1SRQA

Crystal structure of the rap1gap catalytic domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
330
Chain Sequence
KVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein 1
publication title The GTPase activating protein Rap1GAP uses a catalytic asparagine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 89
structure length 330
sequence length 336
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02145 Rap_GAP Rap/ran-GAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1srqA02
3BRWA 1SRQA
chains in the Genus database with same CATH superfamily
5AUPB 4Z0TA 3W5VA 3GLHA 2WG1A 3MLAA 5GVRA 4YCNA 5D5HA 4IEIA 1SD1A 4F97A 3FSGD 4TT3D 1XZAA 3CNLA 3N1UA 2CF5A 2B30A 2H3EA 3HH8A 4KSCA 5CX1B 5CBKA 4EITA 2V54A 3C16C 4FILA 4RJJA 2X8BA 2Y76A 1I1HA 4ZD6A 1KNXA 1L3IA 3ZEIA 3WQQA 3WLAA 1DB3A 1E7QA 2IHNA 1NL3A 2Q3MA 4BMCA 5T8KA 2YDYA 3U48A 4XWGA 4CG3A 1QLWA 2GXAA 1ZQ1A 2FN3A 1QVAA 2J46A 4JT2A 2FW8A 3PQ2A 4P4SA 4XWAA 3MINB 3TNLA 5CK5A 4EFDA 2VQ3A 2R86A 1B00A 4Z5XA 5K2OA 4HN9A 1U02A 5IC5A 1NBHA 2X6QA 4BJ5A 1SXJD 4OQMA 1JEYA 1G7RA 3IIMA 5TX7A 1T0UA 2QLBA 4ZPJA 5KWVA 3JQ7B 1STOA 3H4TA 4GIBA 4OGKA 2GUWA 3LY5A 5FL7A 3THWA 5IJ9A 2IIBA 2P6RA 1NNUA 1SU4A 4C2TA 2DQYA 1NYQA 2OKGA 4CIYA 3W0LB 5EQDA 2FF5A 2J0SA 4POOA 2Q2QA 4R3WA 2NZUG 2FPOA 3KV1A 5GPBA 2ORWA 5KYWB 1F7UA 3FPLA 3DMTC 2BAGA 4Q9HA 5DM70 1TUEA 1TT7A 3UWPA 4K6GA 1EP1B 3WISA 1N4AA 2XYPA 2QLMA 4HJXA 2P62A 2G7MC 1ID1A 4MEJA 2W2TA 5CYOA 4CQLA 1JZQA 1M8PA 5A3VA 3DT9A 3NZEA 2DPMA 4OJMX 5EY5B 1F0KA 1YR2A 3ZU5A 4OAQA 1QF6A 1H85A 3HN2A 3MERA 1U80A 5I7VA 1Z7BA 2WWRA 4NZZA 1RLJA 1GGVA 3AHFA 1CERA 1BD4A 5AKYA 2F8SA 2RHOA 1NIPA 2AUNA 3PC7A 4W7IA 1ODTC 2VRCA 3CUWA 4TTTS 3OTIA 1KARA 1ZM7A 4YI5A 4Y2RA 2V9CA 1SZPA 3QPUA 4YRPA 1KJ9A 3VOAA 4YRGA 1MHPA 1NSTA 3OEED 4WUTA 3MYYA 1G8SA 3NYIA 4ZQHA 3KYCA 3H5NA 4P5PA 4PFKA 5DTMA 4KOEC 4RLSA 5G3YA 1NBWB 3WMFA 1LXCA 2DWUA 4C7JA 2P6OA 3LRXA 5A62A 4AK9A 5LMCA 1G38A 4X9XA 2RSLA 2OHIA 2JLRA 4Y9TA 3AKDA 1IULA 4TSRA 4A8JC 4B3BA 2IK8A 3H5AA 3D3WB 4ENQA 1HI9A 4WCFC 4LXQA 1EZ1A 1JDPA 4F60A 2VAPA 3SMVA 1GFZA 3V4SA 5LDHA 4KR7A 4WKGA 3ICVA 5HKKD 3KWFA 4RL6A 1Y1SA 2GPSA 5HGJA 4AYXA 3SOPA 3EDCA 1T6XA 1V2HE 3IEVA 3IEPA 1T4CB 2BBSA 3UICA 3LVFO 2H1OA 1WDKA 3VPFA 5F12A 3DE3X 4KI0A 4Q3NA 3OCVA 3VYRB 3ADBA 5CT9A 3DEAA 3KETA 1JL3A 1NU8A 2FUG1 2GERA 2Y93A 3LI2A 1D2NA 3KO8A 4URUR 2GF2A 5DCUA 4AY2A 3IT2A 4L22A 1WJGA 4G0ZA 3EFHA 4UUNA 1M34B 4JUCA 4LY6A 1RS0A 4HQNA 5EE1A 3FYDA 4E3WA 4EP1A 3DE2X 1Z4KA 1LRKA 5ALPA 2VWQA 3AY3A 3COSA 3QU7A 4JL8A 2XNKA 1KWGA 1EP3B 3I6MA 4FKZA 5E1OA 3L2OB 1HE8B 4L5JA 2PJRA 3JV7A 4BIIA 2VATA 3GLHE 1EFUA 3ITNA 3K71B 3MD9A 4DMLA 3DZ8A 1RXVA 2ANCA 2FN4A 3G68A 3V7NA 3H13A 1KP3A 2YWCA 3KUCA 3QHAA 1E5QA 3FMFA 4AJ4A 3DYVA 2MYUA 3HP1A 1KDTA 5EL0A 1NI5A 2ZRIA 5FTWA 5BMOA 1WVMA 2BEKA 2VUSA 4DR6B 2PYZA 2DVMA 3I8SA 4JL5A 5IT5A 3U4CA 1G18A 4RDIA 4O1MA 2QAIA 4FDLA 2UVPB 4NPAA 3LSTA 3V1MA 2O2IA 2QRNA 4YTEA 1ZXLA 3MGAA 4C76A 4J3JA 1IN8A 1M75A 3TZBA 2VHUA 3IDZA 5AVUA 1J70A 3CR3C 3KFVA 4C0BA 2VSFA 4ZAVA 2CUNA 3WC4A 2JKZA 4PXSA 5D3KA 3SQDA 1H94A 1PRYA 3M6AA 3AF6A 3QVGA 3QKTA 3NHJA 1V41E 3ELUA 4TXJA 4YDSA 3LP8A 1HOXA 1XDWA 2BCGY 4OIFA 4Q3LA 4XUCA 1UMCB 1TQ8A 5ALTA 3ACDA 3R7FA 4B0PA 4JX9A 2CNBA 5B4TA 4F5YA 3COVA 5KBYA 2FQYA 2XRYA 2QU8A 1KFJB 3O2QB 4UARA 1EUQA 1Z6XA 2RI6A 2FPMA 2VKQA 2XYGA 1DKNA 4UAVA 3NVDA 4CM9A 1NM5C 5HS6A 4G67A 2HMTA 1EIZA 2FXVA 3PDHA 5DHRA 2JI8A 2QL7A 2V3WA 4UASA 1LEHA 3EF1A 3N86A 4LXGA 3OHPA 1GGMA 5CFRA 5J9FA 3NJ4A 3QX3A 1DDIA 1JT9A 3PXBA 1PZGA 5FTLA 4YO8A 4DJTA 4H1WA 4W9MC 4AKEA 2UDPA 4GX5A 4IRUB 3P2KA 4RHCA 4O3MA 1H2ZA 1P1FA 5M3BA 1IBSA 3EAGA 1BVHA 5BWOA 3RWMB 5HUQA 4RQAA 1DUVG 4DNPA 2WIAA 3IJ5A 4KUGA 5JZMA 1SVWA 1US8A 2BGWA 4FFRA 3BL8A 3KTAA 1ZJJA 2ZJ7A 2PT9A 3D3QA 4P3KA 3UMCA 4YYEA 4PGMA 2GK6A 4FYYA 2VP3A 2AS0A 1SIUA 1TKRA 1FEZA 1ZINA 1C30B 4PNHA 4MQMA 3KAJA 2VDUE 4ZT4A 4BBZA 5CLJA 3BQMB 3DKPA 3N76A 3HP7A 3M4JA 4BNYA 3HDJA 3K2BA 4L5IA 4DVJA 1FRZA 2JKYA 2JJ1D 5AH0A 2XUHA 5TARA 3STWA 4XDGA 1G5RA 4W1SA 1F2TA 2J0UB 1N7GA 1YUBA 4MITA 5FOTA 4MQUA 2ZJ4A 5TPWB 3HA3A 5E8JA 1CW2B 2Z30A 3FB4A 5GONF 2ECOA 2Y1EA 2F1IA 4BQSA 4Q34A 2CNLA 3RU3A 5B58C 2Q0QA 5BXQC 1SKMA 3PA8A 2HCBA 3DLAA 3RD5A 4UCWA 4DV2B 2JGKA 1GQ2A 1OMOA 4GM4A 2JFGA 3ROXA 5IWCA 4MYTA 3A3YA 1UANA 3W9YA 4NCAA 3JD3A 4X71A 2JJYA 5TMDA 5BOSA 2WJ3A 5GZ3A 4S0ZA 4NV1A 4P1ZA 3G49A 3M2PA 1S1CA 4EZBA 2XKBA 3GROA 1DEAA 1RRFA 2FU5C 4IGEA 3WWOA 3FHOA 3V1KA 1M6HA 4NJMB 3T7SA 4TKMA 4YV0A 2TECE 4JNKA 4K9MA 4KLCA 2Q4TA 4REMA 2KS6A 4B5KA 2HYDA 3QELB 4F7DA 3QLTA 3MT0A 3PZBA 2VNIA 2IF2A 5AI5A 4CI0B 2YY6A 4OJTA 5D3QA 1NXXA 1PG2A 2J4DA 4CEHB 2ZE7A 1LK7A 2ZTHA 1Q3TA 4RLFA 1SWVA 3H5WA 2D5LA 2WY2D 2X40A 4V0QA 5JD6A 1O1YA 1O5TA 1OBFO 3C7CB 1PVVA 1SC4A 5LYJF 3SR3A 3C41J 1E4VA 3AVVA 4F1WA 3S28A 3KSUA 3JARA 1OAAA 1BCRB 1T9ZA 1OBVA 3C3BA 1UJNA 2O05A 3KM0A 1NYTA 1U94A 2Y2VA 2Q8PA 4F2DA 2LCIA 4I9FA 2XKJE 3KKNA 3IESA 4QICA 3SQWA 1V5FA 1G20A 2PSDA 3VHRA 2ASEA 3W90A 1GTRA 2VUIB 1L5VA 1USGA 4S1NA 3CLUD 2GA8A 3LYUA 3LQFA 4DGQA 1NT2A 1GU1A 1H2AS 1NQUA 3EPJA 4PYNA 2V55B 1RHKA 3BXXA 1ZSYA 3CMCO 3RNOA 5LQAA 5EXEA 1ZK4A 3CTPA 5LMNB 2Y71A 2PTGA 4RFSB 5ALQA 5T41A 4UVHA 4V1CA 3I2IA 3AHJA 4IKPA 1RKUA 2O52A 1EUDB 3MWFA 1Y89A 4QNNA 1PK7A 2HU7A 3CQ9A 5J59A 2DFNA 5HCIA 1V11A 2HCRA 2OHFA 2QLJA 3GL9A 5LCXA 3ZCVA 5C1DA 1QZUA 2IHYA 1T43A 3R4CA 2QSJA 1HMYA 3QY0A 4KQEA 4DLWA 2FHPA 4J8PA 1QRUA 4MIOA 1M2VA 2CLEB 2GO1A 1AHIA 1PX0A 1RYYA 1KO7A 2YN4A 2XDYA 3R6DA 4JCCA 2CBZA 4M86A 3PK0A 4N6GA 5AJWA 1DZIA 3W3AH 4D1YA 1ZL2A 2H2WA 2OBMA 4F6LA 3KDSE 4PCLA 1AUPA 2XT9A 1QC5B 3ESBA 4E5VA 2V45A 4JOCA 5EQFA 4GOJA 2XUQA 4YACA 1DBQA 5HVNA 5A0VA 1UDCA 3BBLA 3GCWA 3I9KA 5KSWB 4NZPA 3K32A 3SSMA 2O8NA 3P0EA 5JNLA 4PLFA 5H3CA 3EOZA 4YDHB 4KCGA 4MKZA 2QXYA 3HV2A 2OHGA 5A3JA 3D81A 2ATXA 2HMVA 3GLGA 1K1EA 2PGOA 1DIGA 3DV2A 2AF3C 5IHPA 2YWDA 2O2EA 3QKRA 4AB1A 3PDWA 4UE2A 2NO9A 4DPKA 4BX3A 2QYTA 4QT0A 2NO5A 3TQFA 2JA2A 5KDLA 4XB1A 3Q8KA 1YMQA 4ZI7B 4L5BA 5AP9A 3SC6A 2CDAA 3GFPA 2IEBA 3AERB 4ZDJA 3P9SA 1GCOA 4GI7A 1VHTA 2X86A 1S5PA 3GRFA 5FWYA 2FSVC 4BFLA 1WU7A 2IOHA 2P75A 3UHFA 1CRPA 3ZE7A 4TV9F 1B6TA 1UWKA 5C51B 1NJ8A 4MVJM 1BGXT 4LXHA 4MGIR 3RK4A 5ULLA 4TLAA 4IH9A 4C0SA 4ZMBA 1QHFA 4CFSA 1WHTA 4Y8VA 5FBQB 3L04A 2IHJA 4LRUA 2CD9A 3QTBA 2E2WA 2XNHA 4MRMB 1L1EA 1IN6A 4JI3B 3O4GA 2Y1KA 2GSDA 2FR8C 4P83A 1W36C 2AQIA 2XBLA 3I2FA 3LP5A 5DXJA 3FGPA 3V8BA 3BXPA 3ZY4A 4DSAA 4BC1A 1VG0B 2WZBA 2FQXA 2VDJA 3L4BC 4G8DA 4JP2A 2BHNA 2NO7A 3EQ2A 3Q7RA 1E9BA 4FB5A 5CBPA 2P9YA 3WLNA 4R2KA 1VCMA 2YIDA 5EXDA 3CZ5A 1TM1E 1PWYE 1VKRA 3W6UA 1AO0A 2EAUA 5BQXA 4HDRB 1XVAA 3AZQA 3LYAA 4ZICA 1KIMA 1MA3A 4PX9A 3EXHC 1KDZA 2X5NA 1G1MA 1I4DD 4A5SA 1VSUA 5HZKA 1BDHA 5AJYA 3CGGA 4DDWA 1EMDA 2G1AA 4RVSA 3R6LA 4BQEA 5AK3A 5DCWA 2OFFA 4LAFA 2WNSA 2G9VA 4H0CA 5JNTA 3EVCA 4GEGA 5DNEA 3RUCA 1G2PA 1G20E 1N8SA 4NU5A 2REBA 1WMAA 1ST3A 4ZRMA 5E3HA 1F6DA 4CRWB 1W5SA 2D5AA 2REXB 2XOKA 2JHFA 4GPIB 5CDYA 5I9NA 2BGIA 3ED5A 1Z17A 4C04A 2ZDGA 3KFXA 5EJ7A 4ZTZB 4ZZ2A 3T12A 1V16B 1AF7A 2XXAB 1T1IA 1I13A 3DBLA 4WLEA 4PG4A 3C5WP 1M1YB 3HVHA 4NULA 1I33A 1GZUA 1UKBA 4Z4HA 2VRWA 3S70A 1PYOA 2BZSA 1T5HX 5JNUA 3EEOA 1KIFA 2WQ6A 1CVLA 1RJEA 5EE3A 3V3TA 5CIYA 1FUIA 2NZ2A 2Q2NA 3IPRA 5LQNA 1BEUB 1XRQA 3WRWA 5E4FA 2NOAA 1NRXA 3EPRA 5C8DA 5K3BA 2IP1A 4XYEA 1P7PA 4QPZA 2NXWA 2PSSA 1BA3A 1UMDA 1VDMA 2HRCA 4F86A 1CETA 1VPWA 2VNKA 2Z0MA 1GQRA 3PC8C 2C7QA 1F4PA 2X5OA 2IIQA 3BRWA 1R8SA 2C88A 1FFEA 2I7TA 5E6UA 3FOCA 3WBJA 2MR6A 4ZO8A 2E3JA 3Q9LA 4MS4A 3B12A 4KQ2A 1BE8A 1GNSA 4HFMA 2A8YA 2V7BA 3D54D 1B15A 2F48A 2GNAA 2GN2A 3IAM6 3SYLA 5JUWA 1E20A 2J3IA 4IMPA 1POXA 3F74A 3MC1A 1GAWA 2XVZA 5JWRA 1LA2A 1OE0A 3K09C 1A0OA 3QRWA 3TR0A 4JODA 3TGPA 4RH3A 5G1NA 3IAUA 2C04A 4E46A 1Y4AE 4WEQA 1SCIA 4NYIQ 5FOUA 3ND8A 1GTL1 2BDUA 4D3ZA 3PFGA 2CCKA 2A94A 3F3SA 3PYMA 3CJRA 2QXTA 1JIQA 2C0PA 3FDJA 2G5TA 1CR2A 2Z1MA 3H8WA 4F9TA 2ZSAA 4YCAA 2GJSA 2GNPA 4CM3A 1L5RA 1E3LA 4EDHA 2W37A 2Q4BA 3NBKA 3RSHA 4PE5B 3ET4A 3CB4A 4JB8A 1OJ7A 3FMIA 5DK4A 4B3DA 121PA 2IHBA 4O4IF 5KHOC 3AGPA 2ZSUA 5EJ6A 3WHPA 4OKIA 4Q7MB 2AT1A 1Y4DE 1L5ZA 4KOAA 1DEXA 4CEIA 2JIZD 1UP6A 1HFKA 3GCDA 3UHOA 4GOLD 4BS9A 2OQIA 2ZJAA 4JASB 4BDTA 3I12A 2EFYA 1RMTA 2QRQA 1DBWA 5TGZA 3G8CA 2O4CA 4RHYA 4HS4A 4FDTA 3WL8A 1B8PA 4DG8A 4YRBA 1Q7BA 2I3GA 2PEYA 2WNIA 1VYTA 4FGLA 2XSZA 4LOHA 1D0IA 1R4MA 1R8YA 1LJUA 3G2MA 4DIOA 3MRXA 1BSVA 5D1HA 3V4RA 3JYOA 5T4FA 1YJ5A 3GJQA 4RJLA 3AJAA 1MH1A 3PP8A 2F90A 4UUBA 3G0DA 5EWMA 4XVCA 2FWAA 2I4NA 3NNSA 4FBMA 5DE3A 3NP9A 4QBKA 3LLVA 4R2MA 4E2ZA 4B9EA 4N0QA 4ZT3A 1HURA 3PT5A 2NP6A 3QFTA 2PU7A 4UTNA 2N46A 4H59A 2AX4A 4HGQA 1TJ4A 1D6MA 2PZMA 1LDYA 1Y5RA 1JIJA 1W2WB 3FPAA 4QJ4A 2VDKB 1MR3F 5A6SA 1X39A 1QIGA 4RHUA 4J1NA 4ZQBA 2QVGA 3RIEA 3UMBA 1QOPB 5KC9A 1MKYA 2E89A 1JEQA 3GJ4A 5F2OA 3PGLA 1M2GA 5BSKA 1WMFA 3FTDA 1AS3A 4RJ2A 1XZMA 4XRRA 1EGVB 3EIUA 4WY8A 3RS7A 4BVEA 3L77A 2CNWD 4DTIA 4LW8A 2OB1A 4JV5B 4DIMA 4DT1B 5BVGB 4G0NA 1Q11A 2I7XA 5FWXA 5FBKA 1GUYA 1BA2A 2HPAA 4JT9A 3G8DA 4R71A 2VHYA 2QMOA 4M9QA 4M9UA 4OD0A 4RK6A 1XCJA 1SQ0A 1CUGA 3I32A 4IHJA 4OA5A 1CJUC 1LD3A 1N1MA 3PYXA 3DE6X 4TLBA 1U0RA 2JKVA 3AY7A 3LQ2A 2K2QB 2VS1A 2Q2VA 3EFOB 1SEVA 3LWDA 2GB4A 3C6KA 4IS3A 4DWJA 3JPWA 1RM3A 1JNYA 1T6ZA 4GOXA 5ECDA 1P74A 3QU2A 2PKQO 2ZQYA 4JWTA 1DJOA 1PNOA 1RZUA 1FXUA 1YZVA 3T7TA 1G6OA 3OD1A 4ZJYA 1JTFA 3RFTA 1KI4A 1DTWB 2R68A 3P0IA 2R60A 3D4BA 1F1JA 5CLHA 4Q1BA 1ZA1A 2XCQA 4BMDA 1P18A 3ADKA 4P7GA 3NR2A 2YZNA 4KR2A 1QTIA 3AEZA 3OQJA 3EY4A 1R4NA 1DO2A 2W43A 4O08A 2VJKA 1OAKA 4LDNA 2ZITA 4UMDA 5THXA 5AM4A 1E69A 5I8WA 1D09A 3W1EA 4CHGA 5DGDA 3WS7A 3X1JA 3G7SA 1JJ7A 2DP4E 2QVLA 2IGTA 2Z4RA 4O8CA 4YAEA 4EKGA 4YRNA 3H1BA 4B87A 2IZ5A 2VQSA 4OSPA 4H17A 3REQB 3HCWA 1K9SA 3W5AA 3MAAC 4MWTA 4MW4A 1QONA 1YB2A 2F6RA 3BERA 4EG4A 2RGCA 1GL9B 4D5GA 4BNTA 2JFBA 3LL4A 3ZH2A 5BT8A 4WFKA 3ONDA 3PXDA 4OMCA 1X3SA 5TS3A 3PF8A 1AD2A 1ZCAA 2Y1WA 5E7IA 1AURA 3KCNA 4YH1A 3GFSA 3K73O 1FQJA 1HSOA 5LXTA 4ICIA 3Q7TA 4XOUA 4GYKA 1J8VA 4ZCSA 2QUAA 3D6AA 3HRHA 4RV5A 5FUWA 2X9QA 1NV9A 2I91A 2Z58A 4OHMA 5KOHB 1BE1A 1P4SA 1QKIA 4Q66C 3SFTA 4WOCA 4ZODA 3GK3A 3TX6A 3DBIA 2B0JA 4CKYA 2BM0A 3VNRA 1XF1A 2OCLA 1AKQA 1N6KA 3SIWA 1G3RA 3MBIA 1ZD5A 3R7BA 2PRYA 4BKRA 5DCYA 1TC1A 1SCKA 1IZYA 3IELA 4NVRA 4P3OA 3T3EA 4FQ7A 2WAOA 4XYBA 4BFVA 2HWKA 2VF8A 5EIBD 3Q3CA 3I6YA 4JYMA 2VYND 2QWXA 1M8KA 1PKXA 2D7CA 4HWSA 4J94A 2AJ8A 6AT1A 3CEHA 2CD7A 3A1WA 3IEXA 3C85A 3SN6A 2AFHB 3TTWA 2QP3A 5BSWA 1NZFA 2JIDA 2BP7A 2V7PA 2XZTA 3NC4A 1JG4A 1XA3A 4HTFB 4Y0VA 1HF3A 4LBZA 3HU3A 4Z1OA 1H9CA 2NTYC 1FJHA 2IPNA 4MKRA 2Q2WA 3LVQE 5IJWA 4XEUA 4DMFA 1EDBA 3RVDA 4HVTA 1N6HA 1ZK2A 3T99A 1U0JA 2QD1A 1E1CB 3PR3A 4G5FA 4KH1A 5CT4A 1ISHA 2W70A 4LI0A 3SDZA 3AP2A 3EVTA 2FPPB 2YQ4A 3OQPA 4JVOA 3U80A 1YMUA 5ISMA 2X0FA 3RKUA 1RYHA 4GL2A 2J59A 2O06A 4IDCA 5ELXA 1XEXB 1VFPA 3HJRA 3REOA 4MR7B 4A91A 4WN9A 3RTAA 3LW8A 3KQLA 1NE7A 4QDKA 5ETJA 5LP6C 3PE6A 4O4JF 5GONB 1YBHA 1Z28A 1Q17A 1OHHD 4IDOA 1C8KA 2VK1A 4Y1GA 4UU1A 4F3RA 3E5RA 1P5ZB 1QB8A 2HRDA 1JYEA 1QG0A 1H5NA 1RRGA 2BFDA 3HY4A 4HDQB 1T5BA 4MB6A 4PYLA 1Y8QB 4Z49A 1VQ1A 5ES4B 5TT0A 2NQTA 4OYLA 2VDWA 1XOIA 3ISJA 3NIDB 4PZ0A 4BE7B 4FGWA 1FDIA 2OK8A 1U9IA 4CM4A 1UK6A 4KX5A 2OYCA 1FQKA 2IEGA 2KWIA 5G2OA 1UC9A 3B3QA 3VDRA 1JXQA 3UHJA 1YZUA 1N32B 1O9BA 2XW6A 3SX2A 1NUPA 3OOEA 3RYHA 5JPIA 3PWKA 2DPYA 2I6UA 1JXAA 4CIDA 1NVXQ 1JLRA 4N9WA 2JCBA 1JKJB 2C3PA 3H9GA 4WZAE 5FFMA 3TRFA 4BNFA 2WJ4A 1BKYA 5JRDS 1YFJA 4EPWA 1T35A 3AJEA 4FDMA 2ZSJA 3BIXA 1GT91 2DPXA 1UJCA 2WUFA 3KDPA 4RXMA 3UXHA 5EJ5A 2SECE 3BWXA 2PR7A 5HPYB 1JVSA 3QEMB 3QXSA 5IABA 3IA7A 4I6GA 1C7EA 3EWAA 5DHUA 3VHXA 3D8UA 2FFBA 3QIAA 4Q7JB 4I19A 2ALJA 3H2SA 4P36A 4TTQA 4WEOA 4KFCA 2ZI3A 5LYJB 5BYJA 3BTSA 2FMUA 1N2BA 3QFFA 3ZWPA 1PGOA 2E6KA 3LKDA 3MRSA 1E66A 3PKJA 1JN0A 1TFUA 3ZNPA 1JRLA 5LQUA 4B3IA 4JI8B 3A6GA 1M33A 5FFFA 2G9RA 3BIWA 4Z4CA 1G63A 4WJKB 2ZIXA 1X6VA 5EHZA 2D4AA 2J07A 4D9KA 4ENVA 3HCCA 3OOYA 5ALZA 5AKHA 3M6WA 4KUHA 1GRRA 1DQRA 1OTHA 3FNFA 3WWZA 3ADDA 2GJAA 3GAZA 2PU5A 1L8AA 4CMEC 3UWMA 1QF7A 4G23A 3K1YA 5FOVA 4ZCMA 5CDSA 3DBRB 2HK9A 2V5AA 5T57A 5BW8A 4K88A 2X0DA 4X93A 3AUFA 4JZKA 3PCRB 3OIWA 4H6WA 4UHDA 5CK4A 3WL4A 5BWMA 3TCKA 3L8YA 1BCSA 4RE6A 1R74A 1NJ2A 1Z5GA 3OZRA 3UMMA 1I9GA 3R1IA 4K9NA 2AOVA 4GHWA 1T4BA 4Q4HA 4EJ2A 4XE5A 2BFBA 4EARA 2PT6A 3SXJA 4QA9A 2NSDA 5DGIA 5TPZA 3EWNA 3EMDA 3OX4A 1KVQA 4GI3A 3RWBA 5IXYA 1VKOA 1EK2A 1Y7HA 1Z0KA 2BKAA 2QTNA 4FI3C 3FIJA 3WE7A 5EYPA 1E3SA 1V1MB 4EPRA 5HG0A 1XEWX 4MUFA 4DY6A 3S8MA 2VJAA 1L7NA 6ABPA 2I3DA 3K8ZA 3VKFA 5KQPA 4IKEA 3R40A 1AGXA 1YBAA 4IIHA 3WB9A 3WLRA 3OAAD 2FPRA 1JA0A 1KL7A 3F1LA 3GQBB 3RFUA 3BIFA 1LPSA 5J5VA 5DULA 4YI3A 2VTVA 3KELA 1W2GA 3EYAA 1P4RA 4UDOA 1XVLA 2I0FA 2ZWVA 2WICA 3AESB 4GLOA 4Q37A 1Z2NX 3IO5A 4OQZA 5F4ZA 3OO0A 4QHYA 2E49A 1Q3KA 3SU8A 1GR0A 3IDQA 3OCCA 5C32A 5EZ5A 4K7JA 3PQ3A 4L4XA 5ENZA 1M67A 3WIBA 4M2LA 3STYA 2PVSA 3DWGA 4WOKA 1VZ2A 4A5OA 3RBAA 2WWYA 2V4MA 2W6ZA 2FZ4A 4R51A 2ZVJA 4D9EA 2II6A 3LCCA 1CJSA 4HEQA 5KEIA 5E4TA 3L1IA 4MVJD 2M98A 2E4XA 1ZJ6A 5BSRA 4C3ZA 4MDEA 4TV9B 4GX1A 3GYGA 5CNMA 1BU5A 1QGDA 1U11A 3SSAA 1XNRB 1D2AA 2C9DA 1K8ZB 4GLLA 1YTLA 3L8EA 2IYAA 5DWDA 1E89A 5BN5B 1TDJA 3RV3A 3R23A 1BQ4A 2YVQA 4IAOA 5JJ5A 4O2LA 3KYDA 3K6RA 4YV7A 4HT3B 5AW6A 3KQYA 4TMZA 3OIGA 4V02A 1Z4NA 3ROGA 1O6ZA 1F8XA 2IDJA 2QMHA 3IO3A 4RZQA 1O57A 3QUCA 4OK6A 3WQRA 1SZJG 3I39X 3W6NA 4A92A 3DSRA 1NVBA 4QODA 2PGIA 2RMKA 1XWFA 2DX7A 3D7MA 1DKPA 4BY9E 2V3VA 4KVGA 4M8IA 4QYIA 4F46A 4V2UA 2CLIB 4K6MA 2RFLA 1CUSA 4CU5A 4D9CA 4E4YA 4PIMA 5D87A 2ZTUA 3EY9A 4WBNF 1EIWA 3IAM1 5H59A 2PV0A 4W5TA 3C3AA 1WNFA 1YVEI 1UMBB 1Z6ZA 2CFTA 3G89A 2QPLA 3O3OB 1C7IA 1IEXA 1KI2A 5HCUA 1YE5A 4QT4A 1COWD 4DOMA 1HNXB 2TRSB 1LK5A 2Y4OA 3OEHD 2R1TB 3B5IA 3IBTA 4B76A 4BQIA 1NYRA 3R0JA 1BHO1 4J76A 4G0UA 2NYRA 1YRAA 2UYYA 1RBMA 2DPHA 3D4OA 1JQAA 3E53A 3O94A 1RM5A 3A2LA 4X41A 4TQUS 2O23A 3P9KA 3U3RA 2XNJA 4AJKA 2M6SA 1FS4A 2IPLA 3OZUA 5I9BA 2IV7A 3T5PA 5K4GA 3VU8A 4ZYTA 4DR3B 3KFLA 1AOXA 1FOEB 4FQ5A 1R00A 4NOLA 1DDOA 3SZ3A 5ITSA 2JJMA 4MR7A 4BLVA 3EGDB 2Q0HA 3JYNA 2BI4A 4MVXA 3MJVA 1AXRA 2QTAA 5FI5A 2CBGA 4ZEXA 2YVUA 3MJHA 1TYZA 3ORRA 1MH9A 3Q0IA 2XITA 1WXQA 1LV7A 5DSXA 2AH5A 1KZYC 1GCIA 1L2TA 1OZ0A 3M7IA 3FKSD 3GUVA 3Q4GA 4LV5B 3WXMA 4BTVA 2YZGA 4EA8A 1KZ1A 3Q41A 4U3JB 3G2NA 2BGTA 2VWPA 1VGRA 3NRCA 1Q91A 4N76A 3CONA 2G09A 4OJYA 4LX8A 4L4UA 3DZDA 3SLRA 2NU9A 3LT2A 4BFUA 4QBIA 5BR4A 3OJLA 4ISBA 4OFBA 3I3SR 3T9DA 1CQJA 1W581 2AHRA 3N8GA 4RJTA 1GAXA 1NUAA 2W0MA 4F21A 1DO0A 1H1TA 5A4DA 3WFZA 1WUYA 4MQLA 4F12A 1KO1A 2ZSFA 3T4UA 4AY3A 3K9LA 4XDYA 3D6TB 1X8JA 3JQAA 4IINA 3DVSX 3UJ7A 3GRKA 4QDTA 2NYAA 2ZYTX 4H7FA 1QRSA 3ZWOA 2IPXA 2FJUA 1A9QA 3FUCA 2RAPA 3HRKA 4X6LA 3RLIA 4DLAA 3M9WA 5A0FA 1DKMA 1HFWA 3BWMA 5JAHA 1MBZA 1GFIA 1YAHA 2QMUA 1HOTA 4QEKA 4WN3A 5A9RA 5BV1A 4G0XA 4MVWA 4EY5A 1AMOA 1XMIA 1ZD9A 2DHQA 3DBHA 4PGFA 1DAMA 5DXAA 1L5NA 4DS3A 4J1SA 5IULC 1B4DA 5J5CA 3K9BA 1GPDG 3IXLA 3AVPA 3ZIAA 1DJLA 4ARAA 1RLTA 2ZUUA 5G0SA 4PC3A 1AK9A 3COJA 1B41A 3S81A 4JT4A 3ONNA 1DOAA 4K0KB 2QTWB 2H18A 2CF6A 4N3BA 1L5GB 1SUDA 3RH0A 4AI6A 1R4ZA 3B36A 1PT8A 1AUOA 3UF0A 2HHLA 1IQUA 5A5FA 1TGVA 5JSZA 1EZ4A 1L1RA 1I5OA 3WG9A 4MKXA 3VUEA 1GKYA 1GNQA 1KI6B 4O4IB 2DT8A 1RQ7A 1LU9A 3OT5A 3KPWA 3OZGA 4CTOA 1LRLA 2GAIA 1VL0A 4QPJC 2ZCVA 2ZYUX 5AFSA 1TM5E 4YIHA 1A9PA 1UXIA 1CT9A 3E3MA 4HWRA 1H8EA 2XGGA 4YXWD 5ADUS 1TCVA 5C1PA 1ZUIA 1C7RA 4N7MA 1J33A 4BV8A 2OZEA 3RRMA 1TEHA 1OAOC 4IUDS 5CXUA 2QM7A 1A69A 4C5CA 2D0IA 4BLQA 3WWEA 4LZLA 1EWQA 1KC1A 3QVJA 2PZBA 3HC7A 3WB1A 1ODFA 2RBEA 1EBFA 2O3TA 4HNTA 3CKMA 2JVJA 1EFPA 3UCEA 2I4OA 3K31A 2EU8A 1CXZA 1OI7A 1L8LA 2FP3A 2O1WA 2VP6A 5GJCA 4RS4A 1QLHA 2J45A 4L2IB 1W29A 3K8OE 3WYNA 2BKXA 4V3BA 4WGFA 5HJ2A 5IDQA 1GZHB 2EL7A 3DZJA 1U8YA 3RRBA 1IOLA 5JYBA 1U7HA 1Z08A 3IMFA 1W85A 5TQ2A 3ESXA 2PVPA 5TMBA 1P4AA 2X3YA 3BHMA 1KO5A 4PO3X 4YJ3F 3IL2A 4PN3A 5DVZA 1KI3A 4GM0A 5DX1A 4CWAA 1TX4B 3L40A 4XM2A 3UTDA 3VKWA 4I0WB 2GLUA 4CNQA 3T5DA 2NYUA 1Z15A 2B4RO 3H42B 3TNDA 3P2EA 4AUMA 1NWHA 2I4IA 5A4FS 2BH2A 2PM8A 1MDBA 1R9JA 3B20A 2OXRA 2VO1A 3MUOA 4KXYA 3IFSA 3VI3B 4LHXA 4PHTA 1ISFA 1A50B 1W5TA 1Q0PA 2JBAB 3DCJA 2R44A 3KTFA 1CLEA 4R9SA 3ZDEA 1INLA 4YAKA 3BAFA 3A1NA 4BUZA 4H4CA 3QYJA 3ICOA 1D5WA 5DP1A 1D1SA 4DIKA 5AW8A 4J43A 4F8EA 4R0MA 2VSXA 5TS2A 1QKJA 3LOQA 2ZREA 4TMTA 3DKIA 4YLGA 4UJ5A 5JZBA 1CD5A 3JATB 1Y1PA 4O2BA 4HNGA 2PL9A 2EGHA 4KFSA 1N2SA 2PJDA 4CLDA 4E3ZA 4MJXA 3GN1A 1KXZA 1AKWA 3WNQA 5AXCA 5CNJA 4DXAA 4W9NC 2J3QA 4QGAA 4S1VA 5BWBA 3HSSA 3U37A 5LR6A 3F6SA 4LYGA 1JI0A 1NDHA 2VZ0A 3SS9X 3V7FA 1QX4A 2EDCA 3B1ZA 4LDAA 1XPUA 1KK3A 2RB5A 1LUAA 1JTVA 1W88A 2JNWA 3VR5D 2E7ZA 1L5QA 1ZMBA 2QW8A 3HCRA 3TNYA 5JZSA 3NIWA 5MFPA 2WZCA 1RXCA 3V5NA 4AU1A 4OGGA 1JMYA 2TYSB 3AEXA 1NXPA 1Z8FA 2EL9A 4JCOA 3OQNA 4E11A 3KQMA 4W5RA 3ASUA 4IYRA 3D8BA 4ZV9A 2BEVA 1MABA 5FUQA 2F2TA 3H11A 2YC4C 2O8DB 4IVRA 1UT8A 4WDQA 5B12A 2YS6A 1DAPA 4J0JA 1CX9B 4FPXA 1T34A 4R1LA 5BWCA 1HDEA 3L82B 3JQBA 1YFLA 2RARA 4KXVA 4LWOA 2ZWOA 1ZVJA 2W8BB 1DAHA 3M70A 3TQQA 1XHFA 4X61A 1U81A 1K6JA 4CGYA 1GQSA 1TVKB 4DLSA 4TTJA 5F7XA 2R4UA 1FLVA 3MUNA 2EERA 1TECE 3BJRA 2WTMA 3EQ6A 1Y8ZA 4C3VA 3NHPA 2B36A 4YECA 4AYWA 4AZ0A 1EA7A 1Z0UA 4MJ3A 2ORED 2QE6A 2E6UX 5BQ3A 5DYGA 1T24A 3OO1A 4F3CA 3TUZC 2XVMA 4NBKA 1VP9A 3RKSA 2R8RA 1NI4B 2H1HA 3HCNA 3EC2A 1JMKC 3M9XA 1FRNA 4J7AA 5SZKB 1K8YB 1JG3A 1L5SA 1OLSA 3HBLA 3V33A 3LQYA 3M82A 4D4GA 1H2RS 4YCSA 2J4FA 2CNDA 3VR6D 3QK7A 3DZHA 3AQ4A 1TPZA 1QP8A 4X24A 1JQBA 3OLQA 4RGVA 2EARA 2K4MA 2HMWA 2GJ4A 3ITEA 3ENZA 4OLJA 4W5WA 4Z8XA 4AIRA 4GG1A 4YR7A 4IMRA 1EUCA 3ANXA 2B37A 2QSUA 3N5CA 4DA9A 2GCIA 2LRHA 1QYCA 3HNOA 4KP7A 3WYGA 5SYMA 5EHXA 4DCCA 3ZLVA 4CNBA 2IPOA 3TRDA 2UYGA 1X1TA 4KPUA 3ZGNA 1AMUA 4Q4AB 1Q20A 2XTMA 3G9TA 4KHZA 4IGAA 4BE9A 1P2DA 3C1AA 4GXNA 3OFNA 4J16C 2OCIA 3OT1A 4HOYA 3DD1A 3RB8A 5DNAA 3RQSA 1TQ2A 2AJLI 1IVNA 4CE6A 4DUGD 4EMBA 1DAFA 2OQ2A 3QSGA 2F3SA 4LI3X 4KPFC 1R8JA 2HLDA 1XJCA 4Q7EA 4EYKA 5I7UA 2AOXA 1UR5A 3HO8A 3O1JC 3OZIA 4Q18A 3OCWA 1A88A 1MCZA 4R9VA 2F64A 2R6FA 2RGAA 2FFHA 2PYIA 5DW0A 5K3OA 1QV6A 2FB9A 2G8LA 3E2IA 5G4LA 2FOXA 1Z7GA 3Q8WA 4ZI2A 3RJTA 3UA4A 5H3HA 4NF2A 3HK2A 2ZIVB 1PJLA 2JFUA 3HKCB 5LWHA 4O4JB 3C3PA 4II7A 1D9XA 4Z9YA 3ZU6A 4C21A 1K8RA 2WPNA 1XEAA 2FZWA 3P0FA 4YUZA 3BZBA 1XFAA 3H5OA 1YVPA 3QF4A 3SYKA 1Y63A 4AY6A 2YHIB 2BGNA 3TGLA 3A3KA 3EXIA 2ZJ2A 1SOMA 2YXLA 3V2GA 2D00A 3S8YA 4G0MA 1YJQA 4XX1A 4U5QA 1D8TA 1KYQA 1W76A 3J7TA 1OKKA 3LA8A 1K8XB 2LV8A 3K5WA 3DL4A 3LUKA 3QBVA 1LPOA 3A1CA 4W1QA 4YT5A 4CLOA 4GBED 3RTEA 3Q12A 4ZT7A 3FNRA 4UAUA 3DHWC 1GRNA 3EZ9A 1RQRA 4QLAA 2MYNA 4RD2A 3V8VA 7YASA 3BXOA 3AUSA 3RSGA 1MNQA 4I1OA 1D4ZA 3KEFA 4DYDA 5HZGA 5JVDA 1VMIA 4JXJA 2QAGB 1K7YA 1W0KA 2BFNA 1NX6A 3Q0TA 4J0GA 2I7CA 4JI4B 3E1GA 1Z4JA 1GTJ1 3REFA 3VH2A 1OXUA 5F9HA 1CFZA 1PFUA 1Z0JA 4FDAA 1K97A 1N5JA 2WJIA 2JATA 3FUWA 1XA0A 3I53A 3LDUA 5H83A 2QX6A 4EELA 2Z09A 1OJLA 2VBCA 3CVVA 3GFTA 3CUSA 3QUSA 3TAUA 3AB3A 3RIMA 3EVAA 4AICA 2OSBA 1R88A 1VGQA 2Y68A 2WYOA 4EG1A 4HK4A 1TCCA 4E7OA 1WQ3A 1PG0A 5AQ1A 1AN9A 1XDZA 2EJCA 3AFHA 2QW1A 1VIAA 1W7AA 4ZTBA 1TMOA 1BE6A 1NVTA 2B92A 2GGSA 3B6MA 4TRNA 4MTLA 1CQPA 3DVAA 3MS4A 4QWWA 5CT5A 3CRVA 4N7JA 4R7GA 5EWJA 5EJAA 2JJ2A 4PQYA 3L07A 4H77A 5J2TA 1X13A 2X7XA 1OZGA 1Z47A 2C5BA 3N6RA 4HDMA 3J7AC 4ETMA 1EEXB 4AULA 1OV4A 4ZQFA 5C5DA 1T6YA 3QIVA 3W5IA 4OXIA 4GS5A 1U8UA 5FI3A 4W5OA 4UBLA 4CCYB 2XB2A 4B3TB 5F1KA 3PQDA 2P67A 4D8XA 1BKSB 2GPWA 1WXGA 2AZDA 3C7DB 2AKYA 3RLFA 4NV0A 1UEXC 2FP4B 3TQTA 1N2EA 2RJ3A 1I6MA 3QKSA 1PT6A 1P0QA 3RSLA 2YUTA 4ZZ0A 2QRVB 1YNSA 1L5HA 1C81A 5ARBA 3LLCA 4KXFB 1RZRA 3F90A 3U7RA 2C83A 3OT4A 5AKZA 3WVNA 1ORRA 3GLTA 4M9ZA 4F04A 3WL7A 2C4VA 3OZDA 3II6X 1U1DA 2WVJA 4K26A 4WGGA 3WDSA 4RVDA 4O2RA 4DY4A 3U5TA 3I2GA 2GK4A 3V4OA 2R8PA 4BMVA 1B0AA 2NUPA 4BUJA 4CM1A 2YV5A 4KO8A 4U7GA 1ZJYA 4UTXA 4B17A 2BD0A 2QT9A 5FAKA 2E4YA 3GYBA 2O7SA 4XLZA 3WJ1A 2BSQA 4DL9A 1HA3A 2XKKA 3C4JA 4MUJA 2M2IA 2CHVA 2R25B 4MEBA 2GLTA 2WU3A 2QY9A 3FVVA 4XD2A 4XFJA 1YAJA 4AQ7A 2LVBA 4CIAA 1ESMA 4PW0A 3WSWA 5KMGA 4DCMA 3CLRC 1BHSA 1QFSA 1PTKA 1K68A 2VAVA 2HRQA 2Q1UA 3TQSA 2YY5A 3C6BA 5K01A 3ITDA 4R3UC 3TZEA 4TRMA 3B6JA 4A27A 2ONJA 1FMFA 1L6RA 3I83A 3LHFA 1TZ2A 4MV3A 2GJKA 1VJRA 4QVKA 4FBGA 2IU0A 4OTZA 4IH1A 4QJ5A 3ZJTA 3LM8A 3QQPA 5ELMA 4C2UA 4C03A 1GFSA 3PR1A 4MJLA 5JBIA 1OV6A 4ESEA 4Q82A 3INRA 2FWPA 1PEKE 4U8GA 4HY3A 4A15A 3MINA 2QVYX 4M87A 4LXYA 3SHWA 1X9GA 2QIOA 1I4OA 4CIVA 2IXFA 3GJ7A 3IH5A 4TSFD 2FUKA 1YI0A 3HFGA 2QTVB 5J4HA 3JQ7A 4LK3A 3KPYA 1Q7RA 3ONFA 1ZN2A 3BJIC 2UXDB 2H00A 3DE1X 4MQFB 3VYWA 4OHZA 4D8TA 3H19A 5IT9A 3MPOA 4FJ1A 2NO0A 4FYMA 4OL9A 4W7HA 2LUOA 4U2KA 4WBNB 1BX0A 1CS0B 3D43A 2QP9X 3GFGA 3OIUA 4R69A 5EVJA 1E1RD 2IEIA 1NBMD 1WR8A 3TCNA 5A3QA 5IZCA 5JS1A 2ZDQA 2I65A 1T5IA 2CJXA 4DYVA 4AWBA 5BOSB 3JYQA 1AB6A 2VP0A 2E4UA 5ERGB 4C7XA 2GESA 3N87A 5JIBA 1U3CA 2OGZA 3WDLA 4P98A 1ZOPA 2RBKA 2C2BA 2AOTB 2QD4A 5KVQA 4KR6A 4RCZA 2AMLA 4BNNA 3GGDA 1FRFS 4AN1A 3AOEC 4H3HB 4YDRA 3FBGA 4HVLA 1CS4C 2XNDA 1QFMA 1L4UA 1OSNA 2DAPA 1WZIA 3HYSA 3K16A 3KPJA 3W3AA 4FWBA 4UVDA 3KHKA 1NY6A 3RG2A 4J03A 1R0WA 4UTRA 5A4IS 4RTPA 4GQIA 4LQLA 4Y6SA 4YP1A 4DBVO 4KMSA 1Y6JA 3EWSA 1T29A 5BW4A 4PANA 1C7FA 1TB4A 2AQKA 3MMSA 3V1YA 4FKBA 3OE5A 3CEMA 3QSYA 1UWVA 4RTLA 4TVBA 1IHUA 1A2QA 2GF0A 3GD7A 1N9KA 1Z4LA 2FEPA 1XCPA 1O58A 1U6KA 2C4NA 3DB1A 1XZJA 4HRXA 4YJGB 2EJTA 1GRVA 1XEFA 1OX4B 3FM9A 2HZBA 3KAQA 2W6OA 3FGOA 4K9OA 4MICA 4E5MA 2XEXA 3L8HA 2EWWA 3DONA 1EKXA 3GJZA 4CR6A 2WWIA 2B8NA 3WYEA 1H4QA 2CN1A 4R4JA 3WA7A 4YB8A 3BTVA 1BJKA 1Y5NA 4AJJA 4UNPA 5BSGA 5FHRA 3C3KA 3THXB 1GUBA 4G5RA 3LPMA 3TK1A 2HSWA 2POCA 2TS1A 2OV2A 4K6KA 4P92A 3DXZA 5FR1A 3S2EA 4JWKA 2HMSA 4X7MA 5FQOA 3GPBA 1M7GA 3QE0A 4EUSA 1NQ5A 1BJTA 1T2CA 3NC0C 1G7CA 2AEMA 3GV0A 4JGBA 4KSBA 3M9LA 4XWKA 1W96A 1S4QA 2GJ8A 2QD2A 2FQ1A 4WLUA 3KLOA 1BC5A 3RIXA 4A8JB 2V7WA 3JASB 4WCFB 2AFVA 4YJHB 5FUBA 4BVLA 1U0BB 1KSHA 1IC6A 5JBNA 1C3LA 1P5FA 3EGEA 3FUVA 5HILA 5D00A 5KPJA 3C7AA 2HCFA 3C14C 1C9KA 5FX2A 5EJ2A 2QQGA 3EWIA 4HQ6A 4GOMD 4OA8A 3EC1A 2JVKA 3A1VA 4CU2A 4IOLA 1YOVB 1QYWA 4IIXA 4JEUA 1J9ZA 3DPIA 3UT0A 4AF8A 1FXWF 3EGOA 4LCJA 3DJYA 4S3MA 4ZV7A 3FOEC 2DBRA 5AUQA 4FFLA 1NTRA 2GAFA 5FPQA 4ZVQA 3IAS6 5C0OE 3F46A 1RAIA 4D4MA 2GN6A 1JA1A 2OZVA 2AOUB 2LD4A 3FR8A 1EH5A 3NHRA 2QBYA 4EFLA 1BAPA 3LBFA 2DFDA 2QRUA 3LC2O 3NNNA 2D1SA 1LWNA 1UK9A 3FMGA 5KWSA 2XVXA 3MLEA 4GFDA 4HZUA 2Y9MB 3U19A 3U44B 4EGJA 2A33A 1OIWA 3SQXA 2IS4A 1QIMA 4FINA 4HYTA 4WHMA 4B9AA 4IV0A 3QG5A 2GRJA 2NZJA 4H6XA 4YP9A 4DCPA 2OCGA 4WACA 3DFUA 4O4LA 3BXFA 3E7FA 3RYIA 1V8ZA 4DZTA 2QL6A 3AF0A 3DEIA 3TDNA 4BNLA 1Y1KE 1FSZA 5JDIA 3TL6A 1I51A 3BA1A 2F8MA 3R7NA 1JW9B 4ZU1X 4YJ3B 5CVDA 2Q7DA 2UYQA 4RIGA 1KFKB 3GDGA 1YQTA 3K72B 4ZO4A 4F4FA 3OE1A 2BFCB 1H2WA 2VZLA 2AK2A 3ML1A 3UK6A 1E6CA 3OF3A 4TTSA 1OGIA 1AXEA 2ZDHA 5LBIA 3WIOA 4COKA 5JTUA 1X9IA 2AQHA 2QX4A 5I8ZA 2XZOA 1DJMA 2PXAA 2H7CA 1ZH8A 1R0ZA 3CBQA 3M6MD 4M4SA 1MEJA 3J80A 4NH4A 1ADBA 4BGEA 2C5GA 4MPTA 1C30A 3V1UA 3HL4A 1VKHA 1RE0A 2HI0A 1JIKA 4MR8A 4AURA 2C7BA 3WNBA 4BB0A 2CL5A 4JT8A 3ANSA 4L8GA 2V0GA 3SS8A 1TA4A 4XIGS 1YDFA 1C29B 1D7AA 5JMOA 2G06A 2ZT6A 4NI5A 2GAJA 4YWHA 1YRYE 3RYFB 3GGGA 1TEZA 1I6WA 1U3UA 2HA4A 3L06A 4LWZA 3RS8A 4QGSA 3FSGA 4TT3A 4WESB 5B64A 2K6GA 3U60B 4YONB 2H4XA 3KQHA 2O2SA 2FKNA 3FA2A 4HC4A 3TWOA 3IT1A 4KQXA 1XXHA 3HYTA 4B74A 2QN6A 5L7TA 1U31A 4LPSA 1NG9A 3H86A 2H6EA 1IM5A 1O96B 1S7GA 4LQDA 3RJ5A 1USIA 2XUGA 5IAGA 5JSUA 4BX2A 3ZKAA 5IAKA 4DEYA 1Y4ZA 3HKBA 4K05A 4X6YA 3QFRA 4LZWA 4YMHA 3FPCA 4FFBB 3TPZA 2QOEA 4RCYA 4AIIA 1QWOA 3OECA 5HJ5A 4Y2JA 3EUAA 4M9XA 1J1ZA 3AKZA 5AHRA 4COOA 2C4WA 1U8CB 2KHZA 2ORIA 2V0NA 3EHDA 2YYZA 4FCCA 3GGJA 4GECA 4LMRA 4NJMA 3RJZA 5JNVA 3MJTA 4Q21A 2JAXA 4G1BA 2EKBA 2BFFA 2Q5OA 2P9ZA 1TQDA 5ERXA 5LP6F 3UPUA 3AZOA 2AI3A 2HF9A 3H83A 5D6NA 3N2GA 4MH0R 3PJEA 2GN9A 3BGSA 1Y7TA 1FMLA 1DAGA 2A1UB 2PQMA 3GEIA 4OYYA 4B2PA 4CM6A 2OCYC 3VX3A 2OV3A 4CV0A 3CVWA 2OFXA 1W94A 3GWGA 2WKWA 3HN7A 4TM7A 2IY9A 2Z8YA 1WP9A 3JTEA 3LCJA 5BQ5A 2EKZA 3W8FA 2L42A 3O3NB 4KC0A 1GPH1 2BKVA 3RJMA 5CFNA 3T5TA 2BGUA 2I4RA 2JH3A 4BEBA 4F3NA 2WSIA 3MHPA 4I5DA 4AXXA 3VPSA 2A9RA 5KTTA 4DLBA 5JMTA 2YYYA 4GU5A 4QQNA 4RNDB 2O8CA 3VSAA 1D04A 2HPZA 2VHJA 2VTEA 1YI1A 4LMBA 3K15A 1V2GA 5K8JB 1YQ9A 1Q0LA 2OQRA 3W9SA 3X1KA 1LB1B 2TMGA 1GAEO 1SHLA 2IDKA 4XGRA 1XA4A 2D5CA 3O82A 3VR6H 4LF7B 2HF7A 1RVV1 4HB4A 4MPJA 4TWJA 5KHAA 4YMGA 2Z6QA 3FDFA 4RFSA 3DEFA 3OMWA 5EG5A 3OLZA 3C4QA 4FR0A 1KU6A 3OEEA 3I9V6 3FGNA 4URYR 1W93A 4RETA 2B25A 3WGTA 4OQFA 4RULA 3M4YA 3IRVA 2O2CA 4EGAA 4BX8A 2XUKA 1FVHA 1DWQA 3CNEA 4QPDA 1CIJA 1VSTA 3PJGA 1R8XA 2CDBA 2I2BA 1RU3A 3OICA 2X1LA 3DF9A 4FEYA 1G19A 3HM2A 3K0CA 1YONA 1BDBA 3OQ6A 1ZRSA 5F7ZA 3CRNA 3NWOA 1AGYA 2VZEA 2YHUA 3CSUA 3NBFA 1QAOA 1S3FA 1U9JA 4AFNA 4S04A 3O8RA 1JFTA 3EH1A 2C2GA 4XOIA 4KRFA 3AJ9A 2YJ4A 3RTGA 4PG7A 3EIWA 4ZI3A 2RK3A 3LNCA 5K3CA 4E31A 1AG9A 2C2WA 4G4SP 4HRVA 4WLNA 1OZHA 3TXAA 4XPIB 1TIPA 2JK1A 1TXGA 1Y3HA 1SZCA 2XVYA 4IL5A 1KMHB 3A2NA 3CX8A 4BB6A 2AN1A 4TMXA 2W2NA 3HBJA 4N48A 2GYYA 3ZVNA 3KKEA 1M6WA 1IHPA 4I9HA 4I2NA 3CLTD 1GAQA 1V5GA 4E13A 4DMRA 1U8FO 3IP9A 3FPSA 4KAJA 1IQPA 3LJKA 1VCOA 4FD2A 4C4RA 4DCUA 1GSOA 1V48A 2GM9A 2QUHA 4Q6BA 4LC9A 5F7JA 5JJIA 3DAHA 1MXFA 2IUUA 3Q3IA 2QLNA 1J2EA 5IS2A 3RC2A 2BFEA 1F9EA 1Y9EA 1J8FA 4CYMA 4QOEA 4R1QA 1C9EA 2VIIA 3EXFA 4HR7A 4FI3F 5IF3A 3B51X 3D1JA 3IDFA 4D57A 4R7ZA 2B2NA 2A59A 2E4WA 4EWLA 2Q5EA 3AERA 3HGMA 4WZAB 1DSSG 4JUDX 4UM9D 2Y05A 3QE9Y 4GICA 2BN4A 3QU4A 2G4CA 3WLEA 1NVGA 1XXHE 3QTTA 1X94A 1ZEMA 1WBJB 3SIRA 3A14A 2GVNA 5KJFA 4YRMA 2VJMB 2LTAA 1KFCB 1CIVA 1MB3A 1SA0B 1JSZA 1UK7A 1GKIA 4GPZA 4ZC8A 3W06A 1VYUA 3OZVA 3EULA 5COQA 5JS8A 1PEYA 2Q49A 4B0OA 1L5LA 5IUJC 3WZLA 2P2CA 3MAGA 4BMOB 3U9SA 2H1WA 2XGSA 3C1OA 4G1CA 4LVUA 2REOA 3DZBA 3P1JA 3OPMA 4HTAA 4QKQA 4C06A 2DBQA 5I48A 4Z7QB 1C3VA 4K3VA 1PR2A 3PX2A 2W11A 3UHPA 4HAYA 3SZLA 3PPYA 3KKPA 5JAUA 1UOEA 1E64A 2J9FB 2VHVA 3W2FA 3PL5A 5L3ZA 3RCBA 1Y8CA 3QU5A 1II0A 2RGUA 2YN0A 2FPUA 3HSKA 1XKQA 3UQYS 2QM3A 4CEJA 3Q5EA 4UHHA 3SR0A 5BMVF 2R96A 1Z6PA 3YASA 4EQ6A 1KOJA 3E9QA 4H08A 3DAPA 2RGDA 3KZVA 4P3NA 1YTUA 5CDTA 5JARA 1N8NA 4FONA 4JNCA 5BOVA 3G0HA 2I3BA 2RB4A 2M9MA 1VKJA 5D86A 2ORVA 2HDOA 4F92B 1TCBA 1U2EA 1IHDA 3PJDA 5L7YA 2CUZA 1W36B 1ZICA 3RVBA 2JC3A 4DRYA 2R11A 2WU8A 1ZGHA 1EA5A 1QZXA 3IA2A 1Z12A 3BD9A 4LOAA 1SUBA 4YCJA 2OUIA 3UBMA 3WY9A 5BYKA 4DQVA 3V4LA 4ONEA 1JB1A 4BZXA 4F93B 2DQSA 4CKBA 1O54A 2GXUA 2UZAA 4HWTA 3KEGA 3F8WA 1G3IA 1KFEB 4H60A 4OHRA 4RO0A 2XIJA 1VB3A 4J1TC 4ALIA 1E7YA 1T5TA 5IKPA 1PN3A 1VJDA 3JY6A 1RWWA 3TFOA 4XGKA 3PV0A 1M1YA 1MPTA 2VTBB 4KFTA 2PPLA 2ZYDA 3LBNA 5JAQA 2J7KA 1JWAB 3EXHB 4E6PA 4LDQA 3VKHA 1UPTA 3KYIB 1M1XB 3MS2A 1PL7A 1U7UA 1Z4IA 2XNCA 4HGRA 1WVIA 1G2QA 2E87A 3VDMA 3UBTA 5ECGC 3EEBA 3GB9A 2XGOA 2VFAA 2IH2A 1VBKA 3CZAA 1EQUA 2H92A 1YKGA 2H7YA 2YWFA 2HLPA 5CJPA 5KTOA 5U9CA 1R6VA 5GADl 2A5LA 2P78A 4XLTA 1P1IA 5AJTA 2BFOA 2XLCA 4BU1A 3ICQB 1DBSA 1R5OA 1RWQA 2I4MA 3BMNA 4S24A 1C7QA 2ZAYA 3R20A 4ZDWA 1QYRA 1AA6A 1IWBB 2HIHA 1EDZA 5D5QA 1N0HA 1IN5A 4CQMB 1NVEA 3NIBA 1CRZA 4D82A 3UWKA 2LBPA 1HRKA 4AL4A 5JSFA 4K9RA 4RF2A 4V03A 1ZITA 1NUTA 1CR1A 3CRZA 1QE5A 2BDEA 2QTFA 3D6HA 3D6MA 1DC4A 4JHXA 4WKBA 3STUA 4BQQA 5AW3A 2AJCA 4KW7A 2B1IA 5EE9A 3F73A 4PAOA 4C0LA 1GV0A 3C24A 3TOXA 3I6QA 1LFAA 3EIQA 3ZQ4A 4PVCA 5L3VA 1J0DA 1I9CA 2PRSA 2QD5A 3HWWA 3RR2A 1KEUA 3CZ4A 3SJCA 4ZAFA 2A0UA 5DYYA 4DKJA 2W6CX 3HJUA 3QMWA 1DKLA 2HN9A 3LX8A 4YGYA 1J1UA 5FBVB 2V65A 3F71A 3IAFA 2FJPA 5EI5A 3TG2A 4M0EA 4H15A 1VP3A 4RPJA 3ZGYA 1MX5A 3T3NA 1E3DA 3I52A 4EMTA 3NASA 2XCTB 3SFZA 1O0BA 1Z8HA 3L7YA 2JS7A 2Q4OA 4B3XA 5DYIA 5AM2A 3G5LA 4GW3A 1DCTA 3KJZA 5AI6A 1V9SA 5ARCA 4MGHA 4EDFA 1KTIA 3D3KA 5ILQA 4ZAYA 4ZVKA 3DWEX 2QGNA 2O8EB 5JCJA 2EJWA 5T3YA 1PEAA 4B1FA 4FCWA 2OMEA 3H9CA 1GR1A 3C1TA 1E3TA 3FCUB 3V55A 2J3DA 3T7AA 1E2HA 5ECWA 2GLXA 4BLPA 4UUPA 2HWWA 1X7YB 2LDXA 2GEBA 3IOCA 1R0XA 2Q9UA 1NP7A 2XR1A 3BKXA 3FYUC 1TM7E 3G6KA 4GVLA 3MILA 4HDKB 2HSZA 3VNUA 5C4MA 3E9MA 5AVVA 2UUBB 3T34A 2J09A 4CDMA 3K0AB 4XIJA 1XDDA 2I87A 4CIXA 4I81A 1AK2A 1NPTO 2Y66A 3DLTA 1PZNA 3SVLA 1IAVA 2QTRA 3L7OA 2DKNA 4QNRA 5HF9A 1OWNA 3QYPA 4KQWA 4Q1VA 5PNTA 3U7EB 4WXYB 2VH2A 2Z2IA 4DG9A 5B7NA 4EHIA 1ESNA 2F9LA 3GDOA 4TL6A 1PLKA 1ZD1A 2CXUA 1QH9A 5A03A 1NXOA 1BVUA 2VEOA 2GKGA 2MSDB 4I55F 4RKEA 1SHJA 1QO0D 1VLJA 2QUZA 2VRCD 1KI1A 2V0CA 2DU8A 1V6AA 3IAS1 3AEUB 4WPGA 1MJHA 1DMSA 2CNOA 2HKIA 3H9UA 3LF1A 2F8TA 1EAMA 2BRUC 3TSAA 4UU8A 3K5HA 4BZWA 3QUTA 4YCCA 1RACA 2H8GA 2D8MA 3FJOA 4CHTA 3K96A 2X8JA 5IN5A 4A8PA 3EZXA 1M1YE 3I5XA 1Z39A 1W0CA 2HA3A 1KZ4A 2IP4A 1YD7A 2XOXA 4DT1A 4LF4B 1NLZA 4FYJA 2H52A 5AW4A 1FDTA 2MHCA 1N2CB 4HBZA 5CA0F 2YR0A 3C5CA 3FY4A 4A0GA 4OSEA 4BFYA 4KQIA 3ZUPA 4ITVA 3CPHA 3KL2A 1QBGA 1MAVA 4TYNA 1PD1A 2O3JA 3DB2A 4MP6A 1BS1A 4IUYA 2PGNA 3QX8A 1FBNA 1YDMA 3NNDA 1U8ZA 2ON6A 1GEEA 3ZS9A 3CO0S 4DIDA 3D2LA 5FR2A 1RYBA 4JK3A 4Y9RA 3SYRA 1NMYA 4LA4A 4PRKA 2PX4A 5AVRA 2QJRA 3SBOA 2X4IA 1D2GA 1DTWA 1PD0A 2QN8A 3JQFC 3PUKA 2WM8A 1FTWA 3THOA 4EATA 5T7BA 4BXOB 3KWMA 4D9HA 3GHYA 5JASA 2B21A 5K0BA 5KYYB 1XD2B 3BE5A 3VYUB 1SXGA 1MB2A 1QGOA 5FEMA 1L5KA 1MFPA 3UWOA 4OXYA 3W2TA 4AX4A 4MCHA 1C9JA 2HNKA 3D59A 3DQZA 5GTDA 4XZ3A 4DV4B 1X7ZB 2ISCA 4YT8A 5ESXA 4TMVA 1WV1A 3R5JA 2PA3A 3GZNB 3VPHA 2XMGA 4IV5A 2QMYA 3EMVA 1B0ZA 1MAUA 3G9ZA 3DPUA 3PSAA 2JH9A 4CBVA 5KOIA 3ZXXA 4M3NA 3REQA 3FB1A 1PJ3A 3QEOA 2OO5C 4FOSA 1WB4A 1CY0A 1DWOA 1HDOA 2DGDA 3QMVA 4IDGA 4IICA 4OQ4A 5AM5A 5LB4A 2BBOA 3OQVA 4XQCA 2NX2A 5HE9A 4XUEA 4UXIA 2XUOA 2Z8XA 4LFAB 1TF7A 2FEXA 3ELWA 2VDVE 4BO4A 2C57A 2V4ZA 1M74A 4IXDA 3ZDFA 3E82A 7MHTA 3BJEA 2YV1A 3JD1A 3EOAI 5DI3B 5DYNA 4X64B 4C4PA 2PSEA 1Q7GA 1XU7A 1ACLA 3ABRB 2PZGA 1KSGA 1QG2A 4TWAA 3L8MA 5AOVA 3WAKA 2BSXA 3KE9A 2GEDA 5AKJA 4FFWA 5KOHA 1A8PA 2AD1A 1OXKB 3JZIA 1VM6A 4XDHA 4CL0A 2VF2A 5A4AA 2P40A 2C92A 4PGGA 4Z0PA 1M72A 2BI8A 1Z29A 2G28A 4ARSA 2CJWA 3CZMA 3RHSA 3R7SA 1EP9A 3E70C 4GUDA 3VO1A 4BJ1A 3Q8MA 2IX9A 1SIWA 1XD8A 5EUMA 3RRJA 1U3DA 1YGYA 3LGXA 1EBUA 4UXHA 5AVOA 2YIJA 1M76A 2VOEA 2B2XA 4RA6B 2QYHA 5K6TA 4CM9D 2JF0A 4DUPA 1KDOA 1YJ8A 1C50A 5BXYA 2R62A 5J4YA 5KSYA 1FLNA 2WIGA 1PUJA 1I2MA 2LP4Y 4OB7A 4V39A 4A0HA 1QQAA 1C9MA 5CFLA 5L95A 4YJFB 3ER6A 4JLSA 2H2GA 4PG6A 2CE7A 3O26A 4UHJA 4ACAA 3U7HB 3DE5X 3HE3A 4H7IA 1FU8A 2R00A 4HTFA 4YRSA 1E18A 4BCDA 4UDXX 1WMBA 3IQIX 1BHJA 4EJSB 5FUYA 1LBQA 3HM9A 2HBYA 3Q98A 5GJBA 3GBPA 1U2PA 2Y6VA 2ZCUA 1YZQA 2INGX 4C4XA 1E1CA 1JAZA 2IJGX 4RMGA 2PRJA 2D2FA 4M76B 4QGGA 2FPPA 3JQ9A 4PCVA 4O4HF 5T8KC 4H3KB 4LNUB 4QJBA 4D45A 4JIMA 3KVRA 4EL0A 4HYEA 2ZUSA 1T1JA 1V43A 1XEXA 4ID3A 5CVVA 3T7IA 3TRIA 4BV3A 2AC2A 1E4OA 2F1OA 2Q8QA 2FYTA 2UZ3A 3D1LA 3D1VA 3IP7A 1KDPA 1T4DA 2X7HA 3A32A 2GZ1A 3AV0B 3LKVA 2V7QD 3OZWA 4OP1A 1RJDA 2R6JA 1T2NA 2ZBRA 3I9V1 3QLUA 3KLMX 2IXAA 3A0UA 2GBFA 3LBHA 5EN4A 1E4EB 1QOZA 1WIWA 1I80A 2CBXA 1NUQA 2BBTA 4LDZA 2B61A 3AJRA 1ESZA 4FFOA 4H31A 4LTNA 3F5FA 3HJCA 2G9QA 1VL8A 3QMPA 1TO1E 2OGTA 3T52A 2CSUA 5ES3A 4PRLA 3VU3A 1UBGA 5DDIP 5FA8A 3DXFA 1W1UA 1L5FA 3ON5A 1MZPA 1J07A 3ZY2A 5INTA 1PS9A 3ZY3A 4UD2A 2X23A 3GLSA 1O2DA 3SF8B 2BVNA 5JHGB 1YS7A 1JHDA 2VR1A 1FU4A 1WUIS 4NL4H 3ZYZA 5A6VA 1RRVA 1MO3A 1MORA 5LP6B 1JKJA 1L4LA 3U39A 1GT6A 1JXOA 1DG3A 4RTMA 1ULZA 3CLKA 1QH0A 4HGPA 4NICA 4LXTA 1F0NA 3PC2A 4P2BA 4OSOA 1QIEA 2AMFA 4BVBA 1SXHA 5EP4A 3AR4A 4GQBA 1OVGA 2H5JA 3WGUA 3HO1A 2QL5A 3CO5A 3JQGB 4WRRA 3LPDA 3FVWA 2NVUB 3WV5A 3KTOA 2O5EA 3P71T 1ZUNB 1Z5VA 4QBHA 5IANA 2WJZB 3E1SA 4BUCA 4RPHA 5AVQA 2VHQA 3TLBA 2BONA 3PFNA 4KE6A 3KJFA 5EXPA 2JJ8A 4WZ6A 3LC7O 5U1PA 3RTCA 1JQJC 2I5PO 5FIUA 3GWZA 3SDSA 4EK9A 1Y4SA 2A3RA 2IOFK 1KC3A 1ADGA 3B1YA 3FROA 3HXTA 1P6XA 4JLDA 3TOCA 3X2SA 3KE8A 4HVCA 1H1LA 2W2QA 2K7ZA 4I5GA 4CTJA 3THYB 1QQBA 4NCNA 1G8YA 2B5OA 1UBLS 1MOSA 5C1IA 4QBTA 4PZPA 1FNBA 3DBRA 5LQDA 3PLNA 1IQ0A 2R6R1 4PQFA 3ZCUA 1N9ZA 5JSQA 1JQEA 1YH3A 3TCXB 5MFZA 1AQJA 1RPTA 2L2QA 1NASA 3SHFA 1UQRA 3DWFA 1ISSA 4MWZA 1VPVA 4PNPA 2W4QA 2GHQA 5ECYA 1CQWA 4JBHA 2WZDA 2VYFA 2Q3LA 4IIUA 1WX1A 4PHGA 1YZGA 3P9ZA 3R8CA 3E81A 2CNWA 1QGED 2HU5A 4NJOA 3JVVA 3GCZA 3VI4B 4DPLA 2LNDA 1GVHA 4ES6A 1TT5A 2BR5A 3ZJ4A 4UAJA 4WWHA 3L0OA 4KAAA 1MXHA 1I7PA 4IJVA 5C8XA 4FYWA 3HDHA 1SU6A 1K0UA 1IZZA 1XGKA 5DEOA 4ZJUA 3JYHA 4Q5IA 2I3AA 2VXYA 3I42A 4DDTA 2AFHE 1DDGA 4L78A 1FP4B 2QIPA 1FX1A 4B4WA 1Z4MA 5JT1A 2JHPA 1UKAA 2RG7A 3FHLA 4D0LB 1GG8A 4U7WA 1X1EA 1YR8A 2AJDA 1P8JA 1P2GA 3D7LA 3M2TA 1IN4A 2YKGA 2BCEA 3G3EA 3Q7QA 4WVFA 1ETHA 1W4ZA 3TLKA 2ZWPA 4YMWA 1QIJA 3H18A 5DJ5A 5J40A 1NVVQ 3AESA 2PFKA 3JQPA 2AK3A 1WF3A 4NPHA 1P7CA 2ZANA 3PENA 3FD8A 4F6RB 2EZ9A 3B78A 3N3BC 4F38A 4FNMA 3TH5A 1E9AA 4JVSB 5GQSA 3A4MA 3TQIA 1Q1BA 4DN6A 2HFJA 5CX4A 1ZYUA 3A1FA 3B8HA 1JG7A 1II8B 1PNTA 3ZBQA 3U5ZB 3E22B 4B7CA 2YHAA 3N05A 3QW4B 2R8XA 5L45A 2G83A 4KDFA 3MFQA 1RKVA 4LZPA 1UXJA 4ETIA 2XCUA 5IT4A 3BILA 2EATA 1LDGA 2P3OA 3CRQA 4TV9A 3GEHA 2IYOA 3I5MA 2DH6A 1SN7A 3QBJA 4HWGA 2QX8A 5A9SB 3G6WA 1KKLA 4N7RA 5C8YA 5JCZA 3RS5A 5G4KB 5EESA 3FPGA 1HT2E 1GRQA 4E0BA 3AR8A 2YNMA 2PBLA 4KRGA 4DXDA 3A04A 2HJHA 2CVPA 2ACVA 1TCAA 3A7EA 2HBQA 2HADA 3PNQA 1T9DA 3BJMA 3AEQB 4OJQA 4A16A 5I51A 5FWAA 4QU0A 1NDQA 2CWWA 5IU6A 3KOMA 1OFUX 4Z4GA 3STHA 3S0JA 3T94A 4MUXA 2IQIA 4BO2A 2JI9A 1UMBA 2C4UA 1O97C 5BMVB 3FOBA 3ZVLA 4J4TA 4QASA 1MP0A 2CDCA 2YUIA 5KC8A 3RYCA 3EPHA 1ZD4A 3T0GA 3KALA 2PUTA 2R1TA 1MW8X 2J5BA 1WBBA 2WIFA 2Q21A 1GNRA 4R16A 4AMGA 2VYNA 5TRTA 3W34A 1VLVA 2ZVDA 2OSVA 1WUKS 1LTQA 4R9NA 1U0EA 5JD4A 3GJ6A 2VSOA 4C7OB 4EY8A 1NW5A 1W6UA 1S2LA 1QOQB 2C9CA 3MOIA 4RK4A 3TOZA 1D4FA 2AW5A 3EX7C 1ND5A 3ZD8A 1DKOA 4HNAB 3NKLA 4X54A 4ARZA 2KPOA 2CCGA 3AP3A 3LPNA 4CMAA 2HRRA 1XLTC 3EGDA 2IXBA 3H7AA 1G55A 3BUSA 4TXMA 4B73A 4C3UA 3AFIA 4QOJA 1M8FA 4TUYA 1SXQA 3WBFA 2VSQA 3CH7A 1MC1A 2J7PA 2BT4A 2XOKD 1B2RA 3HPQA 5AKLA 4L95C 1EJ2A 5F1OA 1P81A 1AVTA 1U0GA 2NZVG 4KZPA 2I6FA 4PHCA 1XZ8A 3PICA 3OA0A 1CJBA 4V24A 1ULBA 2W0SA 2JGJA 5H1YA 5K3EA 3QNWA 5LQKA 4IOKA 1I7DA 2ZZNA 4MWCA 2WKSA 1N3YA 3KQSA 3ZU4A 1OHHA 4NRDA 2VRBA 5DCLA 2JLWA 3PHHA 3BB3A 3M1LA 3NW9A 4JY7A 3Q9UA 1PJ4A 5ICCA 3ZHCA 2FOLA 3MCUA 1Z38A 4RW0A 4OL0A 4D4KA 5KNLA 4NFYA 3WGNA 5JY1A 4KIGA 2CZGA 4UCXA 3WJAA 5MDHA 5CYFA 2EP7A 3ETDA 2Q0SA 5CFPA 1VMDA 2NPOA 3KHSA 1W30A 2RI1A 1G8MA 3MGGA 2OZPA 3RF7A 4CUJA 5DTIA 4E09A 4I1PA 1NDUA 2ET6A 4UFNA 2Q3BA 2SHKA 1JE0A 2JL1A 1BX3A 2Z8ZA 4W7SA 3W5DA 1LF0A 4QL3A 1YFKA 3BRWD 5EWLB 3N74A 5JISA 4P4TA 3DLCA 1E9DA 3IHLA 4D9IA 4MHTA 2E55A 2OLJA 5DM60 4B09A 3T3MB 1X1CA 3DFZA 1ZHHA 1XVVA 4Y0NA 2GBLC 4WKCA 2HXGA 5MN6A 3QVKA 1H6DA 1X70A 4KNVA 1EM6A 1I1OA 2XNSA 2NZWA 2D5IA 1CUZA 4FZRA 2JAHA 1O87A 1HT3A 4WFJA 1GA4A 1EWTA 2FSPA 2GXSA 3OWXA 2XT6A 4R6WA 3SK0A 4Z3KA 2BKUA 1E7MA 2IZ0A 4EO9A 1GITA 3G0BA 4NYJR 4KWIA 3QGMA 4KNWA 5AQEA 4D4HA 3WAJA 1PKEA 1XX6A 2FMXA 4HPJB 4NENB 4O4IA 1XYVA 2A3NA 2YZMA 3BGDA 4KKVA 2FEMA 3SI7A 1FJXA 4P33A 2BWJA 1VRCA 3QKWA 3O8OB 1FNSA 1KSJA 2H2FA 2RC5A 3GRAA 3OHMA 4M0FA 4TVOA 4A2CA 4ABYA 3AU9A 4AMBA 4H1UA 3DXYA 1A1VA 4A1OA 1ITZA 4S1WA 3OFKA 4IO1A 1ENPA 1GGNA 2YVKA 3CNBA 4RSHA 3KR2A 2WA1A 2GBIA 2WSMA 2OGUA 3R3JA 3R9XB 1SK9A 1ZI9A 1C3JA 2O3SA 4F4IA 1ACMA 3P9XA 5BSMA 4Q1FA 1CDOA 1CRQA 1U2QA 1T9AA 2BLLA 2QW0X 3WKDA 1DKQA 1QANA 2XDAA 4MCAA 4B6OA 5TF4A 1XN1A 3UENA 2P2YA 4FHCA 4G4IA 4I4CA 4L2IA 4Z3OA 3TIIA 1E2UA 1Z5NA 2NZYA 3UAXA 3LFUA 1Z6GA 1KAOA 1Z0SA 3EODA 3IMCA 3NM5A 2Q1XA 4LRQA 5DHSA 3ZWMA 1FTQA 2GR9A 3AW8A 4Q24A 1RJWA 5J2UA 2QRMA 3FDZB 3VJRA 1QRTA 3UOWA 2FPSA 4BRUA 1GGKA 3DLIA 1GTG1 2V7VA 3DMFA 4L73A 5FLXA 1HDCA 1EFKA 3X3HA 4A03A 3QLEA 3E1KA 3I9OA 4N3AA 4ZA2A 3NEJA 3CVXA 4X85A 4N3NA 1L4NA 1QGUB 2IWHA 5ANRB 3HFSA 2FSIA 3OAAA 3R7AA 3RQIA 2IIPA 3VZRA 4I55B 3CF4G 1A9TA 1MQ9A 1UXOA 2JGDB 3VO9A 1S8NA 4EG6A 1XROA 5F3WB 4I1IA 1UOOA 1RWXA 2BMAA 1LF5A 2FE4A 2JBAA 2OYSA 4JLOA 3K0SA 4TMWA 1UBOS 1GG9A 3CR7A 3I8OA 3DW3X 4P6VF 4Y1FA 2LZ0A 1RXWA 3W9UA 1P1JA 2EF0A 1ND6A 4HMOA 4EA7A 3CNNA 3FJYA 4HH1A 1IWOA 3GPLA 1A98A 1N7HA 4N01A 4PZEA 3AFGA 3E58A 4LFCB 3NKFA 3P9YA 1NLYA 4N4AA 4R5HA 3BIJA 3JATA 4NLLA 3IUBA 4QTZA 3VR4D 3GAAA 3RJ9A 4JITA 3AWIA 1EG2A 3B2QA 5D01A 5CMLA 3P94A 1X1QA 2I6GA 2JLQA 4QATA 1ECJA 4US0R 4XUDA 2N1BA 2IU6A 5FTKA 1V8BA 1HEUA 2WQZA 1VBFA 1LCIA 1SHUX 1L6IA 1W73A 3UV3A 4BYMA 5I4KA 5JECA 3IKMB 1Y6RA 3QKIA 2AUTA 4UEWA 5CA0B 3MJDA 5JSHA 1B8UA 2QLTA 1X0XA 4B3MB 2H4JA 3SMQA 1ZO8A 1FNCA 3HB0A 2HDWA 3IVCA 3KXPA 4ND6A 3HZHA 2JLVA 3BHJA 3QX9A 4RMNA 3O0TA 3I64A 2FG6C 2NU7B 3OFSA 4L0MA 3WNZA 4ZHQF 2X42A 5EIEA 3U4QA 1EB8A 5HR5A 1L4YA 1P7VA 2ZRPA 1G5PA 2IYZA 2JH8A 1ZMTA 1D1PA 1MRNA 1CK4A 3L01A 2IYYA 2IHKA 4PWYA 4PBRA 1ZCJA 4RY8A 2O8DA 2WFZA 3PFHA 3TLMA 1R9MA 4DDKA 2FRVA 1XWWA 4M7PA 1IWPB 1HLPA 2ZSIA 5TNXA 1SVNA 1ULAA 2DWOA 2YXDA 2B99A 2W8BA 2ZSBA 3E35A 3OEHA 1QTQA 1RXUA 4KQ9A 1TVKA 3LVBA 4KMOA 1PTJC 5F1PA 5IX8A 2VNAA 4FLEA 1UH5A 4JR1A 1BROA 1GTMA 1RMYA 1XTJA 5FA5A 4JC5A 3SHTA 2C9YA 1O94C 5JHHB 1CE8B 1DXQA 1ODLA 1QQTA 5EJ9A 3PTLA 1J49A 1NVAA 1F0PA 4HGYA 4JS0A 4DGSA 5G02A 3UMJA 3I73A 4FXOA 3ZEAA 2RAVA 2RGNA 1AQIA 2A9FA 1K5GA 2WHPA 2HPVA 2I7VA 1SVMA 3ABIA 3K0BA 1ZESA 2ODAA 4FT4A 1A7JA 2P11A 3Q7SA 4PLYA 5HA5A 1CBUA 2NSLA 3H87A 4QUHA 2BTQB 3ZVRA 2AF4C 2PGXA 3GLRA 4Z53A 2XTJA 2VP4A 3ORFA 4IDNA 4B3FX 1NP3A 3IPXA 1P4HA 3WLMA 3D2AA 4UHEA 3GD5A 3L7AA 3EXEA 3RHFA 1WZNA 3FKSA 2GPTA 3PCTA 3D64A 4MIYA 3HXMA 1RTKA 1E1YA 1A5BB 3PL1A 1VMEA 5T5QA 3TZLA 2G9UA 3KKZA 3KNZA 4NESA 2EIHA 3WNCA 3MWDB 5E1MA 5HKOA 1QHGA 4QSHA 2QG4A 3QU9A 1QIKA 1QVZA 2EXXA 1L1QA 2GCOA 3PHLA 4M88A 3HZOA 4BNJA 5J1SB 1IN1A 9ABPA 2VKTA 3RSOA 3MWGA 1AHNA 1UDWA 2RHCA 3GEGA 1VIVA 5CVEA 5DRTA 5HIJA 2MT9A 3TKYA 3U1TA 5TEVA 4F5EA 3I23A 3ETNA 3F6PA 4OK3A 5CUQA 2IW3A 5IM4F 2SKCA 4HPWA 4Z99A 2HL6A 2YMMA 1S0UA 3OTGA 4RPCA 2W42A 3L41A 5ALUA 3C6ZA 3DGFC 1CY6A 1I2DA 4TN1A 3MMPA 2VPYA 2ZAOA 1MA0A 1LH0A 3BWCA 4X0EA 1EVYA 2O2ZA 2I4LA 3P20A 4O4HB 4RHFA 5IP5A 1TU3A 3V46A 4D9JA 4UOZA 5G0UA 4IRMA 2V6JA 2AXNA 1QP7A 4L27A 4M83A 5BN3B 1T0JB 3FBWA 3EGVA 3F7TA 4FZ5A 4PQRA 4QOHA 3R5HA 3QFHA 1D3AA 2YQZA 2HBZA 2GZDA 1A8QA 4WINA 3QUQA 1N2JA 2HDNB 4QOIA 4GZLA 3QV2A 1WWKA 2EZUA 4UQOA 2C2MA 3E3OA 4J3FA 2RH4A 3VU9A 2Q9AA 2QQFA 4ARIA 5AVXA 3CC8A 3VMMA 1N7IA 5JW6A 4BKUA 1GGFA 1YZFA 2HCTA 3UAYA 4NX2A 5TEWA 4HUTA 721PA 1JDNA 4BKOA 2BY4A 1MC5A 1G42A 2IHUA 4HMPA 4RZUA 2BW0A 3T7EA 1QZTA 5MHTA 1USUA 2FVXA 3M83A 4MROA 3K2QA 3NDRA 4E5KA 3H3XA 5EFZA 2VQ6A 2ZSDA 3K4HA 1OIVA 3W8EA 5K1ZA 3EZ7A 1N2OA 3K6JA 3N0XA 3F6EX 2QTCA 2WYIA 3TTTA 4V3CA 4MRPA 3CF4A 4ZVUA 2SKDA 1HLGA 5CXQA 2ZRQA 4GI5A 2D74A 1T36B 2H1CA 3S2UA 2BHSA 3VVMA 5BPHA 3OIVA 3D5TA 1W49A 5H0IA 1U90A 4BBJA 5CB4A 2H3HA 1GTSA 2WK1A 1TF2A 4C05A 2OLKA 2HU2A 1HT0A 1W9HA 3PTAA 2YY7A 5JS2A 3H3JA 4EGFA 3BA6A 4QXPA 4JJKA 3ZTYA 3RARA 1WDTA 1UINA 4N3CA 2J6CA 4H0FA 4LEIA 4MUNA 1Z63A 9MHTA 1D07A 1SU8A 2OR3A 2X6RA 5CLGA 1XQXA 4US1R 2OUKA 2BKLA 4M0LA 1JAXA 3BCHA 3E2MA 1HFJA 3GLVA 5D7NA 3ZHUA 5C18A 2FZEA 5I47A 4K5QA 3UK7A 2ZYGA 4X62B 2HF2A 2W2KA 2E1PA 3IBCA 4Q3AA 5LQJA 4Y6LA 1H0KA 4B5LA 2BM1A 4KXQA 2WAAA 3GUHA 1NQWA 3NO4A 4GYJA 4PLGA 3TW0A 4YRAA 1AU9A 2XRZA 4M9CA 4LXIA 4FMBB 3RUEA 1FB5A 2C4KA 2JANA 4U2GA 3TBHA 4B7XA 1HDRA 4MMYB 5LQCA 3IHWA 3NHYA 3QXJA 3L1HA 3GG9A 1E2IA 3U4IA 4QU8A 4FFMA 5CYGA 4L72A 6PFKA 4N47A 1JAYA 3AJDA 4WKOA 3K35A 2VF7A 2F8LA 4WK2B 5IBRA 3WSTA 3SVZA 3PFFA 1Y1RA 4LWPA 1ISPA 1HUQA 2AUMA 3D0QA 4BQFA 2F3TA 1DUIA 2J08A 2PLAA 1MX1A 2Q1SA 1MQAA 2WM2A 2QQ0A 3IE0A 4GOOD 3RROA 1Y5MA 2FP4A 5SY4A 1A97A 1C9NA 3IPAA 4P5EA 4ZYVA 1HETA 4NXMB 2QK4A 4RDCA 2QRVA 2R1ZA 1NBIA 1J97A 3M5WA 4QULA 4R1OA 4RAQA 5EUQB 1N0UA 4EL5A 1X3LA 2PLWA 3U7JA 1DC5A 3MW8A 4EI8A 2BMWA 3E6AA 4RVCA 3DMGA 1A2OA 1WSAA 2VUTA 3H9JA 4O2AF 1W5BA 3LP6A 4ZMRA 4NBTA 1W5EA 3ESRA 4GF5A 4MDHA 5C7IO 3SJBA 5KX5F 3UJ6A 1X8KA 1E2GA 2DJIA 4IGKA 1NNSA 2ZJOA 3OE4A 2F1JA 1S9HA 2CHGA 1XPOA 1VFNA 5JC1A 3L1KA 4HAWA 4QJ3A 1RYEA 3FMOB 3PUZA 3ZKWA 3FPHA 2Y0EA 1K8QA 1SUSA 1DUSA 5CXSA 3K4PA 3OPYI 3WX0A 4YX9A 4ZEMA 1SCQA 1E61A 1X8LA 4ZOLA 1LSOA 2WPDD 1QGYA 1E98A 1ULUA 2X3UA 4RFLA 1XKXA 1COZA 3L3BA 3M81A 4LHEA 3RBZA 3RRFA 5BUQA 3NGLA 1WD5A 5LU8A 1XTSA 2AYZA 2WTEA 1REQB 2GZRA 4GGPA 2RHGB 1XRMA 4PTLA 3WLFA 5E6SB 4RA9B 1ZH6A 4C22A 1C4KA 1SOVA 4QRHA 1QJ4A 3U40A 1ELOA 2RHWA 3HJAA 1C3XA 1G9TA 2A6PA 3F7OA 3PB3A 1N3IA 3E9CA 3PUIA 4LOKA 4ZCQA 3F5DA 3E15A 1NGSA 2GK3A 2LIVA 3FTQA 3DOEA 4GKVA 4QOSA 3NCHA 1BH2A 4L9RA 2C8KA 2VJYA 1T5DX 2I55A 1V8DA 2QN9A 1SHZA 1V4NA 3KR9A 2YH2A 1QQ5A 4FIDA 1UC4B 3LGAA 1TK9A 3UC5A 3HDYA 1W75A 2I99A 2B83A 4B79A 1UADA 2O20A 4HUJA