3E81A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
b'MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e81A00
4L6AA 2JARA 1S2OA 3WGVA 5ALWA 5AK3A 4BYGA 1ZD3A 3AR4A 4NFLA 2NYVA 4HGRA 2HOQA 3WK9A 4HAIA 4BKMA 3OTQA 4MUMA 4BNDB 4KNVA 5AK6A 5AKGA 3ZW7A 2YN4A 2PQ0A 1L7MA 3L8EA 1TA0A 3SLRA 2RB5A 3ZVMA 1WR8A 4F71A 4EELA 2P27A 1U2TA 4C4SA 2GHQA 5AW9A 5AIAA 1O03A 4QJBA 4FE3A 4RETA 1U02A 2IOFA 1U7PA 3A1EA 2AGVA 4L6CA 1Y8AA 2D2VA 4DW8A 1WVIA 2ZOSA 3NANA 3B8EA 4FYPA 4F72A 3ZVLA 3AR3A 3W5BA 2YBDA 4J03A 2CN1A 3QX7A 2Q4RA 3ZWDA 3AR6A 2W11A 3KBBA 1QQ7A 5AI6A 3ZWKA 3W5CA 2FDRA 3FM9A 3WKCA 2WHEA 3KD3A 2FI1A 5AK4A 2YMQA 2ZBFA 5AVVA 1EK2A 1YDFA 5JJBA 2YMMA 3E58A 3BA6A 4XQ0A 5E0OA 3U7EB 3HYCA 4KN8A 3EF1A 4Y2JA 5A3RA 3L0CA 2YJ4A 3I28A 3AR5A 5AKJA 4EX6A 2G06A 1SU4A 1L7NA 1YNSA 4YGYA 5ALGA 3DAOA 4NWIA 3WK7A 3QLEA 1Z4JA 3FPBA 2GMWA 3QYPA 1QH9A 4EX7A 3U19A 2C8LA 1RLMA 1L8LA 2P9JA 3F9RA 5AM4A 2I34A 2GO7A 3WK6A 5AVZA 1FEZA 1QQ5A 3OCWA 4NABA 4UM5A 4UMFA 1MH9A 3W5AA 5AIBA 3KZXA 2OBBA 4OFZA 5AVSA 2W43A 3ZX4A 2G80A 1JUDA 5IT4A 4UAVA 3HLTA 1Q92A 1TJ5A 3NUQA 3SD7A 3ZTWA 5ALVA 2CFRA 5ALRA 2WM8A 4FFDA 3U7HB 3B9BA 1LTQA 2BDEA 1RMYA 3NAMA 3FVVA 3L8HA 3AR8A 4YIKA 1ZRNA 3ZX5A 5AI8A 5AVYA 4EENA 2P11A 1SWVA 1Z4MA 4YCNA 4YCMA 4O8CA 3OCUA 4HGPA 5AVQA 4UU1A 1PW5A 2JGAA 4QQFA 5AW5A 3L5KA 2RAVA 5AM0A 3NASA 3UMCA 1TJ4A 1RRCA 3WKDA 2G07A 3WKAA 1RPZA 3U26A 5AVWA 2YJ5A 5AW6A 3QUCA 2C88A 3KOOA 2G0AA 4DWOA 1F5SA 1Q91A 4NAVA 3L1UA 4IG4A 3L0BA 1Z4PX 5AVUA 5AKYA 2GFHA 2C8KA 3L7YA 3NALA 2YY6A 1S8OA 2ZXEA 3WKEA 2I54A 4OD0A 3KDPA 3R4CA 2IOHA 3ZU6A 1ZRMA 2HF2A 2HDOA 5AW1A 3N5KA 3ET5A 4XOUA 2HI0A 3FZQA 3KC2A 3UMBA 1U7OA 1K1EA 1Z5GA 2R8YA 4J2TA 4Y2VA 5AI5A 3L1VA 5ALNA 4BX2A 4PNHA 1U2SA 1SWWA 2QLTA 2FPXA 1NF2A 2OA0A 2NO5A 4BX3A 1QQ6A 5ALXA 2Q5EA 4UMVA 3K1ZA 4CF3A 4UM7A 1AQ6A 1NRWA 2JAOA 1T5SA 2EARA 3U7GA 3DNPA 3M1YA 1L7OA 3M9LA 1RDFA 5ALFA 2R8EA 4AS3A 3PGVA 4B6JA 1Z5UA 5AI9A 5AKEA 5AKKA 3RFUA 1ZD4A 2X4DA 2HO4A 4Y2YA 5AKLA 4Y2UA 2FPRA 1YS9A 2HF7A 2CFSA 2I6XA 5ALIA 1TJ3A 3AR9A 5ALTA 1CR6A 5FP0A 5AM2A 3MC1A 3SMVA 2ODAA 2YMPA 5AW2A 1Z4IA 1X42A 1Z4QA 4UATA 4Y2TA 1QYIA 2FPWA 3ESRA 4OCZA 2AH5A 3W5DA 1LVHA 2HSZA 3BWVA 3N28A 3J7TA 4Y2RA 4CE6A 2WF7A 4C4TA 3DV9A 5ALUA 4Y2SA 5ALLA 3A1CA 3L8GA 3WGUA 1Z4NA 1RC8A 1RLTA 3D6JA 3FGOA 3IRUA 5AESA 1XPJA 2YMLA 2JAWA 3QU7A 4ZEVA 1CQZA 3QU4A 1RMQA 3MMZA 5ALSA 5AM5A 5AW8A 4Y2QA 4UW9A 2QYHA 3OCXA 2FEAA 2HEGA 3I76A 3N1UA 5AKHA 3WKBA 4E88A 2HCFA 5AHXA 1EK1A 2YJ3A 4MWOA 3R9KA 3WK5A 2ZG6A 3OCVA 2O9JA 2NO4A 1J97A 5AKIA 4OHFA 1O08A 4C4RA 4ZEXA 4G9BA 3ZTYA 4HGQA 4BEWA 1XVIA 3QU9A 3A1DA 3L0YA 4DFDA 3UMGA 3OCYA 1YJ5A 4KNWA 2B1RA 1ZD5A 3OPXA 3PCTA 5AW4A 2JAUA 4AS2A 3SKYA 4L57A 2C4NA 3WK4A 2IA5A 3IB6A 3R09A 2IOFK 2I7DA 3N8GA 1VJRA 3ZVNA 3I1YA 2PKEA 2WF9A 3U7FB 5ALJA 5AW3A 4GXTA 2BDUA 4YIHA 5A3SA 2RBKA 1IWOA 2MSNA 3SF0A 5ALHA 2AMYA 3CNHA 1L7PA 2B30A 3U13A 4KYTA 3CZ4A 1VJ5A 2CFTA 4UAUA 2PR7A 2OM6A 1ZS9A 5AW7A 4EEKA 4UASA 3FPSA 1N9KA 4KX3A 5AI0A 4HGOA 2DQSA 1NNLA 4Y2XA 3A3YA 5AM3A 1Z4KA 3AR7A 3E81A 4BNDA 2FUCA 1RQLA 1WPGA 3QGMA 2VKQA 1RLOA 5ALYA 3I6BA 3EPRA 2HHLA 3ESQA 1L6RA 2WF6A 5AVRA 5AW0A 1RKQA 2WF8A 4Y2PA 1YMQA 3QU5A 3QUTA 4KX5A 4H1WA 2OYCA 3RF6A 3TLMA 3ZUPA 4GIBA 2WFAA 2ZBGA 3NIWA 4BEVA 4BBJA 5AI4A 3DDHA 4RESA 2AUTA 1VFPA 3SKXA 5AKZA 4YH1A 3MN1A 3UM9A 2FPUA 2Q4TA 4CF5A 1RKVA 1RMTA 1J8DA 1ZD2P 5A3QA 5AVTA 4XPZA 4AP9A 2YJ6A 4I9GA 3QXGA 5AK5A 2I33A 3L8FA 1Z4OA 2C9MA 4CF4A 3IJ5A 3EF0A 1Z88A 2B82A 3OCZA 4UU0A 1XP5A 3QNMA 1L8OA 2O2XA 3E84A 3NRJA 2HX1A 4ZEWA 2WF5A 3P96A 4CNQA 2P69A 3S6JA 2EAUA 5IS2A 1T5TA 1RQNA 4JDPA 2G09A 3VAYA 3GYGA 2FUEA 2IYEA 1T9ZA 4IFTA 4HYTA 3ONNA 4HGNA 3QU2A 2BY4A 4XE5A 5AICA 1Z4LA 2GHTA 5T41A 2ZBDA 3ZI4A 2R8XA 3ED5A 1ZOLA 5ALKA 5ALMA 2B0CA 4I9FA 4NV0A 5ALPA 2G1AA 4G63A 5ALZA 2B8JA 4BX0A 3EWIA 2ZBEA 4UMEA 2I55A 3WK8A 3ET4A 2B1QA 2RARA 4EZEA 5AKXA 4DCCA 1WZCA 1KYTA 2B8EA 5ALDA 4Y3UA 3PDWA 4UMDA 3B9RA 5AVXA 4YCLA 2FPSA 2W4MA 1N8NA 4JB3A 1TE2A 5ALOA 1RKUA 1ZJJA 5AM1A 2EATA 3QUQA 3MPOA 5ALEA 5ALQA 3PGLA 3QUBA 4UARA 2R8ZA 2YFYA 3AR2A 5IT0A 3E8MA 1YV9A 2MU1A 2G08A 3N07A 3SHQA
chains in the Genus database with same CATH superfamily
1O8CA 1WA5A 1XQXA 1YQGA 4MKFA 4QHYA 2QUKA 2PBFA 5AK3A 2W8BA 1XEWX 2X6TA 2ZAIA 1YZGA 3AO0B 4KE6A 5IAGA 3FNRA 4OI1A 2CSXA 4FXPA 1V6AA 1FY2A 5DNEA 4JYBA 2KHZA 2WB2A 3CZMA 1KKUA 3OTQA 3RTEA 4PG8A 1NUAA 2NYUA 2XNKA 2YCBA 1FQOA 1WXXA 1DZIA 3VZCA 4ALIA 2NUBA 2ZT8A 4RABA 2HA4A 2RGWA 4RA6B 3MJRA 4LCEA 3V8MA 2RB5A 2YHAA 1T5OA 5K8CA 4L2IB 5EMMA 4KE7A 3M4NA 1HT1E 1JSCA 3FPHA 3KQMA 5K0EA 4ARUA 4Q48A 1WULS 1Z29A 5AW9A 1Q1EA 1WMEA 3PL1A 3ESYA 3GROA 3OICA 4JB8A 1RLIA 2ZIZA 1G7RA 3ZEIA 3G59A 1EA7A 1NXOA 2XEDA 1L5HA 5BN3B 2CEAA 3BXPA 4H1HA 3F9IA 4EI9A 4E6PA 4FYXA 2R4QA 4N5NA 1WXEA 3WLFA 4TROA 1JXAA 4B8YA 1M2OB 3PZRA 3QLUA 3PITA 4A3SA 1E0AA 1IPHA 3DE7X 1AV6A 2VNAA 3CNOA 1Z5OA 1E2KA 4MV1A 4A6DA 1VBFA 4DLRA 1JHXA 1U9CA 1XQVA 2BMEA 3D1VA 3X2SA 3ELYA 4LMPA 1WXQA 1FPMA 3DEAA 3BERA 1S89A 1ZIYA 1GRNA 3L6OO 4IQ8A 4IICA 2FX3A 2PBRA 3DQZA 3IHKA 3W3AA 3ER8A 3HYRA 4HMPA 5DHSA 2ZJ4A 5JRDS 3U9SA 3WGJA 2IPLA 4QGSA 1C7ZA 3AEUA 4KN9S 4M1SA 2O1WA 4AWAA 2VHJA 4ND4A 2FDRA 2PWAA 3OLXA 4MPRA 3V2HA 1BHSA 1JDVA 3BS4A 4PR0A 2V7UA 1WX1A 1XDSA 5LP6A 1BN7A 1ESNA 1QB8A 2CUKA 4HAYA 4O4IA 4KWIA 4BP3A 3EXAA 4Y6SA 3SYMA 4MCHA 4EVSA 4ZIRA 2ZYAA 3KQPA 1Z0JA 5C3UA 4URWR 4W63A 3I39X 1RHMA 3WFJA 1XO1A 2RHJA 3K72B 1WUKS 3ZJYA 3GK3A 3N05A 4BCBA 4H9GA 5CCBA 1NUHA 5IXJA 1NJ1A 1U4SA 4FT4A 2VPIA 1BC5A 1J0EA 2P9JA 4M76B 2C5GA 3T9FA 3AL2A 5HIKA 1T2VA 1WG8A 2GEUA 1BMQA 1V8OA 4FZ5A 4GX1A 3SLGA 5JD5A 3AY6A 4YEDA 4EG4A 3EBLA 3UT0A 1VKNA 3I9V1 3NO4A 4N76A 1KYQA 1O1YA 4BMSA 3V8QA 2FRVA 3RRYA 3I1FA 3NIDB 3AXTA 4LSWA 1VG1A 2G1PA 1LSJA 5EKUA 4NNJA 3IP1A 1QFJA 3ZZ1A 2W6OA 3F46A 1HZZA 4DDWA 1ES9A 2VYNA 1AK1A 1N2HA 1ZXBA 1RRVA 3NBAA 4JLOA 1V1JA 4NYMR 1QV7A 4URUR 3G68A 1HUQA 1Z6QA 4G6ZA 3NNDA 5C80A 1NW5A 3BKWA 4YAGA 3DDSA 2X2EA 3A25A 1HKUA 3RASA 3TD9A 1ONOA 1EFAA 1EK6A 3KTFA 3URMA 2GR9A 4PFSA 3RJ5A 4UPVA 4J1SA 2E49A 1UDXA 1F0YA 2YV2A 4NXMB 1M83A 4F5EA 4YCNA 5I01A 4O8CA 5SZKB 4B73A 4HN9A 5KNBH 1ZOIA 3KT8A 4AKGA 1KOFA 5AW5A 3GVHA 4KQ2A 2HRZA 3OUTA 4DRZA 2QX9A 1H8ED 3UMCA 1GFZA 2VT6A 3JPWA 4IOMA 3N2LA 3U81A 4BN5A 3VPDA 3EVGA 5B6IA 1DTWB 1P19A 1APBA 3HLYA 1LLFA 5IAJA 3PR1A 2GCOB 2O2HA 2WWRA 3PJDA 3ZHUA 1BH6A 4QUGA 2VJMB 5B1EA 2C88A 4CIAA 1I6WA 3K9GA 4N5DA 4FBGA 4PZYA 2Q9BA 3BXGA 4DWOA 1YDEA 3GLVA 4CCYB 5C46F 1DPFA 2FX5A 4AD8A 2GN6A 5KNBD 3I4FA 4DLAA 1I2AA 3G5MA 4R2LA 5AQ1A 3KXPA 4ERXA 3IJRA 2W70A 1CVRA 2C3UA 2WWFA 4AZ0B 4ZCLA 1YUMA 4KXQA 5IJWA 4JEHA 4KH1A 4C43A 4O33A 1GXSA 1GUZA 3HSSA 3K5IA 1P62B 5COAA 3ANNA 3W3AH 5A9RA 3GJXC 5ICMA 4PZLA 3G17A 2OHIA 4Z3DA 3ZZNA 4DR2B 1EX6A 2F17A 1PVDA 5E9QA 4W6ZA 1E5QA 1RQXA 2HDOA 1PBNA 3R6GA 3BORA 2ZYGA 1GCUA 4BJ6A 1EKXA 1EE9A 1F0NA 4H1VA 4J8PA 1VZ3A 3T4EA 2UYCA 1Z5GA 3SP1A 3ROPA 1V4BA 1NBAA 1HZZC 1DJMA 1KFCB 4PNHA 2H1WA 1RWVA 2E2WA 3A4YA 1XAJA 2AUNA 2P1DA 2I8LA 3EW7A 4GD3Q 2NU9B 3UJ9A 2FPXA 3E5RA 5FFMA 3AF6A 1X9HA 4BX3A 2EHJA 4NICA 1C3OB 3EE6A 5JS1A 2Q5EA 4X60A 2FJ0A 1DIGA 2IEBA 4NMWA 3T52A 2VHZA 3NRBA 5CG2A 1NM5A 3K35A 1JAXA 4IV0A 1KBOA 1CUBA 3TI7A 4DR1B 3BQ9A 2JI7A 5IJ0B 4YJHB 4KV9A 3COWA 2QRNA 1BHJA 1SBCA 2R8EA 3STTA 5IBPA 3AHEA 1US8B 1OFIA 4R40A 1ZPDA 4N8SA 4CKCB 4D3FA 3NTRA 3TLYA 1FDWA 3QBEA 5JO9A 5AKLA 3TZHA 1JU4A 1Q50A 3ZCXA 3CBGA 2V6FA 3LQRA 3ZV7A 2FFQA 2YOFA 3SEZA 1NUQA 2QL5A 2V7GA 2VUTA 2QPAA 4Q4AB 4V0OA 3PNOA 2OZPA 3JZIA 2J6IA 1NMZA 5BQPA 2R6JA 4E08A 1ORDA 1MQSA 1TZBA 3MS2A 3H5NA 1PS0A 3Q2OA 4H31A 1Z4QA 4HHEA 5D85A 2J33A 4FI3F 3SN6A 5KTTA 4BU0A 3ISJA 4MHTA 1ZUNA 2F64A 1DAFA 1BFDA 3G0IA 3HI4A 5JPIA 1BKDR 1ZUHA 3EC7A 3OAAD 4MUBA 4OKSA 1SUCA 4FX2A 4FSXA 4RHXA 1PNVA 3CCCA 3WVNA 2XOEA 3EDQA 4B33A 3E15A 1OTHA 3PXGA 1IHXA 2M6SA 3NVAA 1PVOA 1BU8A 4Q9KA 4JJEA 3U5ZB 3TH5A 1Z2DA 3A1SA 1NRIA 3PDHA 1SCQA 2KSQA 4B0PA 1I9CA 4FFRA 3PC6A 2ZRJA 1C9NA 3TCXB 1JJBA 2B61A 1DG3A 3QHQA 1U1FA 1UMBB 4EOGA 1AQNA 4QLOA 4YP6A 4MRSA 1SBIA 1XE3A 3IOYA 5K3CA 3ZE1B 2WIJA 2LKDA 5ITSA 3TKLA 2JFHA 5J2TB 4PPQA 1M1NA 4KKVA 2Y2VA 4OJMX 4PF1A 1KJZA 5DWDA 3R9KA 3T94A 3DOFA 4J3JA 5H9WA 1EIZA 4UQOA 1KPHA 2Y1LA 2ZJ1A 3ICVA 2CJWB 2IYFA 3I9KA 3R5HA 4MARA 5IP5A 3LGAA 4JKOA 2IZ6A 1NM5C 2V3CC 2O0MA 1WCIA 2G17A 3LP6A 2VRBA 4J2OA 3H97A 4O1MA 2NTEA 3PUVA 4M1QA 1MABB 4YRJA 4GLFA 1ZLYA 1I30A 1V43A 5A3VA 5JXGA 2HCRA 1GCOA 1ORIA 2L19A 1R9MA 1HNWB 4K2HA 5ECGC 5FKJA 4U7DA 2IEAA 3OJCA 4KVGA 5BURA 2J87A 4LMAA 2B1RA 3BE4A 4DA0A 3JWJA 3ZE9A 4G4SO 4REQB 1DZ3A 3C97A 3FCCA 3TBHA 4KPEC 1T3TA 4HR7A 4CNBA 1B41A 2XCSB 5H3CA 1EPUA 4ETNA 4RD3A 1USVA 1YZVA 2DG2A 3EXFA 1K7FB 4G56A 4ZHQB 1TKRA 2ACKA 1V3UA 2Q07A 2Z9DA 1YVUA 3KCNA 3L9WA 4OK6A 4PHHA 4QGFA 4D5EA 3SJUA 4IJ5A 3OLWA 2I7DA 1EDZA 3CWCA 4DPLA 3GLIB 2NU8B 1M2VB 1ULHA 1VLVA 3ZGVA 3WB9A 3QF7A 2JDIA 3N2KA 3H1GA 4HX2A 5AW3A 2GXAA 4A27A 1KJIA 2ZK7A 1KK0A 1EUCA 3ABQB 4Z9XA 1NAIA 1UK6A 1BEUB 4IDHA 4KQGA 1NLZA 2EFJA 1DTSA 5ALHA 1LTKA 2Q2NA 2ZBUA 2J9FA 3AIOA 5KVVA 4GKVA 1CY4A 3I8OA 3EGEA 4HZGA 4J91A 5J2TF 5KYUB 2YDXA 2VAVA 1MR3F 2IOQA 2XQIA 1EX1A 2REQA 2F8LA 4E11A 2QJOA 2B3TA 5JC1A 1KC1A 3QKUA 3RYCA 3QPDA 1W34A 3F97A 2GK7A 4QG3A 5EHQA 3OZDA 1OB5A 3KS9A 4UHFA 4UASA 1F7UA 1UJBA 4MWCA 4MJXA 5DE3A 3TTSA 3WRVA 4ZARA 1A72A 2AG5A 1S2LA 1CE8B 1NXXA 1N2BA 1N8TA 2ZVQX 3A3YA 3KZKA 2EQAA 2D0DA 2EW8A 4DIBA 5AM3A 2ZT6A 1W5FA 3MGAA 4TMTA 2O8CB 2YJNA 3WNCA 2PRYA 4N7RA 1QVAA 1ILWA 2DY1A 4TRJA 4ZAYA 2HQSA 2BGTA 4PQFA 4DNXA 2QS9A 1J25A 4YMWA 2HHLA 2JLQA 4TSRA 4F4IA 1JVNA 3EY9A 2EJWA 5CR9A 3UANA 4TV8B 4Z7JA 4WNCA 4Y9SA 3NORA 1PEKE 1HLDA 2B99A 5JHGB 3HGTA 4ZHQF 2XGJA 4FDLA 3ZDXB 1KZ7B 1T10A 1YL6A 3C3PA 4YAKA 4QVIA 1L4YA 5FR1A 3EEBA 2JG3A 2OV3A 3SJCA 4X20A 1W9MA 4IFBA 3MAAC 4BEVA 1OQAA 4NZOA 5FUBA 5JSYA 3MTBA 4IGAA 1VP9A 1HGXA 4NCJA 2FWRA 5DNYB 1S5PA 2GGSA 4JVMA 3WGNA 4BO3A 4R51A 2PAAA 4I5DA 2WTMA 4K26A 3VFDA 3W5HA 2IH5A 4EUSA 1H85A 2IZ7A 2OFFA 4H4DA 2JJ2D 3F3KA 5DRYA 4GLJA 5C5EA 4ZDIA 1NVBA 1V37A 3G6WA 3D02A 1YRQA 5FWNA 5JSHA 1JFFB 1FSFA 2QVXX 1GPMA 1GQSA 4RL6A 2CYAA 1Q3TA 4BE9A 2A5YB 5L4NA 3CVWA 4KO4S 5ARDA 3E9MA 5IVKA 2AN1A 3AIKA 4E5YA 5HUQA 1QBGA 3TKYA 4YYZA 7YASA 3EF0A 3HHEA 3MRTA 3T35A 5I4CA 2IP1A 4DE5A 3II6X 1ZA1A 3L6RA 4C1BA 3K70C 1C2YA 2GD6A 2HX1A 4JHXA 2O7QA 4LDZA 5FBZA 4EGQA 2MYPA 4H1TA 1A96A 5IULC 3LX6A 3IR5A 2N42A 1CLEA 5FPSA 7AT1A 4PAMA 4M9ZA 2ODQA 4MXDA 1DBQA 1P2DA 3DXFA 1YBFA 4TV8F 4NTZA 5JH7A 3BF8A 1H69A 1KBQA 3GT3A 4MW7A 3U7RA 4BVJA 5K0SA 2AYZA 1Q0UA 4FR0A 4KQEA 1L5LA 4F85A 5F7JA 4X3CA 1Q0PA 4EM6A 3IMCA 3GWZA 5CLHA 4FI3C 4TZTA 3OZTA 3VR0A 4ZFNA 3HXKA 2IH4A 1NJ6A 1QU2A 4F06A 2XWPA 2LNDA 4NV0A 3LFHA 4U7HA 4EWLA 4DWVA 4NAHA 3DJYA 3L8DA 2A0WA 1LDYA 2BH9A 2P67A 1D6JA 4XIFA 1YA4A 2O8VA 1DS6A 2D13A 2XE7A 3FLBA 4MUIA 4PLCA 4B3TB 1HE4A 2A4MA 4PG6A 4XQGA 4B3JA 1H9CA 1GSAA 4O59O 2AK3A 3ADBA 4D9EA 3OY2A 1HDOA 3PUXA 4MV4A 1NVWQ 4R1LA 3I9FA 2YV1A 5TT0A 1ARZA 2VZ0A 3I2HA 3BB1A 3QPWA 2F6RA 2RHDA 4A2CA 3R1IA 2EJVA 6Q21A 1QGAA 2WJWA 3QEKA 3MBOA 4GGOA 1NW7A 3VZSA 4L51A 5BSRA 1K7YA 1JIUA 2ZB7A 1V9SA 4I6JA 2DM6A 2PZKA 1JMKC 3C1AA 1P4AA 2RHRA 3N0WA 5LZ9A 1F6DA 3T7JA 2XQVA 1FL9A 1AO3A 5EIHA 2C4KA 3TW6A 1B2RA 4BZWA 5K0CA 2FMUA 2XNDA 1GTVA 1S7CA 2ST1A 3DQPA 4YREA 2VH1A 3ETGA 4MRVA 4JI6B 1GHTA 3N07A 3VNVA 4G0PA 3BOSA 4DLVA 1U6KA 1FMLA 1Q74A 4KFTA 3HKBB 4RJKA 3TDKA 5JY1A 4KFCA 4N3CA 4WOJA 1ZSVA 1XA0A 5AOAA 2PO5A 1ISJA 1E4OA 2D1SA 4P92A 1DLJA 2D8AA 4IZIA 5LP1A 1AB5A 221PA 3M5DA 2FW0A 3EG9B 3CUWA 1Z47A 2AN9A 3KZVA 3VZPA 3KQNA 3T0FA 1DL5A 4YRNA 1L5SA 3GT4A 3MMXA 2PGAA 4Y1GA 2Q8QA 1R0BA 3UMVA 4MQLA 1NIPA 5FF9A 1A5SB 1Z6TA 2QVYX 1DKQA 3BZBA 3OA2A 1ZK0A 1YDWA 4F97A 1VPLA 2QLFA 4U63A 4QUHA 2D74A 1QO9A 2VJLA 4DCOA 2VJKA 1MAVA 4LFAB 1KMMA 1VSQA 2I1LA 2JIBA 2H2FA 3BJZA 3FDXA 3ULKA 4FUQA 4WZBB 4EELA 1PDWA 2DKNA 1D7AA 3QXJA 5IF9A 5JNVA 3OZVA 1I3NA 3SKVA 4YRAA 3IEMA 3QYFA 1ZGAA 1ZH2A 4BGDA 4YJDA 3KJQA 1I2ZA 2AJTA 3QENA 1NJ2A 1U7PA 1E58A 4ZPJA 3KE8A 4NZ9A 4ZYYA 1JKJA 2OC4A 4YI3A 1VE6A 4H6XA 1VSVA 2NVOA 2Z04A 3RVRA 4X0EA 4CV3A 3O94A 2CFIA 2JF0A 4HVLA 5KNCH 4JOSA 1VSUA 3U39A 3PT9A 4I1YA 4JVLA 2H2HA 3AY0A 4I1VA 4ITVA 2C97A 2WA1A 4O0MA 3LBIA 2SKDA 4EIWA 1VIMA 3QMMA 3T3OA 4LBYA 1K8ZB 4DDMA 1HFKA 4ZO9A 4GNKA 4NCXA 4BLQA 1TI7A 4MDYA 1E9VA 2HADA 4R9SA 4LNUB 4LZWA 2G77B 4IIEA 4MTLA 4F8YA 3B3AA 3HWX1 4RLSA 1ISFA 3FPCA 2BEWA 2W7TA 2CBGA 4FHZA 5AI6A 2EC5A 1OYYA 3UT5B 5KNCD 1V8PA 1WP4A 4RVSA 3TOZA 2KX7A 1OXVA 4CQMB 2Z9CA 2HT1A 3B52X 1RC0A 3H04A 2Z5VA 4UM9D 5BVGB 3TEMA 3RBXA 4IIDA 2YMMA 3JAKA 2PSEA 4W1SA 4YAUA 4R8MA 3U7EB 4UPEA 1FNSA 5HJ7A 3BGSA 4QEKA 2A9PA 2CF6A 1FMCA 2IQ5A 3AETA 1JBKA 1EWVA 3K0FB 4Y7DA 3TM5A 4D8YA 2FMFA 2GYUA 4J6EA 2DECA 1DIBA 4OP3A 4QPDA 2ECKA 4YAWA 3HXOA 3I62A 4AY3A 1O54A 3EVEA 1RJGA 1MJGA 1TOAA 1U0GA 1BZYA 4S0XA 1QOPB 3B78A 3FPBA 1IJBA 1YHNA 2D7DA 4X92A 1XP8A 3PL5A 2JFFA 1KDZA 1W4ZA 3H7IA 3D3JA 4TKVA 1ISGA 1KC3A 2F7SA 5H4GA 2VK1A 3FJYA 3PQ2A 4EA9A 5T67A 3DWEX 3RFCA 1H65A 3SF8B 2Z43A 3HEBA 1F8FA 3L7LA 4RK4A 1QOQB 4G0VA 4FDAA 1ZKMA 2ZZNA 3Q8WA 4EHFA 3W5AA 1IOVA 1VA4A 4C0SA 1XTJA 2D5IA 2D54A 7REQB 2P3QA 4RFSA 3HBJA 2QGFA 4KO1S 4BNHA 1ADBA 5JCOC 1D7OA 4G0QA 5GGXA 1W1IA 1SXIA 1IIBA 2Y92A 2PMWB 3EARA 4FEGA 4J7CA 5CVEA 4CG2A 3AI2A 2A84A 3JQ9A 2W2LD 3O4VA 1VSTA 4FMDB 2B98A 5B1DA 3BRSA 4EGAA 5AYVA 2VXYA 4R31A 5GM1A 3KVOA 4MW9A 4AIRA 3S8EA 4ZT4A 1FX0B 1OXXK 3LPNA 4L8VA 1LLUA 1S3GA 1QFYA 4RPGA 5HJ2A 3TR0A 4AZ3B 3IIEA 3NAMA 4BRSA 4X1IB 4KQHA 1NWHA 4TTSA 1XEAA 2AEMA 1TIPA 2ZB3A 5JCPA 2QN3A 1P0CA 5CB6A 4D9CA 2OLJA 3N8HA 1NQXA 4JYPA 3DXZA 2PS9A 3DLPX 3PQ4A 1FFEA 1R6DA 1ORTA 3NFRA 1E2PA 3A3PA 3H65A 3HR8A 3L5KA 3LCCA 4I81A 1WF3A 3A31A 3OOJA 4IMIB 1F2TB 4EEXA 1YAJA 1HG1A 2OFWA 5L8VA 1RRCA 3WKDA 3CLUC 4P86A 3T54A 4NBTA 2ETVA 3U7JA 2R79A 2V9CA 2QTWB 3NJ8A 2QL6A 2VATA 1E6WA 2Y9MB 1W1UA 4MUXA 3E3MA 4XXHA 1Z8DA 5LU8A 5JY6A 3LX5A 3PXDA 1G1MA 4ZOLA 3GRZA 1OLSB 2EZTA 1QG4A 3G1UA 2FW6A 1JHMA 3I61A 3KYCB 3JTEA 1JDBC 3QPAA 4EYEA 3PHLA 1AF4A 2Y68A 1HM5A 1V95A 5CLQA 4LHXA 2C8KA 4FOPA 1EUZA 5DK4A 2C2YA 4ENVA 2PX8A 3DTVB 2I54A 1Y1PA 1B8UA 1XXHB 2K4MA 2PX2A 1ONPA 2ZKIA 4FMBB 5H68A 4PYMA 3E0XA 3T12A 1C3XA 4DANA 4YRZA 2XKBA 4MQ4A 2HTEA 4ATNA 5K0FA 1FS4A 5EE0A 1NOKA 2IXFA 1T9GR 2OBFA 2IYSA 1N2CA 4DC1A 3E9DA 2E85A 4ZGGA 3T4UA 2WB4A 3MTAA 4FMDF 3AJ9A 1M2FA 3UAZA 1IXYA 3MXOA 4W7SA 5EFOA 3JSXA 1HDEA 4LYJA 3IERA 4ZZIA 1ZIXA 4M38A 4TYMA 2VHVA 4ZTZB 2JBAB 2WUFA 3JQ9C 4G3XA 1NXQA 4E14A 3R5KA 1S3SA 3DZ8A 1CF9A 3OIYA 1N7JA 2JAOA 3MTEA 4OJNA 4OIFA 3VOSA 2QN1A 2M6RA 3WIUA 1XAGA 4YN3A 4CJXA 1NR1A 1WUJS 4QX6A 3A3NA 3R7DA 2Q2WA 1LBHA 3GG2A 4YACA 3CNLA 1SQGA 2HO4A 4XDZA 1JFLA 1VJDA 3HP7A 4FKZA 4RZIA 2NZWA 2QUJA 5EWMA 2FA9A 2ZBPA 4Q12A 2HF7A 1CZHA 2QJFA 3T0GA 1H3NA 3BL5A 4PSDA 1KSGA 4ZYLA 1V3QE 4D8TA 2FJPA 1G5FA 1P3DA 4JUIA 2GYVA 4R8RA 2QB5A 3AERB 3W0LB 5HZMA 2JGRA 3NBMA 4KI7A 4YFYA 1QYIA 3HVHA 4NC9A 4C14A 1QB7A 2FPWA 2DUUA 2ZRDA 3T9CA 1T13A 4MDHA 1MCZA 1VKRA 3T7TA 1QRUA 1H66A 4H59A 1CKEA 2ZIVB 1GGNA 1ZA2A 2X8JB 3LHDA 4O4JB 4KR2A 4TYWA 2M1XA 4JI1B 4O4HB 4QSMA 5FWXA 3ZGLA 1J2EA 2O7SA 2O0LA 3ISVA 3HY6A 3UFBA 1ZMXA 2OORA 4F6LA 1ZAKA 2WIAA 4QQ8A 3EOBI 3IQHX 4LECA 3OQ6A 3RKSA 3TSOA 1SXHA 1YOVB 4HNHA 1X80A 1BDIA 3WLRA 5CDSA 1M34E 2RG7A 3DPSA 3ORSA 3G5UA 5BV2P 5AJVB 4UNIA 3NONA 1Q83A 3CW8X 4LC0A 3H8VA 1EM8A 2CXPA 3CQ9A 4OLHA 3BMXA 4QL3A 5HCNA 4B4UA 1T1JA 5ES3A 3OCXA 2XY4A 1FRNA 2FEAA 2OHFA 3N1UA 5FNVA 1KK2A 4E7PA 1U8ZA 3MWDA 4UEKA 3V4OA 3THXB 3S2SA 2GJ9A 2Q3LA 3WL8A 1TZMA 3OCVA 1O94A 1ZINA 5AWFC 5A5DA 3TQCA 2C4MA 3CWQA 4LBZA 5K3FA 1UPCA 4L5CA 1XRLA 1XQYA 4YRFA 5DP1A 5E6SA 4HH4A 4LVUA 4KPFC 2ONKA 5BVHA 4QUIA 2IY7A 2K7ZA 1BG6A 1H9AA 1PT5A 1T1RA 3BMOA 3EBPA 1MDBA 3U4IA 4G9BA 3ZTYA 5KMGB 4ZMSA 5DN6D 3L0YA 4K6CA 3QKTA 1L1QA 1Z18A 2QGNA 5FUMA 4BTLA 5GY7A 1NKTA 2HA5A 4R7GA 2QSYA 2R7NA 5F7XA 4RJIA 2O23A 4IIVA 3UPTA 1A98A 2CXXA 1CEXA 3E7FA 2VZLA 2O6HA 3X1XA 1TEVA 1BE6A 3ZCPA 3S2FA 1LW7A 3K31A 3WQHA 3E5HA 4DB4A 2OXIA 4IGFA 2ZBVA 4O4JF 3EWSA 4TTAA 1GCGA 4OV6B 1A9YA 2ADFA 3ZQ4A 1EVLA 3GDWA 2JCGA 4G5HA 3DLTA 2AJCA 3W9YA 3WFZA 3A9CA 2AA3A 4BATA 4ZCMA 4DR5B 1EEXB 1UZMA 3BRWD 2QAJA 3NXKA 4WK2B 3RU3A 3VUEA 5IKMA 3RSQA 5A3SA 3LLSA 2PKWA 3CLSC 5C5DA 3QNWA 1WNFA 5D6OA 3IR7A 3T7CA 3BFKA 3W6UA 1JXQA 2QUAA 3MS7A 1W4CA 4UNNA 3WLSA 4WA7A 4AYWA 3U4QA 3IAEA 3CNHA 1Z36A 4L85A 4COOA 5BRJA 5LMZA 3L0ZA 4RMJA 4BFUA 1YS7A 1G4UR 3VU3A 5D5QA 2RG1A 2WYHA 1L5MA 2O5EA 2GPJA 3VMFA 4UM8B 4ED9A 1IQUA 3BWDD 4UREA 2CFTA 4BLPA 4XGNA 3PNKA 3QRWA 3JQ8A 4G86A 1GGVA 1BCRB 3Q7IA 3VPSA 1MT0A 3CUSA 2Q1TA 2GF2A 3N0VA 1CSEE 1URPA 4P53A 1XVLA 4AQ7A 3FIJA 4RF4A 1PUJA 1IRXA 2WSSD 4DG5A 4BV8A 2AZDA 4LA4A 4PY2A 3LY9A 2C9CA 4KODA 2EWWA 4L4ZA 1X1EA 2CFOA 5KC9A 1R9JA 1O94C 2I2CA 2VI5A 3ENVA 4OHMA 4WCVA 1L4MA 2IEIA 3RWBA 4C0KA 2IYOA 4YP5A 4ODIA 5LLSA 4MVWA 4K9OA 2Y1DA 3MYRA 2I2XB 4NYIQ 4PCVA 3EPRA 1K8QA 3JYHA 4WK6A 1UT6A 4YONB 2OXEA 3ESCA 4ZEOA 1ZNYA 3TAHA 3TQRA 4A1FA 2FWJA 2WTXA 4CUZA 2X1MA 4OEHA 1U8EA 2X0RA 4H3KB 4EEZA 1YJCA 4KX5A 5C32A 1JEYB 3CX4A 5DP2A 3MJDA 2D00A 3RIMA 4WFKA 2OOKA 1PRYA 1T5HX 5GQSA 5CH3A 4PRZA 3DR5A 4FN4A 4J0KA 4FYIA 2X0FA 3WR5A 3WYFA 2H63A 3SZRA 2ZDHA 1NNEA 4RVUA 2ZUEA 3H9BA 3JZDA 3VR3A 1FFSA 2W6JD 5G02A 1GV0A 3I9V6 3N53A 3RUEA 1XNQB 2NTYC 3LRPA 5KWEA 4YJ3A 1F51E 2YWHA 3AL3A 5HG0A 3SSMA 2WJ4A 2AUTA 1ZJYA 1U2QA 2NV2B 1P2BA 3C7AA 3MN1A 4EVQA 1U80A 1RFLA 1P4HA 1RKVA 4FFPA 2DRIA 2QTNA 4MUJA 2WTNA 3G2NA 4X8HA 1YZKA 1E2DA 1O0CA 5J40A 5JFTA 4MB0A 2Q5LA 4MWDA 1ODTC 4PX5A 4QSHA 1D5CA 1VI5A 1NTRA 4LPKA 4N01A 3BEDA 2B0JA 1KQGA 3HYSA 3IJ5A 4D56A 4UTOA 3CKKA 1K0UA 2EERA 3CU5A 1MTOA 3DB1A 1F60A 5EWJB 1D1QA 3N7UA 1KY3A 4FFWA 3R7LA 5B1YA 3WB0A 2GM3A 3V1MA 2BGKA 2VT2A 5IS2A 1HFWA 1T5TA 1V5WA 1YT5A 3HVJA 3C4QA 2VQEB 1LI7A 3FHLA 5JPDA 2XCQA 1U3FA 4EVIA 2PWZA 3JR3A 2JI6A 1WUIS 2E5LB 2GEFA 5DSTA 3FWZA 3PUZA 3RYHA 3QU2A 5AQEA 1AE1A 4LI0A 3FI0A 2XDWA 4YJFB 3WLOA 1VL6A 3G2KA 2K6GA 1R5BA 2D8MA 4R6WA 3V00A 4YBZA 5E6UB 4URYR 1T4DA 3OQJA 3ZGXA 1LPMA 2KS6A 2ZRCA 3GV0A 4A91A 5ALMA 1P2GA 4ZC1A 2W93A 3EX7C 4KNYA 2A0UA 4K6HA 5CDGA 3JYPA 4LQLA 1AGNA 1N2OA 4HFMA 3KAPA 4G63A 3JASA 1XZKA 3FOBA 4A5SA 5JS6A 1CY8A 4A0FA 2QMZA 1T4BA 3QHPA 1D07A 5D87A 5TQJA 3K0AB 3UHPA 4OP2A 4PO8A 3LDUA 3RAPR 1WBJB 3WK8A 1T9DA 4M88A 2YBEA 1LC3A 2TSYB 3DWFA 2WSIA 1OC2A 4QIHA 3GLFB 1TYDE 2ZRMA 1YZTA 3KFXA 1PSWA 2NXEA 1F9EA 4MYHA 5FWYB 4R1QA 5J5AA 3N6VA 4ZT6A 5J43A 5KYTA 4PRYA 3TFOA 2GBIA 3M81A 5AP9A 2OAP1 1ZGHA 3KZMA 5H4HA 2E37A 4BUZA 3UV7A 4M0PA 3CUYA 5I7AA 3DCIA 1TM5E 1JHOA 3OLVA 5AVXA 4MS1A 4M9RA 4L9AA 4NVRA 4CL8A 1F0PA 1KVUA 3F96A 4XKJA 4BKQA 2FPIB 3O82A 5ILGA 4Q03A 2FEXA 3EC2A 1ZEJA 3T6KA 3FYHA 3MPOA 1Z2OX 1CUDA 1MV5A 4K40A 4ENQA 4DT1B 5HZGA 3BTOA 2W42A 1JPNA 3NUGA 4OX9B 4FGZA 3OHPA 2QSUA 1HTTA 2A9KA 5JFGA 3QE2A 2G08A 3P9YA 3UO8B 1A27A 3L6BA 3KVNA 4G9EA 4H15A 2HZBA 4RL4A 1QH1B 2VH5R 2R9VA 4B7XA 3SIRA 1DKOA 3E9CA 1N3LA 4TZ6A 1KEEB 2WSBA 1Z73A 3GYBA 4BN4A 2YWDA 1MNAA 3Q3EA 3G8YA 4BNKA 2Q28A 1YMUA 4DCUA 2G9RA 4R69A 3ZJ4A 1G9TA 5BR4A 1A77A 1UBFA 4IIYA 3MOSA 3FWHA 4LZAA 3OQHA 3GMTA 1M54A 1U5BB 3EXIA 3GD5A 3DE4X 4KJXA 5AKGA 3RKUA 3PYLA 4D02A 2IUFA 5DYTA 3FRJA 1EYZA 1TA0A 3FGNA 5F33A 2CKMA 4H7FA 2YFHA 4DV0B 5HJ5A 5ELXA 2LKCA 2P6UA 4XIIA 5DGIA 4EHBA 4ETWA 3DUFA 4PQEA 3KB2A 5BOSB 3OQOA 3DO8A 3HDQA 4B76A 4L28A 5JVDA 3CONA 3PD7A 4KQMA 2AGVA 1RIIA 1A4XA 1LU9A 2WZQA 4TV9B 1EFKA 2I4LA 4PC3A 1GGEA 1WVIA 3ORRA 3TB6A 3F78A 3ASUA 5LPNA 1L8QA 2R7LA 4NE9A 4S1NA 4OH1A 3UTDA 2B69A 3ZVLA 3AR3A 4W5JA 2QROA 5CA1A 5G4LA 3SC3A 5LZ4A 2GM4A 2PSHA 1WUTA 1GU1A 2FMHA 1GKKA 3OJOA 4JAVC 2JLWA 5HQ3B 2GOYA 3N2NA 4I5GA 1YUBA 1S2NA 4R2WA 3BH7A 2DPLA 2HWKA 1E1KA 3P2EA 1FUIA 1VCIA 4DR7B 2WAAA 4D26A 4EPVA 4P32A 4WIAA 2O2DA 1L8AA 4A0SA 1H3FA 2Z1MA 1P8AA 2HIMA 4GE3A 4MYTA 2VTBB 3CCFA 4E70A 2Z6AA 4X7BA 2HK8A 1GAEO 4GX0A 5JQGA 1CJBA 1X7HA 3M89A 1M2NA 5EJEA 3T95A 4PG7A 1TT5A 4IUBS 1SG0A 1DIRA 1N2JA 2O7VA 3LH5A 2A59A 1GUAA 2DFVA 3INTA 3ZD7A 1PZNA 4MMXB 3VHQA 4D0SA 1JSRA 1ZP6A 3I6MA 3L82B 4O2BA 4YGYA 3CVVA 3GA5A 1OX5A 3D6AA 4BFYA 1B6SA 2GLTA 3MT0A 5BWLA 4G9GA 1FP7A 3GWGA 2ZJ3A 4I4TB 3JD2A 2C8LA 1RLMA 3RDPA 2HA3A 5A4JA 3U19A 1ZK4A 2BT4A 4M1WA 4NDAA 4FSDA 4I4IA 2BMWA 1IN4A 1EJ6A 2BKXA 5F7ZA 4MVJM 2X76A 3WGZA 3DO5A 1L3BA 5TARA 1QMGA 2MJLA 1DG9A 4OTZA 4L5BA 1MVOA 1Z08A 3LQ4A 4IHJA 3OFNA 3T3EA 4DLTA 3TI9A 1QQ5A 4DYVA 2APJA 2XRFA 2FUG1 5CB4B 3U09A 5C4MA 4KBYA 2R00A 3Q0EA 3JVDA 2ZJ7A 4OFZA 5FPHA 5AVSA 3OLYA 3TLEA 4DR4B 4C3ZA 5CFMA 3QLVA 1TM3E 4MRNA 1B1CA 1YB7A 2H11A 4UNQA 5F3WB 2B2XA 4Q3EA 1VIYA 4BNGA 4NFYA 3BUSA 4DQUA 1DV2A 5IX8A 2N47A 2ZTSA 1I2MA 4U2BA 1MO2A 2ZGVA 3F8TA 1ZZGA 3B9BA 4FFNA 2VDWA 2EBFX 5ITWA 3C5CA 2V7XA 3GLIE 1FS6A 1UBTS 1L6IA 4GEGA 2BAGA 1HH4A 5E3JA 4UPDA 5EIWA 2XDYA 1ZRNA 3GAFA 1QJ4A 1WQ4A 4GZLA 4RTKA 3NUZA 3KL2A 4A23A 1L4NA 1Z4MA 3DKPA 3BRCA 3R24A 3V97A 4BO9A 1UAAA 4OK3A 3RT9A 1EFPA 2XLBA 1GKLA 2KE5A 2QI9F 2C78A 3I2IA 1VI6A 2H4XA 3E1SA 4QPJC 3STUA 4EQ6B 4HY3A 1OTYA 3G0OA 3HPQA 3P9QA 4RHTA 2AW3A 3UC9A 4AO7A 5AM0A 4EHHA 3SZLA 4X00A 4BMYA 1UDAA 3RRBA 5F2NA 2G07A 4LCJA 3PNBA 3FTCA 4I4TF 1MEOA 2GZMA 1KL7A 2JLCA 2VLBA 2PU7A 4AFNA 1FLDA 1C0KA 2QZSA 3LMKA 1M7BA 4DCJA 2AN5A 1HC7A 1F5SA 4LYFA 4PC6A 4IX9A 3V8VA 5CFZA 2RIPA 2FFAA 1IZ0A 1ZO8A 3BDAA 3Q7SA 4G41A 2A1IA 5AVUA 2GCEA 5CB4F 3IIKA 5JYCA 2B25A 1WSDA 4JLSA 1I2DA 1L4BA 2AFRA 2CNWD 1TZCA 2YY7A 4Z1MA 3RS4A 1J09A 4QOIA 3CURA 4R98A 4PGHA 4PYRA 4OYYA 3N0XA 5EI5A 1RZRA 1TAQA 1AHIA 2OBNA 4MS4B 1HEYA 5CH8A 4EKGA 3N5KA 2R00C 3H1PA 4RIIA 2OV8A 2JEOA 4M8IA 4O4LA 1KKMA 2ZPTX 2ICAA 4TKMA 5ARCA 4RTQA 5E8RA 4B81A 4BNJA 1YJXA 4H27A 2EEZA 3QLVC 3QE9Y 2WJAA 1ADFA 2E4UA 1SKBA 2OBXA 3KSMA 4WLNA 2GI4A 5DVZA 3QEMB 2NYRA 2AB0A 3FSEA 1G3UA 1K06A 3CX7A 2ZAGA 4GSYA 4BXOB 2IW3A 1R4AA 5F35A 3IRVA 3UJDA 3RK1A 2R8RA 4IVQA 4U6SA 3UA4A 4CV2A 1V11B 2FWMX 4P33A 3W90A 3RVDA 3M9LA 1RDFA 1DCKA 2ZUFA 4F7WA 5BW5A 2BFBA 2RDMA 3NPMA 3GAAA 4IYRA 3RC9A 1PJCA 4UDNA 1XTIA 3GVXA 4MRRA 5AKKA 1JNYA 1QO7A 2NZXA 3CLTD 3MK31 4N7MA 2IIPA 2I4NA 3EUFA 4Y2YA 3ZKAA 2XTAA 1NPTO 3ZOKA 2M9MA 3K4QA 1IEWA 1EDBA 3GRPA 1QKIA 4K9QA 4A6EA 4WEQA 5B1HA 2CFSA 1KAQA 1PR5A 4GI2A 5KS2A 4PO1A 4EYQA 4XGRA 1EFDN 2PBZA 4FN5A 1GYRA 1SRRA 3DC7A 1KH3A 1CB7A 1D6SA 1Y42X 3FWNA 2IHUA 2J5BA 4WNAB 1E9CA 1Y5IA 3QA3E 1ZITA 1WY7A 4B40A 1DRWA 4GH5A 3LL4A 4KP7A 5BW4A 3O8NA 4TLDA 2HSZA 1LDEA 5K3EA 3EZNA 1R12A 4P82A 1BD3A 4G1BA 4HN2A 3RVLA 2YQ5A 1M2KA 1UKAA 4FIDA 5DYYA 1OI2A 1YKFA 2GRJA 4GPEA 2MYTA 4H2DA 1K6EA 4MW2A 4EB6B 2OL4A 1MB9A 4MLDA 2EZ8A 1YZNA 1H1TA 1CXZA 3U3MA 2RBGA 3SXUA 3VTKA 2BP7B 1QPGA 2DTXA 1XPJA 2C0PA 2FUNB 3OZEA 1NVFA 1O58A 3M1IA 4N39A 4RPJA 5JS7A 1A04A 3DS8A 1WZNA 3U1BA 2AR7A 3JRNA 2AJ8A 4JH0A 1JWBB 4FDMA 3L8MA 2QD4A 1H0HA 1BS9A 3GJZA 3SX2A 4UQLA 3FD8A 3FUVA 4CL3A 4C0JA 2HCFA 3P7MA 3ZQ6A 4C7BA 3FR7A 4MWOA 3ZWWA 1JDNA 4EFLA 3DYVA 2AXEA 2Q8PA 3WMRA 2XVMA 4FNGA 5EAIA 1NRJB 5AKIA 3C1OA 3S29A 2IYVA 1HF3A 1KJQA 4MPPA 3N59A 4ES6A 2XBMA 4MR7A 3W04A 3RT7A 1KEKA 2P2DA 1XVIA 3SM3A 1V16A 4OXQA 1NY6A 1IC6A 2DQKA 2HSGA 3P9PA 2IV7A 2JK1A 2W6QA 1A4IA 4RPIA 4Q9DA 4GL4A 4JGGA 1FW6A 2XUFA 1KDYA 5AD1A 1QSGA 2DSTA 1Y1RA 3BREA 4D3XA 1U0FA 2WIKA 3LZ6A 1Z7WA 3BZUA 2C2WA 2BEJA 1WIWA 2X77A 4AS2A 5FNZA 1JQAA 1MP0A 4QYIB 4L57A 5E3HA 1RM0A 4M9QA 1Y8QB 3G2QA 2ZM5A 4UDXX 3GI1A 3I2KA 2C59A 4LI3X 2C5LA 3MINB 4TTTS 2SECE 4EHIA 1CQJA 1PL7A 5F4BA 4CCSA 4M1YA 3MD9A 3MSCA 1L5ZA 1UMDB 1VG8A 3DOCA 2IITA 1QLJA 3L07A 2O5CA 4EYGA 4FGWA 4DV7B 4Q47A 1CR4A 2VOJA 1T0BA 2D1TA 2QV7A 3O03A 3TXAA 2XDQA 4PC7A 3BXZA 1DIAA 5IW8A 4CLEA 2ZE5A 2FH5B 2G67A 1FMTA 1P91A 2FPGA 5KNLA 1PU2A 1PT7A 3VNAA 2AHOA 1GEGA 3FW1A 3GJTA 3L7BA 3WFIA 1J39A 1AKMA 1NW6A 4NOJA 1R8SA 3TE6A 1RWOA 4E1VA 3SBDA 4ZGBA 2CEKA 2HREA 4C0AC 3RTGA 3FCUB 1Z07A 1WMSA 1D4ZA 4Z3KA 4YLGA 5IMSA 4HJXA 1XDUA 5IBCA 2YKGA 3VKVA 2HU7A 1G5RA 3R7AA 5I45A 4IOJA 2UYHA 4KXUA 4HGOA 1FXWA 1RXIA 2BI7A 1R6VA 2R25B 3GBPA 5IK2A 4XWWA 4FKBA 4JK3A 1RCUA 3KPVA 1UK7A 4Q02A 3AR7A 3E81A 3CE9A 4QRHA 2E6KA 2Z57A 2FMTA 4P4LA 5F2EA 1K4MA 1ENOA 4Y8VA 3KLOA 4GS5A 3ZN2A 2F3TA 2WJPA 5AOBA 1KJNA 2GFQA 3QV1A 4B82A 1V26A 2Z08A 3VH4A 5I47A 1KI6A 3LBAA 3A4TA 1NVVR 4G5SA 1ZW1A 4I1UA 3W7BA 1QE5A 1B1AA 3JQAB 1STOA 3AW8A 4Y2PA 3JZAA 4C5AA 4COKA 4RTLA 1RPTA 2F55A 3V8BA 4TVKA 3IKTA 3BULA 2JGFA 3PQDA 3ZUPA 4BX9A 4CG0A 2XZOA 4MKZA 5A9SB 2JH3A 3ZGOA 4PN3A 5D3MB 2WPNA 3ZD6A 1AKNA 2WKWA 5HYVA 4KVZA 4QAQA 4EG3A 5TNXA 3CZPA 2XQJA 3ZLTA 1N5JA 3OZFA 4PU0A 5EUQB 3WYCA 1HQYE 3JSAA 7ADHA 2XYRA 4RJTA 2CYCA 4G1VA 1ZM2A 1G8HA 3U2QA 3SKXA 2BONA 3GUYA 4E6EA 2FQ1A 2QW1A 1RQ7A 1FNBA 1HEIA 4C0XA 5LLDA 2OUIA 3RGWS 3V8PA 1SUEA 4R3UC 1ULTA 3UWDA 3NMUF 1JHRA 4KWHA 2MMCA 2J4CA 2L18A 3EASA 3RAFC 3NOXA 1E2EA 1JG6A 1SXJB 3ABSB 3BK1A 4NCNA 1QAMA 1KY2A 2V0CA 3EGDA 4V0RA 3T1YB 2JEZA 3J81A 4C7XA 1Q1QA 1EFCA 5KVQA 1TUBA 1XZLA 4P5DA 3O8LA 1SULA 4AUNA 3TEJA 3ZC3A 1YR9A 2V45A 4Z3OA 5FPQA 1FTYA 1YQUA 5F76A 1AV7A 3O8QB 4L3OA 1YOBA 4X8MA 3EZFA 3MQ4A 5AJUA 5BUQA 3OM9A 3QPBA 2BKVA 1ENPA 1LGYA 3KCQA 3FE2A 2BEVB 4GC9A 4OOFA 1MX1A 1TYZA 2EAUA 4B46A 1FDOA 1MU0A 5FI1B 3HO1A 3CR8A 3T38A 1L5NA 1EP9A 4JDPA 2CDBA 5DT9A 4BB6A 3TNFA 2JFOA 3ZK8A 1QYWA 3K9NA 4TS3A 4U8HA 2FNAA 5CYPA 5T41A 2R2GA 5I7UA 4QLAA 3MCTA 3ASYA 3SFZA 2WY2D 1Z75A 3PXCX 4D46A 3U7IA 3N76A 1E1DA 4EHJA 4UDOA 5SY6A 1ZGBA 3PF8A 3QLTA 2P30A 4KDFA 3MUEA 3H11B 3VR6D 5CAEA 1SK8A 3MBKA 4J7AA 2ZIXB 4LWZA 4RMGA 2REOA 3S70A 3LBFA 3I8SA 3OIWA 4P7JA 4YT5A 1M34A 1I9GA 2B35A 2F43A 3N2GB 5BWNA 2NAPA 5C4IA 1FB5A 1AA6A 2Y0PA 1R6AA 4PX3A 1DJLA 3P2YA 2WABA 5CLGA 3WDMA 4BKUA 5L6MB 4E2ZA 4YTEA 3D6FA 3B13B 1F2VA 1JP7A 2NPFA 4GX5A 1Q0HA 1MIOB 5EYPB 5ALDA 3OF2A 4Y3UA 1QRRA 1CJSA 1RI5A 2D1RA 2F9MA 3IGFA 3LGXA 1JEAA 3PDWA 1WD7A 4KDRA 4U2GA 3ITDA 5EINA 1S0UA 1EGHA 2P68A 4Q7MB 4LK3A 2NVUA 3MEQA 3Q8KA 1HMYA 2FZWA 2H1SA 2DHCA 2FQWA 3BCUA 3CF2A 4IS2A 2ACVA 4QQRA 5EE3A 3DHNA 2EATA 5FL7D 3VPFA 3ZHQA 4DJDC 3FSJX 2WVGA 1F4LA 4U7FA 4CLOA 2AC7A 3H87A 2BBOA 3N5CA 3WNVA 1XXHE 1PR6A 3E22A 3OE7D 2NOAA 2C96A 3MFYA 5LD2C 2GD0A 2DUNA 4WAUA 3KZOA 3QBDA 3H2YA 4F56A 2FR8A 4AJPA 4OAPA 5BR1A 1O95A 3EIHA 4OY3A 5K0GA 1ZM9A 1V3TA 1VYHA 4Q4DA 1W49A 1K6JA 3HCPA 1C7IA 2QM7A 4KN5A 1P33A 4A6PA 2P8JA 2NYVA 4LE2A 3TZBA 4L5AA 4ZI5A 4QDTA 4AICA 1TYCA 1FSSA 3LPMA 3QW4B 2FG7C 3JYOA 5KTSA 3O26A 5CTJA 1QXSA 3LOUA 4B3GA 3OE5A 3PEWA 1G1AA 2RI6A 2O52A 3HJRA 3ROFA 3EWNA 1KTIA 2FE1A 2BUAA 4YRSA 3T3PB 4L3WA 2D2IA 4ZOEA 3RKRA 4OQYA 5HMLA 2MT9A 3ZWOA 3JQEA 2FP4B 3G0CA 3BHMA 3OTHA 4EA8A 4XFJA 2G83A 2XA2A 1SOMA 3PKZA 1ZCZA 4NKRA 5KBYA 3GP8A 2X23A 5H8WA 4CWAA 2FGKA 4D45A 3HB0A 4QPNA 2O8FB 4ID3A 4OBEA 1B6TA 1L9XA 1TRKA 1KZHA 1O7JA 2DE0X 4EATA 4KYIB 2OBMA 1X0XA 4Q1CA 5J4VA 5KQMA 1DX4A 3HUUA 4L3VA 1OFTA 4M8NE 2WM2A 1YE5A 3H0KA 3K9CA 1Q84A 1UBSB 2O59A 1QHHB 2B4RO 2GK4A 4ZO8A 1JVSA 2I7XA 1GQYA 1VE5A 1WVGA 5GMOA 4NR0A 1YCDA 3D3EA 3PLNA 1LBIA 5CDTA 1P61B 1THZA 1EU1A 2YL2A 4PINA 1IK6A 1TADA 5BSWA 2G6BA 2H1VA 2Q3MA 3S55A 3T3DA 3UWOA 4JP1A 3I04M 3CJTA 4EG7A 3CEHA 5K0NA 5KINB 4CMCA 5C2JB 2IEDA 2WHEA 4D92A 3KD3A 2ZULA 2AR9A 3O4IA 4W1RA 3JQPA 5AK4A 3AKZA 1O8BA 5EVJA 2ZI6A 3K09A 3TO5A 1E1NA 3ACCA 1IFXA 3H9EO 4V0SA 2FR8C 3T7EA 1O95C 1KPGA 1PJQA 2W6IA 1AHPA 1ETHA 2NN3C 3OIFA 1SHJA 1XROA 4HX5A 1Q0ZA 3SR3A 3OX4A 4JEIA 1ECJA 1XTPA 4PTYA 1SUDA 5B4UA 5HIMA 2YHSA 1M1ZA 5IZCA 2YHBA 5AXDA 3EPJA 2IWRA 4HUTA 1VPEA 3PF9A 1O4WA 2QTGA 3RABA 4JLPA 4CM7A 4M4SA 5EJ6A 2P9FA 1X2EA 4ASUA 2XUQA 3CKLA 3O7MA 4JOQA 2VJAA 4L4SA 5FBWB 1GL7A 3MTIA 3DBLB 2QDKA 4HZUB 4ALJA 2Q5IA 3MXTA 1J2RA 1TQ8A 3L7AA 1QKKA 4PX2A 2JHAA 3ZJUA 3RNLA 1D2CA 3AEKA 4KAJA 3AONB 3JQCA 4GWGA 3TJZA 1LX7A 2EGUA 3TUZC 3K6KA 4DLSA 1C0EA 1A76A 4HEJA 4G4IA 1CIVA 1VCNA 1KARA 4LY3A 5IDXA 1CYDA 4UOZA 1YACA 1TVCA 2ONCA 2BIFA 1XRNA 2PCJA 2BHNA 2DQZA 3M5PA 3NH9A 3N3AC 1GQ2A 4YP1A 4EO7A 3WAKA 2EYUA 1N0HA 1JHQA 5ALRA 4GPBA 3G2IA 2WILA 4L95C 1Y3BE 2G9ZA 2OENG 2OYRA 4Q01A 1KAHA 1NMSA 4RF5A 2E82A 4KB5A 3DMTA 3R5XA 1ZVKA 4HTFB 3GEMA 5FULA 4ZVNA 2C9ZA 2P9BA 4FVTA 1Y3CE 5KYWA 2QLNA 3HJGA 4IIJA 5TGTA 3PXEA 2GN8A 5KU7A 4FLMA 4EPXA 4GFDA 1CT9A 5JAPA 1JIVA 2OECA 2X8LA 1T3HA 2D7CA 2GJ8A 3SGLA 2KMLA 5LBUA 4ESEA 5GZ3A 5HK8A 2P9YA 2WE8A 4HDMB 2HFKA 4JUFA 4Q93A 3WSTA 1FFGA 1O97C 3ABIA 1XEXB 3OA0A 2AG6A 3U3OA 1NFRA 1FTGA 3FKSA 3K09C 4OM8A 4JSRA 5IC6A 3MMNA 3A7DA 4H77A 3AJRA 4P4NA 3I8XA 2VNKA 3DQQA 4TKLA 5IJAA 4BB0A 2QQ5A 4H6VA 3WIOA 2GCOA 5E1MA 2AV6A 3PIDA 4XCVA 5IZCC 1NNI1 1DC8A 3GBVA 3N2ZB 1E60A 6ADHA 4I55B 3O8OA 1Q2XA 4C20A 4CCAA 1P7YA 5AKYA 1OF1A 4OXYA 3U56A 1DEKA 1Z2CA 3VOTA 4J9VA 3IIMA 3VNBA 2PZJA 4AZ0A 5T6BA 1C8VB 3M5CA 4GICA 4K1XA 2D4HA 3UXHA 5LL6P 2C42A 3KDPA 1OZAA 6GPBA 4YAJA 1XA3A 4LBVA 4B4DA 3GZNB 4XJTA 4XPIA 2GN0A 1ISIA 4FMCF 3ROGA 4GM1A 3W3ZB 4F5ZA 1G5PA 5FLXA 1P4JA 4L0MA 2IV3A 3DT8A 5F9FA 3IUJA 2Q1YA 4P8RA 1YTLA 3WMXA 1F2DA 1L1RA 3BM5A 3DAGA 2C3MA 1FSZA 3K6SB 3LIPA 4ZEMA 1K89A 2AYXA 2GYYA 3PK0A 4GHWA 3TZ6A 3FR8A 3SR0A 4HJRA 2AS0A 4YV0A 2OM2A 3DMTC 5ISMA 1A8SA 3Q3VA 4PFQA 4HQLA 5JBNA 4DUZB 3AVXA 1CYEA 4E07A 3LQKA 1WRBA 4NJEB 3B6MA 1FC0A 4U3JA 2ZQ5A 5JWOA 1ISPA 1VB5A 2WG0A 1RYBA 1VGVA 3W2TA 3A2KA 2Y1WA 4TMZA 3R7WB 2H51A 2X6RA 3Q4GA 3R8FA 5IDVA 5KYYB 2YXPX 2GWRA 4BGIA 1Q44A 1OKKD 2ODTX 3DW3X 1HTBA 2QW8A 3ECSA 1V9CA 2PLFA 4HDKB 3EXEA 3IDFA 4MIYA 4K05A 4XAQA 1LPBB 2I6XA 1WDTA 2C07A 4I55F 3UAXA 4E4RA 4F12A 3ZCVA 1SKYB 1UJMA 4YFVA 3NFYA 3SMVA 4UVIA 3GGDA 4G23A 2N3ZA 4TL7A 2IYZA 2ODAA 1WXDA 3I9OA 4NSNA 4FQ5A 3MGBA 5CVVA 4BAZA 3BQMB 5B4TA 3MOIA 5KYXA 4I8DA 4Y6PA 1NZDA 3H42B 5FI0B 1XUOA 4JROA 3V1LA 4DQKA 5MDHA 3L3BA 2M6KA 3L79A 3VKWA 4DLKA 4YCBA 2B2NA 1C81A 3N28A 2G9UA 1BVYF 4IDDA 2YOHA 5I7EA 1EFVB 3D8UA 1M2WA 1T91A 3T1OA 2C7OA 2DBZA 3KDSE 3Q87B 2FZ4A 3IVCA 1IL0A 1T29A 2VDJA 5ALLA 1RI3A 1ILEA 2F3SA 1FNNA 1LWOA 4X6XA 2XYHA 4ZCSA 2IJGX 3M7IA 3ZVMA 3TGPA 3IRUA 5EJ9A 3L7OA 1UM9A 1EGQA 1II9A 2AZTA 2CZGA 1YDGA 4MYUA 2ZUCA 1LDBA 3QU4A 3KSDO 1MPXA 1OASA 3R9WA 4UW9A 3OQBA 1DWPA 1RHRA 2WWHA 1RI1A 4E88A 3KQSA 2WSLA 4FDTA 1NP6A 3CZCA 2P5UA 2YJ3A 1ZUIA 1WLSA 3PC3A 4Z54A 1NMEA 3KPWA 2JDID 3AK4A 3VYSB 3ZD9A 1P7PA 4ZQIA 4UC0A 5A6SB 1P5JA 5IVDA 2W22A 4CV1A 3Q8MA 1BXGB 4PQRA 1YIOA 4BKPA 1CJUC 1SC6A 2GPAA 5ADWA 4B3SB 4QTTB 1GFSA 3RANA 4P0QB 1C9KA 3AI1A 2GBFA 2HGZA 4OQLA 5E4JA 1R4MB 2DLCX 1EDOA 1AN0A 4JQSA 2B2CA 1L4KA 4IDFA 4JC0A 1EUDB 1WV1A 2NNLD 2RAUA 3RS7A 4CM4B 4JI5B 4BC0A 4BNVA 2IU3A 2PX4A 2ONYA 5AW4A 1YJBA 3O8RA 3FFXA 3HKDB 3AEZA 1Z37A 4RCVA 1SKUA 1BTOA 1NJ8A 1RP1A 4DQXA 5DFAA 3K1AB 1LFDB 3PWKA 3BGWA 4DCMA 4PSAA 1KR2A 5HE9A 4IO1A 4PXAA 2RSLA 2IOFK 1M5TA 4BJ3A 1GG8A 3W8DA 4F93B 1NN0A 1PGOA 1WDLA 3HUTA 4URHA 3GLIA 1E3QA 3MJVA 1TMGE 1DWQA 3DHEA 3L43A 2YWJA 1M2VA 4ZJPA 4WY2A 1J7KA 3OFJA 4BLRA 4GYJA 1GTRA 1Q95A 4B2YA 4I9UA 3KYBA 3ZWCA 2CNNA 4DLPA 1T36A 2XV1A 1IBSA 3E9ZA 4ZT7A 4ZDWA 4EYOA 5B58C 1SVSA 5CIQA 2QX4A 5GADl 2I03A 3OT1B 1UANA 5AOVA 5J4KA 3ZKWA 5BUSA 1DFHA 2XGSA 1U3TA 1G8JA 3DBRB 4BNWA 1LRJA 1ONBA 5EA2A 4RKFA 3ZBUA 1MXFA 4OHXA 4R2MA 3QWIA 2P90A 1RABA 3T7AA 2LZ0A 1RBZA 1L1EA 1D9XA 1U6JA 2QGZA 3CRZA 1OGJA 4KX3A 1KO4A 2C4HA 2CVOA 5AI0A 4CN8A 3QPVA 4RSHA 3GGSA 1KEWA 4Q37A 4P4GA 3TYXA 4U7TB 5IDWA 3HBAA 2MHCA 4YASA 4DSTA 2XRZA 4K6OA 4HVCA 2W58A 2QSJA 3FBWA 4DIOA 3MIIA 1EB8A 3MTJA 5DYIA 4URFA 1A9TA 2A1UB 2OZKA 2LW7A 2OKGA 3NX4A 3AESB 4RHYA 1NI3A 1N7HA 5L3RA 2NSDA 1CEYA 3SQLA 3AUJB 4GSLA 4CM3A 1RXWA 4X1KB 3A1WA 4LXYA 1V96A 4R05A 1SB9A 3WBJA 3V9AA 4AB1A 5J63A 3UT6A 1WWKA 3ROEA 2I6QA 5CURA 3TLMA 2XNHA 3UZUA 1J1ZA 1PFVA 1D9ZA 4P81A 5DO9A 3DL2A 1RKXA 2FLVA 2J67A 1T4CB 2ZBGA 4G81A 1SH7A 4XIGS 3O8BA 3TPFA 4NBRA 3T5TA 5B64A 3PPVA 3VSAA 3MWEB 1KYWA 2ZREA 3JQ7B 3QFRA 4RTPA 2C2GA 2ANCA 4CTJA 3U9LA 4DMHA 1KWGA 2YTZA 2V6IA 3I5YA 3ANXA 1RAFA 4I6EA 5K3SA 2DEUA 5H5JA 1NDHA 2DQ4A 1TEXA 4FEEA 1Y6ZA 4ND8A 1ZM4A 4S1OA 5KQGA 3SC6A 2JFGA 1NBHA 4XH9B 1ITZA 3WLPA 1DKRA 3QW2A 4NESA 4OQZA 2CLSA 4H7EA 3UW3A 4OA8A 2OFPA 4YXFA 1FQJA 2ZTUA 3W9SA 4B4WA 4P38A 4IJ6A 1G59A 1NYLA 2R5NA 3OEWA 4MVJF 2BHRA 1UC5B 4GI7A 1MZVA 4NENB 1R6TA 5JFOA 1WP9A 3PGMA 3KUDA 2HUNA 4BV9A 4LF5B 1KMHA 1EB9A 3FVWA 1BWSA 3E0QA 3NYIA 2MSDB 3KM0A 2YIMA 4N8DA 2VHQA 4QFBA 1LBEA 3F5SA 1BHQ1 2RJNA 4TLCA 2G09A 2G28A 4DC0A 1NXWA 2PMKA 3GUVA 3G7SA 3HU5A 5KWSA 4CTMA 4F1JA 3SDSA 2CCKA 4NS4A 3L46A 4PCLA 4EVRA 1WL8A 3I3SR 2JKVA 5I7HA 3BMCA 2IK8A 3SWWA 3CPEA 5HKBA 3V1NA 3S68A 3VXKA 1NJGA 1P72A 2X42A 3O83A 2BMAA 5JO0A 5FQOA 4OLFA 1SC9A 4R01A 4U7PB 2VAWA 2OQVA 1AG9A 4DDKA 4ENWA 2B3DA 2N75A 5B3KA 4KDEA 3EWIA 3ZR4B 2QZZA 4K3VA 3LUKA 3U44B 3AUKA 4OHYA 1Z2PX 4HYYA 5EMJA 1DXYA 3GGCA 3ET4A 2VDRB 4JU9A 2IUEA 1A69A 2HJVA 2PMFA 2G9NA 4GR4A 2X8AA 2QPTA 3DLIA 3NHLA 4AY5A 1KY5A 4I50F 4OXIA 5ULLA 4D44A 2FUKA 3QH4A 4Z4FA 4BPBA 2GX6A 4MAAA 2RH5A 3L93A 2XMDA 4PZZA 4B09A 4BE7B 4OB6A 1ZONA 2FMXA 5KYKA 5C37A 2EJTA 1R4NA 4JB3A 3OIDA 4EO4A 2VWQA 4Y6LA 3F5MA 4EB3A 3UXEA 2YWXA 1O5OA 3KWJA 1I6LA 1COWD 3U40A 5KTYA 4K46A 1VIDA 2IXDA 3O2SB 4EG5A 5CB0A 3Q3HA 2H1OA 4DZTA 2JFQA 2O54A 5J2UB 4ZKEA 1JG4A 3QIAA 2KM1A 1PJ4A 1UDRA 3LVBA 2G5TA 1QRTA 4LRWA 1GILA 1UP4A 4MNTA 3IBCA 3GELA 3OEEA 2ZIAA 3HN6A 2BFWA 1G7TA 3SHQA 4BVLA 3COYA 1K6IA 3WGVA 1JE0A 3B1XA 1BFUA 2DU8A 3GLUA 4JJKA 3HKBA 3TD6A 2IELA 1JDPA 1K3FA 1UPXA 3B3QA 4ZU1X 5KDLA 1AHNA 4TLBA 3Q0TA 3PLRA 4ZN6A 1ZAYA 2QTVB 1BNCA 3EVTA 3OX3A 3EG9A 5A2GA 2I66A 1VP3A 4XYEA 4PONA 1TYBE 3DGFC 4KNVA 4ZVUA 1T8YA 4A8HA 2FG5A 4DWWA 4JV5B 2R6CA 2J45A 1ETUA 3L8EA 5FTJA 2WAMA 1JMVA 1H2YA 4UVDA 3WSVA 3NETA 2JCSA 1DKLA 1U2PA 3Q98A 4A0GA 2E55A 4NZMA 3VKGA 4F71A 3ADDA 3KJEA 1SFRA 1U2TA 4RZHA 2QJTA 3P9ZA 2VYVA 4E32A 5K4GA 1UKYA 1XTSA 5CG1A 2BISA 2Z5FA 1E3LA 3OPYB 3R74A 1TCCA 4A26A 2PZFA 3ZV4A 1Z0ZA 1UC9A 3C14C 3PA6A 2Q9UA 5T57A 3ZHRA 1TCBA 2WIBA 1C9JA 3KPJA 2Q5QA 1CV2A 4IRUB 1N1EA 2I6FA 3LLMA 4HXEB 4JI2B 1BCSA 4DS3A 4WKGA 4CDRA 1RIFA 4RV4A 5J2UF 1S01A 3VR5A 5FOXA 2E4XA 3HA5A 3JQFC 4WASA 3QMVA 3W8EA 1UADA 1SCUB 3R9XB 2BBTA 1X9GA 3NM4A 2Y0EA 3HA7A 1VE9A 3U4QB 3UHAA 3GRRA 4HQFA 1ZD1A 4PLGA 4RSRA 1W5TA 2F90A 1II8B 4N6GA 1BSVA 3F6RA 1OGYA 13PKA 1UZAA 4JL6A 4XLLA 3I2YX 4GKAA 4WTOA 4XM2A 4OQXA 3TRIA 1KI1A 1NF8A 4NG4A 4U5QA 1W46A 1NVDA 3FDJA 4HK4A 2WINI 2X2PA 3D7LA 3U3KA 2H52A 2BGLA 1QH8B 3W34A 3LF2A 2BGGA 1E7WA 4XQ0A 1PFYA 3NWOA 3GCWA 5SZHB 4AURA 5DXAA 4NZYA 3EGXB 6AT1A 1I6MA 2JLYA 5E1DA 2DWCA 5JAOA 4BP9A 4UVGA 3CZQA 3IMEA 1SU4A 3PNMA 2Y1GA 1KQFA 4FGSA 3GX1A 3LD9A 5EQDA 1XX6A 5FLYA 5DLEA 1OH8A 4O02B 1E5LA 4PV7A 3QWHA 2BC9A 2IPOA 2WTBA 1EBFA 2WU1A 3VNQA 1GPLA 1JIKA 4FZ3A 2PXXA 5FBQB 4KMOA 2H1FA 4HC4A 1A5TA 2Q7XA 1V41E 3ESBA 4MI1A 3KQHA 4RVDA 1JQLB 2XOKD 4DBVO 2Z6VA 3L92A 3MILA 1IQ0A 3KLPX 1YB6A 2AFHB 4UMFA 4NP6A 1G41A 1EG2A 1TUIA 1W4RA 4XWTA 3ZK7A 4PN7A 1SO8A 2XB2A 2QVZX 4HNAB 1P7ZA 4C07A 1Q14A 1NT4A 2RONA 4JCCA 2HF8A 4FT2A 4HD8A 1RRKA 2F67A 4J6FA 4DJFC 2AWOA 4ARCA 3FDZB 2CFRA 3ZE0B 3PDUA 3BZWA 2HV9A 1XF9A 3I2FA 4HQOA 4YDQA 4QGBA 5A06A 1FTNA 1P60A 4AECA 5A5EA 1N6IA 1AIPA 1EVKA 5LFAA 1HYEA 1EUQA 1NUTA 4WN9B 2IIBA 2QBYB 4Z53A 2AOWA 4MQBA 3TZQA 2F2TA 3I9NA 1CUJA 3DVAB 3G85A 2P6PA 1P0PA 4UOQA 1SWVA 1GYQA 3ZH2A 1JHYA 1G0NA 3ZXYA 4GM0A 4UVEA 1SU8A 3PEUA 2PL3A 4WACA 3VPXA 2QW0X 1QHGA 4UHBA 3RSZA 4ERNA 1OHHD 3D81A 1YR6A 4PHGA 1YB4A 4TRMA 5E6RA 3UIEA 2HA7A 2XTZA 3G7NA 1C9EA 1QGUA 1AMNA 3D6NB 3P2MA 3UPDA 3GEBA 2UVPA 5IC5A 3RSSA 4WLVA 1IVNA 3H4MA 3ETHA 4IG9A 5E38A 5T4FA 3RS5A 1ENYA 2FPPB 1BWRA 4C0QC 3EODA 1NXPA 2IFTA 2H1IA 4QNNA 2JGDB 5ICGA 2ODWA 3EISA 1FFXA 4WECA 2O8NA 3OH8A 4Q3BA 3VH3A 2CHVA 4ARIA 4NAVA 1HE1C 3K4PA 1OLSA 2QSZA 4ISBA 2BFFB 1DMRA 2JAXA 4IJMA 2HCTA 1W93A 4JJZA 4E7OA 4OBXA 2PSSA 3OX1A 4A16A 4NLLA 4HWKA 1GIAA 3DWGA 1JFRA 4WXHA 3ZE7A 2PS0A 1VBNA 4KQ9A 3LUAA 3NVKI 2VPQA 3F8WA 3GAZA 1OXSC 4FOOA 4N0DA 2AKYA 2V4UA 3R4CA 1E2BA 1MMFB 3D8RA 1RRFA 3DEZA 4MWTA 2FEWB 4XARA 3N8KA 1QQBA 5C1BA 1WCWA 3TRFA 1T8TA 3HG7A 3OU2A 1F1JA 2X6QA 1I80A 3WLHA 2AJBA 1PO7A 2H4HA 3GCGA 3IUPA 1RP7A 2NU7B 3M6IA 4J2TA 4R0VA 3HZOA 5DYNA 3VHXB 3VISA 3IAAA 4F3KA 3CEAA 3W4KA 2I91A 4CM9A 5FRDA 1EJ2A 1NLMA 4BX2A 3K1JA 3WNZA 4YV1A 1JJAA 1YR3A 9MHTA 1QYCA 4UQPA 1G6Q1 4PZPA 1UDBA 2HMUA 3P0FA 1E0JA 2JJ1A 3G23A 4JFRA 2ZATA 2W6ZA 1P74A 3LDHA 2DFNA 4Q18A 2ET6A 4L4UA 2IXGA 4KAAA 3EUEA 4C2BA 2HXYA 2JI8A 3CLSD 3DLBA 1MO5A 3OKFA 3QF4B 4PIMA 3JRXA 2EARA 1UAYA 1IOZA 1W0JA 4LC9A 4ALNA 2CDCA 4EYSA 4CQMD 2SCUA 2L82A 1J8FA 3K8QA 2YASA 1HNZB 2H2AA 4B17A 3G13A 2QYTA 1Q0RA 4MITA 3THSA 4XWAA 3WTCA 1QU3A 1MD9A 1UJNA 3DF9A 3K92A 4N5LA 1G8YA 2JS7A 4IX1A 1TZKA 4MUHA 5B55A 3RADC 1UPAA 2FGJA 3O9MA 3GBSA 3U60B 1TW2A 2HK7A 5D2CA 1X92A 3DJFA 3WYEA 2XADA 3LG2A 3V4PB 5I9LA 2X0DA 3B89A 3FNQA 1GT91 3SQXA 1DEXA 2O8EA 3AF5A 5FFFA 1X42A 1HDCA 4FM9A 3UC5A 1XC7A 1O94D 1AMOA 4QASA 3NEJA 1OH6A 3BN3A 5CP8A 3L1JA 2ZCVA 2AXNA 5EY5B 3WYDA 2RGYA 2X9GA 5LNK1 1CUYA 3CUEF 1BMFA 2ZSUA 4L08A 3DE3X 2II6A 2X8JA 1KMQA 4ZOCA 1HT0A 3E3LA 2C1ZA 4KL8S 4UNSA 2Z8XA 4O4HA 2C1EA 4YDSA 1YQEA 3C70A 1DOAA 4Z7OB 2AZXA 3C3JA 4P4SB 5LOVA 3BAZA 1LDMA 3Q41A 3EIOA 3FGOA 4HEHA 1TMOA 1SC3A 1U8FO 4P0TA 3OZSA 1E8NA 3D7RA 4EZIA 4J0JA 4PGGA 1VLLA 4GXQA 3A9SA 3QE3A 5JZ9A 5K8TA 2P41A 5AW8A 1WBDA 1TA9A 4O1IA 3ZDAA 3I76A 4ZU6X 3D6TB 4CHGA 4OX9Y 5EIBC 4Q7EA 1Z0FA 1MAAA 2B1GA 3LNCA 4ZQCB 5KDDA 3ES9A 4YVFA 1SM4A 2R1ZA 1G3IA 5HZHA 1MUUA 2IDKA 2O9JA 1DO0A 3V1YA 2QMOA 4OUKX 3W6OA 3NAZA 3ZCQA 4LXTA 1TQHA 3AX6A 1E6EA 1L5KA 3GUHA 4WN3A 4DZZA 1U9YA 2GVZC 3E4DA 1PWZA 1RPNA 2R7AA 1BW9B 3H84A 1XDZA 3HCWA 5I9MA 2ZT5A 1V1MB 5DI3A 1FYDA 4F4JA 1Z5VA 4Z4CA 5HWSA 5K6AA 1FUYB 1KO7A 4B6RA 5ELMA 3EXHB 3RQIA 2E4VA 2PMCA 1PJTA 2Y76A 1HYQA 3W4JA 3OPXA 1Z0KA 1MOSA 1X0VA 3GJ4A 5CVJA 2JKYA 1C4WA 3DZGA 5TGDA 3TEFA 3SZOA 2D7JA 1FVHA 4F2DA 2IQIA 3P0RA 1I3LA 1EI9A 1XTZA 2W83A 5F3DA 4BMCA 5BW8A 4U8GA 1KRXA 3PA8A 2NT4A 1PQUA 3IB6A 5KREA 1F3LA 2V6MA 1IBCA 1FSPA 4KN6A 4RANA 4X1YA 5BW6B 3O8CA 2FJUA 5JU6A 1OXUA 5H3LA 1JXOA 1WKCA 1E4YA 4OXRA 4R1PA 4UXHA 1Y81A 2P77A 3DTVD 1MIHA 3VJLA 1AQLA 1N1DA 4Y9UA 2BDUA 2EL7A 2OGWA 4OSEA 4PLFA 5EZQA 2VJCA 1EJ0A 2X40A 4RV9A 3CUUA 4PVDA 2IYXA 5EXEA 3H0EA 4HLQB 1JJIA 1J23A 3DONA 4XLTA 1SKQA 5JI3E 3U13A 3CZ4A 5JSQA 2P9EA 1DJPA 1JPVA 4B47A 3A1UA 1GVHA 5TMBA 1CUZA 3C3KA 1NSYA 3CRRA 3N0TA 4I5EA 1TEZA 2J9GA 4N8EA 4C7VA 3QSYA 3FCOA 3O75A 4IIUA 2EKDA 1TKAA 2J5KA 3OX2A 1EFUA 2EX1A 2YZKA 3TECE 4JCOA 3IS3A 4MQFB 1R8JA 4XD7D 4IKEA 1Y82A 3FPSA 2PZ8A 5FT9A 4Q7QA 4EHLA 2FN7A 3UAOA 2ZUSA 4Q4CA 4DM4A 3EDMA 3LOPA 3TOXA 3Q8LA 4LSZA 1Z4KA 1EVJA 1DX6A 1WHSB 2ZTMA 4BNDA 3K9FC 1Y3FE 1YRBA 5LJLA 3WGQA 3BCRA 1YU6A 3CRVA 4J0IA 3QX3A 2PIAA 2B92A 5EERA 1Y1QA 4TWZA 4L8YA 4ZO4A 1XZNA 1RI4A 1N6LA 2QAGB 1RKQA 1SBYA 3I64A 3R76A 2CF5A 5BN4B 2XZDA 3P4UA 5K6AC 1N5OX 2UXCB 2KB0A 5LQAA 3O4RA 1K9VF 1VPTA 2CZCA 2FEPA 4JXZA 1X8JA 1ECGA 4OKIA 5CDFE 1TCAA 1NW3A 3THRA 1UL1X 2OG1A 1JI3A 2P5TB 4N5IX 1CJTC 4L9RA 2QENA 3A10A 3A6FA 3KXKA 4F86A 3D2CA 2H9IA 3L8CA 3PC4A 4A36A 4DR6B 3S27A 4EKYA 2PVPA 4NJMB 4P36A 3WBKA 2V6BA 3KU4A 5I9IA 1EK5A 1B0ZA 1MDFA 4ON9A 1K9SA 1ST2A 5DX1A 3T5GA 2V65A 1A2KC 1R66A 2OSBA 5JIBA 1W96A 3OZRA 3B60A 4X91A 3LQYA 2HF9A 2PO7A 1FE8A 1I36A 1VHLA 4RTNA 3G9UA 5G4KA 2HCBA 2J6BA 1ANKA 2O2GA 3SSOA 3IDAA 3OEYA 1Q77A 1R2QA 4F4HA 2OD7A 3GJYA 1JAHA 2ES4A 5L7YA 2JIRA 5CGQB 5DGTA 2X9VA 3OWHA 3LM8A 5A4MS 4BVKA 4E03A 9ABPA 4ARVA 4WY5A 1F20A 3DMPA 4TPKA 2DBVO 2B82A 1A0OA 1E7RA 1L8OA 1FNDA 2I4RA 1PG2A 3DDUA 3EK2A 3Q6IA 4E30A 2PX5A 2FLKA 2QX7A 4IHQA 1PKEA 2WT9A 2ZJZA 3FWYA 4DPKA 3ZGZA 2XNCA 4IR7A 1XPRA 5ENVA 1DAEA 5DNDA 1HO3A 2BMJA 1U5CA 3DAHA 3VAYA 3QFFA 4R9UC 4AO8A 5CA0F 1W0KA 2UZIR 1Y3AA 2WHYA 4IGKA 3WOHA 4JR2A 3KV3O 3PPXA 1XZHA 2RHBA 1B93A 1DRUA 2WU3A 3BXEA 4HYTA 4PWZA 3UB2A 2W2PA 4TXHA 1E5TA 1NVXQ 2PVCA 4IDAA 2FZGA 1U7ZA 3ENZA 2LCIA 1MN6A 4LIPD 2XMQA 4C30A 4W5NA 3OF5A 4RWZA 4YJ2A 5HKKD 4ZOQI 3ADOA 1RBMA 5KSOA 2C00A 3AGQA 3TCNA 4E46A 4M1OA 3BWEA 1GPDG 3LUFA 3MCZA 1BJRE 1U9ZA 3FYUA 3R3YA 1SR8A 1Y63A 2PFSA 3JD4A 1FMJA 4H7KA 4KYUA 1RAEA 4QBIA 1CR0A 4WH0A 1ABEA 4O1HA 1E4EA 3IHTA 4Q3LA 2PLNA 3K0AA 1BX3A 5LQNA 1GKYA 2C92A 4JR0A 4TT3D 3EJ6A 3NCHA 5AKXA 1WZCA 2YCLA 3X1DA 1TFUA 2YWBA 2OWDA 1Y4AE 3FZEA 1GSOA 5BT9A 2VBGA 2HHCA 2FP3A 3K5PA 1PI3A 4JP2A 4DRXA 2VSFA 4YMSA 4BQIA 4EHKA 1DFGA 1LC0A 4RDCA 3W4IA 1X7YA 4E1AA 2FWPA 1C30B 2PEYA 1OB2A 3KB8A 3W2EA 3DT6A 1AU9A 1XZIA 4ABYA 3QA9A 4DJJA 3TGLA 5LVAA 3HACA 2FQQA 3K16A 1R8XA 2G76A