1P19A

Hypoxanthine phosphoribosyltransferase from trypanosoma cruzi, in complex with the product imp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
189
structure length
187
Chain Sequence
PREYEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine phosphoribosyltransferase
publication title Interactions at the dimer interface influence the relative efficiencies for purine nucleotide synthesis and pyrophosphorolysis in a phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
total genus 51
structure length 187
sequence length 189
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p19A00
4P82A 4RQBA 5HKLA 1WD5A 3GEPA 1IBSA 3DEZA 4RAOA 3KB8A 1QCCA 4FYMA 1P18A 4X44A 1ZN9A 1G9SA 1O57A 4P80A 5EUCA 2EHJA 4PFQA 3ACCA 3DMPA 5HIAA 1P17A 1XTVA 2IGBA 1XZNA 1QK4A 1ZN7A 4KN6A 4QYIA 4RAQA 5JV5A 4ZFNA 1OPRA 2JBHA 1BD4A 5BRNA 2GEBA 5K51A 1HMPA 4F8EA 1TC2A 2E55A 4RABA 3M3HA 4LYYA 4LZOA 1DQPA 1L1RA 1I13A 4P83A 1J7JA 4RQAA 4PAWA 4TWBA 5JSQA 3MBIA 3ACBA 3EFHA 1QCDA 2PRYA 1W30A 1I0IA 1G2QA 4P81A 4QYIB 4RACA 2JKYA 1NONA 1P4AA 5BQPA 5E38A 1A95A 1FSGA 3MJDA 3OHPA 1I14A 1A4XA 3OZFA 4MB6A 2JKZA 2YZKA 4QRIA 2DY0A 1V9SA 3N2LA 2AEEA 1YFZA 4JLSA 2C4KA 3GGCA 1U9YA 4S2UA 5BQOA 1MZVA 1NULA 1R3UA 1I5EA 3HVUA 3H83A 1A96A 1QK3A 1A97A 1G9TA 4RV4A 1DKUA 1D6NA 4RADA 1GRVA 2H08A 3O7MA 1G2PA 4LZAA 1L1QA 1QB7A 1ECJA 5BSKA 1P19A 1A3CA 1OREA 4JITA 1UPUA 1OROA 1UFRA 4RHYA 3OZGA 4X45A 5ESXA 1BZYA 1JLRA 4Z1OA 2H06A 3LRTA 1QK5A 1ECCA 1I0LA 3DAHA 1LH0A 2JI4A 4WN3A 2PRZA 4LZNA 5IAOA 4RHTA 1ECGA 1ECBA 4RANA 1ECFA 3ACDA 5ESWA 1JLSA 4P3KA 1VCHA 3GGJA 1BD3A 1O5OA 1HGXA 1QB8A 1GPH1 2WNSA 2FXVA 4RHXA 5KAPA 1XTUA 3NAGA 4M0UA 4WMLA 1STOA 4IJQA 4LYGA 2P1ZA 2H07A 1TC1A 2VFAA 2XBUA 1DBRA 1PZMA 1U9ZA 3QW4B 1AO0A 1Z7GA 4P86A 2HCRA 1A98A 5KAMA 1VSTA 1XZ8A 4M0KA 4P84A 3LPNA 1XTTA 1VDMA 4RHUA 1UPFA 1ZN8A 1DKRA 1Y0BA 4M0PA 2PS1A 1DQNA 4OHCA 3G6WA 5IPFA 3S5JA 1CJBA
chains in the Genus database with same CATH superfamily
3SKVA 3R41A 4NZNA 4E5UA 5JTTA 3MG9A 2PA0A 3RFFA 3ABSB 2QLBA 5FHRA 2WSIA 4NV3A 3IEXA 1ENPA 1MX5A 1H94A 1YS9A 4CKYA 2H1RA 4XR4A 4AWAA 1JP7A 1K0FA 1CQIA 3FB1A 4DWJA 5HIKA 1ZGGA 4GQBA 4TKUA 2OV3A 5HFAA 3RHZA 4MQ4A 1UC4B 5EJIA 3BFKA 5AW0A 4RH0A 1EQUA 3RGGA 1PWZA 2DZDA 2XUAA 3NWPA 1QFJA 1ZJZA 2IYWA 5CDFA 3P4YA 2A9VA 3EYAA 3ZE6A 2O7QA 4EUEA 2E55A 1K66A 2JFVA 2XIQA 1ZMBA 5FL7D 5GZ1A 4UDYX 5B1SA 2X7HA 4C89A 5BMOA 2JLVA 3CF6R 1U94A 4AQYB 3RVQA 3EIHA 1FTWA 1GAWA 2PKYX 3WMEA 1U6JA 2AXNA 2OQRA 1V5FA 4HUQB 4KGZA 3HL0A 1V4VA 1OLXB 4HAUA 4QTZA 2FX2A 4JBWA 4MMZB 3VYWA 1JDVA 4AURA 3G0BA 5DOVA 2JHCA 5B3KA 3A9SA 2VUSA 4DV0B 3JSAA 2FPRA 4P3YA 1RTTA 5JO0A 4PZCA 4E5NA 2C8KA 1AQUA 4HS4A 4BFUA 4CF6A 4EG8A 1ZBDA 1GFSA 3MWLA 3OWXA 3E82A 3F78A 4YUXA 3H7AA 2YFYA 2GK7A 1G6HA 3O74A 2YJGA 1I5EA 4KODA 1GFIA 2C7OA 2X4IA 4NZYA 4BS9A 1P6XA 3PCTA 2UUPA 3IODA 4YUAA 5K20A 1DJNA 1G7CA 3HGQA 3V46A 1M3SA 1IAQA 2ZIVB 4YAOA 3UJDA 4DA7A 1YJCA 2HLDD 2CNWA 3DT9A 4GX1A 4OHXA 2QU7A 3FFXA 3I2IA 3OTGA 2HSDA 3LD9A 3JQBA 3VDRA 1T2VA 4H1UA 5REQB 3BMOA 3BCSA 1G7TA 1EUCA 1JVNA 1YQDA 2P9FA 4JOSA 3W5VA 1U0BB 2G67A 2DAPA 2NW6A 3A6ZA 4H60A 4PPGA 5KMGA 2F55A 3HO8A 1EEXB 3IBTA 3REQA 3VYUB 4BZPA 4KAXA 2V97A 4JGBA 3QENA 3CRRA 5EUBA 4XUDA 1NWCA 3NO4A 3THXA 3ZDCA 5T4FA 3NASA 1DP4A 4FHFA 3RBVA 4C0WA 1R88A 1EB9A 4H4CA 4F2WA 1I3MA 1SKUA 3D0KA 1EDZA 2O2IA 4DRXA 2QAJA 4N3NA 3VC3A 3HLYA 1CUIA 5TVGA 1V16B 3EISA 5KSYA 1XHLA 1WEHA 4LDZA 3SMQA 5LP6B 4GPAA 3Q3VA 4N0EA 4O2AF 5LQAA 3LXMA 4L5IA 1I80A 1SOWA 3JYLA 1N36B 3ZR4B 3O2SB 3LHFA 4A4DA 3L8DA 1T4GA 2B8JA 2HU5A 1AU9A 1E9FA 3ENZA 5BMVF 1AKUA 2B98A 2OGWA 1EP9A 3FX2A 4EUSA 1AO0A 3RREA 4RTKA 3NYRA 1MG0A 5FTJA 5GZ3A 3VMMA 3X44A 4QUBA 4INJA 2OXTA 3B53X 3BKWA 4AKHA 1ZIYA 2P77A 4R9SA 5K0SA 5AI0A 1HE4A 2C92A 1NXXA 2RKWA 4DLPA 3BE4A 4DCMA 1ORTA 1U2EA 2EZTA 5FRDA 1CJBA 2DUMA 3R09A 3TJZA 1NSFA 4RZHA 4MAAA 1Y1QA 1CQWA 1CY4A 2X1LA 3COPA 3EWSA 3GEPA 3W7AA 3WX0A 3DKPA 2Q4RA 1Z7WA 4Q9LA 4GG1A 4DDTA 4I5IA 1WMDA 5KTPA 2P91A 4UTPA 1U4OA 1KEVA 2IOQA 2J9GA 3B3AA 4IMIB 2O8DB 2H2GA 3JQGB 4P54A 4I3FA 2FZGA 4EGQA 2DQ4A 2EF1A 3DO8A 3RUHA 1ZOOA 4UXJA 4ILEA 5B6PA 4UU7A 4IRUB 5IUNC 2R44A 3L6UA 3KT8A 2OESA 1MXHA 1XWFA 4LF9B 2VAXA 2AIRA 3A3KA 3GR6A 5IJ0B 1DADA 1E1RD 1G3UA 4LFCB 3VKHA 3T38A 3IDFA 3LKDA 2Q21A 3KSZO 2Q1SA 2PA3A 4KE6A 3GRAA 2B61A 1FFWA 1WCYA 4IJ5A 4KN9S 1K3FA 4DLLA 1ZH8A 4M9CA 1RAEA 1W4LA 1YR8A 4XTCS 3HDGA 3IOCA 3C1UA 2E6UX 3IT3A 3PNBA 1Z5WA 4OP1A 4UXHA 1MKYA 1X80B 3KKLA 1L8QA 1T4CB 1WXDA 2ECKA 3RSLA 2Z1DA 4WZAB 1GNLA 1ZM2A 4HYQA 4XLTA 4YJKA 1WPQA 2PSDA 2XUKA 1JGTA 2WJYA 2H1CA 3OLQA 3D8RA 3PDHA 3AUTA 4WNYA 3O5AA 3VH1A 4HDSA 1XDWA 1ZNWA 4RSHA 3KJQA 2O59A 1JU9A 1XD9A 3PU6A 5HOEA 1Y1RA 1YQQA 3GARA 1JG2A 3TKYA 5BR4A 4CETA 3R0IA 1OIWA 2H2FA 4OGWA 2PLFA 2YL2A 4M9ZA 5FWYB 3UMSA 3WS7A 3B6JA 3T9AA 3SZUA 5A3JA 5F1PA 3FMFA 1ENZA 4P3XA 1VMKA 1ZK1A 2P8SA 4N5DA 3EF1A 4QU5A 4F3KA 2GTHA 2H54A 2Z95A 4LDQA 4WINA 2C5LA 2MIIA 4ZCSA 5TJ9A 5EWLA 3BMCB 4CMEC 1BMTA 1Z4MA 5IN4A 1DBPA 4Q3AA 2P2ZA 3AL3A 2IH5A 2XXAB 3MGGA 2WG0A 1JUDA 4MI1A 2O19A 3TLCA 1I2CA 1VE5A 3D02A 1EK5A 1U1EA 1MLDA 3A1TA 5B7PA 1MX1A 4YJGB 2D1SA 1AC5A 2FGJA 2XEDA 2XUGA 3OEYA 1XLTC 3GCDA 3ZU3A 4GL2A 1IQPA 1U4NA 2QM3A 1ZJJA 5F2KA 4IM7A 4ZVTA 5JOQA 1WBJB 2ACKA 1BG6A 1O6FA 2C4NA 3BMQB 3DFUA 4P33A 3G5AA 4UCFA 4XX1A 4KIFA 1WMEA 4E4YA 1DTWA 4XJTA 4XWKA 4FLMA 2O2YA 2XKJE 3AEKA 4TTPA 1DAGA 3DE1X 3QWHA 1S2DA 2HRQA 3HVHA 4OHYA 1FFEA 2VP4A 4EB3A 4PLFA 1KP2A 1IMJA 2JPDA 2VDNB 1OE0A 2HEGA 2G9VA 3EDOA 3EXHB 3NXSA 4Q93A 4U0KA 1C0LA 2RHOA 2AG6A 3FRHA 4J6FA 4HDQB 1ZG3A 2TS1A 5CNMA 5JNUA 1IEXA 5KNDH 4WA8A 2I34A 4WASA 2XGJA 2GKGA 3ADKA 1HLFA 2OHVA 3FNBA 1QVAA 2YFHA 3U3OA 1U0TA 2RGDA 1UWLA 4IPTA 2QX6A 3A9TA 3I0NA 4NBLA 2I2FA 2IP1A 4J1QA 4GLLA 1E3JA 3V97A 2C7RA 4QJBA 3MJVA 1GZ7A 3GVCA 4YGXB 1WDWB 4Z86A 3FMGA 2LCQA 4M21A 2HMTA 3WRYC 4ASUA 5TPZA 1RM4A 2ICAA 2P11A 5EQDA 2VF7A 4QUIA 5I4IA 2OSVA 4N7MA 5JSYA 4HUQA 2HIHA 1LY1A 1N57A 2BJVA 1C7QA 2MOKA 4CDRA 2OAP1 1N0UA 1OLXA 5CA0B 2QTZA 4OHKA 1TUGA 3TRIA 4CF3A 4WPGA 2LGJA 4ZVVA 3JVEA 5EPOA 3NAQA 1NVBA 1B0AA 3BWCA 3P2KA 1B16A 3HVJA 3LP5A 2OGUA 4YCBA 4B3SB 2VUIB 3P9KA 3T7IA 1TZMA 1JH8A 3DF7A 5C1BA 4N12A 1FTGA 3T95A 5DT9A 1E2KA 3K0SA 3DOUA 3GJ4A 3K96A 1DPGA 2YWJA 4ISBA 5I01A 1CJSA 1XZKA 3WA6A 4MKGA 3D1LA 2PANA 1BVUA 1NHGA 2JAHA 1QH8B 3M4XA 2DXIA 2J32A 3LZDA 3KOMA 3PQEA 1BXRB 4FHCA 3U4AA 4OGLA 4UQPA 2PTGA 3EZ6A 5LQSA 4EG7A 2F64A 1RXEA 4KUGA 5REQA 3H17A 4ZD6A 4EHBA 2JJYA 1JYSA 4YCNA 1ZHOA 2FDRA 4ABYA 5HMMA 1KK2A 2X76A 3CWZA 3OF3A 4JLSA 1ADGA 1G5PA 1HDOA 2FR0A 3KTOA 3DHEA 4R05A 1LJLA 2X9VA 1DC7A 1AMUA 4NBWA 3IQIX 1M5UA 4YQZA 4KXNA 3DJFA 4RTNA 1IIRA 1FNBA 2Y0BA 1Y3DE 2O2XA 5IT5A 4DLKA 1O89A 2FVXA 4P22A 5BSWA 4U5QA 5FBQB 2GVNA 4K3VA 4AN1A 1JFRA 2FZ5A 1CJVC 1SO8A 3C3MA 3QEOA 5JPDA 2QAGC 1V16A 1YS1X 3NIGB 3QFRA 2DQKA 2XYHA 4I0WB 4ZVOA 2GI4A 4BX8A 1GTVA 1MRSA 2GVZC 5LP6A 3GMDA 2XLBA 4ZAVA 3RCBA 1ECCA 1P0MA 3ORQA 3A1WA 1UC8A 3VZBA 3C3CA 1E2LA 1V37A 1C8KA 2JIQA 2ZBGA 3L7YA 4NNPA 3WLKX 5H4GA 2X23A 4S04A 2ORWA 1GFWA 2CDBA 1YMQA 3A3YA 4PZZA 4DT1B 4EP1A 3ET5A 4XVRA 2AMJA 4CV1A 3P0JA 5HA5A 3Q9UA 3NNDA 3TRFA 1Q0PA 4Q15A 5AM5A 5B4TA 3DC2A 2F43A 3QLUA 4LKOA 2J6BA 2PJZA 2QOEA 4TWAA 1VG9B 2OAEA 1W73A 5I8PA 3IXLA 4FP9A 2LIVA 2PXXA 1QIHA 4BLOA 1GIAA 3OZDA 4S05A 5CYOA 2VFAA 2V55B 3DKKA 3QW4B 4MUKA 4EUFA 4FXPA 2WJWA 2PBRA 1JDJA 1RW4A 3KZNA 1KMNA 4QGFA 4XPIB 3K30A 3S55A 2WZQA 2I67A 1GHTA 2J3QA 3JQGA 1ZFNA 4GZ3A 4U5XA 3SEFA 5DNVA 3FSGD 1HYGA 3TFQA 4TYWA 5D7NA 2H18A 5ESRA 1Z7EA 5FLKA 4JZKA 2CUTA 4Q1AA 1F6DA 1EX1A 4XGKA 2A9OA 5BXYA 3T5DA 5D5HA 2WKPA 2CMDA 2V5VA 4GM0A 4NZ9A 4BQQA 2JATA 4F4FA 9LDTA 1NXQA 1RRCA 4J7CA 1SR8A 3ZY4A 3ADOA 3LY7A 5IJ0A 1NF2A 1E9VA 3MS4A 1AGNA 4UARA 4UPEA 5J1TB 1YOBA 2OBYA 3EXAA 3MA0A 5CIWA 3WQBA 2Q3EA 1XZGA 1ZL0A 1ACMA 1QGUB 3A1CA 4J49A 3RJTA 1ENYA 3I53A 1ZD3A 4LRQA 3REFA 2WYHA 2QMYA 4UASA 1UAYA 1AKEA 4X3PA 5E2BA 2BM8A 3BA6A 4C4OA 3JWPA 1X80A 2WB2A 1T4CA 4AI6A 4OB8A 3FDJA 5KJFA 3PDUA 4X9XA 4DY4A 3VX4A 2UYGA 1G8JA 4WZAA 2G5GX 1XWIA 5SZIA 1VJDA 3ENVA 1R6XA 2GHIA 3HNOA 2H7CA 2IHUA 2NV0A 3R5SA 4LTMA 4QFBA 5IU6A 5KX5B 4EJ6A 2J9RA 1YFKA 3EPRA 1YXMA 2B4KA 5D5QA 2GN0A 1JEDA 4DJEC 1NNLA 3MIZA 1G8AA 1BIFA 2WAMA 3FPLA 1XA3A 4IMPA 4K46A 4MVCA 3ZXXA 4ALIA 5FWYA 1RKQA 2CHGA 3U40A 1DV1A 2ZETA 2C0PA 4EYOA 3BCHA 1GSAA 1Q84A 3HB7A 1E6EA 4N7RA 1ORRA 2HYIC 1OGIA 1TD9A 1XFDA 4KBFA 3N75A 3RQSA 1Z2PX 3BMCA 4GPBA 1ZA2A 2VDVE 3C5EA 5AO9A 4A6EA 2HSJA 2HXGA 3QY9A 4BFLA 4OQYA 1VCOA 5L51A 2XXAA 4HZGA 4YBZA 1NVAA 1O6CA 4ALNA 2JASA 4PZUA 1E9CA 1P61B 4JGIA 3RIXA 2Z9BA 5EKDA 2XMDA 1GT6A 3UHFA 4C0QC 4YJGA 4OH7A 1NQXA 1YKFA 4PYJA 4DR2B 3OPQA 1OBOA 4OJYA 2QL6A 5FBLB 1KPIA 1L1QA 3RRFA 2FMFA 2FN9A 3AUYA 3N7UA 1KAMA 1T1SA 2P3OA 3BMQA 3CZMA 1D2GA 3AIMA 4MICA 3VAYA 1OUMA 4A23A 1A9OA 3W34A 4PV7A 3GLFE 1RZRD 5EEGA 4D9HA 1BWSA 1EHIA 3RRBA 3Q15C 5LKAA 3OKPA 2XDYA 3RVOA 1V0JA 2CV0A 2J7PD 3N87A 1NT2A 3EXHA 3WICA 1KDVA 1LDGA 5EC8A 4R0MA 5LIRA 2I22A 3TXAA 1I94B 3AF4A 5FTKA 3EGWA 3LPAA 2QX8A 2FMUA 4HAOA 3UKDA 4K1LA 3Q8LA 3ZUPA 4W7SA 3VUFA 3CEPB 2RG7A 2ZWIA 3RSCA 3A36A 4AK9A 3AL2A 4PSDA 1K2VN 2ETVA 1TZCA 4EK9A 2VNIA 3MJEA 3M82A 4PC3A 4I2VA 1W5TA 3SX4A 1W49A 3D2BA 5HKKA 2O0MA 5KSZA 4E14A 4H1WA 5BV7A 3O26A 2ZVJA 1T2EA 1RWNA 1AD2A 1CCWA 2B82A 2IPLA 2PKCA 4BVKA 4UTNA 5I9IA 1DAOA 2OK8A 4RV9A 4OJMX 5LDHA 3IS3A 5DCLA 3NOVA 4G2TA 1LVUA 3DKIA 3R4VA 3NOOA 1B43A 5K6AA 5CA0A 3U7GA 1X13A 4ZMBA 4RJJA 1U2SA 3ZOZA 1DQYA 2VHEA 2DEUA 5BO5A 2HU8A 1XHFA 1N0WA 2VJNA 5D3ZA 2R1TB 4RQBA 4OUKX 2KM1A 4KN8A 1T8TA 3FFAA 1IJKA 1Z0DA 4UBLA 3W4KA 4ZIRB 2R84A 1QMGA 2DPLA 1SIUA 1YCDA 5A4DA 2BCGY 4UM9B 5ICCA 4PFQA 4KDFA 1PZFA 5FI5A 2Z2IA 1GQOA 3W2EA 1E1YA 2I65A 3RH0A 2OHHA 2ZSIA 3AM5A 3H5IA 3AU8A 4ZOCA 1QKIA 3LGXA 4M76B 3SJBA 4IHQA 1ZOPA 1QH8A 2VYCA 3A6KA 3ZPXA 2EU8A 1BXRA 1JBKA 2Z8YM 3L5OA 3NBFA 3P45A 5FD8A 2EW8A 2PUTA 4AKEA 4AJKA 3FMIA 1HT0A 1EK2A 2GO1A 4JUFA 4YMTA 5CA1B 1UBCA 1SC9A 4RKEA 1FNSA 3MYRA 4HT3B 3HJNA 1LK5A 1XZCA 2ACEA 3J7AC 2F3UA 2OD9A 3EFHA 2BZ0A 3H9JA 3MVEA 3WFZA 4CM9A 2WFLB 1YBAA 1OBCA 5CAEB 1NVXQ 2W58A 1UBRS 2B1IA 3PZRA 2I91A 5K3BA 2H59A 4UE3S 1IY1A 2VJCA 4NATA 5C7IO 1Z45A 3KR1A 2BTEA 3KXDA 1FSGA 1F4VA 1RIFA 2N47A 2ODBA 2P4UA 5A6VA 5EIXA 4GBED 2PH1A 1NUHA 5F5LA 2FSHA 3W77A 1CERA 3DVRX 4JB0A 1ISFA 1KZHA 1KBZA 4S2UA 5PGMA 4K9LA 4W5HA 4F71A 5LMNB 1HL3A 3AQ4A 3EJWA 2JI8A 1SVUA 3D4LA 4TRRA 5G0SA 1I1NA 1NLZA 1UBHS 1K06A 1W581 3OFSA 5LP1A 4RTJA 4DT1A 1J0BA 3LFHA 3DTVD 3HRHA 3HXPA 2FJUA 3E0XA 4M1SA 3WO1A 4CMCA 1XCMA 4ENRA 4QYXA 4M0FA 5A71A 4GUDA 4MS4B 2XQVA 3HCRA 3RS2A 4YAIA 1BAPA 4U0JA 4L7QA 3MMSA 4XFDA 1XDBA 2Q50A 5TDHA 3FBWA 4BO0A 2JD2A 1JKJB 1U3DA 2DULA 3O9VA 3U4MA 2J4CA 2YYAA 2HUPA 1L5QA 1U7ZA 2I6XA 4RV5A 3CVYA 1Y5RA 1Z0IA 3KS9A 4Q6WA 1UBFA 2I87A 2K4MA 2ZS9A 3ICWA 4FDTA 3OHMA 2PYDA 3WTBA 2H1SA 3MJCA 3PXBA 4NMLA 2Q49A 4XPIA 3QPDA 3WGTA 1CULC 4BVEA 3O6VA 4CIYA 1Z74A 1GV1A 2JC3A 2WF5A 3ZZMA 2PL3A 3OP1A 2AE2A 4P92A 4WW0A 5C1DA 2XZPA 1YVPA 1QR2A 3P94A 3AV0B 4FBMA 1EESA 4U6SA 2O2CA 2G1KA 2RIPA 2P9ZA 1MNAA 4H2DA 4WOKA 2RGAA 1SU8A 1VGQA 4XYMA 1LLUA 1TGVA 2YS7A 2W6NA 1KO7A 4BVHA 1UBLS 4U1RA 1U2TA 2IOHA 1OOEA 2GH1A 3ROZA 4L3VA 1I1HA 1QGUA 5LZ9A 4DQUA 1A8SA 3DV0B 4U7HA 3UHAA 2YHAA 2WQZA 2YV4A 1QH0A 3BORA 1Q0RA 3CMCO 2H00A 3H2BA 1UPFA 2VWGA 3KV1A 4PTYA 5KQLA 4QO7A 4G4SO 1T0HB 4BIIA 1N2ZA 3JYHA 1VHTA 2BHTA 4M0PA 1M72A 2P4EA 3V6LA 4CQMD 5JRDS 2XTMA 2WMNB 4LDJA 3DE6X 4UMDA 2DLDA 4TMZA 3WL5A 2GN4A 5DMXA 1IN1A 1GR0A 4PYOA 5M34A 1TXGA 4HLCA 5AW3A 5KX5A 1QGYA 3B12A 3CVWA 3QM1A 3I0ZA 621PA 5F9MA 3KJGA 2CY0A 1QORA 2J33A 2YINC 4QPNA 3BDAA 1FP1D 3G79A 3CHYA 3NIBA 5FLYA 4BX9A 3Q8MA 1IPHA 1YUNA 2AF3C 2DHQA 1VB5A 5I9MA 4ZC1A 4OHZA 5IAAA 4O5OA 4JVSB 3QWIA 3OFND 5AK6A 1SBYA 3NB0A 4QHYA 2A9QA 5AIBA 3AJ9A 3F4BA 3CBGA 4XGRA 3SJAA 4J75A 2AFRA 5CDTA 2QD2A 3KJNA 1ZD1A 4N8SA 4CV0A 3NX4A 2B1RA 2PZAA 3H6KA 3RSHA 1RRVA 4UAUA 5FWXB 1CT9A 2NQ2C 1NBEA 2P7IA 2VQ6A 4QM6A 1ZPDA 1YSCA 5JISA 2WUFA 5GM1A 1GZ3A 1R6VA 2V54A 4LC9A 2C7PA 3OKAA 2DSNA 4NFHA 4P81A 4P0PB 4AXBA 1D1PA 1DWUA 1L2TA 3KLOA 4P58A 1JEEA 4C0BA 4DJTA 5J43A 1NONA 5BQPA 1Y4UA 4Z0HO 4ZEVA 1JQ5A 1MUUA 2HF8A 1WMAA 5BWNA 4KAAA 3MAGA 4GP6A 5JYBA 1PGJA 2Z5VA 1JA9A 3GUHA 3MCWA 3A3OA 3ONFA 4L76A 5AI4A 4ZQGA 4MVYA 5DM2A 4KXYA 2GX6A 2P4QA 1A1VA 2G17A 1VKZA 3QYFA 4RLSA 4TMWA 2VP9A 3K2BA 1NPDA 2O8VA 2NIPA 1IUKA 1MAWA 1DEOA 2QQEA 2QT9A 1LPPA 4AMZA 3OZAA 3NGXA 5C81A 2TSYB 3VJRA 3PFNA 4GKKB 2POQX 1FFGA 1TF5A 1U5CA 4QQ8A 1R0KA 1A3CA 2X15A 4R5MA 3EVZA 1EZZA 1AHPA 3NGLA 4W9NC 4UHKA 2IHJA 4GF5A 4PAGA 2DWOA 3D6JA 4E31A 3SYKA 1UP6A 2XB2A 1KJIA 1JWBB 1V8ZA 3E3AA 2G25A 3KT3A 2NACA 1ISRA 4BFYA 1ONBA 2PH7A 5F33A 1XFAA 4PBTA 1JTFA 3ZWXA 3BXPA 2CW5A 4MQ6A 4V24A 1SZCA 4CKXA 2YN4A 4HBGA 4REQB 1W2WB 1ZJYA 3IPLA 5HF5A 2ATEA 4CMGA 4YRKA 5HK9A 8GPBA 5I7HA 2MHCA 4QT4A 4HSEA 4A0RA 2OBBA 1DMSA 2WZBA 1Z18A 1XG5A 1ADCA 2FDXA 2GCEA 4G0WA 4FR5A 2Y2UA 3IEIA 1FOEB 4EATA 4HQ6A 3RTEA 5IT9A 1QP4A 2R1TA 3OLVA 3TR0A 5HUQA 4ML3A 5G1NA 3ASVA 4ZIRA 1P2GA 1XZMA 2XMRA 3HDQA 4AUKA 3OECA 2CLSA 4K26A 3PLRA 1N6HA 3MT8A 1NP7A 3RASA 3R4CA 4PVDA 1XQWA 4TTRA 1R6BX 1UIRA 1M54A 4YB8A 4R2MA 3VNSA 2DVMA 2W37A 2M2IA 3HL4A 1ZWKA 3M2TA 5C7OO 4OLFA 5LOVB 2D5IA 1VBKA 1Y34E 3GROA 2UXBB 4RAOA 2NNWB 2CNOA 1IN7A 1G2OA 5CA1A 3KSAC 1UMBB 3E27A 3K16A 3K0FB 3O4VA 3D3EA 1T2NA 2C8LA 4D8UA 3W3AD 1PV4A 2WJPA 3IBCA 1TO6A 1W5SA 1WABA 1UINA 5I7WA 2PE5A 1DL5A 3OE1A 1SD1A 3Q10A 3OEEA 3QG1A 4L8LA 4P98A 1GY8A 2YWDA 4BZZA 2PZLA 3HCWA 1WO8A 3MN1A 1U3FA 2WFLA 1EUZA 1V1JA 2ZWOA 3PKIA 4UUMA 5E4YA 4G86A 4ZEOA 4C7VA 2WWXA 1U8UA 1ZBQA 1H1LB 3JV7A 5E8JA 4XARA 2YY5A 3R3YA 4JK3A 3NCHA 4YC7A 1NVGA 2CF5A 2OCGA 1MG5A 3EN0A 2F9FA 4WLVA 1E4YA 2QD4A 5AOCA 4QUKA 3UQYS 1A8IA 4DR5B 4L9WA 1NVUQ 4ZREA 1AE1A 4Y1FA 3PE3A 3J81k 1Z83A 2PKWA 3MWKA 3BHMA 3MINB 3NC0C 4LZOA 1COWA 1L1RA 4ZI5A 3OEWA 3J7TA 1A8UA 3TZLA 5C3UA 4UEWA 3E03A 2FNAA 3OIUA 5IDQA 4U7DA 3IE1A 3JD4A 2AOTB 1QSGA 4TX1A 2PGIA 1FMJA 3IAHA 5J40A 4M8IA 5DNEA 3OX2A 2X0FA 1LB1B 2DECA 1YRAA 3IHTA 2IV7A 3T1HB 3W7VA 1P4AA 4I7EA 4M46A 4MS4A 4QM7A 3TTUA 3C5HA 4NCJA 3CMMA 1O94D 4QOHA 5ALDA 5JBIA 2QLJA 2I7CA 3PA8A 3GMSA 2C2BA 3MGKA 2HRRA 3Q8XB 1JKJA 3R3SA 4OQQA 3ZI7A 4BEJA 1TQ8A 4MYRA 4JT2A 4CKEB 4RIGA 2F62A 2FZVA 5DHSA 2PSJA 3CTMA 4YRSA 4DV1B 1YA6A 2VJBA 3IP7A 5EG5A 3FKQA 5AM4A 2I33A 2NGRA 3IBSA 4JC4A 4MARA 1A5AB 3OM0A 1PK9A 1EFRA 4YUWA 2H4WA 5LP6F 4O63O 4DLVA 1O8CA 5EMNA 2C82A 1Q7RA 3VNBA 1NATA 4RA9B 5FUMA 1K6XA 2ZYDA 3QI7A 3UMJA 2WD8A 1WCXA 2I6GA 3GGPA 2F3PA 2FU5C 4MWSA 3O75A 1ZC4A 5F1KA 2R4UA 2B25A 2OYRA 4Z6KA 1SCAA 1WMSA 3OTIA 5DEOA 4YRTA 3L5KA 5F4ZA 3P9NA 2R7MA 3RUIA 1VBMA 2CJXA 1JV2B 1IWPB 1ECBA 3CRMA 3W5SA 3RNLA 4ZYYA 4CKZA 2G63A 1W44A 3DV0A 3WBFA 1JJAA 3MUEA 1ICEA 4CKWA 3HU2A 4C4XA 3ABQB 1R8SA 4UNRA 5DJ5A 3TDMA 4PG6A 3RVMA 3UGKA 3UUWA 2PBZA 5AKEA 4BTEA 1CUDA 3FPGA 4IJQA 1RQRA 1SY7A 4UFNA 1QVRA 3OOHA 1OJ7A 2DWUA 3MD0A 2Q27A 5T6BA 2WY2D 5JJBA 1AA6A 1EPUA 3AKDA 5EJ4A 2FN8A 2FSUA 5B2EA 3HJBA 3U7QB 4MEBA 4MGEA 1KZ7B 4C7OB 4AMVA 4P86A 4DHEA 5LXTB 1E77A 1BS2A 3USCS 4PQFA 4ZGGA 1JXMA 1N9GB 1VE6A 2EP8A 4UBMA 4C4SA 4V0MA 1S5PA 1V2HE 3RTCA 2E18A 4WERA 3ST7A 2V7GA 3B3FA 4GQAA 4A0QA 4WE3A 3VKGA 3CUTA 4M9XA 3W5AA 3VNAA 2VP0A 2Z4RA 4AZ3B 1KI7A 2VG8A 3X1YA 1QR6A 1JFTA 3LXRA 1QNLA 1CFZA 1TTQB 3FZEA 1E61A 1C4XA 2RONA 4S24A 5GTDA 3RC8A 1KSHA 2QVXX 2WYUA 3IIIA 2QTFA 1ZOSA 2AG5A 4PRYA 5FWXA 5BOVA 2DQYA 1ZK4A 4ZZ3A 1RXIA 5KWIA 1Z5GA 2JD1A 4L57A 4EY4A 2BGWA 5K3EA 2WJHA 1U8TA 3H1TA 4R3WA 1RYNA 2H2WA 4BMCA 1DV2A 2EG9A 1XE3A 4J8PA 2CD7A 3U7JA 3ZYCA 2OXEA 1P7CA 2WJZB 3E2IA 3N8DA 4WLOA 4HXFB 3QA9A 5M04A 3A26A 4BNMA 4FGSA 1R18A 3A05A 3I04M 4ND8B 1E2NA 1U7XA 4U7FA 1M1XB 3BIXA 3PWTA 1KY3A 4CCAA 5LPNA 2QAGB 1Q17A 3WKDA 4E12A 2YKGA 1T3TA 4XUEA 2XMQA 3FHCB 3L8CA 4O8ZA 2RGNC 4PLCA 4G0UA 3G2QA 4XOUA 2FA9A 4NMXB 5AI5A 1W30A 1RVDA 2R47A 4IMRA 4HWRA 3PUZA 4PGGA 1KI8A 2XNJA 4UD6A 3L7KA 4B4KA 4PHHA 4IDGA 3NT4A 1L0BA 1Z25A 3B1WA 4L4SA 3VAZA 1WSDA 4R1SA 4R54A 5DHFA 5GWXA 1PBNA 2PX0A 4RPHA 4EKEA 3BGVA 2D62A 3H97A 1SIOA 1M6HA 1PRYA 5BQOA 3ERCA 2BFWA 5ELMA 4DRYA 1I3NA 4LC1A 4RMJA 1RHJA 1A96A 1Y98A 3TGWA 4JL5A 4C3OB 2V45A 2W8BB 1ZNYA 2MYNA 5EPEA 3IAEA 4UD2A 3UUFA 3W9YA 5LQCA 3OESA 4FM9A 2G1JA 4REQA 5TQ0B 1KDYA 3WSWA 2CHVA 5IANA 2LVBA 2WJIA 1P4RA 1SCIA 3E3OA 5KCMA 3VGJA 2QSZA 1QCYA 2DBYA 1MJGA 5BV0A 3JQ7B 1W6RA 3VU1A 1CQJB 4LISA 2Y76A 3K5HA 1GDDA 1M1UA 3RRMA 4MCJA 4XW2A 3T7JA 5TT1A 1OAKA 1P60A 4EITA 3KSDO 5JSKA 1GNQA 4FOSA 4G6ZA 1F0YA 2DFNA 1TEXA 4QBKA 5CYFA 2HPHA 2QTNA 4JP8A 2WDPA 2IS6A 1XKXA 1Y8AA 4D4GA 1GG2A 4FW9A 3LJKA 2O0LA 3NU1A 3TI9A 2PH3A 2HHLA 1LJ8A 1OLSB 1YDGA 4X7RA 2OWEA 5CG2A 1YB7A 2JAXA 5LOVA 4AJHA 3VPAA 1KVRA 4W5RA 3ENNA 2WZCA 1Z4JA 5CFMA 4DR6B 2QP3A 1UMBA 1TVKB 2ZU0C 2AOWA 3K0FA 4KO3S 3SY8A 3WP1B 5B5SA 2AOUB 2LWIA 1EFDN 2ZYTX 2VJPA 5CA0F 3DULA 5M7EA 3N28A 1NJ8A 3KEFA 5C8DA 1QV9A 2ZYHA 4LJLA 1C4KA 1NL3A 2FUCA 4EG0A 3IOEA 1YR2A 2VH1A 4K87A 4HEJA 2UUCB 2JGMA 1H1LA 2ZDQA 3X3HA 5DFAA 3VKWA 3MGBA 1SRRA 1IYZA 4A6PA 3P9ZA 3CLSD 2QMQA 2ZYGA 3QSGA 1ZCJA 4C76A 4XKJA 4WGFA 3BF8A 3GD5A 4WH0A 3THWA 4CMEA 1A5TA 1XXHB 2QUZA 1UM9B 4C4RA 3G9TA 1GLNA 3BRCA 4IQ8A 1K1EA 5EXTA 1GLVA 2A8YA 3MINA 1QTQA 1D7OA 3IPYA 3OF5A 2OQVA 2H6EA 3RR2A 4OLAA 3JVDA 3RYTC 1NW5A 3PP8A 2AS0A 2AOTA 1NVTA 1YUBA 4M1QA 4A36A 5L4NA 2E87A 5CU7A 2PUJA 1XLTA 2NPFA 4KJZA 4OIMA 1KIMA 2XUJA 4QUEA 4TWZA 2FWPA 1GTSA 1KQ3A 1NUPA 1FSPA 1DX4A 4MYDA 2IDMA 4OLBA 5GJCA 3B38A 1UJ6A 1SKQA 2OCDA 4JKOA 4RK4A 4D0NA 4F8EA 2BGNA 2GN6A 3NW9A 1VL2A 1CKEA 4KG7A 4Y0AA 4CKEA 2YTZA 4RZXA 1R8JA 1IONA 2K87A 1W52X 3L9XA 4IKPA 4X63A 3VZPA 3ZXYA 2XYRA 1RMTA 1SUCA 4TROA 4NBVA 1EXDA 1TAQA 3AP2A 1YAHA 4JEHA 4LE2A 3R7SA 4BRUA 3IURA 1GUZA 2P2DA 2CLLB 2XT6A 3TLEA 3W2TA 1WQ3A 3GLKA 1SPXA 1ZVJA 2GAOA 2ZITA 3NORA 4RA9A 2BF4A 2PGDA 2WAXA 2XSZA 1MAHA 4UE6A 4EYKA 3T3PB 5LQRA 3MMNA 5ILOA 3IA2A 4MGIR 1G60A 1RR6A 3CPEA 4HGZA 4CODB 2GM9A 4ARIA 4B6FA 3WDSA 2Q3CA 2P2GA 4LJ9A 5E1BA 2WZDA 1XZAA 4R40A 2G9NA 3R0QA 1WCIB 4FS3A 4WFIA 3WRYA 4D4JA 2A5FA 1I4EB 5AJTA 1U6KA 3ROKA 2RCNA 4DTCA 1M10A 4S1NA 1GDTA 4PC2A 2VF4X 3WK6A 4UTOA 2UYOA 3PWSA 1M83A 2CL6X 2FGKA 1E1QD 4OA8A 5I7AA 1BMQA 3THRA 3UT5B 3R0XA 4RGVA 3II6X 4MWDA 4DB4A 1AKWA 1X6VA 3RUPA 4MPPA 3QBTA 3E9ZA 3U7QA 4E33A 4W6ZA 3DZDA 4OBWA 5HDBB 1U2GC 3ONEA 3VPHA 4C7OA 1J20A 1S0UA 4JFAA 1SVKA 5LXTA 4RANA 3QOYA 4BMYA 4RY2A 2I1WA 1Z0SA 2OP1A 1N9GA 2WABA 3CH6A 3KELA 4YRDA 1BXKA 5AM2A 5KHOC 4CQNA 2YBDA 4ARBA 3ZHBA 3ND9A 2VSNA 3C3XA 2HQRA 5EOVA 4B7AA 4FYPA 1K3UB 5B3JC 2XNCA 3LYAA 1MA3A 4YAEA 4AZ3A 5KKAA 5KPJA 3AY3A 4LJ6A 7MDHA 4DHWA 3PTLA 1EGMB 1O0SA 2OBXA 3DOCA 1N32B 3OEHD 3KJEA 2N75A 5JO9A 3HE3A 2ECFA 2FSPA 2ZBUA 1GNVA 3FZYA 4QJIA 1BNCA 4WFKA 5DNAA 1U0RA 1LU9A 4NG5A 2NVUB 2YWEA 3TSCA 3W4JA 4EMBA 2YMLA 1G19A 4XA8A 1E62A 3TBKA 4JXXA 1QPZA 3HI6A 1XRNA 4ZYWA 3UQZA 3EUAA 1H1DA 3MERA 3SYRA 5HMLA 1E2DA 2CFIA 1D6SA 5KX5F 1XQ1A 3EZ2A 1OXVA 2PGLA 2Q2WA 1Z0AA 3QU5A 1KY4A 3ASZA 1ES9A 1SZPA 5IDVA 1GAXA 1M74A 2DPXA 4LN1A 4BDTA 1NW8A 2QAGA 3V9PA 2BIFA 1E3DA 5L40A 2JFFA 2R1VB 2VO1A 1G1MA 3IPXA 4Z51A 5FPKA 2VI5A 2YXNA 5KDDA 4RTSA 4P7BA 5AWFC 4ECAA 5LC1A 4HZIA 2QHXA 3TQFA 2FG5A 4FKMA 3MHTA 1TJ3A 2QZZA 3PDJA 4HWOA 2ATXA 1J0EA 3KZXA 2REOA 1PGOA 2PLNA 4B6EA 2RHCA 4EELA 4F84A 1P1RA 3BH6A 1UM8A 3DDZX 3W8EA 1QHXA 4M1OA 4WFJA 3HPRA 4QYMA 1PFUA 2VHQA 1XZQA 3HZOA 1FRFS 4MX8A 2PZFA 4AX8A 2QD3A 2FQ1A 3DKRA 3G5LA 1LSSA 4ESEA 3OUZA 3PR3A 1ABEA 3LVRE 5JSQA 3FJOA 3D8NA 4N18A 3WMXA 1HMYA 2OXCA 2CK3A 3NNNA 1QJCA 4IF6A 2X3YA 2W8BA 1OT5A 1R9GA 3D1VA 3JASA 4FQ5A 4O2LA 4BQEA 3GLGB 4ESVA 3L93A 2JLWA 5TQ0A 2DCUA 1T43A 1WP9A 3IFSA 3FYCA 4DIBA 5EQJB 3PPVA 3R9IA 1QQBA 2WJVA 2XMGA 1I10A 2GUGA 4WOBA 4IMJB 2OUIA 1RKVA 1SHLA 3OZFA 4OFZA 1LUAA 3JQ7A 3P0RA 5EIBD 1V5GA 3N58A 5K3DA 3ZNQA 4A0GA 1ZM3A 1CQJA 4I08A 1LW7A 2F1HA 2W83A 4Z7QB 1KYVA 1HWYA 1VHLA 2EKZA 1M2JA 1PE0A 3B6IA 1LVHA 1TCAA 1S7GA 1NASA 2C58A 2CC2A 2NVBA 3A58B 1GPYA 2X1MA 3QIAA 4GXNA 5DHUA 4NPAA 4YECA 2E82A 3RKRA 1HZJA 1H5UA 4ZMSA 3R0ZA 4IWYA 4ZC8A 5HBGA 3I37X 2C20A 2GN8A 3T94A 2R8RA 3NRCA 4EFDA 5JCPA 2ZJ7A 4NZOA 1Y6ZA 4JLAA 5MN5A 1U8CB 1VP3A 1ULSA 1KSFX 4DKJA 3ICQB 3E8XA 1OLSA 4X6UA 2PR2A 5HFJA 1N8NA 3O4JA 4HB3A 2ZRMA 3VYRB 5AVWA 2FSGA 3B8HA 3KTDA 1SCKA 4HLUC 4Q9IA 1TVKA 5TARA 2NP7A 4BDSA 5HYVA 4AG3A 4Z4EA 3CB2A 3R44A 4XCXA 2AOUA 5I7SA 1NRWA 3TNLA 1KEKA 2FW6A 1EWKA 3QUAA 3F4KA 1NZFA 1YHZA 3NV7A 3PHCA 4QNRA 1FLVA 3H5AA 4W99A 2NUPB 2ILVA 5THXA 3T9DA 1VKJA 1QTIA 2WP8J 3TDKA 1E0AA 3VR6H 2Q6KA 2HH9A 2BZ1A 4QXAA 5ERGB 5G2OA 4DYVA 1XQXA 3QVOA 1FX1A 1NI3A 3CEMA 4LW8A 4TRNA 3TOVA 4WZAE 3N76A 3GFGA 3CNBA 1S7CA 4D46A 1KWKA 4FLFA 1GT91 5FYQA 1XXHA 1UM9A 1ZS9A 3W1WA 3GLRA 1USKA 1DUSA 3I6ZA 2AVNA 1JNYA 7ADHA 1OTXA 3A9WA 1A9ZA 3SJUA 2FW9A 4ZV7A 4M0KA 4NYJR 3NTRA 1NF3A 1UQUA 1ULAA 2BJHA 1G0NA 2VRCA 1U1GA 3GIWA 4Q21A 3RRJA 3LT2A 4C7MA 3G0OA 5EAIA 1LQTA 4IW3B 3HO1A 4MLDA 1SK9A 2BM1A 3UTDA 2VL7A 5ADHA 4FMCB 5GV8A 5IASA 1LBSA 4F1JA 2ZRAA 2PTHA 3FTDA 3X1JA 4KWHA 1AZWA 1P5JA 4WXRA 3E4CA 3L05A 4HDCA 2Z1NA 4NK5A 3CCCA 5HKOA 3C6QA 1KE2A 4FIZA 5FUXA 3FTNA 1CUAA 2GEFA 5KTTA 4ZYTA 1ZI8A 2BCJQ 1SIBE 1G16A 2RI0A 1S02A 3I23A 4EHDA 4XD7D 3UN1A 1RWPA 1PFVA 1GTZA 1WDTA 3OOWA 5FUQA 1PIWA 2W11A 1R66A 1CUZA 1CIPA 3GG9A 4W7HA 1HL7A 1C50A 2P8JA 2BHSA 4BKPA 7ABPA 4QEKA 3T7DA 5INTA 5LZ4A 1PL8A 1W0KA 1XO1A 5MN6A 2PX4A 2QRHA 3GFVA 3NPMA 3FUTA 5AVUA 3WKBA 3AYZB 1S3GA 4RDCA 5LQUA 3OKCA 3EDYA 4JJ6A 2HA4A 2E5LB 1EBBA 1CUCA 2V7UA 1CY8A 2V5AA 1P73A 2CLIB 2Y93A 4GRAA 3Q72A 5I45A 4XIGS 4G65A 1JPVA 4DM7A 1WCIA 1WNFA 1RXUA 1U3CA 3I4CA 3PFGA 1G64A 4FDVA 5DM1A 4WBNB 1RAGA 3E9EA 2QRLA 4Z49A 4KR6A 2ZYAA 4EEXA 1JIIA 5AKLA 3WGVA 1KYQA 3CN9A 3EB9A 3O3NB 3QPWA 3NM4A 1N92A 2XB9A 3VR0A 3LW8A 1R0BA 2ST1A 3UT5A 3Q88A 3LTEA 3VHRA 3CN7A 4EG6A 5KU1A 3IOMA 4EQ6B 4YCMA 1A77A 2V7VA 1E3WB 4BNGA 2DFTA 4G37A 4UEOA 2AWNA 3KJXA 3FWPA 1QQTA 2JBWA 5FBRB 3SX2A 3WKEA 4ENSA 3AZPA 4DV2B 1P7YA 1V3VA 4TGLA 3U7IA 5DM0A 2WQ6A 3SFZA 2P6NA 4GICA 1R0WA 2IVZA 4I4CA 4AX4A 3TR6A 1UKZA 1QOQB 3AP1A 4JCCA 2ZI7A 1S2LA 1RAHA 2GAFA 4IDDA 4LUCA 2J3DA 2QZ9A 3G0CA 2ZRLA 2IV2X 3SD7A 4PPFA 2IUUA 3G7SA 4Q4LA 3CLUD 4ZVKA 4I6GA 1Q1NA 3OMXA 3DGEC 5BSFA 4JT9A 1CJUC 3FPEA 1CW2B 4PC6A 5FWNA 4PSAA 3KFVA 3PYMA 3QWFA 3NC4A 1QTNA 2XE7A 4U8HA 1WB9A 3AHJA 1YBMA 2ZI5A 5FA6A 1K92A 1GADO 3DBLB 1ECGA 5FFFA 1DWPA 1AM4D 2NVUA 4LZZA 1ULZA 5FPTA 4G0PA 1AH2A 1SD5A 4D26A 1ZQ9A 1DBSA 8LDHA 1MGPA 1OI7A 4MINA 1WD7A 3GI1A 1PEKE 4DR7B 1JSXA 2G36A 2XF8A 5FWAA 1X38A 3AF2A 5I4BA 1STOA 4QWWA 4NESA 4E3WA 4ZAWA 1QNFA 4DY6A 1IUNA 2W22A 5TGDA 4HX2A 4MS1B 2NVOA 3NHLA 2JI6A 4CG1A 2DUNA 4JSYA 4PG8A 4AMYA 2XT0A 1IVYA 4NMWA 5CJJA 2AFIE 2ZCJA 2J46A 4LYHA 2XIJA 4RFSB 2R1VA 3VZDA 3PI6A 1DRWA 5A5GA 2YNMC 3R5FA 3PPYA 1E0SA 1RSZA 1GGVA 1X0XA 1D03A 1KKUA 1M34E 3HPQA 4P8RA 2DC1A 3D7LA 3EMDA 4DDHA 3U31A 5KTMA 2HFKA 1F9EA 1NOKA 1GGMA 2G1UA 1IBRA 3B2QA 4NSNA 1E89A 3G2OA 1P2DA 4M9QA 2BBTA 1X42A 4KBGA 4JDUA 4M37A 2Q8PA 3WZLA 1MZPA 5BVGA 1IY0A 4Q9JA 1EGVB 3HU1A 2OQIA 4B3HA 4FB5A 3OIWA 3P0EA 2VJKA 5TMDA 3NNSA 1R5OA 4MUNA 5IBQA 3IP6A 2BWJA 5A9SB 4QDOA 3GEGA 4BGEA 1EHYA 4XRRA 2EHDA 3H1GA 1GQRA 1R8YA 5LA6A 4LOAA 3K9WA 2IGBA 4J1NA 4L4RA 3W5JA 3WO0A 1V43A 4LHZA 4C3UA 3GLGA 4FT4A 1YZFA 4XJSA 4NBKA 1SWVA 1TZBA 1QONA 5P21A 5EIWA 4J03A 5HF9A 5CB4F 1JR3E 5B64A 1GEGA 1KQOA 4GZ5A 2KW5A 2VYVD 3PLAE 3LX5A 5K3CA 1KMMA 3MTQA 5AKZA 3MCVA 1YMUA 5CLLA 1UOOA 3INGA 1W88B 3A25A 3CJQA 5IABA 1CR0A 3OWOA 4NYJQ 1GKIA 1ADJA 1GZ4A 4JJFA 1JT2A 3WC4A 2LRHA 5MDHA 4JLPA 3VOTA 3RHSA 2IWHA 3ESQA 1KZ4A 5C2JB 1USWA 2IXTA 1WSWA 2H52A 5BY2A 2GGSA 2QGZA 4IDCA 3S8YA 1MOSA 3LXXA 2I6SA 2Z8XA 3QFSA 1XDGA 1G5FA 1I1QB 4KLNA 4C78A 3LE8A 3HLTA 1QBGA 4IYJA 2VSOA 3BFXA 1Q3HA 1ZMOA 1P9OA 2BMJA 3OOSA 1YI0A 2IYTA 4JI0B 3RNOA 3L49A 3BWMA 1NKVA 3FH0A 3HCOA 4WK0B 2V4UA 1LI5A 4JROA 5K0EA 4DLXA 1UKAA 1T5SA 2IW1A 1LCIA 1DEAA 1FU4A 1TO2E 1Z6GA 3GZTB 3L92A 3NJRA 3USZA 2ZLBA 3I9NA 1QANA 1QHIA 2EEPA 4YYZA 2NUPA 3BXFA 1PWYE 3O4GA 4WLFA 3EVAA 1VHWA 1OROA 3NEAA 3IXMA 1BJTA 2HCTA 3MOSA 1JIVA 3A8TA 4QTUB 2R48A 3SK0A 4U6NA 3NIFB 1U02A 2W4MA 3IJRA 4GMGA 4Y7CA 4L4UA 1JJIA 3C3EA 1EH5A 4DWOA 4Y2UA 1FS4A 3R76A 3W05A 2XUFA 4EAAA 3ZWQA 3MBKA 1RQLA 2R86A 3RSSA 2R4QA 1VZ2A 2B35A 1DPFA 1U31A 1RPJA 1UBMS 3CW8X 5E0KB 3EVFA 2WSLA 1JEAA 4GX2A 4ZQCB 5AVSA 2AXQA 5LOVF 4R7ZA 4UUNA 4EW1A 1DXQA 3NATA 1QRSA 2LUOA 4J4TA 3PNKA 3EPPA 5EKSA 1DE0A 1X0VA 2B5OA 4FJ1A 3ZEAA 4OXYA 1CDOA 3BBLA 3IR6A 1O7JA 3RUDA 1CG6A 1HOTA 1PDWA 4H7DA 2Q9AA 4E70A 2GF2A 2Z98A 3AVWA 3TRHA 4RQUA 1PZMA 1A8PA 3OAAA 1P6QA 2SNIE 4L51A 5K1ZA 3ANSA 1CV2A 1J8MF 1P4JA 1S4MA 2JEYA 3LPNA 1YC2A 2EWVA 2OXIA 4C0HA 5AVYA 4NENB 3NJ4A 2C1EA 5LBIA 4YWHA 1C9KA 1NU8A 4ESHA 4Y2SA 5H1YA 2C7QA 4DILA 1WKBA 2ZYRA 3FE2A 2O8CA 2RC5A 5D87A 3O0DA 4HGNA 4N5IX 3VVCA 2IDJA 4KVZA 5GONB 3O73A 4D9IA 5JVDF 2ZWAA 4QFMA 1DHRA 5FYDA 3LT0A 1JR4A 3D8HA 6ADHA 3M6UA 4W9NA 2CV2A 3M1IA 3DFMA 1NMSA 3RIYA 3ED1A 3Q85A 4KO4S 3R2JA 3UHPA 2IPXA 2ZUDA 4G5FA 4JVMA 4U63A 3ZKAA 1ZU4A 4FLEA 4B3CA 2WUWE 3TFWA 1QFSA 3G0DA 4XDYA 2AQIA 1MXFA 4WBNA 5JS7A 2PLRA 1GA1A 1CR2A 2ISSD 3KBOA 3L1IA 4V2IA 4XVCA 4FTWA 3G0HA 4NZZA 4IIUA 2ONKA 4UMEA 3NG1A 1NBMA 2BEKA 3HZZA 4XX0B 3TIFA 3KHTA 3PUKA 2PAFA 4KKVA 4EQ6A 3R6DA 1E3WA 4GECA 4JUAA 4CE6A 4IJKA 2PRKA 3CIOA 4RVFA 2G9ZA 4S12A 4RM2A 1AUXA 3EGOA 3W6OA 5K0GA 2D8MA 1ILEA 1RJEA 2BEUB 4IQGA 2NSLA 3VV2A 1KAHA 1R0XA 2OC4A 3UBMA 2NAPA 3GMTA 3IMFA 4BPBA 3L41A 4FYWA 2AJLI 4HEHA 1IY9A 1Y3AA 2WD9A 3TOSA 4BU1A 1VG8A 221PA 2AG0A 3CVJA 5DWVA 3SX0A 1AQJA 3KPUA 3DWFA 3RFVA 1HDZA 2FZKA 4ESOA 1RBYA 1QIFA 3L02A 2H4JA 4G4JA 3ZU4A 3STYA 1ZUNB 2JK0A 1VJTA 3QJYA 3L8HA 4JR2A 2O2SA 4R6WA 5AJHA 3RHFA 3HHPA 1DDGA 1DKQA 4YMLA 1T5HX 4HUJA 4B0PA 2W9XA 4G23A 5KJ6A 2GMWA 4AUMA 1KVSA 3DBLA 4X6XA 2G83A 3NFYA 3U4GA 1WZEA 1SOMA 3NYQA 5K9ZA 1Z62A 2JLAA 2QZSA 1TTHA 3N7TA 2GD2A 4D56A 5EJ5A 4Q1BA 3FNGA 3HFSA 1QIGA 2EL9A 3GFFA 3BCRA 1E1KA 3UMRA 1NMXA 3V7WA 3LECA 4X93A 1N6RA 5HPYB 3AB8A 4FNAA 1NMEA 2GPSA 3FWNA 5BWCA 4BNJA 5LXTF 5BRAA 4D3YA 6GPBA 4MS1A 2DQZA 5EIEA 3WLPA 2CVPA 3I6MA 3FUWA 3INRA 1RRMA 2CGEA 3DQPA 1M6NA 3CW9A 1Y1PA 1PL7A 4RFSA 2EQBA 3Q40A 2GA9A 2ZRJA 3OZXA 1Y3CE 3PPIA 3THYB 2YVUA 3DO6A 1JQDA 2W70A 2C3OA 3NWEA 1MOPA 1MW9X 4L6IA 1U8EA 5F73A 4CF4A 3CM0A 2GNPA 4KX5A 4UPVA 3IOBA 4J16C 5F2EA 1EXNA 2ET6A 4OKSA 4B3RB 2ZI6A 1Z16A 4O4HB 2HBZA 2IIBA 2QD1A 1HORA 1H2RS 1X1SA 1U80A 2V7QA 3IAFA 3R5TA 1JU4A 1YL6A 2E5FA 4MVJG 4ARAA 1TYDE 4K9NA 3VSBA 3BRWA 4BHTA 4XIIA 5A9SA 3N86A 4FE4A 1VSTA 3HJHA 3DEJA 3GXOA 1ZM9A 1UJMA 4KGDA 1TK2A 1P2UA 4EGCB 3ZLJA 4KPYA 3HDVA 5CDUA 2HSZA 1XF1A 3C45A 3FHLA 2FKNA 1E2GA 1UPBA 4IV0A 4S1PA 1HEIA 1Z4NA 1TTTA 5CLQA 4FK8A 1FUUA 3CV3A 3KT6A 4X1KB 3TUIC 1WEKA 4US0R 3CF4A 3RK0A 1GXSB 1KH3A 3HUUA 3D6AA 1PG0A 5JWOA 4XB1A 3DHWC 1R0LA 2EYUA 1J1UA 1W88A 1CJKC 3EAGA 5TIIA 4GW3A 1XTVA 3K53A 3TI7A 4CQJA 5HGJA 2ZRHA 1LC3A 3ODPA 3L1UA 3PUVA 2I80A 4J0GA 2IZ5A 2JAPA 2GESA 3INTA 1Q7CA 5DH9A 5KTNA 1NOJA 3H42B 4LYJA 1X3LA 4LPSA 3KSRA 1GQFA 4LMRA 4GD3Q 3G02A 4RJKA 2WSMA 3L0ZA 1LWOA 3OJLA 3G2HA 5AFSA 2ZWVA 1J8DA 3TS1A 2PZJA 4MKFA 5BQ3A 4LX8A 1LPNA 2WWFA 3RVDA 3B8EA 2Y3IA 1NYQA 3QPVA 4MPRA 5FV4A 2F17A 2BDUA 3DL0A 4BMXA 3A2KA 4QOFA 1KEEB 4JCOA 3D2AA 4G63A 4TMXA 2DSTA 4B3IA 1E2FA 1P72A 3B9PA 4NYMR 1PJSA 3IVCA 5KDLA 1OY1A 4LRUA 3AM1A 1C0EA 3UJAA 4ZQFA 2YJ3A 3TF5A 5J5VA 2J09A 3KOYA 3JQ8B 2ZVQX 1YFZA 4MGHA 3C43A 2QNIA 5JRJA 5E4FA 3RQIA 3U56A 2ZYWX 3O8NA 4UUBA 2Z1MA 3RIGA 5EZQA 4BFZA 4MR7B 1YVEI 1LNQA 2EFDB 2PMKA 3IPRA 4FEYA 3SR4A 3ICOA 1H6AA 3KLMX 3UXEA 1XQ9A 3NHJA 4EY8A 1RPZA 3GH3A 3H2YA 2FFHA 2EJUA 2HQSA 5DTEA 2P6MA 2QJRA 1VRVA 3U4CA 2O2GA 1VLHA 4DZZA 1ESCA 3WL6A 1NUUA 3GFQA 5E7JA 3R6LA 3I2FA 2OCLA 2WQ7A 1X94A 2GJAA 5HQ3B 1CR4A 4BGUA 5LVAA 1DRJA 1FE8A 2AMFA 4KP7A 4C03A 4S0ZA 2QP4A 4DLUA 4D3FA 3ODGA 2BFDA 2H4ZA 2VTEA 4EY3A 2DQSA 4X54A 2V3VA 4JJ7A 4TMTA 3PJRA 4MW9A 4LHVA 4AQDA 2XEXA 1C7EA 3IUSA 1SVOA 1P4GA 4R81A 1XPUA 2RGNA 4NENA 3RIMA 5KEIA 2BE7A 2ZBPA 2PEZA 3KPJA 2F3TA 4KN5A 4QBGB 4V0NA 1XZIA 4TRMA 3ZGNA 2QY9A 1OH6A 3L79A 2DTEA 5KCZA 1VSVA 4UZEA 1CPYA 3SOPA 5KOIA 5GMOA 4QZVA 2IHBA 3OQ1A 4J1TC 5GONA 4HJXA 4PCUA 3DS8A 1NV9A 1REQB 1ULHA 5IHXA 1NW4A 3P2YA 3LY5A 3C7KA 3D4OA 1O97C 3T3GA 2PWBA 4L0CA 1O0BA 4E3ZA 1M73E 2ZTMA 3A37A 1KI4A 2ZQYA 2OHGA 2B4AA 2VPXA 3AU9A 3AXSA 2AJBA 4YJ3B 1KDZA 1MTOA 2PL9A 4CRWB 3BKXA 2PS1A 2N3ZA 2H1WA 5AW6A 1HG0A 1CZUA 2QYSA 1J0AA 3BRQA 2IX3A 1P2TA 1T91A 3PSAA 2RB5A 3BJEA 4CEJB 4C06A 3KHKA 1K5GA 3LOQA 4XX0A 3TCXB 2ZAGA 1RP7A 3QBDA 1TPYA 4GP7A 4X44A 3RVBA 4C20A 3ZQ6A 2GSWA 2WG1A 5AOBA 3IE2A 2Z2YA 2QL7A 1JR2A 4D0GA 1YUMA 2BEUA 3FGOA 5IP5A 3EIUA 4JYCA 4Z9XA 4H0NA 3NKLA 1OYVA 5BUSA 3K72B 1BFKA 1M1YB 3UJHA 1NI4B 2A3NA 4ISCA 4WLUA 5GAJA 3TVTA 1FNCA 2J5QA 4QGGA 3Q0IA 4AL4A 3ER6A 3DWIA 3C4JA 4ZCMA 1SEVA 3BWEA 3EXFB 1S9DA 2PZKA 2JK1A 3D8SA 2DU8A 2G76A 3GHYA 2JAOA 1ZUNA 4IX1A 4ITRC 1YWGO 1XJQA 2ACWA 1J0XO 3QHAA 4ZKEA 4KO1S 1ZKDA 5L6LB 2H2AA 1Z5PA 2IQ5A 4L0QA 5FUBA 3WDMA 1GITA 1ZVMA 2EP7A 3C39A 3HHEA 5HJEA 1TD1A 1U9IC 3LT1A 1UL1X 2EFGA 4IR7A 2VOJA 1B6SA 3ZNOA 3NBYC 2VJQA 1R8XA 4FN4A 4AY4A 4ZYZA 5FAXA 3BBPA 1ZNQO 2YN2A 4ZJYA 3ZIAA 4KMOA 1IULA 3DZKA 3DZCA 1JEQB 1T15A 3OKFA 4PSCA 1LPSA 1G4HA 3NBQA 2IUSA 2WAYA 3BGIA 1C4OA 2H92A 3BWVA 1TM3E 1II9A 1SHUX 1FL9A 3L1VA 5EJGA 3UJ3X 3WLMA 4AJ2A 5L7TA 3ID6C 4X94A 4ZDIA 4PGMA 3KXPA 1DKUA 4J07A 4TTVA 3UYKA 1BX1A 2VWQA 3THYA 4L27A 4IHKA 4OFBA 3TMAA 3I8OA 3CZ4A 1K6JA 3I3SR 4CN8A 4F1KA 3IE0A 2XVZA 3IAXA 3KR9A 4JXJA 4KQGA 5ALEA 3U0BA 4Q00A 3WADA 1RFLA 1WLYA 3BZBA 3DP9A 3G2MA 5DPMA 2NO9A 4M53A 4F3NA 4YP1A 2X19A 3UENA 1HNZB 3GK3A 5J58A 4O4HA 4ALKA 1D4FA 2X6RA 4HN2A 5AK3A 2HMYB 3D2CA 3V32A 3E05A 2NP6A 4NAHA 4D0RA 2QK4A 4WN3A 3EGIA 1IRXA 5FDFA 4Q18A 3ORFA 4MTLA 2BH2A 4WKCA 3HJFA 2YOGA 2W2XA 4QU8A 5KQGA 5AKKA 1XIVA 1WA5A 2JLRA 3GGDA 3M0EA 5LBTA 3EZYA 4IFEA 1QYRA 4NYMQ 4KQ2A 1XK7A 1TW3A 3NQ41 4PLPA 4Y2HA 2JJ2A 3T7RA 1DOAA 5CAEA 1TX4B 5K0JA 5LYJB 2VHUA 2CD9A 3JARB 4TS1A 1N6OA 1NXPA 2R96A 2L82A 2FZWA 5DBFA 2Q3MA 4OSEA 4TOIA 4X1KA 1HM5A 4FZVA 3L4JA 3D5QA 3OF2A 1GXSA 2WSSA 3SDBA 1QTRA 1Z4IA 5KNBD 2VK8A 3QYAA 4Q37A 3DOIA 3LYLA 3A6HA 2BMFA 1E1NA 1MRNA 4Z2AA 3RAFC 3W1EA 3I45A 4RZ2A 16PKA 1OSNA 2X58A 3A1NA 1J49A 1FPQA 4MV5A 1R5JA 4TT8A 4YREA 4FBLA 4HWKA 5IDYA 3W3AH 2J0SA 1R4AA 4BUCA 4M9SA 4ARCA 1QHEA 5IVIA 3P19A 1ODTC 4MO2A 3TPCA 4IRXA 3ZNPA 4F5DA 3PFCA 1KMCA 2EX1A 4RW0A 4GPEA 4XRGA 2C83A 5DTIA 2QTWB 3GLQA 1TYAE 3EQ9A 3QF7A 3VQTA 5KQRA 1U2GA 1AB6A 1TL7C 1Z28A 3ICVA 1ZHHA 2G0AA 3KVVA 2ZWPA 2Y6UA 4KL8S 4LJYA 4N0QA 3UJ8A 2IYAA 1XZBA 5IYZB 4RZIA 2ZBVA 1KEEA 1V5WA 1PT5A 1RWBA 1VYHA 3F47A 1BD4A 1Q5PA 3R5JA 5F12A 4Q4CA 5AT1A 1E94E 4YI3A 2GILA 1T0UA 1VIAA 4RKWA 4DSZA 3JQ8A 3OJOA 5B3JA 3TNJA 2G4LA 2BT4A 3AWDA 2Q5OA 1E5XA 3K7EA 4ZU1X 4RPCA 2FFRA 1FZTA 5D5PA 3T3DA 1FU7A 4EUKA 3ZEIA 1N3YA 4MR7A 1PR3A 1KQNA 2ANCA 2DKOA 2H1IA 1O95C 3KX2A 4M0LA 1M2WA 2AF4C 2VDWB 1T5IA 1CZHA 4IV5A 2Q1TA 1QAQA 4FSXA 3S0JA 2O5CA 1L7XA 3CNEA 2ZYUX 4ZT3A 3PEVA 4PYMA 4XEUA 1G4UR 1GL7A 2VQ3A 4K28A 1K2WA 4TLEA 1A04A 2ODPA 4YP9A 2C4KA 5C31A 4BMZA 4CIBA 1V1MB 2J9YB 3OZIA 5HQ3A 1C7ZA 1FDVA 1GPJA 4HDRB 3T5AA 4NCBA 4RV4A 2Q1WA 1DCMA 1WQ1R 2OVBA 1F0PA 2Z5GA 4BWVA 2JIPA 3L7LA 1TA0A 3PR1A 4ZT6A 2IOFA 2PGOA 1TAHA 1WW2A 1R4MB 2DHDA 2PIAA 5ILQA 3U80A 3Q41A 4B6PA 2L2QA 1KOFA 2D2EA 3A9RA 3AEXA 3QGMA 2XQFA 3QUSA 5K2MA 3W2FA 3LGSA 2IEYA 4HB2A 4FR0A 4OHFA 3CISA 2QMOA 5GV7A 3O2QB 3W9BA 4D0SA 1M2FA 1DKLA 1UJ4A 3DMHA 3K0AB 4PANA 3RJZA 4CF7A 3JQQA 1G9XA 3ECCA 3G13A 1P5RA 1REQA 2QRQA 2QYOA 2EKPA 4LXYA 3V8EA 5JCJA 2EIHA 3UMFA 3AIKA 1I01A 1U9CA 3M34A 4NFLA 5HIJA 5ILGA 2ABWA 3TLYA 1Y42X 3M9WA 1G20E 1MEEA 1ZLYA 4MRNA 4BB0A 1SCJA 1F8GA 4FMCF 4F7WA 4YJ3A 3VTFA 3T52A 3GP5A 4BNDB 2ORVA 2WVJA 4IDFA 1SXGA 2CKMA 2R00C 1BGVA 3INNA 3B13B 3K2IA 4EB6B 1LV8A 4CEJA 2EGGA 1XX6A 2BUCA 3CIFA 1A8QA 4L02A 4Q48A 4RFVA 3WP0A 1TM2A 3SG0A 4DE5A 3RAEC 2MSEB 3MHPA 1DZIA 5FR2A 2HCRA 3V48A 1B7GO 4ZARA 1VIDA 3FRIA 3ORHA 4CU2A 4F4UA 2Q4OA 5F7XA 1GU1A 3N0WA 3GJZA 3DA8A 4B3XA 1TK9A 5IK2A 3W06A 4GKJB 4N0DA 1VL6A 4YALA 1RQXA 2ZDHA 4W9RA 4L08A 1PWXA 3DCYA 1E79A 1M1YA 3VDMA 5JAIA 3B51X 1NI4A 1JB1A 1IXSB 3T9BA 2VSQA 1BKYA 1ADFA 4EYEA 4P82A 3OC0A 3ZD7A 1E63A 3PWZA 5DHRA 3EXFA 4TQ9A 4XWAA 4Q02A 3WK7A 4WBNF 2CHUA 4I9GA 1NTOA 4HPWA 3A6JA 4EL5A 1F0KA 1X92A 1W4AA 2C9OA 1E9AA 4HLUA 2PPLA 4I99A 4UATA 1GGHA 2AD5A 3DGFC 4MUIA 4RXMA 2OHXA 4Y2GA 3DZGA 2GLTA 2OFOA 4FMPA 1OB5A 1LQUA 4PG5A 4QU9A 3KYIB 3DKVA 5TVKA 4ZFNA 3S27A 2VBCA 3VBCA 1O6ZA 5T4BA 1RC8A 4E2FA 3V6MA 3GDHA 1JEQA 1W9HA 4WQMA 2Y9PB 1EVIA 1JVBA 3OIFA 2ODAA 1FX0B 3LC2O 3OPVA 5K3OA 5NULA 1C8LA 3ICCA 3OOEA 4PQRA 1QCDA 4MDHA 5GADl 3LCMA 1KY5A 4HGPA 4WK6A 3OX1A 1CX9B 1X7DA 3ZWMA 4EVSA 2I62A 5ADWA 1CR6A 3GY0A 1GV0A 1F8YA 3GA5A 2BKVA 4YV1A 5JZ9A 1EBFA 2QA5A 2PMCA 2HQBA 1L7AA 4TS3A 4YA6A 4CM9D 2ESRA 1CY7A 3OZWA 2WWVD 2PCLA 1MJGM 1CS4C 4GPD1 4Y6SA 5FFMA 4IIJF 3CTPA 4EBFA 5DNCA 5KDOA 2A94A 5TX7A 4G85A 4FHGA 4IV8A 4B3FX 4M36A 2ODQA 1B6RA 1XXHE 3OIVA 2XCIA 4RD3A 4ZI3A 4B17A 4LZPA 4IQ0A 1RMQA 1HT2E 1L5RA 4OQNA 2VT3A 3H9BA 3BL5A 3R0VA 4IQ4A 3EQ8A 3UPTA 2NXNA 1WXGA 3O2NA 4L8YA 5LZ8A 5JBNA 3TGPA 1SXHA 5TGZA 1RRKA 2ZTSA 3TNYA 1EAMA 3V8NA 3I73A 9ATCA 2ZYVX 1L7BA 5LYJA 3U4HA 5AUPB 4W9MC 3B36A 4Q1DA 1JAZA 3AFMA 3JARA 5CHEA 1E9RA 3SU8A 1XDDA 3OD1A 5J59A 1ISJA 3Q8KA 1JA0A 2P1RA 2VN8A 2WD7B 2YZ7A 2BM9A 2WJ3A 4FYHA 3WYDA 2Q3HA 2C4MA 4TQUS 3TIVA 2XDQB 3HYLA 2E37A 2K6GA 1RYZA 3FYHA 5ITVA 4XYBA 4HNUA 4LF4B 1ODKA 2VPTA 3H84A 4AP6A 2Q1XA 1JJFA 4RJLA 1XVIA 2VZLA 5KVQA 4XFKA 1LSJA 2P5UA 4Y9DA 1Z0JA 4CFZA 4Q34A 1A4UA 3NAGA 4DV6B 1Z0ZA 4OBEA 2P75A 4MUXA 1SVMA 4HWSA 2J3JA 3JTMA 3AUJB 5H5JA 4N7BA 3DAPA 1E6UA 3IJ5A 1XTIA 3T7EA 5EMMA 5TS2A 4JQOA 1U7PA 2JIOA 5KUTA 3IB6A 2HGZA 1IFXA 3BFVA 3BJRA 2O4CA 4I2NA 3DQQA 5TE9A 1Y6RA 2XI4A 3S1AB 5AVZA 4OXKA 1W7AA 1P45A 3EDRA 3HXKA 3PWKA 4IJVA 1ABBA 4GIBA 3EPJA 4JLUA 5IYZA 3G0IA 4GNRA 5IKMA 2IYEA 4R7TA 1EVEA 1RCTE 3COZA 4FN5A 4RTLA 4UREA 4YV2A 1U04A 2KLBA 4GYWA 3CF0A 2PX8A 5CT6A 1RHMA 4PU0A 4GRIA 2ZJOA 2WF7A 3E58A 4J9VA 1E2HA 2Q45A 4XQ0A 3SE0A 3RM3A 1NVDA 4BO8A 1UBUS 2CVQA 4IS3A 4WL0A 4CM4B 2VBIA 3PC7A 4IJ6A 3OTWA 1CUHA 5DGTA 1XI2A 1KKMA 2A5GA 5H0IA 1WM1A 3WFJA 2IVFA 5CXUA 3ER9A 1C1DB 3KPVA 4RTOA 1R3DA 2VDWA 3JTEA 2YJ4A 3OO0A 5DMHA 1T5OA 2JB9A 1FFHA 1QKJA 4KDEA 5JXGA 2P9QA 2OC9A 2CDNA 1JPNA 1R6TA 4CNBA 1GM5A 3IQFA 3ITKA 3KHSA 3LUDA 5JASA 3QXHA 2X5KO 2Q2VA 4FDAA 3Q3GE 2GRAA 4I19A 3LPCA 5TMEA 4DDWA 1V1MA 5JZSA 1T5BA 1N2CB 4HDRA 3TQTA 3RTAA 1GVNB 1QOZA 2HO5A 1ZGBA 4ALMA 4BCCA 2DJ5A 3NT5A 4P53A 1DC6A 1N5MA 2EXXA 1F48A 1R4MA 4X60A 2YNMA 3BILA 1E7RA 3B52X 5D2CA 1GSIA 4Z1MA 2B6NA 3I0MA 1SOUA 3MWEB 3OQIB 3SC2B 5BW5A 1Z2AA 1TO1E 1I33A 1Y1SA 4IGEA 4MUYA 3MCTA 4G1BA 3K0AA 2Q1UA 3IYLW 4AJEA 1FIUA 2XJ9A 2JIRA 2IK8A 3NT2A 1D4AA 1WB6A 2GB4A 4R1TA 3S5UA 4TZTA 4NDNE 2WMOB 1HDYA 3L6RA 4L1KA 4JLWA 3RVJA 3S28A 3MOGA 4CIWA 3IEMA 3EH1A 1UFOA 4IG9A 3ANYB 3P9RA 2D5LA 4GOOD 3FJYA 3OQHA 4LRYA 4C29A 1DCTA 1QX4A 2PUCA 4KQ6A 4ARSA 2PT6A 2O14A 4OQPA 4MKIA 3SS9X 4DNXA 2ZSBA 4J2HA 1YIAA 1IK6A 2FTKE 3QUBA 1EG7A 1MX9A 1PT8A 3Q7SA 4CIXA 2VH5R 5KJEA 4BNDA 1FB5A 3RYHB 1RAAA 2HPAA 4EB6A 1Z35A 3VI3B 3UFXB 3NBZC 1CUXA 3K9CA 1L8OA 2VNJA 2UDPA 1OBHA 1Y7LA 3DAHA 4M54A 2PIDA 4XR9A 1M33A 2FJ0A 3LX6A 4EHLA 4N76A 3EOZA 4FFOA 2ZP1A 5U4XA 4J4BA 4IUCS 3QUTA 4N5MA 3MS2A 4AJOA 5LL6P 3R3XA 2QL5A 4V0LA 4TKZA 1OF1A 1B41A 1TRHA 3ABOB 2XLCA 4NR0A 5GONF 3UYLA 2UXCB 2A35A 1LD3A 4YMVA 4DV3B 3OHSX 3Q6MA 2CFOA 1P0IA 1VB3A 4BNTA 2G72A 3OT4A 2OA0A 3V00A 1U2DC 5B55A 5KNBA 3KM0A 3T1QA 4MKRA 1U8AA 4LRSB 5JH7B 2WKRA 1F0NA 3JQ9C 1C3JA 3KQLA 2C84A 1L7NA 3MTJA 3NVKI 1I32A 3HYSA 4EEKA 2PT7A 4HADA 5KAMA 4D9BA 3FTQA 3FCYA 1KYXA 5E7IA 1YRYE 1ZD9A 2B21A 5FLEX 1YS7A 1AOXA 1EFCA 1DKOA 1ZN8A 2W93A 1CUYA 1RWOA 4P4SB 4AYWA 1YL7A 5ANRB 1ZCZA 3S2SA 4TUYB 1VIVA 3AP3A 4LI3X 3SYTA 3MTEA 5G53C 4PX5A 5AXBA 4U39A 2I66A 4L4XA 5IJAA 3TG8A 2AW3A 4MHTA 1BYUA 5JFGA 3AJ8A 1GQYA 1IEQA 2V03A 2ODWA 5EIFA 1A2OA 5IN5A 1UKYA 5FA5A 1NUTA 1PJ4A 5FQNA 1FX0A 4YLYA 1EBUA 2AFHE 2HIGA 3IH5A 4P31A 5T4HA 2OYCA 1Y4SA 5LQDA 1OVGA 4PLHA 1F8UA 4UJ5A 5DWQA 1Z6PA 2C7BA 2WUGA 3PIIA 2YRWA 3RJMA 3DEYX 3FGZA 3BXEA 4OMUA 1XU4A 5EVCA 4FOOA 1SELA 4FMDB 4N4AA 4W8OA 3AHEA 3L0BA 2AJ8A 3L0SA 4D9MA 4PR3A 5DCYA 5CFOA 3FPCA 2C96A 5DLEA 2HHHB 1YH3A 2CXTA 1DCKA 4UDNA 4QG3A 1TZJA 2ES4A 3WHLA 1GAQA 4II2A 2D13A 2GJ9A 4OXXA 1XVVA 4PAWA 2PSEA 4HB4A 5E0OA 4YIHA 1VRCA 1E58A 1L4LA 2NXEA 3VR4D 4D57A 1DS6A 1X87A 3BIJA 2AH5A 2DUWA 4OB7A 3D6FA 4RJ2A 3MJHA 2PFGA 4TWJA 1Q0UA 1DUVG 2CJWB 2G06A 2JJ8A 3D3WB 3QMVA 4RCZA 5SYAA 3ZGYA 5T7BA 1HRKA 2CMFA 1OFGA 3HMQA 2P6OA 4GR5A 4OHMA 3OM8A 5D6OA 3RS3A 3WIDA 1EWYA 3AESB 3EDCA 5IC5A 3O0TA 5ELLA 2XADA 1RJDA 4V39A 1X8XA 1F60A 3UV3A 4E1AA 4BRSA 1PX0A 4DM3A 3O21A 2BGRA 2DR2A 4V02A 5FBZA 2WUEA 3K1AB 2PX3A 2HLPA 2WD7A 5JMWA 5H4HA 2W2LA 4G8CA 4RVDA 2IUFA 4HMOA 3UK2A 4BRWA 2GERA 1AK2A 4LHXA 1NYTA 3W9SA 2XDQA 1OFHA 1UIMA 1X7WB 4K2AA 1C9DB 3CJRA 3LQRA 5IAKA 5SYMA 3WGZA 2HV9A 5EGNA 3LH5A 1OXMA 1C4WA 4R41A 4FE3A 4D4HA 4LV6A 1JQEA 3VKVA 1F2TB 3TN7A 3QBJA 4N6GA 4MRMB 1JWAB 2G09A 2N1MA 4KSBA 4PO3X 4LNUB 5BWMA 4KFTA 3SQXA 4LEIA 1RKXA 4C7KA 1KMIY 1W34A 5FNVF 1DVRA 1VLJA 1XQ6A 5C80A 1PYDA 2ZJ4A 4PTZA 4EDFA 4UM5A 3S1AA 2Z9DA 3CLRD 1JE1A 3BREA 4LBZA 4UW9A 3UFBA 1PFQA 3OJFA 2BMDA 1XTUA 4IDNA 4DIMA 2BCEA 3PEWA 1BE1A 1POXA 2QE6A 1AXGA 5ALWA 1Q1GA 3KQYA 1ZEJA 5FPQA 1XRMA 1VL8A 4AP9A 4C22A 1XMSA 3E3NA 4JBXA 3U44B 4B3DA 1XDZA 1WF6A 3Q7IA 4DYDA 1NBME 4QJ3A 3KFXA 2G3YA 1QYIA 1ATIA 2IOFK 4CMAA 2XNSA 1AS3A 1ZD8A 2FN4A 3T5BA 1NYLA 2X0DA 4LJSA 5AHXA 1FRQA 4Y2XA 1EM6A 3ZWAA 1JKFA 2ZR0A 4CM4A 1XTRA 2BSXA 3BRSA 2O4UX 5HJ2A 2AUNA 3JQFC 4PN3A 5U1PA 1V71A 4DIUA 1WWKA 4LXXA 1C1DA 4KLCA 4X5OA 3SFTA 1RCUA 2GK6A 2WMYA 3WWEA 3UJCA 1K8YB 1NY6A 1DXYA 3C8UA 4JZYA 2O8NA 3D6HA 3SWWA 3HXMA 1K6MA 1GZUA 1KEUA 2QDKA 3GPBA 2ILTA 3R3WA 3BOSA 2EKLA 3D4PA 5ETJA 3N07A 2RHWA 4HB0A 3OLXA 2VYQA 1ANKA 2ZSEA 1UAGA 4B33A 1N2CA 1SCUB 4JH0A 1AKNA 1DEKA 3H5OA 2OFXA 5M5BA 4LFAB 1P9WA 1FDRA 2FOLA 3HKBB 3UOAB 3WQQA 4D8XA 1T1RA 3ZI0A 1U1CA 2FFBA 1TW2A 2VHTA 4LJ4A 1IEWA 4UUAA 1ST3A 3IAM1 4H0CA 2QMEA 4EW2A 3DVQX 4IGAA 3U81A 2B36A 4HF7A 3D3JA 2H1OA 3ESAA 3IV7A 3IT2A 3V1NA 2A4KA 3MWEA 5C7LO 3OQIA 3SC2A 4B5KA 1L5VA 4G26A 4J16A 5IT0A 4NOKA 1RAFA 1GUFA 3CXUA 3RS7A 1ZZEA 2CZCA 5DP2A 2JGRA 5HF6A 2FF7A 5JECA 3AG6A 2ZCVA 1SBNE 3HCPA 4ZTBA 3GUVA 3G7UA 2NT4A 4QREA 1LPBB 2PRIA 1OXKB 3LZ6A 3NVDA 4JOBA 1TE2A 3SHOA 3DZJA 5CXSA 3QEJA 1GEEA 2E85A 4B7ZA 6REQB 2SKDA 3FWKA 4R9RA 4WY5A 2QJFA 3KIPA 5D8DA 3RYHA 4C6TB 2G4VA 5JIBA 2BKAA 2XYPA 2Y05A 3NVMB 4KRGA 3UFXA 4FGLA 2K7FA 1NBAA 4IGIA 4UNIA 1T1EA 3G5UA 3WJ1A 3EVGA 3KK0A 5CVUA 5E8RA 3AC0A 2KS6A 3RVLA 1BOOA 1JLKA 4AKTA 1Z6ZA 3UAOA 1GU0A 1QIDA 3OH8A 4C2UA 4BE4A 2O0HA 4WCFC 1SU4A 3HSYA 1VL5A 3NJ8A 2PQ0A 1D8TA 4AQ7A 1S3SA 2GXQA 5CD1A 2RHTA 5JY1A 2BFAA 2BDTA 3LX4A 3PQFA 4B45A 3FOEC 1XGKA 3PYLA 1ZESA 3GZNB 1C41A 4GOLD 5EHNA 2GM5A 5JH7A 3DYVA 4PIPA 5ALOA 4QVIA 3DH0A 1ZRHA 4MPJA 4TMFA 5J9FA 1WAMA 4YJ3F 3SDSA 3ZXUB 2Q5JA 1GFZA 4Z2YA 1P39A 1PHRA 1GKLA 3ZLTA 4BO1A 1PKXA 1UC5B 5CX1B 1NBWB 4FVTA 2J6HA 3CKKA 1ZH4A 1ESZA 2CT8A 4I6JA 2HN9A 4P4SA 3RS9A 5JC1A 2A78A 3U9LA 4M0UA 1HNWB 4WMLA 4Q3EA 1KJ9A 4TUYA 4YCDA 2NYAA 4X8LA 1K75A 1RQNA 3EBPA 5CT9A 3LIIA 1OAAA 3OT1B 1D09A 4GZ6A 4E94A 3A9CA 4B3TB 1XCLA 5CT5A 3OZRA 1Z47A 2OO5C 1UDWA 2V6GA 2Z6VA 4ZK6A 2KX7A 3F9CA 3WL4A 4X3CA 5CIYA 4M99A 3TOZA 3V5NA 2ZUCA 2W6ZA 4EKYA 2K5UA 1H6BA 2OECA 1A5ZA 4I8DA 2HMAA 5DEIA 3FNRA 2PT9A 2C2WA 1G2IA 3B9QA 3CZ9A 1XRQA 3EIWA 2ANBA 3ENWA 4BECA 1LC0A 3OUUA 1Q14A 2C97A 1Z37A 1B8NA 3LCJA 2ACVA 4GKVA 3NHKA 3UG6A 1BMFA 3QE2A 1ISPA 4KK4A 3U6KA 4LY9A 3KQNA 4MR8B 2Q29A 1F4LA 1H0SA 3P9XA 5BVHB 1Y5MA 1DMRA 4MCAA 1JLLB 2JNWA 4A2QA 1FYXA 3DVAB 1G6KA 1P3Y1 2C5GA 1INLA 2FOIA 3SSNA 3ZV3A 1B42A 3SXUB 4DMHA 2M1ZA 3UK7A 1N5LA 1R50A 4M89A 4EH1A 2CJWA 2QG9A 3D3WA 3ZW9A 1WPRA 3L0PA 2JCBA 2Y92A 2Y66A 3SS8A 4BQOA 1VYTA 1ORIA 4N5NA 1T0JB 3KQSA 4ILKA 2C9YA 2KYRA 1G8FA 1SNYA 3AESA 4JELA 4R83A 5T5QA 4BP1A 1EG2A 4IIDA 1KNQA 4Z4CA 3TE7A 1IBCA 1KJNA 3HCDA 3MQ4A 2FQYA 1KFCB 1Q0HA 3HBFA 3HMKA 1EUDB 3K9FC 3IUNA 1PYOA 2E4XA 2XAUA 3A4TA 3K1AA 3NHPA 4J1TA 2WE8A 3ELBA 1X1QA 3EEBA 4MUHA 3O8OB 4BKOA 4WXHA 3KB6A 4R7GA 1QHYA 1PV1A 3G5TA 4KPFC 1X7WA 3IDAA 4GFDA 3TRJA 1YQGA 5BR7A 1K7EB 1ZGAA 3WHIA 2BN4A 3K70D 1L5GB 1SD2A 3L0CA 1AQIA 4N82A 4F9TA 3DEKA 1EVQA 3AMVA 3F74A 2PU5A 3QE4A 4HXGA 2AUMA 4ACBA 1MT0A 4RKYA 3GNQA 3T4XA 1F2TA 2YQZA 3LDGA 4MRMA 1RYEA 2Z2ZA 4YPOA 3H9QA 3ILYA 3P9IA 4LNUA 1JAIA 4J0FA 4NULA 5DE3A 1XPRA 4OHBA 3CKLA 1D9ZA 3LV8A 1EDBA 3HXLA 3H83A 2Q28A 5B30A 1D6NA 2IYUA 1N2HA 4F3TA 4EPVA 1ZN2A 3L1KA 4E32A 3OD5A 4BASA <