1P19A

Hypoxanthine phosphoribosyltransferase from trypanosoma cruzi, in complex with the product imp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
189
structure length
187
Chain Sequence
PREYEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypoxanthine phosphoribosyltransferase
publication title Interactions at the dimer interface influence the relative efficiencies for purine nucleotide synthesis and pyrophosphorolysis in a phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 51
structure length 187
sequence length 189
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p19A00
4RQAA 1BD4A 2H07A 4Z1OA 1FSGA 5IAOA 1GPH1 2H08A 2C4KA 1ECCA 4X44A 4IJQA 1V9SA 4M0KA 3H83A 4PFQA 5KAMA 4JLSA 3NAGA 1HGXA 2PS1A 5EUCA 5BSKA 4TWBA 2DY0A 5JV5A 1XZNA 1DQPA 3GGJA 4P3KA 4WMLA 1CJBA 1XTVA 1JLRA 1O57A 1OROA 1TC2A 5K51A 4RAQA 3GGCA 3ACBA 4MB6A 1XTUA 1G2PA 1MZVA 4P83A 4M0UA 4RQBA 4QRIA 1QB8A 2AEEA 5IPFA 1ZN7A 1D6NA 1W30A 3KB8A 2JKYA 5BQPA 1VDMA 4M0PA 1P4AA 1ZN9A 3S5JA 1I5EA 1TC1A 1NULA 2WNSA 3MJDA 2P1ZA 1L1QA 1STOA 3OHPA 4LZAA 5HIAA 1QK4A 1I14A 1P19A 1QCDA 1DBRA 1A98A 1J7JA 4RHTA 1DQNA 1IBSA 4RHYA 1QK5A 2PRYA 5JSQA 5ESXA 4RABA 4FYMA 2XBUA 1A95A 1UFRA 3HVUA 4P84A 1Z7GA 4RACA 1NONA 4LYYA 1P18A 3DMPA 2EHJA 1DKUA 1LH0A 4F8EA 3ACCA 1ZN8A 4RHXA 4WN3A 4LYGA 4OHCA 1HMPA 3M3HA 4P81A 1I0LA 2JI4A 4X45A 1AO0A 3G6WA 1PZMA 3LRTA 3DEZA 2JBHA 1BZYA 1A97A 3O7MA 4LZOA 1ECGA 3EFHA 1ECJA 2IGBA 4P82A 5HKLA 4LZNA 4RHUA 3DAHA 4RAOA 3OZGA 1XTTA 1U9ZA 4ZFNA 5BRNA 1A4XA 2YZKA 1R3UA 4RV4A 2GEBA 1I13A 2JKZA 1A96A 1VCHA 1QB7A 1UPUA 3GEPA 1O5OA 2H06A 1G9TA 4RADA 1QK3A 1YFZA 1A3CA 5KAPA 4QYIA 1VSTA 1G2QA 1QCCA 1DKRA 1JLSA 2HCRA 4KN6A 4S2UA 1L1RA 3N2LA 1Y0BA 2E55A 5E38A 1G9SA 1ECBA 1U9YA 5BQOA 4P86A 1BD3A 2PRZA 1XZ8A 1OREA 1I0IA 1OPRA 3LPNA 4JITA 4RANA 1ECFA 3ACDA 2FXVA 4P80A 4QYIB 4PAWA 2VFAA 1UPFA 3QW4B 1GRVA 5ESWA 1P17A 3OZFA 1WD5A 3MBIA
chains in the Genus database with same CATH superfamily
1TMGE 3GG9A 4ROTA 1LS1A 1N2ZA 2ONJA 2H07A 5A05A 1R0XA 4TMVA 3QJGA 5JT1A 2C29D 5ALEA 1KAMA 2YUIA 3C1TA 4O02B 2QJWA 3UG7A 4O59O 1LNZA 2WMOB 5JXHA 3O38A 4ZAYA 2XMSA 4BXOA 1KU6A 3OQMA 4IXNA 1YUBA 4TWBA 5ALLA 1P2UA 3VU8A 3NWOA 3RBXA 1NVMB 3NAQA 2WQZA 2B4QA 2XADA 1PJ4A 3AGPA 1BGWA 3EK2A 3GVPA 1EP2B 1V71A 1C7QA 1RQGA 1FS6A 5EA2A 1GZVA 1PR0A 2Y67A 1U1FA 1CX9B 4PRZA 4EG6A 1QP7A 2GLXA 4F8YA 4AURA 2A86A 2XNHA 1YRAA 2J08A 4EVQA 4FYJA 3B38A 3V4SA 2NADA 2QWXA 1NW8A 4PHTA 3CEPB 3ELBA 1DX4A 3HADA 3ML1A 4KO3S 3FPLA 4ZVTA 1CUHA 1YAJA 3Q7QA 5AKGA 2IV7A 1ZI6A 1RXWA 1EZ4A 1LV7A 16PKA 2NZ2A 3DEJA 3E8SA 4Q9IA 3GQVA 2WWYA 4M7RA 2FKAA 3WL8A 4U7TB 4EAAA 5B55A 3L7JA 4JT4A 5AUQA 3UMJA 1QHGA 3DB1A 4ZJPA 1N6KA 1UPXA 3MIIA 2PQ6A 3VZQA 4YRZA 5JSHA 1ZISA 3HZZA 4RIFA 3CRZA 1EQ2A 5LP6B 3F71A 3F7MA 1BNCA 4JJ8A 4P98A 4J8PA 2JGJA 3IDSA 5TPZD 2PXAA 1RWXA 4XIJA 5DF1A 2D7JA 3QXGA 4P5DA 5IJXA 5L4LA 3EH1A 5ALSA 2XBMA 3RYCB 3OZBA 1PJTA 2R8RA 2WNHA 1BCSB 3P2OA 4NWIA 3MMZA 3SBDA 3N2IA 3T5BA 4K9OA 2WMNB 2YJ6A 3TTYA 3EPPA 4YQYA 3QUQA 5JU6A 3FETA 3MTIA 4EY5A 1GTMA 5TEWA 4G0OA 5HK9A 3G5UA 2GBLC 4FDTA 1P5JA 1ZU5A 4D8XA 4KDEA 3T61A 5JYDA 5FNZA 1IM5A 4JI8B 1NJGA 2HXYA 5I01A 2ZJ7A 4P54A 2X0DA 1G8GA 1X1TA 3I0ZA 4FOPA 1VHDA 4IHQA 2DPLA 4G0MA 3QUBA 3FYUA 4HWSA 4U9HS 1I30A 4ZDIA 3H1GA 4KL8S 3MJCA 4ZDKA 1Q7BA 5JNVA 1I6MA 1V7CA 4EJSB 4IMPA 1XQ9A 1EZZA 1E7SA 1YZFA 4FI3F 5ECDA 1E9SA 3SIXA 1XQVA 3VNAA 4ICIA 4KQKA 1AZTA 1N5IA 1D2GA 1VSTA 2AOUB 3S2FA 1E0SA 4H7IA 5WRFA 2RH4A 2C83A 5ALKA 5JDIA 3DZGA 3QSGA 4RFLA 1DBIA 1X3LA 1IM2A 3MC1A 3A1TA 4UARA 3ESQA 4UBKA 1ZGCA 1UKYA 3N2LA 3WHKA 3T3OA 1UJ6A 5AKKA 2H9AA 5CH5A 2XNDA 3A1FA 4PZEA 4MVJE 3UGTA 5GY7A 4S1NA 3B70A 2WHQA 4KXVA 2H4YA 4MWGA 5HS6A 3PKJA 4B4UA 4JXJA 2G5CA 1T9HA 1HDYA 1L4HA 3KT3A 2RAPA 1KQFA 3DE1X 5ADHA 1E92A 1DLIA 1UBHS 3W34A 5SICE 2DGDA 4CQJA 4PS0A 1L4UA 1LW7A 1W96A 2C3PA 2ZYTX 3HJCA 3ZS8A 3CFYA 1MDFA 1JFRA 5B4VA 4MX8A 4DUYB 4C0SA 3D6TB 1DRWA 3KL4A 1HDIA 1NJ2A 4OJTA 5BSWA 4FX2A 2XHZA 3ZBTA 4ZZ0A 1E1KA 3UAGA 3UJAA 3P5SA 4DCJA 2ETVA 1DIOB 1YTUA 1C80A 3NKFA 4IQ4A 4NP6A 4DLVA 4QPJC 5H83A 1TC2A 5GOTA 2FPWA 3ZIAA 1QSGA 3LCRA 2Z83A 5AR1A 5JROA 2JJ2A 2A14A 2OGTA 1JVSA 1VJRA 3URKA 1IXYA 3ZKWB 1RRGA 4YP9A 3ADBA 4EW6A 4DARA 1A2KC 1CEXA 1SVNA 3MGCA 2AN3A 2G5PA 3FNIA 4OA5A 3EEFA 5E4JA 2P2SA 5A0FA 1Y8QA 1T1GA 3R0ZA 3D7RA 2HPAA 1GU7A 1ZMXA 3QEJA 2WICA 2W6QA 5GJWC 4ZOEA 5HBRA 4EVSA 2Q99A 1L1QA 4R9NA 1H9AA 2X4IA 2G5TA 1XNRB 2FFHA 4CMIA 1M72A 5CX1A 2P5UA 1ZDMA 4JQSA 4PO1A 1TRHA 1GGNA 1MHPA 1RMYA 3EGXB 1YVEI 4JBLA 1FYEA 1T9GR 2A9PA 4GMKA 2JLAA 4JUDX 3F98A 5L7YA 4HLCA 3PITA 4FC7A 1M10A 4QGAA 1IU9A 1VL5A 3ZE2B 4M4SA 1HOTA 2VT7A 2GZ3A 2HQ1A 3BGOS 1RBMA 1NR1A 2PMFA 1CZOA 1GPMA 2AZDA 4HDMB 3ZCRA 4ZI7F 3A9WA 2G09A 5KYXB 3M2TA 1H2YA 1M2WA 1MQ8B 1TO1E 2Z9DA 5GZ3A 4DR5B 3I39X 4E5PA 3F78A 3P32A 3HXPA 4EPVA 5JTTA 4C29A 4KQWA 1SXHA 3KX2A 4HAWA 1WOMA 5LKRA 4JEUA 4G0WA 1PFWA 4C0JA 3S1AA 3G9TA 2P4HX 1ORVA 1W0KD 1W1UA 2F9FA 3K0CC 2VHVA 3OVMA 2ZR0A 3QKUA 4FD2A 4IVPA 4UAJA 3D8NA 4LDNA 2IGBA 2ISCA 1WPRA 4OD0A 2GZ2A 3BAZA 3KZKA 4MV5A 2HSEA 2IHZA 4X91A 4ZVMA 5I9NA 1S4QA 3DZDA 1FJGB 2IYAA 2H17A 1ZW6A 4LEIA 4C7VA 3DVQX 3JSXA 3LBFA 4DLSA 2XRFA 2VQFB 3PEVA 5EZ6B 1U0RA 1DKLA 4MYDA 1ULSA 3I05A 3BXGA 3JS5A 5BSRA 1SCDA 4EKGA 1HE1C 1OAKA 1FDIA 4G97A 3E8XA 3HFSA 5LQAA 1J1UA 2QNIA 5AI9A 4TMXA 1EVZA 2XYPA 2OC4A 4JLBA 4QBHA 1DXOA 4UMFA 1M8PA 3PEFA 5C34B 2H5JA 2XDWA 4BB0A 3EEYA 3L8HA 1DC5A 2ODPA 3F6BX 2XUDA 2E55A 1Y5NA 3FMIA 3MNFA 2B9EA 4U7HA 4JI7B 1K3FA 2PRZA 2HDWA 2HA4A 3FSEA 2VHTA 2W6JD 3RFUA 3L0YA 4B5LA 4CF7A 4Q19A 2H2GA 4PSVA 4YI3A 1U0BB 1MVLA 2A0FA 3DTTA 1DEXA 4TSFD 3E35A 1P4RA 3QYFA 4MVXA 1NM5C 3EVNA 3N2GB 3NWPA 4NJEA 1AT1A 1D1SA 1JKJB 1NBHA 1QCZA 2OZVA 1IY8A 3DPSA 3II6X 5I7EA 2Z1MA 1V7PC 4DW8A 1GRCA 4GWGA 4M1EA 2IXEA 5JXGA 4L3WA 2DPHA 2I2CA 1ZX1A 1JFLA 2CJWB 5CIYA 1PFGA 4WINA 1HSZA 1B8NA 5CFQA 4MDEA 1JHXA 4G5FA 4JXZA 3FZQA 1GFIA 2DT5A 1YZQA 2P11A 1AGXA 1RT9A 3H6HA 1O0SA 2X8JA 1WB5A 1CNMA 1NVWQ 5BN3B 1IMJA 3JQ9A 3OOWA 2WUEA 3DPIA 3GAZA 4MIKA 3PD7A 3GAAA 3UT0A 2FVYA 4GI7A 2E4WA 1DEAA 2R4TA 1KJJA 1ODLA 3P0EA 1H0RA 1E1QA 3QE2A 5E2AA 4KR7A 3EEIA 1IUPA 4FFWA 3WGYA 3IO5A 4EECA 4J4HA 1IDN1 1LK5A 1QDEA 2YHUA 5KMGB 2P2LA 2ZE6A 5FUXA 2HUPA 1HE4A 2B1IA 3INNA 3NM5A 4BATA 2WIDA 1EK2A 1BU5A 1SQ6A 2WIKA 4HDNA 2XYRA 4HQRA 5FA8A 3RUPA 1D0IA 4QHSA 4QDKA 5HSGA 5IFKA 3AVTA 1K68A 4KQ9A 3MJDA 4QGBA 3A6EA 3GLSA 1ULHA 3O84A 1XL1A 1NQWA 3DQPA 3ZWDA 2BH9A 3H8WA 1GRRA 2OXFA 3OOYA 1ABFA 2D2FA 2FZGA 4UPVA 5IP5A 1EJ0A 5IAEA 3PEWA 3EW7A 3FLBA 4JFAA 5FTNA 1SXJD 1V3UA 1XTJA 1ORWA 3N3BC 4NBWA 4OK5A 1TCVA 2GZRA 5G40A 5T3YA 4UTPA 2MSNA 4CMJA 1VLLA 3UK2A 1CDOA 1Y7LA 4D3FA 3WXMA 1IG0A 1BOFA 2JASA 3F8TA 2R5NA 1J33A 4IIJF 1DELA 1RQNA 3K5WA 1AIPA 3AUAA 3GZ4A 5EHIA 2CFOA 4BBZA 4EPWA 3DO8A 4D9JA 5HUJA 2W2TA 3BRQA 2B94A 4MEJA 1QG4A 1ZI8A 4JUAA 1ESEA 1RBQA 1UM9B 3COPA 3OTGA 3W3ZB 4Q9AA 3E23A 4C01A 4M88A 2O1SA 5DCYA 3ANYB 3KHUA 4YHHB 2P4QA 2EG9A 5BSFA 2WIFA 4JZKA 2C5GA 2PY6A 3IVGA 3PXDA 3RROA 3OQJA 3IQGX 2JVIA 3D5TA 3OLZA 3T1OA 4N0PA 1L5RA 1IH8A 3D8TA 1CB7A 3OP4A 3VZCA 2WTBA 2C31A 4HZIA 4JD5A 1U0NA 3TEMA 3V32A 2UYGA 5E0OA 3L4JA 2QD3A 1GPLA 2XKAA 1KY3A 1R0YA 1A4RA 3CJRA 4HDKA 3GGOA 3IOCA 3R24A 4C0BA 4P36A 1XYVA 5HR5A 5KHAA 1ZS9A 2UV8A 4PNZA 3CVYA 3PX3A 2ZG6A 4ILKA 5KOJB 5A4DA 3R8XA 3RUFA 2IYNA 4QYIA 1PWXA 3IXMA 2NSJA 3OMLA 4MCJA 4II2A 1WY5A 2GAFA 3WMEA 1BKYA 4HZGA 3FRJA 1NXPA 1Q17A 2W22A 5DISB 5JZ9A 1Y1KE 3DLBA 2CVQA 5TPWA 3MCVA 4ZQFA 2XLBA 2FN4A 4W82A 4EJMA 4WBNA 1POXA 4N7BA 4OG2A 4MYRA 4UM7A 4Y67A 5H81A 2B7BA 4IJVA 3ICPA 5DXAA 4EKYA 4RF5A 1MH1A 4C5CA 3KVVA 5FR2A 3AI2A 2IXBA 4C88A 1HL7A 3VGPA 1P17A 4QTTB 3CVXA 1CRQA 2D4HA 3PEEA 1DEKA 3NTLA 3SYTA 4Z9BA 1JW9B 2JD1A 4FR2A 4YRTA 5KIAA 3JRWA 3QPUA 1VPDA 4DMLA 2P6RA 1EKXA 3QELB 1O95A 2UVQA 3QOYA 4H7EA 4JC0A 3RS7A 1NRXA 1Z8HA 3CN9A 5DWQA 3P96A 3X1ZA 4HQOA 1T4MA 5J2UF 4G9GA 3QGMA 1JDBB 1E60A 2RC5A 5HGXA 4OMFG 1H05A 1CY4A 1FFSA 3GGJA 4V03A 3IDZA 3TUJC 1CJBA 1L8QA 3V34A 5FBQB 1CUJA 3KR0A 4P33A 4O2RA 1UOEA 2ACWA 3OTWA 4X20A 1RC1A 3PQ4A 4YPVA 3E3OA 5BUZA 3CX7A 3QF7A 4EG5A 1JB9A 2BFCB 3BMNA 4DV2B 1NUUA 2JH9A 5F3RA 1EFAA 3CY6A 5LC1A 1D6NA 1KMCA 2VYFA 2XQFA 5K3FB 2IY8A 4KUGA 1W1IA 2EZ4A 1T0IA 2VBCA 2V7VA 4AWAA 3N86A 1NRJB 4LG1A 4XM2A 5AXDA 1BS9A 4E11A 1PGQA 1DC7A 4BEWA 4EAQA 4EGCB 1RHRA 3VYRB 2CLMB 3UENA 4B2PA 1ONOA 1U5BB 3DHNA 5GONA 1QCDA 2HA0A 4MAFA 4HT3B 1SA0B 1RPNA 4HB2A 2G8NA 1U2TA 2AG1A 5HZHA 4ZVSA 4BNDA 1JJAA 2QQ0A 4F4DA 3L1IA 1EX7A 5ARCA 4YXWD 2AVNA 1YZVA 2UKDA 1KQNA 1XEWY 2R62A 5DOZA 5AOBA 1PJLA 4DLAA 4DMFA 4JCOA 2OGWA 4UD6A 3NONA 1CZHA 3H2ZA 2AXNA 3IODA 4BKQA 4DNPA 3EVGA 3TNYA 2XRMA 4FFBB 5C9ZA 1RIIA 4HMPA 4JEIA 4B8ZA 4ENQA 4W7IA 3N6RA 4YS6A 1CUEA 1CY6A 2ZJ8A 4X7BA 1EDEA 3BHIA 5SYAA 5IC6A 4A8JC 1CUXA 3DXFA 1RZ3A 3AGQA 1Y6ZA 2HDHA 3O8DA 4OQNA 1MN6A 1VXRA 2ZSFA 1Z0UA 3S3TA 4NE9A 3RB8A 5JXIA 2JFWA 3CJTA 1BVHA 1PEAA 2GERA 4R2WA 3VR6A 1JIKA 2YV5A 3QVWA 4P8RA 4RZ3A 1XHLA 3EZ9A 2IQIA 3PCRB 4U9UA 3WIVA 2I62A 2WVGA 4M54A 3ZQKA 1K08A 1EFDN 1XQ1A 3GPCA 1NMSA 3KZVA 4PSDA 1H42A 2BEWA 4ARBA 5MGBA 1KWGA 4ESVA 1Z0AA 1MW9X 4DLUA 4G23A 1EBBA 4KKXB 3J81A 2Z57A 3F5FA 3JARA 3I73A 4BC0A 4BLOA 1RMQA 2C4MA 2GZ1A 2Q2OA 2QTHA 1WBBA 4YGXB 1I2MA 4D74A 3IT3A 2C92A 4MRAA 3K1YA 4UUNA 4FKBA 3ET4A 5LUAA 3P2IA 2QR5A 3DTVA 3P0HA 3JYQA 1ZRHA 1DDOA 2ILVA 2JEOA 1JNYA 2QEQA 2ZJ0A 1EVLA 4G2TA 4ITRC 4CV3A 1Z73A 1EFCA 2HSWA 3O95A 5KNDD 1NWCA 1WXGA 3O3CA 4H16A 1BMTA 1JYFA 1OD6A 4K9QA 4QODA 3CR8A 1JIJA 2C59A 2OG2A 3LBHA 1QP4A 1DHTA 1QFXA 5DHAA 2E48A 1AA9A 4C4XA 2PMBA 2FDRA 2G8LA 2QLJA 4XSGA 1O58A 5KTOA 4HCJA 4BMVA 4TUYF 3ETNA 5G1PA 2O7NA 4RESA 4UFPA 4ZICA 1G5RA 1OVGA 1YE3A 3AUTA 1KO7A 3H4VA 3K5PA 2AK3A 3QLEA 1Q1NA 4YNBA 5ITVA 1UM8A 5H3CA 2JHAA 3Q41A 2B4RO 4MGHA 1J21A 4MR9A 2C20A 2FSFA 2MINA 4AMYA 4DMHA 3CHYA 3KWLA 4S1WA 2X0FA 4FDAA 4I5DA 4M53A 2GVDC 4FB5A 4KIWA 4JYPA 1GCGA 1CZNA 4CIBA 1B7GO 4B09A 4DJAA 5FYDA 3N8GA 4XVRA 2V7TA 3TFOA 1BAPA 1QNLA 4L8GA 2I6UA 2ZQZA 4BZWA 2OHJA 3L6RA 3A4IA 1KQPA 3OWXA 1F0YA 3DMGA 3UT6A 5KQPA 3QX3A 3IMFA 3ZWYA 1N1GA 1J2RA 2FSVA 1SVLA 3E5HA 4ZZ2A 2CV0A 2BUCA 4F5DA 2M1XA 5EJAA 2C0QA 2FN9A 4KODA 2VDVE 4M21A 4RIGA 1PQ4A 3Q9LA 4C4AA 3JALA 1KDZA 4D81A 2H48A 2VA8A 4I4TB 3HCOA 1XN4A 2AJ8A 3KJHA 5LFAA 2A9RA 2WKWA 4OXQA 2QQEA 3HJGA 1SXGA 4PR3A 2OP0A 3RC2A 4EPTA 4PLFA 1SU6A 4F1JA 4QIHA 4TQUS 3TZKA 4DL9A 5IT4A 2PKQO 1SCKA 4DLBA 1SY7A 5CCBA 2AOXA 4AWBA 2V03A 5IXYA 1LQTA 3L6EA 3OLVA 4IUYA 4O2AB 5T8KC 4DJTA 3KKMA 3NWBA 1U0HC 3GJXC 5PGMA 1A9SA 3G68A 4EMTA 1D0VA 5KSWB 2YC2C 2NO1A 1Z26A 4C1NA 1MW8X 3ILHA 3M1LA 4HATA 1DRUA 1JEYA 4E30A 4ER5A 2NXCA 5EXDA 1Z36A 2QKYA 1UBNA 1S1MA 3L1JA 4ZALA 1TLFA 4OUDA 4UNRA 1L7XA 8OHMA 4RETA 3T3HA 4OP2A 3ENVA 3BDAA 2RARA 2R9VA 3PXEA 3P0IA 2FFAA 4NPCA 1RZUA 3E9MA 1BJKA 1RWMA 2BMJA 2ENWA 3L02A 2F8LA 5AH0A 3R75A 1UKAA 2DXIA 4KXXA 3NRJA 4W6QA 5ICEA 2J9FB 3HP4A 1EK6A 5KDLA 1WDLA 5AP9A 4HAOA 2ZRPA 3H2GA 1F4PA 1NA5A 1OFHA 2PUWA 2WUWE 3ZS9A 5LA6B 1LPSA 1PBTA 1K6MA 1T0BA 1OMOA 2C9DA 1FVFA 2CMGA 1YS2X 2BFMA 2JFOA 4BL5A 5JDCA 4CKZA 3TZLA 2OXIA 2SCUB 2VPYA 2YS7A 4PLZA 3WK8A 3PJEA 3PRJA 2QMYA 3AEXA 4NZ9A 5CCEA 2BJHA 1HV8A 3IR5A 2JLSA 3G6KA 1GARA 3IP6A 4MS3A 1JLSA 4HWGA 2Z3ZA 3RFCA 1H9BA 2VDKB 4RDXA 1NY5A 2I1LA 2YV1A 1F17A 2AOTA 3R5XA 1G64A 2WU8A 5AW2A 1LFDB 3G9QA 2I8LA 3ND7A 1GGKA 4YCSA 2OBFA 1JDUA 3SKYA 5BR7A 4MVJA 3ZWVA 2AK2A 3HTXA 3PWKA 4JBNA 4N12A 1D6JA 2Y0PA 2Z5LA 4CEJA 5IUJC 2XPCA 3B6KA 3WNQA 2B21A 4UBIA 2O1XA 5COAA 4EYQA 5CFZA 2FN7A 3HMKA 4H15A 4TVSA 4RTSA 5LZ7A 1PR1A 1VGQA 3ZD9A 5A7HA 2IDZA 1VCNA 2E82A 4QOEA 2P3OA 4PWYA 1HEIA 2CY0A 4R71A 3WG9A 5A3QA 4BUCA 3S2ZA 1YVDA 2EXXA 4X00A 3UPTA 1XPOA 5AOCA 1GPH1 3L6DA 4IH9A 3SZMA 1KYVA 3CZ9A 2XRZA 2C5SA 1F2UA 4CG2A 4DJJA 3CTMA 5CVCA 1JFFA 1JR4A 2PO5A 2TMDA 3B60A 3HNRA 5CBKA 5KB3A 1GPBA 5ALTA 2EWVA 3L05A 5A71A 4AK9A 1H2ZA 2CFRA 6NULA 1OLXB 3GUYA 1O57A 5U9CA 1MORA 1VHQA 2BFBB 4FHGA 1QTNA 5K51A 3HCFA 5BWNA 1AQUA 5DULA 4YN3A 5B1IA 2XXAB 1IOLA 4MLPA 3R44A 5HA5A 1MG5A 3V48A 4CTJA 2XUAA 1A0OA 1VYVA 4IV5A 3VNSA 3G0CA 1MAUA 3LSTA 4MRMB 1JRLA 4MKGA 1AMOA 2SBTA 5CFLA 2A9JA 2LBPA 4QM6A 4AMBA 2NUAA 1QYVA 2ISQA 2QVBA 3TGWA 3B36A 4HDRB 4U39A 2PH1A 3T4EA 4JUIA 5KSZA 2PJRA 2GYYA 3PC8C 3HKEB 3Q8LA 1TCBA 1PYDA 4LYJA 4OL0A 2BN4A 1Z8DA 4GU5A 4WKBA 5SY6A 5K6AA 2UXCB 2G6TA 1DAHA 4K7JA 2HJHA 1A1VA 1M34E 3SEZA 1OC4A 5LZ4A 3FMGA 3AH8A 4FFRA 3E9CA 4QT0A 3LCVB 3V2IA 1VPVA 2KLHA 4LDJA 2W4QA 1JIQA 3BRCA 1GHTA 2ZW9A 1GU0A 2B8NA 3OLXA 3K92A 4QQFA 2CVZA 3X1YA 3IX7A 4JNCA 3AHGA 2HU8A 4K3UA 3HP1A 4PEVA 3AWIA 4Q15A 1C7EA 3SGLA 5ELXA 2FK7A 3JV7A 3U9LA 5KNCH 4BPBA 2KLBA 4MLDA 1K8ZB 4XM1A 4CV0A 3L4BC 1N2CE 5B4TA 1QKIA 3PYXA 4NBLA 1JE1A 3D5QA 3BE5A 3D6NB 4DSNA 4GR9A 3PQ6A 5FI1B 4KB5A 3PIRA 2F8SA 3LFHA 1Y42X 4GVLA 1JQEA 3BMCA 5CMLA 5AM5A 5K01A 5ALGA 5D3MB 2ZAIA 1L5HA 1P1RA 3DUFA 4RKQA 1A9XB 2Z8ZA 4V0SA 1LI7A 4OKNA 4MV7A 5T64A 1L5KA 5JAOA 3H87A 4RXTA 1JP7A 2B1GA 4LYFA 1H4QA 4MUYA 2HIMA 1KAEA 2FRDC 4GIBA 1A96A 5BORA 3HFGA 1NC1A 3KHTA 4F9FA 4EHFA 1G5HA 4XGQA 1EFUA 5JJ5A 5IXJA 4K9PA 1NUQA 1FNNA 3QU4A 2W9XA 3GMTA 2FJPA 1DJPA 2CUZA 1PJAA 2WZQA 2YDYA 5G1OA 1Z28A 5TJ9A 3VVBA 5A5DA 1Q91A 3P9PA 4NENA 5FWAA 3X44A 3GGSA 1ML3A 1VXOA 1A2QA 3HDGA 3UF0A 1G9SA 3AIMA 1CEQA 4RK5A 2B1JA 2QOEA 2YOGA 2OGUA 1TQHA 4E08A 1C3OB 2R00A 3F97A 2R6GA 1CJVC 4L9WA 5B6IA 3D7KA 4HWTA 2O8CA 2V98A 2VK8A 3SBEA 5KNCD 1W88A 2P2CA 1WNTA 4LI3X 4QWMA 5ANRB 5BOSB 5JPCA 3NETA 2H7CA 2YV3A 4B84A 3DG9A 2ZAOA 5CJ2A 1UJCA 3ICWA 2QPOA 1A8PA 1BD4A 2H29A 3DOEA 3EXAA 3GLTA 3PNYA 3PWSA 4NC9A 4OBBA 1HTBA 3ICEA 2HMTA 4G24A 3TBKA 3I2HA 2BAGA 5LDHA 3LWZA 2A9FA 3H9BA 2CEAA 3QFHA 1OXMA 3JQ7B 4X71A 2XUJA 3WIEA 1TM1E 4CLRA 3KKOA 1KNXA 1EESA 4ZAVA 1KFJB 4WL0A 3LYAA 2BGGA 2WYVA 3PWTA 1U28A 1QQAA 1CIPA 5JEDA 2CBXA 2X2OA 4FZRA 5FL3A 4KQ1A 2IHVA 2XX3A 3OE7A 1FPQA 3P52A 2O4UX 3REQB 4AY2A 1UBKS 3E0QA 2GKGA 4NE7A 2ZRAA 3SSNA 3N75A 4Q1FA 1MJNA 1Q3TA 3JR3A 4D43A 4PN3A 4ZMSA 4JODA 3UM9A 2GHRA 3LMKA 5JQGA 3FTDA 1CFJA 1UBMS 2BTEA 4B17A 5KYKA 3I01M 1JH8A 1W9MA 1SGWA 2XYQA 4I36A 1AKMA 4GOND 3FG9A 3PHJA 3O4HA 3OZTA 2QV7A 1XP8A 1GPDG 1PZGA 4RCVA 1BDJA 1PE0A 1VCIA 4HRYA 3UFXB 5A3JA 3KWJA 1P5FA 1GTG1 2ZKLA 1CR2A 4FMCF 3BD6A 1X92A 4PYQA 2X14A 5KYNA 3QWIA 1T6XA 3E1KA 2IYVA 2ZWMA 4EYOA 1XR3A 4R1LA 3B20A 1GSAA 1YZYA 3E53A 4IO0A 3A2NA 1ABBA 2Y1WA 5KKAA 1KFCB 2RONA 4ACBA 4K9NA 3JZFA 1N0WA 1QFZA 1GT6A 2J30A 1TT5A 4KO2S 1T8TA 2YVAA 2X2PA 4L50A 4RHEA 3O8OB 1T8UA 2D74A 3ZWXA 5BN1A 2FSUA 3PVSA 4XW2A 1NVFA 4UCWA 2C2ZA 3PQ5A 2IHBA 2MYUA 5A3VA 5BY2A 4TKMA 1PZMA 4TLCA 1KSJA 1EDBA 4ZCQA 1CRPA 3DZBA 3M5WA 1QC5A 1Z7BA 2YX1A 4X95A 4YRFA 5HCUA 1U7OA 5EZYA 1YR9A 3P7MA 4MDFA 3HN2A 2P40A 3PTLA 1DAMA 4GMDA 1DTWA 3OQIB 3MTJA 1ISRA 1W73A 1U31A 1DG3A 1T4DA 1TO2E 1IY0A 2UDPA 2HGSA 4K6HA 3A9RA 4QJ4A 3AF2A 1YIAA 1JXOA 2P9TA 3TD6A 3VHXA 1JBEA 3ZHUA 4Y1RB 2BGWA 2HKIA 1NVEA 3MB8A 1U8AA 3M4ZA 4MW6A 5BT8A 2PLNA 5FUQA 5JMWA 4KXYA 1QB7A 3BBLA 1YB6A 4Y3UA 4G07A 4BV9A 3DP9A 5C8ZA 3OMWA 5ILOA 1IK6A 1G3IA 3CH7A 4NKRA 2PGAA 1T3TA 4J75A 1T9BA 5G1NA 4AZVA 1D1TA 3LK6A 2A84A 1WDMA 1NI5A 2IEGA 1J9ZA 3OZCA 3VKWA 4DG8A 4C2TA 1LI5A 1FNMA 3C3WA 1R2QA 1LRKA 3F6YA 4FLFA 3TMKA 4AP6A 3DE0X 1JDVA 2X5KO 1Q0LA 2OORC 3HMQA 1OXKB 4MUBA 3RK1A 3VU9A 2GARA 1MVOA 3AUYA 2P2DA 1JPVA 1YVUA 4TMWA 5AHKA 5G0TA 4DR7B 3HBAA 2GEDA 1ST3A 4LXGA 5CT5A 2QRVB 4MB0A 2VA9A 4UPEA 2H5IA 1BA2A 3CO0S 1Z2AA 4E5VA 4FW8A 3W8RA 3OZFA 2GF2A 1MJGA 4BRWA 4DR4B 1PV1A 4P3NA 1V5GA 2NU8A 1NJ8A 1V11A 2W48A 1WZNA 4BZQA 4L3VA 2WHYA 3ZZUA 4F04A 2QZSA 3Q40A 2WB4A 2G06A 2Q6TA 2XCOA 3EGOA 3KXKA 4O1IA 5EWMB 3RDPA 3H9GA 3DDCA 2O8DA 5KNBH 3SXUA 2C2OA 1E4EA 1E62A 3BF7A 3AILA 5F23A 4DV7B 5F1OA 4E5YA 4B4DA 2EU8A 2EFYA 1BROA 3NO4A 5GJCA 4B4KA 4BV3A 3V8RA 2PYDA 3CSDA 2LXNA 4ZK2A 2D06A 3CRMA 5KU7A 3TECE 2B83A 4LOLA 1Q7GA 2ALJA 4FEEA 1Z8FA 3CC8A 4MS1A 5HF9A 4MWCA 4F5WA 3SC6A 2XEXA 2Q0HA 5EJ9A 1TJPB 1QLJA 2K87A 3H84A 5B12A 1VMKA 1YQXA 3O03A 1L4MA 5JVDA 4UNQA 5JNTA 4YCDA 3WS7A 3O8NA 3QVTA 1JHMA 1GUDA 3SLRA 2X22A 1M7BA 2JFBA 3RT1A 3VOAA 5L6LB 3E5RA 4J0DA 1NFFA 1YOVB 2PRYA 4NYMR 3NANA 4UHFA 1KYQA 1U6JA 3TWOA 2P5SA 5JR3A 1E1LA 2WG0A 3IBTA 4HJRA 4AC9A 1LSSA 1BDMA 1MD9A 1QGZA 3CX6A 2GPYA 1LGYA 3MCTA 4US0R 4BEVA 5YASA 4DLPA 1V4BA 4U6QA 2G07A 4CLDA 4YONB 4L95C 3T1QA 3U4CA 1YA6A 2QP9X 1APBA 4HP8A 3UCXA 1Z8NA 4J0QA 3GGDA 5COQA 2BY4A 4V0QA 5TGTA 2FDCA 4KNVA 1MIOB 3SIPA 2QW1A 5FTLA 1QVWA 3ICOA 3L5OA 4YMSA 1S1CA 4ZDJA 4C0XA 2QRNA 1MVNA 2SHKA 4D44A 1B0ZA 1YFKA 1SOWA 4KX3A 3RS0A 4OA8A 1YQTA 3IVMA 2DHRA 4W1QA 2AFIE 2JDID 2OHOA 1VM6A 4UQPA 4JI2B 2WHEA 1NUPA 5E9WA 2OHFA 3ZE7A 2BZ0A 2JEZA 1XTBA 2HU5A 3AR2A 2Z6AA 2AXQA 2IRWA 3KBOA 4RSRA 4KE7A 1Z2OX 4S35A 1PT9A 4RH0A 4LC1A 2AXEA 2FN3A 1KQGA 4GRAA 1RFLA 4R8LA 2I0FA 1X1RA 1LSJA 2PIDA 3MQ4A 1MOSA 4MQFB 4O4HB 3W9UA 2AFRA 3YASA 1Z0SA 3MXOA 3OPNA 5ALUA 4F56A 1UBOS 4QBKA 1C1XB 4FYHA 2XCLA 4GZ5A 2YXEA 1SXQA 1ZOSA 2ZIZA 3GNTA 4LMAA 3G5LA 1T1SA 4HEJA 4R0VA 2CMFA 2XECA 3OG9A 3OOEA 4BQFA 1WSDA 4YUZA 4BP8A 3GLGA 2PUCA 4L8VA 4JT8A 1ORIA 2E85A 1MQAA 3BXZA 1MRSA 3F6CA 1XZLA 3MWKA 4PANA 5A06A 2QVGA 2H57A 3PC7A 2PFSA 2GD2A 5BV1A 1QV7A 1VJDA 1CQIA 3R2JA 4H3HB 4QHTA 4DM7A 1Y0BA 4KRXA 1OWLA 2ZDQA 2EQAA 3UA3A 2BZGA 5SZJA 3URMA 2X9QA 3RRYA 3NEAA 2FUG6 4P4SB 3K1AA 4OIFA 2JIBA 3ZQ6A 2P9QA 3CQ9A 4C22A 1L8OA 3Q6IA 2ZYAA 1FMFA 1IHYA 1G16A 4U4AA 1E69A 4LXUA 2J67A 2GR9A 1OX4A 1Z08A 1AXRA 2W71A 2BCEA 4CLHA 1DKNA 4YY3B 4AUEA 3SY8A 9ABPA 1UOOA 2BEKA 5J9FA 3HKBB 2BP7B 3SS9X 3QV1A 4UUAA 5I9TA 2E1PA 4RE5A 3ELWA 1IK4A 2DUJA 5EMMA 3T4UA 2J5KA 2I67A 5CYOA 4KAFA 2NW6A 3O4RA 2ZM6B 3L77A 3LDFA 3OD5A 5L51A 4IZ6A 1J2EA 2XKKA 3QKRB 4L16A 4AXBA 5KNLA 4DPKA 3K31A 4RTPA 4MKFA 3VR4H 1PGPA 3C0KA 1QRRA 3LOPA 4PCVA 2GTPA 4MR8A 1WX1A 4ZEWA 2WD7B 5AVQA 2O8BB 3FWNA 3VSAA 5HVNA 1PNQA 4Y1FA 1W85B 3NGLA 4RIIA 2P9GA 1KO1A 2EKLA 1CF4A 1RSZA 4AM8A 2FFBA 4Z9XA 1TB4A 3ZDCA 4PE5B 1D2EA 3TCXB 2DMRA 3K32A 1NW3A 2MMCA 2ZPAA 1CLUA 4YRCA 4F4HA 1IM8A 2WOJA 4ETIA 4ES6A 3RLIA 1FFWA 1XMQB 4EG7A 3QITA 1L9KA 5ESDA 5J1TB 1J23A 2WUGA 2ZUDA 2CDCA 4ZRNA 1JU9A 3EUFA 1KDRA 1DT3A 4F9TA 4OKIA 1KKUA 3SDBA 1HWYA 5AW5A 5JAMA 3IPCA 3CXUA 1Z5WA 1SKYB 1RTTA 2QUIA 3L7AA 4W9NC 4X63A 5EP2A 2GQ0A 521PA 1X87A 3AEQA 2FGKA 4KXMA 4MQUA 1RXVA 3TW4A 4HGPA 4QC2A 4I4NA 1FXSA 3AM4A 4DG5A 1W75A 1JJ7A 2JBAB 4B6OA 5EHXA 4BNNA 3T5PA 2JLQA 1GDDA 3WIOA 1KYIA 2Y76A 4JP3A 2A33A 2PH7A 3DFKA 2OFXA 3NOQA 2DTDA 2NYAA 3K2QA 1ZN8A 1NN0A 1PTKA 5EQFA 1CZLA 1JKIA 5AW9A 4B9AA 2WT4A 4GYJA 5A4MS 3M3HA 2VP2A 4ZT2A 5KHLB 3LCUA 4CM3A 3O7MA 1BO6A 3NT5A 1X1EA 4OHXA 2BCGY 1C2TA 2YNMC 4IX1A 4JU9A 2H1LA 4Z7QB 4RY9A 4QUDA 5ERXA 1XU7A 3QU9A 2HJRA 1JNXX 1NQ5A 4H1WA 2A8YA 3DAHA 3ZUGA 3QLUA 4MIOA 2AC4A 3LBIA 4QJ5A 4XRRA 1E3TA 1OYVA 1A71A 2CFIA 1LI4A 2IDKA 4IIEA 2V7QD 4S2EA 3AFOA 1A4XA 4EB3A 3UJ3X 4B85A 1RP1A 4ZYZA 1OH6A 2HQBA 4R9UC 3L8CA 3S5UA 2WSMA 1TECE 1KZ7B 1SVWA 1W4BA 1DMSA 2GAOA 5BN5B 2YN4A 3G79A 4KR6A 3G5TA 2ZIUB 3M8KA 4IYRA 5E3HA 1YWGO 3BFXA 1P1KA 3OJXA 5AVYA 3CM0A 1IWBB 2XB9A 2QV0A 1N7GA 3OX3A 4M1SA 4R3UC 4X1YB 1OT5A 4A1OA 4E14A 4Z49A 1BH6A 3BYZA 3RYIB 3NBAA 4ND7A 5H9WA 4C7OB 5ES3A 3E18A 3ZEIA 2Q1YA 5J43A 4X7PA 2ZP1A 3LGSA 1F8XA 1ZCBA 3OA0A 3QU2A 5BQ5A 1M6NA 1DO8A 2G3YA 2NXNA 5LXTF 4Q4JB 4LW8A 1K66A 2C9MA 2X0JA 5NLLA 3A6HA 4C4RA 4DT1B 4HPJB 4F0JA 2V59A 2V0NA 3QOXA 2BGIA 2MSEB 2DM6A 2V6BA 3A2LA 4PYLA 1FTGA 1WHSA 3VDRA 5AVXA 5L3QA 3K9CA 3NUZA 5IT0A 1ZNQO 4C3ZA 2ANBA 2FUNB 4EG8A 3FNBA 3ZJVA 3F7OA 4FZ5A 5E4FA 5G0VA 2AKEA 2JVKA 3AKEA 1WB9A 3ZY6A 4BKPA 4RTQA 1C3EA 1N75A 3HRIA 1NI4A 1XXHB 3HR7A 3UO8B 3ZDRA 4AKIA 2Q4OA 5BVHA 1ZIXA 2L17A 4PIPA 5F77A 5C1PA 1FU8A 1PGJA 1SRRA 2CHGA 2VWHA 2Z2XA 2RK4A 5E9QA 1P7PA 2JJYA 5C7OO 4WADA 3DHEA 1A82A 1HKHA 2H85A 3FTEA 5JIBA 4FE7A 2VUSA 2F9LA 1NG9A 5FEUA 1FNBA 1I24A 1QDUA 1DX9A 1QLWA 3B6EA 1V8ZA 2A30A 2FEXA 2J0QA 4BPRA 4UTXA 1N9GB 3IQEA 4YLYA 2W6ZA 4EUHA 2IF0A 3R76A 4CHGA 4UTOA 2H92A 1GG5A 2VUHB 3ORFA 3U1BA 2WNSA 4OXXA 5REQB 3NAMA 1BKSB 4BFUA 3O90A 2M6LA 2GPAA 3BXOA 3CVJA 3LW7A 1D0SA 1M34A 3F3KA 2ZUSA 4BWGA 2V7PA 2AZMA 2XQVA 3JQGA 4D5GA 2AC7A 2GLUA 2H4WA 2UYYA 3SP1A 4DY4A 3RAFC 1PO7A 3D2CA 5KZMB 3THYB 3GEEA 2YHIA 4MHOA 4BX8A 1DTSA 2PVCA 1TA9A 4A26A 3ISJA 1BWPA 1HOXA 2IOFK 2IU3A 2ZAGA 3I8SA 5FBKA 2VPTA 2OHHA 3NC1C 1ETUA 1GQYA 3O8QB 4LGMA 4OHYA 4L1KA 2ID7A 1KAOA 3LPAA 3RUHA 2HBYA 4M0FA 4I3FA 3EH2A 3ZXUB 1ONNA 1Z75A 3CCCA 4AS2A 3A9UA 3TOZA 3N2EA 1WO8A 2ORIA 5F51A 2PMWB 4KIGA 5K45A 4LZOA 2X9VA 1KL7A 1P0FA 2OFPA 3IJEB 3T4XA 3AONB 1ZUWA 3GA0A 2X41A 4MKZA 4GE3A 3HHEA 5AI6A 2DB3A 3OFND 2ZZNA 4NCXA 3NHYA 1PT8A 1THTA 4MTLA 2BRUA 2QGFA 2VRNA 1VKJA 4UVHA 5EXEA 3MWGA 2AWNA 2EWWA 2AF3C 1N2HA 4GWLA 3I4LA 4BNUA 3H5LA 4K5QA 3RAJA 1VFNA 1V16B 4GM1A 2YN0A 3L01A 1XNHA 4BGVA 5AKJA 2IA5A 5IHPA 5JNUA 1R7RA 4RENA 4XEUA 1DP4A 5DLEA 1OIXA 1Z74A 3A6ZA 1LK0A 3QVLA 5KTMA 1Y7PA 1AK1A 3UFBA 1X7ZA 1W36B 4BZPA 4CM9D 4IRXA 4DC1A 2L42A 3O6VA 4HYYA 2R2AA 1J7KA 3GCDA 3GEDA 5KEIA 3FWPA 1SKAA 1CLEA 3F5SA 1G21B 1V5FA 1KFKB 4C0KA 4Z3KA 3LWBA 1ISPA 3PGXA 2Z4SA 3OE4A 2WWRA 2O23A 1EWRA 1B23P 2X0EA 3BG5A 1IULA 3ZHZA 4XWTA 1CUCA 4JI3B 4BX0A 1KH2A 2OZLA 2D00A 2VBIA 2FPIB 2PAFA 2ZRMA 2F43A 3GFGA 4QAJA 2HMVA 2Y1LA 2JNWA 2VJMB 2YWBA 2Z98A 4H6VA 1COWD 1F4VA 4ZJUA 4ECAA 1C9EA 2ZXEA 4L02A 4FTWA 4H3VA 1L5ZA 3RU7A 4QNMA 4E4RA 1K3TA 1ODKA 2GN0A 1N2BA 4IIXA 4IS2A 1K5HA 3TLJA 5IANA 1JZSA 5K3AA 4EYSA 3KKZA 2EARA 4C6TA 4ZI7A 2FZWA 3F3MA 3QRWA 3G0DA 5K4AA 2GK7A 5HW0A 3EZGA 1D2RA 3RYHB 1OXXK 2F9MA 2VHXA 1J8VA 5JO9A 5IVDA 3ANLA 5K6RA 3C5EA 1MB0A 4A03A 3DDWA 1XTVA 3TLCA 4UVDA 3W2TA 3DM5A 3OM0A 2CDBA 4G6ZA 3L92A 4U1RA 4YVFA 3GN2A 1HDXA 4CKBB 5C1IA 3CS3A 1F4LA 4MP3A 4M76B 5JYCA 2GILA 5B57C 3ICCA 4WY5A 3E22B 4G0NA 5ITZA 1EGQA 2B34A 4LDAA 2PD3A 4JLKA 2BUBA 1CP2A 1RQXA 4CUKA 1PJ3A 1ZQ9A 3A7DA 4GF5A 4R7ZA 2BJVA 3CONA 2AN1A 1W5AA 4GVPA 4UQLA 3GEIA 5DTEA 3ZH9B 5AQ1A 2O2XA 4D3XA 4HQLA 1TZBA 3O82A 3F5QA 2AGVA 2RSLA 3QTTA 3LU1A 4N40A 5EKTA 1ENYA 1S9HA 4N0MA 4CN9A 3EPJA 2Q6VA 4MWBA 1C7ZA 3KVRA 1FFXA 1P1CA 4YRDA 4O5OA 4GPBA 3UXEA 4EI8A 4JVLA 3R9IA 4FHCA 2A0UA 4PHHA 3MLBA 2OB2A 3MUFA 4QOSA 1XIVA 2VHUA 1AM4D 1SUAA 1OFGA 2WJZB 1CY7A 3M5CA 4OLJA 4R98A 1KSHA 2PE5A 1U8FO 5DLYA 4G8BA 2YJNA 4QOFA 1ZJYA 1LVGA 2NZJA 4YRQA 4DLWA 4JGGA 1NTOA 1B0UA 4IBOA 1TRKA 3H2SA 5FO0A 5B1EA 3LX4A 3SG0A 3GF4A 4Q7JB 1G2IA 3MAGA 4EM6A 4MB2A 4IFTA 3J7TA 1UP6A 5IUKC 5KYGA 1DAGA 1JT9A 5JAIA 3ZJYA 2F6RA 3OUUA 1USIA 1PDVA 4IZHA 1FP7A 2GZHA 5F64A 4L9SA 4ID3A 2Y99A 3L3BA 3UT5A 4NE2A 3DEFA 3NC4A 1TJYA 3SHVA 4DN6A 4KK4A 5KQGA 3SZ3A 2C61A 1D03A 3MMPA 1IQPA 3KHSA 4W7HA 1IN8A 2ZUEA 3MHPA 3JQ8A 5I4IA 3O0TA 2JIZD 4JL5A 1EUQA 3NM6B 1JEDA 5DX1A 4UHEA 4ZCRA 1CP3A 4HWPA 1YCGA 3KTAB 5GVRA 3WLPA 1YA4A 3LUKA 4LJ8A 2O54A 2ZZMA 1CY1A 2JZCA 4Y2UA 3DBRB 4MKXA 2GBGA 3VXKA 5CB6A 2FV8A 2FJ0A 3EUEA 3GP3A 4NNPA 4C7XA 1F2DA 4B2IA 1L1RA 1TDJA 3K9BA 1C5KA 3L7IA 1GCUA 1FSPA 1C7JA 2IZ7A 4JLNA 1L5FA 4G1BA 4DXDA 1E77A 1SCBA 2NZYA 3DWEX 5EE1A 3TIIA 5K0EA 5I9MA 1LPNA 1QV9A 2H11A 3RHTA 2GEKA 4RVFA 1ZM2A 2WVHA 3PXAA 4P58A 1E9RA 2XUQA 3PHGA 4YRRA 3X1DA 4BQPA 2AZXA 1IQUA 4D42A 3TTSA 1WUYA 4EB0A 4X1KA 2HSZA 4KHPB 4KFTA 1EJ6A 4U2BA 1U80A 3M5PA 4TKLA 3IQWA 3M6UA 1VI2A 4KI0A 4NYMQ 4REQA 1FTNA 1W19A 2YDXA 1GRQA 1BDBA 2GDJA 3BD7A 1QXSA 1N6RA 1XKXA 3NS7A 1AY0A 4KZPA 3I5YA 5LLSA 2IIPA 3QWFA 3ZJUA 3KQPA 5CLJA 4ZRDA 4A6PA 4W9RA 4RZQA 1UT6A 1ZD5A 1RI2A 1YI8A 1MMFB 2I7XA 2WA1A 3FNRA 1SXJC 3HGMA 3ON5A 4N01A 3G2MA 4YK7A 3TZ6A 3VUFA 4PHFA 1T9DA 3W8NA 5B3LA 4NU6A 1ZUNB 2I3BA 1JIXA 3BCRA 4XDHA 2BBTA 4JROA 3U37A 1QO7A 3NDBB 4DLTA 1G20E 1R9MA 2OBLA 2RD2A 3NRBA 4KO4S 1W2GA 1PK8A 4MW5A 3WISA 2W6ID 2YIJA 3MYYA 1YR6A 2D3WA 2P1ZA 3ESCA 2QT0A 5JOQA 7GPBA 4G37A 3DQQA 4C3OB 1VL2A 1ZAKA 5THQA 1GKYA 2GUGA 3GQBA 3NKLA 4LXXA 4ENUA 1XVLA 4RKEA 4UHCA 4H4DA 4F9EA 3ND9A 3REFA 1JJIA 4ARZB 1MGOA 3AHDA 3X1MA 1IXZA 2C58A 4K3VA 4KV9A 3TSWA 3BB1A 2COUA 3IDFA 3PWZA 3Q1KA 4X92A 4OQZA 5D86A 3UHAA 4TWAA 1G8AA 1ODSA 1RPZA 1N8NA 2Z08A 2C3MA 4MUFA 3RWMB 1L7VC 1T36A 3HI6A 5EHNA 3RSOA 3USZA 5C5DA 4D9NA 2VHCA 2F1KA 3EDCA 1RWPA 2Z04A 3L2OB 1PDWA 3ICVA 3DBHA 1N5DA 4LXQA 4IW3B 5ILQA 4D4KA 1A2OA 1H5NA 4QU0A 5A5VA 4XZ3A 2Z4TA 3CR3C 4FSHA 4DV3B 2Q6KA 2O1EA 1WUTA 2C9CA 2ZRNA 4ZO8A 4JIMA 4L5BA 4UU8A 4M1TA 3KKPA 1DTEA 3P4XA 4HVLA 3N5CA 4HVAA 4ZOLA 1E3SA 2PGIA 5HKLA 1QH1A 4PVDA 1ORDA 3W06A 1IOZA 1OY1A 4DG9A 2W42A 2QUZA 1Z68A 1SBTA 2BBOA 1J00A 1QFJA 2Z5GA 4H18A 4W5RA 2XIJA 1ORTA 1TEHA 1G1MA 1TF5A 2HUNA 2VPIA 4HDSA 3W4KA 4TMFA 4L57A 4MGZR 5IHXA 1E3IA 2BFEA 2RGNC 3AEUA 3HVHA 3L6UA 2KB0A 4UU7A 3A1NA 4Z6KA 1Z25A 3PVCA 2PU7A 1VL8A 2ZI4A 4F2GA 3TF5A 1AQYA 3BVPA 4HX9A 5EL0A 1RDFA 4BFCA 4KACA 3STXA 1BQ4A 3JD3A 4RPCA 2WKQA 4YRPA 3MZ0A 3BXFA 3JQFC 3KPVA 4MROA 3NOXA 1QQ6A 1RKVA 2A5FA 1XZGA 2O7RA 2X1MA 4IRMA 4JJ6A 5D1HA 1XAGA 4AZ3A 4BVLA 2ERXA 5JJBA 1XEXA 3JZIA 2BEUB 3WQHA 4NCBA 2CLHB 3KYCA 4P93A 4WEQA 4ZD6A 3SJCA 1T4CA 2FK8A 4RIEA 5K8CA 3HEBA 1PUIA 3EIOA 1VB5A 2EP7A 3I9MA 4JY7A 3WJ2A 3BKXA 5F9HA 5IXSA 5EUQB 1Q7RA 3EGIA 1YASA 1OC2A 3AP3A 4OQQA 4JLJA 1QOQB 4N65A 4OJMX 2DTEA 3UMSA 2UU9B 4Z9YA 3WFIA 1N57A 3AXTA 1W9HA 1YXMA 3PFHA 4Y2HA 2XYHA 4DZZA 1W5TA 5C7LO 5F5NA 3U5ZB 2RHCA 4G0YA 1B3BA 1L7DA 3CZMA 3DF9A 2QM0A 3MMXA 4HK4A 3D2BA 3QBJA 4QUHA 4CMEC 3AF0A 1AHHA 3SBXA 2Q5CA 5DHUA 1QP0A 2WR8A 1Z5UA 1KMMA 3DEAA 3RT7A 5HE9A 4XIIA 4R5MA 3SC2B 2VR1A 1OV6A 1YFLA 1L3CA 4CDRA 5GZ1A 2GCNA 2DKOA 1ATZA 5K8LA 5KWIA 1KBOA 1N5LA 3DE7X 2EP5A 3HA5A 4ALLA 1PRYA 4GL2A 1DJQA 3H4TA 4W5JA 1E2EA 1NXQA 5IJ9B 2DUNA 2A0KA 3ZXSA 1O9HA 3WSWA 3S81A 2RGUA 4BNHA 4RD1A 4TWRA 2PR7A 3HXMA 1I14A 1UK9A 2N9UA 4K87A 4J6EA 3AV3A 3TM5A 4DXHA 1IBSA 3I76A 5HZGA 1MOQA 3N0RA 1M8GA 4MPJA 3P2KA 4ND4A 4TXNA 2Q8PA 1KMQA 1R27A 2CYBA 1KI6A 2GCGA 2MSLA 2ZS7A 3PA8A 4HN9A 4MP6A 4OMDA 2ZQYA 1S7GA 2B2XA 4GKVA 4LYEA 3NLLA 4ETMA 4J16C 1JALA 2IBTA 3Q5DA 3DCYA 3G8BA 5T6MA 1UJ2A 4OPMA 3F8SA 5EHGA 1XD2A 1JXAA 4AKHA 1CUFA 1FSZA 2VUIB 4AJ1A 2ZEJA 1M2VA 4EF6A 2BM1A 5EUBA 4YO7A 1E9DA 2PRSA 3UPDA 4LVUA 2TRSB 1XBTA 3QKIA 1H6DA 2QL9A 3G6WA 4A0HA 3AEKA 1NDQA 2DUUA 3DE6X 4WJLA 1YQ9A 1PFUA 4BS9A 4QRDA 1ESZA 2MR6A 2F7SA 1UQRA 3V4LA 3AL2A 1RQ7A 2XZDA 1QGUB 3U3RA 4F86A 4MGKR 1FYFA 1U2DA 1UKCA 4H2DA 1U9ZA 1GZ6A 1KC1A 3L0IB 4JC5A 2BHTA 3AWDA 3E9RA 4LRUA 3GUCA 3VO2A 4OKSA 5BV8A 4QDZA 1KYTA 1B76A 2BHRA 5AW8A 3VPHA 3VR1A 3GHHA 3R4VA 4WLNA 5BUSA 1NKVA 2O3TA 4OYRA 1YHYA 2H2WA 5KC8A 3BQ9A 1Z5NA 1VC2A 2YQ5A 3S0JA 3O3OB 2QD5A 1BOOA 3QA3E 2XF2A 2OLKA 1GAEO 2R7LA 3LL4A 3TI9A 3MMSA 3U3DA 2KQUA 3Q2OA 4O8ZA 1IE3A 1C4XA 3HKDA 1JWBB 4BDSA 2EFJA 4C2BA 5CA0B 5IRCD 4KDRA 3EN0A 4MO9A 5TQ2A 3WIDA 4NYJQ 2VP0A 1W0JD 2ZZKA 1HI9A 3A14A 3ESRA 3UGJA 1C8BA 1QIJA 2QT9A 4NS1A 4XJTA 3PJRA 2QTMA 2JFFA 1JR3A 2H52A 2JAPA 1XZ8A 4JITA 1SVMA 1IHUA 1EB8A 4HX5A 5DHTA 1E4OA 4JJZA 5CAEB 3HJAA 5T57A 1X1SA 1NVKA 1QR2A 3B8HA 4TKUB 3R23A 3E1SA 4XIGS 5LDDC 4YTEA 4ZZ3A 3DAOA 4KQFA 5F35A 3N74A 4JEMA 4JJKA 5M5BA 1CJUC 3I37X 3QFCA 1ZMOA 3DAFA 2QDXA 4Z2AA 2Y9PB 5CG2A 2GZSA 2R6DA 3KTDA 5FBWB 3PENA 2A5GA 3P4YA 4HN2A 1OI2A 4UXJA 1LLFA 1O4WA 2OLJA 2VTVA 2RH9B 3R3JA 5AW3A 3PLRA 4HZUB 1L1FA 2NTEA 4KSYA 2CD9A 5CK4A 3V8PA 3B12A 4TMKA 1E96A 2Q5LA 1DQRA 3IQHX 1IL0A 3AFHA 2XOKD 3AVOA 2JARA 3L04A 3N8KA 4NBRA 5B3AA 3ZE8A 4V1CA 2O8BA 3RIXA 1EM8B 4C7MA 2H2HA 4XUDA 5BW5A 4ZI5A 3UOAB 3HK2A 3LTEA 5BVGB 2XZLA 1C0PA 2ZS8A 1LLCA 4X6YA 1UWKA 1ML4A 1UMBA 1JECA 2ZRFA 3KOMA 4EFLA 1Z4QA 2ZYHA 5IH3A 4K9RA 4WCDA 3Q6MA 1AF4A 2FWBA 4WA7A 4X7RA 3RO7A 2QTTA 4F5EA 3IELA 3LM8A 3UYKA 2PZBA 5AXAA 3LGAA 3CSSA 4MGEA 4NEHB 4Q3NA 3MJHA 3BOSA 5EE5B 3UTDA 1QZZA 1UANA 4HGZA 2VSFA 3CZ5A 4ZPXA 5FHQA 4DMCA 3RIYA 2JJ8A 2DUMA 3J81k 2Q3BA 1Q7EA 4D8UA 3G9XA 3MBOA 3N58A 4MRPA 1Q1GA 3T7KA 2IYEA 4CL0A 3VU3A 3PGA1 3N70A 2G9RA 3COJA 1ZH2A 4XIFA 4AICA 2O0KA 2E2WA 5HXAA 5F4ZA 4AZ0B 2OKGA 1E1MA 2BTQA 1EP3B 4FQ5A 4TRRA 4ZQCB 2QLTA 2NAFA 4YAOA 1V1RA 1R6BX 2G82A 1U3GA 2ZYUX 3DLIA 3ZGXA 4AUNA 2UXBB 3DL0A 3I6IA 4NZPA 4UTRA 4ZRMA 4E22A 4Z4CA 1UDWA 1UZMA 3EXIA 3MS2A 4UMDA 3AY7A 2M6KA 4B4OA 1YB2A 2WKRA 3P8ZA 5JWRA 3PIDA 1EX1A 1SKUA 1JL3A 4YJHB 1JA0A 5CB8A 4J2TA 1IY9A 1JN0A 2JGEA 4M8KA 5IK2A 9MHTA 2GYUA 3TQIA 1H8HA 5LYJB 2VIIA 2X58A 3V9PA 4A5SA 1VFPA 4S1OA 1UMCA 4H60A 1JLHA 3UGQA 4W8HA 4BMSA 5ULLA 3VTKA 2CF6A 2VBFA 2DC1A 3TE6A 3AQIA 3DH0A 2Y1KA 4Q48A 4GKAA 4WY2A 1KPGA 3O1LA 4AL4A 4OMCA 4IXWA 2G70A 2PX5A 3F6PA 2CJYA 2F8MA 1NOIA 4G5QA 3KXPA 4GNKA 3WGIA 2AMLA 2BFFA 1G8PA 2Q6LA 3PL5A 2WFMA 1P31A 2I1WA 2ORVA 2B8JA 4FC6A 4LY9A 4PLTA 1TJNA 4WFIA 3TGPA 5U4XA 4JASB 1U0LA 1T3SA 2PS0A 3JR7A 4UREA 5E6RA 4D96A 1M0WA 3KJIA 1GAJA 1WCXA 1YBVA 3H65A 4N0EA 5JEEA 2QPTA 3DV0A 3K73O 4IR7A 4RTJA 5HMMA 1P44A 2XMRA 2ZYDA 3H2IA 4KTVE 4IDPA 5C2JB 5JUWA 2WE8A 1PBNA 3DLCA 3UYLA 4P5EA 1Y5LA 2ZTVA 3PR1A 1F5NA 3D31A 4EGAA 4M9RA 1C30A 1OLUA 3AT1A 4V24A 2D54A 4M6WB 2P1DA 3LW8A 5GM2A 3V1UA 2O7SA 1SBQA 4RPLA 5TIIA 4ZAGA 5B30A 1OHHD 1P1IA 1X74A 3P94A 1R5OA 4KVFA 3AV0B 4Z54A 3S8EA 3GBVA 3GEGA 4O2BF 2IYUA 2XKBA 1EWKA 2FPMA 1N2GA 4XQGA 4FMDF 4XR4A 3M6AA 1FSGA 4IJ5A 4BCCA 1XB2A 1ZJZA 1WCWA 2W37A 1E6LA 4TSRA 3I61A 3ABOB 1KRHA 4LQLA 3EMKA 1EHIA 3AL3A 1ZOOA 4DQXA 5AVJA 9ATCA 1SXPA 3ISVA 3EJWA 4XCVA 2XMZA 3QFFA 1V95A 3O3MB 3FPBA 2RHMA 1CY0A 3VFDA 2TSYB 3F1LA 9LDBA 1YB7A 1CQWA 1YRYE 4RQTA 4WXMA 5AJXA 2Q1UA 4EL0A 2QD1A 1DAPA 3KU4A 3EA4A 4QYWA 4BKOA 1IOWA 2PXCA 1QX3A 2PO7A 3B8EA 4MUGA 7MHTA 2J7PA 2VJCA 4P9NA 4C6HA 1W5EA 3SMQA 3W5SA 1DCFA 1CUYA 2IXAA 2XVMA 4EO9A 4BXOB 3ZN2A 2DR2A 3FLAA 3K9GA 3UGKA 3NC0C 4FHDA 1K6EA 2XNKA 1YR2A 5HTKA 2HMYB 1ZCZA 2J8ZA 3OZVA 1FK8A 3T5DA 2C4UA 3MMNA 3ONFA 3THRA 2XJ9A 3NXSA 1G8FA 1BQ3A 2OK7A 2JH8A 4IWXA 4XLTA 3TM4A 1MC8A 3QLVC 3RGGA 3X1WA 1YA8A 4HMOA 1B6RA 2XW6A 4ZANA 3WLNA 3IDQA 2GA9A 3FVRA 3ZWBA 4CKWA 4MI6A 3G2KA 1RRKA 3MGGA 1Q74A 3NHAA 3P2JA 4CKXA 1L5OA 3HCBA 3S70A 1ACLA 2OENG 2VJBA 2D1QA 1YL6A 3N9IA 3PUKA 4DQKA 2R96A 5A5GA 1ELOA 1UFOA 4JC4A 1PYGA 4KRGA 4QTUB 3TEFA 1JT2A 3H5VA 4UCQA 1RXYA 3SS7X 4AU1A 3KAPA 1VHJA 2EYQA 1VYTA 2IHKA 2ZVDA 3GRVA 5I9SA 4BNJA 3W2IA 1P91A 5KJCA 3PE6A 1NRWA 2QK4A 3DFUA 4JXXA 1IVSA 5A4IS 3MTDA 1S8AA 3WICA 2HV8A 1SHZA 5F52A 2E87A 1NIPA 3RARA 2P77A 4X45A 2QLBA 3N6VA 4CZ2A 3SSAA 1CF2O 1USGA 2YMLA 3RAEC 4BRZA 1UJ5A 2VDPB 2ZR7A 1WZIA 1HX7A 3DBLA 4TN1A 1E89A 3DE5X 4BNIA 3SJAA 5KREA 1JR2A 3MJRA 3G8YA 5T4BA 3ESXA 5THKA 3WGOA 3E7DA 3U7RA 4KP7A 3QJ5A 5T8KA 3E82A 4NFLA 2FEMA 1TM7E 3RSSA 2NPIA 3OQVA 4G4IA 1Z2NX 2PPLA 2ZUFA 4OO3A 2RHOA 3WRWA 4DB4A 3B1XA 1UPUA 3AF5A 5T41A 5FI5A 2HCBA 4KWTA 3NASA 1N6PA 3U48A 4OI0A 1T15A 2REXB 1MAAA 1SEVA 3I5MA 5H59A 1U7DA 2KPOA 3CEAA 4R2MA 4US1R 1B26A 1RHUA 2PFKA 3HBFA 5KUTA 1Z12A 2KM1A 1SU4A 3I64A 4WOBA 4XYLA 2QTFA 2QQGA 3IR7A 1XRQA 2V5UA 2Y92A 2HWUA 3BH7A 3GLQA 4N0QA 3ZHRA 5IAGA 1AJEA 4D6PA 2X0KA 3SFZA 4DEXA 4ZI3A 4RDHA 5CBPA 2ORWA 5FO1A 1OPRA 1V2HE 2JD0A 1U7TA 2FRVA 1HL3A 4JT9A 1JB1A 3UWPA 2EBHX 2ECOA 2P6PA 2VPPA 2R1VA 3E6AA 2JAHA 1UZAA 2QQFA 2HWKA 3KBBA 4QVKA 1QPZA 2BFDA 2IDJA 4FN4A 3TFWA 1NW5A 1QYXA 3CZAA 1GUYA 3KLNA 4REMA 4LISA 2DWQA 4LNUA 1YS9A 1U3DA 3KS9A 2AN9A 3OE5A 4IVNA 4RM3A 1X86B 4E32A 4ZK6A 1KP9A 1RXSA 5CB4F 1J20A 4HGNA 5DZSA 3ZLVA 2WYIA 2WB2A 4M0KA 1CJSA 4C1BA 5KAMA 5CVDA 3IEKA 1MIHA 4L8YA 3LKDA 5C80A 5JHHB 1XNJA 3IH5A 1WABA 3N0VA 3S8MA 1M66A 5A4KA 3C6BA 3GPDG 1PT5A 2C57A 3GRAA 3JYNA 3Q2KA 2IGTA 3G8AA 3L8EA 3ZDFA 4QBGB 4EGFA 4MV9A 4KKVA 5B2ZA 4U7FA 4CDNA 1PL7A 5T7BA 1XCPA 2HF7A 3DYIA 3IERA 4I9GA 1E63A 2OQIA 1G6KA 3G0IA 4Z5XA 4FLMA 3PNVA 5CP8A 1YJXA 3HY6A 1G20A 1E3QA 3MJFA 3PQ2A 3D7NA 2WMDA 3U0VA 3CINA 2PT5A 3SR0A 2X8LA 4V0LA 1C7FA 3GXBA 1G5PA 2OAGA 4TZKA 3THOA 3UJPA 3VVCA 1O7JA 3R6TA 1NXOA 4BJHB 3R5FA 3UAVA 4DBVO 5TV2A 4HYQA 5L40A 1N34B 2PLAA 2R8YA 5KOJA 1S8FA 2C9YA 4TRMA 4YUYA 2A9KA 3GZNA 4NMLA 2XIQA 1QPGA 4GGMX 1R16A 4M9XA 4WUVA 3FMVA 2O8FA 2SKEA 1Y8QB 4EA9A 1CJCA 3CE9A 3K9FC 2L18A 2G88A 1NYQA 4IO1A 2BZ1A 2HRQA 2WU1A 1GSOA 4DJEC 2N46A 5K99A 1RJ9A 2FW1A 2RK6A 1HYQA 2AW5A 3O21A 3LECA 4CODB 2D2EA 5IDQA 4CMIB 1GLVA 3CX3A 3FDIA 5CX1B 5BMVF 1TX4B 5C37A 2NUTA 4MHTA 2LVBA 2OESA 4WXHA 5DWDA 1UXKA 2HZBA 3LIIA 3M5DA 4GSLA 3G9ZA 3G1TA 4LYGA 3IQFA 4JK3A 2CEKA 4EHDA 3PI7A 1Y9AA 5B2EA 3VYUB 3FVVA 4Q9LA 5JAPA 3QV2A 3DS8A 2O2SA 4RCYA 4Y6OA 4D4MA 3TOVA 1YB1A 2AZTA 4R51A 4B6JA 3C8UA 4MO2A 2ASVA 1AB5A 1T2FA 3CZCA 4JAVC 2I91A 3FSGD 2BI8A 4PQRA 3K1ZA 4G89A 2O7VA 2YC4C 4EW1A 1E7MA 1B0AA 4URVR 3NIGB 4ZAXA 4GOKA 3AZQA 2D0DA 1M8FA 1JJBA 2JCXA 1DNPA 2QAGA 3QP9A 4FYVA 3F49S 5H02A 1RYDA 4BKMA 3HUTA 4D0NA 4FHFA 2QPAA 3GR6A 4XJSA 2A0YA 4CM4A 2QTZA 3S1AB 4CU2A 4M1WA 1BEEA 3LUBA 1KI4A 4UM8B 3WL4A 1J09A 2AR7A 3CA8A 2VNSA 1QBKC 3OETA 1ACJA 3H16A 1MAVA 4INPA 2AN4A 4DCMA 3THWB 4DCNA 4DPLA 2Q5OA 4Z99A 1MPTA 4FCTA 5CFPA 4GECA 2QM3A 1OBVA 4R9SA 2EX1A 3T1HB 1EX9A 3DNPA 3LLCA 5EJIA 4B44A 1ULUA 3G7UA 3AK4A 5LYYA 1ZLYA 4B33A 4XQEA 4GUDA 5KTNA 3T38A 1AKEA 3TMAA 1I7NA 2DCUA 3GCGA 4YROA 4X0EA 1ZK4A 3CH6A 1Q1BA 1WBDA 4HH4A 5E7MA 4X1IB 5L3RA 1DQZA 3FI9A 2VFAA 4OHKA 4QUKA 1K8RA 5I8PA 4MEBA 1YB5A 4IWYA 4RQAA 2ACVA 4L07A 7ABPA 5LB2A 4FNOA 2WAAA 1UJMA 3GG2A 3Q72A 2C4KA 3S28A 4TQGA 4FGLA 4HV4A 5J4KA 3GH3A 1AKTA 1KAGA 3JXEA 1RQRA 1UK7A 2QW0X 4DRZA 2QD2A 2C4WA 4XGRA 4FGSA 3SKXA 1XLTC 5IDYA 3PPWA 4NJEB 2ZIAA 3NDPA 4YV1A 5IDXA 1OROA 4GXTA 2OGZA 3GK3A 2NM0A 3GOHA 4FE3A 4G09A 4LBWA 4MMZB 5F78A 1X2EA 4ZEXA 4HWRA 5J5AA 4EARA 3J7AC 4TKZA 1WKCA 3CLTD 2I29A 1B93A 1TTPB 4FINA 4XQ9A 2BGNA 4NNOA 1NC3A 2XF8A 1E9AA 3UBTA 2CXRA 1IG3A 3QH4A 2W98A 4UHKA 2BEJA 2OHIA 1E1YA 1ZM7A 1GV1A 4GP7A 3TD9A 4F91B 1HUQA 1T2VA 3WGNA 5HFNA 3ZQ4A 4A0QA 5KHOC 2R8OA 5DI9A 1EE9A 1OIWA 2QX4A 2X86A 5CH8A 2X8JB 2Q7OE 3LAWA 1NULA 1LF0A 1VBKA 3FPEA 2IYOA 2OV6A 3E58A 3KPWA 3H11A 3VR5A 2JLXA 2AJBA 4MVJP 3UJNA 1GLNA 3V1KA 3C8MA 4XX0B 4HB0A 1JHPA 2ZBEA 4U0KA 3D4LA 5AJTA 1OKKD 3U7IA 1M6EX 4LJKA 2W2VA 5BR4A 1ZAYA 2OTCA 2ECQA 3H1BA 1EA5A 1F9AA 3O0DA 4HDNB 4LYYA 3PP8A 1YS4A 2V6JA 2XAAA 3UQZA 1PFQA 3IP1A 4WK4B 2GYWA 3DDSA 1IBLB 4XA8A 1F1JA 2KS6A 1GPNA 2X0IA 2ET6A 2FX5A 1L6IA 2CJXA 4YT5A 5T67A 4BVEA 1AS2A 1IN6A 1KEVA 3I6QA 2P9HA 5B64A 3D2AA 4QYSA 4B3BA 4LJ7A 1ADFA 1X6VA 3Q3CA 4N8DA 3RM3A 1U8XX 3TIXB 4RM2A 1YO6A 1A50B 4I6GA 3P9CA 4H7KA 3TQFA 3M6LA 1RJDA 3MWLA 3E9EA 1ODIA 4KE9A 4NATA 4DHEA 1Z2EA 4L6AA 1Q15A 1B00A 3ETCA 2DPXA 4DR2B 1E7QA 1F0NA 1R74A 4L76A 3E81A 3EXHA 2Y27A 1XMIA 3I6YA 1OA1A 4UM9D 5ED0A 3ZJ4A 3TLKA 1Y1SA 2PGXA 4WOCA 2QUHA 1QK3A 2AHOA 4KEAA 4WK0B 4B3SB 3I2JA 1UAGA 1NUSA 1NYLA 3I3OA 4NZYA 1TIBA 3PE4A 4DMUB 1V3VA 1PEDA 3BWDD 5J2TF 4MIEA 1UXIA 3PYLA 4Q3OA 2ZUBA 4JBGA 4X8MA 2YWGA 3K4PA 2QRGA 4F1WA 4Y6RA 3Q3GE 3PD0A 3NBYC 4NCNA 1AH2A 4HDKB 4ZHSA 1ECBA 3RU9A 1GIAA 2X3YA 3BIFA 1QG6A 4Z53A 3K6JA 1VGRA 3W6UA 2F00A 3EIXA 4OCZA 1RYFA 1RI3A 1W59A 1BQEA 2J59A 3BHJA 2BMAA 3PFGA 4PLWA 2IW3A 2QB5A 4QYIB 3N07A 3WK4A 4B43A 3OTOB 2JFHA 3D3JA 1X14A 3PQDA 2V0GA 2FWJA 1OTYA 1N9KA 3OPXA 2DT8A 3ZY3A 4ZEMA 3MELA 5BQFA 3OEHD 4RVDA 4OBEA 5TPWB 1DAIA 2ZCUA 4WBNB 1A4IA 4IJQA 4J43A 1Z7EA 5FPPA 4PFQA 1NN3A 4U7WA 3DEYX 3OICA 5K2OA 3T3NA 2W43A 1AKNA 4JJ4A 1PFVA 2KI5A 4M7OA 4WGGA 5IKXA 1H0KA 3KSBC 1KOGA 3CW2A 3EDMA 5CJPA 1Z07A 3GFRA 4ZMRA 4B3CA 2J85A 2VRCD 3V4FA 4JUFA 4WN9A 4XB2A 4L51A 3H1PA 4KO1S 3ZV6A 5KOHA 3E9YA 3ETLA 3GGCA 2H1RA 3VR2D 1BCRA 2MU1A 3Q3HA 1Q84A 1JZTA 4Q3AA 5AT1A 4B7CA 1LBIA 1MFZA 1ZHOA 4B7AA 2F67A 1GDHA 1YONA 4B6GA 4QDXA 3OKPA 1TJ3A 3G9UA 4C4ZA 4DA9A 3I5XA 1HNXB 4M0PA 2NUBA 2PL9A 1SBCA 3ZDEA 3K0HA 4QDJA 4QUEA 4A27A 1QIHA 3BK2A 2PX0A 3OT5A 4H3SA 4NL4H 4PBTA 1KHHA 4R2KA 4OHUA 4QU8A 2PEYA 3A6JA 5EEHA 4X20B 2BHLA 1L8AA 2DECA 3IO3A 1T0JB 2ZBQA 3EGVA 1S01A 1MJGM 1WZCA 2IPAB 3KSMA 4GGPA 4GQBA 4P7BA 3V4PB 5FUWA 2PJDA 3BMNB 3ZK7A 1M67A 1DUSA 4Q3KA 2JF0A 3ZV7A 3LHSA 4RK4A 5EGSA 3WGKA 2QL7A 2WSYB 3HVUA 4KJXA 1YVPA 3FPGA 5KCMA 1QAQA 4D9FA 2Q5EA 3V2GA 1NONA 1VJ5A 3VSBA 3D3QA 3L7BA 1JDTA 4EVRA 3P9XA 1EA7A 2JFGA 2ZE8A 3FYHA 5GONB 1R18A 2OC9A 2Q3EA 4PPQA 2FKNA 1GAQA 3CW9A 1WEHA 2GSDA 5DSTA 4UCXA 4BIMA 4D0RA 1Y98A 4NXNB 4BNDB 2JBHA 2GNOA 1CYDA 3DQZA 2GZMA 5E9JA 4F6RB 1K75A 4G1MB 2HK9A 4QPCA 4AY3A 1K98A 1XGKA 1KRXA 1YRQA 4QUGA 1YK1A 1AQ6A 1PWZA 3M6WA 2V65A 2G1JA 3K1JA 2Z2IA 4ISBA 4WKGA 4RMHA 1J2UA 3GA5A 1XXHE 2XGOA 5FLYA 2ESRA 1Z62A 2ZB2A 3C3XA 4KQEA 1OAOC 3UY4A 2WF9A 3CO5A 3PNOA 4TMZA 1ISFA 2Q9AA 3HFJA 1NN5A 4IDAA 1YRHA 2H9YA 3FDZA 4L5AA 4AS1A 1PKEA 4NRDA 5LQMA 3LC2O 2XCTB 3H9JA 2I4NA 5F5XA 2ZDGA 5FV4A 2FMUA 2GHIA 4JLWA 3FSRA 2H9IA 2ODNA 1OZGA 3AM3A 1RQ2A 2JFUA 5CLIA 4FSXA 1SN7A 4I55F 4R9VA 3WFZA 3P9YA 3NHLA 3ZU6A 4E4YA 5BXYA 2BEWB 4YRAA 1YI0A 5I6DA 2BBSA 5E7JA 4EZEA 4MUAA 2EGUA 3DHWC 4HPXB 3V80A 3JARB 2E89A 2ZULA 3LL7A 3P71T 3WBJA 1LB1B 1W8IA 1KZ6A 1A9ZA 2XOEA 2UZAA 1H8EA 3AX6A 1SELA 3B7PA 3MW8A 4FHZA 3A2MA 3DTVB 5FD8A 4CMGA 2COKA 4MA0A 1I3NA 5FLEX 1AQJA 2J7KA 1X9IA 4D9MA 2OWEA 1GNVA 4DV5B 4CQMD 1F1BA 1KBQA 3U80A 2WUFA 3TIFA 1OWPA 2Q21A 5EMKA 5H4GA 3ZJ5A 3WL3A 3LTNC 3H97A 4ZT3A 4ZAFA 4EUFA 1O0CA 5BPHA 2EKPA 1ZEJA 3OHMA 1SBIA 5KTKA 2WILA 1E64A 3NHZA 4DAOA 3LS2A 3CNNA 3IUNA 3OZIA 5BQXA 4FFDA 2I1QA 1HG1A 1XJ5A 1E1NA 1YKGA 1JSCA 1DC3A 2H2IA 3ZD7A 2P5TB 1HYHA 2IHUA 3RBVA 3I42A 3S2EA 2FPGA 4MR9B 3IGFA 3C6KA 2MINB 1RKQA 4WNAA 1JHZA 1SHLA 3FWYA 3VKGA 1SQ5A 1WE2A 4CF3A 2WIBA 4HDOB 1G6HA 3IKLA 2GXAA 3KM0A 1UBTS 1W30A 3TUZC 1CIVA 4KPFC 1YCDA 2FQWA 3QBTA 3STVA 1EE2A 3W8DA 1OAAA 1C1DA 3DZCA 1JKMA 3FH0A 5BWCA 3V7YA 3GRKA 1T3GA 3UK1A 1Y34E 4MVWA 4KFRA 2O59A 4RBNA 3MFQA 2QQ5A 3E2MA 4GX0A 4BBJA 5I7UA 2HXGA 3HCAA 3CLRD 2W0SA 2XVAA 2NO4A 2E5WA 1F48A 1B0PA 1KP3A 3CT6A 4F46A 1QNFA 2AYYA 1XNQB 3H5IA 3I30X 3BHNA 1YS6A 2ZRGA 1O54A 2I6GA 2YFHA 1G21E 1CJMA 4ABTA 2W2QA 3MOSA 4Q1VA 3RKSA 3VHLB 5JJCA 4XVCA 3T7RA 5EP4A 1YNOA 2RGEA 3UHPA 1PF7E 2FW7A 1ZUIA 1VHWA 3JALB 1MO4A 2F3SA 1P9OA 3BIXA 2XVZA 3OIUA 1MZPA 1KYXA 4J6FA 4B3TB 2O3QA 3UOWA 3TLBA 2G63A 1JPJA 1X15A 2D0OB 3EEBA 2O1WA 1C0LA 1RABA 3P9SA 2CNBA 2X6QA 4KMOA 3QY9A 4LXTA 5F73A 3K9LA 3NTUA 1I1HA 1FS4A 3FOFC 4YJ2F 3WLTA 4LBYA 5DEIA 1XEAA 3EC1A 3T5MA 2HO5A 1D4ZA 3VZDA 2J09A 5BNZA 4XWKA 5HKBA 1A5TA 1ZYUA 5GP1A 3X2SA 3ZHYA 1DKMA 4C0QC 1Q0SA 4IVQA 1M2KA 4ZWNA 4BCDA 5AUPB 4N3AA 1QX4A 4TTTS 1JEYB 2ZTSA 1HT2E 1IFXA 3AKCA 4OUDB 1U8ZA 4LJAA 4L3OA 4DQ0A 3TPFA 2Q0QA 4DTIA 1YMQA 1GTVA 3U3XA 4Y9RA 4DMGA 5AVOA 2ZJ1A 4BQSA 1V39A 1ZU4A 3BCUA 2EX0A 3WYGA 2NU7A 3I1FA 4HYTA 1XAJA 4OI4A 3RANA 4MICA 2HPHA 3WQSB 1RVV1 4K9SA 1GJRA 2XYGA 4D41A 4EPRA 5K9ZA 5AD1A 1ZGZA 1Z9BA 4I4TF 4N54A 3VJMA 3EVEA 5BQOA 2A1UA 2A5YB 2IH2A 2TECE 2IW1A 1QUFA 4A6XA 3V97A 2WIGA 2LD4A 3ROFA 2C3OA 4X62B 3O73A 3EPHA 3L7MA 2AEMA 2ZSUA 1N2OA 1KJQA 1BGVA 1XLUA 4IRUB 4GKKB 3AU8A 1HRDA 2GFHA 5F98A 1DVRA 4OFXA 3PCXA 4MS3B 3RG2A 4JVOA 4IG9A 4ON9A 5I47A 3LX8A 4ZV7A 2JGIA 1S2LA 5EVCA 5G2OA 3LPCA 4GRIA 2AOTB 2ZI9A 4TS9A 1YBFA 3H6KA 3L07A 2JRCA 2F62A 2VQDA 3I4FA 1OTXA 3QBDA 4UUMA 1NJ1A 3WOHA 2XB2A 4BO4A 4CEJB 3NGXA 2KBEA 4OAOA 3Q8MA 2P90A 3NWJA 3OESA 2C04A 3LX6A 2Y1DA 1MA0A 1A7KA 1RCUA 1T8PA 2WJJA 3LC0A 5CLLA 2HSDA 3S2GA 5K03A 1Q5PA 1XJCA 1UMDA 3IV6A 4WCFA 3R7AA 1ENPA 4Q12A 3R7WA 4O25A 1ANKA 4K8OA 3RH0A 5L3VA 3FTQA 2DBQA 3K05A 1GVNB 3OFJA 3E84A 2R60A 2DFLA 4DIOA 2QIPA 2XNDD 1JEOA 4CIYA 4PIVA 1MP0A 1MHTA 1AV6A 5BVGA 3LI2A 2WT9A 3D8BA 4M0UA 4AYXA 1F2UB 1ZO8A 3C3YA 3ZQJA 2AEEA 2WWGA 5IKEA 5KPDA 4L6CA 1JFFB 5KKCA 2D0IA 5LA6F 1U3CA 1YD7A 2WJGA 3O26A 2H2AA 3UXYA 1I01A 4BWVA 2F48A 3MS7A 1N6LA 1GNTA 3D5EA 1UK6A 4OVKA 2BMEA 1K63A 1X3SA 1CT9A 3AOEC 3HKCA 3A2KA 4K40A 3T94A 3G8DA 3JZDA 3VSDA 2AFHB 1QFYA 3I2YX 5FI0B 3KTOA 7AT1A 1RLJA 3F5DA 1XCLA 2JLZA 1DFIA 3QEMA 3IPYA 4N5NA 5SYNA 1LLDA 1WXXA 1SCQA 2I22A 3CIFA 4INAA 5CVEA 5TPZA 1E7YA 3NH9A 4U00A 5TRTA 1QFMA 2D8MA 4LKOA 5DX8A 2NUAB 4F93B 2GK6A 5BWBA 1QOPB 5AM2A 3B2EA 3ZIAD 2YCLA 3WWZA 2IS1A 4G5HA 5EPOA 4B2LA 3P9RA 4RDCA 1MX1A 4CLEA 3NRCA 2JJ2D 4DDTA 3C4VA 5EXXA 1HNWB 4MI1A 1EFVA 1F8GA 3EVDA 4NPAA 1U1GA 2C2BA 2VNIA 1OZ0A 4MNTA 1BZYA 3VISA 4CNQA 5BO5A 1TEXA 3KDPA 3TW8A 1D3AA 4JS0A 3TNJA 5EKSA 4DIEA 3KJEA 2Z1DA 3NHJA 3WYFA 1QVAA 2C1EA 3FR8A 3RV4A 3K0BA 5GINE 5B1HA 4DYDA 1I3OA 3C14C 4DV0B 2X6TA 1KXJA 5LIPA 3ZD6A 3GARA 2PKQP 3DLTA 4LXIA 1EWQA 4RKRA 3Q98A 1X42A 1T6YA 1YBHA 2J32A 2NVWA 1E0DA 1AN9A 2CVOA 3QVGB 1C3LA 4PG4A 4Y18A 3BMCB 5CYGA 3H17A 3WMXA 1IHOA 4IXMA 3H9EO 1H6BA 1QLHA 4X6XA 3HCCA 5KQLA 2C2WA 4JB8A 3C7TA 1RPJA 1L5HB 2QS9A 1OW3B 3DUFB 3TAUA 1XSEA 4RYLA 4CMKA 1P7YA 4QAQA 3GLRA 5DN9A 4TXMA 1EG7A 3TS1A 4W99A 1PAUA 1P81A 5K8TA 4HD8A 3FJYA 2GI4A 4YBRA 5EESA 3WZMA 2CB0A 1KI1A 3DFMA 3ZCSA 1RAIA 4EEXA 3PRHA 2O14A 1YBAA 1QGAA 3V8NA 4EHJA 4J29A 621PA 3EIFA 1TFUA 1T25A 1ZMRA 3AP1A 3OAAA 2GTIA 4L9AA 5DGTA 5IBPA 1BE0A 3Q7EA 3SOPA 5DMHA 3UN1A 1WV1A 4NENB 1S2MA 5K2MA 3UHFA 4F4CA 3D0RA 5EYPA 1TCUA 1IB6A 5FIUA 1Y82A 3WGLA 1FNCA 3FOWA 4IDDA 1WQ4A 2IEIA 2CXOA 2VCEA 2VT3A 2XE4A 3SXJA 4PZZA 1E2JA 1ZEMA 1HG0A