3E81A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e81A00
3NRJA 2FPRA 1U7PA 4OHFA 3M9LA 1Z5UA 3A1CA 2MU1A 2W4MA 2HO4A 4NWIA 3R9KA 2IYEA 3L8EA 1O03A 2G0AA 1YDFA 3UMGA 4CF4A 2B0CA 3ESQA 1ZS9A 4ZEWA 1XPJA 3U19A 3PDWA 3EF1A 3SHQA 4C4SA 3KDPA 5ALDA 5ALPA 2P27A 4CF3A 5ALHA 1U02A 1O08A 1TJ5A 1QQ5A 2GHTA 2GO7A 5FP0A 4YCNA 4UMVA 1Z4MA 3U7GA 3RFUA 2HF7A 4YCLA 4Y2VA 2G80A 3KC2A 5ALMA 3WKBA 1VJRA 3UMBA 5AKHA 2ZXEA 5T41A 2IOFA 4EEKA 5AW3A 3IJ5A 3L8HA 3NANA 4HGPA 4XE5A 5AK6A 2O9JA 3SMVA 3EF0A 3QU2A 2EARA 3OCVA 3AR2A 4BEWA 3P96A 2FI1A 3I28A 4DW8A 1YMQA 2NYVA 3GYGA 2EAUA 1RLOA 3U7FB 2I6XA 5AKIA 4UM5A 2Q4TA 2ZBEA 2FPUA 3QU4A 3ED5A 4UM7A 5AI4A 2FPXA 2G06A 3ESRA 2B30A 5AIBA 3NAMA 4F71A 3AR9A 1WVIA 4BYGA 2R8ZA 2CFSA 1JUDA 3ZU6A 2WM8A 2CFTA 5AKEA 2BDUA 3KBBA 3ET5A 3U13A 2IOHA 5AKKA 2WF9A 2MSNA 4EELA 1TJ4A 2AMYA 1Z4QA 1ZD2P 2EATA 4YGYA 1ZJJA 2BDEA 2FDRA 3PGLA 3L0CA 3NASA 3QGMA 5ALLA 5AVYA 4UAVA 4MWOA 3E81A 4IG4A 3ZTYA 5AIAA 3QYPA 4XPZA 1YNSA 2C9MA 1X42A 5ALNA 3R4CA 3W5AA 1Z4JA 5AW8A 3E84A 4YH1A 3A3YA 1SWVA 1L7MA 2W43A 3PCTA 3ZX4A 3QUBA 5AHXA 4AP9A 1RMQA 2ZBDA 4KNWA 3N07A 2YMQA 4HGNA 1Z4KA 4BNDA 1S8OA 4FE3A 4KN8A 2RB5A 3N5KA 2WF6A 5AVRA 1YV9A 3W5BA 3WK8A 5ALRA 4HGQA 2FEAA 2FUEA 2QLTA 3K1ZA 3I76A 2G07A 5AI8A 4CF5A 3DV9A 4IFTA 5ALWA 3WK9A 1VJ5A 4BNDB 1RMTA 3OCYA 4I9FA 5AW4A 1RKUA 3IB6A 3QLEA 5ALFA 5AW9A 4F72A 5AW1A 2YFYA 4FYPA 3QU7A 3QUTA 4ZEXA 4ZEVA 1Z4PX 3ET4A 3ZVNA 5AI5A 5AVXA 1WR8A 4UU0A 3BA6A 4Y2XA 5ALKA 3DAOA 1CR6A 3NUQA 3VAYA 4O8CA 4JB3A 3L5KA 2YJ5A 3ZWKA 5JJBA 3DDHA 3SLRA 3WKEA 3QNMA 1L8OA 2HDOA 3A1DA 1WPGA 4B6JA 5ALYA 3PGVA 3OPXA 3N1UA 3SKXA 1J97A 4L6CA 5AW2A 1L8LA 3ZVLA 3KZXA 2AH5A 4NABA 5AKJA 5AKXA 3AR3A 1Z4NA 3W5CA 2Q5EA 2P69A 2ZG6A 5IS2A 3WK7A 3FGOA 5ALVA 3NIWA 4AS3A 3AR4A 5AVVA 4Y2PA 1RMYA 3J7TA 1N8NA 4UW9A 4Y2UA 2I33A 5ALGA 4NFLA 1EK2A 1NF2A 3QX7A 4QJBA 2YMLA 3HYCA 2HEGA 4YIKA 3WGVA 4GIBA 1QYIA 3WKAA 3QU5A 3L1VA 3QUCA 4Y2SA 4Y2JA 3FVVA 4G9BA 5ALEA 4KX3A 4UATA 3WKCA 3AR8A 2FPWA 1EK1A 3BWVA 5AW0A 2OA0A 4Y3UA 1YS9A 3IRUA 1TJ3A 2AGVA 2IA5A 2BY4A 5ALXA 3L0BA 1MH9A 4BBJA 2B8EA 2R8XA 2OBBA 3W5DA 1U2TA 2WHEA 1PW5A 2WF5A 3WK5A 4E88A 1K1EA 1U2SA 3OCXA 5AK3A 2O2XA 1L7NA 2P9JA 2RAVA 4HYTA 4RESA 3FZQA 2YY6A 5ALSA 1VFPA 4OD0A 4EENA 4XQ0A 1Z4LA 5AK4A 5AM5A 2CFRA 5A3SA 5ALJA 4GXTA 5AI0A 4HGRA 4C4TA 1LVHA 2AUTA 2JAOA 2P11A 1U7OA 3A1EA 3OCZA 2GHQA 4CNQA 3L7YA 1N9KA 4QQFA 2YN4A 1Z5GA 1QH9A 2ZBFA 2C88A 2C8LA 3I1YA 2W11A 1YJ5A 1Z4OA 2YBDA 3SKYA 2X4DA 3QU9A 4HGOA 2B82A 3SD7A 5AVSA 1L7OA 5AK5A 5ALTA 1IWOA 2FUCA 3KOOA 3ZTWA 4EZEA 1ZD3A 2G09A 5A3QA 1L7PA 3U7HB 4I9GA 5IT0A 3ZI4A 3MPOA 2GFHA 5AM0A 5ALUA 5AVWA 3SF0A 3ZUPA 2I54A 2HCFA 2WF8A 4Y2QA 4Y2YA 2ZOSA 1Z4IA 5AICA 2G1AA 3N28A 5IT4A 4OFZA 5AKGA 4C4RA 2PKEA 2RARA 2B1QA 4L57A 2HSZA 2DQSA 4KNVA 1SWWA 1RPZA 3S6JA 2R8YA 4EX7A 1Y8AA 1AQ6A 4JDPA 4UMFA 4UMDA 4KYTA 3FPSA 1RKQA 2PR7A 2YJ6A 4EX6A 4BKMA 1XVIA 1Q92A 4OCZA 5AW6A 2C4NA 2PQ0A 1RKVA 3R09A 3ZWDA 5AVUA 2YJ3A 4NAVA 3OTQA 2YMPA 3AR7A 3U26A 3RF6A 5ALOA 3TLMA 3ZVMA 3HLTA 2JAWA 4Y2TA 5AM1A 4DWOA 1T5SA 1NNLA 3AR5A 3N8GA 4XOUA 2HHLA 3E58A 4RETA 2IOFK 1ZOLA 1ZRNA 4BEVA 5AW7A 3ONNA 4L6AA 5AM4A 3AR6A 2I7DA 3UM9A 3MN1A 1NRWA 2HF2A 3WK6A 5AVQA 4UARA 3FPBA 3MMZA 2C8KA 4BX0A 3EPRA 4J2TA 3QXGA 1Z88A 1F5SA 4UAUA 4NV0A 3M1YA 4FFDA 3D6JA 3OCWA 5A3RA 5AVZA 1RLTA 4MUMA 1RRCA 1ZD5A 2VKQA 5AKLA 2YJ4A 1CQZA 3EWIA 5ALQA 3B9BA 2OM6A 3ZW7A 3ZX5A 1LTQA 4J03A 2YMMA 5AW5A 1RDFA 3L1UA 5AKYA 3QUQA 1RQLA 4BX2A 3F9RA 2GMWA 1XP5A 2B8JA 2B1RA 1SU4A 2OYCA 2D2VA 3WGUA 4UMEA 1FEZA 1ZD4A 5AESA 2NO5A 3MC1A 4H1WA 4DCCA 1J8DA 4UASA 3B8EA 2FPSA 1S2OA 5AM3A 2CN1A 1RQNA 3WKDA 1WZCA 1RC8A 2G08A 1T9ZA 2ODAA 3L8FA 4PNHA 2ZBGA 2HI0A 2Q4RA 1Q91A 5AVTA 5ALIA 3OCUA 2WFAA 2WF7A 4AS2A 1KYTA 4DFDA 5ALZA 1RLMA 5AM2A 1L6RA 3KD3A 1ZRMA 3NALA 1TA0A 4CE6A 2QYHA 4YCMA 3L0YA 4Y2RA 3CNHA 4HAIA 3DNPA 3B9RA 4BX3A 5AI6A 3L8GA 2JGAA 2I55A 3I6BA 4G63A 5AKZA 1QQ7A 1T5TA 2HX1A 5E0OA 3WK4A 4YIHA 3E8MA 3CZ4A 4UU1A 2I34A 2HOQA 2JAUA 2NO4A 2RBKA 1QQ6A 5AI9A 1TE2A 2R8EA 3U7EB 2JARA 3UMCA 4KX5A 3FM9A
chains in the Genus database with same CATH superfamily
2FGJA 1ZX1A 1GAQA 1UIMA 4Q1VA 4RTPA 1R8JA 4I1IA 2FAXA 4C0QC 3NR2A 5CA1F 1CF9A 2VJQA 4L2IB 4XPIB 2WSIA 2ATVA 2W4MA 1CB0A 1KVSA 4H0NA 4V03A 4X00A 5FOTA 5HKKD 2JG3A 1K86A 3AEKB 2ACVA 4XKJA 4WEQA 1PG2A 2II6A 1ZUNB 3ESQA 3ON5A 3QBDA 1BQEA 2R6HA 2V1UA 2VOEA 4O6VA 1PSWA 5TPWB 3HCDA 4EMBA 1EEHA 3JVDA 4JYAB 1W5AA 2DUMA 2Q21A 3FROA 4BU0A 1PL0A 5ALHA 3RAFC 2AOTA 3O2NA 2GHTA 4Q82A 4G1MB 1Q15A 5TVKA 1XPUA 3HV0A 1XOIA 4OYYA 4TN5A 3CUUA 3LC7O 1NVGA 2OOKA 2QOEA 2Q3DA 1BYIA 2Y71A 3O95A 5LQRA 3D3KA 1L5ZA 3FGNA 1HT3A 4CM4B 5FX2A 1QP7A 5K8UA 1TM7E 1XDUA 1D1QA 1SHZA 5TGZA 3RFUA 5FUQA 2WZCA 5CX1A 1OJ7A 2ZJAA 5F1KA 1EP9A 5T4HA 4HEHA 2QAJA 2OG1A 5CDFA 3ECCA 4DN6A 3FDFA 4CM7A 2FW8A 3K2EA 3GQBB 2QUIA 2JKYA 1NW5A 4JLNA 4LWPA 4UVDA 5FTJA 3VGPA 5E38A 2RI0A 4GUAA 4RJTA 1FF9A 2JFYA 5DW0A 3SZGA 4AROA 1L5NA 3JQAA 2BF7A 3EW9A 2HHCA 5JJCA 3CPJB 3ZDFA 3JPYA 2B1JA 2I6UA 2ISSD 3HZOA 1U3CA 3LRXA 4O5OA 4LFCB 4B6FA 4IHJF 3LQ4A 4GP6A 1M6WA 5HPYB 1DDOA 2V7XA 4G5QA 2ZKLA 2R1VB 5ERXA 5HK8A 3ZZ1A 1H4QA 3LI2A 5IAKA 2G1UA 5BXQC 1XQ1A 2BF4A 4KQGA 4BEWA 2QAGB 4KAJA 3V6MA 3V4FA 5KKCA 1M8JA 3G2JA 5DNEA 1VYVA 1Y3HA 1QANA 1TW2A 2XTZA 1DG1G 4NZNA 3BSSA 5HMLA 5K3DA 3G13A 1A1SA 4DTIA 2VHQA 4G84A 3BH6A 3LUCA 1QG6A 2VTBB 2GF9A 1GDTA 2H59A 2VT2A 3JAWB 2HUPA 3KQOA 4WNYA 5CCEA 1K7FB 3X1MA 1O77A 1XCOA 2R87A 4M46A 4KO8A 4BLSA 3NTRA 4GP9A 5LYYA 2G04A 2Y9MB 5CNMA 3T7CA 2O3JA 2IXFA 2YXDA 3HY4A 2HZ7A 3BF8A 1BS9A 2H2GA 1Z7GA 1WMAA 1XZKA 3BXPA 3VTFA 4HT3B 4IXNA 1GYQA 3MSXA 4WOJA 3S2UA 3ADCA 1KJWA 2QV0A 1ONBA 3GLTA 2QSZA 2VDQB 5G0WA 4WHMA 3T7TA 3I42A 1PR2A 2QJWA 1GGKA 2WBLC 3A6EA 1IWBB 2ZP1A 2WQZA 3E0XA 2PWPA 3HU2A 3E9DA 4H0FA 4YGYA 3RVJA 3F5SA 1AG9A 2QZJA 3WYFA 1QDEA 2DFLA 1W0KD 1A3CA 1I2ZA 5CJ2A 2QG6A 5FRDA 1VM6A 1AKRA 2HNAA 4HO1X 4M7OA 4BMNA 3LP8A 3OJEA 3LIIA 4CLDA 1E3QA 1I5RA 3TLBA 4YRCA 3ZJTA 1SIUA 2JCSA 1C7ZA 2LIVA 2PSFA 3ZWNA 4DPLA 1O58A 2I91A 3KYCB 4E07A 5KSWB 3F3SA 4JCCA 1C30B 1OLSA 3E9ZA 5AUOB 4ER6A 3DLTA 3IDOA 3EG5A 3NBQA 3O6VA 4AN1A 3UGKA 2EP5A 1X1CA 2PWAA 2VDWA 3RNOA 3N6RA 5DHRA 5DX0A 2LCFA 5D3ZA 4IIJB 3OIVA 1H4SA 5AXAA 2D2IA 1ISFA 3DZ8A 3TVDA 3IEIA 4DJ5X 2WUFA 2E21A 1J6UA 3BBPA 4L0CA 2XE7A 4HJRA 4LPSA 1CLUA 4M88A 5A5VA 1A9XB 5HE8A 2FDCA 4CODB 3LDUA 3Q5DA 1S8OA 3RS7A 3U3KA 2D1YA 1VJ1A 2GERA 2VO1A 1YV9A 4MEBA 3BRWA 3WRWA 4G0OA 5JY1A 2CVOA 4GMKA 4MUJA 4HGQA 4LBVA 5LB2A 3DVLA 4I1YA 4LTDA 4JWTA 4BVBA 1XQ9A 1Q57A 3HU3A 2PUJA 4KR9A 4ZZ1A 3KD2A 4BMVA 2GNPA 3R3JA 3ZK9A 1C2TA 4S1NA 2WA2A 4D9KA 5AW1A 2DHDA 2I7XA 4AJLA 2CXOA 4ZEVA 1JS1X 2O2EA 1NPYA 2J0UB 2VDRB 3L07A 3O8OA 3BTVA 4JN6B 2BM9A 5AI5A 4ALLA 1TTHA 2PV0A 1YB6A 2P68A 4IDQA 5KUTA 3OOSA 2LCQA 3F3KA 2H4ZA 4MS4A 5B5SA 1BMFA 1H2ZA 3CCBA 1CR6A 1D6JA 2PMCA 5A7GA 3RRBA 3HKBA 5E0KB 2VRCD 3VR4D 1EX9A 3PITA 1NI4B 1OBFO 1BFUA 3FWHA 3GU3A 3NYQA 4LBZA 1E1YA 2GRJA 4R1OA 4Y2GA 3VI3B 5IFKA 1DKMA 2FKAA 3BRSA 4M9UA 3FLAA 4NU8X 5FO1A 3SIRA 1TA4A 2PBRA 3BXXA 3LE8A 4RK7A 3UFBA 1CUGA 1XZMA 3AINA 3QF4A 1BDHA 1PF7E 3IP8A 1PGOA 5KYNA 2WE7A 1GZHB 1KRHA 2J3EA 3GOQA 1BVHA 4L6CA 2C3UA 1N3BA 3QNUA 4WZBA 3FTQA 5EFZA 4IINA 1ND5A 1S01A 1P1JA 4I99A 4FGJA 3OTIA 3KZXA 3U44B 2VHXA 5AKJA 4U2CA 4F5EA 3VHXA 3THXA 2WG2A 5KTNA 1YVRA 3VV3A 2WP0A 2FWMX 4XEUA 3KLPX 4G01B 2ZTSA 3L93A 3TRIA 3GJYA 3ZQ6A 1U1EA 5IW8A 4DUGA 1JQ3A 2HW8A 2O8EA 2O23A 3BMNA 1BQ4A 3GEDA 1OBVA 1JIVA 4C3OB 4DIEA 4DCGA 4Z53A 4HBZA 3NHFA 1TM2A 1Q14A 1V4VA 4MVJE 2XBLA 5H5JA 1FX0B 4Q3KA 4YV0A 3HLYA 3MCVA 1RMYA 2H2AA 4PQEA 3BUSA 4L5YA 4AM8A 4PPFA 1XNHA 2DFDA 2A57A 4JUBA 3OTGA 1BW9A 2I1QA 2PUVA 3B3GA 3WJ1A 1JNXX 5CVVA 1NTRA 1NZJA 1OWPA 5L6MB 4BUCA 1DXQA 2X14A 2ZB2A 1YFZA 5A6SA 5LXTF 2QD2A 4V0RA 5L3SB 2BKVA 3NTQA 5DBEX 5CDGA 4JIMA 3QU5A 2AE2A 3C6QA 5HM8A 1V5GA 2Z04A 3NZEA 4Y2SA 3PLAE 4PBTA 2JD0A 3RK0A 3PTLA 3U3DA 2J3LA 2HPZA 1LGYA 2QORA 3ANSA 3NGLA 1KDYA 4UM9B 2YXLA 5C2JB 1G8MA 1B15A 2UYYA 3X1ZA 5GM1A 2H65A 4M8IA 1Y5LA 1TJ3A 3L6UA 2FMHA 1N8SA 4HS9A 4OHUA 3OAAA 4PXYA 3EPHA 3MAGA 4CKCB 3OC6A 3NEJA 4W82A 3VPXA 4LZPA 3Q9LA 1YJCA 4HFJA 1NC3A 3PKIA 1Z28A 5DM4A 2WF5A 5ICEA 2BTQB 1E9BA 5AT1A 3VNBA 2J0QA 3UB3A 5DFAA 4ZAZA 3EPLA 1NJGA 3FHOA 3OIUA 3PQDA 4YASA 3S3TA 1R6AA 5LQMA 2I8CA 3WIEA 5KPJA 2EFYA 1NU8A 4UE3S 1SD1A 2AJCA 4BMCA 2EKBA 4P2BA 1VFPA 3RB8A 3ASYA 4BFLA 5JMOA 2OXTA 2XGOA 4ZU3A 5KYUA 3O8BA 3PDHA 1G59A 2AXEA 1GNTA 4KLAA 4LMPA 4ASUA 5D51S 2OP1A 1RZ3A 3VZRA 1PEDA 4H6WA 1QMPA 2H1WA 2VTDA 2H07A 2XMQA 1FFXB 3PK0A 4G0PA 4C06A 1KI9A 2DCMA 1XWWA 3FPKA 1XTIA 2YYZA 4FFBB 4H59A 2JAHA 1L5FA 2W7TA 5LYJA 4CLRA 4IIXA 3BZUA 4EYOA 5CCBA 1T2FA 4E30A 3C7AA 3OE1A 4YUYA 4CIYA 3UB4A 4JHXA 2Y6VA 4YV7A 1XK6A 3NS7A 4WLNA 2XGJA 3DH0A 3D5QA 4AJJA 1XZQA 1E8MA 3K73O 1QV6A 2B82A 3UENA 1H23A 3L7DA 5AVSA 1TU3A 5J23A 4NBUA 1NAIA 3KOOA 3PIRA 5B58C 4YMLA 2D59A 3ZK8A 1HDXA 2LXNA 4QWWA 4LZWA 5EIWA 3QKIA 4F2PA 4QAJA 3DPSA 1VDMA 4XGIA 4EPRA 4Z4CA 3UH1A 1GTSA 3TPZA 1XZGA 3Q0EA 1OLXA 1XSEA 1NYTA 4KO1S 3N8HA 2QN1A 1AMOA 1NP6A 3EVTA 3UYKA 4QXPA 1VPVA 3KOWA 2YHUA 3PC7A 5TNXA 4ENSA 2F1HA 2I87A 1AGYA 1E2IA 2NTVA 2DP4E 2VNHA 3CPSA 4G2NA 4X9XA 2DT8A 4IHJA 4JIGA 4EA9A 1QK5A 1ZH2A 3E0QA 3UA3A 3EPJA 2O0KA 1JLHA 1MAHA 5JI2E 3C6BA 3T54A 4N6GA 4COOA 1TECE 1YZVA 2JI4A 2QTLA 3I53A 3ITKA 3OHPA 5DI3B 3E8XA 3VOSA 1N7GA 4AD8A 3U5TA 2AG6A 3KKQA 3LO8A 4GUDA 1NRJB 2KJQA 4QTTB 2B2XA 3WIBA 4IUDS 1XU4A 1PVVA 1LLCA 4TWIA 2C2WA 1ECJA 1EXMA 1BQ3A 1D3AA 1RKVA 3FI0A 3GVCA 3INRA 1P2UA 2XKJE 4RQBA 5LZ9A 4JI7B 4RX1A 5BQ3A 3FCOA 1B6GA 3RADC 1MENA 3MWFA 1ZIOA 1YS6A 4G0WA 1JKMA 2F64A 3QXXA 1MO3A 3PHLA 4GSLA 4OQYA 2GYVA 3TBFA 2WLTA 4PAOA 3U4HA 2Q62A 3IEPA 3QI7A 4CMBA 3FPGA 4DRXB 3D6TB 5D6OA 3PQ3A 3UF0A 3ZJ5A 3DTVB 3FI9A 3MRTA 1C29B 2FEWB 4R31A 4JJIA 4OYHA 4TTRA 1LI7A 5EHGA 1KDVA 2O8CB 1K5DA 1RYYA 3AFHA 4GR4A 2R6CA 1PJZA 4E1BA 2PUGA 2O7QA 3PSHA 1ECBA 4FFLA 3A26A 1RVV1 1ISJA 2VBGA 3KT3A 1X39A 1J1ZA 1UL1X 1LFDB 1T2VA 3OZTA 5ED4A 4O1MA 5KX5B 3FPBA 3QNWA 3TZKA 5KPDA 3ZDYB 2JKZA 2HA5A 4KTTE 4J2TA 5BN5B 2ECKA 4TKMA 3SBEA 3IV6A 4AG6A 1H3EA 3CH5A 3CTPA 4UNIA 3BRQA 2QT1A 3HZHA 3PC8A 4JP8A 3JYNA 3BFVA 3S28A 5J4VA 4EA8A 2CC2A 1LBQA 5KVCA 1JZSA 4HUJA 4OXRA 4TV9B 4O2AB 3W1WA 2ONZA 5CLJA 4Z1OA 5K0JA 3O75A 5GOTA 1GNRA 1T1JA 5IZCC 1GQRA 4LYJA 4KMSA 2WWXA 4KV9A 4H4EA 4PZPA 1KI1A 3UZUA 4IVPA 4HGZA 4NBNA 4QOEA 4RPCA 5EIEA 2AQKA 4B8WA 13PKA 4OQLA 2Y1LA 4FILA 3PNQA 1QONA 1DC3A 3VDQA 3G2QA 3OEWA 1TMGE 5BPHA 3LZ6A 2X8LA 2EHDA 2OHXA 3P4YA 2QN8A 2AOVA 1ZUHA 1V26A 1E79D 3BCRA 4DA7A 1WAMA 2W8BB 2YL2A 4K28A 3WOHA 1QH1B 2V7WA 3HUDA 2GWHA 2PR2A 1U7ZA 1E69A 2P6MA 3D4PA 3NRBA 5KHLB 4KXQA 4BGIA 5DULA 3BPSA 5CDHA 4BIIA 2ODBA 4NMXB 3OZSA 3PKZA 4P5PA 1GU0A 2ZRGA 3VU3A 2VPZA 2NO5A 5JD3A 3MWGA 4E5SA 3NWEA 1VCNA 5KNBA 2JGLA 3SHOA 3IA2A 4F38A 1XKLA 1AGRA 1IN7A 4DV5B 3H3FA 3KEQA 1R64A 3QXSA 3WLLA 4DNXA 1GG5A 3U1BA 2PX5A 4B2PA 5FWXB 4BMPB 3K6RA 3BRCA 2WU4A 3DEAA 1T6BY 3GLGE 1SXQA 3IALA 1NP3A 1PFKA 4FWBA 1FLNA 3KL4A 4BAZA 5FTMA 4U2KA 1HDIA 1TJPB 4GVLA 3B60A 1F7UA 3O8LA 1UFOA 4ND4A 3D3JA 4FYVA 2GXQA 5C51B 1JVNA 1O5IA 1Y48E 3WNBA 2WWFA 4MIKA 4NYMQ 4RDCA 4DSNA 4DR2B 3PUZA 4A5OA 2V1XA 3QW2A 2DBQA 3OM8A 5FAKA 2J5RA 1N1GA 4XYGA 3RDPA 1COWD 2QYHA 3ZBTA 4CEHB 4MVJA 3DOEA 3V8PA 4MV1A 5ELXA 2PANA 1TZJA 2GN6A 1VE3A 3U9LA 1LSOA 1G2QA 1NXPA 3IDSA 1FNNA 1IEWA 2WU8A 4F0JA 1RRKA 3DNPA 3V8QA 3ZGNA 1QQTA 3L8GA 2RSLA 1Y98A 4R01A 1AQLA 2M1ZA 2C83A 4U7GA 2RH9B 3AL2A 5KOHB 3AKZA 1IM2A 5FD8A 3KB1A 2R66A 3UB2A 1FYVA 2Q3FA 3KO8A 4Z51A 1DRUA 1I2DA 4B3JA 2EIXA 16PKA 1ZM4A 1ICEA 1QTNA 2RBKA 1VMKA 3ICPA 1CUHA 1FFDA 4UM9D 5DX1A 3T1VA 1VL0A 4JAVC 4DA6A 2IYOA 1RXYA 5E6RB 3MUNA 4EVIA 2B8NA 2WY2D 1F06A 5JTUA 3GR6A 4D3XA 1Z5UA 1HNXB 3S44A 3LA8A 4LX0A 4R1NA 4YR7A 5JSHA 1RWQA 4K6GA 3FA2A 3NBKA 3LYUA 1F2VA 1XPJA 1SQGA 1CT9A 3C3DA 1U3UA 3LGAA 3FTPA 5LXTA 2QMUA 1OWOA 3EF1A 4HTFB 1OWLA 3ANNA 2C61A 3MJCA 5BYJA 4D97A 2HJ9A 1GZ6A 1PWYE 2WVJA 5CBPA 3G2KA 4F9GA 2IYWA 2ZSAA 3OOHA 5EJMA 4K1XA 3K9BA 2J4FA 4K03A 3UEOA 2BCGY 2SHKA 5F33A 1CF4A 3RU2A 3K4HA 3EFOA 3BSWA 1J49A 2R6ZA 3ELDA 5KSPA 4DV0B 3U7QB 2IDKA 1X70A 1JKJA 3MB8A 4RIIA 4YCLA 2GZSA 2XYVA 5EP1A 4AZ3B 1P1HA 1RRFA 4RTJA 1RFGE 4DC9A 1FTWA 4L8YA 4BVKA 4ZHQB 3D3WA 3FNQA 4NZMA 4MW2A 1ZRHA 3BE5A 1V5FA 1X7YB 1LRLA 3MCWA 5EPUA 2P2ZA 2VHJA 4FDLA 1EM6A 2WOOA 1ZH6A 4H9GA 4PZUA 2I6GA 2KMLA 3D3EA 4YCDA 4BNNA 4CFZA 1E9AA 5FH9A 2BEUA 2OG2A 4ZVVA 1OGIA 1RJ9A 2M6KA 3HDTA 4FONA 3LT0A 3ZV4A 4C29A 5FEUA 1H8EA 1JHZA 4XIYA 3ZJUA 4RVFA 4X6YA 1O94D 1V1RA 4TWAA 2DKFA 2OL4A 4PR3A 1I9CA 4ZYYA 1GRRA 2OCYC 4ZT6A 4TXJA 4Y6SA 1J24A 1P2BA 3C4JA 2EFCB 2LGJA 2JZOA 2O0JA 3EEBA 3PVSA 3E15A 3HQ4O 1QXSA 2WM9B 3LV8A 5DGIA 5AKIA 3RJTA 3BGVA 4A8HA 3QVKA 2OZLA 3EY4A 2C00A 2HPAA 4IXWA 2OM2A 3HU5A 1NL3A 2DR0A 2POCA 1O57A 1S1MA 1SCAA 4JQYA 1YZGA 2H06A 2BEVB 1YCDA 2Z2ZA 1IG0A 1JYFA 1UJNA 4OUDB 4Y30A 4NBKA 4YALA 1U0LA 1YK1A 2VWHA 1T1SA 3GOHA 4JLMA 4O2RA 4BV2A 1SC1A 3CWZA 1F0PA 2Z2KA 2MTBA 4KOEC 1R10A 4B3HA 2CJWA 1VG8A 4BZXA 1Z5PA 1XXHA 3C8UA 3AVXA 3C5WP 4AECA 1RWVA 1CUAA 4BBZA 3BB4A 3JATA 4TMWA 3EJ6A 4W9NC 3UQYS 3AW8A 4I5EA 3HS3A 4AWBA 2HM7A 1CJTC 1TJ4A 2BM0A 3QWIA 3WYGA 4LJ7A 3R5FA 4FC7A 3OQHA 2W5UA 4I50F 4G5RA 4KL8S 4I4IA 4TS9A 1QGOA 2UZ1B 4UBKA 4EQ6B 5CB8A 5CLFA 3AVYA 3CF4G 4MGKR 1NXXA 4LHEA 3K31A 3TQCA 3VZBA 4F85A 3BWCA 3CX3A 4WV3A 4R68A 3DYVA 3RIMA 3DTVD 4YUVA 3TKYA 2TMKA 5DASA 3F46A 4P58A 1ZLXA 1SURA 2XUAA 4R8SA 2I9KA 1V11A 3GVXA 1CY7A 4H7IA 4N0PA 4ZAFA 3EVFA 4P35A 2QPTA 3BAZA 1H2HA 1XRLA 3H8SA 1G2IA 2CEKA 3L0PA 4J7CA 3IOCA 3S2SA 3AIOA 3H5OA 4CKYA 1ANKA 1C3JA 3N53A 4WN9B 5CXXA 5FQNA 4UTRA 3AB3A 3WLRA 3CRW1 1HYQA 2EJCA 3AUTA 3MK31 1N25A 3W6OA 3ZOZA 4EGFA 5LP6B 5AUQA 3K71B 4LZNA 1OFHA 4EGJA 1NVUQ 4N7JA 2ZUSA 1CYDA 2P4SA 5BT9A 1DAKA 3PCTA 1RBMA 3ZEIA 1IONA 4XDYA 1NBOA 1B73A 1P1RA 2EZ9A 3H6KA 2ADFA 1H2AS 1MAUA 1TCAA 3FMOB 3HNRA 5EKTA 3W7BA 1Z37A 3B9PA 4UVGA 1OR8A 3DLAA 1T15A 4N40A 1OROA 2GN8A 1QG0A 4UEJA 3H3JA 4D4IA 2VYND 5DCUA 5CRIA 4TVBA 4L9RA 1E1QD 2HYDA 4ZVRA 4JI4B 2XWJI 1X8JA 3I9V6 4WXPA 4MVXA 3L06A 3B85A 4YJFA 2C7VA 2J7PD 3SLGA 3TD9A 4BDSA 5EIBC 3WK9A 3ZD7A 1OWMA 4GDMA 3V7FA 1RKUA 4Q3CA 4N47A 2XT6A 3RTAA 5CFMA 3R9XA 3T5DA 1T24A 1DO8A 3WL7A 3F90A 3D5TA 2W37A 4PYKA 4TKVB 4RTNA 3ZI0A 2FMIA 4EUEA 4KH1A 4LOJA 3BWYA 3N2GA 1V96A 1VP3A 2XXJA 1AKWA 2VBIA 1EX6A 1LJUA 3R6WA 3KNZA 1F8XA 1JXQA 5GONF 3WFJA 3FIJA 4L22A 4D3SA 3I2KA 2YJTD 2C4KA 2WJHA 3BSYA 3KHKA 3NB0A 2CHUA 3QLUC 1AMNA 1WMDA 4AG5A 4CIXA 2H4YA 3LZDA 1Y33E 3ODPA 3TLKA 1FDIA 3KTDA 2IUFA 3BMQB 3PNYA 4LJ5A 4FHFA 3HCCA 2GJ9A 3GLGA 3KJHA 3QKTA 1WUHS 1B8OA 4YRJA 1SUAA 1YBAA 4M76B 1YSCA 1I01A 3MBKA 3SJBA 3FKJA 2IHJA 3EQ2A 4QHYA 4AC9A 4F2WA 4MCAA 2VXOA 4EY7A 2P77A 3SNKA 4XUEA 1EG7A 4MCJA 4WI1A 2H08A 3PNKA 2WFZA 1K8RA 1KDTA 2YZMA 3ZK7A 3KAKA 2Q5EA 1CUUA 3JALA 1B0UA 2ZR0A 4IIBA 3AIIA 5ELLA 5TX7A 4YT8A 2JI9A 1Y7TA 3CNEA 3LP6A 2Q0HA 4QVGA 2ANBA 2C5GA 3B2EA 1IHDA 3DO8A 3FBWA 3W3ZB 5BYKA 1PR3A 4RFLA 1N2JA 3SHTA 2YWGA 1MABA 4PS1A 1KEPA 4UUMA 3A3PA 1G6Q1 3DE2X 2VP9A 2WJGA 3KJGA 4UEKA 3HGTA 1M2NA 4MW1A 1A7UA 1U0FA 2JJYA 2X8AA 2CLIB 1DAPA 4UOQA 3ZY5A 1FUYB 1UAAA 2CSXA 1DGQA 1KQNA 4ATNA 3AKDA 3ZS8A 2HK9A 1W1IA 3TMKA 1M76A 3E1KA 3HYCA 2JK0A 4NOKA 4L9WA 4Q9LA 4YIKA 5HKKA 1PR9A 1UDCA 2X41A 3N8NA 1ZZEA 1M2OB 3QIVA 2O7VA 4OLAA 3U3OA 1SZCA 1KJ8A 2AIRA 2Q2VA 4I14A 4Y2JA 3ZWBA 3BB3A 3MMPA 3PUXA 3MQ4A 2H0RA 2ID7A 3VH1A 3ILHA 4QYSA 2CXQA 4D0RA 1FIUA 2VUSA 1BWPA 5IXYA 2IKQA 2C03A 1KGDA 2QTVB 1MVLA 3CIFA 3KOXA 3K92A 4QICA 4WKPA 5LDDC 1JAXA 3MTQA 3C6YA 4TTJA 1EFVB 2XH8A 3I2HA 4ZCPA 1QHFA 5BQOA 2NVUB 3SNHA 3W6ZA 2ID9A 1GTMA 2J41A 4NI5A 4M1EA 5JHHB 4WOPA 1J8MF 2H8GA 3KPVA 3QFRA 5DGXA 4YA6A 4EARA 2WE8A 5HVNA 2AMJA 5ESXA 2IW3A 1KEEB 1NFRA 4ZVPA 3WLMA 5IXSA 1VSQA 1VIVA 3OT1B 1S9DA 4UDYX 3VC3A 2GCNA 1NJ2A 1XD9A 3W8EA 3H5NA 2IPNA 1ZO8A 4RMJA 2GWRA 4YP1A 5KU7A 3BWDD 1G8SA 4G0NA 4BMSA 1U0JA 2DLNA 1NY5A 2MSCB 1SU8A 4J2HA 4NFHA 2HADA 3U39A 2OGTA 4DPKA 1LFAA 1U8EA 2O2HA 3MAAC 1ZCZA 3O03A 1YDHA 4CUJA 3HEBA 1OGJA 2Y05A 4UEWA 2GPJA 1HLPA 1NNSA 1R4MA 1XJCA 1DO0A 4A6PA 3JD3A 2GXSA 4DYHA 4GQAA 2D2XA 2I3GA 2BFEA 1KJQA 1Y3IA 2B5WA 5C18A 1ZZGA 3CZ5A 3H2IA 4MDEA 3U9SA 4NCBA 5BSEA 3OUZA 2EJUA 5DYTA 2Z4RA 3IUNA 3G7NA 4DCUA 2NADA 3AUJB 4P84A 2COUA 1VKNA 2QWXA 2I62A 3H2BA 4X45A 4BATA 2UU9B 2A5JA 1HTBA 2V7EA 3BZWA 3DEHA 1OCEA 2ICAA 1JMYA 5AK5A 5ALTA 5FUVA 1IWOA 4MYUA 5C81A 1E2JA 2A6PA 2Z09A 4WOBA 3KJQA 4KMRA 3QOWA 1IUOA 1O95C 1SC4A 1V25A 2A0WA 4LQCA 4DR4B 1KZGB 3DAGA 4IV8A 4QUKA 3TLEA 3ONFA 1E4OA 3Q7IA 1ZHOA 5B12A 2F43B 2NW6A 5F77A 2FU5C 1B2LA 4XH9B 1VE1A 3NATA 1QFJA 3E18A 3NVAA 3Q15C 1K6EA 2PSDA 4LGVA 5DN6A 1QF9A 4FDUA 1GQFA 4OHZA 4TV8B 1Y1RA 2AOUB 1G3RA 1U8XX 5FL7D 4ZCRA 4MI3A 3T4EA 4D9GA 2J07A 1UBEA 1V6CA 2PKEA 5I9LA 2LKCA 3A32A 4KH0A 1AS2A 5GTDA 1AKMA 5JMWA 1TFUA 1TK9A 4CQMB 4JYCA 2FX3A 5FI3A 2J31A 4OYLA 2DKOA 3QVJA 5TY0A 3JW8A 1U98A 3PFBA 3RIHA 1RKQA 2FSIA 1XKQA 1Z56C 2YJ6A 3WTCA 3DP7A 3FWZA 1UK9A 4J1QA 3SDBA 3D54D 3KFLA 3KTOA 1L7RA 2BBSA 3ENZA 1CF2O 1TUBA 2H2WA 2BGRA 2N1BA 4Q3LA 4W1QA 4EO4A 1EZZA 3IMFA 4J9VA 2FR8A 2R4QA 4QTXA 5F2NA 2A86A 3K0BA 4HDSB 2BELA 4YHBA 1GCUA 4QU5A 2G8LA 4WEOA 5IN5A 8OHMA 2NO1A 4QD3A 1B8UA 1L5GB 4ZYUA 1NZDA 1WPXA 3NC1C 3ABSB 3W5VA 2JZNA 3UJDA 2NXJA 2GUGA 2X1VA 5KTOA 2CE7A 2PWZA 4L8GA 3TAHA 1SU7A 3W1VA 1U3GA 4R3NA 4Q1AA 2QAIA 4KMOA 1QP4A 1OYOA 2J08A 2VF4X 3R75A 4KE6A 3AV3A 4CLXA 2ZB7A 1V9LA 2A9RA 4MQ5A 1UMCB 1C7IA 2X9NA 3B20A 4YFVA 5LU9A 1E98A 1OYVA 1X3LA 4EBFA 2GZHA 1D9ZA 1HM5A 5B1HA 1KEKA 5D86A 3UJ9A 4NG5A 3RSCA 3MELA 3ZGLA 2XQFA 1ECPA 4HK4A 4GX1A 1VZ3A 1OVMA 3HJCA 2DBZA 4B3GA 3L1JA 1GZDA 4LXHA 3ORYA 1C41A 4XQ9A 5E4JA 3MTAA 2DFVA 3DCJA 4URZR 1L4MA 4TROA 5H3CA 4PHHA 5ADUS 1XA3A 1PBNA 4ZYVA 5IU6A 3QYAA 1U5CA 1QHEA 4ND7A 3WRXA 2P9FA 4F21A 2AYZA 1AIPA 3EIXA 3VR5D 3BQNB 3WDLA 5BOSA 2IHNA 5BWBA 3U09A 2XOKD 1TQ6A 1IM5A 4Q21A 2YJ4A 4ZTBA 1JV2B 4CF7A 4TSRA 9GPBA 3ERCA 2VEDA 1PD0A 3DR5A 4KZPA 1T9GS 2R85A 4KQ9A 1FW6A 2ZZNA 3PEYA 1IVYA 5DSZA 2GVZC 2MMCA 3QKUA 3BIJA 5ESWA 2ZWOA 3VR4A 5I9IA 2JCYA 1Z6GA 5FA8A 4LDRA 4CDGA 4NOLA 3I01M 4TSFD 4JMLA 3X1KA 2XADA 2DHQA 4R81A 1H1LB 1PR4A 2C04A 4BC0A 4D8YA 2BGJA 4NY1A 3V7WA 2NUBA 4YJDA 4BNFA 1YKFA 4D8VA 4D4JA 3E48A 1OASA 2PBLA 5IC6A 1QHNA 3HABA 2BKLA 4JA0A 2F1IA 2RHHA 1QDUA 4ESVA 1R50A 1Z62A 2F3QA 1ZMRA 4YCSA 2HA6A 4RDHA 3K0EA 1AA6A 1QIFA 3CF2A 3L18A 5TPZD 4WCFC 4ZGBA 3F1KA 1TCUA 2GM4A 3RPEA 3RASA 3PCXA 1YHYA 2E4UA 4B45A 4LJ6A 4TKUA 4XJVA 3EDCA 2WKRA 1M66A 1WZCA 2QJFA 3RC9A 2DY1A 5FPHA 2ES4A 1SUBA 1VHQA 3VU9B 1WHTB 4ZDIA 3OOWA 5EL0A 1HFKA 2NZJA 4IH4A 4RZXA 4B3XA 1E2KA 2YCLA 4TPKA 5KZMB 3VMFA 3IMEA 1DT3A 4BVEA 4JYMA 5DXJA 3A7DA 5GONA 1XYVA 3O21A 4DFDA 4MI6A 2NAFA 3QELA 4HMOA 3I52A 4OGWA 4TUYF 3F4BA 4IVNA 2RGBA 3GV0A 4JP1A 4LZJA 1MTZA 2YINC 2DHEA 2YWXA 4LF4B 3BIOA 2WPDD 3SEQA 2HR1A 5FORA 4CQLA 2C59A 2NZYA 3CRQA 4ZODA 3PJGA 4A2QA 3D7MA 1H0RA 1JSLA 1PS9A 3M5PA 5EERA 4ZMRA 3FVRA 1OMOA 1XZDA 5HTKA 1RI1A 4IOLA 3EH1A 1T5OA 5HG0A 1JEYA 3HJUA 5DLPA 5FOXA 1XA0A 2HMAA 2YJNA 5FQOA 1KYWA 2O2IA 4KPFC 2GBPA 3I6BA 3ZCPA 3LJKA 1H05A 1C7QA 2HPHA 1ZCAA 4XPIA 1T1EA 1UWVA 3M4JA 4FJ2A 3C43A 4G37A 3PC6A 1GTJ1 4OQPA 4QRHA 4BFWA 4YIHA 3AEKA 5KTMA 3N58A 1LTKA 2BLLA 1MC1A 1ZUNA 3M6FA 3TQFA 2JAUA 2NO4A 1X1SA 3BD8A 2R8EA 4RJKA 5TPWA 2C82A 4GMXA 3M34A 4FWTA 4PONA 2PH5A 3FJYA 1B93A 3EVNA 1Y3BE 4L3OA 4EKDA 4O4JF 2IXBA 2X7XA 4RKFA 2FPRA 3NNNA 4N8DA 4AI6A 5C52B 3I1IA 3IP5A 1ZMTA 1J56A 1I10A 1TGYA 3T94A 3R9KA 3X1XA 3QTBA 2IHYA 3TR5A 3S29A 1YB1A 1UBUS 2N75A 4CM4A 3V7NA 4QTUB 4TTVA 1NFFA 2Z98A 2VH1A 1NN1A 2CNBA 2Q4BA 2ZAYA 1H3NA 3CUEF 5EP3A 3TLXA 4AYXA 1BFKA 1XEWY 1ILWA 2X0JA 4BQPA 5C7YA 3DBRB 1OZ0A 1EHYA 4DDKA 1U6KA 3LXXA 2P27A 1AOXA 2ZANA 2K87A 3GQBA 3TXXA 4HQ0A 3UHOA 4Z2AA 2IYVA 2B7BA 1SHLA 3DMTC 5CVDA 2OPBA 1J8VA 2RGWA 3RLIA 1X0VA 1X8XA 2WOJA 2ZRIA 5FPQA 4F7WA 4FYMA 4LVNA 5K6TA 3QE2A 5CA0B 4MTLA 3NYRA 3ZE6A 2Y1OA 4P5EA 4OQXA 3M33A 4PLTA 1DAFA 1WCIB 4FFRA 1SEVA 4GYJA 2R1VA 2FUNB 1QIGA 2ZDHA 1U0RA 1Y80A 3CO0S 4LRUA 5L3RA 3WKBA 1ZSVA 3K15A 2IIQA 4C5CA 2QAGA 2IYSA 1AXGA 2WWHA 5I3CA 5LZ2A 1XKTA 2CNKA 4ZYXA 1RWKA 2EEZA 4YRFA 5EUCA 4D3YA 1R8YA 4EZIA 3GMDA 1YS2X 4EY5A 2VTBA 2N1MA 2O59A 3JAWA 4JX8A 3YASA 1X7HA 1EP3B 4G5OA 3ZY2A 2Y27A 4EGQA 2MYUA 2GNAA 1RYEA 2H3EA 5IPFA 1RQGA 2Q4OA 3LBFA 1ZCFA 1Z39A 1JQDA 5TEVA 721PA 2Q9UA 4OAQA 5KCZA 3DNMA 3QV1A 3GROA 1F4LA 1U7HA 2NYVA 4NBRA 3D4OA 3GGCA 3LLSA 4R40A 1BHJA 4ZK6A 1AKTA 1DU4A 4IO1A 5CGZA 2XCQA 4C01A 2B98A 1Z8DA 2GCOB 4AIRA 3C4QA 1CY8A 3DE1X 5JAMA 1QH0A 2EW1A 1KFJB 4C2UA 5KQGA 5AI4A 1YL7A 4M0FA 1RYMA 2V9PA 1GUAA 4XGKA 4Z0HO 3B7WA 1HDZA 3U48A 4CQMD 2XB2A 1Z0KA 2CLMB 4DARA 1PJ2A 5KX5F 4N49A 2VCHA 3X44A 4REMA 3VYTB 2ZT7A 2WUVA 1PFGA 4R9VA 2HT6A 1KRXA 5DTEA 2B6NA 2ZITA 2IYNA 1Z75A 3DVQX 3BHNA 4W9RA 4CR8A 4EP1A 3P4UA 3ZJ4A 4LCBA 4ENPA 3KBBA 4Q9JA 4FX5A 5CNKA 3KYBA 1BHSA 1B8PA 4EYKA 1WCYA 4E6EA 4YRBA 4TV9F 2I4RA 1N1EA 2RI1A 3I4CA 4GPAA 3QV2A 3VOAA 2X0NA 1FXUA 5CIWA 1YR8A 4E21A 3KYCA 4AKIA 1NKVA 1VE9A 4D9IA 4Q3AA 1W5FA 2WAYA 3PWKA 1UINA 5DW3A 5B64A 5GVSA 3TUZC 8GPBA 1C30A 5EP4A 3K05A 5H1YA 1U04A 3HL0A 4F1WA 5LP6A 1BE6A 5AP9A 1CFJA 1QWOA 2YV1A 2XI4A 3ELBA 4R54A 4RU1A 1OI4A 4RD4A 5IC5A 4BECA 5JEEA 2VC2B 1XBTA 2OHOA 1VG1A 2R84A 2PJDA 1SC3A 3ADOA 4K3UA 4M9QA 4URHA 5DBIA 3J7AC 3N39C 1IHXA 2HCTA 2WPNA 3MT0A 4JLAA 2PO7A 4M0KA 2EOAA 1BE1A 3EGDB 1YC2A 4NEQA 3UTDA 1W36C 1KP9A 4A2PA 1BS2A 1A9XA 1DQNA 1P4HA 3QE4A 1A1VA 3T5CA 1OZHA 5EXSA 4YUWA 1H8HD 4MO9A 1KDZA 4EB0A 3RT9A 2ZYSA 2W6PA 1AZTA 1QRTA 2E5WA 5C5EA 1CY6A 1I4EB 1N9GB 1PLKA 5BSMA 4URVR 1TCVA 1GKIA 5LD2B 1ONPA 4HDQB 2Z4SA 2ZB8A 5DHSA 1KJIA 4AJPA 1KNXA 1QYWA 1JR2A 3KKNA 2ZS8A 3GJRA 1RQRA 4LSGA 1T25A 4XVQA 3A2NA 3KJXA 1E9RA 1CZUA 3BS4A 1NP7A 1W6UA 2P9QA 4Q1CA 2BH9A 2A92A 5EIFA 5H3LA 3LDAA 4AJOA 1EESA 1SD5A 1E79A 3R5KA 3JXEA 3BD7A 4YAGA 3QOFA 1RTTA 3ND6A 4G85A 3QEBZ 1X87A 1G8FA 1ZI9A 1M6YA 3PICA 1GPKA 2FSGA 2G76A 2QLTA 1V39A 1FQOA 1L4KA 3VNSA 3WI7A 1MXHA 4FKZA 3KE9A 3N59A 4OQDA 1KE1A 1FFGA 1NFQA 1P1FA 2J6HA 3QYJA 1NI4A 3V4ZA 1JX6A 4F5YA 2ZB3A 3ILXA 1YH3A 1KJZA 2PJUA 4BVGA 5JCJD 4NEGA 3WO0A 3PX2A 3V80A 3W79A 3IULA 3GHHA 3X2EA 1GLNA 1CEEA 1K2WA 3DKIA 5KYXB 2CFCA 4AUEA 3BD6A 3OEHA 2POQX 3A36A 2QY9A 1X7XB 3BA6A 1XK7A 2L19A 3ASZA 3KZOA 1OX4B 3T3GA 3S2YA 3FUVA 4AO6A 4IJWA 1W73A 2NU8B 1E3WB 4AICA 1GEEA 2E7ZA 2X7JA 3F67A 5FUMA 1CZOA 3ORSA 3FOBA 3MD9A 1CY0A 3OY7A 4BJ5A 5IVDA 3U44A 1XZFA 3C1AA 2ZCJA 2WWTA 3TIXB 3HXPA 3QVVA 4GP7A 4EF4A 2G1PA 4JI6B 3V9AA 4KQ1A 5MN5A 1GG2A 3PGVA 2IXAA 4US1R 1YIDA 4A0GA 1T8YA 2PUFA 5BSRA 3KR1A 3S8EA 1EFKA 3GT4A 2W2LA 1COWA 1XX6A 2P67A 4QRIA 3KB2A 1FX0A 1PX0A 3LC2O 4LJLA 1KS2A 4WRRA 1M8FA 3ICVA 3JQGB 5JFTA 3KLOA 3EC2A 4QDTA 2WT4A 2ZWAA 3KZ1E 1ZVMA 1GL3A 1E6WA 3WQHA 3OVMA 4FS3A 4ZCQA 4ED9A 1GYRA 4GBGA 3W5CA 5F3WB 3P2JA 1TYDE 3WHPA 1SBNE 4UBJA 1P45A 1XL1A 1DQZA 4GI2A 5BR1A 3KLMX 1GNLA 5FCDA 4FS8A 2LIPA 1H2RS 2CYAA 2FSVC 2Y1EA 3LY9A 4L5JA 3GFTA 4X1KB 4XYBA 5JADA 5CW1A 1E1CB 2O1EA 3V48A 1ZMOA 1U9CA 1MAVA 2AJTA 3BD9A 3EIQA 4LSMA 4C6TA 3FYCA 1BXRB 3E03A 4GPTA 4DY4A 5D3QA 1K6XA 3WGHA 1D2EA 1FDTA 2ZYVX 1XCBA 3LL4A 3PIIA 4I4TB 4IHKA 3TM5A 2JDID 3UG7A 3VKVA 4B8ZA 4CKCA 1TTTA 3GH1A 2R8BA 3STYA 2BTQA 3IUSA 2ZR7A 3NPAA 2RAPA 3E7FA 2C2OA 3INNA 4ZHQF 4HDKB 1NXSA 3K7EA 5EKXA 4UATA 1FMLA 1ZGJA 3ZIDA 3T9BA 2BBOA 1U2QA 3K0FB 2ZYWX 3FCUB 4LSWA 4MRPA 2GN2A 4AXXA 4IIDA 2G7MC 1XELA 1S89A 2P1DA 4GL2A 1SVKA 2BI7A 1U7TA 3EQZA 3GUUA 1U2TA 5GGXA 2OQRA 4HD8A 4NAHA 1OXKB 2IHZA 3TW8B 5KAMA 4HMQA 2VZ0A 1E2FA 3ZE2B 4DLZA 1D2MA 4E88A 1FFXA 2O2XA 3HV2A 1AUVA 4LF6B 3Q5EA 3F74A 2QROA 4FFBA 4W1RA 3UC9A 3EZXA 3U3XA 3FCAA 4NMLA 4MMZB 2DQYA 2XQJA 3JARB 4MV8A 4RZQA 5KJ1A 2YC4C 3NGXA 1S7GA 4O4JA 5JZSA 1QRAA 3BHJA 1Y8CA 5EVJA 3TZQA 1IRXA 3WAGA 4N9QA 4CT5A 4ZCMA 4OA8A 5E1BA 4CIDA 4M49A 2QE7A 4LCJA 1U2GC 2C5FA 3P71T 4NOJA 2JAOA 4DADA 4YI3A 5CD9A 3HA2A 1A8PA 1K8XB 4QRDA 1FB5A 4V39A 4L8FA 1VLHA 3ZGVA 1T4GA 2EKQA 3NBAA 3MTIA 1E59A 3CA8A 2ODEA 1S02A 1VBNA 1Q0HA 2E4YA 2ZJ3A 3AUUA 1D4FA 3FNRA 3RVBA 4JQZA 2ACKA 2GBLC 4W8HA 5D01A 1PDOA 2W11A 2AZXA 4ZYTA 1DTSA 1HTTA 2DTXA 4F8JA 1TNDA 1H69A 3QBEA 3QU9A 4X63A 1ZONA 2A9OA 1W44A 3GZ4A 3O93A 1VCOA 5ADHA 3WRVA 4EHIA 4M1SA 2HBYA 1ZCJA 2OYSA 4DE5A 1SQ5A 2YFKA 4RIGA 4I1PA 5KYGA 1BMQA 5DT2A 5TGDA 2LNDA 8MHTA 3V1UA 2PUWA 5ALUA 4M98A 1FP6A 4TS4A 4MHSA 4XJXA 2PS0A 2ZEJA 3QPUA 1FE8A 1XDWA 3GLSA 4K87A 2CK3D 2VYQA 3W6PA 2OK7A 1RQ7A 2JCVA 1I3OA 1SOWA 2MOKA 3K09C 3E5RA 2GCGA 4N5MA 2Q3MA 1KY2A 3F6YA 3FCSB 4G1EB 1ESMA 3KB8A 4H4CA 3BICA 4MRRA 4CTNA 3HVJA 4L5BA 3L4KA 1IFXA 5DPMA 4KHPB 3QLJA 2ZSUA 1EFLA 4S1OA 2Y1XA 5I7RA 2VK8A 1U0OC 4RELA 5IDWA 1Y8AA 4OQEA 1BROA 4PLFA 4PPQA 4UMFA 5KWEA 4RSMA 3IEMA 1SVUA 2PWYA 3KVYA 3TZLA 5F64A 4CDMA 1ZNYA 3KX2A 4YACA 4DRXA 5JXHA 5DHPA 3BH0A 3L84A 4P34A 3DTVA 3ANXA 4OCZA 3OEEA 3RC7A 3CH4B 2PMFA 3S1AA 4AF7A 5HIIA 2O8CA 4XIIA 5EINA 4GWKA 4LWZA 2YJ3A 3I9MA 4NAVA 2PSEA 4JYPA 1G63A 2ZIWB 4IMJB 4Z3KA 3EXIB 3ITNA 1A2OA 1Z8NA 1CERA 1OPRA 2D2EA 1N92A 4QGBA 2WJ3A 3F98A 3PNMA 5KX5A 3T1YB 1YTUA 1KC1A 1WA5A 1E3IA 2B8WA 2OOSA 1G5FA 3ESBA 3HGMA 5EP2A 5P21A 4EJ2A 5JS6A 3RYCB 5ELMA 3CX7A 4MMXB 3SQMA 4HB2A 1NGSA 4J90A 4KWTA 3RIXA 4CT0A 5BN5A 1FSPA 4ZI2A 2EGHA 3RVOA 2WUWE 1C9NA 3G0IA 1TF2A 4DRYA 4IDCA 2GJAA 1AN0A 2ID4A 2GJSA 4JBHA 4KR3A 3UK0A 2QN9A 3D6AA 5L7YA 1YB4A 4TV9A 3FPAA 1NVXQ 2PX8A 3WG9A 4Z9FA 5C5IA 4RFVA 5JAIA 1RYNA 3HC7A 1C4KA 3ZCQA 1YZNA 1VLJA 3QG5A 2R00C 1F0YA 2HMSA 3PFIA 1JNYA 2O6HA 5F7OA 5C8YB 3TFOA 1XPOA 3EGOA 3PXEA 2EERA 2IPMA 5J5CA 2GF2A 4M99A 2OAGA 2YBEA 1E1QA 3H75A 2NSDA 5LNK1 2YY7A 3UY4A 3KP1A 1EK6A 4FW8A 4BO7A 4NV0A 4ZYZA 1O2DA 2FW9A 3QI2A 1U99A 4RSRA 5DHFA 3E27A 4NH4A 5EHZA 2W8BA 5M29A 1W47A 1QH1A 4MV5A 3OFVA 4KZKA 4YREA 3SQOA 4U2DA 4RJLA 5F4ZA 1Q21A 1KEZA 1UPXA 3CSDA 2WSSD 3PEUA 1EVKA 5EC8A 1DIAA 1PT5A 5F2OA 1THMA 3PFFA 2F67A 4OREX 1Z3IX 2P7IA 2QDXA 2VJBA 4JEMA 2ZXFA 1LTQA 3R8XA 2IP2A 1AVTA 4J03A 2BGTA 2ZGVA 4QYTA 2YHSA 2ZBQA 1KP2A 1FFEA 3MWJA 2O3RA 3MWLA 3ROGA 1NXWA 3NPMA 4DA4A 1D5CA 3IOMA 3TSYA 4DR1B 5EMMA 4RTMA 1WVMA 2W00A 5BSHA 5FWXA 3DXZA 4ARZB 3E61A 3PTAA 1GVHA 2AVDA 3CNQS 3SHWA 4I4NA 1QORA 3A4YA 3K6KA 4PVCA 4FCTA 3ANYB 2IDZA 3DDCA 1T91A 2CVHA 1JXMA 3AT1A 4QDXA 1QH8B 1O6FA 1KPGA 2VUIB 3ESDA 3TE7A 3EVCA 1UAGA 1UOQA 2HO5A 4IDFA 4WZZA 4E15A 1EGHA 3N2IA 1R0WA 1RCTE 2EFDB 2G08A 2J0EA 5E4FA 1P4GA 4CEHA 1JAZA 1FMTA 3BJIC 4WXMA 5DJ5A 2YFHA 3IVGA 1OFTA 1XZIA 3E9QA 4AZTA 3U3JA 4E7OA 3KWMA 5CURA 2W58A 1Z73A 2FX5A 5JSYA 1JBQA 3UCFA 3PHHA 2BEKA 4YJGA 3WGJA 3JD2A 2XRYA 1T3LA 5ALZA 3DHWC 5KOHA 4F6LA 3GLIB 5GADl 5C32A 1ZRMA 1FYDA 1ND6A 3SEFA 4FX2A 4UU7A 2NSHA 4YCCA 3DHVA 4KYVA 2HRQA 2ARKA 2HJGA 4B7ZA 2FPIB 4PM4A 3WZ2A 2ZAOA 4I3HA 1M0TA 2Z6QA 1BA2A 1OFIA 3WLOA 4B6QA 3A11A 3P5SA 3PR2B 4CIBA 1U0HC 4MYSA 4X8LA 1ZJ6A 2GB4A 5JPCA 1NATA 4BX3A 5E6RA 4A27A 4M55A 4RK4A 2X4LA 2KHZA 3OSUA 4G63A 4IDGA 3V8VA 4IVRA 1AF7A 4YECA 3WGZA 2O8FB 2WW8A 4ENWA 1RHUA 1VG0B 2FUG6 2VAPA 3KYDB 3O47A 1GSIA 1O87A 2PZGA 1NNEA 4QO7A 1QRUA 5BSGA 1YNOA 1JIUA 3TZCA 1ZAKA 5CLQA 3WS7A 2CL6X 3N87A 4GC5A 4HFMA 1TE2A 3H5AA 4HTFA 5EN4A 1AZSC 1PNOA 3P9RA 1P44A 1ZGCA 3HWSA 4G4IA 1EGQA 3C5CA 4BRZA 5DTRA 4OHFA 1WPQA 4N54A 3EY9A 5I9TA 2J09A 2WHQA 3DG9A 4IIFA 1GPDG 2FSSA 4GOMD 2W2KA 1KO8A 3L8EA 3ROZA 3K70C 4KJXA 2O19A 2JH9A 2D00A 3HP7A 5JJKA 2WLSA 2Y77A 2ZBVA 4X54A 3FVWA 3H1BA 3H13A 4IJKA 5BRNA 3Q6NA 5CXSA 2OBXA 5JHGB 3GBPA 1J1UA 1KQOA 3R3HA 3F71A 2DY0A 3PNLA 1G3IA 1JEQB 5DXAA 3A4VA 4XFJA 4IV5A 1IXKA 4I5DA 4QUJA 4ZHQA 4W5RA 3U3MA 3WSVA 4HH3C 2J4DA 4M0PA 3C39A 3BK7A 4CU5A 1ZUWA 4TV8F 3PQ4A 2DH5A 4H27A 1ACJA 1NLYA 4N0DA 3MRXA 1L7EA 3FMFA 1CWUA 3HVHA 2TS1A 4EKEA 5EZYB 5EKUA 5U4QA 2V97A 1CZHA 4BNIA 1U7WA 4TXHA 1ZK3A 3QBJA 4C21A 4UULA 4V1CB 3AU9A 4Y2VA 3NYWA 2NYUA 3HBMA 2QSJA 1V4NA 1ST2A 4OJNA 1MC8A 3PJFA 4K86A 1NW9B 5FPSA 1SG9A 3QFSA 2ORVA 4FYKA 5AW3A 3T52A 4C0KA 4YT2A 3L8HA 4MW5A 1JW9B 3LBHA 5JNUA 1N6NA 4MIOA 2H1SA 2WABA 1RM4A 3K2BA 2JD1A 3L8MA 1WBJB 2QJTA 3B3QA 3P9QA 1Z7WA 5FL7A 3LFHA 2NNWB 3DO6A 3PENA 2GSDA 2VJLA 4KCGA 1T5DX 1V6SA 2QRGA 2QR3A 2BEVA 2ZI5A 2ZJYA 2VPXA 3H42B 2YVLA 3NJ4A 3Q3EA 4FFPA 4OUDA 3VSEA 4CGZA 1XYGA 1B76A 1CS4C 1NMXA 1NKTA 1SRRA 2OKCA 3IXMA 3NNSA 1FSFA 2EAUA 2Q5QA 4NH0A 3ZXXA 4W7SA 4BWYA 1L5OA 2LW7A 1RIFA 1STOA 1JHPA 3LK6A 3PBKA 1Q95A 5HK9A 1P2SA 2JPDA 1PJCA 2O0HA 2W48A 3MGGA 3P0RA 4WA8A 1TM1E 1K8YB 1V7CA 3E3AA 1GGHA 1WXIA 3IA7A 2YRXA 4B4DA 1AN9A 3EDQA 4WPGA 1CS0B 3HCRA 4P6VF 2GTHA 2UZ1A 1EHIA 2AL7A 3AF5A 4YRPA 5JMTA 1L5YA 1I32A 3KJEA 5IX8A 3AR9A 5THKA 4ZV7A 1ZFNA 3TTVA 1LQTA 2WWRA 4Q6WA 4Q48A 3GAMA 4LPKA 1DUIA 3RC1A 1DEKA 4WOCA 5LM3A 4WY2A 4EW1A 4IXTA 4E5VA 2EX1A 2O52A 5AVJA 3REFA 2FB9A 3G8AA 4WXHA 5F76A 4C5BA 1QG4A 2DX7A 3W2FA 2C2KA 4REQA 1DXOA 1Z0DA 3LT2A 4CM8A 1DCKA 2WMOB 4GM1A 4LA4A 1T10A 3DOJA 1YHNA 5K05A 3ASVA 2OFWA 3DWIA 1YJ8A 2C7BA 4QXMA 3FUTA 3PYXA 1VGRA 5JNRA 3KPJA 3THRA 2HHJA 2I03A 4MWOA 3ZHOA 3C3WA 4IG4A 1JEDA 3NI2A 3KSUA 2B4YA 3BEDA 4GPIB 2KM1A 1LKZA 4JBIA 1OLOA 4JITA 4UQPA 5FA5A 1A2BA 1F9EA 2KWIA 1QR6A 4HLUC 2OHJA 5EEGA 2PU5A 1WEHA 4AWAA 4BQRA 3AF6A 1F8GA 1R0KA 2VT6A 5I7HA 4JJ8A 3G2MA 3KUKA 4IJQA 1JYEA 1AB6A 1PCXA 2CFOA 2B7LA 2H1LA 3B78A 4G5FA 4BQEA 5CVTA 3R4CA 1GUFA 2BUBA 1RPNA 2PGIA 4ZO4A 3HRKA 1DZIA 2E3JA 2XF2A 5GAJA 4MO2A 1C7RA 4QC2A 5HM6A 5LBTA 3NDJA 4HDMA 4MEAA 3GAFA 4KXNA 1BVUA 2F8TA 2XOKA 3QVOA 1MJGA 1UT8A 1B8VA 1KDPA 2VL7A 2WHYA 5C1BA 4JYBA 4AP9A 1Q84A 1AS3A 1SBTA 2WVAA 3GEHA 1EDEA 4I9UA 2VT3A 3AVUA 3NT5A 2ZBDA 4M0LA 1K2VN 3B6MA 1NVBA 5CB4F 1QFSA 3FR7A 4RTSA 4PC1A 3J81A 1YVDA 1QTIA 4KE9A 4M1OA 4CDRA 2E87A 3N5KA 1DKOA 4QECA 3NEPX 4TSFA 4Y9UA 1GRNA 3IP1A 3H0EA 3NBUA 2PMBA 2IV2X 1RI2A 2YV3A 1QG2A 4ZPJA 3B6IA 1ATIA 1G0NA 4FSXA 1DTWB 2NP6A 5C5CA 4B84A 1E3MA 1XJ0A 4W63A 3HR4A 1TM3E 4OXXA 1IBCA 1RE0A 1R5OA 3SBXA 4E33A 3NM5A 1NR5A 1CUJA 3PI7A 4HPXB 4BV9A 1OWNA 4C7XA 1Z3CA 5ABPA 1PK7A 4GQIA 1W8DA 2YN2A 2HTEA 4RHUA 3VPGA 1QRRA 4R51A 4G23A 4R1QA 3KCQA 4Y2XA 5EE1A 1Q7EA 3DAOA 4Z86A 1L4FA 2QTTA 4KP7A 4WLVA 1JKIA 5IBRA 2QA5A 2CNWD 1R9JA 1X7DA 1YMVA 4M1WA 4QFDA 5BUZA 1A7KA 3Q12A 3F5MA 1KSGA 3C74A 4NE2A 3WB0A 4YMVA 4B85A 1LS1A 4OL9A 1OIVA 4DT1B 3LQRA 5JCOC 3L5OA 1OH5A 2BFBB 9LDBA 4HXGA 1MDBA 2HDOA 3TSCA 2QGNA 1UC4B 3T9EA 3U0BA 3MJEA 1IHUA 3GRVA 1JBEA 5LQCA 2WPDA 4LOIA 3G8BA 4RIEA 1TC1A 2REBA 3TVTA 3WGKA 2QVLA 5EWJB 1J06A 2IUEA 2B4RO 1NASA 3DQQA 2YW9A 3FTNA 4HNUA 4P38A 1FQJA 2C5SA 4TT3D 1Z8FA 3NBZC 4C30A 3WQRA 2NGRA 1QPZA 5JNWA 1Q6ZA 1RVDA 3R7LA 4FHZA 4CTMA 4CM5A 1M2OA 2P8JA 3T0IA 2PD6A 3D2CA 3RBZA 2CB0A 1SCBA 4G86A 1RYDA 5IVIA 3LT5A 5FEMA 2WIFA 3TTUA 3J7TA 3MGKA 4GI1A 2B3TA 2WIJA 1MMFB 2P2NA 2VUHB 1JE1A 1NNI1 3RRMA 2I33A 2OO7A 4B6EA 4D3FA 3V97A 2ZYHA 2UUBB 2VAMA 5A4FS 4V0NA 1OW3B 2NVUA 1EFVA 3OEYA 2DGDA 3QEJA 2DHRA 4ZQHA 4YRZA 3IE1A 2QL7A 1DWUA 4LRXA 2QG9A 4HB4A 4B46A 3BMOB 3O8NA 2UZAA 4FB5A 2PT6A 3L1VA 4KFTA 4LHSA 4N3CA 2FWRA 4B3TB 3EZNA 5DM1A 1KEEA 2FCAA 2DQZA 4OXKA 2WWYA 4P7JA 4MP6A 2OO5C 1Z18A 2WTBA 2RI6A 3BTOA 5BUCA 4P31A 1J23A 2GAJA 1H1TA 5JDCC 2IA5A 1RABA 4B71A 4R9SA 3K20A 4NU0A 1QGUB 4BBJA 4A6DA 4EECA 4ZCTA 1V3UA 3UMMA 1SUWA 1WZ2A 3DBIA 4B2LA 2IUTA 4O33A 5JARA 2RGNC 2VF8A 5ADVA 4CGYA 5KSYA 1EP2B 3P0EA 3WK5A 3C48A 3FMPB 1K1EA 1WZEA 3VPCA 3DZCA 2HMVA 2WU3A 3DLPX 2R68A 1XEXB 2YOHA 2A9VA 3THWB 3CHYA 3FUCA 3CKLA 4MULA 4POAA 3RTCA 2WA1A 3WHLA 4EENA 3TX6A 3TX2A 4NONA 1MOPA 1S2MA 1V7ZA 5ER9A 1MB3A 4AYWA 2ON6A 1IOLA 3UV3A 5IHPA 2Q7OE 5FUXA 3H86A 2QUHA 4PYIA 4C4TA 2PT5A 3HDYA 1SJ9A 5AXBA 1FSSA 4O02B 1XMIA 3PC4A 3SVLA 2DETA 1I7LA 2DU8A 2JGFA 2ODPA 2O2CA 3OPQA 4JH0A 4MUFA 4UDXX 3I4LA 2JLZA 2RIRA 4YAUA 4L4SA 4HAWA 5CW2A 1BVYF 1ZC4A 2F43A 2RD2A 2V0GA 4XFKA 3WNQA 1HKHA 2VRWA 2A1IA 4Y9TA 3RU9A 3W0LB 2YBDA 4MI9A 3SKYA 3D59A 4OO3A 4QPDA 2AOUA 4TV8A 4J49A 1I0LA 5TQVA 1PZMA 4MDFA 2C8JA 4MKZA 2BAGA 5CLGA 1QCCA 1RLJA 4DIOA 1WV0A 1YZFA 3SQXA 1Z0AA 3L40A 1EFRD 4YDQA 5LL6P 4I1VA 2R1ZA 3M49A 4QYWA 1I33A 2QRUA 4PLYA 4CQMA 1ADBA 1E61A 3NTUA 5H83A 3DKPA 5LBUA 5IJZA 5AVWA 4YRKA 3PRKE 1B3BA 2Q3BA 2KBFA 1H1DA 2AHOA 2BI8A 3H2SA 5DO9A 3SY8A 4F11A 3BKXA 4I55F 1KH3A 1ISSA 5CB6A 2P6RA 1B16A 3ID6C 5F4BA 1EHCA 2CF6A 2HCJB 1Z7YA 3ZHUA 1DV2A 3OPMA 4GR5A 1UOEA 4HF7A 5IT4A 1KNQA 1RHQA 4KQFA 4R98A 4RVNA 1WD5A 1HE8B 2XUHA 5K6RA 4KXVA 3K1JA 1TUEA 2QL5A 2AEFA 1JGTA 1NKSA 1GO2A 4X97A 3EEYA 1ODFA 1QC5A 2JH3A 3K32A 1JQ5A 3HXTA 3ILVA 4HDSA 3GLUA 1X15A 5L53A 1WUKS 1PRYA 1GVNB 3I0MA 4TYMA 2EKPA 1E6MA 5BSWA 3IBCA 2QVCA 3K9HA 1CE8B 1YULA 2PR7A 2XWQA 4IJ6A 3RRXA 4JKOA 3KUUA 1A9SA 1KYIA 4FFMA 1K4KA 4ZIRB 4JCOA 5G1NA 5JJLA 1VJ0A 3EPPA 1Q7GA 3KQNA 3AL3A 3JU3A 2PQ0A 2WIAA 3H6HA 2IX9A 2J9RA 1DNPA 5SYNA 5M04A 2FEKA 3D3NA 4BLQA 3T4PA 3DJYA 1O54A 2C7GA 4CVNA 4DXHA 3TLMA 2AEMA 1GYPA 4EG5A 3PNOA 5FPKA 4Y2TA 5HRUA 3R7AA 1J0EA 3EMVA 1H8HA 4D8UA 3N8GA 4BYMA 2XKKA 3I5XA 5K20A 5G02A 4CV2A 2J67A 1HNNA 1B43A 2XCTB 1O6CA 2PH1A 2HIHA 4ZJPA 3ONNA 3DQPA 2NQ8A 1E3DA 3G8CA 2V9ZA 2YN0A 4L6AA 4EGCB 5L8VA 3JZIA 3TZ6A 5JAZA 2NYRA 1LUAA 4YNBA 2PS9A 1UKEA 3O2JA 3U56A 1MGOA 4JR1A 3KUCA 4MPRA 5EEHA 5G4KA 4C4OA 3U62A 2GN0A 2W93A 4J0FA 3RUDA 4P3YA 4YROA 2FSVA 5BUSA 2H4HA 2G0NA 2BW0A 4HQFA 4EG6A 1E8NA 3AZQA 4WWHA 3JR3A 1A82A 1NG1A 1ZJ5A 2ZQYA 4PC6A 4AN4A 1F48A 2C1EA 3DOUA 5ICCA 3ZCXA 3TQOA 2VF2A 3DV2A 3ND8A 5CJJA 4BNUA 1JWBB 1TU0A 1KARA 1NMEA 1P2GA 1QO9A 3BDIA 3P9YA 3U1TA 1P33A 3Q8WA 3K9GA 2XHEA 5CP8A 2V54A 1YGYA 4C0WA 5JNLA 1H1LA 5JCJA 5DTIA 1RRCA 3Q0IA 4X8HA 2JGDB 4LJ8A 2I8LA 1RPAA 2GHRA 2OCBA 4J0DA 4PBSA 2H9IA 3JQDA 5CFLA 1CQZA 3O26A 4URXR 2XVZA 5KC8A 3LTEA 4QYIB 4Y6GB 1OUMA 1ZGHA 1QF6A 4BMDA 4EY4A 4X85A 1R8XA 2VNSA 3EYWA 5HDBB 1QUFA 2J85A 1HFWA 3ZW7A 4ZO8A 3ZXSA 3UT0A 1IRIA 3G7UA 1SKAA 4EPXA 1ABBA 4B6OA 4MVJP 1MHTA 2C5AA 2ZUVA 1Z36A 3USZA 3VQTA 4N8SA 3A58B 4YUZA 4RS4A 5K0SA 3R6TA 4JK3A 3I9LA 1Z2NX 2NT3A 4YJ2F 1YR6A 1O5TA 4O3FA 3VAAA 2B8JA 4PN3A 4HQ6A 5JMPA 3H83A 4UU8A 4JBXA 3VU9A 4J4HA 1HE5A 1WRBA 4X0EA 2V45A 3RUEA 3PHCA 1L7XA 2OBLA 2GNOA 2QN6A 2R97A 2WJAA 3A14A 3OKCA 3PC3A 4ARAA 4AUMA 5B36A 3QWFA 1C9EA 4UREA 2VHEA 4XSVA 3ZWPA 3O31A 2OC4A 2Q1WA 3IMCA 2G71A 2NZ8A 3UJ6A 2Q46A 4JR0A 3U3RA 3HDVA 4MR7B 4H60A 4H1UA 1E5XA 2O1WA 5HF8A 1ZHFA 3PGA1 4BTEA 4LXXA 4DS3A 5JCPA 2I6QA 4WK2B 3WLAA 4DL9A 2XTMA 3G0DA 4H2DA 3T99A 1SHUX 2GYWA 3DMNA 3IE0A 4RXUA 4EMUA 1K08A 2ATIA 1R9MA 2I4NA 2OWDA 2Z8ZA 4DF3A 3B1ZA 1Q17A 4LV5B 5FYQA 5AM2A 4B0OA 1NVEA 1L6RA 4QGSA 3QVSA 1FYEA 3CF0A 4P08A 4EMTA 4UFNA 1B1AA 5LLSA 2IGTA 4O59O 2JDIA 1PZGA 1K9VF 4TYYA 3VO2A 1FTSA 3DULA 1KI6A 5BV0A 3F96A 1GQ2A 3Q3HA 3T7RA 4C7BA 5JPIA 1MT3A 1Z5OA 2PZFA 3B9RA 3OQVA 4YMSA 1MZPA 1EUZA 4N7BA 5I7VA 3C6KA 2HX1A 4PLGA 5HUHA 1ZIPA 2I65A 1T8RA 4PTYA 4AZSA 1WXEA 1G6HA 1VL2A 4FN5A 2QYSA 3ZQJA 4G1FA 4TL9A 1UC5B 4JY7A 3RUCA 1DPFA 1G9SA 2V6MA 1Z6YA 1SKUA 1AM4D 2DPYA 3EGXB 3QRWA 4Q7MB 5FULA 3U7IA 3V32A 1DWOA 4JP5A 4MB0A 5ECDA 3AIMA 3DBRA 3GLHA 3AQ4A 4FUTA 5KNCA 4TTSA 4QTZA 1Y89A 2HK8A 1X19A 1YI8A 3I39X 4PGAA 5FADA 2XCIA 3DQZA 2H92A 2VAWA 1UP4A 4OPMA 4UDNA 1KO1A 2IF0A 1C0EA 3CVJA 2ECFA 2G0AA 1MTOA 1EFPB 3DHNA 4V1CI 5JT1A 4Z3OA 2ZYUX 2XZTA 2QVBA 1V16B 1R18A 1HRKA 3R3SA 3MCTA 3OX3A 5ALDA 3TECE 3X1WA 4R2IA 1UANA 1XTSA 2DH6A 2AI1A 2AWOA 3KJFA 1UPTA 3SSMA 1J9EA 4JI5B 2YUIA 3BWXA 4DLSA 3VJKA 1S5PA 1YKSA 3COYA 3QQ5A 4KXUA 3TGLA 2DBYA 3DT6A 1NQWA 4KUHA 2PWBA 1MJNA 3ESAA 3DDNA 3HUTA 1UEXC 4NICA 5FV7A 3IQZA 3ZWQA 4XRRA 1XO1A 1IBLB 4L78A 1VP9A 4Y1EA 4W8OA 2NZUG 4CJXA 4JJ6A 2JFWA 2YZKA 2HRDA 1QS0B 1SH7A 3MINB 2QNBA 3UFXB 3S2EA 2C3OA 4LI0A 2ZE8A 1VZ2A 2EDAA 4KO2S 3W2TA 3HK2A 1YI0A 4M7PA 2Z5LA 3MTDA 1KTIA 1C7FA 2IYZA 1UC8A 1NXQA 3OIWA 3U81A 1VKOA 2AMLA 2WNHA 2Q50A 3NKFA 3WMFA 4CKWB 3A9VA 1MFZA 4XE5A 3MILA 2GCOA 2CK3A 2EKZA 3TRFA 3VC7A 2FP4B 4FOPA 4QOJA 2IHTA 5EHQA 4IMRA 4D46A 1UZNA 2V7UA 4YMUA 3TLJA 4HL6A 1J2YA 4FP9A 4GZMA 5J63A 3WP1B 4CRWB 2G63A 2WJWA 2YTZA 1EWRA 3F9CA 1OVGA 1TFRA 2CUKA 1NSYA 2FFJA 4JX9A 2WIKA 4G6ZA 5DH9A 4KRFA 3U7FB 2I6XA 2JAPA 4HAOA 2V7GA 1E2MA 1OLUA 2GZ1A 5F3DA 4YP7A 2D1RA 4H7PA 1J2UA 3ETNA 4BO0A 3KAQA 1U28C 1BU8A 1Q83A 2ODNA 2OLJA 4K9PA 2RHCA 5GZ6A 4CCYB 5KMGB 5IK2D 2XPCA 2PUEA 4NQZA 2XA1A 4TYNA 2QN7A 4PLVA 4NJOA 4CTKA 5AIBA 3HRIA 5K09A 2GD6A 3KEMA 1LQ2A 5JXWA 3FMVA 2BN4A 1K4YA 3C8ZA 2PZEA 3CWCA 4PS0A 1CQJB 4BYGA 8AT1A 2R8ZA 1JDBB 3OQJA 1COZA 2RJNA 3N9IA 1HKUA 4ZDJA 4S2UA 3GJ8A 1XTJA 5BN3B 4CL3A 5DX8A 3WBJA 1YU6A 4PHFA 5AKKA 3EGDA 2WF9A 2H2IA 3K30A 4MAFA 4WXYB 5DYGA 3L0DA 1PG5A 3DKRA 4OA5A 4PYJA 1OB2A 1O6BA 3F4KA 1II0A 3JVIA 1ZJJA 2ZQ5A 2Y8EA 2C96A 1KXZA 1V8ZA 2FDRA 4RHCA 1A4UA 5J40A 1VCMA 3NASA 4P4GA 1YR2A 1LVGA 4JOSA 1JZQA 5DK4A 4EJSC 2PYZA 2NO0A 2WYIA 1N9GA 1OIXA 2X2PA 2GEDA 2ZW9A 3E81A 4EW2A 2JVJA 2ECPA 1KK1A 4F84A 3GC6A 1XZPA 1FRQA 5CR9A 2FZLA 4K2AA 4YMTA 1GTRA 2LTAA 3UV7A 1M9NA 5LUAA 3B89A 1LNQA 3GUCA 1VLVA 4O1HA 2BVNA 3FSJX 4I08A 1D4ZA 3B5EA 4ERXA 1ZVQA 4PZCA 2LP4Y 3EOZA 5H4HA 2F1KA 4F5DA 3QVXA 3ORFA 1FL9A 3E05A 2WSSA 5CNIA 4BKOA 4ZVLA 1AHHA 1PJQA 4Z4GA 5BSKA 3N8KA 5LJIA 3K0HA 4DIBA 1NJFA 1CUZA 4OG2A 3S40A 3TTWA 1C8LA 3N07A 2Q0XA 5IYZB 4IP0A 4GYKA 4GZ5A 1KWGA 1V2GA 3MLBA 4JJZA 1T2DA 3H9BA 3FZNA 3TGWA 4ROSA 3DMDA 4S1PA 1HOTA 2V0NA 4Y0AA 3OX4A 3Q98A 5K0EA 2YHIB 4GM0A 3GJTA 4R7TA 4RD2A 1DKLA 1D8AA 2IWHA 1CULC 3RS0A 1X7XA 1RRVA 2VH5R 3JQBC 2JBWA 2Z8YM 3EQ6A 1R0SA 2X77A 1OX4A 4LISA 2NX2A 4RPLA 2NU8A 1MD9A 1P9LA 1SBZA 3DV9A 1E3WA 4C6HA 1PDWA 4KLNA 1WEKA 3AZPA 3M7IA 1LI5A 1WTAA 2ASVA 4C3UA 4ZPXA 4A73A 4I9FA 1ZR2A 3RG2A 1NYQA 4X92A 1IM8A 4ND2A 4KWHA 4NLLA 5I5GA 5AW9A 3LYAA 4MRMB 4B7XA 2QMHA 5JFOA 3UT5A 2JBHA 2IOYA 3K94A 4XWWA 3Q9UA 3SIXA 3GY0A 3T34A 4JJAA 2E1PA 1P5HA 4HG2A 2AOXA 4DYDA 3GLQA 1KO7A 3G49A 2MCFA 1LDGA 1Y8QB 3ZCSA 3VR6A 1A97A 4E14A 3QXJA 4JB3A 3SZLA 3JQGA 4TQ9A 4B3FX 4M7RA 5JRDS 3LXUX 2ZT5A 4GRIA 3SZ3A 3VZQA 3L4EA 3GB9A 1NWHA 3K1AB 1SOVA 4KPGA 4BNLA 1SR8A 4K88A 4K9KA 3KBOA 3PL1A 2A0KA 3GLIE 3GEIA 3GIDA 5TQ2B 3OPXA 4YJ2A 2HWYA 1VL1A 4H31A 2QRVB 2I2XB 1FQWA 4XTRA 2GK7A 4MUYA 4A8JC 5HUJA 3J81k 1E1CA 3ZIAD 1QIIA 3BWMA 2OB2A 2EBWA 2VI5A 3QA9A 4D7AA 1WQ4A 3TKAA 3W4KA 5K0GA 2XZOA 3RHTA 1PQPA 1DOHA 4DMUB 3S2FA 1KU0A 2D5LA 5LR6A 3N2YA 1X1AA 2CMHA 4RQTA 4X64B 1RPJA 2HAEA 3AR3A 1VL6A 1XVTA 2XCLA 4O4HF 1QZTA 4AJEA 2A3NA 4N1AA 3GZNB 5SZIA 5PGMA 2ZPUA 3AP1A 2NVOA 1R3UA 3MWKA 1U7DA 4FHDA 1U1IA 4HUQB 4AFNA 3NH6A 4D56A 1TLLA 1W9HA 5HQ3B 3SHVA 1YU9A 2B35A 4KJZA 5ECGC 5I3ZA 5KTYA 3OIDA 5DWQA 5JFGA 3K0FA 2PZMA 2C77A 3F8WA 4LOLA 5DHQA 3IV7A 3RVRA 1ULUA 2RC6A 4QULA 2C0CA 2DFKB 3QX7A 3MWDA 2WB4A 1I80A 4LJAA 4BLWA 4DLXA 3CVYA 421PA 1A9PA 4IMPA 1ECCA 3ORHA 3EHDA 3DMPA 3QEOA 4LG1A 2HSGA 3BGIA 3KQQA 4QT4A 4KU4A 1E58A 3WVNA 3TE6A 1YZUA 3WKCA 1R4NB 1US8B 2WKSA 3JARA 4DCVA 1QO7A 2HQ1A 2C5BA 3P7MA 4O5AA 4F4IA 4EY8A 1KETA 5EUMA 1ISPA 5GJBA 2XZPA 3A2MA 5KKAA 5TMDA 5JSFA 4YWHA 3UKJA 10MHA 3EZ9A 4GC9A 4YB8A 4ESEA 1JIKA 4L4RA 2GN4A 3AHEA 3EQ8A 2FSPA 1JIJA 4Q7QA 5AVKA 5K0TA 1P9WA 1SXJB 1ZN8A 2P9JA 1KP3A 3EVZA 4RLSA 4GZ3A 3F7NA 3PI6A 3AOEA 4MA5A 3COWA 3KB6A 4GOLD 1JSXA 2JANA 3FMGA 1KMIY 1ZITA 4LRTB 3UXEA 2QRKA 5FNVB 4AY2A 1VE6A 2H5JA 2FN7A 3CMMA 4FNGA 1YI1A 5JYDA 1AKUA 1WSWA 1YCFA 4HGYA 2IP4A 5EESA 1U7OA 3ACBA 4ZEMA 3SYTA 1N9KA 2Y93A 3I1FA 3KHSA 3WX0A 1Y9EA 3OCJA 2CLEB 4CM1A 4OQZA 1M6HA 3CJRA 3IBFA 4C7JA 2ZBFA 5F7JA 4V0KA 2ERCA 3EVBA 3I1YA 4IQ8A 1RD4A 3H9GA 3FWYA 4OYRA 1D1SA 1JXAA 1U5BB 3W9BA 3UJPA 4BQOA 2NYAA 3WL4A 1UMBA 1ZY2A 3IT2A 3CN9A 5KVAA 1HSOA 2WWIA 3R5TA 4UNRA 4GX2A 4URWR 4Q4AA 2N42A 1QNFA 3OHSX 5I4KA 3V7YA 3GD7A 2P2LA 5T4FA 4PYNA 1XAJA 5FPTA 3LLUA 4ILKA 4I36A 1SPXA 4AZWA 1F1JA 5CG2A 3GP8A 3VDRA 1U6IA 2MMGA 3R7SA 4IUBS 3WL3A 5HRCA 2QX4A 3CU5A 2WYOA 3DFIA 3GCXA 5T4EA 3ZGXA 1YD7A 3SCZA 2PN1A 4F9TA 5F35A 2FMKA 1DRJA 3OTHA 3PUYA 3KQKA 4PC3A 4G0UA 2F59A 3UUWA 4L57A 1D1TA 3RSQA 3SZMA 3HL4A 3HXOA 3EXIA 3VYVA 3HU1A 3Q2KA 3NHLA 2NU7B 4YQFA 2PLRA 3GEGA 1AQ6A 2XLCA 4GM4A 4PF1A 4F3NA 2IZ1A 5BWMA 1JFTA 4DA9A 2XMCA 2BGNA 3WGMA 5JJIA 1RC0A 4WDRA 4G07A 2IF2A 5DLQC 3SZRA 4AULA 3T4XA 1EZ1A 4H3KB 1XTPA 5C80A 3HR8A 4CKXA 5AW6A 4JC4A 1BD4A 5IAEA 5K8JB 1A9ZA 4QG3A 3BAFA 4DUYB 3VNQA 5DGCA 2NG1A 3SZOA 4AMUA 5KTTA 3ZDAA 1JSRA 1USUA 2JGNA 3RF6A 3KVNA 4F3YA 4Q9KA 1XTBA 2FZ4A 2PTGA 3E5MA 3PEFA