1SRQA

Crystal structure of the rap1gap catalytic domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
330
Chain Sequence
b'KVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein 1
publication title The GTPase activating protein Rap1GAP uses a catalytic asparagine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 89
structure length 330
sequence length 336
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02145 Rap_GAP Rap/ran-GAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1srqA02
3BRWA 1SRQA
chains in the Genus database with same CATH superfamily
1P2FA 4XGQA 2QXYA 2IV7A 3LO5A 1DDIA 2ZSEA 1T0BA 1G9TA 1NVEA 4MTCA 3OOWA 1LTQA 3IAFA 4IO1A 2VJAA 4EB6B 2TECE 1RC8A 5H9WA 4OD0A 4S24A 1ZK0A 2XVZA 3ANTA 2O5EA 3PCRB 2YYSA 4KE9A 3ZNNA 4DJAA 1XTUA 1G4UR 2PXCA 3K0FA 4YO7A 1JFSA 4EG3A 2DQYA 1E8MA 3MMXA 3ETJA 4RELA 4B31A 2O9JA 2AJBA 2ATIA 3H9GA 3OBIA 4PVCA 3RRZA 2CVOA 3U7EB 3EVTA 1ZBQA 2A5GA 5HZHA 1J06A 1NF9A 2X76A 3C3DA 5AVOA 3NIWA 1E7RA 2HA4A 3EZXA 3D3KA 3EN0A 5FOSA 4IXMA 1R6DA 4AS3A 4CDGA 1J09A 4K3VA 3JQCA 1Q74A 4NPCA 3RYHB 4DT1A 4OV6B 4ERNA 2CUZA 2XGMA 3HKCA 2CLEB 1ES9A 1THZA 5JCPA 3NBAA 5B6PA 5JRJA 4TTRA 3OESA 2DPGA 1IVYA 2QYSA 2R3SA 3DM5A 2LR0A 2CNWD 3ZVNA 1FSFA 1U7XA 1XL0A 2DWCA 4U0JA 5H3HA 1V1MA 5JJIA 4KYUA 1U0RA 2HMVA 3C6QA 4JNCA 4LY3A 4MUAA 3GUUA 1CUWA 4LQLA 4PCVA 2D3TA 3SBOA 3PF8A 4N6GA 1DG1G 4Q5IA 1AHHA 4GBGA 3WE7A 3ZBTA 4BRSA 3P19A 3W3AA 3W2TA 2XMQA 4TLAA 3AVPA 4LOKA 1GYPA 4X93A 2QD5A 2YZ7A 4TUYF 4B87A 4H7FA 3BTSA 2EQ5A 4PYRA 2WBLC 1W6RA 3NI2A 5A4JA 1ST3A 2WPDA 4EBBA 4FDVA 4C4YA 1JAYA 4U3JB 4D1YA 2C96A 2PZEA 5AR1A 3ZE8A 4DLPA 1MHTA 3L8GA 1DELA 4ZEXA 1EHCA 1MAUA 4UOEA 2AYYA 3TEFA 4FFOA 3ZJ5A 7ABPA 1YXMA 2IXFA 4HUQB 4WXEA 4G0VA 4EJ2A 4X7PA 3MILA 3U7QA 1V8DA 2N0SA 4JOBA 1S1MA 3U3KA 5TC4A 4PAGA 5CT9A 5B2ZA 2QV7A 1AHNA 1UFRA 2WD8A 1QHXA 4J7XA 4HDKA 3O2JA 4DMLA 3D2BA 3L9XA 4Q12A 3HKEB 3DZGA 4K46A 2EGGA 3GPCA 5C5CA 4Z3KA 3W1VA 2ZR9A 4TWBA 4JJAA 2CEKA 4IIHA 4I1IA 5LQJA 2X23A 2XUQA 5E3HA 4CMJA 1VIMA 2OZLB 4HDOB 4RSHA 4DCOA 4LNAA 3U7GA 1DC7A 2HV9A 2PTGA 3BSWA 3GJ4A 2R11A 1AZTA 3GJSA 3OEEA 4QD3A 2NV0A 4X6YA 4EVIA 3FPCA 4JITA 3I6ZA 5BO5A 3GGOA 1Z2PX 4I6JA 3TRFA 4YJ2A 5T7BA 4IHJB 1NUTA 1OGIA 1E6KA 2W2KA 2NGRA 8MHTA 2JFZA 4X61A 5F7JA 3DMHA 3GN1A 2GGSA 3V4FA 3AQIA 4E3ZA 5KO2A 2RAPA 3H0KA 1ZD9A 1TTTA 2JGDA 1T9CA 4OXIA 2Z6AA 2LXNA 2JGIA 1ZVJA 5CLHA 2I62A 2PTHA 1Y48E 2W2OA 4GPD1 1EXNA 4NDAA 2G8NA 2QP4A 4JT2A 3VISA 5TEWA 4N39A 5FEUA 1FFDA 2IDMA 5JI2E 2Z1MA 2R7LA 3DUWA 3HYTA 3PQCA 4S04A 1BMDA 1VJTA 2QMZA 2XB6A 2M6SA 2OSBA 4Q18A 3LZCA 1BMTA 3FDJA 3KPWA 4NU0A 2AXQA 4WKGA 5KYWA 4N48A 3KLBA 1T5DX 3N8GA 5IBCA 1X13A 1I5RA 2F6RA 4JT4A 3AGQA 3OCWA 4WKOA 3WLKX 4AVYA 4D8YA 5A03A 3T5MA 4D9FA 3DE6X 3LLUA 3HU2A 1VYVA 2MSNA 1GRRA 4ZZ0A 3BFPA 4FIDA 3P0HA 2VRWA 4WZBE 4A27A 5F3WB 4JUBA 4X0EA 1ZUNA 1CULC 2KLHA 3D64A 4BV9A 2BMDA 4JLMA 3IP3A 2PIAA 4YCSA 4LHWA 1XF9A 3QW4B 4YRCA 1VLQA 1ZW1A 4QDUA 1ONNA 3E9DA 1IXRC 5AT1A 2HDWA 1T5IA 3SM3A 3UWMA 3KOYA 4MI3A 2IHNA 5C4GB 1C7RA 2WSSD 4B44A 3K1AB 2IOQA 2AXNA 3QE4A 3MBOA 4FR5A 1AD2A 4KXMA 3W9BA 4BB9A 2QXTA 4HAVA 5BR8B 5G40A 4O5AA 1GQRA 3HCCA 1MG0A 2XDQB 1WUJS 2FQYA 4CIVA 1F1JA 3FCAA 3AO0B 5HPYB 1JJFA 2P9QA 3N2KB 5F73A 5H3LA 2GX6A 3R3UA 2RH9B 1JIKA 1OWOA 4GMKA 4I4NA 5H59A 2JKYA 3OQVA 1Y8CA 4W99A 3NOOA 3EUAA 2XHZA 4ND8B 1J2JA 1M2OB 5E3JA 5IM5A 2PZFA 3EULA 3GARA 5DW3A 3TBKA 5HQ3A 1GAWA 1GGVA 4Y6QA 5KI6A 4C0HA 4C6TB 4QZVA 5I7EA 1UAAA 1URPA 4OLBA 1GG5A 3NHUA 4G97A 1MB3A 2JIRA 3ZXUB 3D8RA 4QFDA 3AEZA 3LUFA 5LM3A 2MDTA 3U9TA 1U2DA 2PA3A 3R7WB 4E4RA 1VBFA 1QRAA 2HHAA 4FFWA 1RRKA 3SDZA 2IIPA 2W9XA 1NVVR 1ULZA 2B4KA 2H1WA 2PMWB 3TRKA 3V1YA 1QBGA 2MYPA 4AP9A 1QV9A 1L8QA 3KZKA 1Z0IA 3OJWA 3K32A 5JYEA 5KWJA 2PUAA 3F2IA 2GCOA 2X8LA 4BFCA 5ALYA 1OXXK 1ATIA 3AVXA 3GH3A 1BJKA 3NV9A 2CZQA 3WGVA 4ISBA 2X15A 1TYDE 3D3JA 3IJEB 3KJEA 4LXIA 4XB6B 4D4HA 2HPHA 4LKRA 4QBFA 4RZUA 2EJCA 1E9SA 1Q6ZA 1L4HA 1LV8A 2Q5EA 4JSTA 2PWYA 4JJ6A 3ZHTA 4LISA 2BSQA 3BA1A 2IDJA 3AZQA 2W2PA 3JASA 4KV7A 4D57A 3CVOA 4NBSA 1QFZA 1WQ1R 5D86A 1KMMA 1M2KA 4M38A 3DH0A 4L85A 1KJWA 3PUYA 1NT2A 4DJFC 4IH4A 3GMSA 3HN2A 3ZWNA 4CKWB 3IUBA 2ZVJA 2C7PA 3RIXA 1W49A 4HNSA 5FYQA 4M99A 1JECA 4ZCIA 5HOQA 3NKLA 3U9SA 2RCYA 3EQ8A 3OCUA 3PXDA 4DNQA 2ZBQA 4FILA 2JLQA 2CF6A 1ZY2A 4TZ6A 4DLYA 5DHUA 4EJSC 3AHFA 4G0ZA 4LRTB 4BMZA 5EIBC 3PSAA 3RUFA 1RXSA 1X1SA 4BZPA 3KZXA 3P0FA 4WJLA 1R6UA 1HMYA 1CDDA 1CX9B 3G0HA 1L8XA 1E5VA 3QFHA 3ZE1B 4KN9S 4U1RA 1CQJA 3BAFA 1NV9A 3N2ZB 1GGNA 2C5EA 4N9WA 4O02B 5TNXA 3TECE 1GYRA 2ZR7A 1M54A 1WXEA 2BGTA 2QM8A 4WCVA 4EG8A 4LSGA 1G7TA 1NVAA 1ENPA 2YN0A 3X1DA 3MMSA 1HYBA 4EZEA 1Q15A 3AJ9A 4ETWA 1OWPA 2QI9F 3LLVA 3RS3A 4K1LA 4B7XA 3LT1A 2CFTA 4PZ9A 1CQWA 3F9RA 3IURA 1LX6A 2NAFA 1CRLA 1GZDA 1SPBS 2ZLBA 3CJQA 3O0TA 4HP8A 2ZGVA 3S2UA 5AW2A 1N5RA 5KJ1A 2D3WA 1JLHA 1P7PA 2C42A 2XKBA 2XI4A 4Y2GA 2X3UA 2IA5A 4K9DA 4XVRA 1XDUA 1EVKA 4U9UA 2B1RA 5M2QA 4C0SA 3GJ0A 1WOYA 4XDGA 3LMKA 3ZGNA 4Q93A 1E18A 3ZIDA 1Y5NA 1EIWA 4UQLA 1XCPA 5HWSA 2FFAA 1USVA 1UXHA 1BKYA 2WUGA 3ONWA 2RHOA 4FSXA 4PAQA 3UJHA 5HXAA 4XM2A 3A4VA 1DO0A 2YWXA 4B8YA 3EMVA 1Y6RA 4OQYA 4ABTA 2GILA 4ER3A 3O4FA 3DBHB 1U65A 1ACLA 4ARUA 1R64A 4TLBA 3D0KA 3ZWXA 4ZMRA 3HABA 4BO3A 2JEZA 5LR6A 1DX6A 3WK7A 3IVGA 3NVKI 2E1PA 3I6QA 5AM0A 3TINA 4E13A 4YUZA 5KIAA 4FX2A 2ZRPA 4BJHB 3VR5D 2ECKA 4ZT2A 3T5CA 1FB5A 3VPXA 3HV0A 5KTPA 1S2MA 3OEHA 4XH9B 2EZ8A 3PRYA 5BXQC 3FVRA 2CHVA 1NXTA 3G2NA 2O2CA 2VHEA 4KN6A 3V4SA 2CLOB 1FFEA 1JS1X 4JGGA 4UCFA 4DUZB 1Z4MA 4DR3B 1JPUA 1T43A 4EUHA 1J2YA 1FRFS 2PT7A 1UK9A 4Z8YA 1M2HA 5EESA 3W7BA 5IAEA 1DHRA 4HQNA 5FFNA 5JTTA 1FTGA 2FJ0A 2H1RA 1YB5A 4BUCA 3B3GA 3G0GA 3V32A 4YY3B 5BSEA 1TU0A 4O1MA 1GQFA 3Q7EA 1M34A 4XIIA 5FTWA 1HNWB 1E1QD 2CVHA 2YW9A 3OQMA 4AY4A 3NZEA 3PDHA 3OZCA 3L8YA 3SF0A 5KX5F 1HNZB 4OOFA 2H4FA 3OZFA 4ND6A 2IYLD 3SVTA 4FYPA 4G81A 2ZBPA 3KOUA 5BNIA 2ZJYA 1N3BA 1TU4A 2BF4A 2WNSA 3KAJA 4R2LA 5ALZA 5TQ2A 3SCZA 3TJMA 4N41A 2AWNA 4NG5A 4R0NA 4U63A 5BVHB 1D6NA 2R751 1D8AA 5IP5A 5AKKA 4EB8A 1LBEA 1F60A 1M2NA 1WMSA 1Y82A 2F3RA 2HU5A 4JEHA 4MLPA 4CQNA 3O9VA 5H9VA 4BECA 4FWIB 5JAOA 3D8UA 1L7AA 1NRXA 2V7WA 2KJQA 1QRSA 5HKAA 3URMA 4CQJA 4EQ6B 1IBMB 2AC7A 2VF5X 4BO1A 2ZUBA 4DAOA 3K0SA 2HCBA 3FUVA 4N6NA 1MEEA 2W4QA 2WIAA 3SVZA 3HUEA 2NUAB 4M9UA 1A9XB 1Z45A 1HPLA 1ZM4A 4BATA 4EEKA 4EHJA 4DV1B 5KYYA 2Q1WA 4EI7A 4K28A 2ZUDA 5FOWA 1YDHA 3VAYA 4RTSA 1V3VA 5F76A 2G5TA 1IG0A 4TX1A 2O50A 1CRPA 3EGCA 3IQGX 4GVXA 4YDHB 2KHZA 2DPYA 4LWQA 5CBPA 4B6OA 3BE4A 4J03A 1U7WA 3LVQE 4GM4A 4BY9E 2BE7A 2PGOA 2BI7A 4KV9A 4A9AA 4B6GA 5K0EA 1V39A 3I76A 3KYCA 3WHKA 4XWTA 4EUSA 5C8DA 4I8IA 2D0IA 1ZINA 5F7OA 1UM9A 4UTPA 2Z9CA 1R9JA 1SVKA 1SCUB 2RJNA 4HXGA 1HGXA 1M8GA 1OTXA 3EVAA 3IKJA 4TLEA 4KLRA 2R1ZA 5HIMA 3B7WA 5ALSA 5I5GA 1OOEA 1VSQA 5AVTA 1Y8QA 3CUVA 5JXJA 4ZTBA 1YC2A 1GKYA 1BU5A 1A69A 4GR5A 2VDOB 3QTTA 2ASEA 1T5LA 1UFOA 2PZGA 4LMPA 5LKRA 4H1HA 1IOLA 1W25A 1D9XA 2O7SA 4MZDA 1SCJA 3RFUA 2J0UB 4Y9UA 3UZUA 4BU0A 4C2AA 2L17A 4XLZA 3HEAA 2AMVA 4FMDF 2HSZA 1XXHA 5H16A 1A71A 3QPVA 2NVUA 2R60A 3PCTA 4GH5A 1OLOA 1S8NA 2FOIA 1HR0B 1WS6A 2LRHA 3G8AA 5K20A 5AKJA 2H1VA 2ORYA 4ZP1A 3I23A 3FZYA 1MG5A 3L6BA 5JASA 3TZBA 1OBHA 1RYMA 1NG9A 1X94A 1T3ZA 2PWZA 3ORFA 3PC3A 4RLHA 1O5TA 3H3JA 1WO8A 5CG2A 2AR0A 2CZGA 2AQHA 4L8GA 5I8PA 3SHQA 3D4NA 2HF2A 4NU6A 5IULC 1DHTA 2VNHA 5EWJA 5HBGA 2NSDA 3IEUA 2OD2A 1JLRA 3EGDB 3QFCA 1XWIA 1WJGA 2NU6A 5KSOA 2YKGA 1Y1PA 4BHTA 5CVEA 4I6GA 1QIIA 4DA0A 3M7IA 1ZNYA 5LXTB 4W1SA 1KZ9A 4CLRA 1C3LA 1IIBA 1SC9A 3K1JA 2CMKA 4KDCA 4RVDA 5FP0A 4QJ5A 4JBIA 1YFKA 3LY7A 3WMXA 1JPJA 4YAWA 3ADKA 1MW9X 4JCCA 3SF8A 3CCBA 3BWYA 3RREA 3CZ5A 1B6GA 3RGGA 4HX5A 2Y1CA 1IMOA 1E7YA 1QU2A 1FTQA 3ER6A 4QUKA 3ZWDA 2V74B 1FFHA 4DEYA 1KC1A 3H2SA 1A9YA 4X85A 2IZ6A 1I7NA 4FS8A 3WHPA 4ZI7B 1SAYA 4IIBA 3R5TA 2FVYA 1Z35A 4F4CA 5KJ6A 4ZICA 1RRFA 4RDCA 3SU8A 3GLHA 5ALDA 3FJOA 4G86A 5EIFA 1FW6A 3MAJA 3P9QA 3EQ7A 3A3NA 4QUDA 3FOWA 3FOAA 3U7JA 1XHFA 2COEA 2D1TA 1F9AA 2M32A 5TJHA 2IYYA 4A1OA 4LYJA 3VR5H 1SQ5A 4JB2A 1V2GA 3OIVA 4NJMA 2XAUA 5KTRA 1ZOLA 1AUOA 1MO6A 4HDMB 4KW7A 5AXCA 2FK8A 3ZWAA 1RKBA 5K6RA 2EERA 2VHCA 3PNSA 3FW1A 3UYLA 2XRMA 1TQHA 4EG7A 3FOEC 1DX4A 3TTUA 1PZMA 2R4TA 5D3MB 2IEDA 3AOEC 4FQ5A 4HDRA 4JP2A 1E3WA 1Z22A 1KY2A 3TTTA 4CMKA 4O0MA 4DIOA 1C3OA 2X1LA 4U6SA 1WXIA 1VLZA 3BTOA 3V1MA 1JHAA 3AKEA 2GCIA 1UDCA 2VP5A 4PXAA 1Z4JA 5F5XA 1EG7A 3LPAA 1SVMA 1G8KA 1XKTA 1Z6QA 1OROA 3OCJA 3VI4B 1L4BA 1Q91A 1J42A 1SK9A 1U3CA 3AEKA 2A0FA 2IIBA 2YOGA 3OEED 4X1YA 2RGXA 4AMZA 3GRYA 2FN8A 3O4VA 4J0CA 5AJXA 3AU8A 5DVZA 1VHDA 6AT1A 2VDLB 4IOJA 1LNSA 1USGA 3CT4A 1JU4A 4MQFA 3NS7A 5KKAA 3CF6R 1R1DA 5KOYA 1T9GS 3ER9A 4YJ2F 2XUPA 3TB6A 2CDCA 4YRLA 4M1YA 1N92A 3I9MA 4OP2A 2R25B 3UH0A 3U16A 1SHTX 1QF7A 3HVRA 3AFHA 3HEBA 4X41A 3U7QB 4M1OA 5IHPA 3AF4A 1U7DA 2DYKA 2HNAA 2JF0A 5EIEA 1XP8A 3DNFA 1I5OA 3OA0A 4JMPA 2JI7A 2R6HA 3B1KA 4AYXA 3H0EA 2EBWA 2ZTLA 1QDEA 1YONA 4LXYA 1FYWA 1BJTA 2I1LA 3KSDO 1D1SA 4GO1A 3L7KA 2CV2A 1ZI8A 4WAUA 3IIMA 4HN2A 2P6PA 1KAHA 2D06A 3P4YA 3PPYA 2OVFA 2Z2IA 3EW9A 3E3LA 2Q6KA 5PGMA 1K86A 2F64A 4XUDA 4F7DA 3OURA 2OFPA 3EDMA 3OETA 3ZHSA 5AH0A 4CM8B 5JR3A 2OD9A 5GQSA 1E77A 3NRJA 1XB2A 2B4RO 1BJRE 3RD5A 2P2ZA 3I6MA 3TFQA 2QN1A 3WB1A 3TSZA 2C4WA 3P9NA 4TYPA 1FDWA 5K1ZA 3VSBA 2AL7A 3BCUA 5I9LA 1NXXA 2FMHA 3HY6A 2L18A 3TDKA 2XUGA 2VHXA 3PU6A 4R9UC 4QYIB 4TL9A 3R7BA 5LWQA 4M1SA 3Q10A 1A9QA 3IP9A 3LKVA 2MU1A 3OX1A 3U3ZA 3VHXA 1NVFA 3K9GA 3I04M 2I9PA 2UVQA 3ISVA 4HB2A 2IIQA 3GAAA 1EWRA 3TUIC 5C7LO 3MWYW 4HAZA 2Z3VA 3C3KA 1OBVA 2WP0A 1JHMA 1VCNA 4ARBA 1YB7A 2KBEA 1T4CA 3F74A 2W6QA 3GEDA 1A0OA 3F3KA 4KYIB 4RETA 4ILKA 3G2HA 4WOPA 3SX4A 1H66A 1P1CA 3G13A 4PANA 1KI4A 5ENDA 1XMXA 2QQFA 4J6FA 4F1WA 1YCHA 2BFDB 2BUBA 4X94A 3KJHA 4HVAA 1S7CA 1T3GA 1IJBA 1O4VA 3G7NA 4DGQA 1DBPA 4C7MA 1JEDA 1W5EA 1U04A 1RXUA 2AF3C 3RWOA 4K6OA 4Q00A 4DR5B 3WRYC 1EUDB 4J9UE 2FPKA 2P5UA 3QHPA 4KO8A 2V96A 3DE2X 3QKSB 4KLCA 1YB4A 3T7EA 3WK6A 1N2BA 5EINA 2NSHA 4TYQA 3ANNA 3D4BA 3UQZA 1P9LA 2XCOA 4RLSA 2DCMA 2Z5VA 4NRDA 1TLTA 4UULA 2R00C 1UEIA 4N54A 2OKGA 4NL4H 4UBJA 2RGAA 4KP7A 1ZU4A 1JDNA 3A4NA 3HFJA 3SC3A 4B4OA 4CJXA 1T0IA 3ICCA 3BRQA 2W2MA 4OB8A 5LUAA 4FYIA 4O29A 2GT1A 5REQB 4V38A 1NVGA 1S9DA 4C3OB 2Q5CA 1TA4A 2Q07A 4QE3A 4LYFA 3CBGA 1P31A 2RHHA 4INZA 4GMGA 4L72A 3TI9A 5HM8A 1VRVA 2FSSA 1YZ3A 2CFIA 4UOZA 1Z38A 2Y8EA 3D3WA 3WBKA 3ZDXB 5AVYA 5I01A 4MSUA 4CIXA 2Y1DA 3H9JA 4U2GA 4BX8A 2QVGA 2PX6A 4N3BA 2QZZA 3OQ1A 2HYIC 3C85A 3V6LA 3GVXA 1UMBB 3L1VA 4OJYA 3VC1A 2VPWA 4L0MA 3HRKA 5E0KB 4F3YA 3OLZA 1I01A 3IDSA 4JKOA 4YN3A 4Q7JB 1SY7A 3I92A 4EJFA 5DHTA 3LWNA 4N8SA 1KYXA 2P62A 4IPTA 4X20B 1Y6JA 4JQCA 3X1XA 1O89A 1P4JA 2K6GA 3WISA 1B6RA 3UN1A 1S4QA 5DKFA 2NNLD 4YUAA 3PIRA 2CD7A 4J4HA 5EHNA 4EIWA 2HHHB 2Y4NA 1QPBA 3KKMA 5B1HA 3HXLA 4ZXPA 4CCWA 3WA7A 2ZCJA 2J45A 3SMQA 5JEEA 4UXIA 3QEMA 5J59A 2P4SA 4OO3A 5J40A 3CZRA 2AFIB 4RIIA 1EVYA 1GGFA 1ORDA 2JB9A 3SIWA 4BVGA 2WJ4A 2RGRA 3DCJA 3LQRA 3VYTB 3I3SR 2VC2B 1JJBA 3ANMA 1U3UA 4PLZA 4RGVA 5ARCA 3TKAA 4E33A 4CKCB 4TWJA 5DNUA 3C5HA 4WXPA 2GLTA 3ZY2A 3V7NA 1U7HA 1HEYA 1ZM3A 3K4PA 2VJKA 2FDRA 5LVAA 2VJBA 2W2XA 3K05A 3MJTA 1EP3B 2C4UA 3R3XA 1SH7A 1Y8RB 4N0QA 5IJWA 5LBIA 4K0RA 5JS8A 1QJ4A 1TCBA 4OMCA 3WIUA 4CKEB 2VXYA 2E4YA 3EZ6A 1E1RA 4MAMA 1WOMA 3D1VA 3ZI4A 4B47A 1N9KA 2ZYVX 1JLMA 1MXHA 3NCTA 3HA2A 2C57A 3LKZA 2OZPA 3ROMA 2EAUA 2HA2A 3K20A 2ODWA 4KYVA 1L4UA 4WK6A 3HYNA 4RULA 5CD1A 1LF5A 4QXQA 4HJRA 1J6UA 2C8VA 1J0DA 3CA8A 3ZE0B 5JI3E 4HVTA 3LX5A 2QE6A 2XCLA 4YJ3B 4BMSA 4H3HB 3OEHD 2GVDC 4JBXA 1VMAA 4UCWA 1EFAA 2BGLA 3DTTA 4HWPA 2JFYA 1IBSA 1G8JA 1M1NB 4E5PA 1RYYA 3B1WA 1IDN1 1ZXXA 1JIVA 2FWNA 3OPYI 4KKXB 3A9CA 3TLBA 2CFRA 3R6DA 2Y0PA 1OAOC 2PSEA 5TQ0A 5ALMA 3QYFA 1RW4A 3LPDA 4Y6LA 1P5JA 2IHBA 3HI6A 2OP0A 1T3LA 1XXLA 2PGAA 3K5PA 1PJZA 3CX4A 3KSMA 3HBFA 4JEUA 2WLTA 3IGFA 5BW4A 1QGED 1XWWA 4MQ4A 4HZUA 4TQ9A 1X1BA 5E7JA 1C3VA 3SN6A 4EFKA 3OCXA 5H81A 4WLOA 3OZVA 3GF4A 1IPHA 3EEFA 1CWUA 3OU7A 4GOOD 1E60A 3QV1A 2IP1A 2AKEA 3LGAA 1A2OA 1P4HA 2F90A 2QQ5A 4GECA 2CB0A 4UU1A 4DEVA 4EMUA 5IT4A 4WOBA 1XMOB 2GM5A 1WZIA 3UXYA 3T5DA 2AFVA 2ZWPA 3BEDA 1A2BA 5J4VA 3M3HA 5HJ2A 5BNWA 5E6RA 4ID9A 3KFVA 5CH5A 3C8MA 4DHWA 3NUGA 3DOCA 1L0BA 4ROTA 1N0UA 3CX6A 3ZGYA 3AOGA 2VPIA 5CUQA 1W36C 5DI9A 4G8CA 1WUIS 2DKNA 2HUNA 3C7AA 1BHO1 4JL8A 2HA7A 1TCAA 2PLWA 3IKMB 1YOVB 1BDBA 3K8QA 4MR7B 4UUNA 1PQUA 4GXRA 4MCHA 1YWGO 3Q7SA 1B41A 4WESA 1NW5A 4ALKA 5H68A 4M37A 3WXBA 2FI1A 5CB0A 2SKEA 2BJVA 2PFKA 2VO1A 1XQWA 1GUFA 2IYVA 3M4ZA 2ZRDA 2COKA 4CPDA 4RVSA 4H1WA 4G0WA 1R12A 4AYWA 3AVVA 4UU7A 4A2WA 2B21A 3IBGA 3F5DA 1YQTA 1SD1A 1TB4A 3LDHA 4LQ4A 4J9VA 1GA6A 4PIVA 5KQSA 1KA9H 3JZAA 3KSBC 2GVNA 3H17A 3PQ8A 3ZGOA 1V5GA 4KE6A 2JGLA 3ICQB 2JD2A 3B9PA 3EDYA 5EP1A 2Y1GA 3JU3A 4G5FA 4J3NA 4G0MA 1PIWA 3FYUA 4JR1A 1HRDA 4PXYA 4YDQA 1MNQA 1HDGO 4PLCA 4RY2A 3UT5A 4DFDA 3K9CA 2ZRCA 4OBBA 2PE5A 2JHAA 4HDCA 2JFHA 3QPCA 4WEQA 1QGAA 1JIXA 3ANXA 1KFJB 4DADA 1ZH2A 2QGZA 3QXXA 4XCXA 5AVWA 1NWCA 4KQ2A 3B60A 4XASA 5JO9A 4CWAA 4D02A 1XAHA 1PZEA 4WFIA 3G0BA 4RO0A 1P7CA 2FA9A 2VPZA 2YHIB 4OBEA 1II8A 2Q27A 1YQUA 1C8BA 3AFGA 5FJIA 2J9RA 4RADA 5ALVA 1W581 4NE2A 3QEBZ 4RQBA 2I4IA 2IF2A 4F2DA 1CF4A 1UF9A 5LD2C 1K0FA 2CVQA 1PHPA 2ACKA 3DGEC 3PDWA 3T1OA 3L0ZA 2DQKA 2FWIA 4TKUA 3VAAA 1FRNA 2IFTA 2P11A 2C99A 5LKAA 1NF8A 4X6LA 3M83A 3C3MA 2P6OA 2XW6A 1AK2A 3CN9A 1QF9A 3T5GA 4L5CA 4O33A 5LQAA 3NP9A 1LXCA 3SXJA 1P3DA 3ZGXA 3EXG2 4ZVSA 1C9NA 2KI5A 2FZLA 1MVOA 1N1MA 2EW2A 4QPZA 3FBTA 5AXAA 1ZGBA 3IDAA 3IOYA 1IVNA 4OXNA 3RVRA 1FJGB 4X1KB 3SEFA 3GZNB 3KSRA 2VZEA 4CIAA 2VAWA 3LYAA 2AEMA 1XJ0A 1TYAE 1MU0A 1Y4ZA 2WT9A 3EXIB 3MJHA 3Q11A 2B8EA 1F4VA 4TT3A 5E38A 1H0SA 3O3OB 3AVTA 4U7WA 1LRJA 5KVQA 2EFHB 1NDQA 5K3CA 1MJHA 2ZXUA 4NYJR 1IFXA 3F49S 1X7ZA 4XQ0A 2H7VA 3SIPA 2GHTA 4CYMA 5CAEA 4RTNA 2YJNA 5EMKA 5CIQA 3VX4A 2FSFA 5DX0A 3TXXA 3DLHA 3QOWA 4C1BA 3PHLA 1VL2A 1C7FA 4R1NA 3GVPA 1CY8A 2QTWB 1TUEA 4K9NA 1KQNA 4BS9A 5JAZA 4ZK6A 3M5CA 4ZI7F 4P5DA 1LI4A 3ZCQA 3U56A 3T7IA 4JK3A 1NFFA 4JOSA 2X9GA 3LC1O 1FOEB 2C1ZA 1CP2A 2VI5A 3BB3A 4GZ3A 4M54A 5I7RA 3QUBA 5L6LB 1UQUA 3C70A 4BO8A 4YP5A 4RIHA 1LJLA 1QG0A 1Z4QA 2XOKA 2ZJ7A 3EC2A 1J70A 1SBCA 3H16A 3HL4A 1KS9A 1LFAA 4Q9JA 2GZHA 2FWPA 4XR4A 4RPJA 5AW8A 1RAAA 3H19A 2EIXA 3UV3A 3GAFA 3WLHA 3CTPA 2BH2A 2QP3A 1M8JA 1H2EA 4DTCA 1H2RS 1UUFA 3HUFA 1P2UA 1QYWA 3KCNA 2Q4DA 4UFOA 2Q3CA 4F8JA 1X14A 1T9AA 3JD2A 1AQLA 3ZTTA 1HRKA 2BTQB 5C0OE 1NQTA 3FKQA 4YAUA 1JTFA 1XZFA 1YHYA 4L78A 4RESA 1KZYC 1PZGA 1NLMA 1RAGA 3TD6A 5DLPA 3AF1A 5PNTA 5JSZA 1CW2B 1D0SA 2WMYA 3K0AB 4X9XA 2CYBA 4KMRA 2QZ4A 4QLOA 1USWA 4H4CA 4A6XA 4QQNA 3FGPA 5EP3A 4EPYA 3U3XA 5A4AA 4OK5A 1CU1A 4UNNA 3VBCA 4NKRA 3RQSA 3SIRA 1K1EA 4FX5A 2ZXFA 4AKTA 4DLZA 3VA7A 3LQ4A 1IH8A 1OX6A 1PR1A 1UC4B 2R47A 3ND9A 4GLFA 4XJTA 3R7LA 3WB0A 1QCZA 2XNSA 4GX5A 2A0YA 4L1KA 2Q6VA 3DYBA 1DADA 1G2QA 1QTIA 2A1UA 2AJDA 1PV2A 4NFYA 4BLUA 1MABB 4OL0A 1IEWA 2V59A 4WFKA 4W8GA 2E49A 3F1KA 3LVRE 1B8PA 1SUEA 3CR3C 3ZZUA 1K08A 1U8FO 3BFKA 1OCEA 5K8UA 5JAIA 4M1QA 4L8VA 4DDKA 3D6UA 3FPSA 4KFCA 1FTSA 1NSYA 2VQDA 5T6BA 1G5IA 4IIXA 1Z7BA 1AS3A 3SG0A 3Q7QA 4PN7A 1VJ1A 2NO7A 4FGKA 5E1OA 5H80A 5JWOA 2JCSA 2PLRA 2D4AA 2EFYA 3QI2A 1IBLB 1E3JA 4EECA 1HE1C 2ZJ1A 2BAGA 5F21A 1ZAYA 4Q4JB 1ENYA 4RACA 4R1SA 3SJCA 2V7QA 1AKMA 3EBLA 4R1TA 4ZCRA 5FWYA 3IAS6 2VCYA 4MHSA 4PRKA 1TJ4A 1AGNA 5BOSB 5KTMA 3DEZA 5ALQA 3O3MB 2X13A 1EP9A 1N6LA 2B5VA 3G02A 3L9WA 2Y66A 3HO1A 1B74A 1FVOA 1K89A 4HB4A 1IATA 1Z0UA 4JV5B 3AVWA 1QJCA 1GPNA 3TSYA 4UUQA 1UPXA 1T8TA 1GCIA 5ADVA 4F60A 3VOBA 3CMCO 1JAIA 4XPZA 1FFCA 3R9KA 8ADHA 1VM6A 2H1SA 1G8GA 1M9NA 1PBNA 2B98A 1ZHHA 2WB4A 5TGTA 4D2IA 5T8KA 3RSCA 2SECE 5LBTA 1ISRA 3UGKA 2JFFA 3AILA 4G2NA 3W78A 4XTCS 3NKFA 1RRCA 1KS2A 4DF3A 4MB0A 2XCUA 2GYWA 4HLDA 4PGHA 4B4VA 2VQ6A 3ASYA 3HVHA 4MUKA 3USZA 3FDZA 2F8MA 1U4SA 3N8IA 1WNTA 1E9BA 1GZ5A 3ZWOA 2DBRA 4PS1A 1CY1A 1MA0A 4J49A 2AG1A 2RI1A 1N0IA 1SXPA 1M34E 1TM1E 4FDTA 4KFSA 3STWA 5CVTA 1YBVA 1T0HB 5CJ2A 1X7HA 1UJ4A 4QUIA 1N7GA 1AS0A 3DEFA 2XD4A 4AUMA 5K7SA 1A76A 2RG1A 2V7VA 4Y8VA 4D46A 4G67A 2OG2A 2SCUB 3QFSA 2VZ0A 3KZCA 5CU7A 3WLRA 4BVHA 4B17A 4D81A 1YF3A 2UUPA 2X5XA 4M1TA 3ZCRA 7GPBA 3L07A 1MX3A 1Y8AA 4WBSA 4DIKA 4GX1A 4FK8A 1EEXB 2IOFA 2XNCA 3BE5A 4KSYA 1G8YA 3EEQA 4YUWA 2MSCB 2NAPA 2PJUA 5AI6A 5BW5A 2OHJA 4F0JA 1JU9A 4TS1A 1KMHB 2O8CA 2IPNA 4PXSA 3OHSX 4IFTA 5J1SB 3MWLA 1OXUA 3FGNA 4DMUB 2VTEA 4Y2HA 3LHDA 4FINA 4IFBA 4WN9B 3ZU3A 2RCNA 5CFZA 1U9ZA 3R3WA 1NAIA 3K5WA 3VOTA 3B6JA 4BDTA 4DA6A 1EM8A 4MVJM 2M1XA 4B85A 3E82A 2ACWA 4KQJA 3QH4A 5EQDA 1DP4A 1C1DB 3ET4A 3DYIA 3TE7A 2ZJ8A 3NDPA 3L4BA 2NO4A 1P0IA 3DF9A 5JNWA 4QEZA 5F77A 2M1ZA 3LECA 4TTQA 3PUJA 5CLQA 3T3EA 3ZQ4A 5A4DA 3D8NA 4DCNA 2UZ4A 3KQMA 2H8KA 2I22A 3IPAA 1N2ZA 2JAUA 4PG4A 2WTAA 3KSUA 3U40A 3THYB 1GZSA 1BGWA 1ORVA 2NT4A 5JH7A 1N33B 2QIPA 3UA3A 521PA 1FU4A 4JXJA 1N1DA 4YV7A 5JROA 1WA5A 2ZIEA 4GNKA 2XRFA 4B3CA 5C8YA 3BERA 2Q3MA 1SHLA 3E0QA 3K0KA 3OAAA 4AMBA 3C15C 1GSHA 5FBKA 5B53A 3T61A 1ZH4A 3WHLA 3COVA 4CMBA 4B3XA 4YJGB 5A04A 4GYYA 6CHYA 1A9SA 1VKOA 1R18A 1U7OA 2ANBA 2GLUA 2D1RA 5C80A 4HO1X 1NOKA 1E2DA 5A4IS 3PFGA 3CF4G 2VNSA 4MLDA 5DXAA 3B5IA 4B7CA 4D98A 4OMUA 2UYCA 1PFQA 4AF8A 4OY3A 3KXDA 5FPQA 4AYTA 1W36B 2H1IA 2ZKIA 4U7JA 5JAPA 1HSOA 1CZLA 2FR8C 4GZ5A 5DBHX 2QY9A 4KQMA 2AKAB 4OXRA 2Z8YM 4RHFA 1FMFA 1HQKA 1XXHE 1WZNA 2BM8A 4D3DA 2DERA 1NQWA 4GGOA 1XJCA 3PQDA 4QU0A 3VC3A 1AKRA 4N76A 5LQNA 2JFOA 2GPWA 3OZSA 1VDMA 1NBOA 2BFNA 1NUSA 4FQ7A 5CM9C 1KHHA 2F1JA 2VHWA 3LK6A 2FEPA 1DO2A 1MX5A 4MWGA 3IERA 1MT3A 3SSNA 2QJFA 2O3JA 2ZULA 5NLLA 2CK3A 4H77A 4QGSA 4XDHA 1IMJA 1WW2A 1XHEA 1RP7A 2PCLA 3VC7A 4ZVRA 4CMAA 4RDXA 3DW1X 5SZKB 3HU1A 5IYZA 1P4GA 1TTPB 4QGGA 2P9JA 5JRZA 1IEVA 2DR3A 4DJJA 4YHBA 1R37A 5M3BA 1QYVA 1SK8A 4R31A 5KTNA 1P1FA 2PXAA 2CXOA 1QIDA 2QAIA 4Q1FA 2C0PA 4I9UA 3DTVA 2WAYA 2IH5A 1FYDA 5AUNB 3CZ9A 3IPCA 5JQGA 3CWQA 1JN0A 1K8RA 3CLRD 2JIDA 4TGLA 3GIDA 4ZOLA 5K0SA 3VTFA 4BRZA 4YH1A 3GJTA 1CB7A 1XDZA 5DT9A 4DWVA 3SFTA 3I64A 2DPXA 3CV3A 2AZDA 3H1GA 5LDGA 5K0TA 2F55A 2VG8A 1J33A 4H35A 1JVBA 2G9UA 5K9ZA 4H0CA 3IRVA 1W5AA 2Z4RA 3L49A 3OMLA 4YVFA 1Y5RA 1K5GA 1R50A 4Y6SA 5EXDA 4CTOA 3E6AA 4MWOA 4Q3OA 2AC2A 2RH4A 5BVGA 3KT6A 1J90A 3C97A 3GFBA 3AC0A 3U3RA 1AKYA 1QGZA 3H5TA 3LV8A 4Q4CA 5EWMA 4NECA 5IXYA 5GZ1A 3ONEA 4DG5A 3GP3A 2PCJA 3K0BA 4ES6A 1V11B 2HCRA 2WKRA 3VHRA 1ZHOA 2ZUEA 1OGYA 3ZVRA 1H9CA 3BD6A 5A3SA 4C7JA 1X38A 4FOOA 1J0XO 4QECA 2O2JA 1G6Q1 1P2DA 3FPHA 4UZEA 4A6EA 4ZYUA 4MARA 5JNRA 3GRUA 2X5JO 2ZB2A 3LT2A 1J8YF 1VTKA 4JBYA 4OHOA 3B1VA 2UYQA 4JN6B 4BB0A 3GCWA 4POOA 4WEOA 1ZCJA 4Z7NB 3TIXB 2AN4A 1DTSA 2I7TA 2Q0SA 3WGHA 3V3KA 3AR2A 4G36A 4OLJA 2J3HA 2VDWA 1WR8A 3IMKA 2A88A 1M2GA 2LTAA 3H2ZA 2ZROA 1FPQA 4U7HA 2QBYA 3NQ41 4Q1VA 4NXNB 1KTVA 1U9YA 2QPAA 3CLTD 3I2IA 2XWPA 5HTKA 4KSBA 2Z58A 1EX1A 4LKOA 3WNDA 4HDQB 1LDBA 4RD3A 4CGZA 5LD2B 5AI8A 5IKMA 1HORA 4RLQA 4WMLA 1NRIA 4EGFA 5JSYA 3TZKA 2XMGA 5B37A 1UJBA 1NJ6A 3G79A 4WBXC 2V1UA 4BFVA 1DWQA 5LOVF 1DOAA 3ENQA 4F6RA 1ZSNA 2NO5A 3H11A 2P3SA 1WCYA 2ODPA 4ZCPA 1USIA 4I55B 5A5EA 3IQEA 1JYSA 4JEMA 5AICA 4AS1A 2YV4A 4NEHB 1OTYA 3PXCX 4XIFA 3LWDA 1PGPA 1W88B 2OWDA 3HP1A 3EUWA 4G1CA 5IVPA 2ID8A 3OIUA 3ZQ6A 4Q9IA 3DVAB 3FNBA 3V1KA 1XDSA 5KTSA 3BMCA 3DLCA 1WBBA 4RDIA 5EJIA 1SXJB 4YRIA 1NOIA 2EWVA 5K6AA 1O87A 1CG6A 1NRJB 1RWQA 1UBEA 4QU9A 5A5FA 2X5NA 3AL2A 1N2OA 4V2UA 1LQTA 1AM4D 1YZVA 4HH3C 4BTEA 3PGKA 1BA3A 4TKZA 5THXA 2EFDB 3A9SA 1GCGA 5KDDA 1GSAA 3NBXX 4EHNA 5GJVC 4PC6A 1R74A 5EERA 4WINA 3SNHA 3B7PA 1FXSA 1I80A 3KEQA 1BVRA 1FTWA 3CF2A 4WCFA 3EA0A 1CC1S 1SVWA 3JYHA 4XEUA 3W4IA 4MPRA 4F06A 4TYWA 3PXGA 4ECEA 4PLPA 3JQBA 4AWBA 1R66A 2UZIR 1ZD2P 1ZO8A 1IN8A 3A0UA 4IXNA 4JROA 1B8OA 3TLYA 2WJ6A 3CKLA 3AEQA 1JQBA 3WYNA 2EJBA 1IZZA 1YL6A 2F8LA 4B6FA 1OBFO 4JJEA 2YBEA 2Q3BA 1U1DA 1U7TA 2PMFA 1M1XB 3E7DA 3P8ZA 2Z2JA 4WA8A 4B6PA 2GOYA 3U4QB 2QPLA 1DJOA 4FYKA 3DLTA 4FE3A 5JHGB 3FCCA 2A0WA 2Q7OE 2OAEA 5HKOA 2WIFA 2ON6A 2NO0A 2VNJA 1UBNA 4PX3A 4ZQEA 3KR1A 5A6SB 1O6BA 1T35A 3PPIA 4NZOA 3SI7A 2P68A 4TT3D 1NI3A 4Q15A 1UBLS 3NDIA 4DWOA 2RDMA 4Q7EA 1YVUA 3MJSA 3QA9A 2JIQA 4MO9A 1NW8A 4UNRA 5LZ9A 3VSDA 2FFJA 3EJ6A 5FUVA 1KP9A 4P54A 4EO9A 2CY0A 4BGIA 3OM9A 5CDFA 1XJ5A 3K6JA 4KVGA 4TS9A 3UK6A 3NT4A 4WXHA 1KPIA 3B2EA 3L7JA 2QRPA 1TM2A 2WICA 2WMDA 2ZYAA 3OSUA 1F48A 4P36A 2G1KA 4PBRA 4RMHA 4FYVA 4X44A 4Z9FA 3I52A 3VR4H 4EFDA 4XWOA 4P38A 5EIXA 1VHLA 2JGRA 3PC2A 1E2MA 2FEMA 3NG1A 1RTTA 2OAGA 4NHEA 5WRFA 3VNSA 2HA3A 4YRKA 3GLIB 3I28A 1SCBA 3RT7A 2DQZA 4LDNA 2ZYRA 3DPSA 3INTA 4QGFA 3ZGZA 2PD4A 3V48A 1B1AA 1P75A 3N6RA 3QU4A 5FAXA 1DAHA 1V95A 2ZBRA 1Q3HA 1XA3A 3LKBA 3ILXA 3MGAA 3JVIA 4ZVOA 5HS6A 4R69A 1ZK4A 2JW5A 4RKEA 2EX4A 1CUVA 3NIBA 3HQ4O 2GS9A 2R4UA 3IUNA 3AXSA 5LFAA 1M5UA 2GM4A 3I6BA 4IL5A 2WM9B 3OJXA 4LTMA 4WADA 2O4UX 4ON9A 5FRDA 1XLUA 3K70D 1TF7A 1RJFA 1JZTA 1DAGA 1OXTA 1T4BA 2VEDA 3JALA 2A94A 4PFSA 4UE2A 1JXAA 3MNFA 1FLAA 4Q7QA 2AFIE 5C9ZA 4N7JA 2GAFA 4NV1A 4UMVA 1NUUA 2X40A 4ZCLA 3G5TA 3QTBA 2H1HA 3GRKA 5JANA 2XB9A 3NONA 5LDHA 3QSYA 1DTWA 2P67A 5EN4A 2OXCA 4G0UA 2RBGA 1WCXA 1T24A 2YHUA 3LUBA 2C94A 1NV8A 4N12A 2GZ2A 4YPVA 1V6AA 3GDFA 4AG5A 3FTFA 3AYXB 3FG9A 4F2WA 1MRZA 3WDKA 1ADGA 3EVZA 4G23A 4RZIA 1CF2O 1XDBA 3OC0A 3L2OB 1XTIA 4PN3A 3P2YA 4HUQA 5GMOA 4C3VA 3B1ZA 3CWCA 1Y7IA 1P74A 1X8LA 3KUUA 3P94A 2R6JA 3K1TA 3CMMA 2J4CA 4MYSA 1Z75A 2ID7A 3ISJA 1TD1A 4MITA 4YCMA 3VKGA 1LUAA 5GONA 5EJ2A 1QH8A 5ALOA 3UKJA 1UFKA 2RHDA 1NBHA 3H2GA 1SJ9A 3OY7A 1EB8A 5KDLA 1L1EA 3UWOA 2XQKA 4H6PA 1U0JA 5JAUA 4C4RA 3HDYA 2XYPA 5B30A 2YXPX 4PLFA 3N1UA 2HN9A 1I33A 1O58A 1VFPA 2GN6A 2PSJA 4M7PA 3R8FA 1P72A 2OORA 1MBZA 2IOYA 3A4MA 4E94A 1CRZA 2P6RA 3AETA 2COUA 1J0BA 4PSAA 3O2SB 2W11A 5JXGA 2V7QD 3ENKA 1IN6A 1BN6A 5ALTA 1S0UA 4XQ9A 1S5PA 1S3FA 1DXHA 1TADA 2I66A 3W0LB 3R0JA 5KINB 3WYFA 4LPSA 1PEDA 2J7KA 3BF8A 5HMMA 3H5AA 5CA1A 4P7FA 1WU8A 4M0MA 4ITUA 4JFAA 1Z63A 1JALA 1E58A 1ZCZA 2DHQA 4IDDA 2QNBA 1C4KA 3MJ4A 5C1OA 1OFTA 3AHHA 1E7QA 4KO2S 3AUYA 3FMIA 1QC5B 5B3KA 2OHHA 3TD9A 1BIFA 3SR4A 1I1QB 1MB2A 4YEDA 2ZVQX 2HPZA 4JT8A 4YPFA 4FEGA 4WACA 2B0JA 1GARA 3QUAA 5JAMA 1H3FA 1PTJC 4JNKA 2QRZA 3ESXA 1Y4AE 2O8BB 3BB1A 5EIHA 3DL7A 3QM1A 4PQEA 2QRHA 3PA8A 3ZPXA 4LJYA 1K6EA 2VUTA 3WGYA 1DIAA 2FG5A 4AN1A 4B4KA 3ND8A 4IJKA 1Z2CA 3VZQA 1IUPA 5GOTA 4DV5B 3KALA 2PR2A 3QI7A 5AJWA 4C5BA 3U60B 2G40A 5B3LA 5EZYB 2EFEB 2QE7D 3OZGA 2PXXA 1IY9A 1O4WA 2FCAA 3QENA 1R4MA 2YV2A 4FP9A 4GSKA 1FDIA 1MCZA 1TM5E 1Y81A 4QYWA 2R8OA 2B2NA 2O2EA 4F5DA 2UZ1B 3GT0A 3CY6A 5BW8A 4L08A 1RXYA 1T36B 1ORRA 2OBLA 3M9XA 1XC7A 5CNJA 2CFSA 1KQGA 4MB6A 1A2KC 3PJRA 3QVKA 1Y1SA 1GRQA 1R5BA 1SUIA 4Q6WA 1T5OA 1XCOA 4LOAA 3V4OA 2UUBB 1T9BA 4O4IA 5DLDA 1LI5A 1KDRA 1QIMA 1Z8HA 2AG6A 4HZIA 5AWFC 3RVDA 2VYNA 5DHFA 5JISA 4ZJYA 5LU9A 1SQ6A 3QIVA 5IT9A 4MQEB 1OI7A 1MC4A 4GXQA 3WNQA 1D2MA 5GP1A 3ZJYA 4R2IA 4AZWA 4FYWA 5C37A 3EWNA 3KTOA 3RUIA 4ABYA 2QJTA 3IX7A 1Z2NX 3EB9A 1NBMA 1R4NA 4C5AA 1SIOA 2OILA 2VOEA 3TF5A 2HNBA 1QFJA 1B43A 1YU9A 3Q2OA 4EJMA 3AHCA 5LJIA 3CN7A 4YMSA 5JAHA 1GQ2A 1I7QB 2DH6A 4JYBA 2FRDC 3M1LA 3W5IA 5BWBA 1JSCA 1E0DA 4LZJA 1JR3A 3O8BA 6GPBA 4MAAA 2GZDA 2GD6A 5H4GA 2WU4A 1VOTA 3R75A 2O2XA 4E0BA 2H31A 2C7VA 4MRPA 1EBBA 1EFHA 3L7MA 4LRWA 4QT0A 1QANA 2P5YA 3HM2A 3P5BA 4LTDA 3GJ5A 1IPFA 2PMKA 1XN1A 1XEAA 2BHRA 3PC6A 4RM2A 5BV8A 3OAAD 4ZHQB 3WWEA 1M1YB 1I30A 2XBUA 1P5RA 3OTGA 4MVCA 3DWGA 5C8YF 1DCTA 3H2KA 2P8SA 4DNXA 4IQFA 3DV0A 4PC1A 2XUDA 4TXNA 2FSVA 5E4FA 5HVNA 1EVIA 4AWXA 2C7BA 3TLCA 3T9BA 1Y3IA 2QEQA 1BSVA 1CXZA 1UJCA 1KMNA 2BMAA 2A67A 2Y1LA 3C6BA 1DJLA 3ONVA 4TV9B 4I3HA 5CYPA 3UB4A 1R6VA 3E7FA 4XM1A 4QG3A 3IEMA 1VMDA 5A9SA 2GRAA 2WTEA 4NYMQ 4QFBA 1ECCA 3NP7A 4EMSA 4E2WA 4Y2RA 4B7UA 3I83A 3SZMA 5JADA 5KWEA 1TE2A 1BGXT 2PYZA 1K7CA 3EOAI 2ZRBA 1NIJA 4JENA 3EH2A 2IU0A 721PA 1ZJ5A 1FNDA 2ZRGA 4G0QA 3G23A 3RWMB 4DCTA 1U1CA 3EVGA 2V98A 4BQEA 3M4XA 3TIIA 1JMYA 1CK4A 3NPMA 4BLVA 4YUYA 2Q1UA 3HDHA 3UM9A 2P0AA 2QDXA 4ESEA 1PK7A 4LWOA 5KUTA 3RKRA 4ARZB 4OJMX 4XQCA 4D41A 3A10A 1SKQA 3EF0A 1N6OA 1OJLA 3DBOB 3UAVA 2YIMA 1AX9A 2C77A 4ENPA 2C5AA 1JL3A 2P6UA 3IOEA 4CFSA 1PW5A 2B4YA 2ZU0C 3JV7A 1WRBA 1CIJA 1N2CB 2YVLA 3WZLA 3K73O 5AVRA 2AN1A 1H93A 4HPJB 4W5HA 2A0XA 4I66A 1BXKA 3Q0IA 2CCJA 4FGWA 4CG0A 2CJPA 3JQ7B 3PEFA 4A0RA 2V55B 3DDOA 3MINA 5L3VA 3BK1A 2ZE7A 3UO8B 2OFOA 4TXHA 4TZKA 4ZOLF 2VA9A 3C41J 4PG7A 2O59A 5TSDA 2JCBA 4DRXB 1N8NA 2GAOA 1QZZA 3QJGA 4IV8A 4FW9A 1XI2A 5AVJA 2G82A 2WWWA 2C78A 2UXDB 4JX8A 2C2MA 4G0PA 1ZISA 1Q7EA 4D97A 5DNAA 2IXGA 4ZAZA 1OZFA 2C1EA 2FPOA 3LXMA 4HC4A 4PPYA 5GWXA 3K9FC 2C3OA 5LCXA 2BRUC 2HIHA 2P2LA 3ASVA 3CF4A 3OO0A 4KLNA 3D8TA 3AIOA 1VJDA 5D3ZA 3EVNA 3IQHX 4PIPA 1K92A 5BSTA 1KSFX 5EXSA 1MJ5A 5E2AA 4EPTA 4R8KA 3UHOA 2VK2A 4FZJA 1UT5A 3FUXA 4NBTA 4KQHA 3MF4A 3O1LA 4J29A 4RW0A 3TX2A 5C7OO 3E18A 2DCUA 2GA9A 4P80A 4YRBA 2R5WA 2JRCA 3N7UA 2XDAA 2QTVA 1SHZA 3ZDDA 4R1MA 4GOND 2NO9A 3E9MA 3HYSA 4DJDC 1EXDA 1EFPB 3DZKA 3F4BA 2QVLA 3AEXA 3SQDA 4EJ6A 4NQRA 4ZYWA 2WJPA 3O74A 1B42A 3IIKA 2AOXA 4YXFA 2FMTA 2ZT8A 3Q1LA 4L95C 4M8IA 3ZDZB 1ZL0A 1VLLA 2LIPA 4RF2A 2WVAA 1FFBA 3SOPA 3OQHA 2JI8A 4DMRA 3FUUA 3K35A 4BLWA 5GINE 3DB1A 1AKTA 4RVGA 2DGDA 4EYEA 3S7TA 1UPFA 3RVKA 4QNNA 4Z3OA 5FX2A 1TIPA 3FPGA 2CE2X 2FPGB 3K09C 1ZI6A 3E3NA 4L8FA 1DCFA 2GTHA 3UAWA 4O2BA 1KIFA 2A1TS 2REXB 3MCTA 1DC6A 5DO9A 4Z86A 2Y1KA 2ANCA 5ULLA 5BWOA 3T99A 4HAYA 4QWWA 1HNXB 3GLFA 1QGYA 2J3KA 2UXBB 1UBMS 2OYRA 2VK8A 1RBMA 2WFZA 5BY2A 3RUAA 1WPGA 1BQEA 2G77B 4HGZA 2R68A 4CKBB 1Q92A 5EYPB 4IINA 3Q88A 2AUTA 3GL9A 4UE6A 1GT6A 2B92A 3BJMA 2HR1A 4BPBA 3BIJA 3NHBA 2RAUA 4UEKA 3AR3A 4NOMA 1VHTA 1BXGB 3QUTA 1CDOA 3MS7A 5AW1A 3RYIA 1JNXX 3NBUA 5L3SB 5ECDA 5GV7A 4I5IA 3UBMA 1XRNA 2DG2A 3EMBA 3LNCA 4AF6A 2HRDA 1JQ3A 2XD9A 1Y33E 2HCTA 4XWGA 2B36A 3ZI0A 1A9XA 4GS5A 1N7JA 5BSFA 2V8OA 4Q9AA 4X1IB 2GVZC 2IXDA 3B48A 3EZ7A 1GDDA 3EPRA 4FYYA 2JFGA 4LHSA 4PWZA 3X43A 3R40A 5K8TA 3G5LA 1Z62A 3AQ4A 5SV2A 2VDJA 1TT5A 2W43A 4IS3A 4BKOA 3PDIA 1RYZA 2GYYA 2HZ7A 3OX2A 3AZPA 3TFOA 1NMSA 5AIAA 1RHMA 3LUHA 4JGIA 2PD3A 2YWEA 3PFKA 4L0QA 3P5SA 1FP4A 3UANA 2VDVE 1GFZA 3RSSA 1N25A 4RK7A 2YWRA 4IDBA 5I7OA 1A5BB 4ZO9A 1C9JA 1AKNA 3ACDA 5DLQC 5EQTA 4ZVTA 1OU4A 3CRNA 3GGDA 3N2YA 1V2HE 2OEPA 3ICVA 3IMCA 4U39A 1TPYA 4LXUA 2IWHA 1ZGCA 1XTJA 1HFKA 2DFVA 1V8ZA 5G2OA 1QIFA 3HJGA 5DP1A 4OYYA 1MF7A 1R0KA 1QB8A 1TCVA 4QO7A 4QNMA 5F9FA 2PANA 3PXAA 3WV4A 3AZOA 4QQKA 1FDTA 2BD0A 3F7OA 1GZUA 1VKHA 2WM3A 3EXEB 4B3DA 5IJ0A 1M0EA 1HO3A 3DPIA 1FMTA 3TVTA 3UJ8A 1SXGA 4NBVA 4BMDA 1PK9A 1TAHA 2C5LA 2OXRA 3EY4A 3NEYA 3SXUA 3QLVC 1C9MA 4LJKA 2B61A 1US8A 3KJNA 4E5UA 5CXQA 2R8PA 3B1XA 3FVVA 3ACBA 3DAOA 2FZVA 2RI6A 3WDSA 2VHZA 2A57A 3L0CA 2P9EA 5EZQA 4RVOA 5IN4A 4IRMA 1XVAA 1C9YA 5AD1A 4UZFA 4NENB 3IHTA 3CNOA 3MMZA 3TJZA 2B94A 3RBVA 5GJBA 4R9VA 2QX7A 3BWEA 3CX7A 4QOGA 1YRBA 2NSJA 1NXSA 4RUKA 5K3EA 3OFNA 4LA4A 4Z9AA 1GUAA 4DBZA 2QD1A 4Y1RB 1ETUA 1OFVA 4AX8A 1IOVA 1Y5LA 1VCHA 3M2PA 4G4IA 2W2LA 2XEXA 5IXSA 4UM5A 1NX9A 1RSZA 1GVNB 2GK4A 2OV1A 4XFDA 1K7SN 1PJTA 3GFVA 1YS4A 4WLEA 4B84A 4MYCA 1OR8A 3FDFA 3HLYA 1VYTA 1Y3DE 1L6RA 2D2EA 3EQ2A 3HKDA 4G07A 4XLTA 3E22A 1G3RA 2GPBA 5AVZA 4ZOBA 5DT2A 2QG9A 4KAXA 4L02A 2O06A 1M7HA 2YHSA 4PYJA 3H1PA 3OTWA 3SHOA 4B4UA 3QXCA 4QPDA 1ONOA 3WQRA 3KQNA 3DMTC 1BCRA 2EXXA 1Z39A 2LCQA 5K8JB 1HDOA 3AEUB 2TMGA 3OOJA 5L4LA 4ZEWA 4YHHB 4M9QA 1MFPA 1IQRA 3BM5A 1U11A 1YUNA 4K5QA 3SYTA 3KBBA 2JS7A 2RGUA 1L7VC 2FQ1A 3EFEA 4DCPA 2VF7A 2G88A 2ADMA 2EX1A 3ROKA 4B2LA 3O8DA 4HTFB 1OWMA 1YBFA 1PJ8A 3FYTA 1ADFA 3PFFA 5LC1A 4E5YA 1UJMA 1PFUA 1TD9A 2I9KA 4ID3A 4WNYA 3IEIA 1RVDA 1N8TA 1SBHA 1XQ1A 1X7XB 2WAOA 4G5GA 4QAJA 1Q1NA 1LV7A 1UZNA 3O93A 4MPDA 4Y2XA 1JHRA 2JHPA 2P2YA 4RMGA 4CHTA 3NCHA 1Y7PA 4LDQA 2VHTA 5JWRA 4FI3F 4BMNA 6REQA 2WV9A 4LGVA 1ZM7A 4PPNA 5B1YA 1NF2A 4HG2A 5IUJC 3HM9A 2ORWA 2DWUA 3ABQB 3ZG6A 3FOZA 1DWOA 1A97A 1NM5C 1R88A 5D1HA 1AQYA 2JFBA 2VHYA 3WLEA 5JCOC 5EL0A 4BB6A 4U7DA 3OCYA 4JXKA 4M22A 4PYOA 3ORYA 3EXG1 1KK0A 4OYRA 5GPBA 1XU7A 4MROA 1IM2A 4ZEOA 3QU5A 5A4KA 3T38A 1YR7A 2AMJA 4JP8A 1OSNA 3JY6A 3ZDCA 4RWEA 5D6OA 3TLMA 3VTZA 1WUYA 2D2IA 3WGTA 4CQMA 4A82A 4EJSA 2EEPA 2ARKA 2AWOA 3D0QA 1J8QA 4ZVKA 4YI3A 1PWZA 4BLQA 4UU0A 3R5KA 1JDSA 1SC4A 1RJ9A 3AU9A 3BFVA 1KYYA 4ESHA 4KXVA 1ZD3A 4WGFA 1Y37A 3NWOA 3W9UA 1O8CA 3BGSA 4Y0AA 4KTTE 8LDHA 4TN5A 5JNTA 1ZD5A 3E05A 2DWPA 3FH0A 1QIGA 1TVMA 3MJEA 4RS3A 5E7QA 4ZHSA 4FFBA 3S8YA 2CXQA 4EY7A 1L5LA 3SYLA 1I14A 3WP1B 1UPBA 2FPRA 1CQPA 4Q4AB 4MRMB 5DPMA 5ITSA 1R27A 2J3IA 3H2BA 4KPUB 1JSZA 4KMSA 4COKA 3TXYA 5ES3A 3D6VA 5FUXA 5ABPA 3M81A 3UJCA 2AMLA 3MM4A 3AIKA 3PI6A 4U2CA 2R7AA 3KKNA 4Z4QA 4DKJA 2HCFA 3Q6MA 2JFUA 3U44A 1P9RA 5C34B 1V3QE 2OWEA 3F90A 1N34B 2P79A 3VSAA 3GJXC 3B3QA 2NV2B 3KQVA 3F78A 1CEEA 1HTBA 4Z51A 3LXXA 3GELA 2VA8A 2D8AA 3U49A 3RIGA 2JBWA 5BRNA 1RYNA 3DF7A 3URKA 4Q9DA 4P33A 4QM6A 2FE4A 2H3HA 3IAUA 4O4IF 2ZZKA 3SE0A 2NNWB 2WZDA 4WZAA 3VVLA 3ZCTA 4DMMA 1Z5UA 1JDTA 2I4LA 1Q11A 3O31A 4ZO4A 1WZ2A 1Q20A 2PN1A 1R0WA 3P9SA 4KR3A 4F1JA 1UBUS 5FT9A 2YFKA 4CT5A 2VBCA 1ULHA 4F4JA 3V97A 4BO4A 5CTAA 3BMQB 1CR2A 4Q9LA 3BD7A 1WDKA 4IDAA 3RO7A 4D3ZA 1SFRA 3LBAA 3RU3A 1F6BA 3KQOA 4TS4A 4D45A 1JR3D 5A5GA 1TQ2A 3ITDA 5I48A 1NL3A 4R7GA 3NC0C 3TW8A 4BNTA 5E0OA 3BJRA 1NLUA 2XJ4A 1YUMA 4FXOA 5EKSA 3G68A 3CE6A 2WYOA 4IJWA 4O59O 4UM9D 3SC6A 2OTCA 2RBEA 2VZ9A 4WNIA 3RWBA 5L3RA 1C0EA 1QO9A 1LDNA 3KD3A 2WAAA 4PO9A 3REOA 4BASA 4C3UA 4DSOA 1ZJJA 2B1JA 5AKIA 3Q3VA 5FO0A 3MYYA 1G4HA 3RYCB 5CA0A 5KC8A 3QKSA 5U4XA 2ORVA 5FV4A 1KDPA 2Z08A 2DE0X 4R83A 3BORA 3EPHA 2DFLA 5EMMA 4BWFB 3DEHA 3O8CA 2VT2A 3DTNA 4G89A 1S2IA 3JQAA 4XX0B 2J41A 3QKRB 5TPZD 4TKVA 3NU1A 1FP7A 3QX7A 5AW5A 5AM4A 3HJFA 2ZQZA 4M0FA 4JS0A 4E2FA 1J9ZA 1YS2X 5BQXA 1YULA 2GPNA 1XCBA 5BQ5A 2IBSA 3L8CA 2MIIA 1ZIOA 2VF4X 2X9VA 5I47A 5JATA 3ETEA 5KOJB 1B2LA 2BFBB 4HEA1 3LK7A 2IX3A 1HK7A 4Q3EA 4CL3A 3IP8A 1PJLA 4NYJQ 2AMFA 3ZCUA 4BX3A 1E5XA 3H1AA 5EVCA 3VKWA 1SZJG 1KBOA 1T4DA 1Z7YA 2ABWA 4KWCA 3C74A 3VMMA 4P35A 3UY4A 3STYA 3QK7A 1G5RA 3QE0A 1GDHA 5AW9A 3RRNA 3WL3A 3OMWA 3DL4A 1L5KA 3BXHA 1FFGA 2DP4E 1PWXA 1NKVA 4D3XA 5EZ6B 4BJ1A 2YJZA 1G55A 5SZHB 3FVQA 4DIDA 3R5JA 1QZXA 2A35A 2Y6VA 2HGSA 2C3PA 3A1FA 1A5SB 2QU7A 5DSZA 1O95C 3ZVLA 1EBUA 4MVJI 1AN0A 1EQ2A 1G2OA 4NHOA 2ZJ5A 2XZLA 1VKJA 1CQXA 1AJEA 4ASUA 5LP6C 3A25A 4M8KA 3T3IA 1L7QA 1WDLA 3HFSA 4PG8A 1L7EA 2B82A 4J0QA 4GPTA 2VNKA 4G37A 2JASA 4QUAA 1NNUA 3R9WA 3CXUA 1RXWA 3DXXA 2CZCA 4F56A 2BIFA 1EE1A 3PRHA 3ET5A 1P6QA 4HGYA 4HWRA 4JLBA 2PL9A 3AK4A 3QFFA 5EHZA 3T3NA 1WHSB 3PVCA 4HRYA 3LL4A 1JX6A 1T9ZA 4YJFA 1K5DA 5DFAA 1Q0SA 3ZWMA 1HE4A 4DR4B 1PJAA 1WKBA 3OICA 5JFTA 5LQKA 1JWLA 3REGA 1G9SA 4G25A 4ZYVA 4R8MA 3GJRA 4BO5A 3WLIA 1I8TA 4M0DA 1D2HA 1J9GA 1NVDA 3ROPA 4U7TB 4JVOA 1H8HA 3TBFA 4CCYB 1PAUA 3G5AA 5IC6A 4RJJA 1UBKS 1KE2A 1YA4A 4R71A 1VPWA 1UWCA 1VG9B 3I0NA 4WKCA 1J1ZA 2HY7A 4RCVA 2GN4A 4CF7A 1KXZA 2ZTHA 3AG6A 4O4LB 2DWQA 3A9RA 3IILA 4YJ3A 1KFBB 2XADA 3GGGA 3EF3A 3WV5A 1F8YA 1VHQA 4FNMA 2Z43A 1KI1A 4HR7A 2JD1A 5IFKA 1EX6A 1ZVKA 3F2VA 3A1UA 3LLMA 2JATA 4IRXA 5EUCA 2YQ5A 4RHEA 1BX1A 4NS1A 5DCWA 5G4KB 5MN6A 4R2KA 1Z13A 1UZLA 4I2VA 2PL1A 4MS1B 4D6XA 2XOEA 3H7IA 2I2FA 2EP7A 3RU7A 2B5OA 4XI9A 5I6DA 5JPDA 4Q03A 3RAEC 2D62A 2NU9B 1RWBA 1TJ3A 4I7EA 3EASA 4QBKA 5HZKA 1FS4A 4HNAB 3VU3A 1XA4A 3GZTB 2DY0A 3N0WA 4GYJA 5ITZB 1BKDR 2A30A 2Z09A 5KMGA 3K8YA 2VS1A 5KSWB 5GIOE 1J1UA 1DAIA 2I2XB 1X7YB 1IWPB 2Q4BA 4YJHB 4HMOA 4S2UA 2XQJA 1PT6A 3S99A 1OFUX 3QYJA 5I4BA 2I1VB 2HJWA 1TC2A 4EGCB 2V9ZA 3LP5A 3DDZX 1EJ6A 1JE0A 2X19A 2HLPA 5F4BA 1QORA 3LY9A 2B8JA 4O2BF 4Z54A 4NMHA 2M98A 2XE4A 1UBTS 3KQQA 3HFGA 1F3LA 3ETHA 2MOKA 3G8DA 4UBIA 1XD2B 1KK1A 4ZQFA 1TMGE 3TQHA 2ZBEA 1K9SA 2FEOA 4H16A 1C1XA 5ALHA 4RVNA 1MAAA 4OATA 1W75A 2C2BA 2DAPA 2Q5OA 4MJ3A 4Z7QB 5CLJA 4LQDA 2IDKA 2DR2A 1WF6A 4XLLA 5DBGA 1SUWA 4XJVA 2AKYA 5KTOA 2A7XA 4DWJA 1NASA 4R1QA 5BN5A 1AZSC 2IHTA 1Q77A 3B9BA 4LDAA 3SDSA 3S70A 1PR3A 4LJLA 3QFTA 2O2YA 4Q01A 3WOVA 4MKGA 3PB3A 3TCKA 2QUHA 2BFEB 2QZJA 3BMOB 3FFAA 1E1CA 1R8QA 3LM8A 2P2DA 2ZYSA 3OLVA 2X0RA 1HLDA 3QKTA 4TTJA 3TI7A 2GAAA 5EEHA 1COWA 1HMPA 1I3LA 4HWGA 2H18A 5AKYA 2Q62A 4YCJA 3O4JA 1HE2A 2FHPA 2VDKB 3AOEA 2JGNA 3FTQA 5IN5A 3GRPA 3Q12A 5L45A 1GD1O 2YDXA 3PHCA 4ER6A 1LVGA 1WPXA 5FLXA 1C2TA 1TAGA 5IM4A 1GPDG 5ICFA 1DKLA 4NULA 4URZR 3G6WA 3W04A 3C4JA 1H5UA 1KK2A 3SSMA 5FNZA 5KYUB 1JVNA 4WGGA 2G9RA 2O57A 3GXOA 1C1YA 2OXFA 4XM0A 2PS9A 2QN2A 3CYFA 3NJRA 1OLUA 3GDOA 5DRYA 2SBTA 5BV1A 2OESA 1MTOA 2BR4A 2MT9A 2CHGA 2ZIXB 3OCCA 2R48A 4Y7DA 1XKXA 2ZIZA 5T4HA 5J4YA 2YFHA 1CQIB 2J31A 3IOCA 1NPYA 3MJDA 2Q3LA 2R87A 3RSLA 3CUWA 3HV2A 2IQ5A 2O8FA 4ZT6A 2C2WA 2RGBA 2VP0A 3DL0A 3UPDA 1EJ0A 2GYVA 1ICIA 2IYFA 1P39A 3EMDA 4TM7A 2REQB 4MX8A 1NT4A 3V8VA 3FTEA 5DP2A 2Q46A 2CXRA 3E1SA 2A5DA 2DUNA 2XB8A 1M1YE 3T1QA 1ESDA 1PGOA 4F11A 1RAHA 3IQXA 2FZKA 1FP6A 3KTFA 1QAMA 3VYVA 4BE4A 1JR3E 2QRMA 2ZBFA 5BP7A 3H05A 3M6FA 4EEXA 2I6TA 4MIOA 1ND6A 4XPIA 5HZGA 2DJ5A 2OP1A 3GA0A 2XXJA 3ZH2A 3ESDA 2OA0A 1ACJA 8OHMA 4D92A 5EJ9A 3UPUA 121PA 4E3WA 4JAVC 2QNRA 4G9BA 4F3CA 4DV3B 1OI4A 2C20A 2DUUA 3OT1B 3O8OB 5KREA 5E9JA 5A9TA 3JQ8B 2Q4RA 2HAEA 4KE8A 3NALA 4B74A 1U2PA 1CDZA 2CNBA 3KDSE 1NHWA 1NVMB 1XZIA 5E2IA 4BO6A 1F8GA 3BCRA 3DE0X 3KX2A 3H65A 4JLVA 3SC2A 2YQ4A 4EGQA 1EWTA 2L19A 4Z4IA 2WTNA 2GEJA 1WP9A 4P98A 1V9SA 3FMGA 4WDRA 4A8JC 2AUNA 1N5KA 2Q9UA 3O83A 2CXXA 5G41A 1OJ7A 2JJ1A 4COOA 5C8ZA 2VQEB 1Y1RA 4M0CA 4XJSA 4UHJA 3H0CA 1RZRA 2OQ2A 3KLMX 1K2WA 1BXRB 4Q4HB 4C4SA 3MLAA 3HDQA 2FYTA 5LN1A 3E2PA 1QQAA 2NZ2A 3C6YA 1TLFA 4IDGA 3TJRA 2CYAA 1ZR4A 2F2TA 2A7QA 2P75A 1XX6A 2JL1A 1T8YA 4G8DA 1JFFA 1K2VN 3L1JA 4NESA 4ZD6A 3SM9A 4ZK2A 4Q21A 4MQLA 1A95A 1N2CE 2NSYA 2PJZA 1UBOS 3MTDA 1QRUA 3TZ6A 4P6VF 1GQSA 1IPEA 2HI0A 3F6EX 2Q4EA 1ZUIA 4ENWA 4EL5A 1GZHB 2I7VA 3A6ZA 1QTRA 1U94A 1VI5A 3AT1A 2B78A 4YP6A 1L5HB 3RC1A 1M5TA 5FL7D 5TMDA 4EVRA 5DCLA 5JUWA 4PSDA 1BRTA 2ACVA 4XAQA 2X7HA 5YASA 3RBXA 4QYTA 1T8PA 3KG2A 1TAQA 2PVPA 4P2GA 4RSGA 4DLKA 2HU8A 16PKA 4HEHA 3S28A 3RODA 3GJ6A 3ED5A 4KUHA 3C3JA 1QGUA 3WRYA 3CRW1 4CLOB 4F86A 4AN0A 1QHHB 2NTEA 1E2NA 1VG1A 2QENA 5J5AA 3KTAB 3AVQA 4MV7A 4UHBA 2WF5A 4D9IA 4PNEA 4EMBA 5IK2A 1XE3A 1ZRMA 4RGBA 3I6IA 4QDZA 2E85A 5DNVA 4J1TC 1UWLA 2Z8XA 1PT7A 1U7ZA 2HRCA 2QKYA 2ZE6A 2VRBA 2R00A 4R1LA 3TUJC 3T4EA 2K7FA 4NZMA 3SFVA 1TQ6A 1W35A 1SU7A 3ZDFA 1FFYA 1V9CA 4YJDA 4MW4A 2F43B 5FI5A 1RQXA 3AV0B 3GCZA 3GPBA 2PQ0A 2HBRA 2HOQA 2XGOA 3HEMA 3NTRA 3PFWO 1F6WA 3HDJA 4FFNA 4QVIA 2FN4A 1KBQA 4MVJD 1Z26A 4ER7A 2WFLA 3RTCA 2BDUA 5JNSA 5IBPA 4CQMD 1Z5GA 4L5YA 4Y18A 3FCXA 2W2TA 1P17A 4TSKA 5EIBD 4MVJF 3R2JA 3T9AA 3WQSB 1QUFA 4RL6A 5TGZA 1HFEL 2QORA 3MPOA 1JNYA 1S6YA 3H4TA 2Y99A 4N8EA 4LFAB 2W6NA 1EFKA 2YIVX 2J9GA 4UVGA 4JASB 3OPXA 3VDXA 1O8BA 5TXGA 1KFCB 4NMMA 1V16B 5EP2A 4DY4A 3KCQA 4OK3A 1PVDA 1TECE 1F14A 5D00A 8ABPA 3MXTA 4KPEC 4JOQA 4YIKA 3SLRA 3K6SB 1MKYA 3PX7A 4CV0A 1PNOA 3BXOA 3DFFA 4XUCA 5CJJA 2Z83A 4UAGA 1TKAA 5D87A 4A91A 4F5ZA 3A6PC 3CUYA 1MHPA 4FHEA 1WVMA 4G6ZA 4EB3A 1WQ4A 1XGKA 2H2FA 2ZJFA 3NT2A 5IVDA 1COZA 5F78A 2YN2A 3UTCA 4PHHA 5IBRA 2ZG6A 1ID8A 5LP6B 1YVDA 2EF0A 2PNFA 2O8DB 3U7RA 2C3MA 2XBLA 2AYZA 1GU7A 3QWAA 2IBMA 4KRXA 3EYWA 1TO2E 2GD2A 2XIQA 2XOXA 4C05A 5IJ9B 1HE3A 1Z15A 3EZNA 4RD6A 1UPUA 2H9AA 2X0NA 5FPKA 2O6LA 1JSXA 4YRSA 1MDBA 3CVXA 1X3LA 3AL3A 3JQGA 2PEZA 3LQFA 2SCUA 1R6XA 2EHDA 5ICSA 3E27A 1DCKA 2EJTA 4HN4B 2NUTB 1NAHA 1V6CA 4MGKR 2YYZA 3HJTA 3DBIA 3GLFE 3AH8A 3K8ZA 3U13A 4TV8F 2XZDA 3BUSA 3LO8A 3UK1A 1RE0A 4NDZA 4CKXA 3WJ7A 1FTYA 2I1WA 2Q3HA 3BCHA 3O4RA 2H48A 2UZAA 4ND2A 4Q4DA 5EEGA 5J5CA 1YR8A 1QG4A 3FROA 3WLNA 1E3QA 2DVMA 3QXSA 4KFUA 2IV3A 2BKEA 4ER0A 3JSXA 1NN3A 4TM8A 3OX3A 1TVCA 4LTNA 4TMFA 1C50A 1GADO 3LXRA 4QVGA 1YACA 5HJ5A 2PUFA 1VLJA 2MYNA 3G2KA 5AQEA 1U8XX 2ZSKA 1IBCA 2YFQA 3E9QA 4HSEA 2ZWVA 1WUKS 2HWKA 2WINI 1OAOA 2QQGA 1DXOA 4JC5A 1NXWA 5K3BA 3X2SA 2J32A 2R7NA 3PPXA 3LBFA 4C4OA 5MFZA 3DA8A 4QUGA 1ZLYA 4ONEA 5AMXA 4K9KA 1Z83A 3G9TA 1LDEA 4I5GA 5FOTA 5CA0F 1KP3A 1TJ5A 3A8TA 4BVAA 3QSGA 4CODB 2V6FA 2Z6VA 2JFWA 2IE0A 2JZCA 3QVJA 3BULA 4Q1AA 1BEUB 1W8IA 2W83A 2LW7A 1Z6XA 2I34A 1X7WA 2DTDA 1NUPA 2SHKA 3AFMA 3FWPA 3RS0A 4M76B 1N4DA 4BFZA 3TUZC 1F8UA 4O4HA 2ZR8A 5AVQA 2LPMA 2ZB4A 1R8XA 3C6ZA 1O57A 4KMOA 4MLZA 3CKYA 5FDFA 1YBMA 4D5EA 1JDJA 3UJ6A 1ID1A 1PR4A 3NHPA 4XYBA 2HWUA 4YT4A 2HWYA 2D0PB 4G5OA 4IXTA 2RIRA 4LV5B 1DKPA 4MV9A 2NU8A 2BFPA 1DDOA 4YRRA 4B7ZA 5DN6A 3HUDA 2NZXA 4MLCA 1XU9A 2BFCB 1W4BA 1NDUA 3EZ9A 1RIFA 1C4OA 1BEZA 2PX5A 5H02A 4LMAA 1QQBA 2E5LB 3NEPX 3QZUA 3VAZA 3W8DA 4P5EA 2C5HA 3FNFA 5KSYA 3P27A 1I9CA 4MW2A 1W85B 4DQDA 2PUDA 4R54A 2QLBA 3E8XA 3JATA 3UMRA 4KITB 4CBVA 1KAOA 2TRSB 4IMJB 4C4ZA 3IBFA 1WL8A 4MO2A 4R05A 4GW3A 4K9RA 4BNDB 1NLFA 3AW9A 5I7AA 1YMQA 1TZBA 2X8BA 5B2EA 1LC3A 4PFKA 1DJMA 3TE6A 4IBOA 4N5IX 2V3CC 2BDEA 2IRWA 2FRXA 1C0LA 4F3RA 2B8WA 2FPIB 4JYMA 1PS0A 1JB9A 2JJYA 1DRWA 3O9MA 5EJEA 1LY1A 3AI1A 4GHWA 1CJUC 1KAQA 5K5EA 2BEJA 3RNLA 3B7GA 3PEYA 3CX8A 4LC1A 2HH9A 6ABPA 3ADDA 5JYCA 3TLGB 1ZJYA 4N47A 4BVBA 3T0FA 1RI2A 5K0NA 1J7JA 1DV2A 3U1TA 1SG6A 2O07A 2XNJA 4GLLA 1WHTA 2YICA 3OEWA 4NOLA 4FM9A 1YI8A 2BMJA 4KQCA 4F8EA 5CFMA 2FN9A 1V5IA 4CTKA 4DVJA 3KXPA 1FZQA 1PJRA 4J91A 3CT6A 4RA6A 5CNIA 4J0DA 3S2EA 1JEQB 3X1ZA 2OHFA 3NFYA 3A6LA 1EQAA 1I7DA 4ZOEA 3SEQA 1ILWA 1R4ZA 1Y9DA 2FW1A 2I6FA 1SC3A 1MDFA 4OHCA 4PSCA 1XZAA 1B0UA 2JJMA 5AI0A 4CCAA 4TWRA 3TZHA 1BDHA 2IK8A 4OQNA 1A7UA 4HD8A 1N6NA 2W4IA 4C7OB 2JCYA 1FSPA 2KS6A 4ENSA 5C81A 3DO6A 3NUZA 1N2SA 4J2OA 4WXRA 2PJDA 2XNDA 4B73A 4OL9A 1ARZA 4MMZB 2PX0A 5C51B 2CL6X 2P3OA 2A3NA 1U4NA 2ALJA 3PIIA 1TGYA 2D59A 3WQBA 2OM2A 3QLTA 4B6SA 1DFHA 2H07A 3PENA 5CYOA 1WAMA 3TG2A 2R6GA 1GTVA 3GEIA 4IH9A 2CWWA 5H1YA 3SSOA 5JQWA 1QHGA 2V1XA 1RHUA 3QLJA 3VOSA 2PXHA 2AOUA 4CV2A 2E87A 3VBEA 5ED4A 1PDVA 4JODA 4RD0A 1Z5ZA 5IKOA 2Q0HA 3Q4GA 3JARA 3T0GA 3BA6A 3V46A 1NYRA 1ZQ1A 1D4OA 2ZRIA 1OZAA 3A2NA 2ISSD 3FI9A 3L3BA 3PRKE 4UTOA 5CCXA 2GBPA 4XUEA 1KAEA 1MX9A 1EB9A 1H42A 2XECA 4RBNA 3PR1A 3VPBA 3PEWA 5AVKA 1CS0B 4J2TA 3FCSB 3HB7A 1EDOA 3IP6A 3N2LA 1YVRA 3TZEA 1D2RA 5H5JA 4MDEA 4RLFA 1RWWA 5H82A 4YMVA 1FX0A 1NF3A 1GGHA 3IV9A 4NWIA 3GWZA 1VG0B 4MVJE 3BAZA 1IN7A 4IIGA 4Z2YA 1JAZA 2QTNA 3LUAA 4QYSA 4X71A 2UVDA 3FNGA 2OY0A 1O08A 1A5AB 1ZFNA 4IDPA 4QXRA 1DBWA 4WCDA 2ZYGA 4EW6A 4AY6A 1HE5A 3VJMA 2J46A 1CHNA 1V4VA 3CKKA 4PINA 2XSZD 3RSZA 2GJSA 1CRWG 3GLTA 2YMQA 3QTLA 5JCZA 1TA0A 3TGPA 3DBVO 3JZMA 2IHYA 3OT5A 3VR6H 3VZSA 1Z5OA 3P0JA 2PRZA 3CC8A 2HIGA 4NP6A 5AJZA 3RSFA 3AEYA 5F2OA 3VV2A 1C7IA 1H2HA 4JLSA 4RCYA 1M3SA 2GZ3A 3GVIA 2VZLA 1Q21A 4X7BA 3W2HA 3F5SA 3LCJA 4ZKEA 3B1JA 4DLLA 2FHSA 2AVDA 4LXTA 3TQTA 1CF9A 3A3OA 4IIUA 3WNZA 4Q3CA 1O6CA 2ZB3A 2C5BA 1XZLA 2INGX 4U7GA 1I6MA 3JTMA 2FW7A 4N82A 1MW8X 3WK4A 5HKKD 2Q49A 1TMKA 1D3AA 2WU8A 3CR8A 3O84A 5LMNB 1ZNXA 1CZHA 4J7AA 1A8SA 4JVMA 4BKUA 5BMVB 3RCBA 1E20A 4R2HA 1L3BA 3U3DA 1GXSB 1QLJA 1UOOA 1N5LA 1TRKA 2HQOA 3H5OA 3IUQA 3OU2A 1CY0A 2WWRA 4UQOA 3EEYA 3OZDA 3UMGA 3ZDEA 5KNDD 1VPLA 4CFYA 5JYDA 2VKQA 2FMKA 2YV1A 1VE9A 3SS9X 3SJBA 1JQEA 2WG1A 3COPA 2L42A 3DYVA 4ZAVA 4EHFA 4A0SA 4FB4A 3RK0A 1BHSA 4WZAE 3OZEA 4B7AA 5KB3A 4M98A 1Z33A 2WZQA 1L7NA 5INTA 1O1YA 3P20A 2JH9A 5LJLA 1ECJA 2CUNA 1YNOA 2PAFA 5BNTA 1GWNA 3WQHA 3R3YA 2AT1A 4DCSA 1X3SA 1PG0A 1P0MA 1PG2A 1U2QA 2EL9A 4RV4A 1FBTA 2W0SA 3VH1A 4B40A 1J20A 1L4FA 1ZRNA 4IHKA 4C0AC 2HJVA 2B1IA 4YR9A 1FYVA 4AW9A 3G6KA 4ZGWA 2ZRHA 3GFRA 1E79A 5IX8A 2BZGA 1LNZA 1UXGA 4NEQA 4I50A 2WJZB 3CNBA 3D1JA 3CVYA 4HNHA 1GTSA 4Z0TA 3F46A 2IXBA 3DHVA 4KGDA 1LW7A 2M6KA 1PL8A 3DKRA 5EGNA 1ZXLA 5CDSA 1QAOA 4Z1MA 3THXA 3ENVA 1NJ1A 3B6KA 4POAA 1WCWA 3PTZA 4MYTA 4Y2TA 2ZUWA 3WNBA 9LDTA 3UHPA 1XD8A 2GRUA 4Z53A 4REOA 5HDQA 3VHQA 5FIUA 5A0FA 3N8DA 2V4ZA 2X6QA 3IULA 3N3BC 5GAJA 4WK4B 4F71A 1CUBA 3PJGA 3KUDA 3AF0A 2R1VB 5CX1B 1OVMA 5K03A 3VDRA 1YE8A 2VSQA 4AROA 3O7MA 5LQUA 2JJ1D 4PO8A 3I73A 4I9NA 1C7ZA 2RBKA 1AB6A 2Q9BA 1L5QA 2MR6A 3E9NA 2HRRA 5F1YA 5EJ6A 4L4RA 1YTUA 1QS0B 2GBIA 3M8KA 4IO0A 1ZJ6A 2H11A 4WHMA 3E7PA 3PBKA 1JI0A 1FRVA 1QZ3A 2WE7A 1RJGA 2V7BA 2V45A 1NE7A 3KTDA 3LBIA 2FXIA 4J07A 1ZCAA 2GZ1A 4LOHA 5LYJA 1JTVA 1PNTA 1E2QA 1OY1A 3GFSA 4LCEA 3QMVA 3THWA 2X0JA 3LPMA 4OIMA 4IQGA 1X92A 4WY2A 3F8WA 4IJ6A 4YP1A 1IUKA 1W0KA 5FWXA 3LQ2A 2C2YA 3I9OA 4PCLA 2C04A 4HHEA 1CUSA 3WC4A 2AK2A 4YMWA 3FFBA 4D5GA 4W5NA 4BNFA 4NATA 4H3VA 4ADSG 1C8LA 3HS3A 4FT2A 4H0NA 3N2GA 4NZYA 2J9FB 4R5MA 3MSCA 5EXEA 1GPLA 4RJ2A 2XNKA 4JDUA 3QEOA 4JUAA 4N7MA 3SEAA 4EYQA 1EVZA 2AW5A 5F5NA 5IDYA 1K4YA 2AD5A 4GOXA 5K0LA 2WWYA 3BL6A 3C45A 3FUCA 3PL1A 1UXJA 3P2JA