3E81A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e81A00
4BX3A 3IJ5A 4BYGA 4UMFA 4CF5A 2ZBFA 2HEGA 2BDEA 3L0YA 4J2TA 4UU1A 1YDFA 4BNDB 5IT4A 2G08A 5ALRA 3L0BA 3ZU6A 2OBBA 3CNHA 4Y2JA 2DQSA 2Q5EA 2X4DA 2FPUA 1CR6A 4C4RA 2W4MA 3QXGA 1U2SA 5AI4A 1Z4IA 4UAVA 4YGYA 4DWOA 4E88A 2G09A 2W11A 4FYPA 5ALOA 3KOOA 4HGQA 3UMBA 1QQ7A 5AM0A 1FEZA 3PDWA 4RESA 2CFSA 4EENA 1AQ6A 2AH5A 2ZXEA 3ZVLA 5AHXA 2OYCA 2FUCA 3AR5A 3CZ4A 5ALMA 3W5BA 2B1RA 1ZS9A 3OCWA 3DNPA 4UM7A 2CFTA 1K1EA 3WK4A 3EF1A 3ED5A 2G07A 3HYCA 4FFDA 4MWOA 3ZTYA 1RMYA 3M9LA 1F5SA 1Z4PX 1WPGA 3ESRA 1J97A 2C88A 3QYPA 3SD7A 4HGOA 4KNVA 4CE6A 1WVIA 4IG4A 3SF0A 3N28A 2HDOA 3W5CA 3UMGA 4BBJA 5ALYA 3ZTWA 2OA0A 3WK7A 2YMQA 3MPOA 1Z88A 4XOUA 2GFHA 1ZD4A 1U2TA 3U19A 1RMTA 2FPRA 3ZW7A 3VAYA 4MUMA 2G06A 3WKEA 3WGUA 4KYTA 1Z5GA 3DV9A 3FPSA 1N9KA 5AVUA 4BEWA 4F71A 2I33A 1RLTA 4Y2SA 4UU0A 5AM2A 1TJ4A 4EEKA 4OFZA 1L6RA 1IWOA 2YJ5A 2I34A 3W5AA 3U7HB 4Y3UA 2JGAA 4YCLA 4XE5A 3WK9A 1NNLA 4NABA 1YJ5A 4PNHA 4AS3A 5IS2A 2GHTA 5AW7A 3BWVA 1T5SA 5AI9A 3PGVA 3AR8A 5ALZA 3WGVA 3U7EB 5AW2A 3QU4A 2WF5A 3EF0A 1WR8A 3L8GA 3OCZA 3DAOA 2IOFK 5ALPA 1X42A 1QYIA 2B8JA 2OM6A 2Q4TA 4YCNA 5A3RA 4EELA 4UMDA 1ZJJA 5AW0A 2I6XA 2YJ3A 1XPJA 2NYVA 1J8DA 2AGVA 2EAUA 3SKYA 2R8EA 2YFYA 2I7DA 2HF7A 2YJ4A 3SLRA 3GYGA 3ONNA 3NRJA 4FE3A 4HGNA 4BKMA 3QUCA 5E0OA 3E8MA 3FZQA 4Y2QA 5FP0A 2VKQA 1VJ5A 1CQZA 3MMZA 5AK4A 4G63A 1L8OA 2R8ZA 2B30A 3OPXA 3WKAA 3L1VA 2B82A 1TA0A 1Y8AA 2AUTA 4QQFA 2ODAA 2YJ6A 2P11A 1QQ5A 2FI1A 2RAVA 5AM5A 2FPXA 1Z5UA 2P27A 3K1ZA 2WF6A 1ZD5A 3NANA 3QUBA 1QQ6A 4NV0A 2MSNA 3L8HA 3B8EA 2P9JA 2WFAA 2IOHA 5AKIA 5AVWA 2WF9A 4Y2UA 2G0AA 2QLTA 3E84A 3N8GA 1RKVA 2Q4RA 4EX6A 1T5TA 1VJRA 2YN4A 2MU1A 4L6CA 2NO4A 3A3YA 1LVHA 2WHEA 4IFTA 5AI5A 3E81A 2I55A 1PW5A 2AMYA 3QUTA 5AW8A 1S8OA 5AM4A 3I28A 3QU2A 3PCTA 2C8LA 4YIKA 5IT0A 3U13A 3QX7A 4KX5A 2ZBDA 3I1YA 3IRUA 3L8EA 1RC8A 3W5DA 5ALWA 1L7OA 3J7TA 2YMMA 2PQ0A 4I9FA 2WF8A 2C9MA 3N5KA 3P96A 1YNSA 3OCUA 3AR3A 3HLTA 4YIHA 5AKXA 2GHQA 2IOFA 3ZI4A 3B9RA 1RLOA 2FPSA 2C8KA 1TJ3A 4Y2VA 5AK6A 3B9BA 3L0CA 4DCCA 2ZOSA 1RPZA 5AVXA 3AR9A 4BEVA 3ET4A 4ZEVA 3ET5A 3SMVA 4B6JA 3L1UA 5AW5A 3QU5A 2WF7A 3OCYA 3QUQA 4EZEA 4NFLA 3AR6A 2O2XA 3N07A 4BX2A 2D2VA 2BY4A 3NALA 3NAMA 3AR4A 5AIAA 4UMEA 1RKUA 5ALHA 3WKBA 5AW4A 4QJBA 3E58A 4CF3A 3KBBA 3D6JA 4OD0A 5AKJA 3A1DA 2CN1A 3ZWDA 3BA6A 2P69A 3M1YA 5ALNA 4L57A 4UAUA 5ALTA 3R09A 1RKQA 1RDFA 1S2OA 2RBKA 3KDPA 4UARA 4KN8A 5ALKA 1ZOLA 1MH9A 4OCZA 3L7YA 5AM3A 4HAIA 1RMQA 2QYHA 2NO5A 2HOQA 3AR2A 1L7NA 2EATA 2HO4A 3F9RA 2JAOA 3TLMA 4EX7A 3RF6A 3FGOA 1RRCA 5AVSA 3A1EA 4UM5A 3ZVNA 5AKYA 1YMQA 2JAUA 3ESQA 1U7PA 4Y2XA 4HGRA 3MN1A 4Y2YA 3KZXA 4ZEXA 3I6BA 5ALUA 3QU9A 3EPRA 1Z4QA 2JARA 4KX3A 2YMPA 2HHLA 3WK5A 2EARA 1ZRNA 5ALJA 2RARA 5AK3A 4H1WA 2G80A 2R8YA 2HF2A 1SU4A 4BNDA 4AP9A 5ALQA 1NRWA 2HX1A 3WKCA 5AW1A 2IA5A 3MC1A 1Q92A 3AR7A 3DDHA 3RFUA 4OHFA 3NIWA 3N1UA 4UASA 5AI0A 3NUQA 3ZX5A 3QLEA 5ALDA 3WKDA 5AI8A 2RB5A 1LTQA 2YY6A 5AK5A 3QGMA 5A3SA 4GXTA 5ALSA 1Z4MA 4JB3A 3EWIA 2R8XA 2B1QA 4UW9A 5ALFA 2JAWA 1Z4LA 4CNQA 5AW3A 3U7FB 1U7OA 1RLMA 4NAVA 3UMCA 4F72A 3FPBA 3FM9A 1RQLA 2W43A 1TJ5A 1L8LA 2YMLA 4L6AA 2ZBGA 2PR7A 4YCMA 5ALLA 4Y2PA 3KC2A 4YH1A 1O03A 4DW8A 1ZD2P 5T41A 3ZX4A 5AESA 1EK1A 1XP5A 4NWIA 3L5KA 2YBDA 3OCVA 4XPZA 3L8FA 2FUEA 1SWVA 3FVVA 3R4CA 5AKKA 1ZD3A 4CF4A 3SKXA 2GO7A 2I54A 3ZVMA 3ZWKA 1WZCA 5A3QA 4J03A 2GMWA 4GIBA 1ZRMA 3R9KA 2WM8A 4HYTA 3QU7A 4O8CA 3ZUPA 5AM1A 4ZEWA 4BX0A 1O08A 3UM9A 1RQNA 1NF2A 4I9GA 4G9BA 2FPWA 5AKHA 5AKGA 2O9JA 3NASA 3WK8A 1T9ZA 4DFDA 1EK2A 1L7PA 3I76A 3SHQA 5AVTA 1Z4NA 5AKEA 2BDUA 2B8EA 1N8NA 4KNWA 2B0CA 5JJBA 5AVYA 3IB6A 3S6JA 2FEAA 1XVIA 1Z4KA 1Q91A 5AW9A 4AS2A 2CFRA 3QNMA 1YV9A 1TE2A 2C4NA 2PKEA 5AVVA 2HCFA 4C4TA 5ALEA 5AICA 2IYEA 5AW6A 3WK6A 1JUDA 5AKZA 5ALGA 5ALXA 5AVQA 5AKLA 4RETA 2HI0A 4XQ0A 1Z4JA 4UATA 2HSZA 3PGLA 4Y2RA 5AVRA 1KYTA 4UMVA 2ZBEA 5ALVA 1VFPA 1L7MA 1YS9A 4HGPA 3U7GA 1QH9A 1SWWA 5ALIA 4C4SA 3KD3A 5AI6A 1Z4OA 3U26A 3A1CA 4Y2TA 2G1AA 3OTQA 5AVZA 2ZG6A 1U02A 3OCXA 4JDPA 2FDRA 5AIBA
chains in the Genus database with same CATH superfamily
3W90A 3PHJA 1UP7A 4LHEA 5JXGA 1CUIA 3N7UA 3NWJA 3DP9A 4ZJZA 2EBHX 2WTAA 2GLTA 3K9QO 3I9V1 5J3JA 3STXA 3ZGLA 4CGZA 2Y1KA 2FLKA 1YE8A 4JP1A 4XWYA 1VA5A 2IKQA 4UCXA 1AHPA 3U4QA 1LA2A 5IC5A 2Q5EA 2R7LA 4PANA 3KQUA 1IBSA 2BHSA 4JQYA 5FYQA 1F7UA 1X74A 3AI7A 4YFVA 4YJGA 3VC1A 4BFUA 2GJAA 5KQMA 2ZPAA 1PFKA 3NTRA 4O2AF 5CDSA 4E46A 2WJVA 1ZJ5A 5L53A 5AXDA 5F76A 4RZQA 1LJLA 4JVSB 2WZQA 4RVDA 2MSCB 5A5GA 3TGPA 2D1RA 3BTSA 5TMBA 5AUNB 2Q1SA 3JQQA 5AM0A 4EENA 1R0KA 1JJFA 5IFLA 1WW3A 4BECA 2IU4A 1OHHA 1MR3F 2ONYA 2NZ8A 3RVLA 2EKPA 1TKBA 1L7RA 2PLFA 2VHVA 4OQFA 2O8BA 2ORWA 3A3NA 3CZ4A 3HB9A 3L4BA 3X0DA 1C30B 2XIQA 1W5FA 4FC6A 1SD5A 4ND8A 1SBYA 4X20A 4MNTA 3WK4A 1VCNA 2DPMA 3Q3CA 3OQMA 2QJOA 2Q5IA 3NUGA 4MWOA 3TLKA 5JCXA 2FUG6 2QVYX 3SU8A 5D3MA 4YRIA 4AXBA 2UYQA 2H17A 1Z4PX 2ZQYA 4JI2B 4LDZA 4M0UA 5B57C 4HGOA 4PLTA 4BRUA 4L22A 3KSZO 3FPCA 4X7RA 4B1FA 3N28A 3OHPA 1RKBA 1AG9A 3IUEA 3MT0A 3ZBTA 1YZ3A 2WJ6A 5HF5A 2B21A 2GF0A 3WX0A 1POWA 3BM5A 5DTIA 3BDVA 4U6QA 1UKVY 2MIIA 3BUSA 3ZCUA 5MN4A 4BMXA 1KBZA 3FTCA 2NTEA 1EVLA 2E18A 3CB4A 4F38A 3GY0A 4EGCB 3GNQA 4UQLA 2AEEA 3FBTA 1IMJA 1U0FA 3A58B 4MP3A 3UWSA 3IPRA 1W4ZA 1GL6A 2IUSA 1NMXA 2YC2C 4HDKA 4OUDB 2AEMA 1PJ3A 4X1YB 3WGUA 2I7XA 3LBHA 1D6SA 1D1TA 4FS3A 5AVKA 3IEVA 1SXIA 2VZ9A 1FTNA 4EUNA 1Z5GA 3CUSA 4JLBA 4RA9B 3N2NA 4WBNB 1HFKA 4GLLA 1FMFA 3IHWA 4C43A 4EA7A 5WRFA 4BL5A 4K26A 3RQIA 2CXRA 4FIDA 4AZTA 5KNBD 4H6VA 2ZBQA 4KXNA 2Z4TA 3I72A 4H18A 4XAQA 3FLMA 4ZC1A 4ZYXA 3WGIA 3WISA 4QIHA 4KQ6A 4PS0A 4RH0A 1QKIA 3Q10A 1I2DA 1LNSA 4NHOA 4R2JA 1KE1A 1SUBA 4WL0A 4DT1B 4EHFA 2FW0A 1TZCA 2VHUA 4INAA 3EG5A 4GXQA 1DBRA 1FFWA 2R6R1 4UXHA 1DAKA 2OM2A 2DFVA 3HACA 4IGAA 4C9BA 5IEJA 2L42A 4RTQA 3ZXYA 3LBAA 3MBKA 3K6SB 2RGDA 4DLYA 3PDCA 2PA0A 1HDGO 1IEXA 3IQEA 1Z56C 3O2JA 4D9CA 1NJGA 4GNRA 4REQB 1JDBC 1WKVA 1E5QA 3H2BA 2DPGA 3TEFA 5GIOE 5EPUA 4ZCIA 3AJRA 5DE3A 4WOJA 5ALZA 4TTQA 2WKRA 1U65A 3WP0A 4DCJA 4ZGGA 3I9MA 1K9VF 2YUIA 2DHCA 1XAIA 3A1VA 2JEYA 3KLBA 3EGOA 5AHKA 3NYIA 1FL9A 4WJZA 1O6FA 2WZBA 4NU8X 1VL0A 1SVMA 1HY3A 4N18A 1Q0RA 1DC6A 3WRWA 2LWIA 4XFJA 3E70C 5CFPA 5U4QA 2C7QA 3NHLA 4CFYA 1W44A 4WFQA 2QM7A 3P71T 5EPOA 2P4HX 1SCQA 4JT4A 4AVYA 2M6LA 3WL3A 4RHTA 4AKTA 4AKHA 3MWFA 3I3SR 1H6AA 2R8PA 1Q15A 3AEQB 3RADC 1J7KA 4AZ3B 3HNRA 3S1LA 2IV2X 4KN6A 2AFRA 4IQ8A 3C7DB 3UJNA 5A7GA 5TJHA 2Y92A 3RI3A 3QNWA 1IZ0A 1P7YA 2PRZA 5I7OA 3GGCA 4OIMA 1BROA 1GFZA 3AUAA 4J0HA 1D1PA 4YDQA 2ZDQA 1N6LA 1XMJA 3AX6A 3NAGA 1GFWA 1DB3A 2DFDA 4KXYA 4DHWA 5LR6A 4DMHA 1G8HA 1W5TA 2BUCA 3I58A 4I81A 3CLUC 1JLLB 1FX0B 1JLKA 3ILXA 4ZHQA 4K8RB 2Q21A 4XDHA 3DVQX 4ZXPA 4KREA 3OCCA 1P0QA 1K0FA 2QSYA 4FQ7A 5BWCA 1KA9H 1CDZA 1QLHA 2JEOA 3OE7D 4P4GA 1V7PC 1QQ6A 4BNVA 1V7ZA 3L8HA 3B8EA 2WJPA 2AB0A 2XBUA 3E61A 4ZDJA 2CLOB 2C4TA 1QIMA 2W6ID 5FWAA 1IPEA 3MTGA 4XSGA 3NVMB 2ZANA 3VH4A 1PWHA 4DIMA 1WETA 1ZWLA 3EUFA 4H7IA 1QV7A 3H7AA 2MSWA 3PI7A 1YJ8A 3R5SA 1Q2XA 1N36B 4IIJF 2Y9MB 1J2JA 3HCOA 5JI2E 1LVHA 1ONOA 2OO3A 2VEOA 4IWXA 4M83A 2VWHA 2FA9A 4YROA 1WULS 2DGDA 2QRQA 3I45A 4N8SA 2X7XA 5EZYB 3SK0A 4ETNA 4R01A 5LOVB 1DXQA 1TVKA 4DV5B 4GC5A 3O5AA 1I4LD 2C4MA 3B1XA 3E3MA 4R9SA 1O5TA 4DDHA 2IYRA 2HDNB 3K0KA 1WOMA 2GUWA 1FDRA 2HBRA 1XO1A 4CM4A 2P90A 3GFFA 4DCMA 3TW0A 3L8EA 3CLRC 2VK1A 3D6MA 4QPPA 3KLNA 5CNIA 2UZ1B 4CKXA 4MR9B 2V3CC 2EWMA 2YMMA 3BRWD 1PX2A 3IMEA 4GZ5A 4H3HB 4KUHA 1OXKB 1FQWA 4W82A 3JYNA 4O1IA 3ZHOA 4L2IB 3QPAA 2OGTA 4MI6A 4M2LA 2A35A 3COPA 4U7PB 5BQ3A 4IX9A 3B9RA 1RLOA 3DE7X 2W2VA 3TLJA 1FY2A 1OSNA 1SJ9A 3CE9A 1HQDA 1Q1AA 1ZNXA 3Q1LA 1IOVA 1TJ3A 2D0PB 2I4OA 4YVFA 1RP1A 1GYPA 2ZOSA 2C8JA 5LFAA 1THGA 2LE0A 3KR9A 4DCOA 5IULC 4L72A 5KNCH 4JXKA 3RC9A 3T7TA 2XNCA 4ASUD 1HTTA 4ZEVA 3T12A 4D4JA 4WECA 2ERCA 3WNCA 4DJFC 4MYRA 1QFJA 3CSUA 5DHFA 2VP6A 2H29A 5C7IO 1TI7A 2Q41A 5H4GA 1KFCB 3JATB 3OQIB 2GUGA 2XA1A 2GCPA 3ZEAA 4A92A 4GKAA 5HZHA 4Z3OA 2AD1A 4NYIR 4QU5A 2RI6A 2ID9A 2R5FA 4EZEA 1DG3A 5FBVB 5K3OA 5I6DA 2IYOA 2B6NA 2G76A 3AEKB 3WL4A 3JQ9C 3NALA 1O8BA 2IE8A 1E1RA 4O0MA 1O87A 4NOMA 4TKMA 1YS2X 2DSNA 1HT3A 4UMEA 3WKBA 5IH3A 1PT5A 4TLDA 3ULKA 1W4CA 1VGRA 2PG3A 2IDZA 2GVNA 3UAXA 4PYIA 4Q9DA 1MABA 3HEMA 1CP2A 1YI1A 2J5XA 2YS7A 2NQ8A 3M5DA 4PLWA 4EYEA 3WGHA 1OB5A 5A4AA 4GDFA 2IJGX 4DA8A 1U98A 2GB4A 3VDMA 3K1AA 4ILKA 4I14A 3GRCA 4B6PA 2C77A 1MZPA 2XZTA 1GUBA 1WTCA 2I9KA 1U99A 2Q3FA 3SEZA 5JZOA 1ES9A 4XM1A 5KCZA 2ZJFA 4FWBA 4JBYA 5MGBA 3AEUB 4MDYA 5H81A 5G02A 4B35A 3RBXA 3HDYA 5CX1B 3TZEA 3M7IA 1PL0A 2E2WA 1PEAA 4WOCA 1N2HA 3PUHA 4C4AA 3SJ7A 1BMFD 2P9CA 4INZA 5HKKD 1K7XB 2KSQA 3LOUA 1QV9A 5JG7A 2NU8A 3TX2A 1RCUA 4EFMA 2G9RA 3UBMA 3KSAC 1L5ZA 3K5HA 5E4JA 4BKPA 4P8RA 3GB9A 3NHJA 4EARA 3L5OA 1ICIA 4QRIA 5ITZA 3ZH9B 1OC2A 1N5IA 4ZPJA 4C1NA 3KKOA 2Q3MA 2FR8C 4RPLA 1PR5A 1DIRA 3ZJ5A 4QECA 2ZT5A 4WLUA 2JBHA 1QLWA 1GKLA 2C42A 4BVLA 4QGSA 2H63A 2OZLA 4A36A 3CG4A 4TTTS 3QTTA 3QU9A 1VYTA 4UEJA 1KZHA 2XMSA 1PWXA 2I76A 2XY4A 2IEAA 2G83A 1UXGA 3DFKA 3KKNA 4LFAB 3RFFA 5CURA 5ECGC 4YY3B 5B1YA 4O4LA 4DR4B 2C59A 4Z3KA 1CW2B 3DDOA 3HTXA 5EE5B 1BKDR 3C43A 1NYRA 4E2YA 4EY7A 1WCXA 1YU9A 2FV8A 1ND6A 2VYND 3CPSA 3KB6A 4IEIA 4JLPA 4LOIA 5BV1A 3HB4X 4LXGA 4BO1A 3CPHA 4U7GA 5JY1A 3P4XA 4HZUB 5K05A 1D7AA 3RJZA 1EX7A 3AR7A 2MINA 1A2OA 1X1AA 2ZLBA 4J2OA 3HA5A 2ECQA 2BZSA 2H51A 3L0DA 4GRAA 4IDPA 2JIPA 3WFIA 3DYIA 4RM2A 3KR2A 5AI8A 3AF3A 1SOUA 4OFBA 2FRVA 3CHYA 5EIEA 1M2OB 4X1KB 4EKDA 4ENUA 1KYZA 1U9IC 2PGOA 3JV7A 4J1SA 4D7AA 5HTOA 3STHA 4JD5A 2AWOA 2CYAA 3IAAA 4IQ0A 3WV5A 4ZKDA 2GEBA 1MF7A 1C9NA 3LW7A 4PYKA 1HV8A 3TB4A 2IYZA 4AY2A 3GJQA 5B58C 2SKCA 1JEQA 3MTIA 4B9AA 2A57A 4KO4S 5KNDH 4NMXB 2H06A 5DIFA 4DQDA 1H94A 1LVGA 4YAFA 1BG6A 3AL0C 2VLBA 2RJ3A 1Q6ZA 3CRQA 2NUAB 4HRAA 2AHRA 2Q6TA 2AW3A 1SGWA 3M81A 3RRBA 3VZRA 5BUZA 5JNUA 3DZBA 3IURA 3HADA 3MJCA 3C5VA 1JDPA 2QG4A 5KNBA 2CUZA 3HBLA 2VT6A 4NYMQ 1NM5C 3AY0A 3QEOA 1DIHA 2UVPB 4RQAA 3ELBA 3L8ZA 2OBNA 3G2QA 2YHIA 3DL4A 4Q3EA 5K5EA 1JYSA 1FLAA 3B1YA 1Z0IA 1IZZA 2GD6A 3L5KA 3M6LA 1TXGA 4PHFA 4CI0B 2QN3A 2ZI7A 7YASA 3UTDA 4Z86A 3BD8A 3OZVA 1I51A 1Q5PA 3EDRA 4ZAWA 3ZU5A 4CM1A 2ZZMA 4F3TA 2WMNB 1BMQA 3D5QA 3KFLA 3QKUA 1PS9A 2PRJA 3GFPA 4QBGB 2OK7A 3GN2A 1HYGA 1JFTA 2QPAA 3K8OE 2D1SA 1M1UA 1RLIA 4GIBA 4A16A 1EUZA 3BMNA 3VPCA 5BP7A 2BCJQ 3LT4A 1UBUS 3QQ5A 4ZCQA 1UOPA 4KSYA 3IESA 5AM1A 1CS4C 1BDMA 1P73A 3N7AA 3VHLB 3DM9B 3F97A 3G1UA 1DADA 3TVTA 3L7KA 4PYLA 5HQ3A 2FWMX 4ZI7B 3A6FA 1KIMA 2UZAA 3K0CA 4QM7A 5EC8A 1GAEO 3BT7A 3CWQA 1N1EA 1PRYA 1GL9B 1QZXA 1QQTA 2ZTSA 2XR1A 2ZTUA 3LUBA 1CJBA 4M9CA 1N4DA 3WMRA 5KQGA 4RJJA 2DX7A 1LY1A 4IZIA 1P1KA 3PYLA 4EJSC 5JAHA 3AP1A 4BPBA 3ZTTA 4HDSB 2YV3A 1MAAA 2JAQA 4TXJA 5JVDB 1Z07A 3NP9A 3PHIA 4HFRA 4JBIA 2DCMA 4A5OA 1Z4NA 1HO3A 1MXHA 2BDUA 3HBMA 3UMSA 1MRSA 3AJ9A 2G4LA 3R7NA 4IL5A 3DOJA 1GQ2A 3AHHA 1V95A 4I2VA 3SIPA 2GM3A 2F3TA 1JFFB 2YRFA 2CFRA 1BDBA 3R44A 1QGOA 3IT3A 4GU5A 4FFOA 5DT2A 3IOBA 2A1TS 3L0OA 1NVMB 2HHCA 4AJ2A 2B3DA 2IOQA 4HXGA 1TZJA 2VJMB 5AW6A 2E4AA 3GLRA 4HB2A 3DOIA 5LZ7A 2OGWA 5ALXA 1PV2A 4DADA 4LRXA 1JWBB 2OFFA 3DUWA 2XUPA 2HSZA 4QOIA 5DNWA 1ADJA 3N8KA 1COWD 3VISA 2XT9A 4F1WA 1G98A 1P75A 1P81A 1QH0A 1W0KD 2V4MA 3E7DA 1EX1A 3IBYA 4B71A 3OE7A 1SOMA 4ZT6A 3K70C 2PS3A 1N5JA 1G42A 3REQA 3BN3A 2SKDA 5G1NA 5CB4F 4L9SA 4KPUB 5K4HA 5CPBA 3P0EA 3UBTA 3C2QA 1KJJA 3L8DA 4KDFA 3DMTA 2CZQA 2W6IA 4LMPA 3HEBA 2VTVA 4NQZA 1UMDB 4WRRA 3EDMA 3W1EA 1G9TA 4Z99A 3NAQA 5FOWA 2EF0A 3IP7A 4RU1A 4CMIB 3V4VB 1KVRA 1ULAA 4CM6A 3LQ1A 3WMXA 3ICQB 5MF6A 2JGJA 2OCIA 1XA0A 5FUVA 3RT1A 3DVLA 1TX4B 4AM8A 2XLCA 4B3FX 3R8FA 1CJVC 4JELA 3VJLA 4A23A 3HO1A 4O4IA 5SY4A 5LP1A 3UUEA 4YP7A 2WG0A 2XODA 2X4DA 1RWPA 2X6QA 5BNFA 3BH0A 1NW6A 4G37A 4E2XA 2XJ9A 1FUYB 4OGGA 1NLMA 2WUFA 3OHMA 4OPMA 1SC6A 4D97A 2EZ8A 4P4LA 4GSLA 2VHXA 1VJ0A 1W4LA 2XDAA 2E89A 1XEWY 1B93A 2ZIXA 3VKFA 1KEUA 1OLUA 2HEIA 1NBWB 2IUEA 5D84A 5ALOA 3OTGA 2Q5OA 1JFLA 1IB6A 3BRWA 3UMBA 3UN1A 2XHEA 4R71A 1TW3A 3T3PB 3IKTA 2C3YA 1BE0A 3KG2A 2YW9A 4MP8A 2JFBA 1HE5A 4WESA 4V0NA 4HQNA 3Q9SA 2GLXA 2QG9A 4OX9B 3PC3A 5ICEA 1DRJA 1A76A 4P7GA 2ANBA 5A4DA 2N42A 3VSDA 2Q5FA 2EW1A 2WSLA 1TDJA 1YQ9A 2DUNA 1H1DA 1G2IA 1WXQA 5J43A 3TUZC 2CFTA 4P9NA 4ASUA 3MWKA 5HRAA 4GQAA 5HNKA 2G07A 1EGAA 3RYCA 2K7ZA 3WL6A 3H0KA 3PPIA 3R6LA 5IARA 1TADA 3HSKA 2L82A 4R8RA 5FF9A 3EE6A 4U1RA 1F5SA 1IJKA 3Q7EA 1RM0A 4Y1EA 4LDPA 3ZV4A 2PWAA 4DG5A 3ETHA 3OX2A 2J3QA 2R68A 1OFHA 4BZZA 2GGSA 2QUZA 5FT9A 3VPDA 2WQ6A 2IYXA 2HH9A 2XB4A 2YZ2A 2ZVDA 3F46A 4RK6A 4UBNA 5H59A 1N6KA 3OFSA 4JOCA 3UHJA 1P2DA 1R66A 1RBQA 4OP2A 4Q7KA 2VTBB 2OQ2A 2ZULA 3BICA 3JZDA 3JWIA 5DEOA 5DP1A 3LC1O 1O2DA 3MPOA 3OZAA 1P7ZA 3DFZA 3ZY5A 5A9SA 5F9HA 1PZHA 3SJUA 4F93B 2G9QA 1TAHA 3NIGB 1RTTA 5DVZA 1JTFA 4PN3A 1T9DA 2CNOA 3OMXA 3ORQA 4C89A 1OTYA 4C7OA 1YQEA 2IXAA 5ITWA 4YR9A 1ZN9A 1WB4A 4LBZA 1PE0A 3S2EA 3C24A 4EGSA 3JALA 1A50B 2OQIA 4IRMA 4IV8A 4KXLA 3T9FA 4B3MB 5F77A 2ZS8A 1T2UA 3DV9A 2OORA 3ZE7A 2O4CA 4JJAA 2V8OA 5EHNA 2O59A 3N2YA 4ZYYA 1N6OA 5AVUA 2QBYB 1TRHA 4DTCA 3JQAB 4CIYA 4NOJA 1ODLA 3UYKA 5CK4A 2XGMA 1MP0A 2GEKA 2ZATA 4J1TA 3ZKAA 2R44A 3GQBA 3O3OB 2UAGA 1BMFA 1JU4A 3BX1A 5GGYA 4CV3A 5JSHA 5IAKA 1WIWA 1VLQA 2J30A 3V1UA 4URXR 4JP2A 5PNTA 2BELA 4X6LA 3Q8MA 3BFPA 2I0FA 1R5BA 4PC7A 2E4ZA 4TTRA 5FKJA 5C7YA 4QM6A 4LV8B 1J39A 2VAXA 3O0DA 3RIMA 3H4IA 1RAEA 2BM1A 3VJRA 4XCVA 1GM5A 5IS2A 2NTVA 1BDIA 1L5RA 1KP3A 3U61B 3I4LA 4JZKA 3FOWA 1RWOA 2ID8A 3AR8A 3WWPA 2H07A 3O26A 4CXMA 1ZUNA 3KKEA 1WZUA 1RHQA 2BMJA 2EG9A 1NR5A 2PX6A 2XMDA 1FXUA 1RXEA 4Q1BA 4R16A 3TW4A 4V1CI 3C3BA 1PHPA 1DLIA 1G8AA 4JHLA 1SQ0A 4Z4HA 1CJTC 1I6MA 4JBXA 2J41A 5TGDA 4K9SA 4HL6A 2YJ3A 1C1DA 4AWBA 1E63A 1SQ6A 2XSZD 3SKYA 1UMBA 2FTKE 4MCJA 1F4PA 2J33A 4RWZA 5LCXA 3U62A 3HCAA 3UJ7A 3A05A 5DHSA 1U3VA 3H83A 3FLEA 2NYAA 3GDHA 3OQHA 1Q17A 4NMLA 5CHYA 1BKSB 5LUBA 4F85A 2MDTA 1Z7YA 4R7ZA 1QE3A 1Y6JA 1SK8A 5IYZF 4AJEA 4G5XA 4BKMA 5EIBD 4AURA 1J00A 3IO5A 1YK1A 1DEOA 5H7XA 5B36A 2HQBA 4EYKA 3G3EA 1M7HA 1A8SA 2X9LA 4HAXA 2DFPA 3T7RA 1LSUA 4OYLA 4YEDA 3H04A 3O21A 3LDHA 4G23A 1EGMB 1XF1A 1UJ6A 3LPNA 4H4DA 1CE8B 4PFSA 3RTCA 1FVHA 2GSDA 4M7RA 1FZTA 4QUBA 4XYGA 4E21A 5BVHB 2NSDA 4BGDA 3FE2A 3T99A 1NQWA 3TG8A 4PVDA 2VRNA 2Z9CA 3RC8A 4C78A 1ODSA 1VBNA 2O2IA 4H6PA 1D03A 3JD0A 3NX4A 4R8LA 1ONSA 1I30A 3H13A 4QGFA 4YO7A 2COKA 3TQFA 1KEEA 1OVGA 5J2TF 4DJEC 5CDYA 1SD1A 3TW6A 3LV8A 4Q16A 1J6UA 4KRGA 3O8DA 4DUGD 2EYUA 5CW2A 4YRKA 2V54A 3E9QA 3OOHA 4ZANA 3I61A 2VK4A 3PGA1 4MA5A 1GPBA 4B2IA 1U2RA 2JI8A 2UUPA 2EQAA 1VXOA 2XTJA 3LL7A 4I4TA 1W85A 3H42B 4E51A 1YO6A 2IOHA 4F4HA 4E6PA 5KSWB 2AJCA 1BW9B 4UHJA 5LWHA 2WHYA 2C95A 3VKVA 4L3WA 3AOEC 3E9DA 2F8LA 1DIOB 2FSVA 2NPFA 1PGJA 4Q3BA 2Z2IA 2CUKA 1K98A 3GUVA 4EX6A 4QGBA 2YINC 5EUCA 5JPIA 1VHTA 2E3JA 1Q0UA 3UUFA 3PFKA 4FYHA 4CQJA 1XEXB 1DDIA 4IUCS 1IHDA 3FVRA 3KSRA 3Q3EA 2SKEA 1J21A 4OU5A 4RIEA 3GFGA 3IAXA 4OAQA 4IH4A 1CRPA 3UGJA 1ESZA 2SBTA 3B1FA 1W87A 1CS0A 1NF3A 5AM4A 3DT9A 9LDBA 4PY2A 1XQXA 3BGSA 3QU2A 2C8LA 4I66A 4ODIA 5HA5A 3I3OA 3JAWB 3WJ7A 4HYYA 4HAYA 3ZDDA 2Y93A 3A9VA 4HQFA 3UW3A 1WOYA 2ZBDA 3GMIA 3D4OA 1EUYA 1YK0A 4P93A 2GXUA 1G2PA 1EP2B 5CG1A 1Z18A 4WKOA 4UD2A 4BBAA 5LXTA 5L6LB 3A2LA 4O1MA 4FMDF 1XHEA 2MYNA 4FR2A 3D4LA 4HMOA 2O20A 2RC5A 5AJHA 3B6EA 1LDYA 2QXTA 4J1NA 4Q7JB 5DCYA 3P96A 4JN6B 8ATCA 4FOPA 1P39A 1SBNE 2OBXA 1ZM3A 2ZKLA 1G2QA 3EIHA 4OXIA 3X1DA 4RA6A 4RAOA 4EG1A 2HQRA 2QZJA 1F8YA 4BLVA 4MJ7A 1N6RA 5B58T 1RFGE 2E1RA 4BWGA 1HL7A 1TAQA 3AKCA 4JXXA 4OLHA 4FEAA 3BMQA 1E1LA 4Q37A 4WCFC 4RZHA 2E4WA 4NCNA 3TSAA 3GUZA 3TSWA 1YL5A 1OA0A 3OIYA 3DZ8A 2Q3JA 5DHPA 4NLLA 3VKWA 5J2UA 1RI5A 1L9KA 2IDMA 3DL7A 2WU4A 4RORA 1R6BX 5JT1A 1GUAA 4B3BA 2JH8A 4QDZA 4BMZA 2O8EB 3PCXA 4J6EA 4B40A 2KWIA 3AUFA 2FEXA 2ZYGA 3RF7A 1NQ5A 4GPZA 1Y1PA 1N2JA 1XNJA 1B8OA 1JHQA 1WD7A 1RHRA 5EHQA 1W0KA 4NICA 3FJ1A 4F7DA 5BWNA 2HGZA 4QGHA 2X8LA 4MPRA 1SNYA 3VHXA 1QVVA 4R83A 5ELXA 1ELOA 5LYJB 2GXSA 1ECGA 4TXLA 2OAQ1 1YVRA 3BA6A 3MFYA 3CRRA 3N0TA 1D2MA 1XLTC 3FDFA 2BV3A 4BFCA 3T1TA 4RK5A 3P0IA 1SCDA 1UR5A 2G17A 1R5NA 4HGYA 5CYGA 2H6EA 4JLOA 1U8EA 3M5WA 1S02A 1QIKA 3UMYA 1P5HA 4MWGA 4NC9A 3CEMA 1TYEB 1WBJB 3BMOB 3P4YA 2DWCA 3U4IA 4W7IA 1YI8A 5NULA 2J32A 3VO1A 4KXFB 1A3CA 2BGIA 4YPFA 5KQSA 1P5RA 1PJLA 3IEKA 1AQLA 3NJ4A 1BRTA 3P5BA 1F2DA 3KJHA 2BFFA 1H69A 4S1WA 2NO5A 4BJ1A 4KLRA 2RGNC 3BTOA 4LHVA 3O7MA 4C6RA 2P5TB 4RJIA 3KQQA 3WGKA 3A6DA 3DPIA 3VX4A 2OKGA 1P62B 1INLA 1E96A 4EB6A 3B7WA 3HB1A 1JB1A 4D43A 2Y4OA 2CHQA 2D7CA 2H7XA 3L06A 2P77A 1O6GA 3LYAA 4K28A 5IBRA 1LPSA 1R6AA 2NV0A 1M2KA 2CB0A 2XXBA 2OHOA 3FGPA 1DRKA 2OECA 1ISMA 2YXEA 4JUAA 4D42A 4HGRA 4MPPA 5E2AA 4JI6B 3W78A 1USKA 1HI9A 3MGCA 5CDHA 1OJLA 1TTTA 4O5AA 3I6BA 4J4BA 4XR9A 1QCZA 2W6OA 5AQEA 4MQ6A 1RLUA 1M6YA 2B7BA 1V8BA 2JASA 2BC9A 2D5IA 4HQ0A 4RKYA 4EG3A 3LS2A 3IHTA 2XDQA 1KSHA 3KKLA 5TEWA 1VLVA 1ZGZA 1M74A 2XNHA 4BC0A 4RZIA 1YGPA 3ER6A 4E5KA 3BXOA 1I3NA 4JLDA 4WOPA 4B73A 1NP3A 4ZEMA 1RE1A 2WJIA 1FS4A 3OLQA 5EE0A 2XUQA 5ENZA 2PWBA 1HZZA 3KZKA 4N8DA 1D1QA 2Q8NA 5TDHA 3UG6A 1M1YB 4FN4A 1FMLA 2FZVA 2F3UA 2AWNA 3AHJA 1RJFA 4CEIA 2PGDA 3SYRA 3VBCA 3KQPA 1PL6A 3U3ZA 4RD3A 2FEPA 3DVAA 4EK9A 3AKZA 1S2NA 2GM5A 5HF8A 2SICE 3RV3A 5T7BA 4M1YA 3WWCA 4YQZA 4AY5A 9MHTA 3BK1A 4MJ3A 2XJ4A 3DV0B 3Q6MA 2ERYA 1B1CA 3IPYA 4MPDA 3N2KB 3CLKA 3P9ZA 2AF4C 1W2WB 1BA3A 3HJHA 4EPVA 3LGSA 4NJOA 3WNZA 4W7SA 5H83A 1JIJA 1WUKS 1E5XA 5I4KA 1XPOA 3RRMA 2P1RA 3OPVA 4RLFA 5IM4F 3AVPA 4IYJA 3VV3A 3FTNA 4CL3A 2XUIA 1I1OA 4OI2A 2VAWA 2RHHA 5DCUA 2GAAA 3AIIA 3QPCA 3RKSA 1WS6A 3QF4A 3CXRA 3K3PA 5KYKA 4LF9B 4WFIA 3ZV5A 2ZAOA 4L6AA 4PE5B 2ZBGA 4XQGA 4LSZA 4RGYA 3AUUA 3B2EA 4MTCA 2JHCA 4PIPA 3C4JA 3PSAA 2RG7A 3CE6A 3BIWA 1U2QA 2OK8A 3G2PA 3N2ZB 4TRRA 4DW8A 2AFIB 3FYUC 2O4UX 1TPZA 2QTGA 3NH6A 1SOWA 2Z04A 1Y6RA 3KWLA 3R5XA 3P20A 3TFWA 4CNBA 1PJRA 2VP5A 1OT5A 1RAIA 3I2YX 4AJIA 4B31A 3RJ9A 4GKVA 1W88B 4LS3A 4TKUB 1AGXA 3VO2A 3NH9A 4EY4A 4C03A 3B36A 4GMHA 2EEPA 4M88A 2FAXA 1O4VA 2P78A 5EYPB 1K7FB 4TMFA 3LI2A 4AIIA 2X0IA 3DVSX 4O33A 5L3ZA 1ZIXA 4L8VA 4II2A 3TZ6A 2AI3A 3LNCA 2WWTA 4QX6A 3FCAA 4ZEWA 5ES4B 4RD2A 4DSOA 3IUYA 2V5AA 3OLXA 2REOA 2C29D 2FPGB 3QVLA 4BQNA 2HRDA 2OWDA 1LPOA 1ZN8A 2ZI6A 3IAHA 3I9LA 2M6SA 3R7LA 4B83A 5C1OA 1HLGA 5I7FA 1QG2A 3QEAZ 2BTQB 3TRHA 2FPWA 1VJGA 4ZT5A 2PKYX 2XSZA 3VR2D 4C01A 4QEZA 1QH8B 5EKXA 3OSUA 1G21B 2RHJA 4Z2YA 3WGGA 2WWGA 5EXDA 2Z2XA 1RBMA 1DAIA 2ONJA 1FLVA 5I48A 1Z15A 3L79A 1OH7A 3G23A 4XWAA 3Q1KA 4FBGA 1GTVA 3KTAB 1TA9A 3N39C 3R7BA 2I6GA 4HGZA 4KQIA 3UMJA 4C6TA 1OE0A 1F2UB 1SRRA 1N8NA 1WM1A 3FOCA 3G02A 1AK2A 3S8EA 3T1YB 1IL0A 5F7XA 4NJEB 1NQTA 1R6TA 2I65A 4YJDA 1TU4A 3UJDA 4YJ3F 3PJEA 3G9QA 2CB9A 3B13B 3IVRA 3WGZA 3BGVA 4XTCS 4L08A 5BMOA 3IKVA 1Q2UA 4HUQA 2C0PA 2VHJA 4ON9A 3RVKA 3QKRA 3OJOA 4RVFA 3T7AA 3KELA 1K66A 3BGOS 5JUWA 3KHSA 2PMDA 4FWIB 1DBIA 5E6UB 1NN0A 2R6CA 3DCYA 4B8WA 5I4CA 4IIBA 4EMTA 3PFWO 2PD3A 3ILSA 1VTKA 2JH9A 4Y2RA 2HI0A 4G26A 4BQFA 3CBGA 1O94A 3PGLA 4DUGA 3LA6A 2C7BA 3GCDA 3MMXA 4DA7A 3O4VA 3UPTA 4WXEA 1QX3A 4EZBA 1Z28A 3VNQA 2WG2A 3KRTA 3NJ8A 4KNYA 1AH2A 5J4YA 4TVSA 1Q1ZA 2X6TA 4PNPA 5COAA 4LCJA 2I6FA 1S3SA 3HSYA 2VJNA 2OT3B 3THRA 3V32A 2OXRA 4KBYA 2P2NA 4H1HA 2ZBVA 2ZYSA 3OTOB 2V7XA 2Y99A 3NATA 4YJ2B 5EN4A 3ORHA 1QHHB 5DM1A 1NVEA 2DU8A 3I9V6 3SR0A 4DBVO 2B7LA 1FFCA 4FEEA 2JW5A 1F12A 4RTJA 1M1XB 4X6UA 1Z35A 3T8YA 3VPBA 3W3AH 3CLSD 2EBWA 2BKAA 2QXYA 4EHBA 2VUTA 2GHRA 4GPIB 3A06A 3TOZA 3ESCA 1RJWA 3DSRA 2I1WA 4AKEA 5JYDA 1XKLA 3AHIA 4W6QA 5H1YA 1ORDA 2BFWA 5BNTA 4ZREA 4LNAA 3QXGA 5IJ0B 1GN8A 2O2SA 4FW8A 3L9WA 2QEQA 3QE0A 2C58A 1CY1A 1DBQA 4WLFA 5JYCA 4P3OA 3ZY6A 4Q9AA 2Q27A 4NATA 3IQFA 4YRGA 3IHLA 5B4VA 1QS0B 4JUBA 1WG8A 1Z5WA 5FL3A 1AF4A 1DJLA 1NVXQ 1KFEB 4BO8A 3ECCA 1SULA 1SHJA 3O8OA 2ZSAA 3FOBA 4LDJA 4UXJA 2JGRA 2NIPA 3NYWA 3C1UA 2F8MA 1MFPA 1UMCA 3UAZA 1GZ4A 2IUUA 4N7RA 4QC2A 2A9VA 1GPMA 3ABSB 2EX4A 1FVXA 4RFLA 3CR7A 5CFZA 4LQCA 2ECPA 3DNPA 4G84A 1FYFA 1XR3A 3GDOA 2ETVA 5EOVA 1VP3A 5JWHA 4ZT4A 4UBMA 5LLTA 2G9ZA 4C4ZA 5I7WA 1B1AA 1YBAA 4IH9A 1HDYA 2FUNB 2QUHA 4LZWA 1XEFA 3GEEA 2P8SA 4FFDA 2V7PA 2D0IA 2WUWE 5YASA 3PTZA 2DQYA 1C50A 2V3WA 4BFXA 5B6IA 3OTWA 5CDTA 1FFYA 3F6PA 3BPSA 3M9LA 3O1HB 4ZVSA 1X1TA 1BE6A 4BO3A 5HSGA 1E64A 2EV9A 3E2PA 4KMSA 1E0JA 4KNVA 1EQ2A 3CX7A 4QJ5A 4TV9F 2HMVA 3OJFA 2OUIA 5FLKA 3A6PC 4N0DA 2R5NA 1NTOA 4JBNA 1CNFA 1NW9B 1O96A 1UJCA 2VL7A 5DMHA 5FCDA 4ZXFA 5HIKA 3OT4A 2EU8A 1LTKA 4IIFA 3P52A 1P44A 1UDWA 3FPEA 2GWRA 1J7JA 4KQXA 2IPOA 3LT1A 1COZA 2NVUA 3R8XA 2VQSA 3HWWA 1I13A 4IVQA 2QAGA 2O3TA 3S99A 3CS3A 4M37A 2BGRA 3C6ZA 3ZW7A 1PSZA 4LC1A 3RSLA 4OSEA 5EE9A 5JDCA 1CZNA 4IOJA 3WS7A 4JKIA 4B8ZA 3CRW1 2IBTA 4W8OA 5T4FA 4YUZA 2O0HA 3QVGB 3SEQA 4IS3A 5FWXB 4LW8A 1Z6AA 3MJTA 4GR4A 3HV2A 3HUDA 3D3EA 1RACA 4PG6A 1IBKB 3L6OO 3KL2A 4HWGA 3M4JA 2OCAA 2Z6VA 1QP7A 721PA 4B4DA 5JQGA 1V7CA 1FW8A 4I5IA 1NZJA 1E94E 1FNCA 5SV2A 2JCGA 3GFBA 4FFVA 1BHJA 4HVLA 2YJ5A 4N9WA 3VRHA 5BURA 4G0ZA 4UM9D 3KEGA 3K2QA 6REQB 1WRBA 3JPYA 1U63A 1KJWA 5BXYA 2R65A 1Z3CA 2CLIB 4RE5A 3TXXA 4XE5A 4CTJA 4CKEA 1CUXA 5AOBA 4E3ZA 2GCOB 4BNUA 1G1AA 1OA1A 1I36A 1VGQA 2HWXA 2I7TA 1Y1LA 3M6XA 4FT4A 4NABA 4J6FA 5LBTA 1NW3A 5DP2A 1L7XA 5JS2A 3ZNQA 4PNHA 2YTZA 1KEWA 1KIFA 2DFNA 2GAOA 1ZISA 2WM9B 2XGOA 5K03A 2D5BA 1C9YA 3BWVA 5EJAA 4DKJA 2ZVQX 2X22A 5L7WA 2HJVA 2FG6C 5JRZA 4X84A 2GTPA 1YD7A 3RKRA 1N8KA 3HB0A 4EO4A 4D8WA 3JQFC 5HBRA 1OASA 2BBWA 1NAHA 1RXYA 2WV7A 4EUFA 3TBHA 3C1AA 1V96A 1ZRHA 4AY4A 1T35A 1ZJ4A 4LAFA 1ULZA 3EIOA 2NQ2C 2HSJA 1C0LA 1X77A 1P6XA 2FQYA 4BE4A 1HSZA 1A9YA 2YFYA 1DL5A 3MM4A 4IUBS 2UZ4A 3D3WB 1NJ2A 1T9AA 1QCYA 4EB8A 2WYUA 3TRFA 3KOMA 3G2HA 3ONNA 1MNAA 3THXA 2VHYA 4XM2A 3N05A 3VR6D 5FEMA 3NBAA 1G9XA 1QYDA 4MQ4A 4JR1A 4L76A 2P3OA 1HLDA 3I4CA 1AV6A 1E3DA 1VJ5A 1VG9B 2J6HA 4YRCA 4X9XA 1DBSA 4HAWA 2L69A 4EJFA 4FBLA 1ZAKA 2CMFA 3MMZA 1JA0A 3QTLA 3ZZ0A 4BAUA 4OGKA 1DBWA 2BD0A 2GJSA 1DO0A 3OPXA 2VPWA 3HDHA 1X7WB 2Q6LA 3HCEA 4KAJA 4ZOBA 4OXQA 1JEAA 3W9YA 3SVLA 1JWLA 3QMVA 5A6SA 1TYCA 3GGJA 4MEJA 1H4TA 3DB2A 1NG1A 3NRCA 2ZU0C 4M49A 4BFTA 2G1KA 1PBTA 2P27A 3UGQA 3ANMA 3MA0A 5E9AA 1M2VB 2VQ6A 1NWCA 3CX6A 4S1NA 5CVVA 4CMGA 1G38A 3NANA 1I4DD 2WKQA 4LVCA 2AQKA 1J8YF 4EHHA 1I2BA 3M6VA 4COKA 2WSBA 4CCYB 5ITVA 3PC8C 1V8ZA 1FJXA 5AVWA 4D74A 2FEKA 2F1JA 5EQJB 1X86B 3DTVB 5DTJA 4EHAA 5JZSA 3O8CA 1QRUA 4ER0A 2OZKA 3WBFA 3KQKA 1XYGA 5TNXA 3VKHA 2O2HA 4I50F 4LBWA 4FILA 4EA6A 3LYUA 4WA7A 2AV6A 3KXIA 2ZTLA 1FNMA 2IEBA 4QUHA 4ND5A 4G0OA 1HDZA 1DCMA 2OC4A 3NV7A 1IOWA 2A9OA 1GL7A 3M34A 1KXZA 2MMCA 3BWEA 4V3BA 3N8DA 1NUSA 2HMYB 1P72A 2BEWB 4PZUA 4WVLA 5KKAA 4Y6SA 1T43A 3TPCA 4DV3B 3AB8A 1MO6A 4CHTA 1AZLA 1TUBA 5LMCA 3VPSA 3OO1A 5HM6A 2HUPA 1GN9A 2OHFA 3E3OA 1UBJS 1W46A 3OPYB 3EPJA 4PU0A 3QSGA 1QFMA 1EBFA 1X8LA 4MVJI 3ITEA 5DGIA 4QO8A 2MCFA 3BWBA 3BSFA 1D07A 1P7CA 4IWYA 4MWZA 4F4JA 3ZD7A 1R8QA 3T7EA 1A1VA 5KB3A 5A4MS 5L4LA 4XJTA 3W34A 2M98A 3L8YA 3VR2A 1E6MA 1FX1A 1KKUA 1CC1S 3FTFA 2AK3A 1YZGA 3HYSA 1GA6A 1GRNA 1JJBA 3TM4A 5ADVA 1DEXA 1JU3A 1Q6YA 2PRYA 2XWJI 4MKHA 4CCAA 2PKCA 3LPMA 3NHMA 4GZLA 4LY3A 4EDFA 4RJTA 4NQRA 4I55F 5FB3A 2F4VB 3LPDA 2BFOA 1ONPA 5FPPA 1Q20A 3FBGA 2DM6A 4Y2VA 5SY9A 4BMNA 4G0MA 1XE3A 3F2VA 4O5OA 1AK9A 2WE7A 4ZAZA 2PCLA 4Z2AA 1ISRA 1E58A 1DC4A 5LDHA 4RF3A 4EKEA 2NUPB 4X61A 2AYXA 5IJXA 2J5RA 1X8JA 4QVGA 2W2XA 4D8UA 621PA 2A1UB 4LISA 3E9YA 2Z2YA 4HWTA 4L07A 1G3MA 4RY2A 4DLWA 1E6CA 2D7DA 3OCYA 1UEIA 3LQQA 3UH0A 5IYZA 1LV7A 2GJ8A 3CR8A 1OLSB 4MUJA 2FSPA 3IAFA 4UEKA 5GONA 1G4UR 2XNSA 2EEZA 3DQPA 3KJIA 1VQ1A 1FQJA 2GAFA 3A4TA 2HNAA 1Z3IX 5KC9A 2XDYA 1SUCA 4CR8A 3UKDA 3KBBA 4MQEA 4QYMA 3LWDA 3ZIAD 5LDDC 2VF4X 1Y8CA 3PC4A 2HBQA 2RH5A 3H6HA 1WDKA 3MWYW 1QXSA 3HUEA 4TYWA 5ALTA 5LQUA 1LQUA 1L7AA 3R09A 4L75A 1XK7A 2AOTB 3CLTC 5DGXA 3CVOA 3L2OB 3NJRA 1FXWA 2PXXA 3NYRA 2SECE 4D9KA 2W22A 5LU8A 3A1SA 1DWOA 3V34A 2WLTA 5F5XA 2NVWA 1ZH2A 1LBEA 4GE0A 1V9CA 1WCWA 3HBJA 1DG1G 1P74A 1Y9DA 1Z2EA 4V2UA 4DARA 2KMLA 5IPFA 2ZPUA 4RTNA 4B4KA 3AT1A 3JQ8A 1BQEA 1NOIA 4KRXA 2ZS7A 4QE3A 4ARZB 2J6CA 2M1ZA 5KPDA 4MI9A 1KDRA 2JAOA 3ZK8A 3OLVA 1BC5A 2DTEA 3DF9A 1JYFA 2JFOA 2YVUA 3HDGA 1EDBA 5ARCA 4A26A 2VATA 4EGFA 4DLNA 2IP4A 1WZIA 4LF5B 3ZVNA 2Z9DA 3NEAA 3ZQ6A 3MW8A 3Q8XB 5CFLA 1TQ2A 2FLVA 1NRXA 5DBIA 2Z0MA 5HGJA 2QM0A 2YWJA 3MN1A 2J09A 4LYDA 3FDXA 2GCNA 4HEQA 5E9WA 1VSTA 2EF1A 4XLZA 5CH5A 2WICA 1NKTA 5REQB 3N0XA 2FP4B 4J9UE 2HT1A 1QR2A 2BBSA 1KSJA 1VRWA 3VU8A 4KX3A 1JGTA 5I5EA 3WLSA 1KF0A 1U2DA 4DXAA 2YW2A 2UDPA 2XE7A 1DQRA 2PJRA 3QKSA 1HOTA 2FKAA 2PPVA 3WAKA 1AN9A 4BNDA 4S04A 2BF7A 3CMMA 3VNAA 1EIWA 2NUBA 1WP4A 3A32A 4P4SA 3THSA 1ISGA 4PG8A 4QSHA 4PQFA 1I4TD 3JASB 4I6JA 2BJHA 4IR7A 4EVRA 1H1LB 2O2JA 5AHRA 3UIEA 4CUJA 5C5DA 2IXEA 3F1KA 3I2GA 3NIWA 3ZX5A 4AG3A 3WLKX 2WAAA 3B3GA 4JJGA 1CR2A 3QLEA 5U9CA 4C6SA 1XQVA 1E9BA 2COEA 4F21A 1E0AA 1URPA 2JZOA 2WTUA 3F4BA 5C80A 2FXIA 5LMUB 1Z2AA 5G0UA 2P9QA 3MILA 3Q2KA 4TWZA 4HN4B 1EDEA 1AUOA 2J0UB 2JAHA 1FFXA 3H9GA 3QXXA 4QLOA 4URWR 3VMFA 2WK1A 1N78A 4DDMA 1C8BA 4FDMA 4OQQA 5BRJA 1YBHA 3FDJA 5HIAA 2R1TA 2EVWX 2IP1A 4GI7A 3SGLA 3AG5A 1XVVA 4FHFA 2GM4A 1G20E 5B53A 2D2FA 3QUSA 2J46A 4ZZ3A 4M60A 3G9ZA 3DVRX 3L18A 4M9ZA 1USVA 1DLJA 1J8MF 4MS4B 1CNEA 2XMBA 5FBWB 4BNHA 3SZRA 1ZFNA 2BUAA 4L85A 4ETIA 1BOOA 2A8YA 4FVTA 3ZWBA 3GLQA 3DGFC 4YH1A 7ABPA 3BRQA 3FWPA 2FFAA 2ZUUA 4C29A 3GELA 1E8NA 1OAOC 1EBBA 4WBXC 1XWIA 1AKRA 3V9PA 4C0AC 3PXAA 3EPLA 2OGUA 5CB0A 1YQGA 5C4MA 2RK4A 1C1XB 1Y5NA 3IULA 1QFYA 4PYMA 4XPZA 3RW9A 1VPEA 5CEEA 1U2GC 3DEYX 3FPGA 4WGGA 3BORA 4FX5A 4RADA 4RL4A 3SKXA 1NBME 2ORVA 5DSTA 2J9RA 1K89A 1NI4A 4G0VA 2IXTA 2FPIA 1IOLA 4CKZA 3OECA 3FKSD 5A3QA 1ZRMA 2GETA 3UMMA 4K3UA 5FWYA 3ZE8A 4DE5A 4YFYA 3UHFA 3F5MA 221PA 1K7CA 1O08A 2FHPA 2JLZA 3RQSA 5F1OA 3GLTA 2P9EA 4PM4A 1CZRA 4E31A 3SS8A 1ORRA 3CRMA 5K09A 1KYQA 2H4ZA 2OTCA 3RGWS 5MFZA 1A2KC 3PXCX 1SK9A 5EMJA 5EA2A 4AYWA 4UJ3A 3F8WA 4JB2A 3C5WP 4OXXA 1E2UA 3WK8A 1T9ZA 4LYFA 1EK2A 4EFNA 1FFBA 1KNQA 1ZGHA 4RGVA 1MX9A 2WB4A 4KR9A 3VHRA 1PUJA 1X87A 2FETA 4CM5A 1DCTA 1U7ZA 1JXMA 3H84A 2AX4A 1T0JB 3AVOA 3V42A 4ZALA 3ADCA 3IKMB 2R25B 4DR2B 1DINA 2CL7X 4UPEA 5A7HA 5F1YA 5ADWA 4FWTA 1VI6A 3PQ3A 1OX4B 3O4IA 1V7QA 4HBGA 4R40A 4QYIA 3LFHA 3AKEA 4HY3A 5K6AC 4RUKA 2EBFX 4RHUA 1WU8A 1Q3KA 3EUEA 1M34E 4B4VA 4OV6B 3VX3A 4DY6A 3EODA 3DG9A 2WRZA 4M8NE 2HA4A 1A9OA 1I6LA 2O3QA 1SUSA 2C96A 4CEJA 4RETA 4K9DA 1I80A 2FY8A 2JAPA 1ZWKA 4UATA 3U39A 4CODB 3HG7A 5ALVA 1VFPA 3AERB 3IXMA 3JWEA 2RI1A 4QQNA 5DBFA 4DLBA 5IVHA 1XUOA 4CEHA 3CCFA 4J4HA 5FA8A 1O5IA 4XWWA 3RS9A 1B7GO 1Z4OA 4QEDA 1NL3A 4TWJA 1CSEE 3B70A 3IJPA 2W6NA 4L5BA 4ROSA 3GJXC 4XCQA 3ZXXA 1Y9ZA 1T4MA 3W1VA 4UAJA 4YAWA 1E4YA 2EQ5A 4WEQA 5F3WB 5TLSA 2JEZA 1DKNA 4G1BA 4P0TA 1E2PA 5FEUA 1UZMA 1XRNA 1F17A 1OWMA 3WQSB 1UXKA 4CUZA 5K0EA 3W5VA 1BXKA 5FLEX 3S5UA 3A0RB 1CWUA 4YDRA 2V3VA 3STYA 1R1DA 1R8XA 1SD2A 5LA6B 4J0CA 4QXAA 4FNAA 3TVYA 5KSPA 2ZETA 5DZSA 1OBHA 2QI9F 5EG5A 3H7IA 3I6ZA 5CVJA 1Z6QA 2F3QA 1Z2DA 2WLSA 3AMVA 1PVOA 4MCHA 3TRIA 5JSZB 1POXA 1L4EA 1C80A 1BS9A 5AI4A 5TPZA 1W96A 2DHDA 4KEAA 2UZ0A 1IRXA 5JE8A 1QMPA 1Q0PA 2G09A 3EIQA 4XQCA 1CUJA 1MVLA 4HMPA 1N1GA 4IIEA 4LYGA 1M8FA 2IPAB 4R8MA 2XNDD 4YV0A 4B82A 7MDHA 2RHMA 1LC0A 4FB4A 4OTZA 3SHWA 4HQOA 4RAQA 1G18A 1HT0A 4NV3A 4CQLA 1RYEA 3BGIA 1CVLA 3T61A 1IXYA 3NUZA 1GD1O 2AN5A 2A2ZA 5K8LA 4RBNA 4BWYA 4QJ3A 2F00A 1M2GA 3PX2A 4UM7A 3R6DA 1QTRA 4F4CA 4JWKA 3I5MA 1SXHA 2F1IA 3FNIA 1P8JA 3ZJUA 4R2KA 5B3JC 4TL6A 3PIIA 4P7BA 2BLLA 1OX6A 4G2TA 4Z0NA 4KAFA 1ZA2A 5EQDA 1BEZA 3SE7A 3U3MA 2AN4A 3P94A 4A8PA 4AMBA 4DBZA 4W5RA 2BE7A 4NSNA 2VH5R 5K0CA 2YV2A 3AF2A 3D7LA 4MA4A 5HXAA 1VKRA 5KO2A 4OLJA 1XVUA 3K5PA 3PD7A 1AK1A 4QFDA 4FYXA 3HYTA 1CY4A 3SF0A 3GG2A 4D9JA 4BCCA 3AUKA 4MQFA 3IQDB 1OBCA 3QZUA 1SEVA 3RSOA 3FCCA 5KREA 5IEBA 3FJYA 3Q9NA 1LW7A 1S89A 5FNVB 3DO5A 3SG0A 3WK7A 2JI6A 5EUMA 1QP0A 3PJDA 4PHHA 1PR2A 1ULSA 3EFEA 1MQSA 3PG5A 4E4RA 1MHTA 4BGEA 2QY9A 2QV7A 3K0FB 1BWSA 4JB0A 5FBZA 4HB4A 4KHZA 4OJTA 1T9GR 2Q2WA 1T6YA 1V26A 3DV2A 4DLVA 3ZHVA 5BV7A 1XRPA 3OBBA 1L5YA 2VHZA 4R84A 4IIJA 4MUYA 3HRIA 1RTKA 1DKQA 1PR3A 3D6VA 3QENA 4QPZA 2A92A 4OXNA 1T6XA 4K1XA 4GVXA 1J2RA 2B1IA 1BVRA 3BIXA 2OQRA 3FUTA 3M8KA 4QOGA 4B5LA 1KI8A 4H1TA 3NTUA 2JA1A 5K6TA 3H5VA 1C2YA 2X1VA 3PQEA 5IVIA 4DV0B 1JJ7A 1TTPB 3QW2A 3TR0A 1MORA 3A6EA 5AO9A 1UBEA 3TI9A 4RJLA 2PUAA 2ODTX 3WYCA 5LIPA 3FYSA 1RJ9A 2H4JA 3IP6A 1JALA 5EIHA 3W9UA 1SZPA 2DULA 3O4RA 4FQ8A 1WABA 1WSBA 3ZGNA 1I7LA 2ZUCA 1TFUA 3ZWWA 3D8UA 4KQEA 2QSZA 3I05A 5TF4A 1VKNA 1YUBA 1Z5VA 2H00A 3C7KA 1N75A 1JJIA 1R8SA 4AS3A 3C5CA 2JFYA 4DUYB 1M3SA 2I7CA 5FULA 1AA6A 2O57A 1A8IA 1XZQA 4OFWA 2VWGA 1Z22A 2Q1XA 3ZQJA 4UNRA 3MRXA 1DAHA 5D51S 2ZUFA 3L8GA 5SZKB 3SR4A 3FX2A 4KQMA 5B4UA 3KHTA 2NT3A 1EE9A 2VSYA 1C14A 2B8JA 1BMTA 2OM6A 3SQDA 3WY9A 4MV7A 5A3RA 4A8JB 5HGXA 5AW0A 3IP8A 1SXJD 3H8SA 3LY8A 4KQJA 4LZJA 4ERNA 3U80A 3EQ7A 3A2NA 4HSGA 4DR1B 5G4KA 4OA8A 2I3AA 3E35A 1IIBA 4RVHA 2NAFA 3DLTA 4MDEA 3GYGA 1JU9A 4IYRA 1E3LA 2C2GA 2REQA 4P84A 1FU4A 3U7QB 4YQYA 4ZOLB 1HDRA 3EXAA 1YFZA 4LZOA 3FOFC 4XPIB 1KP9A 1IY2A 1TF7A 1QV6A 1USIA 1V3TA 4JBGA 4RMIA 1NBMA 4KOAA 4B34A 3OO0A 3OQNA 5IMBA 3EXFA 2LXNA 1LJ8A 4L95C 4QTXA 1EUCA 1DAOA 1RRVA 2BN4A 3FPFA 3NFRA 3Q87B 5BW5A 1O5OA 2WYOA 2AT1A 2P4QA 4R1LA 4Q1FA 2R8ZA 3KZ1E 3OLWA 5HW0A 1AZSC 3O4GA 5B2ZA 3DHEA 1ZCAA 2PMBA 1NY6A 1Z16A 5KMGB 1T3SA 3KDSE 3LQYA 4FZ3A 1RR6A 3ZXSA 3BHJA 1MNQA 3F78A 5U1PA 3DDCA 2N9UA 2VDWB 1X1SA 4TVOA 2CFIA 3CINA 1I9CA 5CIWA 3HYLA 4F8EA 1V47A 1Z5UA 3EXHA 3K31A 3T1QA 4A0SA 3QEMB 4Z1MD 3WO0A 1W1IA 1L1RA 5C0OE 4IDDA 2CVFA 1VC2A 1C3OB 3DMDA 1L3IA 1MOZA 3RNOA 1MG0A 4V24A 2VUHB 4YQFA 4H31A 1IQPA 1HE1C 2ISCA 5ISMA 5J5VA 1MO3A 2VF2A 3F4LA 3L0SA 2FR8A 1XVLA 1ZAYA 1TCUA 1PEKE 1TTHA 2QLTA 1KEPA 2PRKA 1GU1A 3FSEA 2XQIA 1NR1A 3IQHX 3FGNA 2BGKA 4FZRA 5AOAA 3VA7A 1W36D 3D7NA 2IK8A 2AYYA 2NO4A 3R9XA 1H9CA 4AU1A 1X1RA 3RS2A 3S55A 4DQUA 1U0RA 4TZTA 3NG1A 2ZUVA 3H6GA 3U3DA 1M6NA 2A0KA 3CEAA 4D96A 4B3RB 3O93A 4DC0A 3ML1A 3QUTA 1K8QA 3FKSA 3GEHA 4U2GA 4E11A 4ND4A 2VPPA 3HRKA 5DI3A 3S3TA 1GNQA 1XQWA 5BYKA 1MQ9A 2CVZA 2HK7A 5KTNA 5IT0A 2G82A 3FETA 2ENWA 3OZRA 1HE4A 2I67A 2J4CA 4MR8A 5DSXA 2IDKA 1EFRD 2WZCA 2X7JA 4G4GA 4KX5A 1Q1EA 2ZI9A 2B5VA 3C3KA 3ZLJA 2QT1A 3L07A 2PTHA 1TC2A 4P3YA 1XKTA 3ONDA 4JJEA 3T1NA 3WRYA 1O0BA 4OL9A 2LDBA 1II8B 4V02A 3O95A 4X44A 1VYUA 1SCJA 1Y1KE 2GA9A 3AZOA 5J58A 3UNXA 1U9IA 1YBVA 4CW7A 5KNLA 5B3AA 5FTKA 1MJHA 2A9QA 4CM8B 1Z73A 2ZBRA 1QIEA 2R60A 3EW9A 1QMGA 2D4HA 4L9AA 4OU4A 1LPNA 4FP9A 3QYJA 5F5NA 3E8XA 4WK4B 2ZIUB 4PZCA 1AT1A 2G9VA 2ZSFA 2ZSKA 5BWBA 1FNNA 3QHPA 4Q7EA 3D1JA 4LV6A 4Q66C 4AN4A 2A5JA 5L9AA 1E3IA 4R3UC 2QP9X 2GEVA 4LCEA 1BX0A 4DPLA 3B5EA 3EXIB 3TDNA 1IJBA 1T26A 3EZLA 4YPOA 2ATVA 1JEJA 5DWQA 1ZHHA 1EDDA 4H6WA 4P5EA 1XTBA 2WIJA 3VH1A 4IAOA 3RJMA 2RBGA 2HADA 4IDHA 3GPIA 4CM9A 4P33A 2G5GX 1NM5A 4DG9A 1LS1A 2BY4A 3HO6A 3OIDA 2IPMA 3GD5A 5AIAA 4CQMA 4DNOA 5IKMA 2IKSA 3I9FA 3AV0B 3K1JA 4TYPA 3BCSA 1HDIA 3ISTA 5ES3A 2HA6A 3TUIC 4NYIQ 1NN1A 4BTEA 2JHAA 3B1KA 3GC6A 2HMSA 4OXYA 1Z13A 5CXXA 1G60A 1RQ7A 1PTJC 1JQAA 2H4WA 5JAMA 1GHTA 1ZONA 2PXHA 4KQFA 5EIWA 1NKSA 5JEDA 2LCFA 2GKSA 4UARA 3ZZUA 4JENA 4R7GA 5THQA 1NOKA 4G0YA 1W1UA 4AJ4A 5DM70 4V2IA 3DCJA 3ZYCA 3S81A 2WQZA 1QRAA 3JQGB 2IYQA 4DVJA 1CP3A 1ATZA 1MH9A 3GLHE 3HCDA 5LQAA 1RRFA 1J99A 3CNOA 3N2IA 1KO4A 1LDNA 3QF7A 2QX8A 3CNQS 1Y8QA 3PLNA 5BN5B 3P9KA 4L0MA 2A14A 3CVUA 3KLPX 1IWBB 1L7NA 3NWEA 3OC6A 1KYYA 1R9MA 3JZAA 4UVGA 3SYKA 3VKUA 1U8ZA 4RZSA 4D9IA 4I4CA 4RZUA 4EJSA 1DQPA 1V37A 1LWOA 1LLFA 3FGOA 1OXTA 4YBRA 4QNNA 4KG7A 4RZ3A 1JG7A 1L7EA 3SSAA 4LE2A 3F98A 4PINA 3HUTA 2Z57A 3C85A 4E1AA 3AU9A 4O4JF 2E7ZA 1UK7A 1BEUB 3GBVA 2JD2A 4JY7A 3QOYA 4HDRA 4YC7A 5EWJB 2M6KA 4C5AA 5A7FA 3U4QB 2XNDA 3MS4A 2XB9A 4LZNA 4QXPA 4XDGA 3NHRA 4FFNA 1T5OA 5ALUA 4HTFA 1NVBA 1SELA 1KSGA 4N48A 1ML4A 2CF6A 3NTOA 3UVEA 3R5TA 1G8SA 3Q7TA 4TS3A 3UJ3X 3VU1A 1EFDN 4G1CA 2GM9A 5BSHA 2ASEA 3QJYA 4D9GA 3HKCA 4FMCF 1G5IA 3DW1X 3FA2A 2ZJZA 1JDJA 2IC5A 1MO5A 3VH3A 1NRWA 3EA5A 4M6WA 5G1OA 4QULA 1EUQA 4MWBA 4RD1A 1V16A 5C18A 5CMLA 2QJWA 5ER6A 1DPFA 3MHPA 1P9LA 4KE9A 4UDOA 1JVBA 1GY8A 5FNZA 3G49A 5FTLA 4OHFA 3N1UA 5AI0A 3QKIA 4WINA 4F5YA 5LN1A 3GJSA 3WKDA 2RB5A 4E12A 5KX5B 2C7GA 1JBKA 2CJYA 1F3OA 2XPCA 2RGXA 2C9CA 1W1WA 5BMVF 1ORIA 4G6ZA 4BMDA 2C9BA 4DWWA 3BWDD 4KFUA 5AR1A 3HI6A 4ZAXA 4KGZA 1LBTA 2GK7A 1TZBA 3FCOA 1EM6A 4JUIA 2QZZA 2R4UA 4LJAA 5CB4A 1T3HA 5HDQA 5TQ2B 3MRSA 2O07A 1RHKA 1ZOOA 2B78A 2R8XA 1PZMA 1S8NA 3EVBA 2H54A 2J0EA 1Q7GA 5LB2A 4EW6A 2VCEA 2BBOA 2J8ZA 2RHOA 3FVQA 4WV3A 3UKJA 5IF9A 4X65B 3A27A 3C6BA 1IHUA 4YHBA 3B2QA 2E5FA 4IICA 5E6RB 3PEVA 1GKUB 1B73A 3I53A 2CMHA 3NM5A 4IUYA 4WZBE 2V55B 5K0FA 1B2LA 4J0DA 4OUKX 4YRFA 2IHJA 2IUFA 3MXOA 2DH6A 2PUVA 2A7QA 5FFNA 5BRNA 4A9AA 2R6FA 3EH1A 3G2LA 1A7UA 4H08A 4C76A 4X93A 3DWIA 5JVDF 4DRXA 3EVDA 3OOEA 1XD2A 2D0DA 3IUJA 4X94A 1X8XA 3OJ0A 3RVBA 4ZYUA 4I8DA 5JHGB 1UK9A 4QTUB 4NWIA 4RCVA 1IFXA 3G2KA 3W6ZA 2DPHA 4MRMA 2PKQP 2YJZA 3E22A 2JBAA 1DC3A 2ZSUA 2GXAA 1KK2A 5TQ0A 4Y6RA 1KZ1A 3QPUA 5BN4B 2YYSA 1CHDA 4YRRA 2CBXA 2CHUA 5L4SA 1RCTE 1BXGA 2H1HA 1S8FA 4UDYX 5IZCA 4URFA 4J03A 1MW9X 1SC1A 2ATCA 1Y3CE 4L8LA 5LC1A 4EIWA 3ZUPA 1KDTA 3ORSA 2JGDA 1GTRA 3NR2A 2CFOA 4QARA 3VI4B 1F2TA 1XGKA 2AVNA 2AXQA 3NCTA 1TUGA 3AF0A 3SXUA 2I5PO 3ELYA 1SXJA 1TK3A 3LUHA 5JJKA 4NE7A 2ZCUA 4EGAA 3ZS9A 5JD6A 1PNRA 1ZNYA 3PT5A 1OI7A 4OHVA 4EBBA 2HRRA 4F3YA 3T3NA 3ZI7A 3OWOA 3BD7A 3D31A 4E94A 5K3AA 2NPIA 2B0JA 4J3FA 3F7MA 2BONA 1RWVA 2QIOA 3TQHA 1F38A 1GGVA 2N47A 3KEMA 2P67A 3OZ7A 3WBBA 3SCZA 3FD8A 3OIFA 2C31A 4MR7A 5G0SA 4QVIA 3EWNA 4DMKA 2XNKA 2HCFA 3TOVA 5JMOA 1D2AA 4FCVA 4RK7A 3D2BA 2W83A 1XJ5A 4UUPA 4XGRA 3UCXA 4CKBA 1P9OA 1NXTA 1R27A 2Y77A 4W1QA 1IYZA 2PAFA 2D1TA 3EGXA 4ROTA 4CU2A 1DKRA 2PT7A 3PP8A 3B89A 5B4TA 3BWYA 3RNLA 4E08A 1EWTA 1G3QA 1UT6A 3AM3A 2ZSBA 2HK8A 1UKZA 1KZ9A 4PC1A 3RCBA 2OHVA 2ZEJA 3U4AA 3WIVA 4UMVA 4GEKA 3ZLUA 1WUYA 3UGTA 4Z1MA 3LAWA 3PQ4A 1OZGA 4JCCA 4K03A 1JIUA 2MR6A 4TLCA 4LTMA 2HQSA 3CFYA 4QUAA 2DY0A 4G67A 3TRKA 4AZ0A 1CY7A 2QMOA 3GA0A 1N9GB 1QYCA 1TEHA 1L4KA 3AL2A 1Y6QA 2QQ0A 4NCJA 5GJVC 1WQ4A 3PPVA 4ZOEA 1W4BA 2G1AA 4K5QA 1JDTA 2HYDA 3BJZA 3O8LA 2QUBA 4NX2A 3ZD6A 3G0HA 1XZDA 4L9WA 4S2UA 4F1KA 3SC2B 4ZHQB 2ECOA 1Z68A 2KB0A 3NHFA 3N6XA 4CF5A 2R85A 1BDHA 2WIGA 3TQOA 5B2FA 2NU9A 4BKRA 1O6ZA 4YJFA 2C3PA 5IT4A 5FYDA 5AJUA 3NBFA 4MVJD 3BVPA 4FUQA 1A88A 3AY3A 4OY3A 4Y2JA 1IY0A 2ZUWA 2RGBA 2R8OA 2R62A 1DUVG 4N5LA 3HKEA 1EFRA 2ZWOA 3PNSA 3C16C 2QX9A 3BIOA 3OSZA 3SC6A 4DWOA 4LRYA 2HA0A 3I09A 4Q1VA 3GXOA 2W11A 1OW3B 2XYVA 1BWRA 3HJUA 5IAAA 3KAKA 2ZJAA 5E2BA 2IUYA 2XCIA 3A6JA 3FSRA 3JVUA 4I1SA 3EDQA 2AEFA 2JJ2A 2O3JA 3JD1A 3ZE6A 3JWGA 4UU8A 1DJOA 4OP3A 3KVVA 1FEZA 5KYVA 4URVR 4PZ0A 1I5EA 2KS6A 1TIBA 3LP5A 4GMGA 3M6MD 4DR3B 2DQKA 3GGDA 7REQB 1X7XA 2CHVA 1Q1QA 1SUDA 3QM1A 1A69A 4UHKA 2PEZA 1E66A 2SNIE 2XQKA 3A1UA 5G1PA 5LP6B 3C1TA 2HPVA 2JB9A 3OLZA 1TTQB 2KBEA 2VDPB 2X5NA 2YBEA 1Z08A 3SLGA 2DC1A 1ZS9A 3EXEA 3OCWA 5IJ9A 1MVNA 4GHWA 1P1HA 3GP5A 4NE2A 1DAEA 4ZQBA 1MFZA 3RYFB 2IS4A 3EF1A 3EUWA 4K2AA 2YIMA 3GIDA 3QELB 4YI3A 1HDCA 3LCMA 1MLDA 2XTNA 5B64A 4MVJE 4TYNA 2FWAA 2Z2KA 3UZUA 1Y81A 1YBFA 4OH1A 1KL7A 5BPHA 5ED4A 3LT2A 1JG1A 5J2TA 1QIGA 5KYXB 2PBZA 1YOBA 1JG4A 1TT5B 3KZOA 4DSTA 3TQCA 3VAZA 4E5SA 6GPBA 4D9EA 3C3MA 5J4LA 4XVUA 5EWMA 4UJ5A 2Y0CA 4HH1A 5FI5A 3AOEA 2IEZA 3VZDA 2PO5A 4UZEA 4A27A 1YASA 5CGZA 1BXRA 5AVOA 3WB0A 2JIDA 1U2TA 3NDBB 4XW2A 4E7PA 3WNVA 3AU8A 1GL3A 3HU2A 3RYIB 2O8FB 1OAKA 1HFJA 3O74A 1RWWA 3WKEA 5L95A 6NULA 4LJ6A 5EINA 3T1HB 5H16A 2HW8A 1Z12A 1NU8A 1ZXBA 5A9TA 4ZRDA 1AO3A 1BD4A 4GYJA 4J0IA 3KJEA 2V1XA 2BFBA 5IX8A 1SIOA 2Y1CA 1EHYA 3H0CA 5EP3A 5BXQC 4JI5B 3H5LA 1PJAA 4H1VA 2CNLA 4LFBB 1ZI6A 2EHJA 3EQZA 4L16A 5ETJA 3HCWA 4IQ4A 4NEHB 1IEWA 1TJ4A 1Q3TA 2XB2A 1MH1A 5GVSA 3LCCA 2VIIA 4QYWA 3R7FA 2G3YA 1QHFA 1ZK3A 3K1AB 5FOXA 3MRTA 4O2BB 5TRTA 4XSVA 4RSGA 3KYCA 3TLEA 5JS1A 2QRNA 1MOSA 2QIPA 5GY7A 5DFAA 1AM4D 1M6VA 2ZRHA 3GOQA 1EINA 2DHEA 2VDLB 3IJRA 1U2ZA 1KY5A 4GSYA 1DTSA 5SZHB 3LY9A 4IW3B 4W9NC 4DIKA 4ZT2A 1H2BA 3VOBA 4CLEA 3SYNA 4B3SB 1G20B 3MXTA 4WCFA 1E8DA 4C05A 4A0RA 3ORRA 1TF2A 2IYLD 1IK6A 3EQ8A 1WR8A 4EMUA 1WD5A 2CVHA 1N6HA 1AZTA 2ZT8A 3BDAA 3DEAA 3U4DA 3OOYA 3SDZA 4U7TB 1FBTA 3W8FA 1EUDB 1NRIA 2NYVA 1J8DA 2HBZA 1TIKA 2KBFA 4UDXX 5BQ5A 4YXWD 5BSEA 3PQFA 1Q12A 1IUKA 2BZ1A 3RVRA 2GCIA 3LW8A 3NOVA 1RQ2A 3LX5A 4FTWA 4ZJUA 1V3UA 2W2MA 3FMVA 4YP0A 2X14A 3RBVA 3NDIA 3RSFA 2BKVA 1H93A 3IJEB 2EFEB 1CQPA 1T0UA 3PQ6A 5EAIA 2KX7A 3FWKA 3ER8A 2PLAA 3C3WA 4LWPA 2AF3C 1NLFA 1XLTA 3S2UA 2ENUA 4FD3A 3SJBA 2GYYA 4CKWA 4IG9A 2R66A 4RHFA 4XYLA 5JRDS 9GPBA 5JXHA 3SVTA 1UZLA 4WJKB 4DIBA 4UUBA 2MYPA 1M8GA 2MINB 4ECAA 3DT6A 5K8UA 2XADA 1ZKDA 1CDOA 5EKSA 3G88A 1A0OA 4ZT7A 4R1PA 4TL7A 4IHJB 5IASA 2EYQA 2QGNA 4LK2A 3VDRA 2RGNA 4H60A 4I2NA 3SN6A 3FOZA 2Y4NA 3FTEA 2D54A 2EP5A 4JS0A 1G5HA 2C99A 2PPLA 4JXJA 4B3HA 2ZREA 1OTXA 2WHRA 4JFRA 4PHCA 1PV1A 5HJ5A 3ZBQA 1Z82A 2QF7A 4NV0A 1YFJA 1KRWA 1XCLA 1K92A 1O1YA 4U3JB 1U5BA 2MWMA 3OQPA 3GDFA 3GRVA 1VHDA 1UWKA 1BRMA 1R10A 2LCIA 2WF9A 2ZUBA 3I0NA 1MGPA 4HDNA 5EMHA 4EG0A 3LHKA 4CG1A 2L18A 3EMBA 3GV0A 2PMCA 2DP4E 1ITZA 2REXB 3AHEA 5CU7A 3UANA 4JC0A 5H82A 4D3FA 3A3YA 5K3FA 1BCRB 1PFYA 1GNSA 4IRXA 4M1TA 3HP4A 1L7DA 3ON5A 1JILA 1SUFA 2ZITA 1M34B 3QXSA 2QMEA 3NHUA 2ZUTA 2CKMA 3C3JA 2NSJA 4JVNA 4FK8A 4UHCA 3ESAA 3VVLA 4KR3A 1PK9A 5IP5A 5L7TA 2YHIB 3OA2A 3UK2A 1GG5A 3TM5A 1RC1A 3FI0A 3CG0A 1EM8B 1HG1A 4NU6A 4UCQA 2FH5B 3RIYA 3ABRB 2HU8A 4OHZA 3KTFA 2PRSA 3CUTA 1QC5A 2JBWA 2PCJA 3KYIB 3PRHA 5CT8A 4GLBA 5B1DA 5EJ5A 2DEUA 2JFXA 1GYQA 3A6ZA 2PLNA 4A2QA 2OSVA 1QFXA 1T9GS 2A88A 2WF8A 3V7YA 3BMCB 4CHGA 4M99A 5LYJF 3BE8A 3NNSA 2GPSA 1N2GA 1ZQ9A 2ZJ6A 5H02A 1YZNA 2GI4A 4YIHA 4R4JA 4BQRA 1B43A 3KETA 4G0QA 3N9IA 2A9FA 1O89A 2VJKA 1L8QA 3WDSA 1ULBA 2XKBA 4JJ6A 5AK6A 3A3OA 3QKTA 2M9MA 3AONB 1FTQA 5K2MA 5B2EA 5I7VA 3I2KA 2CSXA 1YIAA 3W2FA 1G5TA 1ZLXA 2QTNA 1FFEA 5JBIA 1EFCA 4K9QA 2VVTA 1T4CA 2VBCA 1K8RA 1P9WA 2R1VA 1XZIA 4RTSA 4EG6A 1MIOA 3TIGA 2GPAA 3DE5X 5IDXA 1JA1A 2HCJB 3MWEA 3PVCA 2HA3A 3B6MA 4MPJA 4I5DA 4AJNA 1JDZA 4EPYA 1YQXA 1Z83A 5B6JA 9ABPA 5KTMA 1FFHA 1V48A 2I99A 5CNMA 3UT5A 4XB2A 2OBYA 2IPXA 4GMDA 3HZZA 5FUWA 1ID1A 4ZV7A 1NLZA 2IYUA 2WVHA 4NFLA 2B3TA 1NT4A 3AR6A 3C4VA 2O2XA 3L3BA 1XAGA 1CQJA 1C9EA 1FUKA 4P7JA 4OQDA 5D3KA 3ZJYA 2PY6A 1XU4A 3FFTA 1P3DA 3C39A 3M9WA 5EMKA 2XD4A 5CHEA 4PFJA 5AKJA 4CLRA 4Z0PA 4RMHA 3MWDB 1PT8A 3OTIA 1A9QA 1P61B 3OJXA 2JJYA 2FMIA 3EAFA 4RVUA 1GADO 2XMZA 3ZGOA 1PYOA 3U3RA 1A72A 4BLUA 4TKVA 1EK0A 2F6RA 1UZUA 3EIEA 4ZWNA 3QJGA 1Q0SA 3KDPA 3E9CA 1CFZA 1SCNE 1C4KA 1AUQA 3UWMA 3WADA 2AMLA 1OY1A 1W59A 4KN8A 4KQ9A 2F2TA 3GAZA 2H11A 4IWNA 4O4LF 3HKBB 2L19A 1GARA 5H3LA 4Q48A 2WE8A 3UAOA 2G0TA 1H2XA 4MQBA 1PVDA 1H05A 3VNVA 8OHMA 4E13A 4KKVA 3IQGX 3KQOA 5AK0A 1O95C 2B25A 2FE4A 4MVJA 5AJYA 3VTFA 1RU3A 5DWDA 3BA1A 3JVDA 1B0UA 4PNEA 2VEDA 1KFJB 1JDUA 3K7EA 2FSSA 2OD2A 4Y1RB 5CTAA 2FF7A 3COWA 1AHNA 5JASA 4W5WA 4GKKB 2OP0A 2E37A 3UK1A 3IP9A 4C4XA 1JIXA 1NUQA 2JI9A 3I5AA 1HQKA 3IR7A 3QOFA 3K9WA 1E3SA 1Y7LA 1AX9A 3IUQA 3Q0IA 4HDQB 4Y2GA 5KJ6A 3NHPA 1RRCA 1V1MB 2Y66A 3IUBA 3DHVA 1AKNA 3DEIA 3H3JA 2QTVA 2OHJA 2RKOA 2W6JD 1AKQA 1Y9AA 3M5CA 3JX9A 4LSGA 3NBXX 1T8SA 1GKKA 1QK5A 2PVPA 3R0ZA 4O4IB 1D2HA 1E0KA 1TK2A 1R8JA 3BXPA 3QWFA 2BE9A 3FH0A 2B9EA 1NXVA 1IC6A 3RHSA 3K8YA 1T10A 1QHGA 2PNJA 5FBRB 4A2WA 2D8MA 2ZWIA 4US0R 1Z2NX 4FCTA 4WZAA 5IG2A 1DJMA 3PNKA 4LRUA 4XSHA 3WYNA 2X6RA 3Q3IA 1EI9A 2EARA 4LJSA 4LJ8A 1I10A 4HQKA 4OM7A 1HMPA 2VYVD 3NGLA 3ZZMA 3CW9A 2OCYC 1VP9A 2WAMA 3PQ5A 3QA9A 5EERA 4UKDA 1UBRS 5DN9A 2XECA 3R1IA 4RKQA 2NO6A 2ORIA 2G5CA 1QM5A 2J3DA 2X42A 3GJ0A 2QE7D 3PQ2A 1OI3A 4WESB 1Z39A 3KCNA 4A0QA 4B46A 3DL0A 4TUYF 2FWPA 3CZMA 1W8IA 1NJ8A 2D62A 3WTCA 5M7EA 4P0PB 3OD1A 4OK5A 5KYGA 1ETHA 3HCNA 4O4HB 2FPPA 1T5HX 3TNFA 4YMGA 3LH5A 3ZHZA 3SBOA 4GP9A 1E2DA 4IDOA 5TMDA 3KUUA 3WSWA 4B6OA 4W5QA 1PL7A 1CEQA 3DOUA 3IQXA 1GCOA 2PKQO 3RS3A 9ATCA 5IAOA 4I19A 1IN5A 4JKYA 5FPKA 4KR6A 4MUGA 3ROKA 2ZZNA 4Q4AA 2QN9A 1D6JA 2MSEB <