1IBCA

Crystal structure of inhibited interleukin-1beta converting enzyme
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
167
Chain Sequence
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords INTERLEUKIN-1BETA CONVERTING ENZYME
publication title A combinatorial approach for determining protease specificities: application to interleukin-1beta converting enzyme (ICE).
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1997-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ibcA00
2C2KA 2FQQA 1RWKA 2HBZA 3BIJA 3R5JA 4IEFB 2QLBA 4JJEA 3H11A 4PS0A 2C2ZA 3OD5A 3H11B 3GJSA 1GFWA 4PRYA 3IBCA 3V4LA 1SC3A 4JB8A 4QU0A 2J30A 4NOMA 4AWAA 2C2OA 1I4EB 4JJ7A 3KJFA 2AR9A 4QUHA 4JR2A 4QUEA 4QULA 4QUIA 2FP3A 3K7EA 2NN3C 4NBLA 4QU9A 1GQFA 1NMQA 3R5KA 5H0IA 4QUDA 3NR2A 3H13A 3RJMA 1PAUA 4NOKA 5IBPA 1PYOA 3GJRA 3GJQA 1RWXA 3H0EA 4D3YA 1CVRA 2HBQA 5IC4A 4JQZA 1SC4A 4ZVOA 3D6MA 1QX3A 2CNKA 2Y1LA 3NKFA 4FGUA 5IAGA 1RHRA 5IC6A 2CNNA 3ITNA 3R6LA 1RHUA 4QU5A 1RWVA 2K7ZA 1RHMA 3P4UA 3R7NA 2H5IA 4ZVTA 4N5DA 4EHKA 2J31A 1NMSA 3P45A 4ZVPA 3PCXA 3S8EA 4AWBA 2XYGA 4QUBA 4DCJA 3V55A 1I3OA 4JJ8A 3R7SA 3PD1A 4N6NA 1BMQA 2CNOA 2HBYA 3KJQA 2C1EA 3DEHA 4N7MA 4PRZA 3V4OA 1ICEA 2H54A 1SC1A 2DKOA 5IAJA 4I1PA 1IBCA 2H48A 4EHNA 1RWNA 2HBRA 3SIRA 5IABA 3UO8B 2H65A 2CNLA 4NOJA 4QTXA 4QUGA 3V6MA 4EHLA 2XYHA 4PS1A 1QDUA 1RWOA 4D3ZA 3EDQA 5LU8A 4HQ0A 1NW9B 2CJXA 2QL9A 2Y0BA 3NS7A 4QTYA 3D6HA 1RHQA 1CP3A 1I51A 1SHJA 4ZVUA 3IBFA 4NOLA 2FUNB 1F1JA 1F9EA 4HVAA 3R7BA 1RHJA 1KMCA 4FDLA 1RWMA 4JR1A 1RE1A 4QUJA 5IBCA 1RWWA 3S70A 3E4CA 5IAEA 4AW9A 3EDRA 4N6OA 5I9TA 4FXOA 2QL5A 4NBKA 3DEJA 4ZVSA 3KJNA 4EHDA 2H4YA 2H4WA 1K88A 4I1RA 5IANA 2QLJA 5LUBA 1RHKA 2QLFA 4LSZA 3D6FA 2J32A 2CDRA 2WDPA 4HQRA 4N6GA 3UOAB 1I4OA 3V3KA 4D3XA 4EHAA 1SHLA 5K20A 2XYPA 5LUAA 5I9BA 1K86A 3QNWA 5IAKA 2CJYA 3PD0A 2P2CA 2QL7A 4ZVRA 5IBRA 2XZTA 3GJTA 4JQYA 2XZDA 4IYRA 4DCOA 1QTNA 2H51A 2J33A 3R6GA 4QU8A 5IASA 4NBNA 4JR0A 4M9RA 3DEIA 4QUAA 3SIPA 1M72A 4EHFA 4EJFA 2H5JA 3V6LA 4DCPA 2C2MA 5LU9A 4EHHA 1JXQA 1NMEA 4ZVQA 4FEAA 4N7JA 5IARA 5JFTA 3H1PA 3DEKA 1RWPA
chains in the Genus database with same CATH superfamily
2FSSA 4KUHA 5K8JB 4IIVA 5D5PA 5KSWB 1BH6A 1WTCA 2R2GA 3CG4A 1HE8B 4G5OA 2JGRA 4HX2A 1PEDA 1RBQA 1NMZA 1SXJD 2VK8A 3AI3A 1U2GC 3C4QA 5C8XA 4DA8A 1JPUA 3GARA 4I5DA 1IM5A 3LLUA 4M76B 3ZLTA 1NYQA 1DT3A 1E1DA 4IJ5A 3GW8A 4NYJR 2WILA 1BOOA 1OBHA 1PZNA 1ENZA 4FP9A 4QLOA 1E3SA 1H1TA 5CIQA 1M0TA 5DYYA 5B1IA 4BC0A 4BU0A 4FFSA 4H4EA 3I45A 4WADA 4D0LB 1A1SA 3FHJA 1U7ZA 3MJTA 3RVSA 2AUTA 2JGKA 2FDRA 1PR9A 1B0ZA 5AKEA 5B3JC 5I7HA 4H3KB 3QU5A 4HADA 1Y9DA 3HGQA 3PR1A 3VJLA 1YQWA 3GFRA 1H6DA 4U39A 4CLHA 1I0ZA 5AKXA 3ILYA 4N7BA 5AKZA 2CLHB 3TNLA 4O4LF 4YV7A 5K9ZA 1U1GA 1T91A 3U7HB 4Z49A 4LECA 4G0MA 4I6EA 1FUEA 4RZUA 2BP7A 2YHUA 2AWOA 4NG5A 4R84A 1E2JA 2FJPA 3IHKA 1TPZA 1X80B 1ANKA 1UAYA 1O95A 3ET4A 4MS3A 3L0CA 1XNHA 1XVUA 4RX1A 1JMVA 1RBZA 1Y48E 1XJ5A 2JFXA 2EDAA 1V4VA 2Q9UA 2ZQ5A 3CWCA 3R2JA 5KNCH 1HE3A 1TJ4A 2P4SA 3QRWA 3GYBA 4WA8A 1HE4A 5EQTA 2CV2A 1II8A 1JHYA 2Q8NA 1OXSC 2PT6A 3B5JA 2VDMB 4V0KA 1O97C 1IBCA 1ML4A 4BMOB 1G8MA 3GLHA 1TAGA 4JLKA 3W5HA 2NZYA 5I51A 3FCUB 3DTYA 1PT6A 4O02B 1FFCA 4KXVA 1A5SB 1JJIA 1QLHA 3P0RA 4U9IS 4WSOA 4BLUA 1Z47A 3KHSA 4HDQB 5LWQA 2DCMA 2Z6AA 1Z45A 1ZU5A 4OQPA 2AK2A 3TLZA 1UF9A 5JFGA 2OZLA 2X4LA 2O0MA 3AL0C 1A5BB 1J06A 5BYBA 5HQJA 4ETNA 4JUFA 1NUSA 1NBMD 3BFJA 1G8YA 3PTZA 4FBLA 4GX2A 1CQIB 3PUYA 3CTMA 4J90A 3THYA 3S2UA 1Q57A 1MDFA 2G80A 3C6YA 1PBTA 2HT1A 4OXQA 4XVUA 2I34A 4IDBA 2JZCA 3A9RA 4HDMA 4IGAA 3T0FA 2NXCA 4U7GA 4EA8A 4GBED 3QA3E 1HFWA 3LCJA 3AJ9A 4ETMA 4DLWA 5K3SA 3RPEA 4QDUA 1EAYA 2DQYA 3M3DA 1SHLA 4XD7A 4EAQA 4ZI2A 1UC4B 1G64A 3VC2A 1ESMA 5CW2A 3UT6A 1DG9A 2ZRGA 1R0XA 4JP3A 4PF1A 4GRAA 4X7MA 5BW6B 2V1UA 1EGQA 2JRLA 2PLNA 3EXFA 2Q7XA 5J5VA 1Z63A 2CCGA 2KQUA 3JRNA 4DC1A 1GZSA 4DQUA 1SQFA 1P1CA 3KXKA 5B4VA 5AR1A 2BGMA 1XP8A 3S55A 2V4MA 2C7VA 1Z0AA 2ST1A 4M9RA 3R3HA 1K06A 2QJWA 3MGBA 2ZR7A 4RLQA 3U3ZA 1EFVB 1TU3A 3LVRE 5ALYA 4KZKA 3RASA 4F4JA 5HF6A 1U3WA 3H5TA 3G85A 2EDCA 1KETA 5E4JA 4YRSA 1U2GA 4FOOA 4RM3A 1NJGA 4G5QA 2A5FA 3FOWA 1K6MA 4NS4A 4TV8A 5AM5A 1U4SA 3EFBA 3RO7A 1CR1A 5D01A 2EG5A 3BD6A 4QE3A 5LR6A 2C2ZA 3BDAA 4KE7A 2GR9A 4CQLB 3SHQA 3MCTA 4DIFA 1JDZA 2JJ1A 1Q3KA 4DCMA 1XUOA 4XVRA 1LTKA 4AWAA 3MJ4A 4XX0B 4DC9A 1O5TA 2NO7A 5HRAA 2NXNA 1SZDA 3DMFA 4CKCA 2NN3C 2VDNB 3HHPA 4IUYA 3B1YA 2R5FA 3LW8A 1DKUA 1NLYA 4WZAB 1QWOA 5SICE 3HJNA 2PT9A 1QVZA 3ICEA 2QYOA 2GAOA 1Q7CA 3G2PA 1KQPA 3FAZA 4MLDA 4YCCA 5KIAA 3ICPA 4KFRA 4YJ2B 5DLDA 5E6SA 3TINA 3WYAA 3Q4GA 3P2IA 5JAQA 2AWNA 1U0FA 2NU8A 1UBNA 1RR6A 2V6FA 1P0IA 4NL4H 5FBKA 4ER3A 2CF6A 2WWWA 4R40A 2WLSA 5DRYA 1QH8B 2XCQA 1VM6A 1VSQA 4JJGA 1Z2PX 4MGIR 4KN8A 1OILA 2R6FA 3EJWA 4QUBA 3AI7A 5CBKA 2WF6A 3Q11A 5DOZA 2Z5VA 3NM4A 4GR9A 4TMFA 1EVIA 4NDNE 3D81A 1VG9B 3F4LA 5JPIA 3EZ9A 1D5CA 1DV2A 1UK9A 2WWTA 1I94B 3QLEA 1IY8A 3AVYA 5KJEA 2P5UA 3MS2A 4MARA 1BD3A 1FXSA 5JH7F 2GHIA 1JJ7A 2JEOA 2YFYA 5EN4A 3O9VA 1M8FA 2PBRA 3EX7C 4TSKA 3W2IA 2HY7A 5IVHA 2O14A 2X9NA 1AQIA 2JASA 4P9NA 4K9DA 2GNAA 3I5YA 4I5IA 4UHKA 4E5YA 2ZDQA 4Q7KA 2AOXA 2Q6TA 4NLLA 2EJCA 1B2RA 4KEAA 2BBOA 2QXYA 2IY9A 3G2OA 3UK6A 4MQFB 2HK6A 2VNKA 5BN3A 4NULA 1FFWA 2Z8YM 4UUQA 4R9UC 4FD2A 1A1VA 1AF7A 4O4HB 5KS2A 2FF7A 3S5UA 1JA1A 5IFLA 5JCPA 2OP1A 4P4UA 5FB3A 4QT0A 3IUQA 2B69A 3IDSA 4NBUA 4CIAA 2A0XA 1NQUA 3D02A 3DVLA 3OQIB 4PSUA 8ABPA 2R1VA 2ZBPA 1FSZA 3TQFA 3FTQA 1O6BA 2XNCA 3NPAA 4IHAA 3SX2A 4B8YA 4PZ9A 5EIOA 4E2ZA 3REFA 4XW2A 3WWZA 5LDGA 1GJRA 5C3MA 3CUTA 1K88A 1QGDA 3PBKA 1JDPA 3WBKA 4BNWA 4AN1A 3IR6A 4NZ9A 3ULKA 1Y63A 2SCUA 3RG8A 3UZUA 5G41A 5I9SA 1DQPA 1I4OA 1PD1A 3I73A 3RSCA 1AZSC 2C0PA 4YDSA 2AFVA 4CM4B 1T35A 3ND6A 3FMPB 1N92A 4M7PA 3UYLA 3CF4G 1QWSA 3F9RA 3HYSA 3ZS9A 4GGPA 7YASA 4NBVA 4HVTA 4UCXA 1YCDA 2CLFB 4FOTA 4YRKA 2WUFA 4Z0TA 3WKAA 4WFQA 4P08A 2WZCA 2V58A 3HP7A 5LYYA 3QVKA 4D0NA 1YUNA 3QVWA 2Z5LA 3FBGA 1WEKA 1XLVA 5FXMA 1CKEA 4DIKA 3ESZA 3IALA 3P0JA 4EF5A 3H1PA 1BHO1 2J9YB 1BC5A 1L4BA 2I2FA 4KQ6A 5AHXA 3V1YA 3BL5A 3FYCA 1IZ0A 4FNGA 3UYKA 5ALQA 2VEDA 2VVTA 3U7GA 1SOMA 3RRFA 4R9RA 3VPGA 4PC3A 3ZBTA 1DSSG 5GADl 1RBYA 4UM9B 2BM0A 3FBWA 1MEOA 4EG5A 3VHLB 3IPAA 3O31A 4B3FX 1PNRA 3JASB 1P4SA 2G28A 2ODNA 4ZV7A 5DHPA 2MSCB 4YRLA 3TOSA 1NYLA 3T06B 1RLMA 1G5PA 2VNHA 5FTLA 1O3YA 3CR3C 3ZLUA 4JELA 2ACKA 1DBIA 3CLHA 1E2HA 2HI0A 3HWX1 3LOPA 3DWFA 2FZWA 1E59A 3K0AB 3MTGA 4PAWA 2VTVA 1XV5A 1KVRA 1ZM2A 1DWOA 4XDZA 3ZTTA 1T2DA 1NE7A 4N9WA 5TPZA 2GZRA 3UJ7A 4B43A 4URXR 1N2GA 1V5GA 4I9FA 2FSPA 2IBMA 2QW8A 3F2VA 2QG4A 4QXRA 5J1TB 2BC9A 2BELA 1SPBS 1KZYC 2EX0A 2PKCA 3BIWA 4OMUA 3L41A 2I3AA 3QEAZ 1RABA 3Q12A 1QP4A 4D26A 2NTYC 2MSKA 1CUUA 1O08A 1J2RA 1V35A 2WWRA 3EPPA 1SKBA 4LJSA 3NPMA 1DP4A 5DMHA 3WVNA 4HDNB 2IYSA 4KWEA 3DF9A 3N5CA 1Q2XA 1AHNA 2WYWA 1A3CA 5DLQC 3RRBA 3KT8A 1QCCA 4P31A 3ZHZA 4RV9A 3R77A 4GBJA 4G0UA 4L8LA 1YS4A 2NVUB 2C88A 2K87A 2YV1A 1MVOA 1RXIA 2GN8A 3O4GA 4WEQA 3T7CA 2E2WA 2OQ2A 2FV8A 3KT6A 2XCUA 3EVTA 4MQ6A 4MRVA 3V46A 3K70D 2V7TA 1AZWA 1H2XA 1W4RA 3BJMA 3WFJA 2YXLA 3W8DA 1NDQA 4WXHA 1KPIA 5JWHA 1ZR4A 1GVNB 3TXXA 2TMDA 2F9FA 1GFZA 2P6UA 3OFKA 1SCJA 1X7ZA 2EV9A 4OQ4A 3U4QA 1RC8A 1CVLA 4DLUA 3BMNB 3R7LA 1NBHA 3ELWA 1HT2E 1ZCAA 2L19A 3E35A 1Y1KE 1Z83A 3RREA 2QS9A 4OQLA 4WW0A 1F38A 2UZ3A 5KYVA 5BR1A 5JXWA 1X14A 2WJHA 3HO6A 3VNSA 1JH8A 1U02A 4NHEA 2LCFA 3TEFA 2XBUA 1DOAA 2REOA 2BD0A 4PPNA 1I3KA 4B6JA 4BJHB 2WYHA 4RVNA 1NXQA 4DQDA 2ZTMA 3CB2A 2D7JA 1GTL1 2JIDA 3T3MB 3WXBA 1VYVA 4PGGA 1S02A 3KJNA 4CI0B 4CEHB 3AGPA 4K9OA 3UJ8A 4MUXA 4RL4A 1GXSB 2BFCB 3FOEC 3ZJVA 2AOVA 3SJBA 2OXRA 4Z1MD 2C5GA 3A7EA 3RTGA 4O33A 3G2QA 5A5GA 1PCXA 1UXIA 3A4TA 3WGJA 1GTJ1 3QOWA 2AMFA 5HFNA 4BLOA 3ZXYA 4ENSA 4LMPA 1GPAA 1WF3A 3D6JA 4TRJA 1AO3A 5FPSA 5TNXA 3SE0A 1L8XA 5J9FA 1J22A 3JQAA 4I6JA 2I65A 5IWCA 4P3PA 3I8SA 4K6FA 3OTQA 4DR3B 3IVRA 2MSDB 3FGOA 4GLJA 4EHJA 3THXB 2V59A 3P9NA 2BSQA 3AU8A 3EXEA 1TRHA 4FDAA 5CX4A 3C3KA 2ZIXB 5AJWA 2NPOA 2RJNA 4MHSA 2I22A 3NNSA 3V7FA 4YRCA 1FRNA 4OB8A 2YMMA 1NAIA 4RYDA 3TIFA 3VBCA 3MQFA 3NJ8A 4ZQBA 3OO1A 3OE7A 3DEKA 4B3DA 3NHLA 1F20A 3N6XA 4HAXA 5CK4A 3TX2A 2XVYA 4LHEA 1FYFA 1QK3A 4HWKA 2C92A 4R7TA 5T67A 5A0TA 2XIJA 1BGXT 3AVQA 5I9LA 3OU6A 4LHZA 3K2EA 5AW5A 1G6Q1 1XNQB 3GUUA 5AUNB 1WWKA 3EK2A 4LI0A 4U5XA 3LP8A 1D4ZA 3DZDA 2O5RA 3QW4B 3V2GA 4DM4A 3T1TA 4N0MA 1WULS 4U5QA 3ZVLA 3IMFA 3DE0X 4I19A 1WKCA 1NVMB 3HBLA 1DBSA 1PNOA 3PWTA 4C4XA 3ZHBA 4QXMA 4EDHA 4F93B 2QUBA 4YUAA 2B98A 3JV7A 1PEYA 3OPYA 1U3DA 5LIPA 4YJFB 2O2GA 1JE0A 4YMLA 4D9BA 1XDWA 3PI7A 3R3JA 3RC1A 2QX7A 5MN4A 2YTZA 3GLRA 3R4VA 3TKAA 3BE4A 3I5UA 1LGYA 2GYWA 3QVGB 4LWOA 6ABPA 1W36D 1FVHA 2M1XA 1JP7A 3IURA 3Q8MA 1C8VB 3CLVA 2A67A 3EWAA 4Z4IA 3AM3A 1UZNA 3QVLA 5DM1A 3GUCA 4MVJP 3FSRA 1Y4ZA 3P52A 3SXPA 2OOKA 4RWEA 4X91A 3QBTA 4OQYA 4AWBA 1Y6FA 3A05A 1I6MA 2SKCA 4DCVA 1L7VC 5SY9A 3RSLA 1DUIA 2HJWA 4MUHA 4PFJA 3UY4A 1QUFA 2YJ6A 1S2DA 3GBSA 3ZY5A 2YBDA 4IEIA 3IAUA 2GCPA 5GONF 3VSCA 5DTRA 1VLZA 4PWZA 1IL0A 2IV2X 1WZIA 1KAMA 1SU8A 2OK7A 4EG6A 2LCIA 2ZXUA 1ONOA 1EUDB 1G8GA 1LJ8A 4RKRA 1N3LA 4ZAFA 3EVGA 2HUNA 3PUZA 3NNNA 3SBDA 4KRGA 2GVNA 4CQMA 1NOKA 3R0ZA 4QOJA 5KVSA 4UCWA 2WAYA 3I04A 3IEVA 1A9QA 2V7EA 4LPSA 1NPTO 2A30A 2QSYA 2X4DA 4ZVUA 2EP8A 5HMMA 3WIOA 5LQUA 1E6UA 5IJ0A 2ZULA 3GNTA 1F1JA 2OV1A 2CMHA 1IVNA 1OTYA 3DWEX 3MMNA 3NYQA 4QO8A 5CYFA 1JYFA 4MIYA 3O2SB 1GIAA 1NQ5A 1SB8A 4HQKA 1ZH4A 3A6ZA 3OEEA 2GCOA 1TAQA 2Q5OA 2J0SA 2LVBA 1KAHA 2JAXA 1GRQA 1CF4A 3EZ2A 4DWWA 2HOQA 1QVVA 2WA1A 1GNSA 1X7WA 4NMMA 5JD5A 4DREA 2FRXA 1D6MA 2KM1A 2CXHA 2J32A 4G65A 4WOJA 1Y82A 3FD8A 5GOTA 1DTEA 1XTRA 1YRWA 4G1BA 3DQZA 3ZDEA 4YDQA 3N8IA 3PD0A 1ZD5A 2ZE5A 1KK3A 2P5SA 1Q5PA 3I6ZA 3QXSA 4QG3A 3SSAA 2HK8A 3KQNA 1BAPA 4A23A 4ATNA 1RIFA 1Y8AA 3FIJA 1WOMA 4Y2YA 4DDMA 2WG0A 3BZWA 3O7WA 4HQ6A 1XSEA 5LQSA 1C41A 4C2UA 1CLEA 1KNQA 1M2KA 2O4UX 4ICIA 1Z17A 4CCYB 3NT2A 4X60A 1K8XB 2ZU6A 4FE7A 4EEZA 3JWGA 5THQA 5A62A 4F5WA 3L8HA 5HX7A 5T7BA 1P3JA 4UBKA 3ICOA 3O8RA 4HWOA 2C9MA 1D3AA 2OHJA 4C08A 3K0SA 1IVYA 2OAQ1 2Y1OA 2UUBB 3UUWA 3BPSA 3OOWA 1M54A 5CNJA 3LSTA 3OD5A 5DBOA 4DNFA 1ELOA 3F46A 2NNLD 3EMVA 5DCUA 2A5JA 4UASA 1NXWA 1Z7BA 2NTVA 3O1LA 4G4IA 4WE3A 4DNQA 4O2RA 3S5JA 4CG0A 1Y3CE 3HVUA 2BGTA 4UD2A 5FI0B 1SB9A 2CVZA 2R87A 3IT2A 1ECFA 2XGSA 1WEHA 2XUOA 3FZGA 3KPVA 3PXXA 3O8QB 4U7TB 4JVSB 3NTOA 4V3BA 1RRGA 2AN4A 3DTTA 4J3NA 2QROA 4HNVA 5A2QA 5HS4A 3OT4A 1EIWA 2UU9B 4YP6A 2FEXA 1K27A 1QK5A 4E4TA 4F12A 1E9FA 1YR3A 2QLMA 1KP9A 4C06A 3HM9A 2AH5A 2ONCA 2BHRA 2GESA 4I5EA 5EXXA 2MYPA 2GK4A 4JT2A 4QNMA 1L4LA 2O4CA 2EP7A 3KYDA 4OXIA 1U3CA 4GS5A 2IHUA 2GJ4A 3FRHA 2H31A 3BGDA 4KLZA 1QUEA 4MS1B 5PNTA 5HZGA 1U9CA 1WQ3A 4PVDA 1MTOA 3VSDA 5E8JA 1BH2A 3Q5GA 1UEJA 2R5NA 2IYYA 3PHCA 4ZAVA 3FNEA 1MW8X 5E4TA 4F8EA 2IYAA 4MV7A 5IS2A 2AGVA 3RUPA 2JLWA 1I14A 4LN1A 4REOA 3UFBA 3OSZA 2XE8A 4EJMA 2Y2VA 4FZ3A 2VAVA 2FN7A 3Q41A 2BHSA 5F52A 1FTGA 3DZHA 4UM5A 3EC2A 5CA0F 3FAKA 4EKEA 3I8OA 2Z57A 2O54A 4CZ2A 1IDN1 4OMCA 3KLMX 4IH9A 2VDPB 4MCIA 4A8HA 4L28A 3AFGA 1ZX1A 3QBJA 1WQ1R 5E7MA 4I8DA 4GSYA 5EXSA 5JALA 2Q2OA 4LE2A 4OXNA 3G02A 2F55A 1IUOA 1C30A 1FNMA 1GZVA 1MABA 1VMIA 4V1CB 1TT7A 5LJLA 2DFDA 3E9MA 4IDPA 2DFPA 3NFRA 1GM5A 3IEUA 3WMEA 1MFZA 1QVWA 4FYWA 1M2JA 2BFNA 2XY4A 3H8WA 3LVBA 5DN9A 1MHPA 4B8WA 1D1SA 4LTMA 1D03A 1ZN9A 2FPPA 2VK4A 2HA7A 4NESA 4OGLA 3IVMA 4PGHA 4KQMA 3TR6A 1SBTA 1ZUNA 2CXTA 4RV4A 2FTKE 4XASA 4GZLA 5FWDA 5LLSA 4EJ2A 5AVVA 5AI0A 3ZCPA 2ZB7A 3V4FA 3GEEA 1KEEB 3R7WB 3USCS 4K9NA 1ZH0A 2PX0A 4YRFA 4DMFA 4G0QA 1F7VA 4PXYA 1KSJA 4LGVA 3W5IA 3D2AA 1Q22A 1M1UA 3H16A 4E13A 1N2CA 2AS0A 3W3AA 3BA6A 1U9ZA 1VZ2A 3A14A 3I1FA 4J9VA 4EB0A 4KXNA 2ZIUB 4Q9HA 1XZGA 1WKVA 2IYXA 3K96A 5FAXA 2GO1A 4MQLA 3NHZA 1A9SA 4IQGA 4Q3EA 3LKVA 4S12A 5HGJA 2ODQA 3IT0A 1XCOA 2ZI6A 3LWNA 4J1NA 4QIHA 3PGMA 3RU3A 5GVSA 5JD6A 4FWTA 2R25B 1R88A 4MO2A 5EG5A 1QANA 4MW7A 3LL4A 5CA1B 1DBVO 5CH3A 4Z51A 1FK8A 1XQ9A 1YJQA 1RC0A 3N07A 1KU0A 4C0BA 3G1WA 3PDHA 5DYNA 4MQEB 2NO9A 2Q5FA 4EECA 2O59A 3OMXA 4XJSA 4Y1EA 3T5GA 4C6HA 3WFIA 4ZK2A 2F90A 5KNBH 3MS7A 1JF8A 2WAAA 2C2OA 3FUWA 1D2AA 1LD3A 1KJWA 3BJRA 3G7NA 4HBZA 4UBNA 2AF4C 4EZEA 3D6UA 4FCVA 2XAUA 2PYIA 4IDAA 2IWRA 4LF8B 3GFBA 3ZWBA 2BE9A 4F5EA 5JZSA 2A8YA 1TE2A 2HHJA 2ZUEA 4GF5A 2PZFA 4AP5A 5A7HA 1XD8A 3SGLA 4URHA 4MINA 1K0FA 4R98A 4BXOB 3U16A 3OQPA 1Z18A 1WXEA 1X6VA 2ZJ3A 4AJ4A 1PWYE 1ZIXA 3GFPA 5IKEA 1CQZA 2VP9A 1KO5A 3CGGA 2YWGA 1PUXA 3ZY6A 1EWYA 2KBFA 4YRAA 1ISIA 1I01A 5J59A 3BGIA 2C04A 4G9EA 2DFTA 5CDYA 3EIFA 1PSZA 2A5DA 2VYCA 3CM0A 2OTCA 5J63A 9ABPA 2DR2A 1Z8DA 3W7VA 1KR2A 3HDJA 3T7SA 3LE8A 3ZWDA 3G2KA 4FZ5A 4QPZA 2YJZA 1V5WA 2EGGA 4EG1A 3ZDBA 2XUGA 1NKVA 5JLJA 3SQMA 1ZPDA 4CKBB 6Q21A 1MENA 4G8BA 1P5JA 1S6YA 1HFKA 1C7FA 2WFLB 4WWHA 1U8UA 4ENUA 2VQDA 2HSDA 3KOMA 4EGAA 1G5TA 5A1JA 3WKDA 2HRDA 4QQRA 1ZESA 3AR2A 4L4YA 4OHXA 5L3ZA 3LY8A 5LU8A 3DZJA 1UBEA 1A96A 2Z98A 2CJXA 1LPBB 2OSVA 1Z5PA 2DQZA 4O1HA 3CLUD 5SZKB 5JNRA 3IIKA 4G5YA 3K6SB 1KEWA 1XNRB 5KWSA 5CFNA 1DC5A 5KVQA 3P9RA 1KEUA 4O4LA 5JU6A 3FNQA 3DLBA 3KUKA 4PBTA 4Q7JB 1IYZA 4TTVA 4XWKA 1W581 2W6JA 1EFTA 3LP6A 1BN6A 3OUUA 4KDFA 5CB4B 1NJ5A 3B60A 5HILA 1XWFA 2IYVA 5C52B 1CJBA 1FDRA 2J9FA 1U8EA 2V03A 3B13B 4YMVA 4GOKA 4MV9A 3L8DA 3U5ZB 2QRNA 1BTOA 3Q9SA 4B6EA 4E4RA 4YHHB 2ZVDA 3CF4A 1II9A 4RVHA 5CMLA 1CJMA 2C2YA 2WEKA 3CA8A 2A5LA 2DUJA 2FSHA 3AR4A 1SVMA 3FYTA 1E1LA 1M5TA 1KNXA 1XDUA 2B4KA 1TK3A 3FR7A 2ATEA 1WUTA 2B8JA 3BWYA 3ORYA 1P2TA 1YONA 2OCIA 2RB5A 13PKA 4JOCA 2J33A 4IGKA 2C54A 3LBAA 2XUFA 5JAMA 2DBZA 3MB5A 5SZJA 3GEMA 3DOOA 5ERXA 1T3GA 4AYWA 5B3LA 3DXYA 2C2HA 1WW8A 3KDAA 3ZD8A 4BAUA 1DAGA 2AW3A 1XRPA 4KBFA 1T3TA 1B8PA 3FSGA 3HCFA 3Q7SA 5K09A 2WTXA 1FU4A 4XD2A 4ZFNA 4PSVA 3HKBA 4XB1A 4HHEA 4Q9IA 2APJA 1DXHA 5JS8A 1Z0DA 2J46A 2ZANA 3RVPA 3PRKE 3NEYA 3TCXB 4DJTA 1VIYA 3DAOA 2BLNA 3MJRA 2CEKA 5P21A 3HYLA 4DV0B 5HBGA 3WGTA 5F3WB 1TMYA 4D80A 4MW6A 1STOA 4Y2SA 4U7HA 1QSGA 1CQXA 1KMQA 1QPGA 3OEHD 3PLNA 5M34A 2EBHX 5T64A 1MB3A 1Q11A 4HVLA 2DCUA 1T1GA 3LZCA 3VR3D 2WHYA 4Y0NA 1RRFA 1IFXA 1KZ4A 1ZRNA 5CDHA 5A1TA 3ER9A 1VGRA 4LV5B 2ZUVA 1TU0A 3QMVA 3SF0A 4GMFA 3ZWWA 4AD8A 4B7AA 3UB4A 3S81A 5AI4A 3UCFA 1ZCBA 2DSNA 2YWDA 2XDQA 3MWDA 3PUHA 3IIMA 2NZ8A 2Q1UA 3I05A 4LQCA 3VAAA 5FHRA 2P5YA 4BKUA 4E3ZA 2FWNA 2H1RA 2VRCD 4EKNB 2PD3A 2R6CA 1W44A 2XT0A 4HS4A 4PZPA 4XARA 4QEKA 2XYGA 4U9UA 5EL0A 4D8TA 1W49A 1Z4NA 2XUPA 4OQDA 1VBKA 5EWJB 4Z4GA 4OX9Y 3IXMA 3H84A 3KEQA 1J1UA 3AF5A 2NNWB 4BNDB 2BMDA 3OEYA 1PJ4A 4KK3A 4TZ6A 3AVPA 3ZJ5A 4ADSG 1V1MB 2ODWA 3BHNA 2XUJA 3HQ4O 3MBIA 3RFFA 2YWXA 4I08A 3WQRA 2JLCA 1R0BA 3UWOA 1P5HA 3E82A 3NTRA 2PUEA 2DHDA 3F78A 4UATA 5CW1A 3IUYA 4RKYA 4NNJA 3RABA 1V2HE 3QKSA 1JZQA 4G5FA 3JQPA 1SXHA 2EFEB 3GGDA 4X97A 1DNPA 1Q0HA 2CL0X 4ZU3A 4NU0A 3T38A 2PRYA 4A0RA 5IFKA 3ZYZA 4EHIA 3F6CA 3ZZTA 1NM5C 5BSGA 5EPUA 5KCZA 3K2BA 1FFGA 3E84A 4FD3A 5ABPA 1G291 2R1ZA 4NOLA 1KBQA 4RK0A 1EX7A 1I7QB 5C8YB 1ZS9A 1NP7A 1QZTA 3WMFA 2GPWA 4CCWA 4JI0B 1X1AA 2UZ4A 1UBMS 1VPTA 4OI0A 1NYRA 4DLSA 1RRMA 2G5GX 3HDTA 1U0JA 2PS9A 3RIGA 5TVGA 3WK6A 1EUCA 4M0EA 4JCOA 4V39A 4OGKA 1RM4A 3HJRA 3WWYA 1SCQA 1J56A 4TWIA 1JHDA 1R6AA 5FNVB 5REQB 3UMVA 2WU4A 3TN7A 4D4KA 4JI7B 3DP9A 5IKOA 4LSWA 4DY4A 1T2CA 2OYCA 3WHIA 3OZSA 1U80A 3H4TA 4KLCA 1F8UA 1VPLA 1IHOA 3DDNA 5AJYA 4ITVA 5LL6P 1DO0A 3D4PA 2X0NA 5EFOA 4LZPA 2G72A 4OQXA 5JH7A 3SZRA 4KR6A 2IZZA 1GPBA 5EJ8A 5CDUA 9ATCA 5K8IA 1SVUA 2A1TR 5H7XA 1OLOA 2JFFA 2Z3WA 3LK6A 2FK7A 3TW0A 4GWKA 5DHTA 4ARAA 4EDFA 3PHBE 4JGGA 5GAJA 2LDXA 3N5KA 2AZTA 2G6BA 1T4DA 2JBHA 1KY5A 1VKRA 3B2EA 3HRKA 4HGQA 5AJVB 4AROA 4OM8A 5L8VA 3B7GA 4BASA 2XTJA 2ECQA 3PLAE 4Q1CA 4NCNA 1YR1A 5JSKA 2O3RA 3F2IA 3KRTA 2DP4E 3CXRA 3LT0A 3MUNA 5B64A 5I7OA 2ZTHA 3O1HB 4JEUA 3PF8A 5ALWA 5E1DA 1R0RE 2IYPA 1FFSA 3IC5A 1J8FA 3FFBA 4QL3A 5DK6A 3ZE7A 3IBCA 3D0KA 3PGVA 3PJDA 4W99A 3KZVA 2I4RA 1UFKA 3PZRA 2LD4A 3HM2A 3KKKA 4NZZA 5FOTA 3X2EA 1JPJA 4ENVA 3ADCA 2PPLA 4XQGA 3KB2A 4C0HA 5H16A 1ZL0A 3M5CA 1BXGA 2KW5A 3VX3A 3U9TA 1OW3B 3CPEA 3PNLA 2WAMA 1YRAA 5JRDS 4CV3A 1LDYA 4H0FA 3NUGA 1CUWA 2CHVA 3O8OB 4ZWNA 5B3KA 4ZICA 4AS1A 2GDJA 1Y9JA 1WCIB 3Q8WA 5LMNB 2CKMA 3PITA 1WW2A 5IC4A 3EWNA 3PE6A 2ECOA 1BJTA 1UBFA 2WBLC 3PVCA 4IMJB 4JVMA 5KJCA 4XAQA 3ZKAA 3THWA 3VXKA 1BCSB 4NFHA 4O59O 3AVXA 1GT6A 4LOHA 1TAUA 1MNAA 2ES4A 2HMUA 3QXJA 4M7OA 1TC2A 1N2EA 1RW4A 2O48X 3KZKA 3EZGA 4Q47A 4DR1B 4MYTA 3ZY4A 1PX2A 4WZBA 3HY4A 4NEGA 1EUYA 1MIOB 3ADBA 1E3QA 1VDZA 1GKIA 3WK8A 2TMYA 1T5OA 2M6KA 5JRJA 3CUVA 2DR0A 2CNWD 2QY9A 3LLVA 4IL5A 3A0UA 1FJ2A 1QFMA 1W6UA 1X1BA 1L5VA 2H54A 4OSEA 4RZIA 4RGYA 4BV9A 4KYTA 5AOCA 2M6SA 3TMKA 5D7NA 4EW6A 1GNLA 4GHWA 5LCXA 5IK2D 4C3ZA 1LBEA 2PBFA 2W4IA 3E8MA 1NM5A 5D3MB 2CNLA 2AFIA 2XSZA 2NPIA 1O6CA 5JZOA 3C7DB 1H1DA 1MB4A 3G8AA 3OFNA 4MVJF 3S1LA 3K9FC 1JHAA 3SAJA 1ZIPA 3SR4A 5C4IA 3M6FA 2HC9A 5GP1A 4WESB 5CXSA 3GL9A 2EZ4A 1ZISA 2I62A 1EGMB 1HA3A 1QVAA 4G81A 1NMYA 3A1VA 4C9BA 4DUGA 4ZCRA 4BCDA 2PIAA 5IBCA 2XQIA 1MFPA 3LUCA 2HYDA 2HXSA 3JAKA 1DDGA 2PRZA 4Y98A 4DABA 1UMBB 4LF9B 2EZ9A 1J8MF 3HYRA 3YASA 6REQA 3L01A 1CY7A 1FX0B 5JQGF 4NNPA 1R0ZA 1E66A 3W2HA 4FJ2A 4JLPA 4ID3A 3EWIA 1GEGA 2O2ZA 3KTAA 4WCFB 3GV0A 2P2SA 4F2WA 1E2QA 3H4IA 2XQGA 3ANNA 4O3MA 3GG2A 4GMDA 2GQ0A 3OI7A 3KJXA 4KQ2A 4ZEVA 2CJYA 4YRPA 4C2TA 4ZOLF 5CLFA 3QH4A 1I33A 4BNLA 3TUJC 3FJOA 4PZLA 3C3WA 4F2DA 2WIDA 5L3SB 2ZBEA 5F2EA 3DO5A 3QBVA 2Z9CA 3GMTA 5JO0A 2HNAA 3TAXA 2ZSIA 1GPYA 1V16B 5EIWA 1D7OA 2GZHA 1N1EA 4J1TC 2VK2A 2E0IA 4RD4A 1N2SA 1YB2A 4MWEA 3IAM1 3OP4A 2GUWA 3QMMA 2HAEA 4IVNA 3MLBA 1I4TD 4BO1A 5KNDD 4F21A 5HUJA 2B5VA 1DWUA 3SBOA 5CXQA 3AU9A 4FXPA 3EGDA 4BZQA 5JHHB 2IYEA 3H5VA 3KZNA 5TMDA 5A05A 2I87A 3G2JA 5ALPA 1MOQA 4PG5A 4X41A 1ULAA 3CT4A 4JBWA 4CMIA 3JZAA 3KG2A 4QLBA 4OX9B 4TXHA 1BU8A 3H0KA 2O8CA 4U2CA 1NATA 3DHVA 3K6RA 2QK4A 1PT9A 4EG8A 4Q5IA 3HB7A 2UXBB 2B82A 5BMOA 2P1DA 2DERA 2R7KA 4N8SA 3KOWA 5TMPA 1TVKB 3QKRA 1TCVA 3I04M 1ULHA 3DE6X 3UUGA 2QYHA 2ZJAA 4ZVOA 3DKIA 3GJZA 3NKFA 3LZDA 2YJ3A 3L82B 4M9CA 1ATZA 1CDZA 5DNWA 3PEFA 3UXHA 4E22A 5B12A 3VHXB 3N8DA 3GT0A 3SJZA 1RQLA 3SBXA 1G20A 2WSBA 4FYKA 1R5BA 1RLOA 4LRWA 3SKVA 1RYBA 5GIOE 3CUUA 3HB5X 4JL8A 4RHCA 2CHUA 1GG8A 3HBMA 5DHRA 5TE9A 1W9MA 3GJ3A 2ZSFA 4TMWA 2ZR8A 3T1HB 1L6IA 1D0SA 3N87A 3T1QA 4ZN6A 5BMVF 1JKMA 4KG7A 4C6RA 3U7QA 4MVCA 3N0XA 3PK0A 4EB6A 7REQA 3M6IA 2XW6A 2HZBA 1N2JA 2DECA 1KDTA 3HCOA 3EDYA 2WJ4A 2H2FA 2XNDA 3NIFB 3PYXA 4M2LA 4WLVA 2YZKA 3RC8A 4G4SO 3N2EA 2O8BB 1FX1A 3PC8A 3CCFA 4DLXA 1NC1A 1PQWA 1PJSA 1SKYE 1X1TA 1E3MA 3S4YA 1VA5A 1FUUA 4M83A 1SIUA 3O74A 3ZZMA 4UNPA 3AUKA 5BNTA 4LWZA 4AY2A 4Y2UA 3NDJA 3U44B 3ZJTA 3LWDA 5DDIP 2AFRA 2HJ9A 2AFHE 4PIPA 4BKOA 2KLHA 4KHPB 3DV9A 1OZGA 1M1YA 1EVYA 3Q3CA 2YMQA 4URFA 4MKXA 4JXZA 3JVIA 4JR1A 5FLYA 1RE1A 3CW2A 4V0LA 5JDCC 2DPXA 3KV3O 4YRNA 3ZWOA 4OHKA 1JW9B 1S3IA 5EUQB 1VJDA 4LMRA 4Q19A 5IJZA 2WTNA 2PMKA 3ZHYA 3V2UA 1MXHA 3AZOA 3AONB 4IOJA 5I9TA 1OTHA 5IANA 1YJ5A 2B4RO 3U31A 3R4CA 4IJMA 5DTIA 4BO5A 2KHZA 2PTGA 3C7AA 4M8IA 3OLWA 2CE7A 2QUHA 5ENDA 2YDXA 2J08A 2OV2A 2QAGB 4G26A 3WSWA 3WY9A 5GONA 3H1EA 3L93A 4C5AA 1A2QA 1Z9BA 3E5MA 3EUAA 3PDWA 4OI2A 2COEA 4OHOA 5FUXA 3QEKA 5AW3A 3C14C 3WAGA 2O19A 1TAHA 1P44A 2IT1A 5FPYA 1N0HA 4Q1FA 3LQ1A 3AETB 4J1TA 4CMCA 2CLEB 3Q9LA 2I78A 1BU5A 1OI4A 1L7XA 2G88A 2QNBA 2V97A 3A3OA 1ESEA 2XWBF 4ID9A 4L4SA 4M9ZA 4D45A 4JYCA 3DO6A 4HUJA 3FYUC 5J2TF 1G8AA 1Z0UA 1NPDA 4PO9A 3G2IA 3GEPA 1VGQA 1ICIA 1U8XX 3N9IA 5J1SB 4R1TA 2D2XA 2X7HA 4MVJG 4FGLA 2I4NA 1OBFO 5HKLA 2D4HA 1UKAA 1VPVA 1E7MA 2XD4A 1V8DA 3NHBA 2AC7A 4OH1A 3OJWA 3GX1A 4P4SB 4DIDA 4K0KB 3GLFA 2UZ1B 4GNKA 5L95A 4DEYA 4GZ5A 2NW6A 1AT1A 1FTWA 1W6RA 3HZRA 3WKBA 5ITSA 3N6RA 3MT7A 3RTBA 2JG3A 1B26A 4JBLA 2WY2D 3K1AA 1H9AA 2PWBA 3MWYW 3PRHA 3NAMA 4ZPXA 1JQBA 5TF4A 3V80A 3E0QA 4EGFA 3B8HA 2J4CA 3QE3A 1OR8A 1T2AA 3EOZA 3A6EA 3OICA 4MYUA 4TMYA 3UJ6A 4YEDA 1W85B 4A9AA 1VCHA 2NXEA 3KELA 3WWPA 4CQLA 1RU3A 2HLDD 2O0LA 1O4WA 1XMVA 1Z2CA 1XR3A 2ZYGA 3AVOA 1EU1A 2YHBA 2P3LA 2PX8A 4RE5A 5IBQA 2GAJA 1UJ6A 3EJ6A 3B7WA 4IIXA 4PZAA 3RYTC 1XL1A 4NPAA 5EHZA 1RHRA 1KKUA 4B33A 2HT6A 2C2XA 3S7ZA 3RHFA 1LVHA 1MO4A 3FETA 3ACDA 1G2PA 5BURA 3K4HA 1J24A 1HE1C 1LA2A 2YWCA 2VSFA 3AJDA 5F3RA 4N18A 2J3JA 1JHPA 2HRCA 4A5SA 4HZUB 3FOFC 1MAAA 1UM8A 1F14A 3GVHA 2FCRA 2H1HA 2YVKA 3MF4A 2GFQA 5EIFA 4Y0AA 2HEIA 4LZZA 4UHCA 1R9JA 4CM9D 3R23A 1KC1A 3ZE8A 4N01A 4DRXB 4CE6A 3GT4A 4ZYWA 4COOA 1XX6A 3D6VA 3LX4A 2BI7A 1T24A 3MBOA 3QKTA 1ZC3A 3VC3A 3ONFA 1ISSA 1YE8A 1CYDA 1SAYA 5A0VA 2CD7A 2H5EA 3A06A 3CWQA 4FFWA 4HXYA 4LE1A 2NU8B 5EQFA 3S68A 4ZXFA 4CKWB 4D44A 3JD4A 4US1R 3HPQA 2XMSA 1G7CA 1JR4A 3I23A 3TH5A 1MQ8B 1E1MA 4P36A 4YJGA 3QTBA 5HPYB 1RLUA 3TRJA 1I3CA 4YMIA 3EF0A 3PZBA 4ZAGA 3GLTA 4E7PA 1F9EA 3MTAA 1RAAA 4FK8A 1ZI9A 4N65A 1SGWA 3AERB 4BWFB 3OOSA 2FW0A 4B6QA 4BFSA 1F0PA 1XZAA 6NULA 4DW8A 5J43A 2RE8A 2EZTA 4M1ZA 4OF4A 4IUCS 5TGTA 1PQYA 3ICVA 3GP3A 1JEQB 1M10A 2NZWA 4RFLA 3U3DA 3KSBC 1DE0A 3GMSA 3UCEA 2J8ZA 1WXDA 4PCLA 1DJQA 1HWYA 1GWNA 5DLEA 4BL5A 1P31A 1PF7E 1PJBA 2ZK7A 2QGZA 2BFBA 1UPCA 2D2EA 5TT1A 1LSJA 3QYJA 4TKUB 4EFLA 4R3UC 1R8XA 1K2WA 4CIVA 1NAHA 1SY7A 4UPVA 1C0LA 4JA0A 4BO0A 1M0WA 2C5BA 3WISA 4M0FA 1FPMA 3P4YA 5IJWA 4P58A 1TA4A 1E9SA 1L9KA 1KK0A 4FDUA 5F1PA 5CA0A 4OK6A 2XOKA 3BSSA 4C89A 3UK1A 3ROZA 3FYUA 3BXXA 1F4LA 2FEMA 3MINB 2A7QA 5EKUA 3B2QA 3ZK7A 3CRVA 1FP2A 5FPPA 4PYOA 2QW0X 4RDHA 4KACA 2GN6A 4PRLA 5FR2A 2GA9A 4CEJB 3K4PA 2E87A 2OD7A 3O92A 2V4UA 3DBLA 4O4JB 4UM9D 4AN4A 1TGYA 1XPRA 4C3OB 3E3MA 2QRVA 3IBSA 3VZQA 3F7OA 3R5JA 1ZO8A 4F11A 2RIPA 1YR6A 3MYRA 1SU6A 2CE2X 4HDKB 4N54A 1J0BA 3F4KA 2Z6QA 3KCNA 4JDPA 4X92A 1QRTA 4FN5A 4HX5A 3ZWYA 3JQ6A 3N70A 1RLJA 1FYWA 5EE5B 5EWMA 2BTQA 4B73A 1AURA 3RHTA 1DQRA 1BE1A 1JQJC 3QIAA 3HR8A 1ATIA 1SIOA 4RACA 1CY0A 1H65A 4NV3A 4PV7A 3OURA 5EJ9A 4HLCA 5FTNA 3ERCA 2I7CA 2NU7B 4MS4A 3TEJA 3BXZA 1Z39A 1RDFA 3H13A 3ASVA 3L05A 4RZSA 2Y1FA 4RPLA 3R20A 3QNUA 3CNEA 3N8GA 3AFIA 3BIFA 3BS4A 4OREX 5LIRA 5CPFA 5K4GA 221PA 1D0VA 2X4GA 1FDTA 1Z74A 4HSEA 5E1BA 1WQ4A 1TK2A 4NEQA 4PZ0A 2Z30A 4HB3A 4B84A 1OZFA 3CKMA 3LNTA 2UVQA 4YCAA 3KPUA 4LDAA 4ERNA 1XYYA 1G1MA 3OF2A 1CUIA 5EJ7A 1THGA 1P5RA 1OZAA 2CHGA 2JVIA 2FR1A 4FLFA 1JXAA 3AY3A 3ZBQA 4HKTA 2DU8A 2X86A 2BBWA 2B9EA 3FWZA 1W9HA 2N1BA 1MGOA 3NBUA 4HB0A 4PQFA 4X6UA 5BPFA 4RJ2A 5MN6A 5E6RA 2P9JA 3TG2A 4EUSA 4Q16A 3L9WA 3WQBA 1FMCA 3GAAA 1TVMA 4RTJA 2VA8A 4D0SA 1ZOOA 2E89A 4RENA 2PAAA 3K2QA 1NQWA 5BXYA 1IJBA 1K8QA 3PHHA 4A0QA 3GT7A 1TMOA 4RPIA 3EA5A 1Q1EA 2B0CA 4WTOA 3BB1A 4JT9A 5HKKA 4D3ZA 1KIMA 3HU2A 1XG5A 1RPTA 1X0XA 2YIDA 1EZ1A 3AB7A 3RT9A 4X66B 1XCMA 5HBRA 4XI9A 3V8QA 4KQCA 4EG4A 3F74A 1Z5GA 1RCTE 1JIJA 1PQ4A 1ZM7A 2FUNB 3UA3A 4OLFA 3V8EA 5IU6A 2PUAA 2HKIA 2JGDB 3GD7A 1US8B 4GP9A 1WXXA 2C42A 3CE6A 3U48A 3ZU2A 4C07A 5KNDH 2OUIA 3HA2A 2F1HA 4LXXA 4RL6A 2PT5A 4GVPA 3FDJA 5KYYA 4FINA 3P0FA 3JVVA 5GOZA 3RWMB 3PD7A 1U0OC 4AZ0A 2X5XA 4LRYA 5TJHA 4FFNA 1R4MA 5JI2E 4IINA 3TLXA 4M60A 1Y8QA 4F4FA 4Z0NA 5CH8A 5KQRA 1E79A 4I66A 4XPIB 1EXVA 4F85A 1XNGA 1A4IA 2XYPA 2ZBUA 3UQZA 3WHLA 3N2LA 1QRAA 1YKFA 1E1RA 2X58A 3OZWA 4LRSB 3WLQA 4INJA 3IQXA 4KJXA 3UAVA 3Q7TA 2A0WA 3AK4A 5A5EA 3U4QB 5JNTA 2V54A 3H2GA 4WJKB 4CM1A 1Q7TA 1EP3B 2FFBA 1Y1TA 1UINA 1XT6A 4P8RA 2HW8A 2C7BA 4UUAA 2GFIA 2PGLA 3H3XA 2KS6A 3GCXA 3OZFA 4XYLA 4MWSA 3LMKA 3ZY2A 4C4TA 1R7RA 2BV3A 4A2WA 3PQ5A 3C45A 4YMTA 5JUWA 2IIPA 2ZDGA 4LJYA 3ST7A 1XFAA 2OB2A 2WOJA 3R0XA 4RXUA 5TEVA 4YT5A 5C5IA 1C1HA 3JQGB 3NEAA 1JQ3A 1CEXA 1Q50A 3VPBA 2BJWA 3SN6A 1YRLA 3OWXA 2AJLI 3QJGA 3TPZA 4E1AA 1GLVA 4AI6A 3MWFA 4QOGA 1C9JA 1E62A 1V3UA 1XAIA 3B51X 3JWEA 3KETA 1NVDA 1F60A 4JZYA 2J30A 2G9ZA 1M34E 2QP9X 1XRNA 1ZSNA 3HE3A 4IQ4A 4BVEA 3V48A 1WJGA 4L8GA 4KMOA 3J7TA 3VR0A 1QRUA 1UZUA 3E0XA 4BJ6A 3KQTA 4JYBA 5SY6A 3TSWA 1DV1A 3BMQB 2UUPA 3I9NA 4FVTA 2IUFA 3IJ5A 4JN6B 1M2GA 1H8EA 3EVFA 5FRDA 1P1JA 3W3ZB 4BNJA 1TEXA 4HPJB 4W6ZA 5A6SA 2WJIA 4MULA 4REQB 4WCVA 5MFPA 1EP9A 1XMIA 1G59A 1NZJA 3KIPA 2ZUUA 1HI9A 3SR0A 1XPOA 2CT8A 2FW1A 2NU9A 3MOIA 1M2NA 2VK1A 1DAIA 1OAOC 3C1UA 2W5UA 2P9GA 2REQB 3LG2A 1R0LA 2WMNB 4JROA 3IE0A 5EJIA 3KOUA 5K8LA 2XODA 1YD7A 4TQUS 5F2KA 3L4KA 1ODKA 3TZCA 3VYTB 2HK7A 1QTIA 2YHSA 2JEYA 2QX9A 3IMEA 4F6RB 3SS9X 2A9FA 1X1DA 3L79A 2PT7A 3TTWA 4BNVA 1TUBB 1M1ZA 3C8HA 3K35A 5AIAA 5I01A 5LYJB 3LOQA 3HACA 2YXEA 4EGQA 2HU8A 3QXCA 1Z2NX 3K0FA 3LVQE 4ED9A 4X63A 5TQ0B 4R0VA 1V1RB 4Y8VA 2NVOA 1GDDA 1GQ2A 2QSZA 4QUGA 4MDHA 3RF6A 1RAIA 2D62A 3QA9A 3FROA 3ELDA 2E4WA 4JLDA 1U3GA 1L5MA 3RYIA 3QV2A 4UE6A 4WAUA 5ITZA 3WFZA 4HH4A 1H0RA 1OV4A 4QBKA 1KH2A 1IWPB 2JGNA 4BVBA 3PHGA 4CMKA 1YJXA 4R54A 4DCSA 3RTCA 5FF9A 1L7PA 3S3TA 4TLCA 2H00A 3MEQA 1PHPA 1U98A 2OXEA 1ZBQA 2VDQB 3NHPA 1ENOA 2NV6A 2BMVA 3BN3A 1TDJA 1T34A 4LXQA 2J9RA 3G9UA 5SYNA 1G6OA 5BWBA 1IEWA 3ZPXA 1SCDA 3HKDA 3KEFA 4NBKA 3C41J 4K9MA 4A16A 3V8PA 3QV1A 1P0QA 4JQOA 4QTZA 3PEVA 4B17A 4DUZB 2ZVPX 1HQKA 4O2BB 4ZZ1A 3EZ6A 3PDUA 1KI6A 1R0SA 4HN4B 2GSWA 3LF1A 4MW1A 4H6XA 1KVUA 5L45A 1YS2X 3JARB 4C0XA 1OIVA 4CQMB 5IUNC 3DAGA 3I9V1 2IS4A 4I4TF 2G36A 2Y0DA 2WJJA 3TLYA 5LXTB 3K53A 4XOIA 1CPYA 4XWWA 4ZD6A 1OLSB 1QGED 2RHBA 2XRZA 1VKOA 1QZXA 3S40A 2FSFA 2RGGA 4K6CA 1EP2B 3CEPB 4D02A 1Y3DE 4BNHA 3A6JA 2YHIB 3QWHA 3WTCA 1KRHA 2QORA 3H1GA 3D5TA 3G9XA 3OLCX 4MCJA 4RVSA 1BE8A 2IX3A 4J6FA 1Q0SA 2VNJA 1WUJS 3B3FA 3IBGA 1UKZA 1UQUA 2IXBA 3QELA 2CB9A 4M36A 3MMXA 4CIDA 2VYNA 3IIIA 2N1MA 1FF9A 1SCBA 5CD9A 4L7QA 4TUYB 1DO8A 2ZJYA 4B09A 4JC4A 4BVKA 4EPTA 3NDBB 1AIPA 1NR7A 4IG4A 3U17A 1GAJA 1QKIA 4C7MA 3RAGA 1SU4A 1HXHA 3LUKA 1DKPA 3EEFA 3N74A 1RKVA 4FC6A 1II0A 1SM4A 2YVAA 2GK7A 4QQ8A 3HVKA 4RQAA 1UXKA 1FLAA 1RE0A 2QSJA 5DWVA 1EEXB 4RIIA 4D4GA 3TLBA 4ZMSA 5HGXA 3GJRA 3SDSA 2DQKA 1WRBA 3EG9B 2IDKA 1G8JA 3AO0B 1LRJA 1QTRA 4R05A 2NO0A 1G8KA 3EDMA 3EDCA 3PX7A 4F3TA 2VJMA 3TZBA 3LBNA 3MTJA 1AUVA 4EZIA 1WSDA 3UV3A 3LYAA 2FWAA 4UUOA 1FTYA 3GRCA 3P1JA 3FE2A 1H05A 3INYA 3OTHA 4AURA 1YKGA 3Q7QA 2SNIE 4H7KA 4LX0A 1I0LA 2PUTA 2VPIA 3NETA 4M1KA 4R9VA 1ZM9A 1XMJA 1Z62A 2Y1CA 2NTNA 2PKXA 2WP0A 3AWDA 4N6NA 4R1LA 2P78A 4TTAA 1THTA 5H3HA 3SVZA 1FOEB 2B1QA 3A8TA 2P7HA 4QDTA 2C1EA 4D56A 5INTA 1LX6A 3K4QA 1R2QA 1X1RA 1D4FA 1V11B 3VJRA 2OVBA 3Q88A 4NS1A 4XCXA 1L5OA 1NNEA 4NFYA 3NTLA 2YC2C 3HRIA 3ROPA 2VJKA 2JDIA 2HYIC 2ECFA 2ILVA 3K32A 1DQSA 5B2ZA 4HNTA 2HZ7A 4RMGA 2ORVA 2HA5A 3DT9A 2BUAA 1CRQA 5AKIA 5ER9A 3HXMA 3V4RA 3GFTA 5K01A 3BEOA 4DXHA 2JJ2A 5FWXA 2O23A 1QCZA 4C78A 4IDQA 2JIZD 1G8HA 1Q92A 4PX9A 3MUOA 3ZCRA 4HLDA 4TYNA 2VJQA 3E22A 1RHJA 2FH5B 3GA0A 3UJCA 5MHTA 1TU4A 3K3PA 4L5IA 3GP5A 3NATA 3NUQA 3SSNA 4N0DA 5ELLA 4BDSA 5AOBA 1P80A 1ECPA 1YVUA 4P3XA 4EX6A 4RVUA 2V4ZA 1SHUX 4JASB 4PY2A 1IQ0A 1V47A 2YFQA 4PO1A 4EYGA 1ZGHA 4ZTBA 1C2TA 4L9RA 4JC0A 3ICCA 2P3QA 1K98A 2UYGA 4GRDA 4L16A 3DXXA 1PQPA 1R8YA 4RM2A 4QELA 3L07A 5CFLA 4Y9UA 2BMEA 3QUTA 4N5LA 1K5GA 5DASA 2FMTA 1AA9A 2C2BA 3VYRB 3LZ6A 3O2QB 3OWHA 1M7GA 4JQSA 2IH2A 5AUQA 3U40A 3ZE9A 2R48A 1GNPA 3KOXA 2ZZKA 4MVJA 2GLXA 1AOXA 2J59A 3EZLA 3EA4A 2ROQA 3DQQA 4OJMX 4S1NA 3KTOA 1G3UA 2C31A 4BGEA 3A04A 3GRKA 4F96A 2XGMA 4Q3KA 4Q9AA 1BMDA 1T5IA 5BNIA 2F43B 4QM6A 1WB6A 2PGIA 4TX1A 2UVPB 5JS6A 1DCFA 4HXGA 1A7KA 1HFEL 5FUWA 4DLBA 4M21A 3HN2A 3LX6A 1QH1B 2F9MA 5JQGA 1FFDA 1IXRC 2W00A 2CMKA 1ZJZA 4PTYA 3WNVA 2WHEA 3A3KA 4GM1A 5AVKA 4FMDB 3IQIX 1F48A 5KYGA 3CEHA 1EKXA 1NU8A 4LFAB 4AUEA 4J07A 2WD7B 4JBHA 4ARVA 4C29A 3T4XA 1ORHA 3H9CA 3NO4A 4ZOLA 4ZI7F 1GFSA 1QXSA 1GUFA 5DGDA 4YT8A 1YIDA 2B2CA 1Y80A 1I6WA 1BXRA 3BRQA 5G3YA 4FIDA 3ZD9A 3MM4A 4ND3A 3ZV6A 1QMGA 4OHPA 3PCRB 2PZLA 3D3EA 2QW1A 3L1UA 3MJSA 4YXWA 2JC3A 1Z0JA 4U0KA 1OZ0A 1UDBA 3ESQA 4B7CA 5CITA 3D3NA 2YYYA 5BNFA 5AI8A 1O4VA 2BGRA 4UAVA 3DA8A 1BRTA 2VDVE 3HGTA 4ZIRA 3OZXA 1IOLA 4LJRA 2OXTA 3TJRA 1F9AA 2ABWA 1DPGA 4PINA 3PTLA 4WECA 4AZWA 2P4HX 3NTQA 4HBGA 4RIGA 5BN1A 2WF5A 2CLDX 4EHLA 1PV4A 1KP2A 3LQ2A 5LA6F 1VJCA 4UUNA 2PSHA 5HP4A 2PCLA 3NEPX 2M6RA 2C9BA 3BTUA 4G2TA 4UAUA 3VOAA 2HHHB 2LPMA 1H69A 3KJZA 1U7XA 2H29A 3OMLA 1NT2A 1EBBA 4D3SA 3ZDDA 2W70A 5CM9C 4R81A 1XC7A 2VAWA 3JVEA 5AK4A 3ZV7A 5GM2A 5TJ9A 2JFNA 1KTVA 4C0SA 5JMOA 3GLGE 1E6EA 4HEA6 4OJYA 2EFCB 2WPDA 1XB2A 3P5BA 4EGSA 3FGNA 3PWZA 2CZGA 2BKXA 2C4TA 3C3CA 3PQ3A 4J0EA 3L7LA 2OZKA 2CVQA 1QFXA 3RC9A 2GPSA 5BMVA 2HJRA 3JW8A 4YPVA 2P9BA 5K8UA 3RSFA 4Q00A 3TKYA 1Q84A 1DAHA 4QPCA 2V7XA 1OX4A 2QL6A 1JECA 2ZOSA 3GY0A 3B1WA 3Q72A 4NG4A 4OL9A 3OU2A 3UCXA 2MYTA 4L8WB 1D7AA 2JANA 5TEWA 4CT4B 3A4MA 4UOZA 1VSTA 2G70A 5JISA 1L5FA 1B1CA 3MQ4A 1J2UA 1L4HA 3HEAA 3PDIA 1Z6GA 4FNOA 3JYQA 5DZSA 1HYEA 1M2FA 3K9NA 2WE8A 4QJ5A 3PHLA 2ZYSA 5D51S 1QO0A 3UIEA 1T0JB 2OCXA 2I6GA 1QGAA 3B6IA 3OD1A 3UPTA 1PYGA 3KKQA 4FEAA 4HTFA 4AAYA 4TOIA 4JH0A 2XWJI 3FTDA 4C7JA 5IUKC 1GTZA 4I5FA 1MPTA 1I8TA 1IHPA 1LSOA 2MINB 2OCPA 2XTNA 3BIJA 4EKYA 3LP5A 4IVQA 1ZI6A 2X1LA 2AXEA 1CYEA 1GNRA 1G21E 2DZDA 4HYYA 4XLLA 2EW1A 3R44A 3PFIA 4Q3NA 2P6OA 1Z3CA 1N7JA 1XN1A 3ZIAA 4HRAA 4IQ8A 1YB1A 4FOPA 3N0TA 1TZMA 4JR2A 4ARZB 1XIVA 5FP0A 5I7VA 4HAUA 4E2FA 4K88A 1EWVA 1WB5A 3VRHA 5L4SA 4R2IA 2PZEA 2WHRA 4UM7A 3I6QA 5EMNA 2WTUA 1NULA 5D87A 4CPDA 1D1QA 1HPLA 4UDXX 1RWXA 1IZ8A 4G6ZA 4BQNA 1E2MA 1A8UA 3OECA 3HV2A 1E1CA 1JMYA 2OMEA 4BRUA 4LDRA 5E4FA 4KH1A 4KX3A 3UBTA 1O9GA 1V8ZA 2GRAA 4FMCB 3B85A 3WYCA 3MA0A 3V9PA 3D8UA 4Z3DA 1XEAA 4G89A 5LSAA 3KWLA 1WZ2A 3ENZA 1BX3A 3MWJA 5EQDA 5DX0A 1USGA 5J2TA 1C2YA 3D54D 1BWRA 4LHWA 3EVAA 5F9FA 2PJZA 3SYKA 3VZBA 4YRQA 3HHEA 1QOZA 4P38A 4LW8A 5EZQA 3VV3A 4YRMA 2FUG1 1B0UA 3ELBA 2JLQA 3EFHA 4DQLA 5FWYB 5JT1A 1E2PA 3LCRA 4OD0A 5F23A 3I61A 3RS4A 1ZK0A 3HWRA 1WSBA 3UWDA 3VR5A 3RR2A 3ZWXA 1ONPA 4G3XA 2XQJA 4QDKA 5KU7A 5DBEX 1JE1A 5AKGA 4BJ1A 3ZE1B 2Q5QA 4KXWA 5FOUA 1W87A 1ZEJA 2IW1A 5FBWB 5FYDA 1NF8A 1AHPA 4AKGA 2QRUA 4YJKA 4OXXA 5AK5A 2Y4OA 4F3NA 5JQWA 1EK1A 1RI3A 3ILHA 3HXPA 4GL4A 4L02A 1RAEA 3OTIA 4CBVA 4F72A 4FHGA 1SMKA 4JNKA 5DKFA 4L50A 5EOVA 2P3OA 3HFGA 3PR2B 4AN0A 2W2LA 1TPYA 1T26A 3BH6A 1F1BA 4FC7A 3RS9A 2HEGA 4XJXA 3JWHA 5EVJA 1LNQA 3CMCO 2JGEA 1SR8A 3KAQA 3F96A 3EXG2 2C3YA 1P4RA 2P9YA 2QL5A 3BCUA 4IFEA 4UTXA 4D9HA 5ALVA 3LRPA 2R8BA 3QVXA 1Y5IA 3AI1A 3KSMA 3DFIA 5IJXA 4XLTA 1JDBC 4ZT6A 3OPVA 5JVDF 1W35A 3TL6A 2DUUA 1JI3A 1XTPA 3F1LA 3NLLA 4KRYA 1Y1LA 1C7RA 1V8PA 2GETA 5ECGC 3CCBA 5CDSA 1Y8ZA 1KI7A 2Z6UA 1W94A 4Y7DA 3E2PA 3ME5A 3RVQA 3WLOA 2CXSA 5IBRA 5E1OA 1TJPB 1ZXBA 4RJJA 1JKJB 2AEFA 3L6UA 1EFPA 3W8EA 2VL7A 4M54A 3IHLA 2WTBA 2J87A 4DA6A 3L04A 4IILA 3HGMA 1CBUA 4LISA 1N0UA 2VDUE 1PGPA 4JBIA 3V6LA 4BX0A 1PFWA 1SH7A 3PIDA 4Q3LA 2XKKA 2UDPA 1EM8A 4OBEA 1NRJB 2AI3A 2GZAA 3HBAA 3L02A 3ODGA 3TUIC 4EUKA 2J5QA 3CLRC 3R76A 4OPMA 3GNLA 3GFQA 4WLFA 2X6QA 4XDYA 5FTKA 5CB0A 4TSFD 4ND4A 3NHJA 3RTEA 3IDAA 2QRGA 3ESAA 3D3QA 4D9NA 1QG4A 4M53A 5L40A 4B3XA 4TV9F 1GFWA 2XLCA 1RZ3A 4M6WA 5FFMA 4RW0A 1XTUA 3W5DA 1K7CA 3BRSA 3SQXA 4XWOA 2X1VA 4UUMA 2JZOA 3SDZA 1Z26A 2K5UA 2VNIA 3KJFA 2FG5A 4FFLA 4MEAA 4MI1A 2QKYA 3EGXB 1PGJA 1SXQA 3DC7A 4MKIA 1UOOA 1R1DA 1W2GA 1S0UA 2WIGA 4C76A 1NX6A 3GLIE 1IY0A 4AO7A 4BOYA 2IP4A 4UNQA 4LK2A 3ED1A 4S1VA 1QQAA 1LV8A 2XMPA 4I36A 3UJAA 1O89A 4URYR 5ARDA 5A5DA 3TWOA 3AVUA 1JFFB 5HQTA 4IIDA 4TVOA 3W5CA 2FUKA 3U7JA 3MD9A 3RLIA 5C5DA 1QYDA 1MH9A 2OHVA 5FO0A 1BN7A 2DFVA 3NHUA 2VS1A 3W7BA 2COKA 1JIVA 2CC2A 3ADOA 1UMCA 4IHJB 1BIFA 4ZYXA 5DULA 1C0IA 3FHTA 1SG9A 1HKHA 1NVWQ 4BNGA 3H1BA 1K7FB 3V1LA 4LQ4A 4U7JA 5ISMA 4Z99A 1Y81A 1E6CA 1VZ3A 4P81A 3SHVA 2NQTA 2B4AA 2GKOA 3USES 1XJQA 4Z9FA 2VATA 1GR0A 3OSUA 5DTJA 1NP3A 4XH9B 2PXXA 2MMCA 5IH7A 1RWNA 1W8DA 2ZYDA 1PL0A 1TEHA 3ETHA 1V8BA 3EVBA 4AQYB 2IPOA 3GD5A 1BWQA 5D3KA 2P11A 2CL6X 4NE2A 3DOUA 1L7BA 2ZETA 1V96A 1TCUA 4DLNA 4DVGA 4NMHA 4RA9B 5H5JA 4C0KA 4OG2A 1WBDA 1SHJA 4POOA 1Z0FA 2RCNA 4YJHA 1S01A 3JZMA 5B5SA 1R74A 3QUSA 3O90A 3RS2A 4ZMBA 5JHGB 1G9SA 1EHCA 1G2OA 1H93A 2QD5A 4LQLA 4RZHA 3D8RA 4C2BA 1POXA 4J43A 2A1TS 1AQ6A 1JWAB 3L8EA 2H08A 1YRBA 3WR5A 2VBCA 1HGXA 1QAOA 4U7WA 4IIUA 5HJ5A 1P8AA 4RMJA 3HN6A 4NDZA 5K20A 1M2OB 2NPFA 2UYCA 2Q5IA 3ETGA 2ZT7A 3N2KB 4MUKA 5DCLA 2Q07A 2A86A 4ZQEA 5TQVA 1QHXA 1MB0A 5H70A 1QQ7A 2EKBA 4BNXA 1F2UA 4H77A 1BVUA 1QIJA 3BSWA 2LTAA 4GP6A 4TTTS 4OSOA 3UATA 4QU8A 1ISRA 3O2JA 4MUEA 3X3HA 3Q8KA 1K6IA 4MI9A 1LXCA 2V5UA 4OM7A 5FL3A 4FB4A 1LRLA 3L92A 3SM9A 2HSJA 4JDUA 1G55A 3B38A 2XF8A 4QAQA 4KR2A 3ABOB 2XZLA 3F8WA 4ZDWA 3MRVA 4I8IA 3T8YA 1SA0B 1M6NA 4JI8B 1LUAA 5HQ3A 2ET6A 2OR3A 1GZ4A 3HCEA 4CIBA 2QV0A 1CZLA 4ODIA 2I7DA 2JK0A 4D98A 4ZHQF 3L1KA 2WJYA 4NH4A 1DX9A 1GYPA 1VB5A 5DI3A 4HRVA 3OZTA 3DCJA 4KNWA 1TW2A 4J16C 1ZICA 3C43A 4CDGA 5JSHA 4XQ9A 4AP6A 3HABA 3R5KA 4DMRA 2ASVA 2I2AA 3HYCA 4Z4CA 3SK0A 4WFKA 2MDTA 4JIGA 3P71T 1ZK1A 3OQJA 3W9YA 3WMXA 3E9ZA 1FDVA 3HS3A 3W5JA 4F9TA 3KWJA 1A5TA 4ENRA 2PRKA 4LNUB 1FDOA 2IPAB 2IEYA 3C6XA 2YJ4A 4I99A 1P1KA 2C4NA 4B3CA 4DWJA 3VVLA 3CVVA 2GHRA 1JG3A 3BHMA 5A3RA 4FHEA 1VL1A 1YL7A 5HK8A 2J31A 4A6DA 3ACBA 4QJIA 1HDYA 3FLMA 1JB9A 2HV9A 3OIFA 3L1HA 4KXLA 1X3SA 2HSGA 1RXUA 3IP8A 3RVNA 4R69A 1U2SA 2OQVA 4BP8A 2I67A 1BFUA 3ZEIA 1QS0B 1K68A 1L7AA 2VDRB 3HDGA 5AVWA 4G1EB 4PE5B 3NX4A 1CP2A 3D0QA 3F90A 3AR9A 2C00A 3V5NA 4CUJA 8MHTA 1B00A 1Q1BA 1VHWA 3RVDA 2J09A 2UUAB 2HBRA 2C5LA 1FFBA 2IP2A 1YNSA 4GFDA 3ZVKA 1J5EB 3QLJA 4NOJA 4JBGA 1ZK3A 2XKAA 1Q1NA 2BEVB 1CRZA 1UWVA 3PB3A 2M32A 1O95D 4YAEA 3TSCA 5KQPA 2AN9A 2Y2UA 4CJXA 5JZMA 1P4HA 3RAFC 1PJCA 1H42A 1Z8NA 4I55F 4OFBA 4U7FA 3RJ9A 2ISSD 3RRMA 1I51A 2QN2A 4LXUA 4YR9A 2RONA 4NCJA 5J4KA 2AZMA 2HDHA 1VLJA 2JCBA 4B1FA 3NP9A 3DFZA 4JLNA 3EAFA 5IKPA 4HAOA 4NPHA 4ZT3A 1C3EA 3DUFB 4MPTA 5CVVA 4XCQA 2VDWB 3ZKWA 4EB6B 2G4VA 7REQB 5IAOA 1S3GA 3H6GA 5J40A 1YZLA 2N3ZA 3P9SA 1Y9AA 2P9HA 5KYWB 2VH2A 3MGCA 1UMDB 4EHDA 5ADVA 3AM5A 5HCNA 4TWAA 4WZAE 1N6NA 1X2BA 4UAJA 2OCGA 1Q7EA 2OZEA 2WDPA 1G60A 3QTLA 4UTOA 4KQHA 1P2GA 3OJLA 5G1NA 4Q4JB 3H9GA 1EE9A 4ZJYA 5AW8A 2DQSA 3BE6A 3SZ3A 2ZFUA 3PFKA 3N2GB 4RESA 4UQOA 3QPDA 4X8OA 5BW8A 5IXSA 3EXG1 5E38A 3LC1O 4JI2B 3Q6IA 2F1RA 1SOWA 2IEGA 4Q18A 3RS0A 2ZRQA 4F38A 4N39A 3DZKA 3HCCA 1I36A 5HIIA 3VAZA 2GYUA 1FJXA 4NYIQ 3FKQA 2R96A 2X7XA 2DQ4A 4H08A 5HTKA 4BGDA 3LLSA 4MB6A 3FZYA 1U1IA 2ARKA 2CB0A 2AB0A 3H2YA 3ILVA 4JC5A 4XD7D 3HB4X 2FQQA 3LQ4A 4OHCA 4WUVA 5AJUA 2XCRB 3KXPA 3LXUX 5FPHA 4RPHA 1HV8A 1ZU4A 2ADMA 1H1LA 2C9CA 2CLMB 4NZMA 2GT1A 4M49A 5DHQA 3JAMA 1A77A 3GFVA 2IA5A 4J16A 2RHJA 3FF1A 3MPOA 4WFJA 2Y1EA 4HMOA 1ZHHA 2XMGA 3LKBA 3CVYA 2JJ8A 5B4UA 3PTAA 4B44A 1KQGA 3NW9A 4IWNA 1YH3A 2IWHA 1RYDA 5EESA 4BQEA 3T7DA 5MFZA 1A72A 3IELA 4IDCA 1W1WA 4WNYA 3TJZA 4P86A 1BEUB 3WHPA 2JAPA 1RVV1 4U3JA 5E7IA 5TLSA 3AM1A 2Q3BA 2J45A 1L7MA 1ISHA 2AD1A 4I4TA 3VYWA 2NVWA 5D85A 5THKA 4AX8A 1FSSA 2Q4OA 3NCTA 5IJAA 1Q1AA 2FZLA 2IE0A 2Q99A 3B20A 4DBZA 1XD2B 2GFHA 2JJ1D 3D8HA 4HQFA 4ZDKA 1PS9A 3NXKA 4Q4HB 2F64A 4U63A 3CH5A 3P4UA 2H5IA 3C6KA 3T4PA 4R1NA 2XV1A 4ECEA 1QYCA 4KAXA 2H9YA 3KPYA 1Y3AA 3C4JA 3KAPA 5J2UB 2JFOA 4RPGA 5LNK1 4L95C 1T6YA 1JHZA 4LOAA 3SHWA 4IR7A 1YZGA 3GOQA 3N86A 4RK1A 1AQLA 2A0FA 1W0JA 4IZ6A 1F8FA 1ND5A 5AQEA 4DEXA 2Q27A 5ALXA 2OYSA 3M34A 3WC4A 2EYUA 3PIRA 1E6WA 3DDSA 4UHFA 5AXAA 1EJ2A 1CETA 4PLVA 4MR9A 3ZDQA 1YCFA 2B36A 2AN5A 1VRVA 5DK4A 4D9KA 2ZRAA 1PVDA 5DFAA 3K0CC 3L0BA 2CVHA 1FRQA 4N3BA 1LBHA 1ST3A 5DHAA 2NUTA 4DL9A 1E98A 2UV8A 2RK6A 2BEWA 3IKMB 1HH4A 3R0JA 4MVJM 5JSZA 5FBQB 4RMIA 1Z06A 3BWCA 4IDOA 2PMFA 1ZH6A 2X2EA 3HKCB 4JLMA 5LD2C 1D2EA 2JA2A 2O0JA 2X76A 4J1SA 1H6AA 1K2VN 1SVLA 3P9PA 4MGZR 1F2TA 4RUKA 4QKQA 4RTSA 2Z6VA 3AKCA 4FUTA 3AINA 1ISFA 3H9UA 1QMPA 2CDAA 4X20B 3GVXA 2CYAA 2KMLA 4CLOB 3G1UA 4RSMA 3L7AA 2YWHA 2BDUA 4FCCA 4GRIA 4IJKA 3N2IA 2PLWA 3BE8A 4X1YA 3BMCB 2GEBA 1N0VC 2NV0A 2ODBA 1I2BA 2ONZA 3KWMA 3QX8A 4K26A 4KTTE 1Y7LA 1WHTB 4FFVA 4MDEA 2C4VA 4LG1A 3JATA 3SEQA 4YV2A 1B8UA 3WXMA 1V95A 2P2YA 4K8OA 4OYRA 3DV0B 4P4GA 4FFBA 1DAMA 2Y67A 3LCUA 3HJAA 2PTHA 2PSDA 1EMDA 3IVAA 4XUEA 5KB3A 3DMDA 4DT1B 1QTNA 3GIWA 1AG9A 1JKIA 4CRWB 2JIBA 4K9KA 4B4VA 1IXSB 1AZLA 3TD6A 1DELA 3C24A 2AVNA 3TRFA 3W1EA 3NOVA 4C6SA 4BFTA 3OZAA 2PS1A 4MVYA 1TZBA 3TQIA 4GOND 5C7YA 4LPKA 2WIAA 2V55B 1AS3A 3DVRX 4WQMA 2JAUA 3VDRA 3AHHA 4HJXA 1TQ2A 1S1CA 3I2JA 1XTJA 2KX7A 4RHEA 5LQKA 2DBRA 3D8TA 4KSYA 1FSPA 2FE1A 3A2NA 3GH1A 1LTQA 1N0WA 3V4LA 4EJSC 2R8RA 2BFDA 2H59A 3OCVA 2I1VB 4RGQA 1A50B 1X70A 2OENG 2AQHA 1QJ4A 1DVRA 1TQ6A 2RDMA 4JJ7A 1NBAA 2GVZC 1DDOA 2M2IA 1U4OA 1ID1A 3AR6A 4WFIA 3P9XA 5TT0A 3ZNOA 1U0EA 3UHOA 3C8MA 1FLNA 2K2QB 3WOVA 4B8ZA 5L3QB 1V5IA 1P18A 3VR1A 3TR0A 1EFKA 3ZW8A 3I6IA 4G84A 1DAFA 2CMDA 3OWOA 1TZKA 1N1MA 1YSCA 1ZL2A 3OHSX 4HF7A 4L4XA 4UTZA 4EH1A 4YQFA 2AKEA 5EY5B 1BVHA 1QRRA 5KQSA 1CUDA 3D6MA 1X7YB 1YDHA 1ZIDA 3M6AA 5EINA 2PA3A 1CC1S 4H6VA 1GUDA 1NUPA 4UUPA 4KIUA 2OA0A 4NAUA 1LDBA 3MN1A 4RIHA 3ZHXA 1NVVQ 2UYQA 2OY0A 3MGAA 2QLTA 1UADA 3RH0A 1YOVB 2ZP1A 2FU5C 1FTQA 5DP1A 1ZVVA 1RKUA 1AMOA 1T3SA 4CMBA 4QGSA 1P3Y1 5BV0A 3MTQA 1GLNA 2OO3A 4JOBA 5DIFA 4R7ZA 3WBFA 2V7WA 2PU7A 5T6BA 5KTPA 3K0CA 1ODFA 3K31A 3VDQA 2V7UA 4G07A 5TPZD 1M0SA 1GU1A 4TS4A 2WU1A 5K4AA 3DVSX 1T9GR 1HLPA 5G0SA 3UGJA 4IYJA 1Q74A 3PGKA 4GKAA 2UYYA 3HFRA 5H80A 4KI7A 5IDVA 4A8JC 3C3EA 5KQGA 3RUIA 3FCEA 2WA2A 3LFUA 1RWOA 5H02A 4WKPA 5AK6A 4D46A 1DEKA 1YR7A 4FONA 4ZAZA 3T94A 3W7AA 1G5HA 4HGPA 1YULA 4BZZA 1F6DA 4ZI7A 3HCAA 3T52A 3EODA 2P90A 5HM8A 4OXRA 5KYUB 1E18A 2XJ4A 1S4QA 3OOYA 3GJ6A 1VIVA 4IXNA 4LIPD 4EI8A 2A84A 1O5OA 3KQLA 4RDIA 2KE5A 2O6LA 3ZX4A 4B2IA 4DYHA 4YPOA 3E7FA 3QG5A 4WLUA 3RCBA 1QDEA 3ZLJA 3KOYA 5ADWA 2SKEA 4GX0A 5I7FA 2PBZA 4MYHA 3TIXB 4DAEA 3ZCXA 3VGJA 1EAMA 5F76A 4R8LA 3F3KA 2CCKA 4EA7A 1KMMA 1JX6A 1P7WA 4JL6A 4QJ3A 2QE7A 4QYIB 1WG8A 4M0UA 5EMLA 2H52A 3ZJUA 2O06A 1HZZC 3F0TA 1EK5A 3P2YA 4MR8A 3Q8LA 3WJAA 2V7BA 4YJDA 5BW4A 4LGYA 4L78A 4P53A 1KYTA 2WUWE 1GG9A 3CNBA 3IQDB 4LVNA 2PUBA 4R83A 1SXJB 2YRXA 4RFSA 5IG2A 4NXNB 1C9DB 2F2TA 3G6KA 3U0BA 1SRQA 3MIIA 3OT1A 1FXUA 2MHCA 3EQ9A 4DV3B 1YJBA 4MI6A 2R84A 4GKVA 1AKQA 5EQJB 1MORA 3GC6A 3GZNB 3OG9A 4WNCA 3PHJA 2QIOA 1VL6A 1J70A 4AKTA 1RLTA 1V26A 4GX1A 3CWZA 1ZVJA 1KAQA 4X61A 2DJ5A 5TGZA 2V8BA 2OEPA 3IYLW 2RHMA 4EJSA 4ZEMA 1K0UA 1UWKA 5ENVA 2CCJA 4RXMA 2E49A 3DE7X 4KXXA 3G8YA 3LNCA 3SJCA 2PKEA 1IIBA 1VJ5A 1AKVA 1EEHA 3JQAD 1IN4A 2BGLA 1KWGA 2IUUA 2WDZA 1LWNA 2DKFA 1J23A 3PI6A 4PHFA 2HPAA 4DJJA 4XWAA 2J7KA 3D3JA 3GFSA 3TI9A 5A6VA 4CKZA 3ABRB 5L7WA 1TX4B 1XMXA 1OFGA 3QVTA 5HRCA 5LZ2A 5TARA 4LC1A 1QHHA 4MV1A 4YLYA 2OBMA 3FWHA 2H1LA 4W8GA 2CJWB 2XB4A 3OE7D 1KHTA 2OBNA 2XDAA 3TNYA 4OIMA 1D2MA 3IAEA 5LDDC 1F2VA 2GK6A 2H6EA 5KJ1A 2HTFA 2BGKA 1UFQA 2IZ1A 3M4JA 3ZZ1A 2X2FA 3WYBA 1GGMA 4RORA 3CONA 1MR3F 4GPZA 4J2TA 4PFKA 3AP1A 1JLMA 2FDXA 1MG5A 1SNYA 1YZKA 3TM4A 1RJEA 4M1OA 4MA0A 3H5RA 2ZCUA 3KVNA 3EGEA 4CHGA 4YT4A 5TQ2A 4HAWA 4Y6LA 1I7PA 2YINC 1B8OA 2YZGA 4QRDA 2NACA 2RHDA 3V8RA 1GCAA 5KOYA 4KLRA 2V6IA 3F4BA 4IKPA 1IN1A 3PXUA 1OA1A 5B6JA 1GYRA 1W4BA 4YGYA 2BHNA 3JD2A 4A8JA 1ZINA 1IM8A 4EGCB 2XYQA 4BHTA 3NTVA 4P54A 2C8JA 2Y05A 4YQEA 1MPXA 3A2MA 4KWTA 2Y1DA 3DHNA 3E2IA 3EXAA 3O0DA 2ZJZA 4IV8A 5FIUA 3T7AA 1W4ZA 3ZLVA 3OLVA 1K75A 5BOSA 4TKVA 3Q6NA 1GSOA 1HQCA 1M8KA 1DRWA 1NHGA 2GHQA 3KX2A 3VZCA 5E1MA 3KLNA 1KDYA 4BMSA 1APBA 5CHYA 1C14A 1MRNA 1VG1A 4PLFA 2P9FA 4DR7B 2JFZA 2JW5A 3IERA 4MV3A 5BRNA 1V9CA 4R2HA 3SC4A 4ZJPA 5K51A 3D43A 3W5VA 4C0JA 1NVXQ 3T1YB 3U9SA 2RK3A 5AM4A 2YQ5A 4QODA 2ZI4A 1C9MA 5JD4A 4LXGA 3Q5EA 1O54A 2I54A 2I4IA 1PFVA 4KWHA 4C7KA 5AQ1A 2G63A 1P3DA 1HZZA 2OO5C 2ERYA 2P65A 2QX8A 3SS7X 3SHFA 1T9DA 4CQMD 4N76A 2YXDA 2QVBA 4S35A 1BVYF 3GWGA 1MBZA 3S0JA 1OFUX 3FYHA 4E5KA 1O87A 3EBOA 3DMRA 5DHUA 5EJGA 4DLPA 4AMZA 5C7OO 1D1TA 3O6VA 1U0HC 2HRQA 4M8NE 2DPYA 4A8PA 1F06A 4HPXB 1ULSA 2GILA 3DPIA 2XECA 3GB9A 2XA2A 1OXUA 2H0AA 3O82A 3OEED 4BATA 3RFCA 1CNMA 1YJAA 1Y3IA 4DCOA 3EHDA 3FPGA 3LA8A 2VYVA 3I4LA 4LZAA 1KJ8A 1IQRA 1NMXA 3SOPA 4A1FA 3HB9A 3T0GA 4ESHA 5FEUA 5BP7A 2A35A 4E5MA 2XUKA 4BBAA 4IVPA 5ALFA 5JEDA 4F6LA 1IZ9A 1H3FA 4AICA 5FH9A 1OXXK 5E6UB 1AB6A 2GPTA 4OUKX 2Z2JA 2IUSA 4Z7QB 5FA6A 1NI4A 1HDRA 2GEUA 2FK8A 3KCQA 4DR2B 4QBGB 1NV9A 1E3JA 2ZI7A 2A58A 1R12A 1M2VB 4G9BA 2IYOA 1PZEA 3H18A 1M67A 4AXBA 4UFOA 2WNIA 2VLBA 2ANBA 4OAPA 4S1PA 5AJHA 3L0OA 3KTDA 4FMBB 4JEIA 1KZ6A 3WKCA 3G6WA 1ZD1A 4JYMA 4KK4A 1PIWA 1R9GA 1THZA 1ZVMA 4LDPA 4NE9A 3WV5A 2FP4A 2B1GA 5JVDA 3TLGA 1IRIA 1CHDA 1CU1A 3L8YA 4RSHA 4YDHB 1O77A 4FT4A 2C9DA 3KDPA 4JZKA 5ENZA 2ACWA 1GCOA 3LK7A 5AW1A 4LA4A 5DX1A 1J21A 3FCSB 2E5WA 4DSOA 1F6WA 4PSCA 4DDTA 2O5CA 1SKQA 1PNQA 5B58T 4JWTA 4B3JA 1CNEA 4MRNA 4WMLA 4Q0MA 3N7AA 3WLTA 5KYTA 1NT4A 3CF6R 4Z6KA 2UYHA 4UQPA 3MTDA 1FDIA 1TTPB 1U3FA 3OQVA 4E08A 1VYHA 4TYWA 2RD2A 3KEGA 4RHUA 1JILA 4W7IA 4G0OA 3AHEA 2ZUSA 1L4EA 2IFTA 1QIMA 4J3FA 3ND7A 2WWGA 1RM0A 1AMNA 2AXNA