1SRQA

Crystal structure of the rap1gap catalytic domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
330
Chain Sequence
KVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase-activating protein 1
publication title The GTPase activating protein Rap1GAP uses a catalytic asparagine
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 330
sequence length 336
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02145 Rap_GAP Rap/ran-GAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1srqA02
3BRWA 1SRQA
chains in the Genus database with same CATH superfamily
1G9XA 2EHDA 5EIOA 1N2JA 3OO0A 5B1EA 2IBSA 3IDSA 2IVFA 2IUTA 3DZFA 2VRCA 1IEVA 1Q1EA 3ETCA 2E1PA 4FLFA 2LDBA 2OP0A 3BWMA 2BELA 2REBA 3HABA 1LH0A 1YIDA 3LXXA 4QBIA 2XITA 4L3VA 1T1SA 2VBCA 1N5IA 4ISBA 2HNKA 1DAOA 4B3JA 3MJSA 5FQOA 2FPPA 1YB1A 3W2GA 4C0LA 4UDOA 3VPHA 3PEUA 2IGBA 4TL9A 621PA 2GXSA 3K3PA 4ZDKA 3OKAA 1Z16A 1UJNA 3N8KA 3OZGA 3DE0X 4HB4A 4YMTA 2ZBPA 3MGCA 1K9SA 5AVWA 2IV2X 3GLSA 1MKYA 4A1FA 1KFBB 5B53A 1M34B 2JGLA 4MP8A 4CMBA 5EINA 2HSEA 1ZYUA 3K1YA 4I36A 2XAUA 1XRMA 4WHMA 2J0QA 3HNOA 3N6VA 4LYEA 2J0UA 1Z75A 2UZ3A 3AKEA 3F71A 3C74A 3GRCA 4L8YA 1X8XA 1G59A 1HRDA 4PZYA 2HNAA 3AESA 5KNDH 3STHA 2FSPA 2F1JA 5KTMA 3KAJA 4CR7A 2DPLA 5BWOA 4H1WA 1ULHA 4IGIA 4QFDA 3PHJA 4PO1A 2IXGA 2JGKA 4Q3CA 3CNBA 3GFPA 1Q6YA 5DTJA 1NXSA 3U3MA 4A8PA 2PO5A 4WNAB 1AKMA 1U3UA 3H5LA 4CKBA 3CLSC 1M1UA 3G8BA 3GQBA 4GGMX 3SLRA 4YMGA 2HA5A 3JAMA 1LF5A 2H5IA 1DB3A 3L79A 1T8WA 5ETJA 2JKVA 1YHYA 1LY1A 3CE9A 3W9SA 3K70B 1U3GA 2QZ4A 1M67A 1P2UA 3X1DA 1XZNA 3GCZA 4CFYA 2GNAA 2G5CA 3D6UA 3OJXA 2A0XA 3OZTA 4MDHA 1ZH4A 4G2TA 3GEMA 1F2UB 5MN6A 4WXYB 3ADPA 2EKQA 5FT9A 3T3MB 2BFMA 2QM0A 2TECE 1OYVA 3N8HA 4QNRA 3ZLBA 4KPUB 1P1FA 1HXHA 2R8YA 2WI8A 5JDCC 3U9SA 4RY9A 1UZMA 4ESVA 2Y77A 4ZZIA 2BSXA 3OEEA 3PLNA 4BV2A 1EQUA 1YK0A 2ZDQA 4EO9A 3NJ4A 3UFXA 1J97A 2FU5C 2BHNA 2FP4B 4N6NA 1VRCA 2PCLA 3BICA 4CQJA 5K0ZA 4GLJA 1N25A 1NJ2A 1SCIA 1UOEA 1V37A 1VIMA 1NBIA 2GPTA 4PCAA 4HXGA 4D5GA 4YV1A 4J0GA 4LZZA 1N77A 2Y1EA 4DV5B 1RPJA 1VHDA 1NXWA 1I7PA 4L9AA 4U0KA 1GKUB 1QYDA 4WN9B 5CHEA 5JRDS 4GUDA 1ZR4A 3ONEA 1DINA 2PYDA 3CH7A 1AV7A 1W0JD 3U60B 2QYSA 1QSGA 1RQLA 1JIIA 2AMJA 2PPVA 4QWWA 1PUXA 3R44A 4HNRA 4ZT2A 1JQKA 3VHXB 4N76A 4URYR 3DJFA 5HILA 3AVQA 5GGXA 4UDXX 4EYQA 2ZTVA 1WEKA 3GGGA 2E82A 1Y7IA 2Z9BA 4BFZA 4BTLA 2W4MA 5AUQA 3OHPA 2XGJA 5MHTA 3PNOA 2VPXA 7ADHA 5LBTA 2DC1A 3QMVA 1GZHB 1OX6A 3LCMA 3PYMA 3A28A 2EYQA 3SBDA 4PPYA 2ZIVB 4QUBA 1ZN2A 1R3DA 3NIDB 3PSHA 2OQVA 4OMCA 4CT4B 4E30A 4RK5A 2I67A 3QOXA 2MJLA 2VDUE 1KYQA 4YH1A 2QTVA 4RA9B 2XA1A 3DAPA 4BO4A 1TF7A 2ZIAA 1VECA 2FR8C 3GR6A 3WLNA 3UIEA 1FLVA 1SK8A 1UDCA 2FSVA 5JCZA 3ZLUA 1E3LA 4U2FA 5ABPA 2H1FA 1Z29A 3TLZA 1MRSA 4CLDA 3UANA 1R0SA 2O1XA 2V5VA 3V33A 3ER9A 3L8EA 2PMBA 3LQKA 4NCIA 4QJ4A 2PO7A 1IN8A 2DH6A 3UKJA 4Y6OA 1EFPA 3NW9A 5EMHA 2RGXA 4WASA 1A0OA 3PLRA 4E94A 3UHFA 3DD1A 1CG6A 2C8KA 2JVIA 6REQB 3KOXA 4P98A 4U7WA 5JVDB 2JIQA 2J67A 1L9KA 4IDPA 3LBFA 3PXGA 2RBGA 2ZAGA 2YXBA 3L41A 3R3VA 2I6QA 4NFYA 1PG2A 4WBNB 1IEQA 4IPTA 1YZFA 5FWYB 2EWWA 4K9SA 4MPPA 5JANA 4B3GA 3K5PA 2YWJA 2Q6IA 3QUSA 2JFUA 1G2PA 5K0BA 4RH3A 3WRXC 4NBRA 1H93A 2NQTA 4HWTA 2BFWA 4HNGA 4FR0A 1U2EA 5K03A 3KJQA 3CBQA 1F2DA 1UJ5A 4NRDA 1LFDB 3PUYA 2IDZA 3PC7A 3MD9A 1MRZA 1L5YA 2OV3A 4IFBA 4MI9A 4OATA 3TLGB 3AGPA 4CKCB 1LB1B 5EMMA 3THYB 2G83A 1ATIA 1A5ZA 1LSUA 3V1YA 2KBEA 1U81A 1QRTA 5A4DA 4RPLA 2FETA 3LGXA 2P9GA 1FTNA 1VPLA 4JBLA 4JZYA 4CMHA 2N9UA 4MITA 1LGYA 1U0JA 1NN0A 5F4ZA 1ZHHA 2W6PA 3X2EA 2C7QA 3TOVA 2IUUA 2MSEB 2C9BA 4LV6A 4AZ3B 2X4LA 4ZI3A 1IAVA 3BTUA 3SICE 1T9HA 4DARA 1E5XA 4OBEA 5TEWA 2ARKA 3ICWA 4NBLA 3UYLA 5DOZA 1I2ZA 2PZGA 5FEUA 5TQ0A 1NZDA 4JB8A 4NOJA 3NHRA 3W6PA 1G4UR 1XCMA 2C5AA 4R2HA 5CU7A 5EA2A 4FI3C 5ECYA 3X1YA 3DDCA 3FYCA 1UUFA 1MC8A 4DC9A 1HT1E 2D2XA 5TB5A 2XAAA 3U61B 1ADBA 4X64B 1HYHA 2R44A 1MOZA 4GI1A 3STUA 3VR0A 4B6RA 4CTMA 2NAPA 2ZETA 1GSAA 3DV2A 4I14A 4X41A 4Y0NA 4GPEA 1RMTA 2OBBA 5F5NA 3T5PA 4P0QB 2Q0HA 1SA0B 3K72B 2VOJA 3HKBA 3OQ1A 2NZVG 5GVRA 3W3AD 2J3HA 4JOCA 4I08A 1P77A 1XZPA 2EOAA 3QMWA 2QUAA 2W6CX 1RWXA 2WDPA 4QAJA 3TW8B 2ODEA 4C7VA 1VFNA 1EP9A 4K05A 1TZJA 3EQ9A 1QAMA 1QX3A 4AJHA 2V9PA 2PE5A 4ML3A 4UJ3A 4K88A 2Q0QA 4TWIA 1TMKA 2D1TA 4PC2A 5U9CA 1EQAA 1B3BA 3IP7A 2XIJA 1N2IA 3FMIA 4LG1A 2AJCA 3RG2A 1RYDA 1T9GR 1WF3A 2AFRA 1CNMA 1L7VC 1RWNA 3IMKA 4IV8A 4IOJA 2R751 1EP1B 3QFFA 3W5UA 5E38A 2E4YA 3BE5A 3RS7A 5A04A 1M6VA 2WD7B 3W8NA 3A6FA 5FPSA 5I6DA 3CVWA 2C3MA 4WNIA 2G9UA 5CXUA 2W6MA 1Z7YA 3U19A 1IHYA 2I9KA 2P75A 2RHMA 1LTKA 1S3SA 1GSOA 2A92A 2XEDA 3ZGOA 4X62B 1P1BA 1R4MA 1E3JA 3LI2A 1RDFA 4O1MA 1OH5A 3RU7A 4HFRA 2XBUA 4J0CA 4LWZA 4EA9A 2JI9A 3M6IA 3QFHA 3P5SA 2QT0A 1NMYA 1E20A 3LLCA 1U8CB 1NJ6A 4INJA 3ZCXA 2H2DA 2Z1DA 4DMKA 2BOVA 4RF3A 1EESA 3WGJA 1W52X 2GVNA 5I9BA 4G65A 2IZ6A 3LVQE 3QYJA 1QYCA 3CV3A 4PSAA 4A2PA 1UL1X 3I6MA 1LQTA 3KPVA 4G8CA 2QIPA 2HPHA 2BSQA 1RJ9B 3LVFO 1DIGA 4UBMA 5A5FA 1E59A 4F2HA 1II0A 1KO8A 4IFEA 3UJNA 2HF8A 3Q8WA 2QL9A 2AW3A 3K0HA 3DT9A 5GV7A 1MXHA 4B79A 1UMBB 1TXGA 1AO3A 3OT1B 1ZG3A 1U98A 1OFUA 3A26A 4DLPA 4HLUA 3SZLA 2DT8A 4EUHA 4H1HA 3OQOA 2P68A 2W9XA 4FUQA 3ZW9A 1O0SA 1V5IA 2O1WA 3MJFA 4GT1A 4YNBA 4Z7NB 3HBMA 5CLHA 4ZMRA 1GGKA 2X23A 3INYA 1I7DA 4NATA 1ORIA 1PP4A 2G9VA 4PINA 1NPDA 1C8BA 3WYAA 1AE1A 1H0HA 1XSEA 2J07A 4YP7A 3TKAA 1RQNA 4C7KA 3QPAA 5F1YA 1EFUA 1MO6A 3CF0A 2OO5A 3GA5A 3PKIA 4LHZA 4R1PA 6CHYA 2EIXA 1MEOA 1C2TA 3ZKWA 2Q2VA 4OXIA 3FZNA 4P0PB 4HEHA 3EGDA 5IVPA 1KU0A 2GMWA 5ALDA 2FWNA 2JIPA 5C34B 3RRBA 5IXSA 4WACA 2WHRA 2RGNC 4LDAA 3TS1A 2GBIA 3ZHRA 4C0HA 2C04A 3AR6A 1JNYA 4Y6LA 3A9SA 1V11A 1EFRA 5H02A 2JATA 3QE9Y 1C0EA 3TLMA 1FX0B 1GFSA 2P1DA 4F3KA 1QRSA 3AVOA 2CVZA 4DMRA 1MX9A 4CM8B 1QKKA 3AIIA 1PNRA 1EGVB 4PNEA 1G2QA 4C20A 5IVHA 4B3IA 4D96A 4U00A 1XF9A 4LZNA 2HC9A 2OGUA 2GOYA 5AP9A 1ZQ1A 5DDIP 1I30A 1PDWA 1W5SA 2QAIA 3K2IA 3U3KA 4L72A 2PH5A 2W6NA 2CB0A 4WAUA 5LXTF 4KOAA 4DCMA 2LD4A 3FWKA 2B4KA 1Z6AA 4IXNA 1M9NA 1NIJA 2J3JA 1FJ2A 4ARUA 3SHFA 2CLMB 3OE7D 4Q6BA 3K20A 1B16A 2GCOB 2WEKA 5ALNA 4RESA 1C4XA 1KOGA 1H42A 2X9LA 1JWLA 4ODIA 4S05A 1AQLA 1TQHA 1GWNA 1G7TA 3LKDA 4PO9A 4LNUA 1PRYA 4W7SA 2Q5EA 4QBTA 2NU9B 3SR4A 3V8PA 3H9QA 3UJBA 4EFMA 4D25A 2EERA 2YOGA 4ZYWA 3G49A 3DZHA 1Z5PA 1Y1QA 1M34E 1QRRA 3PGJA 4UHEA 5HJEA 1CX9B 3TVDA 1Y5NA 3VRHA 3TZQA 4L22A 4F4FA 4ADSG 4YMLA 3RAFC 4NENB 1TCVA 2AHOA 2OZEA 3QEJA 5I7UA 4QU5A 5EKXA 3OX3A 1SWWA 1AA9A 5CHYA 4KITB 3Q9NA 1TFUA 2FOXA 1D2HA 4R5MA 2WU8A 3K0EA 2V0CA 5DU2A 1G8PA 2NM0A 2ZREA 3RBXA 2AF3C 4EPRA 5JAIA 4M9CA 1IOZA 1IHPA 4O2AF 4LZOA 3RKRA 1KDPA 3IPXA 3SC2A 4RNDB 4XGIA 4M7WA 1NKSA 1B23P 2VWPA 1YXMA 1JYFA 2BP7B 3EG5A 3QW4B 4N5DA 1I8TA 2Q50A 3RT1A 4M98A 1ODFA 5EOVA 1FUUA 4P81A 3QX8A 4BNVA 5BN5A 5A4FS 1CRLA 3BIWA 3GEDA 3FGOA 3UK7A 5ELLA 1IEXA 2V9ZA 3ICOA 3NEJA 5CK4A 4YP0A 1STOA 4PX5A 4UXHA 1G41A 4Q1AA 5DISB 4ZJPA 4O63O 1OFGA 2XR1A 4HKTA 3M4YA 4G5XA 4DNFA 5HQJA 3I2FA 1NY6A 1JA0A 1T5HX 2QL5A 2ZM6B 5BT8A 1FRZA 1YS1X 4D9HA 4IIDA 3BB3A 1PX0A 3D1JA 1SKUA 2XSZD 3L4BC 4Q1VA 4ENPA 4B2IA 5K6TA 3BMQA 4CF6A 1MAAA 5KC9A 3V4ZA 3GMSA 4IUYA 4B4KA 3ABSB 4B73A 1F7UA 1O4VA 5AMXA 1GQQA 5EPUA 1EWQA 3HU1A 2GSDA 1XLWA 4G5YA 3RJ5A 4S04A 1E3SA 3LC1O 4KE9A 1UT5A 1UADA 2VQ6A 3IJPA 4O2RA 2O23A 3BMOB 4LY3A 3U9TA 4EAAA 2HF2A 1Z2OX 3DAGA 4XWKA 5BSTA 2YBEA 5EVCA 5ALJA 4G1BA 2QTTA 1ZM7A 3DEJA 5CG2A 5JCXA 1J2RA 3RE1A 4JLBA 3C14C 4J16C 1LS1A 3IUBA 2BCGY 4TV9A 3T35A 4JAVC 3RC2A 2QTLA 1Z2PX 1JEAA 3NKFA 2H1VA 1OBVA 121PA 2XHZA 3O94A 3U4QA 1XT6A 4NBWA 5FOUA 5IH3A 1ISJA 1ZOPA 5BQ5A 2QTRA 2L19A 3BXZA 3AHDA 1L5KA 3THRA 4FJ1A 3WZMA 4NZNA 3O8OB 3KYDA 5E95A 4R01A 4YCBA 1M7BA 1NQWA 4TSKA 4DWWA 3ZD7A 1SGWA 3DOEA 3AWDA 4UEQA 1LXCA 3UAVA 3FDZA 4YCAA 3N75A 5LB4A 3EBPA 1LPBB 1IG0A 2VT6A 4YGXB 4OHMA 5MN4A 1H1LB 5F5LA 1U0OC 4BZWA 3I5YA 4KVZA 4FIZA 3ZV6A 4PZCA 3G85A 2I6GA 3CZ9A 3AEKA 1IM8A 3LCJA 4GLOA 4MX8A 3SSAA 4DGSA 1IE3A 1CF4A 1KZ7B 4TS1A 1XO1A 5D3ZA 2AWOA 3HYLA 1NVXQ 2ZI5A 3IPYA 1SCDA 4MZDA 4C5AA 4EPYA 2EJVA 1EFVB 2QL6A 3DPIA 3ILXA 2QY6A 4N5IX 4IW3B 3WGKA 1GRRA 5C2JB 5K0LA 3URMA 5DTQA 1EDOA 5IVDA 4WJLA 3DBRB 4M1MA 2GTHA 4L73A 1IUKA 3WRYA 4DLRA 3EG9B 3HDGA 3O31A 4QDJA 3RC7A 3D8TA 4BRWA 1F4PA 1J8VA 4P92A 2VPPA 2PSDA 5GJVC 1A2QA 2WJ6A 3DG9A 1WIWA 3GROA 5GINE 3NTUA 2DYKA 2UU9B 4V3CA 4LSWA 4HFMA 3PRYA 3CVJA 2X9GA 4Q7EA 2P4QA 3G0DA 4MRSA 3R41A 4PYOA 1QZXA 1I01A 2DWUA 1B0UA 3HZZA 2OWDA 5HF9A 1I4TD 1O8CA 3U48A 2PMFA 3M6LA 1E2QA 2JK1A 1U9ZA 4I5FA 4DTCA 4QQNA 3MINA 1R0YA 3D8NA 2EXXA 3WJAA 4DIBA 1KKMA 2X9NA 1G9SA 2GM9A 4ZQGA 1TEXA 2AUNA 2F67A 4RD0A 1YC5A 1CHNA 1NVDA 4YCNA 2RCYA 3CF4G 1NPTO 4UZEA 2ZPTX 1JLLA 1E5DA 1IEWA 3KVYA 6ADHA 3JVEA 3LY9A 2CEAA 4QOEA 3D1VA 1SBTA 2BUAA 4TKUB 1LRJA 4F72A 2ZUTA 2FN7A 4YRFA 2QYHA 5KYTA 1NVVR 2OO3A 1S3IA 4W9MC 3DOCA 4G9BA 3BX1A 4Q82A 5M5BA 3T54A 4NPCA 2HMUA 3LQ2A 5AJHA 1W2GA 5DI9A 4DLWA 2MIIA 4MP6A 1IQPA 1G19A 1WS6A 4LI3X 3ZLVA 2PUVA 1THGA 1EA5A 2J5BA 4FTWA 2QZ9A 3T9FA 1UXJA 2ZSJA 4KZPA 2IIVA 3WDMA 2V97A 2AC4A 2EL9A 2EFYA 3RFTA 4F85A 4MUAA 5IKMA 4E2YA 5DNYB 5F76A 3ZNPA 3G7SA 2AG0A 3QA9A 2FXVA 1LPOA 4F4DA 4MJLA 2WVAA 1GUYA 1D2RA 5JEEA 1GTZA 2HXGA 2YHIA 1VPEA 5A1JA 2IEYA 2BI8A 1JVBA 1ZBDA 3ELDA 1Y8CA 3QUTA 2QS9A 2O4UX 3PXDA 4HSEA 5DTMA 4RKEA 5EYPA 3DQPA 5HHTA 3PI6A 4KUGA 4C9BA 4LJ8A 3F6CA 3HTXA 1T4DA 1S8FA 3DKIA 4B6OA 1M2GA 1NTOA 1D9ZA 4GHWA 3VU9B 4RMIA 3E5NA 3ZU3A 4DANA 4PIVA 1VE1A 4BWYA 4GL4A 1TKCA 2NAFA 1U9CA 1UMCB 1XL0A 1SHLA 3ND7A 4IM7A 1TKAA 4WKBA 3V1KA 1PKEA 1MORA 1X94A 4DWVA 8ABPA 3BZBA 1AUXA 5HGJA 1T6NA 1R66A 1JPJA 1RXCA 6GPBA 1FFAA 4LE2A 3ZCTA 3ZD6A 3OLXA 2Z57A 1WSBA 3IIJA 3QVLA 4Q4JB 1FJGB 2VF4X 3REQA 4IV5A 2XNKA 4RPHA 1FQWA 4RD6A 2ZB3A 3AFGA 1UM8A 2PBRA 2RC5A 5GAJA 1VL2A 1V8DA 2IE8A 4H6WA 1D1SA 1O58A 1VE3A 4YP5A 1ADCA 5K2MA 5ALKA 4CMEC 3WB9A 1U2SA 2SKEA 1FFEA 2CHQA 3KJFA 4MUFA 4PGHA 1TQDA 4C89A 5ITZA 4Y2GA 3ST7A 1DBWA 1FVHA 1XIVA 1Z6TA 1U2TA 4KO2S 4MQ4A 2IV7A 5ALVA 2Y9PB 5H1YA 4PTYA 3BHNA 1XDGA 4FFVA 4M0PA 4BCDA 3KD3A 3T3GA 1BVHA 3PJFA 5FHQA 2QD5A 3DYVA 3KHSA 4E3WA 2XCTB 3OD1A 2AMLA 3NGMA 3PFNA 5DWQA 5E4TA 3S29A 2Q7XA 4RK1A 4G26A 1QH8A 2FUKA 5BOSB 4HRXA 2J0SA 1OZAA 3A2KA 3RK0A 5IRCD 4ZVQA 1E2UA 5IC5A 1IOVA 4B6QA 3R0QA 2GJ4A 2DUNA 4IDGA 1UK7A 3GJQA 2OV2A 4MQLA 4U39A 4E2ZA 1JEDA 1FXWF 4L15A 5DBIA 5L53A 4RABA 5LD2B 2WJ4A 3OTIA 2Z58A 1X8JA 2ZJ6A 3FTPA 1OTYA 1XLVA 4INOA 4AZWA 1FQOA 4O4HA 4CM9A 4GGPA 1W1UA 2G5PA 3U7GA 2D1RA 3EBOA 5F3DA 4JFRA 5DN6D 5KWJA 3IDQA 3BSWA 1U0RA 1NZFA 5AJUA 3M0EA 3V8MA 1MIOB 1S1CA 1JEQB 2WMYA 4CEIA 2FCRA 3N74A 3BSYA 1SXJC 5F1PA 1RJEA 4PAMA 4CYMA 2E0IA 1AKTA 2Q0XA 4GZ3A 4K26A 1DKRA 3HLTA 3KZOA 1RE0A 4LRQA 1M6EX 1ZUIA 1IFXA 1SR8A 1ZDMA 2CFTA 1Z5VA 3VR5A 2YFYA 1RYBA 3F9IA 4G67A 1SJ9A 2PTGA 5EZYB 3GW8A 4E4TA 5JWRA 3ELUA 4A2QA 4C3UA 2BGWA 2P35A 1Y5MA 2WAOA 3T4UA 4PBTA 1UMDA 2NWQA 4DDHA 4DAOA 4JLPA 3QHAA 4DCGA 3HXKA 4TWAA 3V1MA 5JDCA 3FSJX 4KB5A 1ORRA 3W9YA 4XJVA 2V7UA 1TE2A 4TRNA 2GDJA 3E03A 3K9CA 1MB4A 3ESQA 3F8TA 7REQB 4HDRB 4PR0A 3OCUA 3ICEA 3B5IA 3GJ0A 2ZUWA 4E1BA 3QWFA 2YC4C 5TMDA 4HY3A 3ANSA 2WZBA 1EGAA 3A6KA 2H11A 4MGHA 3ZR4B 4C6TB 1G5IA 2EHJA 1R8SA 1VJ0A 4MJ3A 3O6VA 1E60A 1O03A 3PL5A 4DBLC 5BWNA 4HAZA 4RVDA 4YY3B 4IQGA 4YQZA 2GFIA 4MZXA 2B6HA 2XOEA 2R8ZA 1TF2A 4HO1X 1Q12A 3NWEA 4H3HB 4ZVNA 3RS2A 3TD9A 3U4GA 5JFTA 5DGIA 4TWRA 2D3WA 3ENWA 5JD5A 1X7XB 2B61A 1BAPA 4CLOB 5HF6A 3F67A 4NZPA 3WAKA 1R4ZA 1UKBA 3RUPA 4YJ2B 3ZWQA 5A2QA 3LT1A 3HFRA 5EIBC 1QGED 3HGTA 3GGJA 1G6KA 1KPIA 4MQEA 4PSDA 4PE5B 1QDUA 2P1ZA 4Q1DA 2GHIA 2I5PO 4B82A 4EBBA 4A8JB 2J6BA 1XNJA 4TS9A 3CGWA 4HD8A 4XRRA 5KAMA 4BZXA 3GNTA 3I42A 4JJIA 1E1RD 2YFKA 4G8DA 4TL7A 3V46A 4JMLA 5KSWB 2MR5A 3ZXUB 4B71A 1L4HA 2ZYSA 3SR3A 1UF9A 2R25B 3GFOA 4FYJA 4M54A 3ND5A 4XR9A 2QENA 1EVYA 3A0RB 4ISCA 1XB2A 4DF3A 5KX5A 1C50A 4YAWA 4PGFA 4J0KA 2YVKA 4P1ZA 4H9GA 3WJ2A 1WOMA 1HL3A 1F4LA 4HX2A 1YFJA 1Q0ZA 1GSIA 1DJQA 2AXEA 3CLUC 1KOLA 3WYNA 5D5QA 2BFEA 4D1YA 4EECA 3FTEA 1T9KA 2DPXA 4HJXA 4H7DA 5LNK6 1CY0A 3IHLA 5PGMA 3JD1A 2F4VB 4EHAA 2ID9A 1T25A 4RFSA 1X70A 3IODA 4HHEA 3VMFA 4AURA 4YUZA 2CWDA 5HX7A 5JNUA 5ENDA 1PJLA 3L8HA 1JAHA 2F6RA 3LBHA 3MUNA 3U9LA 3G0BA 3ZXXA 2IS6A 1K92A 3LDAA 3LL7A 3MRSA 2L42A 2XRYA 1VJGA 2DQZA 3GAMA 4FYVA 5DGHA 3UHAA 3W1EA 5JCPA 4OVKA 4UM9D 1SC6A 4ZVUA 3NTOA 4BNIA 3LK6A 4D9FA 1UKVY 4FLMA 2ZTUA 2HBYA 4OHRA 4P80A 4P9NA 3MT0A 2HPVA 1XXHB 3ZWVA 5JNRA 1ZA2A 1UR5A 3QWAA 1Y7LA 5K4HA 4MS4B 4KI0A 4CTKA 3T7DA 2HMYB 5A6VA 1CWUA 2LWIA 1G66A 3O2NA 3AF0A 2XB2A 1ULAA 4MPJA 4EW6A 1OVGA 1I33A 1RHKA 1UFVA 2F4NA 2YFQA 2DZDA 2Z4RA 3OX2A 3PENA 4MUHA 3VKVA 1YR6A 5LQSA 3W2EA 1N6KA 1HNWB 3H5AA 2F8SA 2I6FA 2O2SA 4N6OA 1Q1AA 1MOSA 3HKCB 1FTSA 2C2YA 5TV2A 1WXFA 1NONA 3FFAA 4GKAA 4H1VA 3VNAA 3EGIA 3GA7A 3H65A 3G2LA 1UBFA 2JFXA 4XYLA 2AEEA 3NAGA 2JKZA 3DOHA 4I4CA 1IONA 2JARA 3VSEA 1V4BA 2M2IA 1U1CA 3WLQA 3TLEA 5I7EA 3VSDA 1XTPA 3E3NA 3RYCB 1P6XA 3PIRA 1UH5A 2FMXA 2VR1A 3EEYA 1OLXA 2DWCA 3NATA 4JMPA 4YCSA 2A5LA 1H4QA 1E1CB 3DM9B 3UAYA 1GN8A 4KX3A 4F71A 1GVHA 2V7EA 3VHRA 4KN6A 4G5QA 1NOKA 1MQ8B 1Z34A 4EW2A 5B1YA 1RQPA 1XRQA 1LDNA 1QK5A 2BY4A 3SY8A 3SPXA 3NCTA 1BOOA 1F2VA 3JYNA 1ILWA 2GWRA 2OCPA 3AMVA 5HSGA 2AI2A 3ONVA 3TUJC 3OX4A 2YOFA 3CRQA 4RELA 1P4HA 1H94A 1QHHA 2E87A 4EY7A 3J80A 3FF4A 3EJ6A 1TM7E 1A2KC 4GOND 2QDXA 3BIJA 3GELA 2VWGA 3E9DA 4Q4HB 4Y9RA 3SYNA 4LF9B 1GPYA 4PLYA 2VQDA 4IHJF 3E0XA 2I2CA 3WGQA 5IBQA 1N2HA 2ZRMA 4RLQA 1RXUA 3FKQA 3ZIAD 4EHIA 5JSHA 2H06A 2Z95A 4LDNA 1E2KA 2RHJA 2SBTA 3QYAA 4M55A 1O97C 4C6SA 4KO1S 4W8OA 1DOAA 5ICCA 4E5DA 5ALSA 4I8DA 4R41A 5A7FA 2X8AA 1WXDA 4HI0E 4HGOA 2GPYA 2UVPB 5FAXA 3VR6D 1VLMA 3KZMA 1RP7A 4OI4A 4E5SA 5HKBA 2JDID 2PYIA 2W6ZA 1JNXX 2WJYA 4PZLA 5HEKA 2GJ8A 5C52B 2ZJ3A 3AZQA 4E03A 1UEIA 4E11A 4LV8B 3EYAA 4IJVA 5JW6A 3IIKA 4Y6PA 4QNMA 4ZQBA 3LH5A 1MQ9A 1YUNA 1TW2A 1YMUA 2AW5A 4MW1A 3S4YA 1QHYA 3FB1A 5LBUA 3D6MA 3EEBA 4ND4A 1ARZA 1VHLA 4IL5A 2O1EA 1P33A 3LOUA 4KXWA 4LQDA 4R2LA 3UC9A 5B57C 2OFXA 1PX2A 2H54A 4JK3A 1EBUA 2HDHA 4K6KA 4W5HA 4YYEA 3U5ZB 3JVIA 3R1IA 3RU9A 3E3OA 4QA9A 4ZI7B 1GGFA 2HK7A 5KNBA 3A3OA 2W0SA 1D2EA 5CLIA 2VEOA 2HH9A 5LP6F 2B4TO 2IYRA 5IM4F 4IUDS 1IK6A 2X13A 1VGQA 2GHQA 3DQQA 4BVBA 4B34A 3GPCA 1BWSA 2QLFA 4IDOA 4D6YA 1YRLA 3KL2A 1T35A 4OJNA 5D8DA 4YXFA 5KTPA 5IJ9A 1C0LA 1B1AA 2QU8A 4CJXA 1KH3A 2V7PA 1QO9A 4KBFA 2EFCB 3Q6IA 5LQDA 2A0UA 2DPGA 3H9GA 1OJ7A 3OZBA 1TM2A 1Y63A 2VWQA 2WJHA 3PEYA 1P3JA 4HDMB 2C9MA 4CF7A 2V4UA 4FHFA 3ONWA 4DLAA 3L84A 1ENZA 2OZKA 1EKXA 1GCAA 5JCJA 3PNKA 3JWJA 3SMVA 3JD2A 3L6BA 4ZI2A 4EJSB 2Z6AA 1LJUA 3GPIA 4F60A 2WWGA 3LJKA 3BB4A 3JPYA 3LG2A 4LMRA 4NMWA 1Q7CA 3MTGA 3TRJA 5A4AA 1FFHA 2D1YA 3UT5B 3NC4A 1NE2A 2MTBA 4ZD6A 1C3EA 5FF9A 2ZVDA 3N07A 3K70D 1G55A 1VA5A 1JIQA 2DECA 2CWWA 5EKTA 3M81A 1IZZA 3FSGA 2QG9A 4I6JA 1BFUA 2R7KA 4XVCA 3VYTB 5BW8A 5EJ6A 4OYLA 1EGHA 1EB8A 1SQGA 3A1EA 3CUTA 5ARDA 2HA3A 4CKWB 1R0LA 3HR4A 5C7OO 1C1DB 4LISA 5BNWA 4YAUA 3A11A 2ZWAA 1SUWA 1VCHA 4BNTA 2Y4OA 1YASA 3Q5EA 1D0VA 2JCVA 4QJ5A 5AJTA 1W0KA 4LOJA 2JLRA 3HYNA 2W8ZA 3I2GA 2RARA 4OHOA 4RTLA 5T7BA 1PR5A 1Q6ZA 4BPRA 4DCVA 2MYNA 4PG7A 5KQSA 4JIMA 5KNCA 3WWOA 4BO8A 3H6GA 2GM5A 3D6AA 3ELYA 3LY5A 3N5CA 4KL8S 2DHCA 5F2KA 4D8YA 1THZA 2ATEA 2XRMA 2NTJA 3C8UA 3PDWA 4O6VA 2MMCA 3RUIA 1WQ1R 1EX9A 1I3NA 4FDMA 1A88A 3CUVA 5FB3A 3P2JA 2RAUA 4DGQA 1VKHA 1TIBA 3VPXA 1OOEA 1ZD9A 3IC5A 3EUWA 1NW4A 2ZJFA 3VNQA 1JIKA 2ZUSA 3FWHA 2HA4A 3ZK8A 3NHMA 3PHBE 3VTAA 5CFLA 3Q3CA 2X4GA 4YXWA 1ECCA 4H3VA 4JT9A 2Q6TA 4XWYA 2Q7DA 4RS3A 4DC1A 2OXCA 4DIDA 1ECPA 3MJDA 2C29D 4EPTA 5JLJA 2HY7A 2VKQA 4ETMA 5FNZA 4ZDWA 3M9WA 4KH0A 3VUFA 2IP2A 3NBQA 1UXIA 1ZMBA 4M1SA 5HP4A 4E4RA 1KK0A 1EFCA 4IXDA 4EHFA 1T6ZA 4RS4A 3U1BA 3W4IA 2QE7A 1GPJA 2FWMX 5C1OA 1CRZA 1XAIA 1QH1B 4DV0B 2CJWA 3QM1A 4IOKA 3S2YA 3BA1A 1ZMTA 3I64A 1N2XA 5I9NA 4YASA 4KWEA 1LBQA 1PBNA 4FC7A 5I7HA 4FM9A 1J7KA 1N5OX 1UPBA 3IAXA 4RTKA 4RMNA 1EPUA 4AJ1A 1JAIA 3R6TA 4XTRA 1DP4A 5C1PA 5BYJA 1JEYA 2LZ0A 4BO2A 3PLAE 4TWZA 1OVMA 3ETHA 3NM6B 1BSVA 4ZANA 4CEJA 3ASYA 2E37A 1YI0A 4P7JA 3PF8A 4EGQA 2PT5A 1CUXA 2H85A 3A8TA 3KPJA 4WFJA 3UPTA 2BMAA 4BKPA 3HADA 4AM8A 1MB3A 3OWXA 1NN5A 1L5MA 1SBCA 1W2WB 4DVGA 1TYDE 2F8TA 4FFBB 5ADVA 1DKUA 4MQFB 1LNZA 1FUIA 3D0KA 3OU6A 4BP8A 3D6NB 3IT3A 3KKQA 1H4VB 1ZRSA 3MWLA 2X0JA 1XD9A 1KWGA 2ZJZA 1WZNA 3VA7A 1CS4C 2P2DA 1NXVA 2AOTA 1XU7A 1Q3TA 5LC1A 4AJPA 2IU6A 3E9MA 1VP9A 3A1TA 5CB4B 1N32B 2NUAA 4MVJH 3LGSA 1PZGA 3CINA 1VP3A 4WY2A 3G9ZA 3OKPA 4W6QA 5KQRA 2HU2A 1LDMA 4O8ZA 2BE7A 4J16A 3IFSA 2DXIA 4HAIA 2YRWA 4K6MA 1MQSA 1JKJB 4NJMA 5FWXA 4JNKA 3VZCA 1IIBA 4UCQA 1O4WA 2G04A 5LZ5A 3VX4A 4CMIA 1AHPA 3QKUA 4PSVA 4UDYX 3FXAA 2CMKA 3ZTYA 2ZE6A 3I9V1 821PA 3W1WA 2WQZA 1Q11A 2REOA 4ZQIA 1L3IA 2WYUA 4RD1A 3VZSA 1AO0A 1UK9A 1UK8A 1PR3A 2FQWA 4MV6A 4QXMA 4KIFA 3I5XA 1M3SA 1QU3A 3CA8A 3D8BA 2PY6A 3AUFA 4BIMA 2PBZA 2YINC 3KWLA 4MW6A 2RGRA 5GM1A 5L7YA 4C14A 2D0DA 3DLTA 4BKOA 2PT6A 4DCPA 4W7HA 2BDTA 1GNQA 4Y7DA 5E1BA 3WJ1A 2C4TA 3VYRB 3Q3GE 2OILA 3TOCA 2PUBA 1RBMA 5JR3A 3NVKI 3H8SA 1HNNA 4OK5A 1ZUD1 1HFEL 4D7AA 4CKWA 5CFRA 3P2YA 2ZIXB 2V7VA 3TO5A 1CZKA 1V6SA 3GEGA 4QD3A 5B5SA 4FQ5A 1G3UA 3EPJA 1A4XA 3GNQA 3L8ZA 1D03A 4AS2A 4HXYA 3BGOS 5BVGA 2Q4TA 4WGFA 1DO0A 3P2IA 1DUSA 4KKXB 3FVVA 2FDRA 1JBEA 2IZZA 3A10A 5BMVB 2V5UA 5JZSA 1VG1A 5HUHA 2DOKA 3IELA 4ZZ2A 1K4MA 2CK3A 3HKEB 3AR5A 3JARB 2DTEA 1OCEA 4P38A 3KQLA 2PA0A 1G5HA 3HGQA 1A9ZA 5EEGA 3EA0A 3O26A 4FYMA 4PLFA 5JQGF 1S2LA 3BD8A 5M34A 3WP0A 2BT4A 2QTCA 3ANYB 3LA8A 3BD6A 1HE3A 3EPPA 3AY7A 4GWKA 4EQZA 1AV6A 4OLAA 3VI4B 2CUNA 1YR3A 1II8B 4C0JA 4BE7B 3HXLA 1XALA 3QPWA 3O1JC 4I9GA 4O2BA 1M0TA 1YS2X 1ADFA 3EQ7A 2OXFA 3L6DA 2KMLA 3NFYA 1J22A 5D3MB 1ILEA 2EL7A 4LXQA 2BGGA 1XXHE 2CC2A 2OLKA 3MNFA 2CZGA 2IRWA 5A05A 1LVGA 4XIIA 3HDQA 1HR0B 1VZ2A 3RYTC 1KO5A 3N2KA 4CM4A 1DKPA 3LNTA 1KRWA 4NONA 1ZSVA 4QXRA 4OXQA 4NCHA 1XTQA 1PG5A 1LW6E 1AHHA 4MGIR 3U5TA 3CWQA 3I3SR 1WB9A 1ESZA 4D9EA 1U0FA 1YRHA 4CM3A 1FE8A 2TMKA 5L40A 1P1JA 4OD0A 1FU7A 1NUTA 4Z1MD 1NQTA 2PDAA 1W25A 2FPKA 2ZWVA 4HWSA 5FULA 1CEEA 2QD2A 5AW6A 2IA5A 4KO8A 3C6XA 3GT4A 4KQ9A 5HMLA 3WNZA 5K8TA 3OFNA 3I04A 3IQGX 4TSFD 1XLTC 2PKWA 3W5VA 5B2EA 3CJQA 4BAGA 4WGGA 3UT0A 5F7XA 4X1KB 5KSZA 1TEHA 2WOOA 1U2RA 4S3MA 3TNFA 1VE5A 2NO6A 1BWRA 2QVLA 2VCEA 3OVMA 4HAWA 1B14A 3F74A 4HF7A 4DXAA 4XXHA 5AVUA 2O8VA 3EZ2A 3M5DA 4D79A 4HQNA 4I50A 3ZDXB 1PR2A 4C7OB 2XA9A 4G0QA 4LHVA 2AX3A 4GOJA 3SIXA 3T3IA 3O1IC 3RHFA 3TVTA 2LRHA 4TTPA 1CR0A 2M6SA 1A8HA 4X6YA 1CYEA 3MCVA 1AXGA 1D6JA 5DEOA 1SULA 5HCUA 1QJ4A 5CCBA 1XMXA 4TXNA 1RKVA 3CZRA 2C00A 2GZMA 4L4SA 3AKDA 3KLPX 2OCKA 1Z6ZA 4LECA 1V9CA 2Y66A 1KI6A 2YIDA 3FPEA 4QOJA 3OZSA 2C96A 3SBXA 4D4MA 5JXJA 3K6JA 4OEHA 1PT8A 3A14A 2BM9A 2YWBA 2WU0A 2XODA 1H2XA 4OKNA 4R8MA 4CV2A 5BY2A 1GA6A 4OHPA 1YULA 4CMEA 1QGUB 3M4ZA 3ZU2A 1ONSA 4JQCA 3N7TA 4Q7MB 3VI3B 4MKFA 2HWYA 3FGPA 3L6UA 3WGOA 5JMPA 1L5HB 2BFFB 1XEAA 3FBTA 4HNUA 4J1SA 3AY0A 2QTHA 1W85A 5FOWA 2V98A 3E70C 3WRWA 3HCFA 1VCNA 4L28A 1SVOA 3DZGA 1Z0JA 4YDHB 3P52A 2IHJA 4OG2A 1PV1A 1KJWA 5FA5A 1DNPA 1R6XA 1ZKDA 2D7CA 1OFVA 1X7YA 2AOWA 5A3RA 1YZUA 1JQ3A 1DEOA 3ABZA 4I8IA 4B33A 1KGSA 3CLTC 4DJ5X 4KHPB 4PYNA 2IEZA 2BRUA 2P3QA 2CHGA 2VP9A 2QF7A 4YO7A 2X0FA 1SXHA 5K3EA 2XZDA 4AAYA 3ACBA 4EMBA 3H3FA 2BM1A 3W05A 1NUSA 1XYVA 2IHVA 2F3SA 2XDYA 2XLCA 3U37A 1L7XA 2RGEA 4GP9A 5TSDA 1T2UA 4FFWA 1R6AA 2VN8A 1R8JA 4OGKA 1RWOA 4BMOB 1P0PA 5B36A 3T3NA 3O82A 1JGTA 4CDGA 1YOVA 4N8SA 4NE9A 1UZAA 3FPAA 4LJ5A 4AX4A 2C5HA 2WIGA 5ILQA 1GQRA 4W1SA 3TKYA 3OLZA 1XROA 1W5FA 4C06A 1TFRA 2IYZA 1E92A 1PK9A 4GDMA 1NBMD 4N39A 1CJKC 2F17A 2XCUA 5L3SA 1H9AA 2CB9A 3E9EA 3V3TA 5IX8A 3CIFA 3PSAA 4YV0A 2JFYA 2DPMA 1A9XB 3BIXA 3LPMA 1GAQA 1YKGA 3TLKA 2SKDA 2HYIC 4MIYA 3TAUA 4JC4A 2P9TA 2FPIB 2WTNA 1MDBA 3JQ7A 1JILA 4MYDA 1KE1A 2VIIA 1WHTA 3W34A 1PHRA 1EXNA 1JSXA 3DFFA 4C0QC 1U8ZA 4EQ6A 4K1XA 2Q9AA 1A9QA 5HRUA 4M9ZA 1GUAA 2V7GA 2VHCA 4UASA 1Y9EA 1KJQA 1ACLA 1DO8A 1CZOA 1C9NA 5D7NA 3G2OA 4MTLA 1Z56C 2FSHA 4L76A 5IANA 5LZ9A 2EATA 4L6AA 1Y9DA 5AWFC 8ATCA 1DUVG 3AUXA 2PZ8A 1HLFA 3GLKA 3EZXA 4NV3A 4JP3A 3WQHA 1ZU5A 4MYHA 1EDEA 4IP0A 5CT8A 2CJFA 4K6HA 5JZMA 5J4YA 2WP0A 2IKQA 2H2FA 4YK7A 5FEMA 1ZM4A 2Y1GA 3K5IA 3QGMA 5FTWA 1A2BA 1RRVA 2HGZA 4TKZA 1YJCA 1P1RA 1W1WA 3A4IA 3GT3A 1U7UA 4QODA 1CD5A 4WZBA 2H18A 3IQEA 2OAP1 5AJWA 1U9JA 1NW5A 1HT3A 2UUOA 1BEEA 5IK2D 2QBYA 5KS2A 3KHTA 3BCHA 5J5AA 2X2OA 5AW4A 4FHCA 4FCWA 2UUAB 1E0KA 1XC7A 3F3YA 1PJTA 4HDCA 4JR0A 4P3YA 4ZOAA 5EMJA 1XDWA 3DVQX 3TNDA 1T9ZA 1ZVMA 1BMFD 4LCEA 3ZHCA 4XOIA 4MUKA 3TI9A 2BWJA 4MB2A 1K9VF 5IMBA 1F8XA 3SQDA 3BXOA 3ENZA 3IURA 2VA8A 1PYOA 3B2QA 3SF0A 1Y6GA 3EZ7A 2YVAA 3O8RA 2JJ8A 4UU7A 5LA6F 1L5GB 4MCJA 3UMVA 4EEKA 1OLUA 2HKIA 4AD8A 1U11A 5H83A 4UE3S 3VPBA 5IJ0A 1A8SA 2IUSA 1MG0A 2AQKA 5A7GA 2K2WA 1AKVA 1UPXA 1WZCA 2NVWA 2CCKA 1WB4A 2O3UA 2QRLA 5C3UA 3II6X 4V0QA 3RASA 1PFUA 4ARVA 1G0NA 4ENSA 4ZDJA 2WTBA 1U2QA 2ZRKA 2OCIA 4J4HA 3HWSA 3T0IA 4G86A 1V71A 2ZM5A 1XZDA 4Q3LA 4D6XA 3AKZA 2ZT6A 5CR9A 2JLYA 1WV0A 4FYKA 4L0DA 1SEPA 5C46F 6PFKA 1FTWA 1MQAA 3DDWA 4DCTA 1XDZA 4KFRA 4MW0A 2B2NA 4FJ2A 3EDYA 3TR0A 4UVDA 5H68A 1MRNA 3IB3A 2C4NA 1EJ6A 4MVWA 4ZT4A 4KEAA 4EI9A 3KU4A 1VKNA 1CIJA 4LQLA 1RAFA 3UV7A 4A7PA 4BGEA 1EFAA 2H4FA 2O0KA 1W5EA 3GLHA 3KYCA 4OMDA 1S3GA 5FOTA 2FMTA 4U2GA 4U7HA 1WCWA 3OC6A 1M6WA 4PV7A 4WZAB 3AG5A 5FUMA 2H7YA 3VPCA 4TOIA 2WDZA 4XJSA 3C8ZA 3DEKA 2QAGA 3EYWA 3RFFA 2AJLI 4RHUA 2PLFA 2PQ2A 5FTKA 1GR1A 3DLPX 3MCZA 2W98A 5AI6A 4U7TB 5AI0A 1SY7A 3BM5A 3HUDA 3PZRA 4H7KA 1QNLA 2FG5A 1IDN1 4MUBA 2J7KA 2YJ5A 3GUVA 5L6LB 2O8EA 4HPJB 3KLMX 5DW0A 3HBJA 2R1UA 3T52A 3MJVA 5T4BA 2I54A 3RRFA 4IBOA 1WXGA 1EM6A 1Z13A 2PJDA 3KUKA 5CYGA 2WRZA 4YROA 2FZEA 3DTYA 2AJBA 4MI6A 1AGNA 1THTA 2FEWB 1W5TA 1CR6A 1E3DA 1XD8A 3T1NA 2ZE7A 4BN0A 2IYXA 3BN3A 1IZ0A 2QJTA 3DZBA 3C41J 2WMDA 1V2HE 2P90A 2Q2NA 4H59A 4LY6A 1SM4A 1FY2A 5TF0A 1ZU4A 4UCFA 1K8QA 5JD4A 1IHUA 1WUJS 5THQA 1QO0D 3H2SA 2ACWA 2GBLA 1CDEA 4N0PA 2P2CA 1QS0B 1ORDA 5ED0A 2FUG1 3ETEA 2G9NA 5HRCA 3LTNC 2CCJA 4CCYA 2RGWA 4DCUA 3PCTA 1RU3A 3EGXA 4LOAA 4EB8A 5B3KA 2X8JB 2ECQA 3GARA 3R76A 3IOYA 2P9JA 3UMMA 2ZYWX 2F7SA 4B2PA 1CTQA 1M72A 2CNOA 1T1JA 5E4YA 1R27A 1J2JA 1UT6A 4N0DA 4UVIA 3VZRA 1LI5A 3KWFA 1GQYA 3EUAA 3HCEA 13PKA 2HDOA 4GPBA 2IGTA 1L5FA 4G0YA 4JLDA 5ALUA 4B3SB 2GAAA 1Z36A 2OK7A 1BFDA 3FW1A 2O20A 2UYYA 4LMBA 1Z0IA 4KNWA 4AG6A 3GYBA 4G56A 4R4JA 2YXNA 2LIVA 2GPJA 4K03A 4A6XA 1N8TA 2JH3A 1NQAO 1X86B 1J9GA 1VGRA 2M98A 2PFGA 4FGWA 3MGKA 4K9OA 2GD2A 4P7BA 5F64A 5E9QA 5C53B 3M3PA 1B4DA 1H6CA 2O8NA 3EY9A 3FMPB 3TECE 4XX1A 1UDAA 1O6GA 1RWMA 3LKBA 4JBXA 1EFDN 4UJ5A 4GYJA 4WKNA 1S8OA 4LBVA 4TRRA 4TVBA 1RIIA 1BJTA 4IMIB 2EFJA 4OCZA 1J1IA 4R9UC 4RVSA 3O2SB 2OAEA 2DPHA 3N9IA 4FFPA 4MO9A 4F5EA 4HWPA 4ZVKA 1FSSA 3F97A 2E5WA 3OTWA 3O0DA 1X80A 1G1MA 2EBHX 4RIFA 1IJKA 1KETA 1WVMA 1KI1A 3PGKA 1BXGA 3SJ7A 1QPGA 3QWIA 1T4CA 4RZQA 3INTA 4XB6B 3TH5A 2I71A 4WFIA 1YQDA 2HU8A 2KLHA 5DH9A 3GBSA 3CH5A 2E3JA 4QTYA 4WD3A 5SICE 4FDUA 1BXRA 3MWDA 1IG3A 5TQ2A 1QVRA 4JT4A 4Q1CA 4GD3Q 2J8ZA 4CKZA 3QEMB 4UQOA 2AV6A 3QITA 4AJEA 3D8RA 1ISIA 2FAXA 3C87A 4NHOA 1MA0A 2FLVA 1WDWB 1KTVA 2A78A 3AFHA 3VR2D 4WI1A 4D9KA 1FK8A 4ZEVA 2DE0X 4PN3A 4RANA 2IC5A 1NLUA 3RH0A 4ER5A 3HA3A 5I5EA 1X6VA 3P96A 4L9SA 3WZLA 5L3QA 3K8YA 4DMFA 1TVKA 4C0AC 3W6NA 5CDHA 5JSZB 4KBYA 1OWMA 1ODLA 5B2FA 5LQUA 4EELA 1RCFA 2JGFA 2P30A 3ZWXA 1UCFA 3OPXA 2R48A 4NP6A 1TB4A 5TR9A 3WLPA 1AUQA 1TD9A 221PA 2NO9A 5FOSA 4BQFA 4UE2A 4EY4A 5ARBA 5FPKA 1YC2A 2P65A 4EEZA 1EP2B 3FA2A 1F6BA 5FAKA 2VA9A 3C3PA 3WWCA 3HJTA 3QJYA 5CX1A 2VPTA 4GSKA 1G5FA 4GC5A 4KPYA 1TYBE 2RG7A 2C9OA 2CDRA 2XXBA 3ICVA 3ME5A 3K1JA 3L6RA 3OCVA 5IT0A 2DFPA 1KXJA 1GKLA 2E4XA 3UK6A 4HQKA 5LDHA 3ZZMA 4PZUA 2O3SA 2IF2A 3I39X 3IUNA 4GDFA 1M6YA 4MMZB 5IKXA 1CV2A 1R74A 2B99A 3HM9A 4LXUA 1KAGA 2ZI9A 3DEAA 5CYOA 1XJCA 1YE5A 1C9MA 3FRIA 1NNSA 2A86A 3H9UA 3MB5A 3Q7SA 4NR0A 5IDWA 3EWIA 4LSMA 3QVMA 3TXXA 1IY8A 1DTWB 4FOLA 1IY0A 4ZYXA 3DWGA 2WWFA 5CH3A 4W9NA 3GI1A 1AY0A 1GQFA 2GD0A 1RWQA 4AMVA 4MAFA 4KWHA 1VE6A 4MK4A 4G24A 4E51A 1KFCB 4N5MA 4EP1A 5JTUA 2R6AA 1U2PA 4MRNA 2IZ1A 2WM9B 3EFOB 3RVRA 1ZBQA 1BHQ1 4ZIRB 1EDDA 2B1RA 2X4DA 1D6MA 1L5WA 2MMGA 5EIWA 3W2IA 1S9DA 4ED9A 2P41A 2Y27A 3QX7A 1CC1S 3P0IA 1ISGA 2WFLB 4Z7OB 2XVMA 5FX2A 5FDFA 4DMCA 3K1ZA 2G9QA 2P6MA 5J3JA 3ZWCA 3ZHVA 1O08A 2Z8YM 3TXAA 1WXEA 3MT9A 3ZDQA 4ZC8A 3OWHA 4K9PA 5KI6A 4B6JA 2O7QA 3H4TA 2HRQA 3A05A 3H1PA 4JUCA 4EX6A 3QYPA 2IFTA 1GGMA 3FNRA 3IXMA 2W42A 4TMXA 1KQ3A 2DUMA 1ZGJA 2FWPA 2ZI6A 2FRDA 1QR2A 2LUOA 3D4PA 4IICA 1PJSA 1BG6A 3EOBI 3P0RA 4A6DA 5G4KB 1TLLA 2Z9CA 3EXHB 3TTYA 4KSYA 2BC9A 1JSLA 2CLSA 2PUDA 1CNEA 4G0ZA 3HCRA 4HAUA 3BB1A 2R8EA 3KSUA 5H3LA 2QXYA 2H1SA 3GGPA 2DY1A 4OA5A 5THKA 1J9ZA 1MVNA 1K8XB 3ZU6A 3AXTA 3STVA 4B0PA 4MKXA 5JNSA 4OLBA 2Q46A 1MV5A 1P5ZB 3KQUA 4N0EA 1GEGA 5D51S 1U1EA 3T9CA 1XMPA 1QYIA 4N3GA 4OK3A 1N0UA 2CNBA 1SCNE 3PE3A 1Y6JA 4KQJA 1PFWA 4NMLA 5IUKC 1IM2A 1JA9A 2XI4A 3JQGA 2HSZA 1Q5PA 1RLOA 3HFSA 4MYCA 4YRCA 4A8TA 5L7TA 4GKJB 2FWBA 3CCBA 4MLZA 1YL7A 2WJIA 3Q0IA 3N2GB 3M9XA 4O2AB 1W59A 2FX5A 1EIZA 2DBRA 2Y1CA 2BTOA 5DIZA 5DLDA 1OYYA 1Y1KE 2I80A 3RT9A 4A23A 1BGXT 3RSGA 4MV7A 1OW3B 4JGIA 2QTZA 3EFEA 1E5VA 1ZH0A 1G38A 1BCSA 4P58A 2YZGA 1Y37A 3NOQA 3LT0A 3I6ZA 1V25A 5CA1B 2HZ7A 4G1UC 5G1NA 5JO9A 1I1NA 4YT2A 3TSCA 3KAKA 2JPDA 4COOA 1A9TA 2Q2QA 3GL9A 3SVLA 4Y2RA 3Q8MA 1PWYE 3WGGA 3ANLA 3OE7A 3DDOA 5KQMA 5C9ZA 3HDHA 1U3WA 3BREA 3TMKA 4KN5A 2IYUA 721PA 4TT3D 4BFCA 1CJVC 1TC1A 4BFLA 4II7A 1BZYA 3CUWA 2JAPA 2VP6A 3P9ZA 1HDYA 5EWLA 5LR6A 5LQNA 3IKTA 1IN1A 1H69A 1CUUA 2HSWA 2ZWPA 3OE4A 4XFJA 2FW6A 2HAEA 5HOQA 4RPKA 3WGTA 5EJEA 1EUYA 5FPYA 1OU0A 3IBFA 3UXEA 4DJFC 2XMDA 4YP1A 1AKRA 4N3NA 2QVGA 4QX6A 4RHXA 1MENA 4C29A 3EPRA 1BRMA 4Y8VA 2A0KA 4EFDA 1YDHA 1B8OA 1LK7A 2NG1A 3RIMA 3RV4A 1VMEA 4PCUA 4GVLA 1ND6A 1OIWA 1XZLA 1SUBA 5B1IA 2ERCA 1H2ZA 3A36A 3ACDA 4KE7A 1RYYA 2CKMA 4WXRA 4EG6A 3EISA 4U7PB 1O6FA 3U2QA 2OB1A 4REOA 4U2CA 2JIDA 5CGQB 3KL4A 1F12A 2IU4A 1JLHA 5EQFA 1PLKA 1S2MA 3IA7A 4E09A 1IY2A 5IAAA 1NBEA 2TMDA 3HVRA 4KR6A 5CB0A 1JR3E 1KS2A 2GN6A 2VUUA 3DB1A 4CL2A 1GARA 5A5EA 1NYLA 1SURA 1US8A 4BRUA 4BMDA 1FNMA 1K4KA 5CA0F 2W83A 4ENRA 2CUTA 4Q9KA 4O4JA 3NVAA 1TKBA 2G8LA 1VKOA 3KM0A 3RYIA 4FGZA 5IUJC 3FPJA 4QBKA 3VDNB 1ZGBA 1Z6PA 5DEIA 1GGNA 2NU8B 3J81A 3CKKA 1I7QB 5TMBA 1BWQA 3K6SB 5K8JB 5KSPA 2AHRA 4OSOA 2XSZA 4W7IA 4B4WA 4EITA 2VJNA 1KMIY 1T5LA 5H7XA 4ZKEA 2A4MA 2ZJYA 3MJRA 3A3YA 1NUUA 1I2DA 3KFVA 4LIPD 4MV9A 4G1VA 2OCBA 2I6XA 3HEMA 1Z5WA 3RSCA 3T4XA 2JAWA 1R0ZA 2ZS9A 3DE5X 1D5WA 2IOYA 2WYHA 4IEFB 4B6PA 2L2QA 3L49A 5EZSA 1XD2A 4XDZA 3JATB 3U7IA 2GN2A 3A9UA 4RDIA 3V7FA 4DWJA 5TEVA 5CLJA 3CNNA 3PWTA 4GXRA 1LDBA 2Z5FA 5EE0A 5GGYA 3T0GA 5LYYA 2WJVA 3TCXB 3OIFA 3VNBA 3HSKA 4CM6A 3ESBA 5BQ3A 3USCS 1GA4A 3GFTA 5F35A 2P40A 1MW8X 2PWAA 3AO0B 3DL4A 1ZOSA 4WERA 5ELXA 1DQNA 3JQPA 4EYKA 1JI3A 2AOUA 2JGMA 2VSFA 1WMAA 4OHFA 4KQHA 1M2OA 9LDTA 3ED5A 1FPMA 3HM2A 1DBPA 4JYBA 4MVJD 2PUAA 2O8DB 4HGZA 5ALEA 4TV9F 3WLSA 1JDPA 4KN8A 1G7CA 2ZG6A 3GLIB 4F3TA 4HDNA 1WY7A 1HE1C 4J1TA 1JL3A 3AF2A 3B1WA 4QDUA 2QRHA 4E5YA 3W6OA 5LB2A 3UN1A 2EFEB 3RC3A 1ULUA 1QIJA 2DFTA 2QMHA 1BCRB 4HCJA 1XAHA 4KQMA 2C8JA 2XNCA 3FTDA 3SX0A 5A0VA 1P7ZA 2V3VA 5CIWA 2YW2A 1EB9A 3BK2A 4MYRA 2FY8A 3VU0A 1EBFA 3AEYA 3MJCA 1HEUA 4MYSA 2H00A 4G5SA 1VBKA 2J3MA 1PJQA 2IPAB 1RKBA 2XECA 4ZMBA 1IVYA 3KPWA 1W4CA 1XP8A 1BVYF 1NBWB 3FTQA 1DPFA 4MPRA 3FD8A 3RYFA 2JCYA 1KP9A 4JCOA 5AI9A 1BDJA 4P5EA 3KQTA 5FPTA 4RORA 1E7QA 1D2MA 1EQ2A 1WDTA 2DKOA 3OECA 4Q01A 5CT6A 4IDHA 3AYXB 3EMVA 3PQ6A 5EERA 2OSVA 3B1KA 3PPIA 4D9NA 2W2OA 3Q8LA 4JI7B 4BB5A 1BJRE 1C1YA 4XJXA 4YJGB 4IOLA 2HDNB 2WWWA 2SNIE 3O8DA 3HYTA 5ECGC 2R11A 4I5DA 4MUYA 2PX5A 1ONPA 5IM5A 4EI8A 4YV7A 5K8LA 1UBOS 1K6MA 2Z5VA 3AF6A 1V1MB 2IOFA 3A31A 3JQAB 1ZH2A 1M6NA 3PFKA 2B7LA 3ZX4A 2YS7A 1DBRA 3Q98A 2HWWA 1RTTA 1AB5A 3QJ5A 2CXSA 5IARA 2NZXA 3E5RA 3ESDA 4YI5A 5E8JA 2FK7A 2YMLA 3K0FA 3QP9A 2JGNA 4HG2A 4M8IA 4X94A 3GLTA 5DXJA 4FS3A 3W5SA 3KDSE 4H7IA 3DV0B 2CJXA 2FZLA 5LU9A 3EGOA 5F3RA 4LFAB 1U2GC 3OE1A 4ARZB 4Z4CA 3NTXA 1TNDA 2MU1A 1W7AA 1G63A 1ODTC 1SCUA 1KHTA 4Z0HO 2BFDB 1W93A 1XX6A 2DQKA 3HP4A 3KS9A 5AM1A 2VZ8A 4G0NA 4ZCLA 1TLTA 3HR8A 3ODPA 5FA8A 4R05A 1RHQA 2CVOA 3I09A 1WW2A 1TU3A 1YFKA 4X71A 1QJCA 3IRVA 3RHSA 4YRTA 4NICA 1NT2A 1EHYA 2CJYA 3LPLA 3G88A 4U7GA 3GC6A 4ZXFA 3IO3A 2O2CA 4IDCA 3OPYI 3RIXA 1H2FA 1ZH6A 1XKQA 2CL6X 2JGEA 2ES4A 2JAXA 3BRCA 2KE5A 4M1EA 4BCBA 2B1GA 4O5AA 3UG7A 1I2AA 4C87A 1B2RA 2B25A 2I7CA 2G9ZA 1B0AA 3KRTA 3HCDA 3LX5A 4I55F 2CDNA 2GBCA 1A5BB 1XCJA 2PIDA 3OTQA 3WK8A 4AULA 1RHJA 4DSTA 4PLVA 4AKEA 2B6NA 3JU3A 1N5MA 2ZWMA 3D3KA 1EMDA 3QRWA 2ZYGA 4RY8A 3SKVA 5DCUA 3TQIA 1O5OA 3KR1A 4JY7A 1RD4A 2YN0A 2X4IA 3DZKA 3NUQA 4KPFC 2FZCA 1N9ZA 2DKNA 5BVHB 4LHWA 2XF8A 1L8XA 1PQWA 5KOIA 4FHEA 2PGOA 4RZ3A 1NG9A 3CKYA 2QRPA 4ECAA 4FMDB 1RKUA 3C3AA 4UHJA 2XMBA 4R2MA 2VAVA 5ALFA 4BMSA 2OZLB 1NL3A 5DHPA 5JZBA 3U4HA 2GEJA 4UQPA 3UMFA 4ZC1A 3KEFA 5DNEA 4X0EA 3WLFA 1Z0KA 2ZVQX 1RAEA 2PS3A 2RKBA 3CVVA 2Q6OA 4UBNA 4P3KA 3MBOA 1C8VB 2OUKA 3LZ6A 5K6AC 2PX6A 5I47A 1QHEA 1SKYE 3ZXIA 5B58T 2DY0A 3W5JA 1KMHB 3HUTA 4OQEA 2GXAA 1JG1A 1HYEA 1H9BA 3T7JA 5DBHX 3DZJA 4C5BA 5JH7F 2I22A 3WTCA 1M1NA 4I1YA 5CRIA 4BVLA 3OPYB 1QG0A 2R47A 3JQFC 4RMGA 2IWRA 2O8FB 3WDSA 3O83A 1JHZA 4L51A 1E6UA 1NMQA 3NQ41 3D64A 5FJIA 3HDVA 1FYWA 3A4MA 5CNJA 3D6HA 3ILVA 2CBGA 1EEHA 4MXDA 4Q0MA 4S1NA 4XEUA 2Y1LA 1OROA 5CGZA 5ECDA 3O4IA 4URVR 4TYYA 4K2AA 1MJFA 2QD1A 3RVLA 4J7XA 2GZ2A 2IHUA 3F90A 3MWEB 3N1UA 4R9SA 1Y8RB 4IIGA 1QVAA 4Z1OA 1TYCA 4E08A 2CXUA 2HF7A 4D56A 3Q72A 1YVDA 2QN1A 4HEA1 4QUIA 7YASA 3I9LA 4J0HA 3WL4A 4NI5A 2ATXA 5F5XA 4OY3A 4AXBA 4DSAA 1NTRA 5FLEX 2E4ZA 2IPOA 1RQGA 2Q5CA 2GO1A 1VJ5A 3DMFA 3PUJA 4I1VA 3RSQA 2ZVJA 1EG7A 1U5AA 1KJJA 1SNYA 2ZS7A 3KCNA 5D7BA 4EMTA 2Z3ZA 2ZJ7A 3F2IA 4ND7A 4S0ZA 2D6FA 2MWMA 4PHFA 1H5UA 3WYBA 1EUCA 4FZVA 4BLWA 4PGGA 3LP8A 1OA0A 2NTYC 4L75A 5K0FA 1XTZA 5DN6A 1GTL1 4M86A 7ABPA 1VXOA 3UHOA 2HB6A 4LYJA 5DHFA 3V4RA 3UG6A 2C9CA 3N2ZB 3A0UA 2I4TA 5CNKA 5EG5A 3ZGLA 2HQOA 2H92A 3LX8A 3SNKA 2PWBA 2NUPA 4O4HF 2X9VA 1DC3A 3BVPA 1M2HA 3GEHA 4S2UA 5AW2A 4YPOA 1ZD2P 1ZD4A 3C5VA 3R3XA 2CLKB 3NJ8A 4UHDA 3IAM1 2R1TA 1KO1A 5EXTA 1IY9A 7GPBA 1G8GA 2A84A 3OOEA 4XPIA 5EJ7A 3QFSA 3U3OA 5K3DA 5IYZA 1H65A 1KZ9A 1BIFA 3I5MA 1SVMA 3ILSA 2ZRGA 5HDQA 5EMNA 1N3LA 4UNNA 2ZUVA 1E2HA 3C43A 4DCOA 5GOZA 4DNXA 1ST3A 2AQIA 2BMEA 1IN4A 3HBNA 3VJLA 4B8WA 5K3AA 2E4AA 2HUNA 1AQNA 3DBIA 3M6UA 2VK4A 2XUGA 1IWPB 4QXAA 4N1AA 3HDTA 2J3DA 1N1EA 4N7MA 2WIDA 1FS5A 1AGRA 3E7DA 3NH9A 1XZMA 4H3KB 5FUVA 2XZTA 3HFGA 1T43A 1Y7HA 5I7SA 1F5SA 2FPOA 1OUMA 4XWOA 4CZ2A 1O94C 3USZA 3C7AA 1UZUA 2RHWA 5I01A 4F6RB 1QHXA 1E2BA 1TPZA 2HM7A 2NTVA 1U3CA 3E81A 1WY5A 2WF5A 2FZ4A 2BDUA 3HG7A 4A0RA 4C4RA 4ABTA 2PR2A 3HRIA 3QFTA 3AP3A 3LLSA 4FWTA 1RFLA 5ALLA 1K7XB 1SVWA 2AVNA 1R12A 1GTVA 4JUDX 3PGLA 4LDRA 4XGKA 1WLYA 1DXHA 3JZDA 4PO8A 1T2VA 1CVRA 3UXHA 1SQ5A 1G42A 5NULA 2EFHB 1RNLA 4RKQA 3VR5H 1Q1GA 2B3TA 4OXXA 3SHTA 2NNWB 1C7ZA 2P8JA 1LK5A 2IDMA 3F6SA 3H2KA 4TV8F 5G4LA 2N47A 2V6GA 1CYDA 3F6YA 1LQUA 1VYHA 3HJNA 4RUKA 4D4KA 5DBEX 4JUIA 3QQ5A 3AZPA 4KYUA 1C7FA 5DNUA 4AWAA 2AF4C 1WOYA 4Z49A 3V7NA 1E1RA 4BBPA 1YJ5A 4C4ZA 2R65A 5BQOA 1D7OA 1G60A 3U13A 4H35A 4HH3C 5TGDA 1M0WA 2UZIR 2J3LA 1PHPA 1I24A 1YJQA 3MHPA 2Q99A 4OQPA 5JTTA 3D8HA 1NBOA 3UMJA 1EFLA 3WYDA 5AT1A 4U6QA 4JLSA 3EWSA 2Q4DA 3CUUA 1SVSA 1XRJA 2X2FA 1JHPA 4LS3A 4W9RA 3RU3A 1OGYA 2MDTA 4G8JA 2QI9C 3FJOA 1EM8A 3PQEA 3PNVA 2V4MA 1SBYA 5I3CA 2I1QA 3PUIA 3JASA 3BFVA 4RZUA 4UEWA 1TO6A 1X13A 1BO6A 1F60A 3DKPA 1OB5A 1R0CA 3UK2A 2WABA 4E32A 1SIUA 3LQ4A 4UVHA 1W6RA 3UH1A 2QW0X 4F84A 4ICIA 1DXOA 3L02A 2OFFA 5BR1A 3IR6A 4XLLA 2J9RA 1YZ3A 4CTOA 3JYOA 3KT6A 3TINA 2O8BA 4J94A 2WP8J 3BEOA 4FDLA 5REQA 1ITZA 3RC8A 4YJ3B 4OHUA 4N5LA 2FE1A 1WQ3A 2QM7A 2ZAIA 4BLTA 3O8QA 1Z0AA 1WHSB 3G17A 5A9SB 1VI6A 6NULA 3I2JA 4DS3A 3H4IA 3KCQA 1Z83A 1PV2A 3TLAA 3TNJA 5JYDA 2VQEB 2PK3A 1IJFA 1T2NA 1JFSA 4IHJB 4LKOA 4BQQA 1F2TB 2I4MA 5TF4A 2AYZA 3ZKWB 1TVEA 4OJQA 2VRCD 3KEGA 4PC7A 4D9CA 5KOJA 2I55A 4E46A 5KOHB 2ACKA 5AKEA 1U1DA 1YR9A 3K7EA 2ZRDA 5BWCA 1UDRA 3BHMA 1FJXA 3BT7A 1Z25A 3VPSA 1W5BA 3PNMA 1HMYA 4ARBA 3Q6MA 1IQRA 4I3HA 4NZOA 5F1KA 2EX0A 4YWJA 4DTIA 4AMZA 4AY3A 4HRYA 2DH5A 2VKTA 3GLIE 4WESB 5AK6A 1Q19A 3A4TA 1E61A 1Q3HA 1P5JA 3PF9A 5F78A 3A25A 3JR7A 3KE9A 2AN1A 4MVXA 5AK5A 1FLAA 3R24A 4KQEA 3V1LA 5BRJA 5ITVA 5B4VA 1VCMA 4E3ZA 2F3PA 1Z5NA 3KQNA 3TLJA 1OPXA 3IUMA 4BASA 5A03A 4NWIA 3WLTA 4X8MA 3BGIA 3CYFA 4HAYA 1KYIA 4RCZA 4F46A 3F98A 6LDHA 3V4OA 2ORED 1M0SA 3E05A 3ET4A 3FJYA 4JJEA 1R8YA 5LM3A 1ISRA 4L5BA 1NBAA 1I4EB 4F7WA 4E5PA 4AFNA 2GUWA 3PFIA 5IAOA 1HA3A 1C8LA 1QFJA 1NI4A 3ZCRA 2YUIA 3GZNB 1PNVA 3H5VA 5ESWA 3T1TA 3UJ6A 2ECKA 1TUIA 1KMMA 5E4JA 3C3JA 4ZOLB 5EY5B 1FP4A 4CU2A 3ZIAA 4L8VA 2VL7A 2O2JA 4Y0VA 4OHWA 3F1LA 3IEVA 4QYIB 3RS4A 2VRNA 2VG8A 3F9RA 4R1TA 1J4AA 1C30A 2Y92A 3HY4A 1TQ4A 2AJ8A 5J4VA 2HRRA 1Y9JA 3PXUA 3VR6A 1WZIA 1O0BA 4KGXA 3BOSA 3ULKA 4JT8A 4YAKA 4URZR 4IG4A 1AS0A 4G4SO 2JDIA 3UENA 1O95D 3DE4X 1TZMA 2HA7A 1CFZA 3GIWA 1YB7A 3GLGB 1KJIA 1SQSA 2M6KA 4FR2A 2PD3A 4TVOA 4YMWA 1TU4A 4AQYB 4WVFA 5IABA 1MPXA 1OKKD 3HO6A 3NVMB 3W2TA 4K6CA 4GYKA 1AS2A 2O2IA 2YIJA 5EKDA 3CQ9A 2Q1SA 2Q1UA 5L95A 1ESDA 1M1ZA 2O2EA 4ZTZB 3UVEA 4M9XA 2ZUEA 4IDBA 5C8XA 3WVNA 3T12A 1I6LA 2FEOA 5C5EA 4W5OA 2EAUA 2XYGA 3KV3O 1KFJB 3EARA 4MV3A 3ZYCA 2VRWA 1M34A 3C6ZA 1UBRS 1KR2A 3RUCA 3OESA 3AVWA 2EP5A 4R2KA 1J8YF 5F33A 4BEVA 1PWHA 1TZBA 3UCEA 5LD2C 2O6LA 4OJTA 1IRIA 1XTUA 1N9GB 3PFHA 3LRXA 4Q7JB 5BQFA 5J58A 2OY0A 2IY9A 5AI4A 5DK4A 1TUGA 4TWJA 4U2DA 1T1IA 4REQB 1BKSB 2BF4A 1AS3A 3EAGA 3IPLA 4HC4A 2QW1A 1E8NA 2IW3A 3AEQB 4TQAA 4GEGA 1ECLA 5E1DA 4H7HA 5C51B 4WNAA 4G5FA 2VDKB 2VAXA 3ZZ1A 2FEAA 2DJIA 4QGGA 3PX3A 2B4AA 2DFDA 4OA8A 2PJZA 5E3JA 4BB6A 3CVUA 5T57A 2V96A 4Q3KA 4WOJA 2HTFA 4FFRA 3QKIA 4MA4A 4P31A 1NC3A 2I2DA 2YRXA 3MFQA 4ZVTA 3I01A 1OILA 5CLGA 5KYWB 4GP7A 1BE0A 2G1JA 3P9QA 4HT3B 5ITSA 5KQPA 5KHOC 2N1BA 2OB2A 1L5RA 4MWEA 1QTNA 4KXNA 4ATNA 5KNBH 1F2UA 3MRVA 4CV3A 1JJAA 4G0VA 5BURA 3AF3A 4FQ7A 4G41A 1DL5A 3D31A 1OX4B 1AZWA 1N8NA 4GU5A 1CEXA 1VCOA 3O5AA 2Q4BA 3P26A 2X1MA 1R4NB 4UHHA 1JRLA 3DUWA 4E2WA 2M9MA 4XIGS 2FWAA 1MAHA 4LF6B 1DTSA 3IBTA 3I6YA 2FP4A 2I2BA 2JFBA 1YGPA 4DFDA 3TX6A 3L7JA 2XWQA 5I9LA 2BMFA 2RE8A 5F9MA 1PT6A 3DA8A 4X7MA 2LNDA 3PDIA 3THWA 3FTFA 4WN9A 4PANA 2Z43A 1RRFA 5CURA 3TZBA 1G7RA 5FLXA 1HDXA 4HAXA 1Q20A 2B30A 3CEHA 4RVFA 1NBHA 1UJCA 3I45A 2J3IA 5I4KA 4WEQA 1MB0A 4U02A 3VHXA 4CIBA 5LJIA 2XDQA 2WMNB 3K6KA 4ZYLA 1LJ8A 5B1DA 2ECFA 4PSUA 4CM5A 4MKGA 2PNJA 3T5DA 2AYYA 4HVCA 3DHNA 2GVZC 3CEPB 3IV9A 1I0LA 4M9UA 4GMXA 2HT1A 1ZNQO 4IXMA 4MWTA 4IDDA 2WKQA 1WO8A 2ZITA 1CUIA 1E5TA 3LSYA 2JFVA 2BEWB 3I52A 4J90A 4NG4A 3RSOA 4D42A 2ZAYA 1E1MA 2YN2A 1Q22A 1ZI6A 3KUUA 2CUZA 4LMAA 3QU9A 1FU4A 1A9SA 1JPUA 3ECSA 4QSMA 1VSVA 5EZ5A 2NYRA 3TIVA 3UJ3X 5FLKA 3OFSA 4W8HA 3DFZA 3TK1A 1YDWA 3MLAA 2GLTA 3RI3A 1O9GA 2A58A 4JBNA 1CZLA 1WA5A 3WIEA 2I4LA 4GZLA 1YAHA 5JS8A 3QHQA 2O48X 3EIEA 1OU4A 3JWPA 5JXHA 4TUYF 4MR9B 4BNDB 4X1YA 1K5GA 1ZNZA 1E3TA 5KNCH 2OK8A 4EHNA 3OETA 2FG6C 1QKIA 5DYTA 1KDRA 2YYYA 2QTNA 2IYEA 2Q5LA 1GZVA 1PZMA 3QHPA 1Q16A 2VNAA 2B0CA 3CN9A 4K9RA 4Y2XA 1DCFA 3ECCA 1V8ZA 6REQA 4PHGA 3PTAA 1PL8A 2Y1OA 3S2ZA 5EP2A 1OBOA 5JVDA 2PT9A 3QVSA 3X1WA 1K8YB 2XUAA 4PC1A 2XMPA 3W0LB 2AA3A 2MSWA 3WHKA 4IDQA 3FVWA 4IDAA 4WBNA 3R20A 1BA2A 4MW7A 4WE3A 4JROA 2P11A 4MB6A 3HR7A 2W8BB 2B5WA 2PWYA 2VF2A 4Z2YA 3P0FA 3ZK9A 3NBXX 3PC8A 2HEIA 3E7PA 1JU4A 1ZL0A 2R4TA 5LPNA 2JFZA 4Z8YA 5JCOC 4XWWA 4GYWA 4X24A 4LYYA 3BGVA 2X2PA 4I1RA 2XA2A 1GCUA 1BD4A 3NAMA 3B9RA 3TLGA 1ZN9A 5JALA 5ALYA 5GIPE 4CKCA 1SOVA 2COEA 1N7JA 3N70A 1C0KA 4JEUA 5J2TB 1E7YA 3MWGA 2A14A 3AWIA 5KTRA 1OWLA 2EJCA 1KY4A 1Z9BA 3GCGA 3B85A 4KFCA 3N87A 1EZ1A 4RVOA 3GCXA 2OE2A 4OYRA 4YDSA 2MCFA 1WETA 1MOQA 4DCCA 4DN6A 3H5OA 4CL8A 3L01A 2P67A 3G1WA 1L5VA 2O50A 3CB4A 1U3FA 4Q16A 5EUBA 1JT2A 4AZ3A 2ZI4A 3FFTA 1M2JA 3AUAA 1BFKA 1T1RA 4LXYA 3QKSB 1PQUA 1PFVA 2DULA 4QNNA 3C0KA 3CF4A 2C5EA 3D9QX 3SK0A 2BH2A 1A7JA 4X20B 4QLBA 4G0MA 4CODB 1I1QB 3GFGA 1AU9A 2A1TS 1E1LA 1MXFA 1HFKA 2X41A 1Q15A 2CVPA 5EWJB 2DTDA 3FSRA 2D59A 4U9HS 4L27A 1DJNA 4RPJA 3EPLA 2ZTLA 1W9MA 1CUFA 3TL6A 4JX9A 1NMXA 1RZ3A 2OXTA 2ZJOA 1X7GA 4N8DA 4UTZA 4B3FX 3EZNA 4MLDA 3M8KA 2P7HA 3I83A 1SA0A 3LIPA 2B8TA 2PKEA 3AYZB 3C16C 1ZCAA 1ESEA 3Q5DA 4OP2A 3KDPA 4PCLA 2B78A 3VV2A 1W2HA 1K5PA 1Q0RA 3TW8A 4OHYA 2OHIA 3ZY4A 5FNVB 2WIJA 2GPNA 3Q11A 1X14A 3WNQA 1P7CA 4KR7A 5JMWA 2GEVA 3L7LA 3DBHB 1N1DA 4UHFA 2AK2A 4IUCS 3C1AA 2FFAA 4WCFB 2RI6A 4GRAA 4IX9A 5HVNA 2WYIA 1JB9A 3BH6A 5GPBA 4MUJA 1AUOA 2G80A 3AVPA 4M1OA 4TTQA 1Q1BA 4EG8A 5CA0B 3NYWA 2GHRA 2WD7A 1IOLA 1HYBA 4B85A 1N2ZA 1Z8DA 2QRVB 3NOVA 3B3FA 5BW5A 2QGNA 5H70A 2C2XA 4HP8A 4MQ5A 3R6WA 4X7PA 2IODA 4X90A 1B7GO 1EWTA 2ADOA 1RS0A 1CS0B 3IBYA 3IXQA 4MSUA 5U4QA 4DBVO 4FGSA 5D5HA 1GZ4A 2P0YA 2WAMA 4LC1A 3GPLA 4TTVA 4XSVA 1FZTA 1C7JA 3GXOA 5EJ9A 1SUFA 1Z15A 1OV6A 2YVLA 3D4IA 1I51A 4O2BF 3RARA 2ENWA 1CP2A 5HM8A 2BTQB 5DLEA 2NVOA 1U4OA 2H4ZA 3NEPX 1B6GA 3GWZA 3PE4A 3IAM6 4GPTA 3WHPA 4D3ZA 3A1CA 4R1NA 1KC1A 1RJ9A 2D74A 3JD0A 4N7BA 4PS0A 2AH5A 4XASA 3TBFA 4ESOA 3FOEC 4LFBB 4LK2A 1XVTA 1JA1A 3VAYA 1Y6QA 4G23A 5K0SA 2HCJB 1L7MA 3N86A 3CONA 3FUCA 1YS4A 3FIJA 4JP1A 4Z1MA 4A10A 3WGLA 5I51A 3IYLW 4BE9A 3HL0A 1UMBA 3PDCA 3P4YA 4GXNA 1VB3A 3AVVA 5AQ1A 3KKKA 4XIFA 3FHOA 2ZIUB 5H5JA 4TSFA 1WU7A 2BIFA 2GEBA 4WXMA 4CVNA 4AZ0B 5CDSA 4BXOB 3G0IA 4GI3A 3DTNA 4OTZA 2V0GA 2BMWA 1B00A 1VSTA 3TN7A 3K4HA 4C4AA 4F06A 4DQKA 2UYQA 3PFWO 5GY7A 1RRMA 4EJSC 2AIRA 3W5BA 1FXSA 4FKZA 1QFZA 1Z0UA 1C0PA 3C98A 4NYJR 3STYA 2F64A 3GDOA 2C07A 2HR1A 1IIRA 4GMFA 2HV9A 2Q28A 2OPBA 4G37A 3H9EO 1SXJB 2HSJA 4O4LF 3BMCB 3MVEA 2WV7A 4TRJA 5A4JA 5CFQA 3LO8A 2HIGA 5SZIA 2REQB 4DM4A 5AIBA 4O59O 2Y0PA 5DFAA 3U80A 5I4IA 1FX0A 1Q2UA 1ZFNA 3BYZA 3ZS9A 5JFGA 3UHJA 3ZCSA 4I50F 1LJLA 3AR8A 4DT1A 1D5CA 4CM8A 3E82A 2PSSA 3PDUA 3P20A 4IKPA 3U4MA 2WZQA 1TOAA 4KV7A 4F93B 4P4UA 3OKFA 1WTCA 4X3OA 5CT4A 4BNUA 2GILA 4EA6A 1N6LA 4ZWNA 1TK2A 1SFRA 3OFKA 4OBXA 1W47A 3KOOA 1N78A 4HMPA 3DULA 3QLUC 4YDRA 1SK9A 1TCAA 3NOOA 2GFHA 1X1TA 1ZKMA 1L8AA 2XT9A 1XWFA 2QROA 3GLGE 3CE6A 1WD7A 2FF5A 3Q4GA 5ERYA 1UJMA 4PFJA 2G7MC 1U7PA 2B94A 4D46A 1WM1A 3WLJA 4NFLA 5KYUA 1ZIOA 8AT1A 1G8AA 1DWOA 1DWQA 1JFFB 1CPYA 2NU9A 1HWYA 2YYSA 3BRQA 1UBGA 3RVNA 3N05A 3VAAA 3EXIB 4YEDA 3ICQB 1OI2A 3RF7A 4A92A 3VKFA 4L50A 3KTAB 1R88A 1ZL2A 5KVSA 2PVCA 2F8MA 1TM4E 1EWVA 1PDOA 3K71B 2QSYA 4TMZA 4NENA 2ZROA 3S3TA 3FTNA 3VU8A 2BEVB 3I3OA 2VYQA 2JFQA 1OAAA 2CMDA 3Q88A 3TFOA 2KSQA 3MAAC 2FWRA 1NJ5A 4TXLA 1XCGB 4GL2A 2P6UA 4N9QA 4EX7A 2WSSD 2O7RA 3TCNA 5BV8A 1HZJA 1MHTA 4BVAA 5TJ9A 3S5JA 1V8FA 4I4NA 5L4LA 1P74A 2PEZA 1ONOA 2BP7A 2V58A 4GM4A 4JJZA 3BJRA 4KQCA 5SZHB 5I7OA 1NN1A 3TJZA 5FI3A 3HXQA 2QXTA 2FZVA 1G4HA 3R3ZA 2IY7A 2UVQA 1JAYA 2JKYA 1GV0A 3HXPA 5B3JA 1AZLA 3GVCA 3QKWA 2OHVA 1DT5A 2F8LA 1NBMA 1TDJA 1MVLA 3IEMA 1IJBA 3PHGA 4DLTA 1MH9A 2A3NA 1H1DA 2F1RA 2ORYA 4CR8A 2QX6A 4FVTA 5LA6B 4DIOA 4PLGA 3LK7A 1DAMA 2WPDA 1IZ8A 4ACBA 2ZJBA 2XKAA 4CG1A 1VL8A 2QLMA 4FMPA 4YJFB 2RD2A 1R15A 2AN5A 1JSZA 1PQ4A 3HP7A 1F8YA 4ZRDA 1U4NA 5ICMA 2NXNA 1LKZA 2VHUA 2W6JD 1OXBB 2GEKA 2QP9X 2WKPA 3HV2A 3CISA 2TMGA 2WLTA 4J6EA 1GT91 2Z04A 2I7DA 4FFSA 5FO1A 1XTRA 1FPQA 2QLBA 4UREA 1FRFS 2C84A 2ZRIA 4WKPA 4BUJA 4BEJA 1FBTA 2VJCA 1QFMA 1UWKA 3SC4A 1GTJ1 1GAEO 4LZLA 1PT5A 3DDUA 2HIAA 4N5NA 1PJ2A 3D5QA 3ESRA 1HQDA 3BMOA 2W5UA 3Q85A 3LYAA 5KU1A 2FWJA 5E3IA 1VPVA 2QX9A 2R86A 3VC3A 2ZB4A 2NVBA 2X76A 4KDEA 4C3ZA 1E3EA 3OZRA 1HE8B 2XXJA 3TBHA 5JJLA 3I73A 4YJKA 1E18A 3HC7A 1SOUA 4F38A 3DLHA 1R50A 1Q0LA 5D5PA 3N5KA 1M8PA 1QM5A 2RG1A 3QNMA 3RUAA 1GLGA 3AQIA 2P6NA 2PH7A 2G4LA 3H86A 4FEYA 4IGFA 5IK2A 2B4YA 4EWLA 1SXIA 2OL4A 5E7JA 3D0QA 2PZJA 2HBQA 2R7MA 3W7VA 2OKCA 4ALNA 3O8OA 3WJ7A 3NHKA 3JQ9C 4KQIA 4OQFA 4DM3A 4BMYA 1BMFA 4OQYA 4TKVB 5EQTA 2VK8A 1RIFA 3K5WA 4RY2A 3RNLA 3GUZA 3KQWA 2VXCA 5JS1A 1UJ4A 4GRIA 1XUOA 2AFHB 3CR7A 3CN7A 1ZONA 2C1ZA 3OSUA 4NYMR 4Y30A 2OORA 1PTJA 6AT1A 4P5PA 4LOHA 3WWEA 4IRXA 3GZJA 1JIVA 1XJQA 4KWTA 3ADBA 2XUOA 3L0DA 4NOMA 3EDMA 2ODAA 1X3LA 3GRVA 3LDGA 3MRXA 4F4HA 3ZOKA 2OVBA 4KHZA 4FOPA 4KQ6A 5J47A 5M04A 3MAGA 1EE2A 1D4OA 3NM4A 2ON6A 3UPUA 3ZNQA 4Q24A 1DV2A 4XFKA 3BHIA 3R75A 3PEEA 4WMLA 3DBRA 2GBFA 4ZAXA 1XEWY 1DJOA 4C01A 1ZX1A 1AQ6A 3BJEA 3HZOA 2YWCA 4FKBA 5ESDA 3U49A 3EY4A 3UJ8A 2VDOB 4KTVE 2ZRCA 1OB2A 2RGUA 1OLSB 2RFLA 3AP1A 3PC6A 4YC7A 5G1PA 4UPEA 1KC3A 2NT4A 3L7CA 1R0BA 2O3TA 2G17A 2G8NA 3UT6A