5AW2A 1RRCA 2WF8A 3B8EA 5ALMA 5AVRA 3NRJA 3ZX4A 4CE6A 3I76A 2YMLA 2R8EA 5ALEA 3U7EB 1CR6A 2YMMA 3N07A 2I55A 4O8CA 3R09A 2W43A 5AI5A 1NNLA 1SWWA 4UM5A 4KX5A 3S6JA 2JAOA 5AW3A 5AM0A 2G06A 5AI0A 3NAMA 3L8HA 1T5TA 3D6JA 4UMVA 4UAVA 3QU7A 3OCYA 2DQSA 1IWOA 3FZQA 2FEAA 1L8OA 3WK7A 1L7PA 2G80A 4EX6A 5AVTA 1QQ7A 3SKYA 4NABA 1TA0A 1N9KA 5ALQA 2C8KA 3U7HB 1ZRNA 3B9RA 3N5KA 3KBBA 4HGPA 2B8EA 2I6XA 2BDEA 2GHTA 4BEVA 3U13A 2P11A 2GMWA 2WFAA 4BEWA 3F9RA 2VKQA 5A3RA 5AK3A 1S8OA 3ET4A 1Z88A 1Z5UA 4G9BA 3HLTA 3TLMA 3W5CA 5AVVA 3U26A 4Y2YA 3I28A 2C4NA 3IB6A 4YCNA 1VJRA 4Y2PA 4EEKA 4EX7A 3A1DA 5ALXA 3AR4A 2W11A 3QUTA 3WK5A 1X42A 3OPXA 3SMVA 4AP9A 4DFDA 1RMQA 5AM4A 3PGVA 3UMBA 3UMGA 3KC2A 2WF6A 2JARA 5AW7A 3L0CA 2P27A 3WKDA 4BX3A 4OCZA 3OTQA 5AW6A 1Z4MA 4HGNA 2HOQA 1U02A 3FVVA 5AW5A 3PGLA 5AKLA 2QLTA 4UMFA 5ALGA 4UW9A
chains in the Genus database with same CATH superfamily
5FUYA 2YWXA 4JCCA 1WMAA 1WMBA 3M1YA 1CY2A 3CZCA 1A2BA 4J16C 4EA7A 5EPOA 1RCTE 3L1JA 1HTTA 4EDFA 5A4IS 3T9CA 3S4YA 2HMTA 1MAHA 1QHEA 1FUIA 3BXGA 4IV0A 1ZJJA 1TJNA 4WGFA 5BUZA 3IA7A 2QN2A 3LL4A 4PSCA 2ZULA 3TFWA 5JTTA 1CYEA 4XASA 4ARAA 5IVKA 4NOKA 1Z4IA 2Q0QA 5AVKA 4H7EA 5ENDA 1XDUA 4KAJA 1IM8A 3ICWA 3OIVA 1AKWA 5FQNA 2EQ5A 2FLVA 4MVJM 1IOLA 3S29A 1U1EA 4J0CA 5KSYA 1DNPA 1PNTA 1U65A 3ENQA 3WB1A 3HB0A 3GFQA 4CKZA 1GEEA 2ZRKA 1T9GR 3DBRB 1QCZA 4MMZB 2PXAA 5EVJA 1E9RA 3E9DA 5HRAA 1RQ7A 4OQPA 1N92A 3ICOA 5CT4A 4BEBA 2E3JA 3DB2A 3JQFA 3NBXX 3U6KA 1YK0A 1MG5A 4YH1A 2WPDA 3BQNB 4MI1A 5K8LA 4JJIA 5DLYA 5TDHA 2BUBA 2Q3DA 3HDQA 3AFGA 3LCJA 3GCWA 2XF2A 4IDNA 4A82A 1F1BA 2NVWA 4TQUS 3W2GA 2F62A 1QVRA 1L7RA 1QIIA 1RPJA 1QDLB 3PBKA 5F77A 4POAA 3VKWA 3R6TA 2Q5FA 4AW9A 1HUQA 3KUUA 3W6NA 3ZKAA 5E1OA 2FOLA 5H80A 3SVTA 4GO1A 3AJRA 1Y42X 3D3WA 4S1WA 4NMWA 4E5MA 4XWYA 2ZR0A 1BQ4A 1BE1A 4UNQA 4CPDA 5K6TA 3U61B 1KZ9A 3RFVA 2PGJA 5FA5A 3DMFA 4U5XA 4N8EA 4ZVQA 4E3WA 3ZJUA 3KFLA 3G5MA 5CDFA 5LSAA 3WV4A 1RIIA 4K6GA 2A5FA 3KEQA 2V54A 5ECDA 1HEYA 3VKFA 4GIBA 3DDOA 2R6ZA 1Y4SA 2ZSUA 1LDMA 2D1YA 1OIVA 4A2CA 4ROSA 1A5ZA 3DYBA 5CVJA 2O8EB 1E1CA 1HL7A 1QIKA 3LX6A 4Q1EA 4LI0A 2Y99A 4R54A 4ZVSA 3PD0A 3SGLA 1XCOA 3FUVA 4G4SO 4PGAA 1OQAA 3DS8A 3EEQA 3TL3A 2W2MA 5JYEA 1GNLA 5HEKA 2WVJA 2C3OA 1NNUA 1SOWA 4Q18A 1X92A 4NBTA 2P1RA 3PG5A 4MS4B 5KTYA 5IUNC 2BTQA 1SOAA 3HABA 3AL3A 3EQ7A 1B2RA 1BE0A 1Z6QA 3B5JA 3H83A 1BKDR 2BEWB 2Q4DA 4G6ZA 2VF7A 1NJ5A 4W1QA 2WJGA 5C8YA 1J2UA 2XQKA 2HQRA 1DJLA 3V6MA 1CCWA 3OIYA 4GP7A 4XQEA 1RCUA 2LUOA 2IYOA 2G1PA 5LQSA 4JEHA 4PSDA 2GPAA 4TWAA 4A2PA 1ECGA 2R1UA 5E6UA 5JI2E 2ODQA 1RP1A 1ECLA 4JLDA 3V8EA 1F8UA 4AD8A 1VXOA 4AWXA 2G36A 4CIYA 1OWLA 4UM9B 1L9XA 1RQRA 3EXIB 3PUVA 2EZ9A 1SQGA 1NE2A 3LFHA 3COSA 2P67A 2GF2A 5PGMA 1JDUA 4IOJA 4DA8A 4JNCA 3HACA 3IDOA 3RRXA 4RZHA 4FZJA 3WKAA 4BO5A 3L06A 4M6WB 2W2KB 2RHRA 4TV9B 1YQXA 2QUHA 2HJSA 2CFOA 4XEHA 3TMKA 2YWJA 4P80A 3VTFA 4RVHA 4MMXB 3FDIA 3DTYA 4CDMA 3KLOA 3G9QA 2BSAA 2CFCA 2C3UA 1MOQA 4ZOLF 2OV8A 1NVFA 3G23A 3IUQA 3R3YA 3E5NA 5DGXA 5K4GA 2WJ6A 4P3XA 5ARBA 4LXUA 3I2JA 3GXBA 2VQFB 3R7WA 2PFSA 3UT6A 3LKVA 3AU8A 2AVNA 4DE5A 1JAIA 4M9RA 1Q50A 2OORC 2ZI3A 3FPHA 3L8FA 4OI4A 3THXA 3MW8A 4QOSA 3C41J 3F3SA 2UYOA 3RIYA 5DNYB 2PUTA 2WT8A 4DV5B 2RGWA 5KQMA 3AM3A 4NFLA 2WSLA 3BAZA 4B80A 3OPYB 4BYGA 5L51A 4PHTA 4QODA 3FSEA 1Z4OA 3EQ8A 2PO7A 3OEED 3WBKA 3IPLA 1P72A 2W6QA 2XTNA 1P7PA 1YONA 4Q3AA 3B1YA 1MGPA 1V3VA 1Z8HA 1Z68A 3OUUA 3H1BA 2YJ3A 3NHZA 4WY5A 3TAHA 3WYGA 4EB6B 1HEIA 5BURA 2W58A 1VFPA 3GMSA 4LHWA 5D51S 3LHFA 1ZZGA 1Z35A 2P40A 2WWVD 5JEDA 1MQAA 1DPFA 1PFYA 3WLQA 1Y7HA 4BNTA 4OUKX 3K9QO 4Q12A 3KQNA 2LTAA 3V1NA 4NZOA 3MCTA 1CUXA 4JLVA 5DX0A 4CBVA 3AFOA 6YASA 1OGYA 1BTOA 1DUVG 1JPNA 3EDYA 4WW0A 4MPRA 3LT2A 1DKUA 4MW9A 4PX2A 4RH1A 4JWKA 3SD7A 4RD0A 3T5PA 4FQ7A 1FSPA 1JLLB 3N2GB 3DPIA 4NBRA 2FMTA 3OFNA 3C97A 1BXGA 1JPJA 2B8NA 4RIEA 1D2NA 3SEFA 2B98A 4AQ7A 2Z5LA 1OI3A 1JG2A 4BVJA 1G38A 1Q2UA 2NU6B 3ACCA 3OLVA 4NP6A 1BA2A 2YIJA 1KOGA 1YS2X 4P22A 1IHOA 1H05A 5EQTA 5HNKA 3DAPA 1LX7A 3DBRA 4BTLA 2O2CA 1QKKA 2ACKA 4QAJA 4C4PA 2WKRA 2IH2A 3GUHA 5CXXA 4RQBA 4UHHA 2D0DA 4GPEA 1FMJA 4FXOA 4KSBA 1UQRA 2X8JA 3TRKA 2FZKA 4GYYA 4MV4A 1UODA 5TGTA 4KGDA 4BZZA 4QPCA 1YB1A 3TFOA 1E3EA 4ON9A 2LR0A 2YFKA 5DCWA 4RFLA 2YV1A 4CV1A 2ZJ3A 1LPNA 3V55A 3F6EX 2A88A 5IJ9A 1WUKS 3T0IA 2NSDA 5A1JA 1D0SA 5JANA 4A36A 1KH3A 2YOHA 4P7FA 1M1YB 5IDWA 4AY2A 4G1EB 3L4BA 2AZTA 3DNFA 4I9HA 4R8KA 4ISBA 3WB0A 2H2AA 3R7WB 3MXTA 3EEBA 5I9MA 1WF6A 1YIAA 2HSZA 3UVEA 2XJ4A 1OR8A 4BX9A 3GRVA 2B37A 1ODFA 1JE0A 4UZEA 1YDEA 2OWDA 5MDHA 4HGOA 2JHGA 3B9BA 4B6FA 1PK7A 1XNGA 2WJZB 4HRYA 2IOFK 4KHZA 4YP0A 3VYRB 1DE0A 1ZHHA 3WL4A 4DCOA 2EEPA 1CHDA 2VUHB 4MWOA 4P86A 2Y6UA 3RS9A 5IHPA 1OE0A 2R7MA 1L4FA 1NHWA 2VUUA 2WY2D 3K72B 4K87A 4X0EA 5KPJA 3SFZA 4XVCA 1N25A 3F5QA 1QFMA 2YQ4A 3GAMA 2KS6A 2AJTA 2PX4A 5JXWA 4P5DA 5JCJA 3S1AB 2J3MA 4HFRA 1YVRA 3DO6A 1QGDA 3KHUA 1SWVA 1NWCA 2ISCA 4QQFA 4DLPA 5K5EA 4H31A 4A6PA 1YZGA 4C5BA 1B41A 1YMVA 2A4MA 2HKIA 2VSFA 2ZI7A 1BW9B 1X7GA 3G9XA 1DO0A 2P9HA 3R3HA 3NGXA 4EO7A 4HC4A 1UXHA 3FG9A 3AR6A 2PX8A 3IBTA 1S9HA 4OJQA 2C7OA 4IXTA 2GF9A 3ENWA 3D4IA 3KM0A 4FEYA 4ZT2A 1XV5A 3SLKA 4BGUA 4B3MB 1O94A 1YOVA 2ASVA 3ZE9A 1SA0B 2Y2VA 3FYHA 3FFTA 3QX7A 2FFQA 1P1BA 1TQ2A 4MVCA 3UK6A 4EIWA 1QRAA 4FLEA 3IHKA 1LPSA 3OKAA 5DM1A 3ZW7A 5ADVA 4DQXA 3FDXA 3ADCA 1XXLA 1GFZA 4Q1VA 4XB2A 1PYDA 1J8YF 5A04A 1CF4A 2PR7A 3TQQA 4DRXB 4K9KA 4I2NA 3OPNA 2QNRA 1OLXB 1JR4A 2Q27A 5T4FA 4DY4A 4QXQA 1PTJA 3OZVA 1DSSG 4RNCA 4ZT6A 2QTWB 4NWIA 2P9CA 1E69A 5F2EA 3L79A 4P31A 1Q1EA 3NHBA 3NRBA 4S1OA 5DHRA 2E89A 1Z7YA 4F7DA 1MG0A 1KU6A 4C4TA 4DSUA 3JZIA 3BDIA 2HBRA 3A4TA 4D4LA 4CLRA 1I2BA 2RGEA 1EFTA 3OZAA 1E92A 5E9WA 4UCFA 2D54A 3DJFA 4V0MA 3QPVA 3CCCA 5SICE 3T54A 2WU0A 2PU7A 1UQUA 3LC0A 4KDRA 3AVTA 4RD6A 5BR1A 4KE6A 3RVBA 2DHEA 1YH3A 4Y9RA 2Z3WA 4QXPA 2WIGA 3DC2A 5DB4A 1TVEA 4A1FA 2XGJA 4QTXA 1PFVA 3WGTA 3QZUA 3GAZA 1KJZA 1ZK2A 1ZKMA 3OQIB 3LZ6A 1W4BA 1X38A 2H7VA 3GA5A 1HFKA 3C6ZA 5D1HA 2BM8A 1NQUA 1QIEA 2A78A 2WA1A 2PJUA 1M2OB 3G1UA 3CG4A 3CS3A 5DCUA 5EHNA 1G8HA 3PFHA 3CLRC 1DC3A 1KYYA 1Y6QA 2BCGY 4UU1A 1I3LA 4DCVA 4DQ0A 1SQ0A 2O7NA 2W6IA 3NQ41 2WV9A 2J0UB 4QE3A 5JASA 2WMYA 2C03A 1Z2CA 4MVXA 1XMSA 1PDWA 2PMCA 4YMIA 4ZRMA 1QHXA 4U39A 1GUAA 4ZV7A 3FHCB 5L6MB 1UDWA 2YRWA 4LVNA 4Q0MA 1OLOA 3T7JA 1OMOA 1IVSA 2RHLA 1V3UA 4Q1DA 2EEZA 3NV7A 4LWQA 2ZKLA 2EG5A 3KE9A 2DSNA 3H5NA 4B45A 5F23A 4LHVA 1V47A 2G08A 1LLQA 1M34E 2GVZC 3I53A 4BMNA 3B60A 3L4SO 4EG4A 2CBZA 4RTPA 3T5CA 3TQOA 3RKSA 3WMEA 2CVPA 2WI8A 2ZUSA 3AUAA 3C6MA 2IS1A 1JHYA 4TKVA 4KQ9A 1ZRSA 1RAAA 2JFQA 2J9GA 4M9UA 1C9MA 3PC3A 3R5TA 2QAGB 3WTCA 3THYA 3OTGA 4KZPA 1XZPA 5TPWB 1U0NA 2PIDA 4QBHA 3IOEA 4INZA 1TYAE 4HNAA 2Z8XA 2CJPA 1LBTA 5J63A 3FKSA 5DW0A 1W85A 5ICCA 2FN4A 1TM1E 2XQGA 1I4TD 1Z28A 3KSZO 4IHJA 1JAZA 3R1IA 2DSTA 4KX5A 1GADO 2Q7DA 4E1VA 5L7TA 4G67A 4KFCA 4GZMA 1M6EX 2JHFA 3NAMA 4RK6A 4KE9A 5HF5A 3Q5EA 2B2CA 3RCBA 2TMKA 1KSFX 2AFHB 2VF8A 3AU9A 5IM4F 2IT1A 2D59A 3R0VA 4JD5A 1UOEA 5DN6A 1KSGA 4F04A 2MR6A 5F5LA 3FUWA 4LYJA 2X0FA 3SR0A 3BS4A 4RIHA 5LFAA 3BORA 4LC0A 3MBIA 2NWQA 4QO8A 4KMOA 1ZH8A 5LDDC 3CLUC 4X1YA 1OWPA 1TEXA 1W0JD 3HRKA 4BNJA 3C6KA 3H2BA 1ZL0A 3D8SA 3H19A 2GCOA 5GIPE 3RR2A 1JKJA 2Y4OA 4KQWA 4AULA 4LX0A 4RANA 5IBPA 1ICIA 1K3UB 4CEIB 2Q5OA 1XRNA 3SC6A 3VC3A 2ZSFA 5MFZA 1W5AA 3TVDA 2CXOA 3BZBA 4O4JA 4DSZA 2WFAA 3CINA 3FJYA 3H1GA 4KXWA 1DTEA 2VKQA 2FP4B 2P90A 4DCUA 1ETHA 1C3VA 4XFJA 2V4ZA 1S8OA 1HA3A 2B4AA 5JQGA 3ET4A 5EIXA 1Z88A 3UA4A 5DV9A 3ZNQA 3SZUA 4FCCA 1WA5A 4J1NA 4WMLA 2PGDA 2ZRIA 1EXMA 3IEKA 3MRVA 4Y2YA 3Q1LA 3STUA 4RDIA 1USVA 3PUHA 1YCHA 5JPIA 1QHFA 2X8AA 5IZCC 4R1OA 5JRJA 1D07A 2HN9A 4OQLA 3BIWA 3L7OA 4H17A 4QARA 4FB4A 1B00A 1NY5A 4L0QA 1GTVA 2W11A 1AHIA 4MCIA 1HSOA 4PQYA 3ENNA 5CBPA 2RKWA 3F6CA 3AEKB 4DFDA 2RJ3A 4TMFA 5FPTA 3NBYC 4I1PA 5JECA 1RMQA 2C0PA 2O5RA 1GGFA 4J07A 4NFHA 3CZ5A 2CYBA 3MJDA 2X8BA 3T3EA 5KX5A 4G07A 1NTRA 3VOSA 4CKCA 2FR0A 1CIPA 2JRCA 3H04A 4I55A 1DHTA 3G2IA 4WACA 4XGIA 1SVIA 4I1IA 4CCYB 1RVDA 2L0XA 4D2IA 4DGQA 2ZXUA 2QRPA 1Z6GA 3X1WA 4K5QA 5JCPA 3O1JC 3Q9UA 4HWPA 3LW8A 4TROA 4NYJR 2H9AA 1QQBA 1NUPA 3PVZA 4MYDA 2CKMA 4ESHA 3FPFA 4MHSA 1U02A 2HPHA 3PF8A 4PWZA 1ZNYA 1JDBC 2PKXA 3HXPA 4WNAB 4ZIRB 5IM4A 4K8RB 4TLAA 1FFXB 1F2UA 1OAKA 1XVAA 4IM7A 3IV6A 3DZHA 3SM3A 3CUEF 3JYHA 3ZLVA 1MLDA 5FXMA 4NK4A 1NR7A 1X0VA 5C8ZA 2VPXA 4FC7A 3OAAA 5EE1A 4EYSA 4B74A 4HTAA 1DIGA 3EUWA 4HDNB 4AJIA 1IZ8A 3FRJA 1T3LA 1CTQA 1QYXA 3WWZA 3LXUX 3ZWBA 2OV4A 1V5FA 3BCHA 3CWQA 4KH1A 5YASA 2DUJA 4JYCA 5DT2A 5LU9A 3ZE8A 2YCLA 3DLBA 2OYCA 3DR3A 2GASA 2C82A 3LWBA 4IYJA 1PYGA 1NUHA 2Q1YA 2ZRDA 3QBDA 3UWOA 2EX1A 1MB0A 2AG1A 2HL6A 1FVFA 2OHXA 2VYVA 4MVJG 5FBKA 3U4HA 3ZWMA 2LW7A 5CDTA 1WMFA 2H2HA 1VRCA 1R8JA 2ZI9A 2PRIA 1NQAO 1COZA 3BGVA 3IDAA 1PD1A 2Z6QA 3VSDA 1N57A 3VQTA 1UZNA 2EKLA 3M81A 3P52A 3F3MA 1AOXA 1I6KA 2O50A 4RC9A 5B37A 3JU3A 2LPMA 1JWBB 2ZVJA 4FDTA 1T1GA 1S89A 3BZWA 4ARBA 4E31A 2IY8A 3RABA 1W2GA 3N7UA 4DAEA 1P1RA 2R7LA 3CUVA 4H3SA 3TIFA 4QNRA 2XQFA 5ALVA 1ZJYA 2YV3A 2W6MA 3I12A 4CT4B 1D4OA 3JQ7B 4ZI5A 2BKLA 3T9BA 5IANA 2WYOA 2GTHA 2QV7A 2CXHA 3PQ2A 1M67A 3P5BA 4R68A 4U3JB 5BVGA 1STOA 3ND5A 2EBWA 3VVBA 2DWUA 3VDRA 1NV8A 5IG2A 1W46A 2BRUC 5BNWA 4F5DA 3OWHA 5CH5A 1G3MA 3HA7A 1WPXA 5KJFA 2UZ3A 2VPZA 1M33A 1QH8B 3F5DA 3ELYA 5K8VA 1GTL1 2JF0A 2QZ4A 3VH3A 3U4QA 1FTWA 1F38A 3OOSA 4WDRA 3ND7A 4OMDA 4B4UA 2G9ZA 3QJ5A 4KTVE 2EW8A 3DVLA 4PR3A 5TPZD 4O59O 1GQFA 1W34A 2QRVB 2IKQA 4P36A 4EI7A 4Z1OA 4K88A 4F7WA 3ROZA 3JQ9A 2R5FA 5CPBA 4UCXA 4IDGA 1T2NA 1QFXA 3PNKA 1XXHB 2P3LA 4RENA 5COBA 3ORRA 5BNIA 1C9KA 1FS4A 1E2KA 4LY0A 3IKVA 1DDGA 1DAKA 3KAPA 4TWRA 3F1LA 4NTZA 1ZOOA 1QAOA 1YMUA 3DGFC 3HKBB 4NMHA 2OXFA 1MB3A 4L8LA 1XAJA 4OXQA 3DR5A 2G5PA 3QOFA 4H16A 4YJHB 4BNNA 4FOSA 4CKBB 3VR5A 1IN1A 3IEIA 5E7QA 3P2YA 1IHYA 1NOIA 4IHKA 4OL9A 3IDSA 5IDVA 5DN6D 2EJWA 3LY9A 3KTAB 1T5SA 4IG9A 4KOEC 3CMMA 2AQHA 1OC2A 3SS9X 3HU3A 4O4HA 3STVA 1G2OA 4F4UA 4MPTA 3VPAA 1W76A 4KNWA 2APJA 4M88A 4QT0A 4TMYA 3ZGNA 4FGUA 4M46A 1A04A 3VMFA 1E1DA 3VR6A 2EL7A 3QUQA 4X1IA 2HZBA 3JPWA 3L1VA 4RU1A 3VTZA 1N5IA 2AR0A 1Z08A 3LGXA 1P9LA 1X19A 2PUDA 4HZIA 5EHQA 4ZQIA 1XCBA 2UYYA 4FOOA 1R4MB 2CL5A 1GPDG 2QORA 3NANA 4YV2A 5FIUA 2W0MA 4PSKA 4CLEA 1R6VA 4HUJA 3DLHA 2ZR8A 5COQA 3UG7A 5K0CA 4RVOA 4Z5XA 5C3UA 1UJ4A 4MDEA 1IN8A 3IPAA 4P92A 4CMAA 1NT4A 2VSNA 2W4MA 3M0EA 3TX2A 3GIDA 3JPYA 4UCWA 1GRCA 5IS2A 1C9EA 3T9DA 1ZD2P 1ZM7A 1ZNXA 2NYUA 2B4QA 4YIHA 1VL6A 2FSHA 1X77A 2IYVA 4LDNA 4N6OA 3WYDA 3U7GA 4IVRA 1M8PA 3BH6A 1F2VA 3I2FA 4OB8A 1X9HA 2HQOA 3E35A 3VYTB 1YTLA 5E3HA 3C3JA 2CVQA 3DH0A 3TSOA 2VLBA 1VE3A 4FD2A 3ACDA 1SUFA 4AT1A 4EZEA 1CJKC 3WRWA 5I4CA 1C9DB 3OWOA 3V7NA 1GT91 1T4GA 4AJPA 4EJSA 2GEVA 1SOMA 5KAMA 3P9ZA 5EKSA 4Z7NB 2JZNA 4J7AA 4TLCA 4DNQA 4LTMA 3ZTWA 2O8BA 1L6RA 2VQ6A 4PANA 5KX5B 1VMDA 2Z9BA 3KJQA 4GMGA 2QK4A 3Q5GA 4IJ6A 4XJXA 3X1YA 3TG2A 1ZXBA 4BU1A 5A0VA 2GD6A 2PV7A 1YS4A 3N6RA 1ECPA 1N6IA 1U8AA 1RFGE 1U3WA 1FP6A 1RHQA 2OILA 3CUSA 2F00A 4L5YA 1CZRA 1MZVA 5KVQA 3FOZA 3OD5A 3AEZA 1Y34E 1C4KA 2WTNA 3EEOA 2O2HA 1A7UA 4WLEA 2WIKA 2ZBFA 1JEYB 3R3ZA 1RMYA 3LUGA 1SKQA 1TQ6A 3H2SA 5ER9A 4BE7B 4E6PA 1MB9A 3FOEC 1D4FA 1E9EA 4CKEA 4YPVA 4MWGA 2UZ0A 3RIXA 3GJ0A 4Q9DA 5JAUA 1GLGA 3N86A 3PL5A 2DFPA 5DSZA 4C06A 1J2EA 3W3AD 2IDZA 3TX6A 3CO5A 2NU9B 3FDJA 4M86A 1LCIA 3M4JA 1XTQA 2PKWA 2O7VA 1FDRA 5U4XA 4JKYA 1U7OA 1R6AA 3SAJA 3A6KA 3KQLA 3E9RA 4BCBA 4F4FA 1P6UA 3DBLA 3OJOA 3SX2A 2PLRA 1TKRA 1NXSA 2X1HA 3HKDA 5CYOA 4HEA1 1AA9A 1VG0B 4Q7JB 2IV3A 4BRUA 5M34A 3NHPA 2FB9A 3E53A 1NMQA 2WAOA 3EG9A 1XAHA 4RH3A 1I7DA 4E94A 5JZBA 1VSQA 3FB1A 1L4MA 4EA8A 4HX5A 5C7LO 2JLYA 4JBNA 1N1EA 1KJQA 1Q44A 4WLUA 3HCOA 1G2PA 1SUAA 1II8B 5L4NA 3FNHA 4DLBA 5CP8A 3OOWA 3PSAA 1OHHD 4XCXA 3ZV4A 3PC6A 1UR5A 4NYIQ 5C1IA 2FX2A 1QJCA 5GJVC 4BPBA 3LVRE 3KQYA 3ONWA 5E4TA 2P1DA 2YWHA 3C3MA 3QH4A 1ZKDA 4N8SA 4PQGA 3ILXA 1N0VC 3G85A 2CCKA 2EV9A 1AN0A 3OCUA 3WMXA 2PL9A 4K2HA 2D0IA 4L07A 4KDEA 2IYZA 4RMIA 4TLEA 4JH0A 1EJ2A 2AWOA 2N9UA 5E3IA 1NLZA 1ULZA 4RYLA 3W5DA 5LOVF 2FVYA 3V4OA 4NNPA 1TM5E 4D7AA 1GQSA 3R5FA 4HDAA 2UUCB 2FZLA 2P2YA 1QNFA 2IHKA 4PYLA 1GGEA 4MK4A 4KR0A 2PQ2A 3JQ8B 2O8EA 2HYIC 3PXUA 1HPLA 2C2OA 4KV9A 1DCKA 1AXRA 1SGWA 3ZCRA 3ILSA 2B5WA 3DLCA 3AJAA 3QU2A 3IALA 2CNLA 2H1VA 2PJRA 1TQHA 4R8RA 2X4IA 2BEUA 4K26A 2WJPA 5FI1B 1B7GO 4DSNA 4F71A 2QTTA 1T5OA 1JJIA 2DQYA 3OBBA 2W5UA 4TTRA 1OBVA 1RIFA 4NNOA 5FYQA 4FEGA 1CPYA 2XUPA 1CULC 3SF0A 2RHGB 4UM7A 2OG2A 2H16A 3CEHA 4FM9A 1KI2A 3GNSA 2BJWA 3CF0A 1W88A 4KFRA 4C4YA 1E2GA 2IBMA 1E4EB 1GPLA 2ACEA 3LZDA 5H3HA 3AESA 1GIAA 2JH9A 4I4TA 4KDCA 3P97A 1UFKA 1PR9A 1Y5IA 4IDOA 2I3DA 2RJOA 3THOA 2CHUA 1YCGA 3A3KA 3H8VA 3LYAA 5CK4A 4CM4A 5B3JC 3EVNA 4C9BA 2ECOA 2DKOA 1MB4A 1NUAA 4ZK6A 5FPKA 4FI3F 1ESNA 2IOHA 2OK8A 4MQEA 1WDKA 2EBHX 3IQWA 2BFEA 3DUFA 3WFJA 2AW3A 4MKXA 1THGA 5LR6A 1Y7TA 2AFRA 2HTFA 3VU8A 1LS6A 4BNLA 1OWNA 3PR2B 4JN6B 3SFVA 4OQXA 2C4HA 3FYUC 2J3EA 4HEHA 5KKCA 4QICA 3TD2A 2EJUA 5LA6F 4KIUA 5DTMA 3DA8A 2NIPA 2I71A 3O8QB 2OZVA 2Z2IA 3UAOA 2NU7B 3A28A 3V7FA 1T2CA 4BZWA 5LJIA 5CAEB 1ZMBA 1WQ1R 3CNQS 1A71A 1ZYUA 4HQOA 4JT2A 4FW8A 2C59A 5HILA 4LRXA 5CT9A 3OAAD 2ZKIA 3HH8A 4PG4A 5L3SB 2VPYA 1II8A 3BOSA 4GEKA 1OYYA 1ZESA 1DX4A 1PZFA 1XK7A 1MOPA 3WC4A 1YGYA 3T1QA 1T9GS 3WGLA 1PLJA 2JCYA 1ZRMA 3PDIB 3A4IA 3FYCA 5IVIA 3SQWA 1UEJA 2V59A 1N6PA 3GGGA 3VOAA 5HHTA 4TN1A 2HC9A 2ZRAA 2IOYA 3ZTYA 1XZGA 1B42A 1BWPA 1E63A 3C1OA 1XTUA 1YR6A 1PG2A 1QZTA 2GVNA 4XE5A 3PC2A 1EH5A 1RRKA 3MSXA 3IHLA 3WNVA 4FIZA 3GFOA 1CUDA 2VZEA 3KR9A 4UMEA 3M1IA 1ZFNA 2ONKA 5CBKA 4UOQA 4E1BA 1N6NA 2AEEA 4RLSA 1Z38A 1YC5A 2BM9A 2CCGA 3H5WA 2VHEA 5EMLA 3TLGA 3M6LA 3BX1A 4DUGD 2FXIA 2ZB2A 3CKLA 3H97A 3DE5X 5JIBA 4C4ZA 1G9TA 4D92A 1OT3A 5TT1A 3Q40A 1L8LA 2XVYA 1US8B 4L85A 3F98A 2VBGA 4N9QA 3TUIC 2FK8A 1GFSA 4IEEA 3UJ7A 3RRBA 4HNSA 5J5AA 1AB5A 2OLJA 2VKTA 2BFEB 2BC9A 2DBZA 1U0FA 2QTGA 3L2OB 3E7PA 3VDQA 4WECA 1A9QA 2FRXA 4QU0A 5BW5A 2JIMA 4PICA 1TDJA 3ADKA 3UNXA 2F1IA 8ADHA 3H1PA 3AETA 1RKXA 5KOJA 3UMRA 2RDMA 4G5HA 4PW0A 3LVBA 5JE8A 3DDHA 3QPUA 5FNVB 5A7HA 4ONEA 1XTSA 2YTZA 4UZSA 4MB2A 2WU4A 4YXWD 1KI7A 1RC8A 1Z4LA 4O0MA 4I0WB 4ZJYA 4MW5A 5A4AA 3MIZA 5DH9A 1DG3A 3BTVA 4J2TA 1C0PA 1EBFA 1KC1A 1HLGA 3EC7A 3Q8WA 3SYMA 1D2GA 5I7FA 1EYZA 4WL0A 1JVSA 3AVOA 3TI9A 3FKSD 4L5AA 2Z5GA 3UV7A 3PHJA 4AMGA 2HW8A 4E32A 2HBQA 4N3NA 4CDNA 4PGGA 2NSYA 2NZ8A 4XR4A 3O26A 1UBNA 3ABRB 1S2DA 3R76A 3ZY3A 4YAUA 4FNGA 2O3RA 1XDWA 3AZPA 4GZ5A 2DUUA 1W1IA 2AT1A 3JYOA 2P3OA 4DM7A 2ZRQA 5J1SB 1BJRE 1I4WA 2G4LA 2AOUB 3FCYA 2LCQA 1U8CB 2FDCA 2B82A 2HZ7A 4HCJA 4EL0A 1HMPA 2C92A 2JAWA 2WF8A 3CU5A 4L22A 3I76A 1EXNA 3JZDA 3LSYA 5A0FA 5LZ5A 4DMRA 3N74A 1FQWA 3AUUA 3HYRA 4CG0A 3N2YA 4R1NA 4Z7JA 4F5YA 4ZMBA 4QHSA 5HGJA 2WZBA 4M7PA 2O3QA 4RM2A 4KAAA 5AM0A 2JB9A 1Q83A 4ZICA 5LZ4A 1JP7A 4IX1A 3TZLA 1P1KA 4RLQA 1RHUA 3OJXA 1MTZA 2VP0A 2Y1CA 4KNYA 1W36B 3PWZA 2JK0A 5ESWA 3KUXA 4GQIA 2X8LA 4HDKA 3OI7A 1SKYB 3AT1A 1ZN7A 1ZQ9A 4KK4A 4MQ5A 3BMNA 4V1CA 3CUUA 4G01B 3RC7A 5HQ3B 2VT7A 5G0SA 4II3A 4N5IX 1BFDA 1G1AA 2UXCB 3FVTA 3HCCA 2GHTA 4G1UC 1OXTA 3GPIA 4NCHA 4RIGA 5JATA 1FQJA 3GMDA 3SEZA 5LVAA 4Z53A 3FN4A 4MVWA 1HE4A 5FOUA 1KI4A 3L6EA 3C8HA 3T7SA 2VUTA 1IRXA 1GDDA 3DD1A 5IBRA 5J40A 4N0EA 2CLOB 3RSFA 4BMDA 3Q7PA 2IHJA 3EVCA 5KZMB 1CBUA 1SZJG 1U99A 2MYUA 2PUVA 3OIWA 3Q9LA 2C42A 5T5QA 1QX3A 4WBNB 1PNQA 1OFHA 1R6UA 2WSYB 2XQJA 3CPHA 3GJQA 1ZSNA 4LS3A 4RTLA 1RBZA 3W5CA 1QUFA 5T3UA 1RI1A 3HC7A 2H9YA 3OH8A 4LF4B 5JJKA 4PX3A 5EP2A 2COKA 2QTVA 3DXZA 3AUKA 4CL2A 1RJEA 1XJCA 2C4NA 5TMPA 4HQ0A 4UFNA 4N5DA 4BKOA 1LWOA 2GPSA 4TXNA 1R0LA 1XHLA 1XX6A 1JAHA 3W7VA 1ZM2A 1JDTA 1MFZA 2X6RA 1IOWA 1HRDA 1WW8A 1XA3A 1S8NA 2FZCA 4YJGB 1YUBA 2QD3A 1VKHA 3LT4A 4L72A 4N7BA 5DXJA 3AKEA 1TUEA 4GGOA 1HM5A 4RACA 4RK5A 1H8HA 1KE1A 3UB4A 4EG7A 1V7CA 1QH0A 1LQTA 2P9QA 1L4YA 1RD4A 1SIBE 3B2QA 3UMBA 2IXGA 5J5VA 1T0IA 1RWKA 4CQMB 2R8RA 3PD1A 5F76A 5AJWA 1A9YA 2YWRA 3H7IA 4ZYUA 1Z63A 4XGQA 5JAOA 1GGNA 2Q9CA 3I1FA 1A98A 3BGIA 4S2UA 4X6YA 4P83A 1YR7A 1NBWB 1VDMA 3C6XA 3EIWA 2P5UA 4U63A 5DYWA 4QM7A 2DRIA 4QUDA 3I9NA 1Z8DA 3PGLA 2J41A 2J9XB 1JX6A 2QLTA 4XX0B 4QM6A 4UMFA 2JFUA 4C05A 2VDLB 3E9NA 4YMSA 1Z8FA 4S24A 5ITZB 1ABBA 1JR6A 4HNHA 1GV0A 4UAJA 5C5DA 2BHTA 2BH9A 1Z2EA 5F1OA 2WRZA 4YR7A 3K9BA 1Q77A 5FTMA 1UJBA 3KYJB 2QIOA 1JEJA 2GN4A 3ODGA 2OTCA 4A3SA 2ANCA 5H70A 4MGIR 1JG3A 1KNXA 1P2SA 5K3FA 1B1AA 2AB0A 4HLNA 4B3RB 1XLVA 2Y0DA 3U37A 2NQ8A 1SU8A 3OQMA 1C14A 3LF1A 3VJRA 1WD7A 1MVOA 3K35A 1UM8A 3OLZA 4WK4B 3U16A 4KREA 1G7RA 4WZAB 3DBHA 3NT2A 3UYLA 1LC3A 3OC0A 1REQB 3BWXA 4FX2A 4GOOD 5FRDA 3VX4A 4BLVA 4TRMA 5ITWA 3S2IA 2DHRA 5IAJA 2QDKA 1JUDA 3G5UA 1IG3A 2X6TA 3VR2A 4YT4A 5L3SA 1E4YA 1RDFA 2XMRA 4OBEA 3IRVA 1S3GA 2QRVA 4AL4A 1LUAA 2HU7A 1UK7A 2JFFA 5HF6A 2JDID 1QNLA 3U7JA 3WGYA 1TNDA 4FP9A 3AGPA 4D5EA 3A6GA 2BGTA 4DR7B 3GGDA 3P9KA 2BEKA 1JJBA 1CUVA 3EWSA 1DX9A 2RARA 2XY4A 4IIVA 1M0TA 3BG5A 4LOIA 4M1OA 3QF4B 4QAQA 5K1ZA 3URMA 1RHMA 2AFIB 4JLUA 1NVVQ 1SVNA 4Z4HA 4MVJA 3UGTA 2QX4A 3AKYA 1HZZC 4EL5A 5EA2A 1KWKA 3O2JA 1JHQA 2XXAA 1V95A 1W1WA 1C7ZA 4UMDA 3MBKA 5CYPA 5LLDA 3AFMA 3WP1B 1GA6A 3ONVA 2PYIA 4IKPA 3K1AA 1K2WA 4OM7A 2I9KA 2AFIA 4LMBA 5HF9A 1GGJA 5I9NA 1M6VA 4JXJA 4DCSA 3A4LA 1GYQA 1L7VC 2P7HA 1RMTA 1U81A 4X71A 4AZ3B 1GSOA 2PRKA 3KCQA 4O4LA 3NFYA 3VPXA 3WMWA 4Y98A 3VR4A 1G291 4QUBA 3BFPA 2BGNA 4DPKA 2GZSA 4MUAA 3NTUA 4QWMA 4MP8A 1HZJA 3T1OA 3IA2A 1RJFA 3N2KA 1TCCA 1Y98A 3FPAA 3T7KA 2B30A 3UWDA 4AMYA 4LDJA 1W59A 1K5DA 4HI0E 1A2KC 1EE2A 2G5TA 2VSYA 3L7KA 3W2HA 8OHMA 3EZ9A 2H1OA 3KV3O 5B53A 1G8SA 2B1IA 2AX4A 3G0BA 2RHCA 4QASA 2DMRA 1VYUA 1P4SA 2DPMA 5LQUA 3LBHA 4IIXA 4ZQHA 2GYWA 1A9ZA 1PJ3A 3Q3IA 5AHKA 3TPFA 2JG3A 4NU6A 1CDEA 5JVDA 3BE8A 4GZ3A 1PT9A 4KPYA 1I14A 2C5FA 3EJWA 4KLZA 5G4KA 3VYVA 3T3HA 1BWRA 4I46A 2GAAA 3D3NA 3K6RA 1EJ0A 1H9BA 2BISA 2XUAA 3QI7A 4MQFB 1AE1A 3HJRA 1GP2A 2CSXA 3BL8A 3V8MA 2ONYA 3OOHA 1NVBA 3LKZA 1K97A 1KXJA 1J97A 4D5GA 1W5EA 3D1JA 1UP4A 3IS3A 1XN1A 3TIIA 4NLLA 1JDVA 1RLUA 2JAXA 2UZ1B 1MXFA 4YONB 4WX2B 3C16C 5BMOA 2UUBB 1VJ5A 3NJ4A 1Z73A 5JNWA 1UAAA 1Y4DE 4OB7A 3OVMA 4PWYA 3TIGA 3HR8A 2GWRA 3KLMX 3IC5A 2O5CA 4PHFA 1COWD 2N47A 1AQ6A 1I9GA 2IEBA 2CMKA 3KYDA 1UC9A 1FP2A 2QG4A 1Y0BA 2TMGA 3MK31 2R7KA 4HP8A 4ILKA 3VAYA 1EQAA 4AJOA 2YZKA 1LVGA 3QG1A 3TVTA 2WOOA 4IP0A 4PBSA 3TM4A 4MKIA 3F8SA 4C21A 4KNVA 5IABA 4HADA 1MHTA 2JJ2A 4C03A 3HB9A 1EWRA 1FDIA 2ZZKA 1F6BA 4EW2A 2GZMA 1ORVA 2BW0A 4MV5A 1DO8A 3I4LA 1P4RA 1DAIA 2FZWA 1WVIA 5EVCA 4Q9HA 4ZAVA 1F3LA 1BKSB 3AW8A 3BXPA 3D3JA 1JYSA 4M8IA 2PXHA 4OQ4A 5L3ZA 3WLPA 3ZU6A 2XDQB 1JH9A 2OO5C 2D1TA 2IIBA 3FPKA 1Y6ZA 2ODBA 3JD1A 2ZR9A 3WISA 2J30A 5JHGB 4OAQA 1T1SA 4HFNA 5U1PA 2HBZA 2Q8QA 2W2QA 5K4AA 2QR2A 1JKXA 3BFJA 2QAIA 3G82C 4M1QA 4AY3A 1QRUA 2VH2A 2GBIA 3HN2A 2X9NA 1TLTA 4XQCA 1Y5NA 2Y3IA 2FP4A 4L15A 4DLRA 4EARA 3OPYA 3W7AA 1S01A 2EZUA 1BE8A 2V0NA 2B2XA 2GGSA 2MMCA 2DETA 1YRBA 4FYYA 4HQKA 1ZOIA 1LI5A 2QAGC 5F73A 2QE7A 3UK7A 4JI4B 2GT1A 4EP1A 4R0NA 4WEOA 5ALFA 2K2WA 3GRCA 1SQ5A 4MWEA 3UT5A 3ZHUA 5J43A 2NO5A 2Z4SA 5D3QA 1ST3A 2UUPA 2XUZA 4M83A 5B12A 4AY6A 3NI2A 1V5GA 5AKKA 2O2EA 4ATNA 4YMVA 3ZZMA 4F92B 4PLZA 1E1LA 1RXEA 1X9IA 2MSNA 3H4IA 5LA6A 1MP0A 2TS1A 4GX2A 4B3HA 3LMKA 2VRNA 3U3DA 4DRZA 1HX7A 1KQNA 1BDJA 3CUKA 3R7SA 4D9MA 1PFKA 3EVGA 3IGFA 4S1TA 4BX0A 1JTFA 3IUPA 3T7CA 2XSZA 2FG5A 5LMZA 4D80A 2GRAA 2OO7A 4UM8B 4EUEA 4JVSB 4NPAA 2YBDA 5EZYF 1E1QD 3HA3A 5FOQA 3GLFB 4KE7A 2ZWIA 1SBNE 4ZJPA 1XE3A 5F3RA 1QV6A 4V3BA 3VVMA 5K0BA 5JDIA 2G0NA 1RQNA 1P4GA 1RWWA 2PLFA 3DE7X 4HDOB 1SAYA 1TIBA 2A4KA 2J7PA 3NEJA 4N03A 4UOEA 1FX0B 3ETEA 4BLQA 2V55B 4J9UE 4DZTA 2C78A 1GYRA 3JVIA 3UH1A 2Q2NA 3OJLA 1JQ3A 1L5ZA 3TNLA 2F8LA 4OXXA 2PA0A 4KN8A 5HR5A 4HWRA 1Z25A 3ZGYA 4BNDA 2FEWB 1CJCA 5CB4A 1YJ5A 5FP0A 1P5RA 5DXAA 5HKKD 1SCUB 2I6SA 2WLTA 5TGDA 3WQHA 1SUPA 2UVQA 1FFBA 2QX7A 3DDNA 4Q4JB 5K05A 3LUDA 3EFHA 1TT5A 3H3XA 4YHBA 2Y77A 5C51B 4MRPA 4CJXA 4N65A 4CR8A 3BD8A 3VU9A 1OX5A 1PGJA 1GLVA 1XEAA 1D1QA 2NP6A 4WZ6A 2EJVA 4IOMA 3JVVA 1UKZA 3EA5A 4MUGA 4BZQA 1JQLB 4O2RA 3AF1A 3RUHA 1B76A 1X0XA 1VGQA 4BLRA 4YTEA 3QRWA 2IX3A 6ADHA 1D8AA 1DC6A 2XNJA 4FYVA 1SEPA 2PTHA 4RZIA 1WBDA 1CDZA 2PAAA 3C39A 1ZX1A 4F86A 2NGRA 2E4AA 1J9GA 3HKBA 3PFCA 1P2DA 1G98A 3OFVA 5MN4A 1T2AA 1AS2A 1NW9B 3KKMA 4QLBA 1CJMA 4Y2UA 3DFIA 4JNKA 4Y2RA 1LLDA 2Q0SA 4MI3A 4RPJA 4XQGA 1D0VA 1TJ3A 1C7RA 2QGNA 4EZIA 1VLJA 4IDCA 5EZ5A 4LXGA 1DOAA 2XOEA 3C4JA 4OGKA 2JBAA 2I7XA 5B3LA 1HYHA 5KJEA 2NUTA 2ECFA 2V6JA 2XUIA 5ALIA 4XRGA 4B3DA 4QATA 1EJ6A 2RHTA 1C29B 1NXQA 1DQRA 4C4XA 5FBZA 5J2UF 3AHEA 3OLCX 3N75A 2VUSA 3D3WB 3IE0A 3NJRA 1NBMD 2ZRCA 1Z0SA 3GB9A 4CRWB 5EL0A 4X91A 3FDZB 4KQIA 5KYTA 4H4EA 3IT0A 4PLPA 4YPFA 4A03A 2ZZNA 3HKCB 2VYVD 5EWMA 3HJAA 4BCDA 5E1MA 4CG1A 1MH9A 2ZT5A 3B1VA 2VAMA 2PWPA 3HZOA 3S5UA 2XUDA 4HT3B 1PHPA 1WMDA 4GKAA 5JD3A 1Q0HA 3CH5A 1R15A 3FI9A 2YKGA 4JJZA 2IHTA 2PEYA 4BQFA 4DLKA 2X7JA 1JEQA 3QX8A 2B34A 4QNMA 1V5EA 2G07A 2FMFA 3EPRA 4JUAA 4JZYA 4LECA 3N28A 4TWBA 3RUCA 2JCXA 1F4PA 3CYFA 3UKDA 4CQMD 4ZI7A 3RC8A 1FFYA 1Q0RA 1E7SA 2OA0A 4M9SA 4NBLA 3H8WA 1WMSA 4MCJA 3KZCA 3H8SA 2PDAA 2UKDA 3GVCA 3FCXA 5I48A 2FSIA 1FB5A 1VKRA 4TQAA 3I8XA 1Y5LA 1ZMXA 3B85A 3GDFA 3IXLA 5I3CA 3BSYA 2CWWA 2FF7A 4IJWA 5EUCA 3Q8LA 4YGXB 2Z2ZA 1QQTA 1C30A 5TPZA 4DXDA 1DBRA 1Q12A 3MTGA 5FUQA 4NC9A 3K32A 3WSTA 3NVKI 4XYMA 3V3TA 5CT5A 4F93B 1V7ZA 2QPAA 5IFLA 1XQ1A 2YC4C 3LPCA 2GBCA 2R8PA 1XDSA 1SK9A 3M2TA 4IMJB 1EFUA 1O2DA 1Y1RA 2VZ8A 2KM1A 4A8HA 1J5PA 1RWQA 1VQ1A 4I4TB 1L0BA 3GUCA 1VRWA 1JG4A 2G7ZA 3HE3A 1YR3A 2BMFA 3FIJA 4JI1B 4BN5A 1IN5A 1K6IA 4C0JA 3GJ4A 1V8OA 3D4BA 4OU4A 4IUBS 1RVV1 2R8YA 5CT8A 3KHKA 4CLXA 4MIYA 3QEAZ 1AKVA 3NJ8A 1XKQA 2RAVA 2VDWB 2OXTA 5BR4A 4TT3D 5EUQB 1GGHA 2YW2A 1SBHA 3FMPB 2O2DA 2RHWA 2XEXA 3DTTA 3H4MA 4OXYA 3QGMA 5CA0A 3IULA 2M1ZA 2QG6A 2ZXEA 3GBPA 4JK3A 4O8ZA 4D0GA 3K0AA 5CB8A 3FBWA 4M0EA 2CNWD 3PNBA 4YMTA 3FF1A 2XVXA 4HYTA 1TK9A 1ZEJA 1JHXA 3S1AA 1RKBA 5HCIA 3KQMA 3Q98A 4IV8A 1H1TA 4RLFA 3VDMA 2PUBA 1DKMA 1HQKA 1W8IA 3F2IA 3P9XA 1GPH1 4BY9E 2YVUA 3CUWA 3RS8A 3KWMA 16PKA 1NGSA 1H65A 1W4ZA 2I3AA 2WICA 3CT4A 1V37A 3L4BC 4Q00A 1NYRA 2H4WA 3T15A 1WZCA 2WJ3A 3CVWA 1SQFA 3AERA 3PJGA 4CEHA 3QY0A 2H0QA 1I1HA 1E1QA 4IDDA 5B36A 3KYBA 1XAIA 3PPXA 1HT0A 1P5HA 1T2UA 2RBGA 4E5YA 2QN9A 2C9CA 5DNAA 4C1NA 3H6HA 3W1EA 1D3AA 4QD3A 3TOZA 4URVR 4RTSA 2JAUA 1T91A 3IHWA 3TD6A 2Q5HA 2X4GA 2ADOA 3U7QA 3RSSA 3VR4H 5GAJA 1XD8A 2RB4A 1RR6A 1Y1QA 1Z0JA 3NIFB 4G26A 2I03A 5ALLA 4UBNA 4C6TB 4A16A 3I34X 2Y0CA 1QONA 3MF4A 3NP9A 4KV7A 1L3IA 3VX3A 1H66A 4IWYA 5GP1A 1IN4A 4NARA 4B76A 2ECPA 5JJBA 3QF7A 1IBKB 5BO5A 4TN5A 5F7JA 3OBIA 3UAVA 4YPOA 2Z98A 3LTNC 1N2GA 5EIOA 4XD7A 3EZFA 1SBCA 4II2A 3SP1A 3V1TC 1D0IA 1JKJB 4MDHA 4ITRC 5IEBA 2J0SA 2V5AA 3O0DA 121PA 2CUZA 3FHTA 4DR3B 3R09A 2A3RA 3GH1A 3WL7A 3UJHA 2FY8A 2GS9A 1VPWA 1V3QE 5D5HA 2OHHA 3EXHA 3LIPA 1XNJA 3I2IA 4D3FA 1IWOA 5F98A 3IE2A 1P4HA 2JJMA 2NU6A 2DH6A 1G8GA 5CFNA 2A7XA 4Y8VA 3ZHCA 1FFHA 4NABA 4XM2A 3L0SA 2Q3BA 3WZ2A 4ALKA 1RACA 5KUTA 3WAGA 3N5KA 1Y63A 3NDPA 3FFXA 3DMRA 3OTHA 4MEAA 3HBJA 1IH8A 2R7AA 2G67A 1QVVA 3OZDA 3G7UA 2ZWPA 2NO6A 3G0DA 5TQJA 5IZCA 1RRMA 1ZN8A 3E27A 4P34A 1YZLA 4DYDA 1ZJ4A 1TTPB 3TTYA 1JT9A 4BEVA 3T1YB 1AU9A 1ZMTA 3CLTC 3GRZA 2QDXA 2K6GA 1OXUA 1O95D 1M75A 3LVQE 2GA8A 2C8VA 2VWPA 5A3RA 3COJA 1NKTA 1I2DA 3NH6A 3WO1A 3FX2A 3VUFA 1OBFO 5CEEA 5AJYA 4YJFA 1KDPA 4F4CA 1THZA 5A9TA 5I8ZA 2JVJA 4RPKA 3WYBA 2X4LA 2VNKA 3SJZA 4FFRA 1ZJWA 2ZE6A 3INYA 1U2GC 2NU7A 1XZQA 3ZWNA 2I6GA 2HLHA 2C2WA 2R79A 4EX7A 4KZKA 5FR2A 1UXGA 2IKSA 3SJCA 5FJJA 1YB5A 3LQKA 1Y9JA 5BYBA 1IUKA 2SECE 1RWVA 2MSWA 3QUTA 5H4HA 3I05A 3E3OA 1AMUA 1VA5A 5A4KA 3D8RA 1UWVA 1HG1A 4TXLA 5B1SA 3ER8A 1HOXA 4OFBA 5LC1A 3OX1A 3TZCA 5TLSA 2WUEA 3NYIA 3HWX1 2WB4A 3HDHA 4K46A 3SJBA 3HSSA 1YR2A 3NC1C 2F4VB 4R1SA 2NX2A 1QIDA 2BMDA 4MIOA 4CVNA 4I5FA 1G20A 5DEIA 3SSMA 1KMHB 5TJ9A 4MJ3A 5JVDF 4GZ6A 1LSJA 1BH2A 1H2RS 2C9DA 3ZY6A 1E5LA 2WDPA 5AW6A 1KQFA 3FHOA 4U6NA 5BRJA 1EFAA 4ARCA 3PU6A 2EFEB 1KZ6A 2GTIA 3G2PA 4MI6A 3MTAA 1Y4AE 1UBKS 2HMWA 4RD4A 5SZKB 5B6JA 2CCJA 4HUQB 1UUFA 5DOVA 4HNAB 1FDOA 1EVLA 1WP4A 2I80A 3NAQA 3PGJA 3EN0A 1G41A 3HJGA 4N82A 1F2DA 2OV1A 1J7KA 4X1OA 1CERA 1FU7A 2FFJA 4IVNA 5JHHB 3ZGZA 4YMWA 4Q34A 2ZRLA 1TCAA 5HTKA 3AGQA 2L69A 1D5WA 1QZ3A 2WIJA 4P9NA 5EJAA 3VTKA 1W8DA 4TT8A 5K51A 3ZWDA 2SKEA 3HUUA 2R6DA 1IJFA 2WSSA 3AL2A 3QWAA 5HKLA 1HT3A 4HRXA 1XZCA 1F1JA 4L9WA 1HLFA 4TPKA 1Z15A 4R9RA 1Y4ZA 4I66A 2HJWA 3UUFA 3VNAA 1N2SA 3COWA 3LQRA 1S6YA 3DPSA 2QTCA 1PJAA 4B87A 5HRUA 3NX4A 4HB4A 4ZCQA 3WGKA 1IZ9A 1R37A 1AUVA 2RAPA 1PEAA 2IIQA 3FA2A 3C1UA 1PSZA 3CIFA 1P7VA 1ZVVA 1CRQA 4FDMA 3O93A 5CIWA 4BNXA 4Y3UA 2H1LA 5KU1A 1L5HB 3E9QA 4P4SA 3P9IA 1K4YA 4MZXA 3IIJA 3UOAB 4MUIA 3MYYA 4TV8F 1R88A 3AW9A 3PKZA 1FC0A 2MINA 3A2NA 4W9RA 2XMSA 4PN3A 1AQJA 5J3JA 3N2ZB 2ZAMA 1M1UA 4GNKA 4CM9D 2EZTA 4O4IF 5P21A 1P29A 1W29A 4U6QA 2PUCA 2ZRGA 2RBEA 1Z6AA 2ZS8A 4DARA 4QG3A 1LS1A 4NBSA 2JS7A 3Q6IA 3GG9A 1IEQA 5AVUA 3TLXA 3GLIA 4XYGA 2F3PA 1GEGA 4RF3A 5IMBA 4EAQA 2J6IA 4GSLA 4MS1B 2FW6A 1YI1A 3ETJA 3KQVA 1ZUD1 1T1EA 3KT3A 3V1KA 1V1JA 3U40A 2NG1A 3CN7A 2PUJA 3RHZA 4AJJA 3ML1A 2HHCA 3SXPA 2NV2B 1E79D 3QU5A 4HY3A 3U48A 4KMRA 1OBCA 1EBUA 5AKEA 2HRZA 4M38A 4ALNA 3FBGA 1A8UA 2F4NA 9GPBA 3QUCA 5J4LA 3LS2A 3UJCA 1IIBA 2V9ZA 2X5NA 1AKQA 2AJ8A 2Z8ZA 4JL5A 4OI2A 4M36A 1NVMB 1OVMA 3Q11A 4DLAA 4ABTA 2I9PA 4MDYA 3T4PA 5C4IA 4URHA 2K4MA 1FLDA 4RNDB 821PA 3B6IA 3SHWA 5I8WA 4MYCA 3JX9A 4BPRA 1K98A 1LV7A 3OE4A 3PRKE 4JYBA 2OGTA 5CXQA 3EEIA 1KYQA 1Z6XA 3AY6A 2VEDA 1QX4A 3E15A 2BBOA 3K5IA 3QKUA 4R01A 4IIFA 4MA4A 3MAAC 2ZTHA 3BXXA 2OEPA 3FCOA 1LNSA 1ONSA 4MPPA 4NIMA 2YIMA 4TXMA 3MOGA 4FW9A 4EPYA 2I2AA 4HPXB 3GW8A 1XTKA 2OZLB 1E2LA 3CCFA 3JYLA 3EVEA 3A3NA 3UYKA 4TMTA 4UZFA 5AK5A 4DVGA 5DX1A 2XF8A 2DY1A 2VBIA 3KT8A 4MZDA 4JXZA 3GJ3A 4EHNA 1ZRHA 4OFXA 4G5OA 3NG1A 4E08A 3JASA 1OH8A 2OV6A 3S2ZA 2ODTX 3TD9A 1RE0A 3AF0A 3WL5A 1G3UA 4N6NA 5C0OE 2UDPA 3O8BA 4K6MA 3ZU3A 1L7NA 4PAWA 4COKA 1SXJD 3WYCA 3QA9A 4UTVA 1YHYA 2B8JA 3ABQB 2XCTB 1EVYA 4WLNA 2XLBA 1H0HA 1TF7A 2QW8A 1RHKA 3ASYA 2C5SA 1F0PA 3OE7A 1VYHA 3TE6A 4BNIA 1FNSA 4X60A 4YRNA 2FPSA 3GNLA 3G88A 4UAGA 1EZ1A 4CU5A 1XVLA 3WLFA 4KK3A 5BSGA 2WUGA 4JXXA 2W2XA 4Z0PA 2ZSDA 4RJKA 1CZUA 2ZJBA 3F74A 1QC5B 4TL6A 3IAM1 4TYMA 4B75A 1KARA 5DNUA 3GFTA 4E88A 1OHHA 3OJCA 4UVIA 4XLTA 5E0OA 3LYUA 4J49A 1N2HA 5G3YA 3SBEA 1OYOA 4LNUB 4F96A 5CG1A 2F1RA 3VR1A 2DFTA 1R7RA 2JI9A 2YR0A 2Q2OA 1OX6A 1RYEA 3PHLA 1G5RA 1N6KA 2X9VA 4DQUA 5F78A 3NXKA 3ESAA 2QTRA 4BQSA 5KTPA 1TADA 3ZOKA 1U9CA 1QCCA 2VT3A 4CMEA 5T8KC 2C3PA 4PC2A 3O0TA 5C18A 4DMMA 1AMOA 3AY3A 4Z1MA 1R74A 4NEQA 2I3ZA 2XIQA 1KYXA 2H5JA 1KH1A 3F7TA 3LDFA 4RHCA 3R24A 1YB2A 1X7ZA 2ALJA 5AI8A 3RYFA 3OKPA 1LF5A 3USCS 3F6PA 4IMPA 2YC2C 1QM5A 1B8OA 3GR6A 3G5AA 1TM4E 3PXAA 4NE2A 4S0XA 4WZZA 3OEEA 2XUGA 1I3KA 1UXOA 2H54A 1SKUA 1XVIA 2J7KA 1ZWLA 3BWVA 2QD5A 1OB5A 2ZRJA 1ZC4A 3ZE2B 3VC7A 1GPMA 1U6KA 1K8XB 5K6RA 5FNVA 1YZHA 2R1TA 4ZJUA 2C58A 3R44A 4IY1A 4Y6PA 1YF3A 1DWUA 4R1QA 4CKWA 5FLXA 3P0HA 4HLQB 2FPIA 2GJ8A 1VFNA 4I1UA 3MS4A 1BQEA 3G8CA 3T61A 3F7OA 2EDAA 2V65A 1DIOB 5B30A 3FNGA 4X90A 5AICA 1CS0A 1QOZA 1CQZA 2MYNA 4UTPA 6ABPA 4DCGA 4ERXA 2HGZA 1IEVA 1GPKA 2DH5A 3CVOA 3ZWKA 4AUMA 4CODB 2QYSA 3T06B 1AT1A 1LJ8A 1PGQA 1B2LA 1SULA 4ZQCB 1M34B 5TB5A 3H84A 2FPKA 3WGNA 3ZHZA 1YKSA 3SPXA 3AG5A 1F7UA 1YS9A 4FZVA 3IIMA 4MVJI 2E6UX 4KP7A 4JI2B 1PVDA 4IS2A 3WNDA 1CQPA 1SJ9A 4OOFA 3HYLA 4LZOA 4GKBA 5AW8A 2VFAA 5AI6A 4X63A 4O33A 3R3VA 1QO0A 4K9PA 1JEQB 4IJVA 2CC2A 3VHQA 4HLUA 3RSZA 1GOTA 2PWYA 2BGGA 3HY6A 3IJ5A 5IKPA 4BOYA 5AI4A 5ICGA 2WSBA 1DKRA 1HDIA 3DZ8A 1ZJ5A 4KI7A 3NAGA 1OH5A 4OLAA 2GK7A 3K15A 4QPNA 2PLWA 4FFSA 4LY9A 4QLOA 5F33A 2Q1SA 4RK7A 1UFVA 1U31A 3NHAA 5H02A 5EYPA 4EQ6A 3X1ZA 5JZMA 2NV6A 1UC5B 2JFBA 3DEAA 4HDSA 2QRQA 4LXIA 4M37A 4PZYA 4CUJA 5CA1F 4U4AA 1ZI8A 1KEWA 3WXMA 4D4MA 3R20A 1VLVA 3TG8A 1PYOA 1V9SA 4RKQA 3KOMA 2J0QA 2R6GA 5KTMA 4NZYA 4ZIRA 3MJVA 3HV2A 3ME5A 3NHSA 3FFAA 3FSGD 4M1ZA 2Y92A 1QGUA 1HYQA 1LTQA 1UBUS 3AZQA 4R2KA 2DR2A 1YZUA 3UJ6A 2XAAA 5E6RB 4DQKA 1OLSB 1KNQA 4AJ4A 2Y9MB 2J6BA 3WLTA 4LOKA 2Z2KA 4K9LA 1T35A 3RS7A 3B1FA 4ZRNA 2C1EA 2IDMA 2X1LA 4JA0A 5F7OA 3RU3A 2GUGA 1QWOA 3E6AA 4YCSA 4HWOA 5JRDS 4TM8A 4K0RA 4ACAA 1OH6A 3K9FC 2BOVA 2CDNA 3I62A 4WTOA 2XKBA 3C45A 3Q1KA 5IXJA 4HNQA 2YZNA 3SIWA 3P0RA 1Y3FE 2VDWA 4JJKA 3CW2A 4NBNA 3HU2A 4ZQGA 3CJRA 1F4LA 1E6MA 5BMVB 3LQ4A 3A8TA 3G2OA 3GJZA 4EG8A 4QG7A 3INNA 3RUPA 4JELA 3KCNA 4DG9A 1UZUA 5CVEA 3TJZA 4TLLB 1JR2A 3ETGA 4UJ3A 5CR9A 421PA 2AC4A 2VOEA 3IPYA 1EBBA 1EMDA 3N7AA 1XL0A 2PX3A 4HX9A 1YOVB 4Q82A 2EFHB 4G8CA 5AKYA 5HFNA 5JNRA 4D9IA 1PVOA 2GJAA 5JS1A 5LLTA 1JYFA 4AIIA 1JEEA 1YQTA 3D7LA 4RM3A 1NFRA 4O4JB 4XEUA 4Y18A 4LW8A 2WJVA 5DHUA 4MS4A 3PNYA 3RTCA 4YMHA 5GOTA 1ZM4A 2IHYA 1U7WA 4E0BA 4Q3OA 2O05A 2AN9A 1FJGB 2Q4TA 1LZLA 2HEGA 3IUSA 1P9WA 4RV9A 4YUAA 1VA4A 1ISRA 4FT4A 3FLMA 4ZOEA 3QUAA 3S0JA 5THXA 2Z09A 3E7FA 3R3UA 2FWBA 3JR3A 2YIVX 5CM2Z 3KOUA 4HUQA 3R7LA 4Y2JA 4M54A 4Q21A 1GL3A 2CBXA 4IXDA 4JP2A 4LC9A 4YCJA 2GZHA 3TDMA 3BB1A 1R9MA 2YFYA 4DLWA 5LWQA 1TZ2A 4RVUA 3N3AC 1FFGA 2X14A 3QXXA 4DJJA 2JGDA 1ND6A 5M29A 5ERGB 2WUDA 2ISQA 4OAPA 1H1DA 1EIZA 2VNSA 4IPTA 4CNQA 5D3MB 1ZVJA 5I7OA 3ZKWB 5GGXA 2A9FA 3DL7A 1XEXA 5JDCA 1KZ1A 5JARA 4FFDA 5B57C 1NA5A 3UFXB 1MC4A 4F0JA 5EJ6A 5IYZB 1JB9A 4WWHA 1OZFA 1C1XB 2PHZA 3ANTA 1EUCB 4FSDA 4FYPA 5IT0A 1DT5A 3O4VA 1EP3B 1FFAA 4NYJQ 4DC0A 1FRZA 1NXXA 1VMEA 3V1LA 3AIMA 2P9ZA 3EGVA 3BPSA 3Q7RA 4Q9AA 3BHMA 3REGA 1ATIA 2JFZA 1T10A 1L4NA 1C3EA 4TQGA 5E1BA 3VNRA 1PAUA 4ZK2A 2ODPA 4R3WA 2G9QA 3CZAA 1KZHA 1TK2A 5TGZA 2Z04A 5GVSA 3GAAA 1SRQA 2Q0HA 3BB3A 2HRDA 5I51A 5KYKA 1UDAA 3DYVA 1NF8A 2NADA 2HO5A 4PYIA 4ENWA 1Z5PA 4DCPA 1FXUA 1DJPA 1VXRA 1I7NA 5JOQA 1R9GA 2R48A 3K9HA 3W77A 4RTKA 2IXAA 4UE3S 3W79A 3TQFA 4MA5A 1ZUIA 4MPJA 3G0GA 4FONA 4LPSA 3TB4A 5K2MA 5CFMA 1K0FA 4DC9A 3IE1A 2CNNA 2PO5A 4NDZA 1QMPA 2V6BA 4BC1A 2P9BA 3DMPA 3GRKA 4S35A 1GA1A 3K2IA 5IN4A 4ZHQA 2NVBA 1A69A 2VAVA 3HJBA 2GFIA 1JBKA 1QR2A 1KETA 1I4EB 1V26A 2AC7A 1QHSA 3L8DA 4HWGA 1Z7BA 1NZDA 5TR9A 2PZAA 3PTLA 2QL9A 5FLYA 4MDFA 1KYWA 1G3IA 1GAJA 2XCQA 3L0YA 2OHGA 2H08A 4HVTA 4M89A 1VBKA 4IKOA 4Y67A 4HNGA 4QGBA 4X00A 2GPYA 3TTXA 2ZRMA 1II9A 1E32A 2P6MA 2V7WA 4MYHA 2NNLD 3RBXA 2XUKA 2BZ0A 1B26A 1QMGA 2JGIA 5DK4A 1E3DA 1CF9A 3UUEA 4KO8A 3UT0A 3GLSA 3PK0A 4DZZA 4AMUA 2YFQA 3T12A 2FCAA 3U80A 4PSVA 4F5EA 4OHMA 4QYWA 1Y6RA 1OBHA 5ELLA 2D7JA 4J0JA 3FNEA 3I0MA 4IMRA 1U5CA 1Y9ZA 5LZ8A 4PPNA 2X41A 2CJYA 5HZMA 2SHKA 4D44A 4UBIA 4W9NA 2KLHA 1L5FA 2ERYA 4C6RA 3QJGA 2HJVA 1XCMA 1B73A 5EQJB 2JIQA 2VJOA 3K2BA 3G2KA 5G1PA 4YRMA 1QG2A 5CMLA 3AILA 2ZYGA 4H6VA 2I76A 2IC5A 1PR6A 1AY0A 2CLHB 4EG3A 2ZJOA 2C7BA 1G8AA 1Y5RA 2CF5A 1II0A 1EQ2A 4O29A 1W30A 3ZE7A 2ZVPX 3RW9A 4R8MA 5EG5A 1V35A 2GMWA 4W82A 1I0ZA 4NBUA 3EBPA 3RNOA 1N33B 1RYHA 2OOKA 2EJTA 2IYLD 4PZCA 1OA1A 4Y9SA 4AJ1A 2FWNA 5F2NA 1RBMA 2QF7A 1ODTC 3TLMA 1V4VA 2N42A 1MAUA 5AVVA 5JDCC 5T7BA 1HE8B 4P7JA 4N0PA 1TJPB 2ORWA 1JA0A 3IB6A 3PNOA 1VJRA 3QOYA 3H3JA 2ERXA 4MH0R 4X1KB 1U0RA 1NW4A 3TJMA 2PX2A 5K0JA 1QP8A 4HS4A 4OK3A 1D7AA 2JAHA 2Q1XA 3B82A 4KVFA 1ZM3A 4LYDA 5I9LA 2W2KA 4TV9A 4YWJA 4AP9A 5GPBA 4JJAA 2WHPB 1FFSA 2BI7A 3RYIB 4YMGA 1N5MA 5J59A 3SEAA 4INOA 4UEOA 3P9PA 2D74A 4CMCA 2XNDD 3TBFA 1G5FA 3IAEA 4PZZA 3C3BA 1LVUA 2NV0A 4N5LA 3K0AB 5IMSA 4J6FA 1KC3A 2XTMA 3TOVA 1I33A 2YRXA 1R0WA 4P4SB 2FK7A 1VPDA 5DI9A 1L5HA 1EVJA 1QTRA 4G5FA 1P0IA 1XWWA 5JSUA 5J2TA 1XD9A 1DQPA 2CLIB 3I32A 5L4LA 2HXYA 2GERA 5EMJA 4GW3A 3OOJA 4M8SA 1S2NA 3H0EA 1Q20A 4NOMA 1PKEA 3FNRA 4IH9A 5AJZA 4R05A 1NDQA 3KPJA 5CT6A 5PNTA 3UAZA 1O58A 5A9SB 4JLMA 1ZW1A 4LJKA 1RZVA 3B38A 4Q6BA 3TW8A 2V7QA 3TXAA 3IPCA 4KXUA 1X7WB 2FN8A 4EJMA 4C0QC 3EK2A 2WJAA 2O57A 3A6EA 4B3XA 5JS2A 1UZLA 4PPFA 1AHHA 3ZCVA 4Z3DA 2R6FA 1SU7A 2YOFA 5HIAA 1ADCA 3DE0X 4AN0A 1KORA 3LIIA 3W8NA 3ZHVA 2YZ2A 4Q4AB 3CSUA 2W6JA 3PHIA 2OBYA 1YZYA 5L7WA 4DUYB 1NM5A 1PJBA 1TL7C 2QL5A 3DMGA 4XI9A 3UQZA 3DHEA 4A9AA 1GG2A 2WIDA 4Q93A 1FCJA 5E8JA 1O0CA 1LH0A 4C88A 2OO5A 5L6LB 2C20A 3EIOA 1YIOA 2HCFA 4QVKA 1IY9A 5AFSA 1E8MA 4MRMA 3WRXA 5KINB 4I14A 1KFCB 1VKZA 4MYRA 4R0MA 1YZKA 4EJ2A 3DKPA 3K0HA 2KW5A 4JL8A 4R69A 5TQ0A 3EDQA 4QPDA 2P8JA 3WBFA 4EMTA 1MTOA 2DKNA 6AT1A 1XPJA 4D56A 1A4UA 4DANA 2LCIA 4DCMA 1W9MA 4ZAYA 4AQYB 1E89A 1OW3B 2JFOA 1K68A 5C4MA 1KAEA 3NR2A 5ETJA 3WL8A 4JB2A 1D4AA 1QIJA 1ZHFA 4R1PA 5LJLA 4NEGA 3W5HA 1TW2A 1ZN9A 2PKYX 3GFPA 1JR3E 3KDPA 4H27A 1I9CA 4IUCS 5AJUA 4E5VA 1FRVA 4J1QA 4EPRA 3BB4A 5D5PA 4CIVA 1Y3IA 2VLIA 2ZIUB 5D3KA 1NN5A 1HQYE 3HRIA 2BI8A 2XNCA 4G2NA 1Q11A 4FK8A 5JY6A 3NNSA 2JFHA 5ITZA 1WB4A 2RBKA 2AQKA 5CLFA 4J8PA 3GU3A 4B85A 2WSIA 3AINA 3HXMA 4KXFB 1WEKA 4QOEA 3DOOA 1GFIA 1UJ5A 1MORA 4Y2QA 3AF4A 5AQEA 5ILGA 3A2KA 2H29A 4UU0A 3AOEC 2BR5A 2I91A 4BDTA 2I4NA 2WTUA 4TOIA 4B84A 5JNLA 4CDRA 1VSBA 3HDGA 3F67A 1VI5A 1O4VA 3DE4X 1E3TA 1VTKA 5HJ7A 1FZTA 4RD3A 3EUEA 4HXYA 3Q0TA 3DL0A 3GIWA 1WCYA 2XZDA 3E8XA 3DZKA 3LT1A 3DKRA 1HT1E 1VPTA 5JLAA 1DCTA 3ESRA 3NT5A 3V8QA 3KRTA 4LJ5A 4LV6A 5T6MA 1ZO8A 3ZG6A 4BVEA 5L3QA 1Y3HA 2HLPA 3LZCA 2ZYVX 3DOFA 1P7ZA 2VJNA 2ZJ5A 5AUPB 2PRSA 2COUA 5I5GA 2WTBA 1SC6A 1J0XO 1DTWA 2ON6A 1SVOA 1YL7A 1M8JA 1G8FA 2IRWA 2XRZA 1B3BA 4QHTA 3GO4A 3AM4A 2WTMA 1WD5A 2O8DA 1UOOA 2ATEA 1R4ZA 2GI4A 1VOTA 1JJAA 4AS3A 3AB8A 3IQZA 3A6ZA 2A9KA 4AYTA 3PXGA 4E03A 4H7HA 2XT9A 3WYFA 3HCAA 1A76A 1Z07A 3DBHB 4KMSA 2H07A 3DGEC 4URWR 1OSNA 2EFDB 3Q88A 4ZZ0A 1BFKA 3BHJA 4HAIA 3RTEA 3TS1A 1ESMA 3FKJA 3UAXA 5IAAA 1A5BB 3BQ9A 2CXQA 4U2GA 3W2EA 1NM5C 3QOWA 3CZ4A 4LJ8A 4MB6A 2MIIA 3QUSA 4C08A 5IJZA 3QSYA 1V11B 1U04A 2XWQA 3N0TA 5LNK6 2WE7A 3KG2A 3E2MA 4TLDA 5B58T 3D3QA 3RHFA 3S28A 4HGQA 5LU8A 5CTAA 3BGSA 4NPCA 5AVOA 3UJBA 4DNPA 2FSFA 5CK5A 2MDTA 4LCEA 3EUAA 3SZGA 3WRXC 3E58A 3KOWA 3GEHA 2V7XA 1AF4A 3ZZ1A 1Q0PA 3IAHA 1E0AA 3VZPA 3QYPA 4LOHA 2UXDB 1JR3A 2J59A 2VL7A 2JFPA 4KACA 3VU1A 1CSEE 2Q5IA 5EZ6B 3G2JA 4GNRA 3V2IA 1VCIA 1IWPB 2C77A 4LMAA 4GS5A 4PS1A 2PWZA 3CGWA 4XARA 3B13B 3FPCA 3HBNA 4MKZA 5DYYA 4HNVA 5KTOA 3RHTA 4IILA 3CFYA 4D41A 4L8FA 5CGZA 1AHPA 3QBEA 1C8LA 5KYWA 1GSIA 2BCEA 3C5CA 3CE9A 3T5AA 4G1CA 4FMDF 3UT5B 3E8SA 4I5EA 1JHRA 4CF6A 2UXBB 3IAAA 3C1TA 2D2VA 2P2ZA 2X0EA 1P2BA 2C4UA 5ALRA 3PDUA 3M6UA 3LT5A 1WCV1 3KJHA 1HZZA 4NAVA 4EEZA 1AB6A 4ZCSA 2BJVA 1NNEA 3RV3A 5FADA 2HY7A 2OAEA 4MVJP 4AZ0B 1IPEA 1ZICA 6REQA 4YJGA 3L7NA 5SY6A 2HU5A 4FGWA 3SC2B 2X5KO 1XXHA 3BXFA 5DLPA 2EIXA 2X7HA 4QQRA 3ZJTA 4Q4LA 4A26A 3O1IC 5BW4A 5GADl 2I4IA 1T1RA 4YFVA 1MEOA 4I9FA 3WMFA 1Q1GA 2P4UA 2LCFA 1FY2A 5B7PA 2AEMA 4Q66C 4N3AA 1XKLA 3PS9A 4XUEA 4ZCLA 3TCXB 9LDBA 5JJCA 1A5TA 3LM8A 3W2IA 5C35A 3AYXB 1XG5A 1DFGA 3R74A 3QVLA 2FV8A 5FH9A 4QXAA 4C20A 1VM6A 3O4JA 4KFSA 4BFWA 3DCYA 3ZWYA 3B9QA 3PCRB 4EITA 1K88A 2PUAA 3D6TB 3TLZA 4IDAA 3CNHA 2MSLA 3GNTA 4KQCA 2QMZA 4Q4HA 5IRCD 4FKBA 4TTJA 1KBQA 2ZS9A 3RF6A 3D81A 4QGGA 1P9NA 4UHCA 3ZU4A 1J56A 1XQ6A 4R0VA 5CXSA 5H8WA 1FXWA 1L7MA 2A9QA 3DXYA 4RTRA 3GJRA 2CE7A 5B64A 1YQDA 3K6KA 1A5AB 1V39A 5D85A 1AZLA 1L4EA 2IXDA 2P8SA 2HBYA 1E1RD 4OREX 3T38A 1EWQA 4RDCA 1YS1X 3M6IA 2VRBA 1KSHA 3WIOA 5AI9A 3OIUA 1I6WA 4KXMA 1EEXB 2OXRA 2YN4A 1X1EA 3DV0A 1PW7A 4BMCA 5B6IA 3UHPA 2FN3A 3T7RA 4AWAA 4I19A 5BSFA 4YP1A 4KJXA 1URPA 5DP1A 1XIVA 2XMCA 4DA9A 4EHJA 5LMCA 2VDVE 4DKJA 5FFFA 3SQXA 2N1MA 3FAKA 3LT0A 2CXXA 2HGSA 3JR7A 1ABEA 1QYRA 3Q2OA 4EFNA 4B44A 2CVZA 2QW1A 3HKCA 3L1HA 1O95C 3GARA 5EWMB 2AOVA 1KR5A 4CMIA 4DOMA 3W1WA 3EIUA 3LLVA 4KBFA 3ICPA 1DKLA 3Q6MA 3T34A 3M3PA 1C7JA 1DZIA 2GRUA 2ZJZA 3EZYA 3L4EA 1CZNA 1U90A 1W2HA 5F35A 1LBQA 5C1OA 2AD5A 3PWSA 1T9AA 5ERYA 1QPGA 4P3PA 4BYMA 5B55A 1WZNA 4DDKA 3A26A 3FE2A 4C14A 3KP1A 2VT6A 3OG9A 5F1PA 1HL3A 1QKJA 1OC4A 4P6VF 1M66A 2OC9A 5LP6C 4HMQA 3RYCB 3NWJA 2B8TA 3N0VA 1W4CA 2ZJFA 4I55B 1E2MA 4ND8A 5IBQA 3EEYA 1QHIA 3WLJA 3PI6A 3KKKA 1KZ4A 4HAOA 4M3NA 5J4HA 1CLEA 2DF8A 4RHTA 2DULA 2SCUB 3RVKA 2BFCB 3RAFC 1ZMOA 3H2KA 2W98A 5DT9A 4E2XA 2FQYA 3NTVA 4CMJA 1V1MA 2KLBA 1XRMA 4OXRA 2LKDA 3GLUA 4RHXA 3UJDA 4E21A 4EKNB 1E2DA 3IVMA 1G7TA 4DDHA 1N9GB 1V8PA 3V2UA 3L6RA 3ZXIA 4ESOA 1JMVA 2REXB 2YWBA 4ZAGA 4FJ2A 3WZMA 1MJ5A 3P2JA 1ETUA 5DN9A 3C7AA 2D2XA 1U8FO 3EXG1 1X8LA 2B8WA 2XA9A 1FQOA 4KQ2A 4Q4JA 4J43A 4CW7A 5FPPA 3ZCSA 1RC0A 1AMNA 1USWA 5GV8A 1XLTA 5IF9A 1V7PC 3VJMA 2J85A 5LP1A 3CNLA 2AD1A 4J75A 2H5EA 4NBVA 4JI8B 1R0CA 1Z4JA 5IPFA 3M5CA 3QV2A 1EX9A 2ENUA 4GYJA 5FX2A 1C9JA 1P1IA 1MJNA 1TI7A 2GEUA 1I2AA 2OXCA 2ZCVA 2WF7A 4YASA 1IZZA 1YQQA 3A3YA 3EZ6A 4LYGA 4YV1A 1K8ZB 3EYAA 1CNEA 1NVTA 1OPXA 1Z5OA 2QVCA 4FHDA 2BD0A 1XZ8A 3IHTA 4MKRA 3O92A 1WWKA 2D0PB 4C7OB 1YDGA 3VHXA 1FBNA 1W4RA 1KTVA 2Q21A 2JGKA 2M9MA 2WAAA 1XI2A 4WINA 2OCYC 3E18A 5JJIA 1SG9A 3RGGA 4FYIA 4LHYA 5KCZA 3GQBA 2NTJA 5LZ9A 4DUGA 3V4RA 1W73A 5M7EA 3DMTA 3QVVA 2ZUWA 3AHJA 5IN5A 2V6FA 5IH7A 2B5OA 2XDAA 2VSXA