1P19A

Hypoxanthine phosphoribosyltransferase from trypanosoma cruzi, in complex with the product imp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
189
structure length
187
Chain Sequence
b'PREYEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine phosphoribosyltransferase
publication title Interactions at the dimer interface influence the relative efficiencies for purine nucleotide synthesis and pyrophosphorolysis in a phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
total genus 51
structure length 187
sequence length 189
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p19A00
5EUCA 1V9SA 2P1ZA 2JKZA 3EFHA 3LRTA 2WNSA 4QYIA 4F8EA 2YZKA 4LZAA 4P82A 1FSGA 4RHXA 4WN3A 4LYGA 2PRYA 1YFZA 4MB6A 1QK3A 2IGBA 1W30A 4QYIB 1JLSA 1UFRA 5BRNA 1P4AA 1A95A 1A97A 1HGXA 2JI4A 4X44A 1ECJA 4ZFNA 1L1QA 5BSKA 2VFAA 4P84A 4P80A 5BQOA 4RACA 4P3KA 3S5JA 1QB8A 1QCCA 1DQPA 1VDMA 5E38A 5IPFA 4RQBA 4RAOA 1A96A 2H06A 4RQAA 3DAHA 1G2QA 5JV5A 1UPFA 1DQNA 3KB8A 3MBIA 3QW4B 1PZMA 4RHYA 1A98A 3O7MA 4JLSA 3ACBA 4RANA 4RADA 1XTVA 1Z7GA 4P81A 5KAPA 1I0IA 1XZNA 1QK5A 1OPRA 1A3CA 1DKRA 1MZVA 1ECBA 1A4XA 4P86A 4X45A 5KAMA 4OHCA 2DY0A 3DEZA 1AO0A 1O5OA 2HCRA 2AEEA 4Z1OA 1QB7A 1BD4A 5HKLA 5HIAA 5IAOA 1HMPA 1LH0A 4IJQA 1ZN7A 3OHPA 4LZOA 5ESWA 2E55A 1J7JA 1DBRA 2GEBA 4FYMA 2PRZA 1TC2A 3ACCA 1G2PA 1OROA 1BD3A 4JITA 1U9ZA 1DKUA 1CJBA 4M0UA 3M3HA 1I5EA 3HVUA 3DMPA 3LPNA 3GGCA 1D6NA 1ECCA 1I0LA 2JKYA 4PFQA 3GGJA 4RAQA 5K51A 3MJDA 1I13A 1NULA 5ESXA 1JLRA 4QRIA 1GRVA 3NAGA 1ZN8A 1P17A 4RABA 2EHJA 4LYYA 1I14A 1QK4A 1BZYA 4TWBA 5BQPA 1OREA 1G9SA 1G9TA 3N2LA 1P19A 1VCHA 1ECGA 1NONA 4P83A 2FXVA 1ECFA 2JBHA 3G6WA 1UPUA 3ACDA 4PAWA 4WMLA 4KN6A 2H08A 3GEPA 4M0KA 2H07A 1R3UA 2PS1A 1XTTA 2XBUA 1GPH1 1VSTA 1XZ8A 3OZFA 4RHTA 4LZNA 1ZN9A 1L1RA 1QCDA 1U9YA 2C4KA 3OZGA 1O57A 4M0PA 4RHUA 1WD5A 4RV4A 4S2UA 1IBSA 5JSQA 1Y0BA 1P18A 1XTUA 1STOA 1TC1A 3H83A
chains in the Genus database with same CATH superfamily
2CLKB 2BC9A 4X3OA 4ANFA 3NTLA 2A0YA 1H6AA 2ZT8A 3SICE 2GFHA 3ETCA 3R6TA 2O05A 1GIAA 2VJLA 2ZBVA 5J2TB 2XWSA 1RRCA 3TLYA 1NUSA 4F2PA 5BSGA 2XR1A 2ETVA 2J46A 1PGOA 5ALIA 4L75A 3W34A 4KFUA 2CXNA 1T4DA 3LVFO 2Q5FA 4ENTA 1DOAA 1PJLA 3NIWA 2ZXFA 1SXIA 1H93A 1QVZA 2R1VA 5ER6A 2FW7A 4JX9A 2DLCX 1JXOA 4KLCA 2O8DA 4BE9A 2LZ0A 3KQKA 3NPAA 2RHJA 4O4LF 1S9HA 3K9GA 1OBFO 3H5RA 1XRPA 2BMWA 3OFND 4KIFA 3RANA 3L7DA 3ECSA 3SJUA 5C51B 2P6NA 2BFBB 2IXTA 5EG5A 4ZVVA 5BN4B 1M2OB 1N78A 2XWPA 1Y81A 2R4UA 5HCIA 2PU5A 2HXSA 2X2OA 3AKDA 2GHTA 3E53A 3AESA 3S7TA 3TLMA 1UK7A 4FYVA 3VMMA 1VJRA 3OJLA 1N5OX 3Q40A 4QTZA 1DQSA 1G5QA 5NLLA 5C4IA 1D2CA 3H2ZA 2HC9A 4OQLA 4Q4HA 3MCTA 3UW3A 4ENVA 3HUFA 4HQFA 5U9CA 1I24A 5LB2A 1B42A 2FMTA 3AOGA 4TMVA 3NNNA 1O96A 3RAEC 3F4LA 3O38A 3C6MA 4ER3A 3UMMA 3W2FA 1SKQA 3M83A 4WINA 2UU9B 1M6VA 1XR3A 1WZIA 3ZEAA 4YCSA 3R6WA 1LFDB 1G3RA 1B23P 5ALGA 1EKXA 1TPYA 3TVYA 1HFJA 5AVJA 2YBEA 3LLMA 2RGNA 4X65B 4LJRA 1PWZA 5EI5A 3I9JA 3RASA 1CJCA 2R6GA 2FF5A 5BV2P 4HDOB 3P9KA 4G8DA 1P77A 3E15A 4C5AA 1GZ4A 3PX3A 4GMFA 1I7SB 3AY6A 2FP4A 1UDAA 3I45A 2A9JA 1K5GA 2GF9A 4YUWA 2GCOA 4DFDA 1DCFA 4ZT2A 3TE7A 2R8XA 1M34A 1NR5A 1OI2A 4CR8A 4P0QB 3QTLA 3ZHQA 3R24A 2BGIA 3PJFA 4L5YA 3K73O 3ZK9A 1I7NA 2VT3A 3HQ4O 2C7VA 5IG2A 4HYQA 1EK1A 1KI3A 2BMEA 3KPJA 4HX5A 1BWQA 3DS8A 5L3QA 3QLTA 1KJ8A 4NJEB 4CMAA 4DGQA 2V7PA 3KXIA 4YUVA 2AI2A 3B6IA 4INAA 1MXHA 2JGJA 2FXVA 4AZ3B 4B2IA 3AXSA 3CE9A 1NDHA 5J4HA 1N2JA 2P9GA 1VDZA 1TRKA 1NVKA 1QYVA 2BKVA 1K4KA 4YP0A 1VLQA 1MNQA 3UXYA 2QVXX 5JAQA 4JAVC 1U1IA 4I50F 2ZCVA 3PE6A 4PYQA 5FA6A 3R0ZA 4FE3A 2IUEA 3DXYA 5K09A 1VMKA 4UC0A 3EG5A 1I1NA 2JVJA 1GNQA 1WXHA 5CGZA 5HUHA 1BE0A 1SVMA 3E9MA 4NS4A 4QOJA 3ZLUA 4W1RA 1JZQA 3VQTA 3JD1A 4TWZA 1MVNA 1SOAA 3LL4A 3MCVA 3FMPB 1ORDA 4H0FA 5AXDA 2VSQA 2QE7A 3OCYA 1E1QD 3IKJA 1WE2A 2F64A 3SZMA 3W2EA 3VGJA 4DQUA 3PRHA 3MXOA 4TS1A 5FWXA 3IHTA 2I2BA 2IBMA 4MYTA 1V3QE 3GJQA 2C2HA 3CIFA 5LJLA 3W5AA 1MIOA 3VYSB 3QMVA 1OLXA 4WA8A 1ADYA 2XZOA 1QHYA 4DYHA 1N6LA 3D7KA 3ZWQA 1JEAA 4KXFB 3LX4A 3T9FA 3TI9A 4YMSA 4CR7A 4F3YA 4LCEA 1NDQA 4IX9A 1H2ZA 3QHPA 1DARA 4X0EA 1DKNA 2ISSD 3RKSA 5ALWA 2I6GA 3Q85A 3H0CA 1K06A 4P84A 4UUPA 3JY6A 4KREA 10MHA 4AS1A 1W52X 2I2CA 4B6OA 3THXA 1Y9AA 4EY6A 4MP3A 4CKEA 1QFYA 2QSUA 4CGZA 3OKFA 1G66A 4F2WA 3NVDA 1FPQA 4R9SA 4HQRA 1WPGA 3G1TA 1ZJ6A 5H5JA 2YHIB 3UFXB 2P9JA 5BR8B 2EFCB 4HGOA 4ATNA 4XUEA 5A7GA 1Z8DA 3TLJA 1PJAA 3WB0A 4Z1MA 1NOIA 1C9YA 2JH9A 3PEWA 1M1ZA 4IOJA 1GPMA 3GHHA 4M4SA 3TX6A 2XMBA 5GY7A 1EQUA 3WKAA 2IS4A 1NP3A 4BQNA 3UT6A 1JG4A 4B09A 2COEA 3I09A 2WPDD 2FW0A 2V6IA 4TT3D 3TQOA 3ITDA 3ZHZA 5EL0A 1V11B 1N8KA 5HPYB 2XOXA 1AMOA 1IOWA 1Z0IA 5C1PA 3I34X 3A32A 4XXHA 5F5LA 1ISMA 3E5NA 2JLVA 3QVVA 3AVWA 5T3UA 2Z57A 1XZIA 3V80A 2P6PA 2H5LA 1EU1A 3M4YA 1O5TA 1IUOA 1XMIA 1ZVJA 2NW6A 2QTCA 3EC1A 3CO0S 3K0EA 3UVEA 3ICEA 4IO0A 2VDMB 2PLWA 2XEDA 8ATCA 1NG9A 1XMQB 3MRXA 2GK6A 2QIOA 1YASA 2ZS9A 2QXTA 4G84A 4R9RA 5KHAA 3WDSA 4CEJB 3VDQA 3R44A 3GZ4A 5K20A 5D7NA 1LW6E 2Q1XA 4RABA 3R3JA 4E5MA 4EOGA 3CVUA 4DUZB 4Q4JB 4KQJA 2DBVO 1N5DA 2OGUA 4PSDA 1LPNA 1XN4A 3TG8A 3L4KA 4PX3A 3A6ZA 8AT1A 3PXUA 1VL8A 3FDFA 4PW0A 4QRDA 4C22A 5CIYA 3ENQA 3F98A 2YJ4A 3FMVA 3HR7A 4G5GA 3IT1A 1G64A 2Y76A 3NT4A 4NE2A 3ACDA 1KYXA 2BFCA 2P9YA 3E58A 4HUQA 2HWYA 2X6RA 4MKIA 3AF0A 1I5RA 4D79A 2AJ8A 3PFIA 1NJ1A 4EB6B 3BJZA 3OHMA 4N0QA 1ADCA 3W5BA 3TECE 4IDBA 3O8LA 1XTTA 4Z4EA 2GN4A 1R4MA 5D86A 5B4UA 1BXGA 1QRUA 2GEJA 2R5WA 2VJCA 4IF4A 4RVSA 3CUKA 2R60A 2PBLA 4ALIA 4B2LA 5I7VA 1H4QA 3CQ9A 1KP2A 2YY6A 3EFOA 3L3BA 2YRXA 4KFSA 3L4EA 4XJSA 1KDTA 1XVAA 2F62A 2RHRA 5DTEA 1W59A 2W4QA 1NZJA 4RTOA 2B4AA 2DWQA 3GLFE 4UU1A 3EX7C 4DV2B 2AKEA 1DJMA 1GQFA 1GA1A 2E4AA 2FA9A 1YS7A 4MIOA 3RIMA 2M98A 2ZBFA 3BE5A 2X0DA 3H0EA 5JNVA 3JQDA 4L7VA 1KQGA 2XDAA 1QP0A 5FR2A 2Q4DA 1XTJA 2XUZA 4MX8A 4YRDA 4D96A 3L18A 3NVAA 4FGZA 2WOOA 4L5JA 2BRUC 4EVIA 2XQVA 4G5YA 5JCZA 2YC2C 4C7OB 1AN0A 2CE7A 2AKAB 5KMGB 1ZFNA 3GNTA 4XQ0A 3FNRA 3I72A 3ABIA 4DUPA 4FSXA 4Q82A 4BTEA 2NZUG 3D0OA 4WERA 1MB9A 4OHVA 1RLTA 2VJAA 4A5SA 4ZFNA 1AXEA 2FQ1A 1QHGA 2CMDA 3GB9A 4WK2B 3E0QA 4OKIA 1GU7A 1G59A 4UZFA 5LZ4A 1LQUA 5LCXA 1U2GA 1VBNA 2E6UX 3DFZA 2B1RA 1T3SA 1N3LA 4BVFA 5HZGA 2OGSA 1D4ZA 3NM5A 5DULA 5EIEA 1GZ6A 1QG0A 5ITVA 2ZULA 4NYMQ 4BVEA 6CHYA 4Y3UA 1Q0LA 4IYRA 3T7EA 5AOVA 4KN8A 3JQCA 4HDNA 3HTXA 1L4EA 1OQAA 4IEIA 1ZD5A 5DFAA 3BK1A 1C8KA 1D4AA 1FRFS 3IP7A 1XTKA 2DC1A 3VR2A 4U7GA 3PKIA 1TMOA 2V1XA 2DU8A 3TNJA 3EPHA 1JKIA 1P31A 3STTA 3TPCA 4EMTA 1C2TA 2LPMA 2QM0A 1KZGB 1V6CA 2C59A 3D6MA 4N0DA 4QNNA 3U9TA 3IDZA 1AO3A 2KPOA 3HJCA 3IBGA 4MIYA 2IE0A 4TROA 3U9SA 1OYVA 3URKA 4WA7A 4S05A 2CK3A 3BQNB 4Y6PA 1XTQA 5C9ZA 2OYSA 3WRXA 2Z6QA 1AS0A 1K1EA 2KX7A 2ZWAA 3NT2A 4ZXPA 1KZYC 4BKMA 4BMNA 3K9FC 5ERGB 5H80A 1P7YA 2X23A 1E1NA 3E82A 3GEBA 2X5KO 4UQLA 5P8WA 4BAZA 3OF2A 2NVOA 3ZCTA 5EQJB 3TLAA 4MGEA 2BCEA 1YR1A 3KJFA 2PKXA 3MT0A 4G1MB 1L3BA 3HHEA 4I55F 3LA8A 5BYJA 5C7OO 3R7WA 4RV9A 3V4RA 2JK0A 1NVTA 1UJNA 3G9XA 3DEFA 1S2OA 3OCVA 4ID9A 1D2AA 3DHNA 4ZQGA 1GPUA 4H7EA 2IZ6A 3TBFA 1M1NA 5EGNA 4CUKA 1CZOA 3OETA 2P4EA 1B0UA 1I4DD 4LYYA 5KVCA 1R4NA 1IRXA 2G88A 3BGDA 4M6WA 3B82A 1K4MA 2H8GA 3GAZA 4W1QA 1FOEB 4N12A 3AUKA 3L7LA 4ALJA 3KTOA 2C2BA 1WG8A 4G4GA 4WCFC 1UOPA 2ZTSA 4BX9A 5AK6A 5CDTA 2BEUA 1ZD4A 4AF7A 3ILHA 3N2KA 2HLDD 3GJ3A 2Y1GA 3EG9B 3GNLA 2HHHB 4JH0A 5T8KC 3QU9A 1MP0A 3HADA 4B1FA 4YHHB 5G53C 3GJ5A 1QAMA 3NXSA 2UUBB 5K0ZA 4LN1A 2XD9A 4N3GA 4C2AA 1JZTA 1T6YA 2XW6A 3KK0A 3ONDA 4HKTA 4HCJA 1QCDA 2OHVA 2ASVA 3O92A 2PUTA 4IAOA 4X92A 5ILGA 1PFUA 3QUCA 4NL4H 1JDVA 4MUHA 4WN9A 3W5DA 4LMBA 1CR0A 2HCJB 3B89A 5EYPA 1B4DA 3FSEA 3MEQA 3MS7A 3DEKA 4XYBA 1W1WA 4DSNA 1CR2A 3FPEA 2O1XA 4I4NA 3IUSA 5DNDA 3ETGA 1JEDA 1TE2A 1X39A 3TZKA 4BU0A 1FFCA 2N42A 2NTVA 4H7JA 4W7HA 5JALA 4ZHQF 5GONA 3FGZA 2ZYHA 4YJ3F 4W9RA 2VQEB 4C7VA 1YFJA 4D3XA 3D4BA 3WAKA 4ENPA 3V7WA 4KYVA 4Q1VA 1UT8A 2BFDA 3GWZA 5E9AA 4E70A 1TQ2A 4QQFA 4GKJB 4NNPA 3PX7A 1A82A 4MW5A 3N07A 4WVFA 1HGXA 1NPDA 4ZALA 3VKUA 1XEWX 3D6AA 4PYIA 2OO7A 5KB3A 4J2OA 4W5NA 2O23A 3HA3A 1UANA 2IIVA 4W5TA 2AN4A 1OTYA 1XTBA 4G63A 2WV7A 3RYIA 3TW4A 5A05A 2Q45A 5GQSA 2UYHA 2CL5A 5ITZB 2OFOA 4ND8B 3N58A 1JQ5A 5A1JA 2QQGA 4PYKA 4ZPXA 1I32A 1ZPDA 2Z09A 1JQDA 1XCBA 5LP6B 5EP4A 4RIIA 4II7A 4Q21A 4DBLE 5K05A 4PX9A 4E30A 3WGIA 3S7ZA 4N48A 2Q0QA 3JQEA 1H9CA 1G17A 3SHWA 3GYGA 4HDRA 3P0EA 3ULKA 2IYNA 3IHLA 4J0HA 2J5KA 4M1OA 3C7CB 4RKQA 3LWNA 4RHFA 4PR0A 1AV6A 4B0OA 2GN0A 3RVKA 3ZV6A 2XMQA 4KX3A 3CUVA 5F9MA 4BRWA 1AO0A 3G88A 1JG6A 2CYCA 3BRSA 3DKIA 5EHQA 3FOAA 1JQAA 4RKYA 4LHVA 3NAMA 4CIXA 2R6HA 2WD7B 3LT4A 1T8YA 3N8IA 4UCWA 2JZOA 5EOVA 5JBQA 3ASVA 3CW8X 1KQPA 1G18A 4D2IA 3QX7A 3LUKA 1BD3A 2DAPA 4MIKA 3Q15C 4FDVA 1GR1A 2XMPA 3D7NA 3TLGB 1WMBA 3X1ZA 1J42A 1PX2A 4OXKA 4PPNA 1W5EA 3P2MA 1JALA 2E49A 2QQEA 2QNBA 3Q3IA 4PCAA 4ZDWA 5A3QA 2YWGA 3EBLA 5IBPA 5IDWA 3GVXA 2GJ4A 3W5IA 5A6SA 1KI4A 2C9MA 2GZRA 4XSVA 3H8VA 1T8PA 1CRQA 2WYVA 2I3DA 5LQMA 4OJYA 3RYHB 1IK4A 5HKKD 4KUGA 1SU8A 3KZXA 1WHSA 2RARA 1AC5A 2O8FB 1GGFA 5BQPA 3A6DA 5CXQA 4AN4A 1G9SA 4BVGA 2ZRHA 3CWZA 3IYLW 3ZHXA 1Z0SA 3UT5B 2H5EA 1PJ8A 3WLKX 3DB2A 1MNAA 2A88A 2NU7B 1FP6A 4POAA 5JFTA 1RXVA 5LZ9A 3F7OA 2GVNA 1OLOA 2I5PO 4X6UA 3VV2A 2B5OA 2ERYA 2Q4BA 4RM3A 3UCFA 4BPRA 1NNEA 1MZPA 1N6NA 3B3QA 3NIDB 2J48A 4XQCA 4YJFB 5HBRA 4W5OA 1WP4A 4LFBB 4KKVA 3GLVA 3BK2A 1KK3A 1DV1A 3OZFA 4E1BA 2O4UX 2AQ8A 4BVKA 3EXG2 3F1LA 3RRBA 2GTIA 1BMDA 1JR3A 1TZBA 2REQB 5KJ1A 3C85A 1ZN2A 3ILXA 2IHTA 2FZVA 3R9KA 3VZBA 5JSQA 3Q41A 4D42A 4BPBA 3T95A 3Q4GA 1CY1A 5C8YF 3H83A 2VSOA 4LISA 4PQEA 1Q83A 2K87A 4OHXA 1TQHA 4I36A 5CIQA 2IFTA 1KKUA 1P1CA 3P71T 7AT1A 1EGAA 1L0BA 1Q0RA 1CZNA 5K8CA 2XD4A 3N7AA 1QFSA 3OQHA 3O8OA 3UHAA 3GY0A 4DRZA 5IVKA 2VT7A 1EUZA 1IY2A 2B8TA 4LXIA 3QBTA 4QUKA 2O2XA 1QPBA 1UDWA 4OGFA 3Q2OA 5TQ0A 2H1VA 1J9ZA 3NRJA 3PL1A 1T3ZA 3AUTA 4I4TF 4N76A 2QA5A 2AT1A 4FJ2A 4WUTA 1A1SA 1UMDB 4DNXA 3I5YA 2DQSA 1NT4A 1XZQA 3B5IA 3ZLBA 2C95A 3M9WA 1TCAA 1QE3A 5E7QA 3GBSA 1DXOA 3EQ2A 1MQ8B 4FI3C 3ZDBA 3DVRX 5HUQA 4OJKA 3B5EA 2NWQA 3WSTA 1LW7A 2AQIA 1DQNA 4BN4A 4GPAA 1A7JA 4DA9A 1QRTA 2H63A 1XNRB 5AHOA 5FNVB 1QC5B 4MV3A 3GG2A 3UHFA 3FA2A 3IPRA 2Q5QA 4MR7B 1I0ZA 5AD1A 3STVA 2NYUA 3FAKA 1PFQA 2RK4A 3DQQA 3TZLA 2W2QA 5LUAA 2IEZA 3C1TA 3P97A 2RGDA 2ZJFA 3BX1A 4L8YA 1KDOA 3LA6A 4C0LA 4CVNA 1F3OA 4A8JB 3NHKA 2LBPA 3K96A 1IEVA 1V2HE 3L2OB 4FOLA 3HI6A 4QUEA 4C6HA 4JYCA 3MMZA 1TA9A 3KYJB 4U0JA 3RS9A 2VH5R 5FUQA 3BGSA 3NM6B 2GNPA 3QIAA 5FWAA 3SYMA 4MGKR 4R2WA 2F4VB 5DEIA 1Q0ZA 3HJTA 4BP9A 1TQDA 2W71A 3WBJA 4LJSA 5CLLA 4DE5A 2ORIA 1LDMA 5CVEA 1K4YA 1UDXA 5EWJB 3R40A 2W6JA 4KBGA 4XSGA 4TMKA 3U7FB 2JKYA 3E1GA 1OFGA 1DAKA 2ZJ3A 2WKSA 3HWSA 3F6YA 3AF4A 3NR2A 4HH0A 2HNAA 1GRVA 4G07A 4MUFA 4RD1A 1ADBA 4LC1A 1HXHA 3IIKA 3HDYA 4P8RA 1Y8QA 1EE2A 4UHJA 2EBFX 3FOWA 4HS9A 4NBKA 3UMVA 2Q5CA 1VPDA 1WO8A 2G4LA 1Q7CA 2A5LA 2QHXA 1UJ4A 3B6KA 1QVRA 3CISA 3NGLA 3OKAA 1ZLXA 5I3CA 2LTAA 5EIBC 3LKDA 2OY0A 5TQ2A 3T0FA 5E8RA 1EFDN 4YGYA 2B5VA 3NG1A 3L1HA 3PXAA 5DK4A 1GTL1 1A2KC 1IRIA 1RLOA 1R6AA 2FSSA 2NZYA 4PGGA 2XB4A 3KOXA 4MITA 5E95A 5LLTA 3OUTA 4B3IA 3MS2A 4G0NA 5HXAA 1PI3A 1Y8AA 1DNPA 1E9RA 1XMPA 1HNXB 1KFEB 3HSYA 3UMFA 2FUG6 4HB2A 3IUJA 2AUNA 4IH4A 5J9FA 1G4HA 4EHFA 2XGOA 3KZ1E 4NVRA 5K9ZA 2P5UA 3QKTA 2Q3JA 2O1EA 3T1VA 3FF1A 2ZREA 3H2YA 4TL6A 1JBEA 4YP6A 1UBRS 5J2TA 4Z4QA 3GFRA 4WBSA 4KR2A 2YJTD 3V4OA 1ZSYA 3W9BA 1Q1AA 1JBKA 2OAEA 3T1TA 3F7MA 2HMSA 2CSUA 3GR6A 1Z37A 2IYLD 1HL3A 3GFVA 1Z45A 1QP8A 2Y0EA 2JH3A 3PE3A 5F3RA 5FADA 4NK5A 1I4WA 1ECPA 1DC4A 3UJHA 4TTPA 1DKLA 4E11A 2BJHA 1TTTA 3O95A 1GQSA 4TKLA 2EG9A 3IJ5A 3AVVA 2GDJA 1FVHA 4EJ2A 4CT4B 4MGYR 4MHSA 2KLHA 3WLOA 1VGVA 2ZYDA 4AS2A 5BN4A 5BSKA 1VE1A 3CEMA 2HRCA 1M2OA 3R20A 4Q19A 3Q6IA 2W0SA 3LJKA 3D6VA 1EVJA 4RDHA 3GAAA 5DU2A 5FBRB 4YPFA 1JG7A 2GESA 4JIMA 3VI4B 4CFZA 1WNTA 2DMRA 1L4YA 3EDOA 3EDCA 4IJWA 3TQRA 3FD8A 3NWOA 3R09A 3BT7A 4BX0A 1PBNA 2FR8A 5JHGB 1NUAA 5DWQA 4BBZA 4V0OA 1B6SA 3MCAA 3I2YX 2BGRA 3SIRA 2CYAA 3WLMA 5B6IA 1OPRA 4QUIA 4M0MA 1G2IA 1G8GA 2AR0A 2RHDA 2RG7A 4O25A 1K8XB 3ICWA 4FMDF 3B6EA 3WLQA 3E7DA 3BA6A 3DJFA 4Q34A 4LTDA 5EIXA 1DCTA 2ZS7A 4WGGA 3DC2A 3HFRA 3LQKA 1XZAA 1ZHFA 2BHNA 1EA5A 1TAQA 3X1WA 1CY8A 1TA0A 4QD3A 1BVHA 1SBQA 2PGAA 5F2EA 5JG7A 3L4JA 2PUEA 4HGRA 1Y9ZA 3OHPA 2M9MA 4ZYLA 1K6IA 4OQNA 1Z6QA 3DW3X 4XE5A 1N6OA 4C21A 4DTCA 1XMXA 2R7AA 4N7MA 2EL9A 4YK7A 1PJZA 1NP6A 2WNHA 2SECE 1WA5A 3CW2A 3ZS9A 1OH8A 4G0WA 1CJBA 3HU1A 4AROA 5FXMA 1ZIDA 1L5VA 3M34A 4YRBA 2BKAA 2X8JB 1EXMA 2Y6VA 3RS5A 1T6NA 1G8PA 2EW2A 5JEEA 1EIZA 5EXDA 2CHQA 3HWRA 1A9TA 4YA6A 4MUBA 1ZMTA 3AIMA 3WI7A 2A92A 4FNAA 2YFQA 4ZAVA 4CMEC 4PNHA 2GTHA 2IYZA 4GUAA 4H4DA 5CJ2A 4ZKDA 2B1IA 3LU1A 3B70A 4AZ3A 3Q11A 4EVSA 3F67A 1RKVA 3PUKA 3Q8LA 3RGWS 3NTRA 1PW5A 1Z0ZA 2HSJA 3SYTA 1VMAA 2H85A 2HTFA 4Q0MA 3R9XB 1B6GA 4L16A 4FYPA 1F14A 1JWAB 1L8AA 4PLVA 2FNAA 3IXLA 4HB3A 4ZICA 1TZJA 4R1SA 1DKQA 2NO9A 4WFJA 1N34B 4AKIA 4J16C 1YDFA 2VT2A 3UJ7A 3FBWA 4O5OA 1FCJA 4GLFA 2CV0A 2JGDB 4MKZA 3R5XA 1VSTA 4FINA 1TOAA 3WFZA 1VB3A 2OPHA 2H4YA 1QIHA 2A0XA 3IQEA 4K9RA 3EMVA 2FQXA 3GEEA 1CZUA 2YIVX 3RROA 2VYND 4BFVA 1OOEA 4CKXA 5LBUA 5JUWA 1LBSA 4N3NA 1HPLA 4DY4A 1Y0BA 3D6FA 1QHFA 2G09A 3V6LA 4C0QC 3Q9SA 2YWDA 3IKVA 1QZTA 4EG3A 1VQ1A 5GINE 3AM1A 4ZRDA 4G4SP 4FZ3A 3UK0A 2Q8NA 4GM4A 2YW2A 3PVSA 3OF3A 5IDVA 3MZ0A 4QPNA 3HB5X 1Y3BE 2NSHA 2HK7A 5JZOA 3BMCB 3GZNB 3IP9A 1VE6A 3C7DB 3L4BC 1PTKA 5C8DA 2QMZA 2WSLA 3MLBA 4RKFA 4AY2A 4TWAA 1RHMA 1S3SA 1ECJA 1Z6PA 4GS5A 4ND5A 3H86A 2BCGY 4F06A 1ZS9A 5HFJA 4PG7A 1QG2A 3HABA 3JARB 3QFCA 3K71B 3PGKA 2OMEA 3DOFA 3LBYA 4LOIA 2FLWA 2AUMA 2QTNA 4NX2A 5JNSA 4CEHA 5SY9A 1K7XB 2YHIA 5HGJA 4KRYA 4MCIA 3UFXA 3WNZA 5KX5A 1JWLA 5FJIA 2JIPA 1FFSA 4E7PA 4CTMA 4US2R 4G85A 4Q3EA 1ISRA 3RLFA 5A3SA 2R85A 1QNFA 4IIHA 3DEAA 5GGYA 1O8CA 1VYUA 2Z4TA 3AKEA 1T5BA 3CN7A 1ZRSA 3KBBA 1ZRMA 1A5AB 1ELOA 4FYJA 4LAFA 4N39A 2FDRA 1N5IA 1V11A 1TEHA 3FPBA 4K2AA 3CFYA 1PJTA 2WJHA 4BAGA 4QM7A 2YKGA 4MA0A 4OHCA 1GA4A 5LD2B 2Q7OE 3MW8A 2BH2A 5CW2A 1JZSA 4L9RA 2HLHA 4MJLA 4CTJA 1ZONA 3Q6MA 4WLUA 4G36A 3AR9A 2AH5A 2I1LA 2YUIA 2XWQA 1B1AA 3AEUA 4HR7A 2SKDA 4Q6BA 5F73A 2RH8A 4V03A 3C4JA 4FHZA 5CVTA 5JWHA 1U1GA 3KELA 3QEMB 4UTNA 4FZVA 3LECA 1NXTA 4JUCA 4LV5B 1YBMA 4LHYA 5BV1A 4IIYA 1MIHA 4C7JA 3R75A 4CKYA 4DM7A 4CEJA 1LWNA 3LT2A 4B44A 1FSZA 3H16A 1Q92A 1XQWA 3OFKA 4PLZA 3KLPX 1CRZA 4GEGA 3D59A 2X7XA 1V1MB 4IDNA 4LMPA 4RLSA 3H5LA 4Q4JA 4MWEA 2CLLB 2W9XA 1J5XA 4JLVA 4JA2A 4E94A 2AD1A 3IGFA 1FFAA 2QX8A 1MV8A 2IY8A 2FPUA 1ZUNA 3MSCA 4FYYA 3QLVC 4BNFA 4AMYA 4CG3A 1EE1A 1T2DA 1HTTA 2G04A 3AIKA 5BPFA 5JT1A 4P4UA 3NJ4A 5LZ8A 3PCRB 3CX4A 4OXNA 4DUGD 4EB6A 1V8BA 2PXHA 4RS3A 3T3NA 1QIKA 4EYKA 2BR3A 5G0TA 3BTSA 5JLAA 4C6RA 1CQZA 1GKIA 2WIGA 4BOYA 2I29A 1C3EA 1TFRA 2OR3A 1U3UA 2G0NA 4IJMA 1JQKA 4UHEA 4DDHA 4EABA 3OESA 4EUFA 5A62A 1MLDA 2FLVA 2Q5HA 4X91A 1DIAA 1AF4A 1HFWA 3QYJA 3VO2A 1Z18A 2GBPA 3FPKA 3RVQA 1SB8A 2B82A 3QF4B 5K8VA 3PHBE 1DQRA 4CMIB 4NCHA 1T5OA 1PJCA 5GM1A 1Y5MA 3QQ5A 4GL2A 3ABRB 4RPKA 1CR4A 2H31A 4GKKB 5BUSA 1R0LA 4B31A 4CLRB 4RD2A 1PNRA 1UBGA 2FMXA 1XNGA 4H3SA 1L9XA 4IV0A 4XWTA 1ZOOA 2BKLA 3IO3A 3AJ9A 4EG8A 4LJ9A 4QT4A 3EC7A 3ROEA 1OZGA 2VPXA 3G3EA 5KMGA 4K6FA 1QLHA 1HLDA 5A4IS 4C0JA 3IQFA 4I6EA 4L6AA 4P22A 4MKFA 3ZWPA 2O50A 3AHEA 2K7ZA 3DL7A 3FE2A 4NICA 2JZNA 2I9KA 5DYYA 4LHZA 2Q4EA 1E8MA 1VBMA 1DOHA 2DWCA 4WW0A 3WOHA 2E82A 5IJWA 1IIRA 4MV5A 1OF1A 4D57A 1RIIA 2BFWA 4B4DA 2FFQA 2CZQA 4M7OA 4QDOA 1LDYA 3UQZA 1NJ5A 1DCKA 3EB9A 1Z6TA 4HFJA 3Q8KA 4QJBA 3HB0A 5LYYA 1CFJA 2JVIA 1F5SA 3I12A 3IVAA 2OMKA 5FI5A 4JLPA 2ZYWX 5L53A 5BO5A 4FOOA 1Q22A 3PGXA 3X2SA 5ADWA 4CE6A 4YRAA 1YKSA 1IQRA 3QVSA 4IHJB 1KIAA 2VYFA 1Z4QA 2PZBA 3EAQA 3NZEA 3EGVA 5GZ1A 3JQ8A 4E1AA 2EIHA 3NHBA 3R7AA 4YUZA 1R8QA 4W5QA 2CD7A 2QNRA 4Y2HA 4EF4A 2G1KA 3CBGA 3IUYA 4OBBA 1OBHA 4YRQA 1USGA 3UFBA 3KWFA 2WMNB 3LP5A 3QPCA 3DUFB 1Q91A 4KI7A 1W94A 5KIAA 3LRPA 2ZQYA 3I8OA 1SKUA 1TNDA 4FX2A 4UVGA 3TD9A 3I9V1 3EZXA 4BCDA 3E70C 2H7YA 1JRLA 3G49A 1L4GA 2IUUA 6AT1A 4YR7A 1FX0B 1DAHA 2B2NA 1QF6A 1CHNA 1IHOA 2OGWA 1MC4A 2PUDA 1E2EA 4LF5B 4INZA 3CLUC 3A7DA 5GJBA 1TTHA 3I6ZA 3OZIA 2VLBA 3TRFA 2BFNA 3KVNA 4MWTA 4Q9DA 4UCQA 1T9HA 2G25A 4NCXA 5FWYB 4OLHA 1YA6A 1UZLA 2C0CA 2D6FA 4HH4A 1HR0B 1JSXA 1ZMOA 2VCYA 3RC8A 2HU7A 4P58A 4PPFA 3S2UA 1ZN8A 2J0UB 4K6KA 3COZA 4YAFA 5ALUA 1SCJA 2OO5A 2CN1A 2CWWA 4A0HA 4DA7A 1FSSA 1CJTC 3KJNA 3PPIA 1AUQA 2FSVC 1R6VA 1X1BA 2X0RA 4DIMA 4LWQA 3HXQA 3MGGA 1Z74A 3C7TA 3FYDA 5DGCA 1JJBA 1TYAE 2C3MA 3MF4A 3AL0C 4KG7A 2HXYA 4RKRA 4YI5A 3FHTA 3L7MA 4C0KA 1QFJA 2RBGA 1EJ6A 2ZI5A 3CRRA 3GVIA 2NUPB 4MXDA 5ENVA 1XZBA 2JASA 1YRQA 2YVLA 2NU6B 3DZKA 1RDFA 2Q9AA 4OI1A 3CBQA 5THKA 4FGSA 3EZ7A 4H6VA 4I5EA 3EGXB 2O8EA 4TKZA 1TTQB 1JMKC 1U8YA 2CD9A 3QA9A 4JI7B 3K30A 1UEIA 1W47A 1BA3A 3S0JA 3WR5A 1T0BA 2F17A 3OY7A 3PQ5A 4HLUA 3ORRA 2GNAA 3VC1A 3QOWA 3KLMX 1UXHA 2GZHA 3I8SA 1J0XO 4CHTA 3SQXA 4LOHA 5FOWA 2UXDB 1O97D 1MABB 4JVNA 3OP1A 4J03A 3I5UA 4V1CA 2F1KA 2A1TR 2VHQA 4K5QA 3GDWA 4PCVA 2OK8A 4WZBB 3U2QA 3AILA 1M76A 2LW7A 2OUIA 2VOJA 2NT3A 4AO8A 4DDWA 1U0FA 1N2XA 1CNEA 1I01A 1YR3A 2HJRA 3DDOA 1A5BB 1S4QA 1IN5A 3C1OA 3G5LA 3SZGA 2XEXA 1KWKA 2IDKA 1UZNA 3QFTA 1R64A 2RC5A 3IAUA 5GV8A 5JY1A 3TIFA 3OQMA 4U2GA 2XH8A 4O4IF 5JCPA 3IKMB 5ITZA 3K70D 4RKWA 2ZSJA 4ND8A 4PG5A 4A82A 1HYHA 4F60A 1Y3HA 4NV1A 2X0FA 1MHPA 1F12A 3CZAA 4ESVA 4QHSA 1RRGA 3HKEB 3L8GA 4XH9B 3UMJA 3OF5A 4IDFA 1U0GA 4RZUA 5F5XA 3PGMA 5LP6A 4MOWA 1N7GA 1QRDA 3IP8A 2ZAMA 2YICA 4TSFD 2FAXA 1ESEA 1XRRA 1PG0A 3R3ZA 5FI0B 1NXQA 3DAYA 4JI6B 2BFMA 2D06A 3UF0A 4BE7B 1ISPA 1GGKA 3EBOA 3B9RA 3LCVB 2XXJA 3P20A 4FFWA 2P65A 2C4TA 5FBQB 4WOBA 4DV4B 1CXZA 1FFHA 1YQUA 1N2SA 4FHCA 3PXDA 5EIHA 3IV9A 4QG7A 5MN5A 2Z58A 2P3OA 4N5NA 4RJJA 5EUBA 5ALOA 3TL6A 2WD7A 4HWSA 2GO1A 4BJ5A 2HEIA 3EZNA 4F3TA 1ORTA 4OQXA 3H4IA 3ZGLA 2QN2A 1F2TB 5D51S 3C5HA 5HIAA 4LIPD 5AKZA 3TLGA 5BNTA 3WSVA 1USIA 4EJMA 3FTQA 4DUYB 1GZHB 2R8PA 3OTQA 1GG9A 4TKVB 3HUUA 3W6NA 5D5PA 5HJEA 1TLFA 3IQZA 4WKGA 4R40A 2O5CA 1XVLA 3TE6A 3BE6A 2JJMA 4IUDS 2CHVA 5CCXA 1U9ZA 3RKUA 1DGQA 4BEBA 1FQOA 4JB0A 1BFUA 1DINA 1J39A 2XNDA 3EQ7A 2Z2KA 3RYHA 3LQ2A 3ZK7A 2ZWMA 1VHLA 3D81A 1F8XA 1JJAA 5AH0A 3VKFA 1GNVA 1VKOA 2V4MA 3ZU2A 1ZGJA 5JCXA 2P2NA 2VHZA 3SVTA 3ZH9B 1DQZA 2HMVA 3UT5A 3ZI4A 2Y6UA 3DW1X 5D8DA 2NU7A 3M6WA 4CV3A 2J3IA 4RGVA 4GYYA 5EIWA 1B2LA 4ITRC 2GAFA 4EPVA 2JIBA 2QJFA 2YMMA 3MWKA 1OIWA 1AV7A 4HAXA 4YJFA 5AWFC 5IUJC 1XYGA 1ZK3A 4II2A 4LK3A 3K20A 1YGYA 5G02A 4QEDA 2ZI7A 2QLFA 3BG5A 2D2EA 2A94A 2N0SA 2H48A 2ZUVA 3BS4A 3RVDA 5JXJA 3BXEA 1G5IA 1EFHA 4N40A 4OHOA 2YWJA 2VP3A 2REQA 1I1QB 4YUXA 1FE8A 5TGDA 2A86A 2QU7A 2CCGA 2HQRA 1ZD9A 3NV9A 2GEKA 4IIUA 4L9AA 4X94A 1TYZA 1KL7A 4A0RA 1G8MA 1LV7A 1XEFA 2AQHA 2ZIVB 2VHWA 5ADHA 2XKBA 2AOTB 2PEZA 2YFYA 4MAFA 3OFNA 3UCXA 4DV5B 3FNEA 3ZX4A 2C2KA 4E6EA 5KTTA 2QTGA 1RP7A 1EFRA 3AB7A 1IEXA 1YAJA 4LSWA 1JVBA 3HA2A 3N8NA 1VGQA 4RIEA 4DA6A 1HH4A 2EKLA 2WB4A 2E4ZA 4JOBA 4LS3A 2DFLA 3VZQA 1XZCA 1YR7A 5F7OA 2YJ6A 4YT4A 5IDQA 3FUUA 4DQVA 2BPOA 3V5NA 4F6LA 3QEAZ 1Y9JA 2QVLA 4J0EA 4LI0A 3X43A 2XCSB 1JMYA 3AHHA 1UMDA 3DD5A 3HLTA 4CQNA 5IXSA 3D3KA 1P4RA 2A5FA 5DGHA 3CH4B 1G8FA 3VDXA 4J43A 2Z30A 5LWHA 2BL4A 4G0XA 1MCZA 1JEEA 2J7PD 1GZ5A 3D0RA 3DBHA 1SUFA 4F4HA 3WFJA 3EMBA 5IM4A 2C5GA 2B83A 4LJ4A 3E6AA 2G4CA 4P3KA 3K92A 1J09A 1EWRA 2JFHA 1SG9A 3GLTA 1VLMA 4N8EA 1QGYA 2JD0A 3ZGZA 3FB1A 2AK2A 1A72A 5FNVA 1QC5A 3T9AA 4CFSA 2PGXA 3D4PA 1KJ9A 5ADVA 4LI3X 1E4OA 4MR7A 3RSZA 1NNUA 4DVGA 1NDUA 3L0ZA 1YZTA 3LPCA 1Q15A 3E9QA 3EGEA 2W6OA 1FJHA 4XB2A 1M6HA 2VL7A 2Z5LA 3LT0A 1CB0A 1U2TA 4K26A 4NOMA 1S02A 3QXCA 1RAAA 1OB5A 3LKBA 3J80A 5JADA 3WLPA 4DVJA 4TZTA 1EA7A 3C98A 1VIMA 1ONSA 1XDZA 2XCIA 3ESDA 3IAAA 3O9MA 3AF5A 4X45A 5EWMB 3M6MD 1P4SA 1NG1A 3L6RA 4A8JA 3DSRA 4AYTA 4HWTA 1KSGA 4X3CA 2PRKA 1WSAA 3VVBA 2YW9A 1FNDA 4NQRA 1E77A 4PSUA 3W2GA 1C1YA 3V8RA 4JB3A 3ZTWA 4IDPA 1L7EA 3BWCA 4KYUA 3HXOA 1RXWA 5IABA 1BDMA 3HFGA 5D2CA 4PU0A 1ZL0A 3E18A 2Q99A 2YXPX 1Z6XA 2QE6A 3M89A 1KXJA 3ZWWA 3JTMA 3FPAA 5HKAA 5KKCA 1KEVA 4DLSA 1MOPA 5A06A 4MRVA 4EI2A 1E8NA 1T36B 4PNPA 2EX0A 3V1KA 3U17A 3WZLA 1ZJWA 3GLFB 5HHTA 3VFDA 4DV0B 3U3OA 1FUEA 3AJDA 3UYKA 1E7MA 1ZXBA 1KYYA 1DAMA 1NJ6A 1HDGO 3SQNA 4LF7B 3OIUA 4MPTA 1VPTA 4Y6OA 5H83A 1DIRA 4DREA 1GDHA 1K27A 1EX1A 4IEEA 3ME5A 4YPOA 3WKEA 3RBAA 2GB4A 4JVOA 1K08A 4B73A 4Q00A 4CTOA 1DAEA 3SS8A 2ZI9A 2X40A 3DMTC 3TTWA 1ORRA 4BO1A 5B7PA 1Z0AA 3L02A 1GXSB 1JXMA 2DQZA 3EIUA 3R3XA 5J40A 4M98A 5T41A 3SYNA 3UAWA 4P7KA 1M67A 1MJFA 2FX3A 3RK1A 4UARA 4WADA 5EQDA 1A9XB 4PO1A 4L0QA 4ZV4A 2K4MA 2VQSA 1V16B 4RMIA 2HU2A 3L8CA 3QVUA 3M4JA 1K7SN 4AICA 4C78A 2KYRA 3M5WA 2C7QA 3S1LA 3ZJ5A 3NBKA 5CCEA 1WSDA 1FYVA 2D1RA 3LQ4A 1T3HA 2IBSA 3OSUA 2ZIUB 1HYBA 3BQMB 1WD5A 4M88A 1E2FA 2WR8A 1XZDA 3R7LA 4DSZA 2PJUA 3TKYA 1UZAA 4LX0A 4CLDA 5DI3B 4OSPA 1P91A 5SZIA 4FCCA 4GPTA 3AI3A 2SNIE 1KRHA 1RJFA 2XLBA 1YIAA 3B85A 3SC4A 5DN9A 1EQAA 1NY6A 3MPOA 4IGIA 2HYIC 3CLTC 4BJ1A 4OI0A 4OSOA 5CAEA 5I7SA 1K75A 4UUNA 1SC9A 4MYRA 2D13A 1PZHA 3LGSA 4N6GA 4NHEA 4P5PA 3X1KA 5E7JA 4B87A 4BZPA 1NNSA 3JWGA 4QC2A 1UMKA 1PGNA 4OCZA 5FPQA 3RFTA 2HW8A 4PYMA 1HNWB 4RIHA 1E6WA 3O6VA 1RCFA 4GFDA 4IDQA 3MM4A 2WPDA 3VH2A 3QVMA 4LOKA 1A8HA 2C5AA 2X7HA 1QOZA 4U2KA 1PE0A 5ERXA 3GN2A 3LC2O 4J75A 1CV2A 3VR5A 1P6UA 2CW5A 5IX8A 2XCTB 1CZHA 4WFIA 3NYIA 3GP5A 4HOYA 2RGAA 1YCFA 3KLBA 4JJFA 4HK4A 2RJOA 1FNNA 3VZRA 3F6CA 3LXUX 4MV0A 4FC6A 2WF8A 1PS0A 1N3YA 3EIHA 2PS0A 4DA8A 2G76A 3H1GA 1YVPA 3DE0X 2B8WA 3WAJA 5BUZA 4EDFA 1O0BA 1CHDA 1VSQA 2DVMA 4W5HA 3DNMA 5F9HA 5K3AA 4RHCA 2XTJA 4NZNA 2VBGA 2ACKA 5A9RA 5K3OA 4E32A 1ZNXA 1TVKB 3K6SA 3KUDA 1U8AA 2V7UA 1LJ8A 1QXSA 5K0JA 1NUQA 3OA2A 2VVTA 1U7UA 5K7SA 1KI7A 4MWOA 1A7AA 3BB4A 5CM9C 3CJTA 2C8LA 2C5SA 3WGMA 2NUTB 4GPZA 3NWJA 3PCTA 5DLPA 2X8JA 3BHNA 4P4GA 4TVKA 3VU9A 4UBLA 1SQ5A 2G3YA 1E4EB 1N1MA 4XVCA 3BXGA 4K1LA 4D3DA 2TMGA 5AXCA 5BUQA 5MN4A 2VQDA 3UJPA 3MIIA 4OM8A 4PLPA 1QV6A 1PR1A 3RADC 4AI6A 3ZV3A 1D4OA 1JPNA 2EX4A 2XDQA 4AAYA 1Y89A 2OV3A 2PMFA 4KK4A 4MQ4A 4P4TA 4U7PB 4X7PA 4CIVA 1UBJS 5B2EA 1HX7A 3K0HA 1YRLA 1J7KA 3BD7A 3OPVA 1ONBA 3R9XA 1GUBA 1UPTA 2UZ4A 1GU0A 1G5PA 4YMWA 4DV1B 4QDJA 2ILVA 4UM8B 3R3VA 1V25A 3HB7A 1JQ3A 4LXHA 1IYZA 4G37A 5KNDH 3G23A 4FXPA 3WA7A 2FJPA 3I23A 3U56A 1BH2A 1W4RA 3MJSA 1TUBB 2JGDA 3ND5A 4G97A 2N46A 3D3WB 4F3NA 4IVNA 3QX3A 2M32A 1VHQA 1XMSA 2MSDB 2JFPA 3DTVB 4M2LA 5HMLA 4LDJA 2MMGA 2ZUBA 4EUSA 3QUBA 4JBWA 3M6UA 1O9BA 4HEA6 2CL0X 4Y7DA 1GUDA 1YQDA 4Q1DA 1IN7A 4CMGA 4DLXA 3OEWA 1SULA 4KNWA 4LTMA 4LXTA 3UMRA 1GL6A 2GM9A 1SZCA 3DMGA 2OVBA 1IPHA 3F5FA 3JQRA 4IIXA 1CNMA 3OLCX 1DBVO 1E6LA 1PG5A 2VRBA 3N7TA 2RCYA 5MGBA 4Y7CA 5DCUA 3U48A 1ZW6A 3LWDA 4XWGA 4RMHA 4E46A 2FE1A 1D0SA 3DP7A 4YRJA 4HXGA 3GJXC 6ADHA 1L5NA 1C0LA 2FUKA 2JAXA 1ZVMA 4K3VA 3L01A 1OD6A 4M0LA 3CTPA 5DM1A 2V3WA 4D9HA 4QAQA 1SRRA 3ZLJA 2H2WA 4DGSA 3L8YA 2BKXA 4IICA 5IZCA 3QUAA 2ZBPA 1GFZA 3NTQA 1REQB 4QOGA 3H99A 4G9GA 2OM2A 3F3SA 3JARA 1GCOA 2X41A 4Q1AA 2IYFA 2O2IA 5C1IA 4AYWA 4YQFA 1GFWA 1PJSA 3IEMA 4EARA 4PZDA 4A1FA 3A14A 2A33A 1LQTA 2AJDA 1OCEA 1G5FA 3KJHA 3Q1KA 5FYDA 4M8LA 3TTSA 4D97A 1NUUA 2QRMA 5LZ5A 1AK2A 1LNZA 4C4OA 1DPGA 2JLZA 2X4LA 1IQ0A 1YQEA 1O5IA 4X41A 3GRFA 3JQFC 1U98A 4MW2A 1XF9A 4FGKA 1PO7A 4LGMA 2GJ8A 5B58T 3G0DA 3NO4A 4MYCA 4U2EA 5A1TA 1KIFA 1RSZA 2HMUA 1Z29A 1EP1B 2WEKA 3BMXA 1RPNA 4FS3A 1WXGA 5KOJB 1P5JA 5HQ3B 1COWD 3T54A 3WRYC 1C1HA 5L40A 5M5BA 4OH1A 1Q12A 4LDRA 1NQTA 3OAAD 2OC4A 3STYA 4DG9A 3A4MA 2FHPA 2VQ3A 3CX8A 1CJSA 1JKXA 2V6BA 1C7QA 1RI5A 1AGXA 3OIVA 1EEHA 1R0KA 3DBRB 2O7NA 2VA8A 3AERB 3QEMA 3LZCA 2QZZA 2Y2UA 4KC0A 1JIXA 2IPAB 4FWBA 3MSXA 4XFDA 1M2KA 4BWYA 3MYRA 4E51A 1Q17A 2GPJA 3VISA 2I65A 4BKQA 1ZK2A 3REOA 4IJQA 4GMXA 1RHUA 1GCUA 3FMOB 1K66A 4FZRA 3LX5A 4XPIB 4CV0A 1LTHR 4EKIA 1AXGA 3ITKA 2QKYA 1V1MA 4B6PA 5D3QA 3QU5A 1Y5NA 5HSGA 4X20B 3R3UA 5A7HA 3LPNA 5EKDA 1JDUA 5JRZA 3TTXA 2I4OA 1GQOA 4MYSA 3K3PA 3OT1B 4PFQA 3OLQA 3W06A 4D4GA 5IKPA 1EVYA 3T3DA 1XO1A 2A30A 3ANTA 3DT8A 4YHBA 4YJGB 3NUQA 4P38A 4QEKA 3ZWOA 3Q9LA 3I30X 2Q3HA 4G01B 3I53A 3PXBA 3H1AA 4QL3A 2B35A 3Q3VA 2XRZA 5CFQA 1BKYA 1RYEA 2EDCA 3O9VA 1NWHA 3SVZA 3TSZA 2I91A 3QF4A 4HAVA 5EIOA 4CMIA 1O1YA 3D1VA 4MA5A 3H3XA 1W34A 3ZKWA 4LRQA 2X3FA 3AVQA 4W63A 3M1LA 2ASEA 5EHGA 5FOXA 5KTSA 1SR8A 1R5BA 3DAFA 3RD5A 4Z7QB 4CLRA 3VR3D 2ONZA 2PFSA 2VUHB 2ZDQA 2V58A 3GUZA 3GJ4A 2DPHA 3P4XA 4AJHA 4GW3A 4OXRA 1J8YF 1X8XA 2QGZA 3FBGA 1ORWA 1CY0A 1QZZA 2UAGA 3H7AA 4MLZA 4WKBA 5IH3A 3WDMA 4L4XA 2PUAA 4KO4S 5HTOA 2HI0A 4DMGA 1NFFA 1N9ZA 3OJOA 4J9UE 4CU5A 5SYAA 4DSOA 4F1JA 4OHPA 3T06B 3ILVA 1OY1A 3BF7A 2BBTA 4Q48A 4UPDA 1U6JA 5D00A 2AGVA 3W3ZB 3ZW7A 3E03A 3HBLA 3A6PC 4U4AA 2DPMA 3DKVA 4YCJA 3FXAA 2A57A 3FPSA 3OPQA 3ONVA 3HBNA 1MX3A 3BE4A 2OTCA 3DA8A 4RNDB 1XTRA 5IUNC 2IXBA 3DFUA 2Z5GA 3W9SA 1YZYA 1OWLA 1Z12A 3BILA 1O0CA 2R4QA 3VNVA 3VC2A 4YJKA 1Y3CE 3GD7A 3RUFA 3R5TA 3ZXYA 3KT3A 4IHJA 1M1YE 3ZXUB 1CJUC 1J2TA 3A4YA 3C7AA 3ETLA 4CFYA 4LF8B 1S2NA 2JCBA 3RTGA 1MRNA 3H11B 3F9IA 4NXMB 2WDPA 2QTVB 3BICA 5KINB 2GFQA 4KAXA 1NVGA 3FPFA 4GZ3A 4ZCMA 5EJEA 4K8RB 4RVCA 2P0YA 2VSXA 3HYLA 2QUKA 1A9YA 3PHCA 4G23A 1DDOA 2J0EA 5EXXA 3T61A 3W9YA 5FPPA 3ZVMA 1YQQA 4HQ0A 3GU3A 1ZQ9A 2BELA 1GGNA 3DUFA 3IMKA 4IH9A 1UIRA 4Q6WA 5DNEA 5TQJA 2GD6A 4X1KA 5JXWA 5EQFA 4EQZA 3M4XA 4URXR 3QVLA 5HKKA 3CY6A 3NNDA 1ONPA 4RDIA 5EQTA 3H4TA 4IGEA 3P0IA 4MUAA 1GZSA 2YNMD 3UMBA 2JGKA 3PUWA 5AXBA 4BVBA 1U63A 1QTQA 1XPRA 3K1AA 3PG5A 1XXHE 4PC7A 4XYGA 1U7ZA 1FX0A 3HJRA 1XLWA 4E03A 4N5DA 2IYVA 3SZ3A 5FV7A 1DELA 2WZCA 4JT2A 5U4XA 1PNQA 3K9BA 1COZA 4Q3KA 4ZEXA 5FBLB 5FWYA 3W78A 1QTNA 2XRYA 3OLZA 2O3TA 1Q7TA 4M0FA 2W6CX 3ANXA 3EVBA 1VJGA 4HDSA 3UH1A 1HTWA 2WINI 3WIUA 2J32A 2R1TA 3DOJA 3M6AA 4F1KA 3O1JC 2QMUA 1OW3B 4NU8X 4Y0NA 4AJNA 4WKOA 1R88A 2PMKA 1JL3A 2WU0A 1G8HA 4TL9A 5CLJA 3H5VA 3AUFA 3MCUA 3C5EA 4HSGA 1OZHA 1UC8A 4BNXA 2X1MA 3GLSA 1Z3CA 3KD3A 4RCVA 4YMUA 4EENA 5FTWA 1UFQA 2NUPA 3Q7QA 3HGQA 3UWDA 2NU6A 1SXJC 2ZIXB 2BFAA 4M54A 2N47A 1OXMA 3EGXA 2JEYA 3EFBA 4I50B 4IJ6A 3GUVA 5IANA 5IT9A 5FYQA 1KA9H 1K68A 1PYDA 3GEGA 3KT6A 5TGZA 2RGWA 3WE7A 4CI0B 2O8VA 2IGTA 4JUIA 4OHWA 4MQ5A 1PW7A 3IC5A 1S8OA 5FULA 3HYSA 2RK6A 3Q5GA 1PTJC 5HP4A 3SKXA 1M73E 1X13A 2BZ1A 3V46A 4F6RB 2V5AA 1GAWA 1HEIA 1MABA 3ZZNA 4G09A 3DT9A 1RBYA 4AMUA 4F12A 4LFCB 3T9BA 1KP9A 3C3XA 2IOQA 3QVXA 4ITUA 2RH9B 5CT9A 1OFTA 5EJFA 5TJ9A 1KEWA 3UTDA 1SCDA 4PLFA 4KJXA 1Q5PA 2R86A 4GR4A 2D3WA 4NI5A 5GONF 1L5SA 2GN8A 3QUTA 4CG2A 2ZSHA 4IMIB 4MV9A 2I62A 3SLKA 4BMYA 5CVDA 3HBJA 3SEAA 1CX9B 3ZCSA 5ILOA 4JBNA 1YFZA 2D0IA 2CZCA 3AF6A 1WW2A 4HF7A 3KYCB 1E5VA 3M70A 4WLNA 4HBZA 1P0PA 3HYRA 1JV2B 3QPUA 2XWJI 4J4BA 4UXIA 1LF0A 5BW4A 2QT1A 1N2EA 4HRVA 1GFSA 2W5UA 3AVUA 1GT91 1H5UA 3H3FA 4YALA 1R0RE 3IEPA 3NC4A 3V3TA 1KE1A 4EA7A 2PV7A 4EHDA 2W6NA 4RQTA 2QP4A 4ZJYA 1L7BA 1PJ2A 4DDMA 2H65A 4KHZA 5KREA 1GQRA 1KDVA 1WCWA 2EFDB 2GDZA 1B16A 1RWWA 4KMOA 2DQ4A 3IIIA 2V65A 4NNOA 3HU2A 5AOBA 5JJLA 2DT5A 3RARA 3LLVA 2ESRA 5AVOA 1SUEA 3GUUA 5DCLA 1KEZA 2HA0A 2R00C 1B0PA 1VLZA 5EPOA 2ZTHA 1QK5A 2WUGA 1U9IC 5JCJA 1EP3B 1F1JA 4EP1A 3N0WA 4R0MA 1L4HA 2A0FA 2QV0A 2XYQA 1F2TA 1AG9A 2HDWA 4QFCA 2LNDA 4LY3A 3IQWA 4I9NA 4OATA 2ZJAA 5ETJA 3ZV7A 3NATA 1WF3A 4C43A 8MHTA 1NVDA 2PZMA 4MKXA 2EJWA 1OFUA 1H8HA 1CP2A 1FU7A 1V2GA 1GLNA 2WP0A 2GA8A 3ORYA 4IFEA 2HH9A 2G0AA 2RKOA 5FWDA 4IZIA 5EEHA 3MRVA 5IT4A 2UVQA 3VBEA 4FEEA 2L0XA 4OU4A 4R68A 3NH6A 4BGEA 2WT9A 3R76A 4E7OA 1U0SY 2JIZA 3A28A 1PR2A 5JYDA 3X1JA 1VZ2A 3QXHA 1F48A 1OC4A 2DKOA 2IHBA 4ALKA 2OOSA 4JSTA 1T2VA 1Y3AA 3KE8A 1WMAA 2C58A 3ONNA 4A92A 4DLBA 3DE3X 3I5XA 1TCVA 3PQDA 4KFRA 4UFNA 3K9WA 2HF7A 3GW8A 4X5OA 5BQ5A 3ZLVA 5IRCD 1YB1A 4YCNA 1BE6A 4Q4CA 4FGLA 3JAWA 1XELA 4K6MA 4OJQA 4PZUA 5EP2A 1WQ1R 1JHYA 2ONJA 2P7HA 4Z3DA 1PJ3A 2GXSA 3HHPA 2WZQA 3BH7A 3U81A 3DVSX 2Y1FA 2I2XB 1ZCBA 1QGAA 4I1IA 4B17A 4CCSA 1YS4A 3MTEA 1DX9A 1M33A 1SUPA 3Q0EA 1Y4AE 4GP9A 1UPUA 2WFMA 3V4ZA 1C0PA 3V32A 3ZDYB 1N0IA 1Y7HA 1V8FA 1Y98A 3I2JA 121PA 2IIQA 3GEPA 5DSZA 4EGFA 1GQQA 3OCZA 1XL0A 5FAKA 2Y67A 4ZA2A 2HRDA 1LSUA 2AOTA 2VZ0A 1GPJA 2RJNA 2Z2XA 4FT4A 1TTPB 3T3IA 2XYRA 2G7MC 3RRYA 1XG5A 3L82B 2CXRA 3GRVA 1BIFA 3L0CA 1FQWA 3AHCA 2QENA 4KYIB 4N6OA 1HY3A 3F7NA 4EB0A 5L51A 3TUZC 1DTWB 3DE6X 1OVGA 1QV9A 3CUYA 2AG5A 1JJ7A 2ZB4A 3RVBA 4JUAA 3N2NA 2QTMA 3L7NA 3G1WA 2M1XA 3GCGA 4OB8A 1H3EA 2GOYA 4Q7MB 2IXAA 4R8RA 2XUKA 4HT3B 5CEEA 1LRJA 4KPYA 4B79A 4GKVA 2PUCA 1OJLA 1ZGBA 3P9SA 2PUJA 3RWMB 2IHYA 4LZJA 3IR5A 4ZXFA 1U3TA 2EAUA 3EYWA 1Q3HA 3FJ1A 1XZKA 2P11A 5BUCA 3PEEA 3GRUA 2FOIA 4URVR 2Z3ZA 4QVGA 2BFOA 2ORWA 3NIBA 2AI1A 4KN9S 5BRNA 5A9SB 3G9UA 4EAAA 4YRCA 2VG8A 3FI9A 1ZCJA 4W9NC 1NU6A 1DMSA 3UMCA 3W5HA 3W5CA 5AJUA 1EZ1A 3IT0A 2XHZA 1E79A 2QM7A 2YV2A 5KTYA 5JSHA 3K9NA 3PQ6A 4PNEA 1XVIA 2QRGA 4IOLA 5G40A 3I1IA 5F1PA 4UM5A 3E9RA 3G7UA 4PC3A 3WJAA 2OK7A 1UBSB 1Y1PA 2Z2IA 4NNJA 3VKWA 5CD1A 3GLUA 4MUEA 4N82A 1L8XA 2RHLA 5BWNA 821PA 1V5GA 3FIJA 1NF8A 2DKFA 3EHEA 4FBGA 5KYWA 4WOKA 2H57A 4HD8A 3SWWA 3AMVA 1RP1A 3QVOA 3QPVA 4FFSA 4JI1B 2TRSB 4KMRA 4DLTA 1JR6A 3NBZC 3T99A 2Q3LA 1XZPA 4OB6A 3HFJA 4DQXA 4K40A 4LJ7A 3J7TA 3OEEA 1E94E 3PJDA 2H0RA 1SHLA 2QS9A 3DDHA 3ABQB 1V0JA 5EFOA 3RRJA 3SJAA 4ZPJA 2WWIA 1SRQA 4I55B 1T36A 4JL8A 2VP6A 1DRJA 3GLFA 3OWOA 3OOEA 3BRQA 4MGHA 4TN5A 1T1SA 3JAKA 2NPIA 3OOWA 4Y9DA 3ROMA 4DQKA 4KR7A 3TXXA 1E6UA 2VP5A 3BZBA 3TO5A 1QLJA 2B7LA 3O03A 3VOTA 1PZGA 3KWLA 1WRBA 3CZCA 4D8TA 4IQFA 5LN1A 3CV3A 1S6YA 1QKJA 3C45A 3I92A 4QJ5A 2ODBA 1HZZC 1JDBB 1OBVA 3SQLA 4ECEA 5JMTA 3K6KA 4ACBA 5ARCA 1GXSA 3TIIA 4HX9A 1JFFB 1C5KA 2AWOA 2G9QA 1XSEA 3H2GA 5C5IA 1IM2A 2QTWB 3DQPA 3OQJA 1A9XA 3VOAA 2XZDA 1IDN1 2Y3IA 3FNIA 1V16A 4S1WA 2BH9A 4ZO7A 4HLCA 3OPMA 4C6SA 1FSPA 5BP7A 2JLAA 1S3IA 3I0MA 4GBJA 4J7UA 1GPAA 2BTQB 1YFLA 4IWNA 5HILA 1ENPA 2ZB3A 2JKVA 5AMXA 1SUCA 1Q6ZA 2DBZA 3O8BA 1YWGO 4JUFA 3FVWA 5AESA 5IZ4A 2GM4A 2XT0A 4Q01A 4Y98A 3TRIA 1FP2A 2FOLA 4LRYA 3PUIA 5J2TF 5BSMA 5I48A 1Z13A 2QZSA 4URHA 4QPJC 2CUTA 3C8UA 3WIEA 5CEFA 2VLIA 5DI3A 4ZMSA 2HOQA 4JV5B 4KHPB 3A31A 1C29B 1T4MA 2X2PA 1U9YA 4I8XA 1NNLA 4PCUA 4BFUA 3OEYA 5HRAA 1IOLA 1WUIS 1YCHA 1IM8A 2J9FB 4YAJA 3RRZA 1K7FB 1TF2A 4KPEC 4P92A 1RRPA 2EJTA 4ZHQB 1P33A 3UUWA 2P90A 3U3KA 4YJ3B 3SZUA 4IXDA 4TMWA 1IY0A 2BONA 4L4UA 4A6XA 3OPNA 5FPSA 4LZPA 1II8B 2BT4A 1G98A 3LYHA 1GDDA 4C89A 3U4GA 1TT5B 3HCNA 4KBYA 8ADHA 2Q1SA 3KJZA 2H7XA 3IV7A 3MTGA 3TCKA 4QYIB 2XKAA 3U6BA 4ZTUB 1H42A 4C76A 4R9UC 3ZE1B 2DFVA 2J7KA 1AGNA 2KMLA 3HCRA 1V9CA 1K3FA 3JVEA 2O52A 2WAYA 1ZESA 3OQPA 4GZ6A 4DMUB 3D2CA 3PTAA 3W7BA 5ISMA 2QRHA 4MPJA 1FL9A 4N0PA 3KXPA 1Q0UA 5BWCA 5HKOA 1EX6A 5KJEA 3TSYA 3AFGA 2ZIWB 5AJXA 3TQHA 1M66A 5KHLB 3LPAA 2EWVA 2HBRA 4NG4A 1SK8A 4R16A 2OCAA 1S3GA 2NV2B 2R751 4A6EA 2ZKIA 4MVJI 3GQBB 5JAIA 3A70A 1ISHA 2WWRA 2VWPA 1TVKA 4L8FA 4N3CA 2F1HA 4ADSG 3KR9A 2QRQA 2VHVA 1TO6A 3JQAD 4TLBA 2IH2A 1JHQA 3F90A 4MQFB 2I22A 3PGVA 1D7AA 3WK8A 4JC8A 2P35A 2BR4A 4I19A 5H3LA 3SQWA 3JS5A 4GRDA 1H5NA 2NUTA 2GHIA 2GS9A 3HKCA 1TF5A 2DY0A 4R2MA 3SSAA 2ZBQA 3LV8A 4JLMA 3CZQA 1E4EA 1T1RA 4RH3A 3L1KA 4WKNA 1D8AA 4H6PA 1BROA 2VAXA 3ICCA 3H4MA 3ICPA 1JTFA 3LCCA 4KITB 1ACJA 1DS6A 4YMLA 7MDHA 5KC9A 4RD4A 5H3HA 4GBED 4UUMA 3ZR4B 3FZGA 3CNNA 2IIPA 1AOXA 4Q9HA 1E2BA 2SKCA 1X1TA 3FUXA 3K15A 1KH2A 4B7CA 1UFVA 3CB2A 4RELA 1HK7A 3HPQA 3DBLB 5AKEA 1N4AA 4CZ2A 5K3SA 2ODWA 3W7AA 4HV4A 4HI0E 4UU8A 3ZTYA 4FYHA 1T2NA 1J9EA 3KZVA 4INPA 3EW9A 2BISA 4Y9RA 5EIFA 3RFFA 2XCUA 3V2GA 2ZAGA 3TN7A 3X2EA 2W37A 2CBGA 2HPVA 2NSLA 2WFAA 3D3WA 4KP7A 3ESBA 5JCOA 5HM8A 5IJ9B 3ZQ4A 4HNVA 5CGQB 3RSLA 2FVYA 3LBIA 3JD4A 3L1VA 5CVUA 4C01A 3GG9A 1KPGA 1EEXB 5AVVA 1CTQA 1T29A 1SZJG 3EGWA 2B2XA 2XYGA 5DB4A 2F7SA 1P4JA 1VJ5A 3OZBA 3VHRA 1KMQA 4A6DA 4ETWA 2CMKA 3M1YA 3CLSC 2J9XB 2B78A 5E7MA 2PL3A 3KCQA 4FDTA 2H59A 1FPMA 3DV0B 3HCBA 4Y6RA 2XZTA 4HB4A 2HCBA 2M1ZA 4PWYA 4RETA 4YCCA 4FIZA 1JJVA 4KGXA 2I1WA 5C8YB 2AQKA 2OAP1 3LPDA 1QYCA 3A4VA 5GTDA 3O2SB 2W4MA 5D1NA 5B58C 1QO0A 1GWNA 1EFPB 1R50A 2H52A 4J2TA 4OQ4A 5DM2A 5UKDA 1O0SA 1PT6A 2C20A 4BKOA 5MN6A 2C1ZA 2LDXA 2WU8A 3A1DA 5JSKA 4ZZ2A 5IF3A 1MD9A 1REQA 4I4TB 1D7OA 3IOMA 2VR1A 2GF2A 3OCJA 4P82A 4Y2YA 3C15C 3K53A 5FL3A 5JQGA 2HV9A 4GI5A 5B1SA 4DOMA 3UK1A 5FORA 1LLDA 4OYYA 2A5JA 2ALJA 3DFFA 3IAS6 4LHEA 1EBFA 1ECLA 1XPJA 3DZCA 3MILA 3OU7A 4X90A 4XQ9A 5J5AA 1IWOA 4OM7A 5JAUA 4DRYA 4XM2A 4N49A 3DFKA 3EVDA 1I4EB 1W0JD 4KXXA 5KX5F 2PS3A 3VX4A 3AHFA 2JFVA 3P8ZA 3RKRA 3BXZA 3ES9A 1FYXA 3L5KA 4L6IA 3T9DA 5KOJA 5HQ3A 3QM1A 5K3DA 1T15A 3FHJA 3ELBA 1CDZA 4QOIA 3SCZA 3KQLA 1GU1A 3RSCA 1K3UB 2VCHA 4C3UA 2FCAA 4UOEA 1GPNA 1O6GA 2HA3A 3O82A 4PLHA 3U3XA 1NX9A 4YP5A 4HS4A 1C9EA 5CPBA 3H6GA 3R4CA 4QDKA 1JFVA 3DBRA 1YF3A 3PEFA 2ZRCA 1XCPA 5JASA 1VZ3A 1NW6A 3C3KA 2DT8A 2BUAA 2Z4RA 3DO8A 3P96A 4AS3A 4YJHA 1IBRA 1OJ7A 4KO1S 1HDZA 5TF4A 4MS3A 2Q49A 2F90A 1C9JA 1T4CB 1Y48E 4BKUA 2CDNA 4RLHA 4XPIA 1WU8A 2P6OA 4KIJA 5AKLA 1KIMA 1P0QA 4UVEA 1LWOA 2H16A 2VJMB 2I0FA 1KKLA 3I83A 4KXUA 5COAA 4X66B 1EAMA 1TW2A 1VPWA 1TC2A 3PT5A 1EVZA 1MO3A 3OT1A 2XCOA 3P94A 1QBKC 4OFBA 2N1BA 1Z7WA 1YR2A 1VJCA 3C3AA 5B53A 1Z07A 1ORIA 2EGGA 4Z9XA 1VBKA 4RGBA 1Y1TA 4R2LA 3HKDB 4XUDA 2GYYA 3DOCA 4TMYA 2WKRA 1BXRB 4HNUA 2CGEA 4MQ6A 2PVCA 4ZTZB 4B40A 4L0MA 2OBBA 4JYBA 5JZ9A 2QM8A 2R2GA 4BYMA 1WXIA 3CRMA 2BVNA 1K2WA 3C4QA 1QK4A 1KHHA 1LX6A 4C29A 4POOA 2ZWOA 1YZLA 3TD6A 5FDFA 4L1KA 4R31A 4KGZA 3EQZA 2AKYA 2V9ZA 2QUHA 3DZIA 1BEUB 1C3JA 1X7XA 4GE3A 3WL7A 1XAJA 4ZOBA 5C37A 1HNZB 4HVCA 4IXWA 1GV1A 1M2JA 2C9OA 3USCS 2QY6A 3KOWA 4FFBB 2CNKA 1M2VB 3MGCA 3RIGA 4RH1A 2HGZA 2VYVD 2ZFUA 1QHIA 4PLTA 2IELA 4IKOA 1GA6A 4DR3B 1ABEA 2Y1KA 2IPNA 2P9QA 1XB2A 2A67A 4N0MA 1ODTC 4YT5A 3DCYA 4U9IS 4MWGA 5L7TA 2PZJA 3A6EA 4JIGA 4X6LA 5FQOA 1LSOA 3U7EB 2JHGA 1UK9A 5BVGB 3R3HA 3CE6A 2XF2A 4A1OA 1GTVA 2OQIA 1IB6A 4NFSA 1Z0DA 4KMMA 1HLPA 1NBOA 2ZUUA 2CNOA 3U16A 1GTSA 1H6CA 4IFIA 2B7BA 1OXVA 1TIBA 1DJPA 2J3DA 3B9PA 2X3YA 4PYOA 1Q7BA 1XYVA 2O3JA 4O6VA 1CIJA 2AG0A 1FTGA 3TAHA 1IPFA 1UBCA 1T4GA 2V5UA 3OZ7A 4LYGA 3O4IA 4MB6A 1SZDA 5I9LA 1EK2A 1KY3A 4QU0A 2LE0A 3ZS8A 4BBPA 4JQSA 2PCLA 1T9BA 2WUFA 5DHFA 3OCUA 2JLWA 1K5PA 1L4MA 3EXG1 1Y7LA 3E5RA 3JVVA 4QOEA 1XP5A 4XSHA 4ZAWA 2QX6A 4OHKA 3H11A 2ZU0C 4PXAA 2QTVA 4I3HA 3M5CA 5DWDA 4EY7A 1CUUA 5H4HA 3GO4A 1UC9A 4OQZA 5LDHA 2QB5A 3LT5A 4XJVA 2VDJA 3U0BA 1ZD2P 1F2DA 1BX3A 4YRTA 4BX8A 1RABA 1L5FA 3KV1A 3VVLA 2O59A 2XZLA 2JI8A 3UJ6A 1VP9A 4HN9A 3DCJA 3OWXA 1JIUA 4HEHA 4MDHA 1Y8CA 3EPRA 1GZ3A 2C42A 4EHHA 4HJXA 3N3AC 4WPGA 2H1OA 2CNWD 2HGSA 1RZUA 1Z4JA 1IZ0A 1KAGA 3K1TA 4XPZA 2QTTA 2EBWA 1V71A 4FWTA 4CJXA 1T5LA 5IS2A 2BUBA 2NO4A 3X1XA 3PIRA 3SE0A 5HIIA 5IAOA 3ZC3A 4I9FA 4NAUA 3G85A 3N28A 2IZ5A 4FNMA 1JE0A 2JI9A 4LY9A 2FZGA 3PHIA 1SMKA 5BVHB 3QENA 5G2OA 2CJFA 1KJWA 2JPDA 1TYDE 3KQOA 4B45A 4JWTA 1FZQA 3NHAA 3C70A 5JH7F 4HC4A 4KK3A 2E48A 4LNAA 1D9ZA 1I10A 2AJCA 3GJ6A 3GJZA 4JLOA 2FPSA 4XUGB 2ZSAA 2AX4A 3UK2A 3RVLA 1Y5RA 2HQOA 2R8EA 4KDEA 4DR2B 5J58A 3KO8A 1ZZGA 1FDWA 1W5TA 3JU3A 3WV5A 4KE9A 1N2OA 1BEEA 1RAHA 2BJVA 2XPCA 2ZIXA 3DR3A 4FMPA 4Q3OA 1OU0A 4TPKA 5I5GA 3G8CA 1RYDA 3DYIA 2VBIA 4RO0A 1HDOA 3O0DA 4GECA 1OWOA 2FN3A 1E3IA 2HIAA 2V74B 1U1DA 5AVXA 4DDVA 2GVZC 3AEXA 1XEWY 3ZGOA 2F55A 2QT9A 3ZE7A 2RG1A 1D9XA 2Y77A 4F6RA 4EUHA 2VHCA 3KR1A 3NEPX 1CULC 2PJRA 2XV1A 3SHVA 3HU5A 4ZT6A 4D02A 2CLMB 1BCRB 1F8UA 3DZFA 4EATA 1M2HA 2J7PA 1H2FA 4ZCTA 3KL2A 3EAGA 1HG1A 1ZNWA 2ZRAA 3EZ2A 4KXLA 4WIAA 2JB9A 1GLVA 5CITA 3OHSX 1N9GB 3PSAA 3UPDA 3K31A 2JHCA 3LQQA 4NV3A 4XRGA 4GU5A 4KXNA 2QDKA 2I2DA 3IPLA 3WRWA 3CMMA 1B3BA 4Q16A 1S9DA 4UPVA 4WESB 1CUZA 5C4GB 1ZHOA 4MYDA 1FTQA 2N75A 2OXIA 3P9CA 4Y2XA 1FDIA 1AQYA 2C2GA 1Z62A 1WS6A 1D2MA 3UK6A 4D9BA 4OOEA 2X15A 3EUAA 3GT4A 2Z8ZA 2FSHA 2I7TA 5KSWB 1USKA 3AG5A 3B48A 1KC1A 1OIVA 2WWWA 5GADl 2WJ3A 1XAIA 1HRDA 2FGJA 4L27A 5L4LA 3FZNA 2YY7A 1SOMA 3WYFA 1WZEA 2O6LA 3H2HA 1J1IA 2Q7XA 1A27A 5EIBD 13PKA 1SIBE 3VX3A 5JD6A 1G42A 1K7YA 2J3JA 3KXKA 5TXGA 4ZEVA 5LP6F 2PWYA 3A1EA 4BL5A 2V0GA 1XD2B 4MARA 4XD7D 2L69A 1E9VA 1K3TA 5IC4A 5HJ7A 2PD6A 3PKJA 3F74A 5P21A 2H2GA 1DIGA 3RHZA 1ZI9A 2H2HA 4M55A 1PVOA 2BGMA 2H06A 3GLHE 3E8XA 5EINA 1CIVA 3IAHA 4WOCA 1NI3A 4K9PA 1LA2A 3O31A 2AZMA 4F2GA 4L3OA 3UG7A 1I2AA 3T38A 5JAOA 1J25A 4NWIA 4D4MA 4P86A 3P4UA 5ALLA 1SD2A 2IZ0A 4NRDA 1B74A 2XMSA 4Z53A 4LZWA 1NV9A 2H7CA 2IZ7A 3F5QA 3BA1A 4OHRA 4BN0A 3DKKA 2P78A 2J07A 4KQHA 1PLJA 5CRIA 1JHDA 2EWWA 4UCXA 4P3XA 3HVHA 2MU1A 2PMEA 2XA9A 1AQIA 1Z68A 1Y4ZA 3JZIA 4XAQA 1ZNQO 4EFDA 1J2JA 1G21B 4FM9A 5TQVA 5FLXA 2O0JA 2BZ0A 1QQTA 3FNHA 2HHLA 3HN2A 3OP4A 1QGOA 2FFBA 4OOFA 1WX1A 3LLCA 1SOWA 2GARA 1N1EA 4IP0A 3RSFA 4QUDA 4V0SA 4Y6GB 1BWSA 4BVJA 2AW5A 3IIMA 3FTNA 4RE5A 3E7WA 3G7SA 1PEAA 4C2BA 1B6RA 2PAFA 1HT0A 1VA4A 3E23A 3IVXA 2BM1A 4LE1A 4LV6A 2B4YA 3ZIUA 4F7DA 3TK1A 2V0CA 3RV3A 1PUIA 5JD4A 3Q8WA 1LC3A 1WVMA 3SSMA 2DFKB 4IX1A 2PT6A 1U7TA 1DG3A 2IC5A 2RHCA 2RAFA 4ARZB 1WLYA 2YHUA 2JAQA 1Z2PX 4H4EA 1Z0JA 2QLNA 2VPPA 2DBYA 2IS1A 2R1UA 3C7KA 4LGYA 4W1PA 3LNTA 3LWZA 1D04A 1O89A 2MOKA 3AW8A 3FWZA 4N54A 4RLQA 3G6WA 2GZ3A 2WQZA 1M54A 1WXXA 2I4LA 3EZFA 1XQYA 1GCAA 3ADDA 1HOXA 2O8BB 1M8JA 1U28A 1BXZA 3VTFA 1GAJA 2G40A 2UDPA 1KOJA 2HA7A 3T4UA 4F9FA 1DTWA 4BGDA 3KM0A 1KF0A 1FDTA 3ESQA 1GGVA 1QP7A 1XOIA 3TNDA 1JIQA 1OFIA 1JDZA 4MZXA 3DDZX 3NALA 3SDSA 3TEJA 1J07A 2GRAA 3GRCA 4ZP1A 3TB4A 3OJWA 2XVMA 3EH2A 5AIAA 2BI8A 4D7AA 2BMJA 3WGKA 2D0PB 4MMYB 4MMZB 1FW6A 2PGJA 4D9IA 5FTJA 3HRIA 3QLEA 2ZLBA 1L2TA 1GFIA 2QU8A 2V4ZA 1TA4A 3TBHA 1EWYA 4RE6A 3VTAA 5E1OA 3ZU4A 3DL2A 1IC6A 2WNSA 3IP6A 2GLXA 4IYJA 3FWPA 1U0TA 4LZAA 4AP6A 4PRLA 4D41A 3K5IA 3B38A 3GVHA 3MA0A 1SHZA 4YAIA 3V48A 1Y7IA 4IIVA 1X1EA 5AXAA 2CHFA 1QORA 4EG1A 2Q27A 4CUZA 2Y8EA 1RAGA 2WVGA 4G8CA 1IXZA 1SEVA 3UV6A 1FUKA 4Q7QA 2QLMA 5H8WA 3JQAB 5LVAA 4OD0A 1AKMA 5FNVF 4Y2RA 1O6CA 3NMUF 4Q1CA 1JW9B 4I8IA 5EMHA 1CZLA 1Z35A 2NXNA 2GHRA 3C8DA 3KP1A 4N5HX 4Q4AB 1JEJA 2H8KA 4JI3B 2GCGA 2AW3A 4GOXA 1T9AA 2HD4A 3KQNA 4UREA 5DGXA 2HWUA 3OJ0A 1BU5A 1FUIA 1KPIA 1R8SA 1XX6A 3DTYA 4FR5A 4H1WA 2PCJA 4WDQA 4H6XA 4FGWA 2BGJA 3MGAA 5CR9A 3TOXA 1ADJA 2R9VA 4NCKA 4P1ZA 1AS3A 1JWBB 1DBWA 2EOAA 5SYNA 1P2DA 4DEVA 1RRKA 3PDUA 2I3AA 1QJ4A 2XB8A 3M6LA 3ZY2A 2ZJ7A 4CEIB 1V37A 1KY5A 3P9QA 4C6TB 4F21A 5L9AA 2QVZX 2PGIA 3UUEA 2LV8A 4H4CA 4JY7A 2D00A 3F96A 1RTKA 3O4HA 4LSMA 3WL8A 3NDPA 3OPXA 1MG0A 4G4JA 4MKGA 3A1FA 3W8EA 1PD1A 5BQXA 2NZ2A 1E5LA 4DF3A 4UTPA 3AHIA 3KYIB 4JZKA 2GBFA 4DCSA 2IEAA 2QORA 3IBYA 1J5EB 7ABPA 1UQUA 3ER6A 5K3EA 4P6VF 1WSWA 5BT9A 3RI3A 2QROA 5CHYA 4HHEA 3FCAA 2Q3CA 1PLLA 1ZBDA 2K7FA 4OSEA 4UKDA 5FIUA 3VPFA 4A3SA 4M0EA 3O47A 3HVUA 4G0QA 4JYMA 2O07A 4XQEA 5IDYA 3NGMA 4G8JA 1AZWA 3PUXA 2B6HA 4GOMD 1L8LA 3BJIC 3A1VA 3EA5A 1JFFA 3EXAA 4EQ6B 4Z0NA 4I8DA 5ARBA 1P6QA 3EXIB 2ZETA 1IN8A 1ZX1A 2WUVA 3H5AA 4BNNA 4ZDJA 1S2DA 2PT9A 3AZOA 2YZ7A 4R8LA 4JKYA 2B0CA 3CINA 1UODA 1Z8HA 3L46A 3OZVA 4QM6A 1YJCA 1KVUA 3CSDA 4UFOA 2GFIA 1RS0A 4B6SA 1FNCA 5AK4A 5D7BA 3FLMA 3EEBA 4FGUA 5ITWA 1G5HA 1IAVA 3N2LA 2I3BA 5DYTA 4RULA 1JLKA 4OJTA 3MTQA 1HETA 3IL2A 3C3PA 4RMJA 2NU8A 3Q2KA 1ODLA 5LR6A 2CCKA 1EBUA 2NMVA 1R5JA 2AYYA 4MTCA 2EATA 2JGIA 1RVDA 5M7EA 1EPUA 2F59A 2ZYTX 2YV5A 1YHYA 3FY4A 1SCIA 5ALZA 4DAOA 4EHJA 3ENNA 3C16C 3LO5A 2J9FA 1M1YB 2GMWA 4LXYA 4TQ9A 3DKPA 2UXBB 1O2DA 2FW8A 2V4UA 2JAUA 4H77A 4WCFB 4XRRA 2WJPA 4GO1A 1OLUA 1ZM9A 4YJ3A 5ECYA 2PH1A 1LLCA 1GV0A 1QR6A 3ND8A 4X8HA 4CL3A 2Y1OA 2AMJA 4RZIA 2QN3A 4TQGA 1II8A 1AHHA 1JHUA 2WT4A 1P7VA 1WCXA 1TC1A 1CY7A 1BVYF 2JBWA 1TT5A 2Y0DA 4FIDA 1MW9X 2WD9A 4JLDA 4MQLA 5CB8A 1HO3A 4AN1A 4QYIA 1COWA 1RYNA 1QTRA 4KWTA 1F6DA 3OAAA 4B6GA 2O2DA 4RSRA 4S1TA 4L5IA 4DJJA 3AR6A 3M5PA 5EXTA 4HH3C 1Y6JA 5IUKC 4BDTA 3VR6H 1XXHB 3G5UA 3RQIA 3ANMA 2IVFA 3JAMA 4XJTA 3LUDA 4DR4B 4BZXA 4UEKA 3AUUA 2JD2A 4LMRA 4PSCA 3FW1A 4XIIA 3W6OA 4AZWA 3SR4A 3MQFA 2IYEA 4IHKA 2DERA 4NCIA 1UWCA 2AFHE 3CONA 1YZ3A 1ZOPA 3GQBA 1P2BA 1FEZA 3HJHA 3TOCA 5JWOA 2AXPA 4BZQA 2R47A 1T25A 1T6BY 2REOA 3ECCA 1QLWA 4MKRA 5C7YA 5CFRA 2EQAA 2C2MA 4HRAA 4ZT4A 4D3ZA 5EHZA 5H1YA 1WDLA 3LUPA 5DGDA 1W36B 1CLUA 4MQFA 1XCOA 3GGPA 3DZGA 3WWOA 4BFCA 4RF3A 4F9EA 2VI5A 2XODA 4OXQA 4CM3A 1Q16A 3QVGA 2VPWA 3DMYA 5K0TA 4JVMA 3OIYA 1GSAA 1X70A 2J8ZA 5K2OA 2Q5EA 4AJ2A 3DBOB 1ZC3A 4IGKA 2ZT5A 1YSCA 3WGTA 2OQVA 1TU3A 2OD2A 2NVUB 2PNJA 5G1NA 5ICGA 4W6QA 2Z6AA 3PNKA 3MWLA 5FEUA 1E63A 2WZDA 2GTPA 1WW3A 4LC0A 3BORA 1QZ3A 3KQQA 3RC9A 3FGPA 4TLCA 2LCQA 4B47A 2C5EA 2Y0CA 2HMYB 4HLQB 5CG2A 3IRVA 4ZVNA 5EJAA 5TPZD 1NQOA 1PR0A 5JD5A 3ICQB 1L8OA 2C7GA 1IDOA 3DBLA 5CVCA 5ALXA 3JWHA 2A7QA 3M9LA 5JVDA 3AJAA 2EJUA 2GZSA 3HZOA 5A4JA 4W5WA 4XEUA 3FDIA 3LXMA 1KYZA 5IJ9A 4HPJB 2JGNA 2QJTA 4KDFA 4M49A 5EHXA 2V0NA