3BRSA

Crystal structure of sugar transporter from clostridium phytofermentans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
276
structure length
271
Chain Sequence
QYYMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEEDYLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKEIKDAGIKLIVIDSGMKQDIADITVATDNIQAGIRIGAVTKNLVRKSGKIGVISFVKNSKTAMDREEGLKIGLSDDSNKIEAIYYCDSNYDKAYDGTVELLTKYPDISVMVGLNQYSATGAARAIKDMSLEAKVKLVCIDSSMEQEGIFEAMVVQKPFNIGYLGVEKALKLLKKEYVPKQLDSGCALITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title Crystal structure of sugar transporter from Clostridium phytofermentans.
rcsb
source organism Clostridium phytofermentans
total genus 100
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brsA02
2FN8A 4IRXA 4Z4EA 2JBAA 3KKEA 2A9RA 3O2JA 3TMYA 3OQOA 1VKRA 4YV7A 4NCBA 1QMPA 1YVUA 2HSGA 4MR7A 4ZMSA 4OLBA 1Z12A 1BDJA 2PKXA 1NY5A 1NTRA 4XARA 2IPAB 1DZ3A 1F4VA 1BVHA 1M5TA 3L6UA 2LP4Y 2FSPA 5FBKA 4Z4FA 1PNTA 4G86A 1C4WA 1KMIY 3BBLA 5BRJA 4MS3B 2B1JA 3URMA 3A0UA 3HUUA 4UHKA 4MAAA 3DZDA 4W5TA 2FVYA 3DLBA 2QW1A 4F8JA 1Z2DA 1GCGA 3D8UA 4G0YA 2PAFA 3OLVA 1RZRD 2Q5CA 4RS3A 5KQLA 1Z18A 2IPNA 5E3JA 3IP9A 3I42A 5TPWA 4EYKA 1SD5A 2QXYA 4G0QA 4ETNA 5EWLA 5C5CA 3P9YA 3OLWA 1YK0A 2FKAA 5TQ2A 2LUOA 2L2QA 4EGSA 1PNRA 5F64A 3ROFA 2PUFA 1C0EA 1XWWA 2TMYA 4MR8B 3RQIA 3SY8A 3QLVA 1D1QA 4S05A 2YHBA 3JPWA 4G0ZA 3HK2A 2VUHB 4G0XA 3Q7TA 4JA2A 4WXMA 2J48A 2HJ9A 5DKFA 1ZVVA 2P4UA 3IDOA 2IPLA 1CHNA 2JK1A 2MYPA 4UHJA 4G0OA 3G85A 2PL9A 6CHYA 1JX6A 4MS1A 1I3CA 4MR9B 5ABPA 1LBIA 3QEMA 3QX8A 1Z13A 2NT4A 1Z25A 4EVRA 4PICA 3H5IA 4RXUA 5JNWA 1A2OA 1Z26A 1AB5A 1JBEA 1YMVA 3VNBA 1QQBA 5CNMA 1ZN2A 2DRIA 2FQXA 1DJMA 3OMWA 4WT7A 3SG0A 2B4AA 2O20A 3N0RA 3H5TA 4NV3A 3M9WA 2VYCA 4P1ZA 1MAVA 1L5ZA 5JNVA 2PUCA 3SM9A 2YHAA 1KRXA 3C3MA 2QZJA 4MGEA 1JYEA 3LUJA 1GLGA 3EULA 3MM4A 3A3KA 3QLUA 1QKKA 4MLCA 1QP4A 2WMYA 5JS1A 3GWGA 3RVJA 2WB4A 4KRFA 3BILA 4JAVC 1NATA 2GWRA 3FDFA 2R4QA 1KGSA 3MYYA 2FLKA 3O2SB 2LBPA 2FTKE 5DTEA 4OG2A 1M5UA 2RJOA 1A0OA 1DRKA 3QELB 4YGXB 4Z4CA 5JNSA 1ABFA 1D5WA 4G97A 2E4UA 3TO5A 5T3YA 1LK0A 1Z17A 3D02A 1PHRA 2MSLA 4MS4B 3RVRA 1CYEA 3Q9SA 3RVPA 3JVIA 3RVLA 1PEAA 2NT3A 2CHEA 2JVKA 2QU7A 4IF4A 4MRMB 3O21A 1RPJA 3GRCA 3QX9A 3TD9A 1GUDA 4GNRA 3EDCA 2PL1A 2OQRA 1M2FA 2FMKA 2M98A 2IPMA 3CLKA 3O1JC 4N03A 2H3HA 4RSMA 5FWYA 3HS3A 3CTPA 3RH0A 3T8YA 1NXOA 4EVSA 1MIHA 4FE4A 1EAYA 2A9PA 5CNKA 3UK0A 1TJYA 1DC7A 3LMKA 2FEWB 4Z0NA 3R0JA 3NHMA 5FBHA 1LJLA 1TMYA 5B3JA 4E7OA 4LZLA 3E3MA 4YRZA 4RK4A 1EHCA 3GBVA 4FB4A 1JDNA 3KJXA 1MB3A 2MYTA 1JHZA 3DGEC 4RK7A 3A10A 3LKBA 2FMIA 3IPCA 2LPMA 4LX8A 3JVDA 2JB9A 4HNSA 2HQBA 3LUHA 4YWHA 4MQFA 3H6HA 3MMNA 4XASA 1D1PA 2PUDA 4TLMB 1OXBB 1QP0A 2NZVG 2IKSA 1D2AA 4YLEA 5FWXB 1NXVA 3ILHA 4JASB 1VRVA 4RV5A 5TQJA 4XAQA 4H3KB 5KQGA 4YS6A 1R8JA 3T95A 3EODA 4LE1A 2JBAB 2JVIA 3IP7A 4EY3A 7ABPA 4DADA 4ZJPA 5T7BA 3K9CA 3W9SA 5TQ0A 3H5OA 4MR7B 3HV2A 2HPHA 2E4VA 3CZ5A 4TMYA 5CHYA 2MYNA 4WZZA 3GBPA 4Z4GA 5HQJA 4EVQA 1ZESA 5IEBA 3Q7RA 4W5QA 4D6YA 5DLEA 4QYWA 1JL3A 3OM1A 1KRWA 4MQEA 3MQ4A 4F12A 3IP6A 5C5EA 9ABPA 2CWDA 1DBPA 2PJUA 3Q7SA 1NXTA 2CHFA 2GX6A 4KZKA 5TPZA 4ETMA 1JLKA 3NNSA 1SXIA 4KK3A 1U8TA 3ROTA 3HEBA 4PZ0A 5TPWB 4KV7A 3BRQA 3SNKA 2F8TA 5EWLB 1H9CA 2N9UA 5TQ2B 1BA2A 2PLNA 4P98A 3NHZA 5ED4A 2GBPA 4XLTA 5PNTA 2PUAA 4WUTA 3S99A 5IBQA 5HM6A 1Z2EA 2I6FA 4OTZA 4RY9A 3FFXA 2NUBA 4PEVA 3O75A 1NXXA 5EWJA 3SQNA 1JYFA 1SXGA 3C97A 1Y1LA 1NXWA 5IULC 1EWKA 3Q41A 1UDRA 1YS6A 5DCLA 4MS1B 1B00A 4RKQA 5KC8A 3H75A 3QEMB 2QVGA 1ZGGA 2V0NA 3JTEA 3C3WA 5BRAA 1FFSA 4W5OA 3OQNA 3FFTA 2FEPA 4S04A 4DN6A 4LRQA 1PUXA 5JNRA 1Z15A 5EWMA 2GKGA 4N41A 1DCKA 3LUKA 3KS9A 5JNUA 3L49A 2IDMA 3N0WA 4W5RA 4YP9A 3TX6A 3MA0A 1MB0A 4NQRA 4HYEA 4WWHA 3H1FA 3LUGA 1QNLA 3N0XA 5GOTA 2FLWA 4MYRA 4W5NA 4G0PA 2R47A 3UKJA 3OO0A 3BRSA 2PE5A 2CD7A 1QQAA 4YCSA 2ID7A 1ISRA 5GQSA 3HUTA 3OLXA 2XDYA 2ID9A 1HEYA 4F11A 3F7NA 3VNAA 2E4WA 3LUDA 4FE7A 3M6MD 4F06A 4ETIA 2ZAYA 1JH9A 1XHEA 3KSMA 2HQRA 3KCNA 4XXHA 3T38A 4KQCA 3HXMA 4Q6WA 2X7XA 4LDZA 1XHFA 3OLZA 1USGA 1JDPA 1VLZA 3E61A 3H5LA 4OBBA 4Y9TA 2WJWA 3F6CA 4RDCA 4RU1A 4RY8A 1BAPA 4IMJB 4PE5B 3GL9A 3GT7A 1U2PA 6ABPA 3RVOA 4H60A 2E4XA 3LFTA 3N75A 5IEJA 3HSYA 4DQDA 2RDMA 5BQ3A 1EFAA 1OXKB 1ZITA 3O2QB 4ZMRA 1RXIA 5FWYB 4Z4HA 1F51E 2A9QA 4YR7A 2FXIA 2PUEA 4Q6BA 1CEYA 1E6MA 3CFYA 4EUKA 1K66A 4EYGA 2VK2A 3H5VA 4E7PA 3CKMA 1BDHA 1ZGZA 4MLDA 4Z9BA 3CHYA 3HJFA 3GYBA 3K4HA 1BDIA 3C3KA 3F73A 3IP5A 1L5YA 3Q15C 2M1ZA 3OQMA 3BREA 1JFVA 3CZCA 4HNQA 3OLYA 4JB0A 4RK5A 1FQWA 1ZH2A 3RVKA 4IMIB 5D2CA 5IUKC 4KMRA 3F6PA 1DC8A 1FFGA 2WJAA 4MQFB 8ABPA 3CU5A 1JWLA 3CS3A 3CG4A 3HDVA 4RXMA 1DCMA 4RK0A 1EWTA 4KK4A 1P2FA 5HSGA 1YMUA 2PUBA 5IUNC 3H5WA 1E2BA 3RVQA 1DBQA 4QPJC 1ZAYA 3MIZA 1A04A 3KG2A 1JFTA 4O1IA 5TPZD 5KQMA 5DGCA 1WETA 5TQ0B 3NBMA 1APBA 2FQYA 4Z4IA 3DBIA 4LE0A 2FW0A 4EYQA 1VPWA 4XFKA 4O1HA 1FSPA 3C6QA 1EWVA 2BGGA 3NNNA 1Z16A 2E4ZA 5HKOA 3HVRA 1ZHHA 2JCGA 4MS3A 1FFWA 4L4UA 3G1WA 1DG9A 1RXEA 4LE2A 4RWEA 1PEYA 3FFWA 3KYIB 3SAJA 4Z9AA 4RK6A 1DRJA 3I5AA 2ZWMA 2MSWA 1LBHA 1AB6A 2VUIB 4MQEB 3O74A 4KQ9A 2WWVD 1ZH4A 1T34A 2L17A 3T6KA 3QLVC 3H1GA 2KYRA 4N76A 2WRZA 3OO1A 3HO1A 3N8IA 3UUGA 2AYXA 3CG0A 3LUAA 4ZYLA 3MF4A 3LKVA 1DBWA 1LJUA 4TN5A 4MR8A 1DCFA 4RK1A 1QO0D 3JY6A 4LDAA 5BR1A 4JOQA 4OLAA 2PMCA 3B2NA 3DLHA 4IILA 4ZPJA 4N0QA 3O1HB 1USKA 2R48A 3KLNA 1GCAA 3IPAA 3HCWA 4Q7EA 5IUJC 1E6KA 2PUGA 4KVFA 1YTUA 2A9OA 3H1EA 5EWJB 3EGCA 4MR9A 1RZRA 1K68A 5I4CA 2W42A 4CBVA 2QSJA 1QO0A 3FMVA 1DP4A 3GA5A 1U04A 4QYMA 2JVJA 3JPYA 3LUFA 3TB6A 3O1IC 1MVOA 3QLUC 5IX8A 1IIBA 1SRRA 1YIOA 2OENG 4JP1A 4RKRA 3GV0A 5EWMB 4EYOA 2FN9A 2IOYA 5KWSA 2R25B 1P6UA 1RNLA 4H3HB 1TM2A 4KPYA 1D4ZA 3EAFA 3I45A 3LOPA 4TLLB 4D6XA 1E6LA 1ABEA 2RGYA 5KC9A 3A0RB 3QEKA 1W9HA 1U2QA 2RJNA 4OATA 5CNIA 4YO7A 3KTOA 1ZDMA 2E4YA 2L19A 1TVMA 2HQOA 3QELA 1QPZA 4HNRA 3DGFC 3QK7A 4Z99A 4L85A 5TE9A 5JNTA 4MS4A 1YS7A 4RZSA 2LIVA 3HZHA 3NNDA 4MRMA 2AYZA 3HDGA 4O5AA 3HM9A 3N6VA 1S8NA 1TLFA 3LTEA 3N53A 2L18A 2H0AA 2NZUG 1NXSA 5IC5A 2MYUA 3ILYA 4NICA 4NCAA 4MPTA 2QR3A 3QLTA 4IGAA 4WXEA 5B3JC 3CNBA 1W25A 1SXHA 2FMHA 4D74A 4KFCA 4ML3A 4RY0A 5KQPA 3M9XA 4RXTA 2JRLA 4N0PA 3RVSA 1JF8A 1J56A 3KHTA 4QICA 1NXPA 2FEKA 2MSKA 3KYJB 5KI6A 1ZY2A 3EQZA 4B09A 1U0SY 4JB2A 2QV0A 1QP7A 1ISSA 2QVCA 3I09A 3KLOA 2P9HA 4GPAA 1P8AA 3H6GA 3LUCA 4N47A 1URPA 4KNYA 3JS5A 1P6QA 3RVMA 3CRNA 3OMXA 1JFSA 2FMFA 2GI4A 2IYNA 4PYRA 5JS2A 3EQ2A 4KREA 5FWXA 3FGZA 3EJWA 3RVNA 4G0MA 5CNJA 1USIA 1YK1A 1M2EA 2FQWA 2WY2D 2F8SA 4M88A 4F3TA 1GUBA 3OM0A
chains in the Genus database with same CATH superfamily
2DX7A 4IRXA 2JBAA 3D7KA 1J7JA 1Q2XA 1R0ZA 1W46A 2V6JA 3UCFA 4FZJA 3KKMA 1C3LA 4AKSA 4F8EA 3DZKA 3E9YA 3N6RA 1DQYA 2OL4A 4IIGA 1X7YB 3D4NA 3U4HA 3TBFA 1RAEA 3QXCA 4ZMSA 4PU0A 3GT4A 3NP9A 4L4ZA 1NLFA 3IMGA 1ECPA 5FPTA 3TX2A 1DNPA 3S7ZA 2WG2A 3QXJA 3H11A 3QGMA 3R75A 4EBFA 2Z6UA 1U11A 1Q0UA 5J43A 1DV2A 2IY8A 1NMEA 4RTPA 4JBGA 1YV9A 3ZS9A 2R62A 4LOHA 3GLFB 2BM1A 1BCSA 4QSMA 1J90A 2QY6A 2BZ1A 3TTVA 1C29B 3CLSD 4ND8A 4XRGA 4ZVNA 1C14A 1UIMA 3B7WA 4MVCA 2I6SA 5EA2A 3PUXA 3ZZUA 3NO4A 5BQFA 4JI1B 1JQDA 4V0NA 4MWOA 1RWKA 1KJ8A 3IULA 4BCCA 3T7JA 3TOZA 1BX1A 1SA0B 3GRVA 4MQMA 2YDYA 3BC1A 4MDYA 2R68A 4JDPA 4NK4A 1JPNA 4UXJA 3OE7D 2FEAA 2VSFA 2RKOA 5HE9A 3K0FB 2RK3A 3ROFA 3FGOA 1FYWA 4MR8B 1JAYA 3M1YA 4BB5A 1NV8A 2Z6AA 2GAAA 2M6LA 2ANBA 3HWWA 1NF9A 1XSEA 3N2ZB 1N5RA 3DLPX 4I99A 3CLHA 4G5QA 4UUMA 2H2WA 5KMGB 1P0QA 1Y9AA 4GZ5A 4XVRA 3ZNNA 2WQ6A 1KU6A 1N9ZA 1UDXA 3WKCA 1BW9A 1TT5A 1XZJA 3OE1A 2F64A 3IB3A 3AILA 4JSYA 4H1UA 1A8UA 5DMXA 3NDBB 1DBSA 4X61A 1VHJA 2RH5A 5DM70 3HKDA 3TQFA 4BVAA 3AKCA 2JKYA 1AXEA 3I8OA 3GLTA 1QQBA 4V0ME 1LU9A 4PQEA 1CR4A 1WB9A 1N0HA 2JC3A 3TH5A 3H5TA 3T3NA 3BICA 4OMUA 5JNVA 1X0VA 4UQLA 2R00A 4NNJA 1LQ2A 1JH8A 2CUNA 4E3ZA 3L82B 3R7WB 2QZ4A 2Y1DA 2OC9A 1ZOOA 4P80A 1ONNA 2FRDA 4U2BA 2FPGB 3QLUA 4X91A 3B6JA 3P9KA 2C5FA 4Y0AA 4ZAYA 3SF8A 5JXWA 5KIAA 1PDWA 3OEEA 3WGQA 1EK0A 4KR2A 1LI5A 3L01A 3ZH9B 4KRFA 5K6TA 3PGA1 3FDFA 3JQ9C 2R4QA 4CUZA 4FYHA 3THWB 1G8YA 1IHOA 2B35A 2JIPA 2Q1XA 4XWYA 4JBHA 2FSHA 3IMEA 4HXEB 2OVFA 4BQEA 1U94A 3JSXA 3ZWAA 3AFMA 3D02A 1HZZC 4BC1A 1X77A 3D4OA 1FOEB 3QPBA 2FOLA 3CLRC 2POCA 1Q7GA 1L5GB 5B3KA 4H7PA 3VR4H 2RHBA 4DDHA 4MRMB 3N7UA 4IUCS 2NV6A 3SEQA 4C3OB 1DKNA 2WJJA 3B9BA 1RCUA 1GN9A 1DJOA 1Y3AA 2QG9A 3ONDA 2N3ZA 4LEIA 3PUVA 3T1HB 2CSUA 3WGNA 2IEYA 3KB6A 1SXJE 3IA2A 1CJCA 3Q3JB 3T8YA 1OLXB 1PR2A 4UDYX 2D8AA 5TRTA 1JHDA 3BXOA 2XBMA 2XB9A 4QSHA 3RS5A 1YR2A 1H3FA 2WW8A 2QD5A 3AY6A 1C9JA 2GBCA 3O8DA 1B1CA 1P39A 1XZ8A 4QC2A 2D8MA 2XGOA 3DE1X 5FOVA 1Z7BA 2Q1UA 3WRYA 1VLJA 1TIKA 3Q7PA 4HDMA 4M7WA 3E9RA 4Q3DA 3VSCA 3PFCA 4AJIA 3MCWA 3M0EA 3IV9A 5SY9A 2GUWA 3WXBA 4FGSA 1JHZA 4CUKA 5MGBA 3ZDDA 4RH1A 4PSVA 2Q1WA 4CEIB 3IPCA 4LX8A 5FRDA 4ESVA 1XCLA 4YWHA 2GN9A 3DOEA 3H6HA 3WGVA 1GPKA 1W4CA 2Q5IA 1G5FA 3NDJA 3HKEA 1CDOA 1NKVA 1YE8A 1VIMA 2OPBA 2WJ4A 3DUFA 4MJ7A 4XD7A 3REGA 5I7EA 2IXFA 3LHFA 1W0CA 2P3OA 3I04A 4Z86A 3E0QA 1I9CA 5AD1A 1T0JB 4OQQA 1VRVA 3FPSA 4XAQA 2F48A 4HAIA 4PCLA 1WE2A 2R1ZA 1XQ1A 3E1GA 1GPLA 5HKAA 2P90A 4AJKA 4CFZA 1WDLA 4TN1A 1P5RA 5A9SA 7ABPA 2VIIA 1FNDA 2W9XA 3VKWA 1AU9A 2A2ZA 3PPVA 4TWZA 4IWYA 2WSYB 1NYTA 4XM1A 1SZJG 3EDOA 4G2TA 1L4UA 4OUKX 3PXXA 1JR3A 1U8AA 3O4JA 4QOSA 5CDSA 3H2ZA 5F1PA 3A37A 2HX1A 2BF4A 2G83A 3C3XA 3LT5A 3IIMA 3BFPA 5EE1A 1I6KA 5CVTA 1NWHA 1H94A 4WNIA 1FQOA 1BROA 3RT1A 5BR7A 4TUYA 4G4GA 3D3NA 2X0JA 1OA0A 3HN7A 3IP6A 4ZDKA 5IWCA 4IEIA 3IQGX 3FNEA 1XQXA 1EE2A 2OILA 4TROA 4IIBA 3PQEA 2PGNA 4BV3A 4TV9A 2IBMA 3BRCA 4MSUA 3Q8KA 3CLSC 1Z37A 1NQ5A 1IN7A 1WMSA 1Y9EA 3A06A 2CEAA 3HEBA 4PZ0A 1WLSA 5LBTA 5JHHB 3N1UA 3QPUA 4O4LA 2F1IA 3K2IA 4TLCA 4O4LF 5ITWA 5D00A 1UBGA 2HLNA 4NTZA 1KC3A 5HIMA 5JC1A 1EM8B 2X42A 3ERCA 1FTQA 1SPXA 2R79A 4WUTA 2BGWA 1E2HA 4FFLA 2V1UA 5AI6A 1IAVA 1TM5E 4TRNA 3C85A 3DW3X 5IXJA 2ZVJA 1NF2A 621PA 1IZZA 2EL9A 3AB3A 1ZA1A 1EK1A 3RLIA 1YDEA 3QWAA 3ZQ6A 2JHFA 4K9OA 2BW0A 3C6YA 3VA7A 2BGUA 1UOQA 3OEED 4GYWA 4PLWA 5JCOA 1ZG3A 3PXAA 2CYBA 1T6YA 1XFDA 3JTEA 4XCXA 5EIWA 5A5FA 3FFTA 4V0KA 1PUXA 1G63A 1YI1A 4OHCA 4YPFA 4IX1A 3EXIA 4RW0A 4AN1A 4TWBA 3DTNA 1NBOA 2EBHX 4K9KA 4M1YA 4X7RA 2VTDA 3JQ8A 3WK4A 1Z06A 1Z0SA 2EKZA 3U4GA 2Z8YA 4FNGA 1C0PA 1LF5A 3BMNA 5BNWA 4MNTA 5B37A 1RQ7A 1Z5WA 3GVPA 3MPUA 2I4NA 3RYCB 2OHVA 2J09A 3CO5A 3EXEB 4K81B 1EUCA 1I01A 1UPTA 3V80A 4B4VA 4CMEC 2JASA 1MX3A 1ISRA 4DQ0A 5KOIA 1L7DA 1XXHE 5NULA 1SIUA 1SUCA 4BWGA 2A35A 3BE8A 3DF9A 3EPJA 5T4BA 1P44A 2CVPA 4QBGB 2HZBA 5AFSA 1JMKC 1LPSA 1KPGA 2X5JO 2VQDA 1KSJA 1XLWA 3P0JA 4LDRA 4X71A 4V24A 5G1OA 4QKQA 4XXHA 4DKJA 2VWQA 1OJ7A 3T38A 2FG5A 1T8PA 3ETEA 4NQZA 4GP6A 4TT3D 5AK3A 1H3NA 1BJTA 1ZM2A 2P9BA 2PFSA 1A9PA 3GPCA 1VLZA 4WLVA 2E87A 4QXOA 4XDYA 4HQNA 1GNVA 5A7GA 1OU0A 3MNFA 5CA0A 3UTCA 2NMVA 3MK31 2I6UA 1NUSA 3O4FA 1QYXA 2XIQA 3NQ41 4XIFA 1EFVB 4IMJB 2OQVA 3ZU6A 3CVXA 2A7XA 3HDQA 3H3FA 4MMXB 1EA7A 1WCIB 4PNHA 2ZJ7A 3IDSA 4AICA 2C00A 1XRJA 4L0MA 4L50A 2Q0XA 1UEJA 4RADA 4E5PA 2VDRB 3EVGA 5FWYB 3EZFA 3LP6A 4ZMRA 3ZJTA 3WOVA 2HXYA 4HRVA 2HRRA 4REQA 3ZWXA 4Q6BA 4EDHA 1I80A 3JQRA 4IDPA 3BCRA 4Q05A 2AMYA 1CUDA 3PQ4A 3GI1A 1BCRA 1V0JA 4YGYA 4TKVB 1SCDA 1FXUA 2D1FA 1NVMB 3HCAA 1U0EA 1NQXA 4G2NA 1Y5LA 4P4SB 5DPMA 4DCPA 4L5JA 3E22B 3V1UA 1KFKB 2LE0A 1B93A 4NFYA 4QECA 4B32A 1TVEA 4CDGA 4X85A 3IP5A 4QPNA 1Z4JA 4B5KA 4M21A 4AX4A 2QL7A 3E03A 3A1CA 3H2HA 4LF9B 5DNAA 1JR3D 1JKMA 1QFZA 5KX5A 4I2NA 2XSZD 5AHRA 5HF9A 2BZGA 3UT6A 3NGXA 3V8BA 4BQNA 1U9IA 5KX5F 2WQ7A 1FDOA 5IVKA 1D1SA 1CEQA 3E7DA 1OGYA 1SVNA 2C4VA 3D1VA 5IZ4A 4X93A 2NZ8A 4CKXA 1FMCA 2WYUA 3NMUF 1CF9A 1NF3A 2B34A 2VDLB 2A1TS 3KJZA 1U3GA 3KO8A 3T1VA 3I28A 5IM5A 3TW8B 3NV9A 2E85A 1K8ZB 3JQGA 5F7ZA 8ADHA 2BL4A 3DEKA 3ER6A 4B6EA 1RQPA 4EJ2A 1ESMA 4PGFA 3EVZA 3L1HA 2HU7A 1IQ0A 3O94A 2XDWA 2OE2A 1Q84A 1VPWA 2C7GA 3CF0A 2LCFA 5F1YA 3OEHA 5FPHA 3RSHA 2NM0A 4UOEA 2QX9A 3LCCA 4PQYA 1VCIA 1JLHA 4EB6B 2EHDA 2N75A 4DMMA 4P3NA 3G1WA 3RRZA 4IAOA 4DM4A 3TRFA 4M9RA 1H8EA 2GSDA 4ZI7A 2VJOA 3PP8A 5KYNA 3L0ZA 1Z5ZA 4RK6A 4TQGA 1BJRE 4YX9A 4ZI7F 5KNCA 4TS1A 1JKFA 4WFQA 1RXSA 1K27A 2JGNA 4MHSA 2YJGA 4BZZA 3HA5A 2PGOA 3VRHA 1JSRA 3AW8A 2C1ZA 2J31A 4WKGA 1YZFA 4JIMA 1WUJS 2QUKA 1C80A 3AIIA 3RSCA 1OB2A 1Z29A 4CM1A 4ODIA 1DBWA 1LJUA 2LVBA 3SQLA 1MLDA 4D6XA 1NLMA 3A7DA 4RK1A 3JY6A 3BWBA 5FI1B 2C7BA 3CH5A 5L3QA 1HG0A 4OIFA 5CGQB 5LLSA 4CRWB 3GLGA 4LF4B 1QKJA 2OCAA 2F8LA 2OZLB 3AKEA 2X9VA 3AM4A 4GNKA 5ERXA 1J39A 3ZHUA 1HKHA 5HUQA 2JLZA 3O6VA 4YCCA 3DBOB 1BXGB 1T2FA 3AMVA 4Q7EA 1F1BA 4LDQA 5LQMA 2X41A 3K2EA 4RY2A 2PWAA 4WFJA 3EXFB 3KXDA 2Q5JA 1T3HA 2GILA 3AG6A 3FLAA 1MB4A 2QMZA 3DBRB 4CXMA 4FHGA 2ES4A 1KEZA 3H2GA 2C96A 4PLYA 4R8VA 1TW3A 3UJBA 1JJFA 5TEWA 5A6SA 3I1FA 2Q4OA 2H63A 1L1EA 5C2JB 2SKEA 5AVRA 5TV2A 1E3DA 2FRDC 3W7AA 3QLUC 2HRCA 1YIOA 1C3EA 1PJ2A 2Q5EA 3I34X 4NJEB 5AO9A 2AFIA 2CHVA 2R25B 5IVPA 3G2KA 1CV2A 5J4HA 2VJBA 1YJXA 1F60A 1J23A 2AW5A 5JHGB 4J0IA 1G20A 2GEKA 2B5OA 4KNVA 1Z2CA 1JFFA 4R2IA 4Y18A 4KX5A 1S7CA 5EMKA 5FUXA 4POOA 4JLDA 4E07A 2CK3A 1U0TA 4FR0A 4MWZA 1ZCBA 3LDHA 1I5RA 3PE3A 2WA2A 4LHSA 1TZMA 4K9MA 1FP4A 2XZTA 3UM9A 2C4WA 4WXPA 5IAGA 4ER7A 1QF7A 1XD9A 3W5SA 3DEHA 1TYZA 2YOHA 1CWUA 1RPAA 2OD9A 3F5QA 5FA8A 4AJHA 4ZV9A 1G41A 2QE6A 5I9MA 1DHTA 3OZUA 1ECFA 3TW4A 4EGQA 2MMCA 3WIBA 1V5EA 2DBYA 3IT0A 1VYVA 4C0WA 2JKZA 4XVQA 1PV2A 5ANRB 2WAOA 2QSUA 3OC0A 5EVCA 4LGYA 4OP2A 1WJGA 2QZSA 1JDUA 2EKLA 3EIHA 3G2QA 1NVXQ 3G6KA 5AM2A 5F7XA 1IQPA 1QH9A 1BYIA 1OIVA 1PZEA 2HA5A 3RKRA 4MPTA 4WXEA 3FPHA 4NI5A 2HIAA 1OT3A 1I4OA 1R0KA 1UZAA 2G5PA 2FMHA 2R6GA 2XRFA 3N2EA 4O2LA 4QEKA 2AFHE 4R0NA 4R8KA 3V4SA 4RXTA 3F46A 3K9QO 4HRYA 3RVSA 4AUEA 5I8PA 1T2UA 5ALWA 1GSHA 2GK4A 2IXEA 1SD2A 5A4FS 3DLCA 3KYJB 4IVRA 1QH8A 3QHPA 1MX9A 5AOBA 5KI6A 1ND5A 1WEKA 4AB1A 3PRKE 3PA6A 1A5SB 1VKHA 4OHWA 2OKCA 1QU2A 5CBPA 1XEXB 3OZTA 1P8AA 4N47A 1T5SA 1WXHA 2WJZB 3BX1A 3DULA 3M8KA 3RARA 3CM0A 3THOA 4IWNA 2DBZA 3SHTA 4QU9A 5A9RA 3OMXA 3E27A 4CR6A 1E9FA 4HDAA 4DUGA 4ILEA 5FV7A 1V6CA 3TLGA 4X64B 3OEHD 2P6MA 1FLVA 2G8NA 1QJCA 3A1DA 3CA8A 3QWIA 5FOWA 1ZNYA 3SC3A 4DXAA 2FX3A 1O87A 3IPYA 1W2HA 1MJFA 2F7SA 1EKXA 2HA4A 3C3JA 3DJYA 3GLQA 1H8ED 3H04A 4YRLA 3U9SA 1ADJA 5BNIA 2HO4A 2YVAA 3F71A 1LSSA 3AUSA 3O2JA 2A5JA 4UEQA 5KNCD 2CVOA 1KEEB 3LLCA 2R8BA 4XQ9A 4IFEA 4XW2A 5K0LA 3SVLA 3MJHA 3V9AA 4OQMA 3IAS6 4UJ3A 1GZ3A 1Z12A 2LD4A 3Q7QA 4N3GA 4XD2A 4ZK6A 1KI6A 1WNFA 4FCTA 3U7RA 3ZWVA 4RQTA 4RTOA 2XB6A 1WBDA 3IJEB 4X45A 2RAVA 3USZA 1BX3A 1PQPA 1D04A 5JPIA 1LC0A 4PZLA 4D0RA 2QENA 4QT4A 1VCNA 2XE8A 1ZAKA 3IBSA 4X7PA 1KYTA 1OXVA 5BWOA 1W5BA 5LMCA 1ZRNA 4UOQA 4MAAA 2MMGA 4URYR 5AW9A 4MDHA 3EPHA 1QFYA 2QW1A 4ATNA 4KG7A 1KEVA 1ZGBA 2P65A 5CJ2A 3T5TA 2R8OA 2H57A 4KKXB 5KQLA 1G4UR 3PR3A 1G3QA 4FYIA 5TPWA 3GJ8A 2PX6A 4ETNA 2F3QA 3FCUB 3INTA 4YAGA 3UUFA 1Q7BA 3RK1A 5TT1A 1CRLA 1M1YE 2EFCB 2ZAIA 2L2QA 3IV7A 3Q6IA 3B3FA 3SEAA 1XTUA 5F64A 3IRUA 4QTTB 3RQSA 3SHQA 1ZCFA 4FMDF 4BUJA 2NSDA 2VQ6A 2XY4A 4KQWA 3SY8A 1WSAA 4HH1A 3GFBA 1E2NA 4I1IA 5JCOC 1GG2A 4P81A 2B0CA 4YCAA 4MO9A 3AEZA 3DOHA 3HXPA 1E66A 1ZI8A 3MSCA 1ZVVA 2FWMX 4OOEA 5D5QA 1RJ9B 1BO6A 1NI5A 3UPTA 1MC1A 3U4QA 3EZYA 2G4VA 1O3YA 4MR9B 1ODJA 3QX8A 2Z4TA 2HF8A 2CK3D 4P0TA 3OQIB 5ALSA 3ONNA 4D8TA 2JDIA 4EVRA 4YAKA 5KHOC 2QBYA 3PKJA 4HEHA 1ISFA 4EHAA 1XCBA 2TECE 3D6VA 5CNMA 5B55A 1G21E 1YQXA 4ZU6X 6ADHA 1GXSB 2JH9A 2O20A 3NC1C 5JY6A 3RSLA 4I4TA 3W2IA 3UMGA 1G98A 1NV9A 3L79A 4P31A 4QDUA 4CW7A 4E2WA 1UM8A 1U7PA 2QPTA 1YIAA 1P9OA 1GLVA 2KE5A 3GVHA 4ROTA 3FWYA 1J0DA 1R88A 2C5GA 1UDCA 2HFJA 1T9BA 1XTKA 2Q62A 2PGDA 1S2MA 5TGTA 5IJAA 1WUTA 4IGKA 5KQSA 4BDTA 2UVPB 1OMOA 2ODBA 4QFCA 2FWJA 1VJRA 1NOIA 1WQ3A 4FHZA 5EP4A 4NH0A 3SZOA 4ZYXA 5FTLA 2QD4A 4BFVA 5BMVB 2WHYA 1BEEA 2WFLB 3OFSA 1M5UA 3QMPA 3WC4A 5IJZA 5JNSA 5DFAA 3LP8A 1FU7A 2ZROA 4K2AA 4JUFA 1FNMA 2WJIA 5HFNA 5IDVA 2GS9A 5FX2A 1QANA 3UQYS 4A0SA 1LK0A 1SM4A 2I66A 2DAPA 2QJFA 2WE7A 1HE5A 4H7EA 4KGXA 1COWD 4HNHA 2B2NA 2AOVA 1WVGA 1IUOA 3R5SA 3RVPA 2PMBA 5KINB 3RR2A 1QLHA 3VU1A 2PRZA 1RPJA 1WD7A 2H9YA 3B20A 3QX9A 3KPUA 3WLOA 4YRPA 1FFXB 4J91A 3HXOA 2Z09A 4IJWA 1KEPA 2UYYA 13PKA 1JSZA 2FWBA 1LCIA 4PPFA 3QFHA 4MVWA 3DQQA 4BB6A 5MN5A 4KR0A 1ILEA 1HYQA 1TFUA 4GRAA 3URKA 121PA 4LXGA 2JCVA 2AN5A 2P75A 3FDIA 1N2HA 1NBAA 5EG5A 2OCGA 3Q9LA 5B3JA 3FYUA 1W4AA 1U65A 1X8KA 1YRQA 4J1QA 2MCFA 4BATA 3BQNB 4D92A 2WHPA 4EABA 4GOOD 1YH3A 4UNQA 2D74A 2ERYA 3DGEC 1WRBA 3A10A 5H4HA 3ZTYA 2X4GA 3ZIDA 5IKOA 3G2HA 2HYIC 4CV3A 1SB8A 3EMKA 1EIWA 1JDBB 3NVDA 2EGUA 1EJ2A 1ZIOA 3D54D 4H3SA 4DY6A 4FU0A 3LX4A 1CY2A 1KO5A 2SICE 1OR8A 1TIBA 2REBA 4WY2A 4BMVA 4E09A 3AM3A 1X7DA 2A3NA 3ED1A 3F9IA 2CNBA 3HXLA 5ALRA 5K6RA 2IHBA 4JASB 4QIHA 1PE0A 3VTKA 1KAOA 5I7UA 1U7DA 5KQGA 4R2HA 3U7GA 4B7UA 3RYHA 3EODA 2OBYA 1L5MA 3WYGA 2ODWA 2Q9AA 3KPWA 4PCUA 4DADA 1F4LA 3O4HA 2QRNA 2ZJ3A 2DCUA 4R7ZA 5DYIA 4YP1A 4PQRA 1JWAB 4RAQA 4W1QA 3WY9A 3ITNA 3Q8WA 3DUWA 1XZIA 3LUBA 4JOSA 2VDMB 3U5ZB 1ZESA 5GADl 5ALGA 4UNSA 3RFVA 2QM8A 2VZLA 1KY5A 1QDEA 2PM8A 3L4SO 3M70A 1RC0A 4NDZA 4NU8X 1JG3A 2D5LA 2AEJA 2OV2A 2Q6KA 3L1KA 4X6YA 2E18A 3C8HA 3ADKA 1DT3A 1GGJA 1KRWA 4CLEA 3HGMA 2W8ZA 2VAMA 2MR5A 3BIFA 4HWOA 3GU3A 3X1JA 5JO9A 2OCXA 2HWUA 1NI3A 4YRDA 2QP3A 3DVAA 2FU5C 2REQA 3FE2A 1CJSA 2KBEA 2NTJA 1U99A 3RJMA 5C7LO 3L9XA 1GU7A 1KYVA 4WUVA 1X7XA 4BXOB 2ERXA 4G01B 4F45A 5HQTA 5EZYB 1ODLA 3PT9A 4F3KA 1E7RA 4D4GA 3AV3A 1XEWY 3N39C 4KSCA 5TJ9A 2XEDA 3QNUA 5FPPA 4CDNA 3I58A 5FJIA 2L69A 1NZDA 1SCIA 3LAWA 4WLOA 5EGSA 4E5VA 4JJEA 4BFTA 4HZUB 4WCFA 1VIVA 5JEEA 4O4JA 1I1HA 1ESZA 4O4JF 2AOUA 2ZUVA 3A6PC 4Q48A 3JXEA 1QCCA 4F71A 3FI0A 3UG7A 1TRHA 1UDRA 4G26A 3TNJA 2ZSUA 4MS1B 1MA3A 1W6RA 3H75A 4AY5A 2HD4A 1BJKA 3PXDA 1MV8A 2V6MA 1Q0LA 4PFKA 1N3LA 1Q1AA 3GDOA 4EECA 2XUGA 4S04A 1K8QA 3VKHA 3BJIC 3WLSA 3FZQA 3CVJA 1NUQA 2W83A 3IBCA 4OCZA 5DTJA 4NZMA 4N41A 5TC4A 3FTEA 2W2KA 4DIKA 1RI3A 3U80A 3K2BA 2X0EA 5DTQA 4KWHA 3MOGA 4TQUS 4W5JA 3LUGA 3PGMA 5KHAA 4WESA 1NYLA 4BJ3A 1W29A 5C1DA 3Q3IA 4U7FA 4PYOA 2R1TA 3BZWA 5FOXA 5JZOA 2VSQA 4BNJA 4E11A 1KF0A 2O07A 1QYRA 3EB9A 3QY9A 2BR4A 1KJWA 2QYTA 2XDYA 1GAXA 3VHLB 1SNYA 4MICA 3KB1A 4PANA 4S3MA 4WLFA 3F7NA 5FR2A 4H1VA 5DB4A 3VPCA 5K3OA 4L8GA 1DGQA 2Y92A 4KH1A 3ROGA 1XQVA 2BMVA 4NG4A 4CMIA 4ZOQI 2EP5A 3BE4A 1F2TA 4TMWA 1A97A 2O2CA 2AG0A 1SVLA 1W8IA 2W6CX 4KXNA 1N7IA 4KQCA 3WMFA 2Z98A 3I8XA 5NLLA 3SDSA 4DYVA 1K06A 1F6BA 2XE4A 4P5DA 3HDHA 4MV4A 4OFXA 5F1KA 4US1R 5YASA 4YFVA 1C1HA 5AHKA 1TU4A 2C58A 1Z35A 3H65A 4FSHA 3VPAA 1F14A 2WTBA 4KQXA 3D59A 3ITKA 4YREA 3D3WB 3DD5A 3AOEA 6ABPA 5CCXA 3DHEA 2K2QB 3EDYA 4X5OA 9GPBA 4Q7MB 4U2KA 4DQDA 2RDMA 2BMWA 3A1WA 1J07A 1N0WA 2O4UX 4R16A 5K09A 2OV8A 2J5BA 2LXNA 3EXAA 3VZPA 4B0PA 3JVUA 1P60A 1ULHA 3LY9A 1K66A 3NBUA 5BWMA 1GR1A 4OOFA 1O77A 1NRIA 3ESDA 2RH9B 4D6PA 3OT5A 4LF5B 4NU0A 1EJ6A 2Q2VA 4JMPA 1ORDA 1V95A 5A02A 3QF4B 4HFNA 3A6EA 3FNRA 1JU9A 2DHQA 2E0IA 3K8OE 1LLUA 3EPRA 1TYEB 3CT4A 4AT1A 3T34A 4LGMA 1B0ZA 4P83A 5H68A 1RQNA 4GL4A 4PQFA 3D6UA 4MQFB 3TIGA 5ELLA 1Z07A 2Q2NA 1YL6A 1DEOA 2IZ1A 7MDHA 1ES9A 2DG2A 1G1MA 4FCCA 5TMEA 3T54A 4GFDA 2RSLA 3VPGA 4DTIA 3BGOS 1LB1B 2HMYB 1K7EB 5FI3A 5HK8A 4CJXA 1N75A 4A8JC 5CT4A 2O19A 1RM0A 3EIFA 3B1ZA 3EGWA 1P9RA 2C5HA 2K4MA 1D9XA 3FFBA 4H4EA 1APBA 3T1TA 4Q21A 2WWXA 2FW0A 4XLZA 4G25A 4YLGA 5IC6A 3UV6A 4EYQA 1BS1A 1ZMBA 1MBZA 1ZRHA 1XJ0A 3FBTA 3ISVA 3PFIA 3TZ6A 3ZDCA 3I9NA 1RQGA 3OCCA 3KLMX 2OKGA 1GFSA 4KHZA 1DJPA 1S9DA 2QMEA 1T0IA 3UTDA 5LMNB 1M75A 5J1SB 1RRGA 4QOEA 2K6GA 2EJBA 1NMYA 3NX4A 3W8EA 3WRXC 5BV7A 3I61A 2EF1A 4CN9A 3H9QA 1RYBA 3CLVA 2UVDA 2FPMA 2XVZA 4K6HA 1NPDA 1AKNA 3G5LA 4PC2A 4XYBA 4I1SA 4OM7A 2W6ZA 1T3SA 2WWWA 2WRZA 2PTGA 3G49A 3RWBA 4JBNA 2PWYA 4UNRA 4S1VA 3N9IA 2OQIA 2HSZA 1Z0JA 3DO5A 2I29A 2D1QA 3FMGA 2DCMA 2P4HX 2B6HA 4AZ0A 2W6JA 1T5IA 1YQQA 2XA2A 4Q34A 2BC9A 1ZD1A 5AJXA 4RHYA 4OP3A 3DA8A 4NP6A 2PYZA 2G3YA 2QN3A 3EVCA 4OJNA 5IMBA 5K3BA 3CQ9A 1WDKA 3RHSA 4KLRA 4E4YA 3DD1A 4CMGA 4R2WA 2MINA 1J8FA 4D42A 4NWIA 1K68A 3O0TA 1C41A 1OV4A 1PR4A 3NHJA 4ZQHA 3GZJA 4TOIA 4B46A 4OGGA 4RYLA 3WBJA 4KDRA 2J0SA 5LNK6 3MTGA 1V8DA 1BQ4A 1GO2A 1ENOA 2OG2A 2PV0A 2YVKA 4X3PA 3DZ8A 1E7QA 3DVSX 2BSXA 2PLWA 3PICA 3MMZA 4NBUA 4DCVA 4TYNA 3T9BA 2ZSFA 2JIBA 3TTUA 2X8JB 2FSGA 4Y0VA 5DN6A 1TFRA 1XTSA 3RBZA 1UBKS 3VO2A 4ZZIA 1DQRA 4H3HB 4F3NA 4D8VA 3K0SA 3A26A 3AZOA 4XSHA 3DAPA 2WF6A 4Q82A 4WE3A 5E7MA 5EN4A 1F3LA 4HQRA 4PZYA 4BGUA 2XGGA 4O2AB 1HDOA 1RYMA 1VI2A 2GM9A 5F12A 1FYXA 4CKYA 4EHLA 4URXR 2G70A 1JG2A 1GARA 3MUOA 1U2QA 2JFXA 3L4BA 5GPBA 3F3SA 1MIOA 3LVRE 1C30B 5ALHA 4U39A 4C43A 4J75A 1ZZGA 2FPWA 2V65A 3IOCA 3K9BA 2FUKA 4PVCA 4HNRA 3ETLA 3RYFB 3V8NA 1C9EA 2HDOA 2ZRBA 4A6EA 1ZM4A 2H51A 5TE9A 1TZJA 4D81A 1Y1PA 3C1TA 3B5IA 1T15A 1ZNWA 4BJHB 3RGWS 5JYBA 2ODTX 3GP8A 4QRDA 1H1TA 1U1EA 4UAGA 1U2DA 2B4QA 2NPIA 2AXPA 2FFJA 2ZT5A 2Q3EA 3K16A 2CLDX 4LC1A 2PX8A 2O3RA 1J70A 1YDGA 4LOJA 2NU6A 3GN2A 3HCFA 1L7AA 2ADOA 4M0MA 5B3JC 1ZIPA 3FYUC 1VE9A 4U2GA 5C46F 5AVYA 4G9BA 3JD1A 3UG6A 2Q3MA 1YE5A 4F6RA 1BS9A 1OAAA 4F2DA 2C2ZA 1PR0A 1SVOA 1GAQA 4UCWA 4BFCA 1JTEA 1PS9A 2XQFA 4URZR 2DP4E 1U7UA 2MSCB 5I9BA 4F9TA 2ZIFA 4BP1A 2ZRLA 4XWWA 2DWOA 2AOWA 2XZOA 1CQJB 3OJOA 3SFVA 1K0UA 1T4BA 3C15C 2O2ZA 2YWRA 3PHIA 2IVZA 2V8BA 4GPAA 2CHGA 4MV3A 5AW6A 2V58A 1JIVA 4D3YA 1V3VA 3HG7A 1EHIA 5CFMA 5KHLB 4JV5B 4KE6A 1S3SA 2AJ8A 2C5LA 4BN0A 3E3OA 3PUIA 2CUKA 2GR9A 3EW7A 1Z0ZA 3BMOB 3WGGA 2H1VA 3BXPA 4R01A 3EUAA 4BAGA 4OH7A 2QLFA 1OWLA 4RULA 2GI4A 3AH8A 5AOVA 1TCBA 5BQOA 2AQIA 4IBOA 4ZOLA 5THKA 3Q12A 1SGWA 4ZOLF 1JIJA 5FWXA 1PR9A 5JG7A 3WYEA 3OJXA 5EE3A 5EE5B 5DIZA 3C7CB 2VBGA 1AKYA 4QREA 4NKRA 3U7QA 2YMMA 3KJIA 4B4DA 3DMTA 1JAHA 1N2XA 2ACKA 4FHDA 1YI0A 2Q9UA 4ACBA 3O8BA 3DJFA 3TF5A 1MG0A 3GRFA 3BS4A 1JB1A 4KBYA 3GCZA 3GFVA 2YXBA 3Q3GE 2X2EA 4HAWA 1XPUA 5A1TA 3R5XA 2IEZA 2IPAB 2ZRDA 4CM8A 3KR0A 3R4VA 4QXAA 4OBXA 3NTUA 5H0IA 1NI4B 5ALYA 2DT8A 3NWJA 2BCEA 2O50A 1JTFA 3VU0A 4Z4FA 4RVOA 3N7TA 4CMCA 1UOPA 4YECA 2A9JA 2W6JD 3AP2A 1U8YA 3HZOA 1GKUB 1JHXA 3V2HA 2J0QA 3MJDA 3ELBA 3HUUA 2DEUA 4M37A 3ABSB 2GCGA 4GC9A 5CLLA 5EGNA 2EX1A 4DLRA 2ZSBA 5GIOE 4CQLA 3M6AA 3RC8A 1BXZA 4X0EA 5T4HA 5DHQA 1PG2A 3TLCA 1I2AA 3QFCA 1SHLA 1O6ZA 1BCSB 1TDJA 2HJGA 1ZI9A 3LQQA 3AJAA 3GDGA 1U3VA 3UHPA 2G36A 2JL1A 4G0QA 4WAUA 3W8RA 1OX5A 4QXMA 5HF8A 2VUSA 2VF5X 1FX1A 3F6RA 1SK8A 3F97A 3G13A 3FY4A 3FWZA 2BM0A 4J3FA 3NHLA 5CDYA 2EFDB 4D46A 1C0EA 3RQIA 4O0LA 3IO5A 1FXSA 4EG6A 5G3YA 5GMOA 3S5UA 4DR7B 4JJKA 1CJVC 4RX1A 5DN6D 1FVOA 4QBKA 4ZVSA 1N1DA 1YBAA 2QJTA 4M9CA 3M49A 4L51A 4TMXA 5FFMA 4BQRA 3AHGA 1QZZA 3AVUA 5TMBA 1BG6A 1JQLB 1QKIA 5FO0A 3AETA 2BFCB 4L57A 3G79A 4BBAA 1JLLA 1OV6A 1N6KA 3H1PA 1QGDA 1J00A 4DR4B 2QLJA 4LXXA 4LJ4A 3H5IA 4RXUA 3CKYA 4TV8B 2I7TA 2XWJI 2Z3VA 3CEJA 3KTDA 4WD3A 5E4YA 3B12A 3VPFA 1UUFA 4BNFA 4HT3B 5LOVF 5JR3A 4TTJA 1CQXA 1KERA 3RIEA 3GJ4A 2XHEA 3IOYA 3OZIA 1M2NA 4H17A 4JHXA 4O63O 4WCDA 2TRSB 3P7MA 1OFUX 4IV0A 5CPFA 1R4MB 1RWXA 3CRQA 1NVUQ 3PJFA 3V46A 3WYFA 1DWUA 1HDRA 4GP9A 4YJGA 5KYXB 5LJIA 3N8NA 1GT6A 4MW9A 4RPIA 5GY7A 4WLNA 3FWHA 1XGKA 4MCAA 1XCJA 1W4LA 1BGWA 3MVEA 3GNTA 2V96A 1TAGA 2E5FA 2ARKA 4GI3A 4C21A 3TOVA 3JQCA 1CZRA 1U1IA 4GPZA 2WMYA 5JS1A 1VG9B 3RVJA 1UMDA 2GWRA 2O8DA 2FLKA 1ODIA 1V7PC 1G5RA 2OCLA 2PXAA 3EZLA 1Q20A 3QEOA 4DB2A 1V47A 4F2WA 2VPTA 3ACCA 5FTJA 4FZVA 4IJVA 3IUQA 4P4UA 1D4AA 3SBXA 1VP9A 3LDAA 3RRYA 4EHHA 1CYEA 3JWJA 1O96B 3GGDA 1AKTA 2WVJA 1NAIA 1TTHA 4R8SA 4DA7A 2BI7A 1I51A 2H16A 2WD7A 2OZEA 3JQPA 2YV1A 3USES 2I8LA 2WIAA 5A3SA 1XVIA 4RZ2A 2H6EA 4KE8A 2DFLA 1V4VA 3F67A 4J1TC 3COWA 4FPXA 2JFQA 5AXCA 5EJ8A 3HYSA 3W77A 4IVQA 1UP6A 4PGAA 3KWJA 2ENUA 3ZLTA 2KX7A 1T4GA 1ADFA 1Y4DE 2A0KA 2Z08A 5K0JA 1PGOA 5CNKA 3R7SA 1A50B 1J2UA 2Q0QA 4MCIA 2O3TA 3R0ZA 3SDBA 2XXBA 3FPJA 3OJ0A 4YROA 3BIXA 1BEUB 2O2XA 3T9CA 3NHMA 4JEIA 3ZVKA 3TINA 2VFAA 4PG7A 3B38A 4B43A 3BK2A 1XHLA 1SUWA 3R6GA 3WFJA 1VIYA 4UMFA 2OHFA 5E2IA 2P9FA 1M2JA 1XL1A 4L8LA 4IP0A 2F1RA 3MUFA 5THQA 3AYZB 1GDHA 3OQHA 3QOXA 1GU1A 2GDJA 4RPHA 4R0MA 4AO8A 4CMKA 4ABTA 2VHZA 4NJMB 4HHEA 3G0IA 1NKSA 2GYWA 1SCAA 2X23A 3HM2A 1NR5A 1ECCA 3BDAA 3IAHA 4G56A 1TF7A 2YWXA 3A4VA 1UJ2A 3R6LA 3IAS1 4QUGA 2XB8A 4DG8A 2C5BA 3R7FA 1J25A 2MTBA 3E4DA 1TMKA 2SKCA 3L0YA 2ZI4A 2IUSA 4NAHA 1OKKA 1W44A 4QHSA 3I9V6 1CNEA 1NHGA 1Y4SA 2XUOA 4M1WA 3QMMA 4MYTA 5HF6A 3TJRA 1MJGM 2CXNA 1HT1E 2I67A 2RONA 2UDPA 2C2MA 3NIGB 3SNHA 2QTVA 1QH1A 3GGSA 3GJRA 4MR7B 3HB0A 4BJ1A 2Y0DA 2QN7A 4A23A 4HN4B 2BUAA 5BUZA 4Q9NA 4A82A 3R76A 5AW3A 1GJRA 1BH6A 2IOFA 2XLCA 3BKXA 3BEDA 1Y8RB 4G1FA 4TL6A 4L3OA 3SJUA 2VDNB 4YQEA 3LHDA 3UJ3X 2UZ0A 4GLFA 3J7TA 4O4HF 2PQ6A 1SUPA 2VJQA 4ZV7A 4C0QC 2E3JA 3I9JA 1MNAA 1P2BA 2D2EA 1RHUA 2Q41A 3U13A 3MTDA 2PGAA 1DLJA 1G18A 3G9QA 4ZVMA 1JG1A 4NF2A 1C7IA 3KT0A 3AV0B 4R05A 5AM4A 4DR2B 1DAKA 1P7WA 1X1BA 4CCAA 4PTZA 2WHEA 4KN6A 4N01A 3ANSA 4BO4A 1KORA 1L9KA 3QYJA 5ALQA 1YB1A 2F43A 1P1FA 1U5BB 3OETA 2FFHA 4JGIA 4RMJA 2C4KA 1JQ3A 2PPLA 3KKNA 4L8VA 1DWOA 3QKSA 5TQ2B 4TRRA 4YCNA 4JI6B 4TV9B 2V59A 2Q0HA 4BHTA 4ZI3A 1OB5A 3KV3O 3SSMA 1MXHA 9LDTA 1DRWA 2BEWA 2WSIA 2YHIA 1EB9A 4WN9A 3BGVA 3JZFA 4UAJA 2NUBA 2NVBA 4F56A 3QTTA 3O8QB 4R6WA 3G6WA 3THYB 3FYTA 4XOIA 2QTWB 4YUYA 3TTTA 1PNQA 3G5MA 5FT9A 1WTCA 2WFMA 3OBBA 4RZIA 3FUXA 4HDKB 1PL8A 3CBQA 4MGYR 4ER0A 1L4BA 3IAFA 1LRKA 2Z3WA 5C80A 1YS6A 2Y2VA 2G17A 3VPHA 1G42A 3OZ7A 3NYQA 2ZTLA 1LZLA 3BWMA 2ZBGA 4A9AA 1SMKA 2ZWAA 3FAKA 4P3KA 5JNRA 2C7RA 2D7DA 2F59A 4J16A 2VO1A 5EMHA 5EWMA 3CUTA 4TL7A 1EWQA 1CY8A 4V3BA 4DMGA 2D5CA 3CH6A 4CKCA 1V16B 3KYCA 5K6AA 3BXEA 4X1IA 1YS4A 3JYLA 721PA 4DV3B 3JR7A 2R2GA 4EFDA 4ZREA 1EFDN 3DYIA 5BW8A 2R66A 2GO1A 3KXPA 2ID7A 3ETCA 3R3VA 2ROQA 3FCXA 3EGDA 2GPYA 3HCRA 1NZJA 3OTGA 1YGPA 1EP1B 1VB3A 2R8EA 1IHPA 1GGHA 2OCIA 1IY2A 4HNAA 1O4VA 1JQKA 1DQPA 3TFOA 3MGGA 5B1IA 1J22A 3WG9A 1PCXA 2BGNA 4UUAA 2DJIA 5KWVA 4ER5A 4RVSA 3LSTA 4DSNA 3AEQA 1J4AA 1M2WA 1X9HA 2EG9A 4RELA 4FDUA 3SC2B 3C2QA 3KWLA 5B2FA 2V7GA 1W5EA 4BX9A 2HCTA 2BZ0A 2SKDA 3GVIA 4PG8A 1C9MA 1SIBE 1T1JA 1IUNA 4W7SA 1IXZA 1FNSA 1HRDA 2CL6X 2J5XA 2EGGA 3DTTA 1ID8A 5CVVA 3FETA 1GOTA 2V6FA 4KPFC 3IT3A 3M89A 4LK3A 4P3OA 3E18A 1EVEA 1M6VB 5DYTA 1DAPA 5JU6A 2PZBA 4AS3A 1GDTA 3CKMA 3DS8A 1Z4QA 1D6SA 2LV8A 4WNYA 5UKDA 4V0RA 1J8DA 4MEJA 4EG5A 2ZXUA 1JSCA 1SUEA 1VHQA 3C3KA 3T7SA 3IMFA 1JVBA 2GAJA 4JBLA 4OQ4A 4JB0A 3QPWA 3U7HB 3CUWA 2O3SA 2O1EA 5IUKC 5HQ3A 1DC8A 4RYDA 3PPYA 3RJZA 2QTGA 1GL3A 3HDVA 5FPSA 1L6RA 1QFMA 4BE9A 2HLPA 2HBQA 2ZRHA 3H97A 1P18A 1UJNA 1NLUA 3EC1A 5MN4A 2J30A 3TCKA 2VDOB 1EIZA 4MHTA 1E2BA 1HLPA 5E0OA 2H1CA 1NN1A 3V1YA 1T5TA 1C4XA 3KG2A 2CV1A 2RGRA 1ZQ9A 1PIWA 2CL5A 3I2HA 3DBLA 2FSVA 3M5PA 1M34E 3NEJA 3UK1A 1R00A 1Q83A 2XMBA 5FKJA 4CUJA 3U31A 3MT7A 5ECYA 1NM5A 3OHSX 2CCKA 1TRKA 2XRYA 2B4YA 1PFQA 1AUPA 3HKCB 3PRJA 2ZRQA 3QVMA 4AFNA 1FS6A 1VKZA 2VH1A 2VP5A 1DKMA 3DM9B 4BLQA 5AW4A 3WL7A 2MR6A 3D6JA 1DKPA 3EWSA 4RWEA 1UWKA 4RETA 1OLUB 2CNDA 4XB2A 4HUQB 2YUIA 4YP5A 2ZUEA 1Z5OA 4DLKA 2FHPA 2QUBA 5HZHA 2FRXA 1SB9A 2YVQA 4G4SO 4MRPA 3HYRA 4NEGA 1SD1A 1SHZA 2PZMA 3K3PA 3PEFA 3T15A 1NBHA 3HU3A 5E7JA 1WL8A 2PCJA 1DI0A 1HR0B 2ZTVA 3AI2A 3LHIA 1ESEA 3DOJA 3E3AA 4HEQA 5IBPA 4F3RA 3MF4A 3FVQA 3TQCA 1J8QA 4BIMA 3KTFA 1FRZA 4MH0R 4BLVA 4DJFC 1REQA 4DL9A 4DNOA 5CA1B 1IEVA 2MWMA 2O2GA 4OO3A 2BFFB 3PDIA 3B2NA 1P5FA 1E1CA 1QO9A 3E84A 5SYMA 3LTNC 1TEHA 1ULUA 4D0SA 3EZGA 2WKRA 3GNLA 1GCAA 3CNHA 2WTUA 3QPVA 5ALVA 3CRRA 4H7JA 1QZXA 1RXYA 1YTUA 2GEBA 3EGCA 4WACA 3OZSA 4BNMA 1R10A 2YJZA 3OCUA 1H4SA 1AUOA 1RWNA 2UZ1B 2JCBA 3U4IA 4N7BA 3ZGYA 1J8YF 3G8CA 3TB6A 4GKVA 1UMCA 3TSAA 1GKYA 1Y7HA 4QDOA 4B8ZA 1PLJA 1ZGJA 2C2XA 5AKGA 2HBRA 4QL3A 1RWQA 1OYOA 2FPXA 3O1IC 4OYHA 3OTWA 4RGYA 4J43A 2YOGA 2AR7A 4H6VA 3SS7X 3WKDA 4C0BA 1QTNA 1I0LA 4DC1A 3HGTA 4JP1A 4KU4A 1OH7A 2I7XA 3SICE 1YIDA 1P6UA 3ISJA 3QVGA 3GJQA 1H1LA 4PLCA 4L7QA 3JRXA 3ZWKA 1GRNA 1Y34E 4M99A 3TDMA 2QLLA 4TRMA 3AF0A 1E98A 2QV7A 3KJFA 3KZ1E 2ATVA 1TADA 4MWGA 2C03A 2OB1A 1YC5A 3WLNA 1CR6A 3HTXA 3VC1A 2A3RA 1E1QA 3SJ7A 4B4KA 3ZD9A 5HZGA 5HBGA 4YPOA 2E4YA 1KI7A 4D57A 2CXTA 4BQPA 4M0PA 3GGJA 2PKRA 2HQOA 4JK3A 4HV4A 4QBFA 1X9IA 4BTLA 1ZLXA 5M3BA 4C08A 1N6HA 4LA4A 4Z99A 3KR1A 2FGKA 3OZXA 3LDFA 3UMFA 1WBJB 5KNLA 3LBYA 4F2HA 5KVCA 1TT7A 2WZBA 4G4JA 5AYVA 4UHBA 3JYOA 3IVAA 5DLDA 4DSUA 2PVPA 3GEPA 3NM5A 3EF1A 3QVOA 5JYCA 5CLGA 3KQUA 4K0KB 1VL1A 2H07A 5FNVB 1QRAA 1I6WA 3I5XA 1T9DA 2HXGA 3RS8A 4ARVA 3FTFA 3HVKA 1FFEA 4S35A 4E15A 4OB7A 3M4NA 3KQNA 3F3MA 2ZTMA 4K6OA 3PC3A 4W8HA 2J4CA 4RY0A 2I4TA 2ATXA 2QXUA 4L5YA 1FFYA 4WN3A 1QJ4A 5TF4A 1TI7A 3L5KA 1LQUA 5E8JA 3VNRA 1B2LA 4ZHQA 1IOWA 2AC4A 1FU4A 3T5MA 4ZHQF 1YRYE 2B3DA 4WXRA 3AG5A 2VUTA 4I8XA 5AKYA 3CX6A 1FMJA 3EQZA 1RAIA 2YS6A 2BYTA 3G0HA 4OQNA 1NKTA 1RC1A 2QV0A 2WDZA 1F38A 4UNIA 1W88A 2NTEA 1R0CA 3IEUA 2P9HA 2R1VB 5ES4B 1URPA 1ISHA 3K6RA 3I01M 1IVYA 3FCAA 3FWPA 1L7RA 1RCFA 4HVTA 4DILA 2CFOA 2IXBA 2WLTA 2ZYDA 2YNMD 3AY7A 5LZ5A 3WWEA 5H9WA 1I9GA 5G0SA 3C48A 3CIOA 1YQGA 3MJTA 5BSTA 2GXAA 5J40A 2JAWA 1W5SA 3ZPXA 3EQ2A 1U3FA 1VXOA 2Q2WA 2QROA 1ULSA 4G0MA 3FSRA 1EBBA 1M2EA 1Q7EA 3OICA 2H1OA 1QF9A 1LNZA 3ICOA 4M88A 5J59A 5B1YA 4YA6A 4IV8A 4TKUA 1N6OA 4HBZA 4GSLA 2CVFA 1C0KA 3TBHA 3PXUA 4I9UA 1Q16A 2QLBA 4IHJB 3PJDA 2VPXA 5DXJA 2O0JA 4CM6A 1OY1A 3LT4A 3UBMA 4D0NA 1OFIA 1J21A 5C31A 4NBLA 3K8YA 1L5KA 1GNLA 4P8RA 2WAAA 2Q3LA 3WBKA 5IF3A 4AU1A 2QI9C 1CQWA 1GG5A 4GVXA 5FAKA 2FSSA 4IF6A 2ZWOA 1BVHA 2G07A 1ZNXA 2FSPA 1LDEA 1H2EA 2I62A 4FEYA 1C4WA 1NUUA 1HSZA 1OAOC 2XQVA 1MW9X 1TQHA 3ZUPA 1O8BA 3HFSA 4UQPA 5C1IA 3T3PB 4DJJA 2XWSA 3VI4B 3Q1KA 1T91A 3URMA 2UZ3A 3CUEF 4TYQA 4OJYA 3STXA 2HYDA 4EPVA 2XR1A 1GYRA 3THRA 3QE0A 2F8MA 3MSXA 1Z2DA 4Y6RA 1T3GA 2PUTA 4R5HA 1CUHA 3ENKA 4DLLA 1N6IA 1OZGA 2TS1A 3RAPR 1CHDA 4WFIA 4WNAB 3L41A 3ZHXA 2W2NA 5CJJA 2FR8A 1GITA 4F04A 5BVGA 1M0EA 4BX8A 1BS2A 2YUTA 1CG6A 1YK0A 3UCEA 1ZUIA 4I55B 1C0IA 1ZMXA 1VBMA 3U7EB 4FOOA 4UTXA 4Y2YA 7AT1A 1ENPA 3JPWA 4I14A 1O94A 1P1RA 2C92A 3DXXA 5FV4A 2QLNA 4CGYA 1J5PA 3IYLW 1G5IA 2HA2A 2VHQA 4U7JA 5JO0A 3UB4A 3A4NA 3INNA 5JJIA 1M1NB 2MYPA 2FFBA 2V98A 1XTRA 3I4CA 4FLEA 1GPUA 3G85A 5EP3A 4DRXA 3BHJA 2I1LA 3KTAA 3L7OA 1E64A 2NT4A 3WWCA 1UBJS 2C2BA 4D80A 5K6AC 1E1QD 4KQIA 4Y2VA 3KE8A 2JZCA 1YMVA 2GEFA 2JA1A 1MRZA 3T1OA 2PH7A 2J33A 3TLKA 2FHSA 1EEHA 3MTJA 4CFSA 2V9PA 4XJXA 2VYCA 1KARA 4AXBA 1NNSA 4G09A 4QJ4A 2VAWA 2IUYA 1TJPB 2XUZA 1U0FA 3LO8A 1E8NA 4NIMA 3QVLA 1N7JA 3C3MA 3D81A 3DE3X 1DPGA 1Q1GA 1I3KA 2GBLC 2UUCB 1B2RA 1T1EA 3AP3A 4NDNE 3EOZA 4CM9A 4ERNA 5B7QA 1JQEA 2JF0A 3D2AA 1CVRA 3ILVA 4AXXA 1H5UA 1WMAA 3CZMA 1XZPA 2QRVA 3AO0B 2OSBA 2VPQA 3NALA 5EHQA 2SHKA 4Z4CA 2P2YA 4XYEA 4BUCA 1Z2PX 2YCLA 4GBMA 4BQQA 3OKPA 3MWEA 4G97A 3SQOA 4D82A 3C4QA 2MSLA 4FYXA 5IABA 4UVHA 3PXBA 1NDHA 4PLFA 3RREA 1P1CA 3JVIA 1S8AA 1PEAA 4Q9HA 4A0FA 2QQ0A 3LXRA 2NO5A 4NMXB 2Z9BA 4B6QA 1XJ5A 2GD2A 3C24A 3M3DA 4KUHA 2OQRA 3UK7A 3W6NA 3L1JA 2Z2KA 4TQ9A 1SU7A 1B1AA 1N2EA 1USUA 1XTZA 2ZVDA 3AL3A 2OZVA 3KQVA 7ADHA 5F9HA 4QHTA 2P4QA 1NBMA 3HS3A 1XMSA 4FFVA 4HVCA 4ZHSA 1WNTA 4ND4A 3HJHA 4NRDA 4XWAA 5A3JA 4QAQA 3R0QA 2WHXA 1QRUA 4D3DA 4F6RB 4Q9LA 1D2RA 1DAFA 2V7QA 1RSZA 1UKVY 2DT5A 4U7TB 1EHCA 1EU1A 3PNSA 2GTPA 2WZCA 2GKSA 4QO8A 3KJXA 4YCBA 5JWRA 1P6XA 5CEFA 1Y80A 3RNOA 1KAHA 1SQFA 2FX2A 2FZLA 2XTZA 1WF3A 2IEBA 3KAPA 4GGOA 1B76A 4NCIA 4Y3UA 5BSKA 1Q5PA 2XB2A 4BV8A 2EBUA 3GEDA 1RQXA 2OECA 1WXDA 1D1PA 1TKBA 4PIPA 2REXB 4FBLA 1XROA 1ZGAA 1UPUA 1DQSA 1NDUA 4PF1A 4TLMB 1NRJB 3CUYA 2UKDA 4Y2SA 5ER9A 4EFKA 3S3TA 1FQKA 2J9FB 2OV6A 3O47A 1BMDA 3A9SA 2OXCA 3FF1A 3U7JA 3VR1A 2YNMC 5AK4A 4C4XA 1E2UA 4HZGA 4GLOA 2FPPB 1IDN1 1YR8A 3IJ5A 3UMBA 1N6LA 2WYHA 4U8GA 3A9TA 4LE1A 5E3IA 4RJ2A 1FNBA 2LNDA 2JEYA 1YB2A 3GLHE 3TZBA 1C9YA 3GUZA 3HDTA 4G63A 1N0VC 3HWRA 5K4AA 5TQ0A 4M46A 2X13A 3WJAA 2DF8A 4RJJA 4QBTA 5EXEA 3D1JA 3DO8A 2EOAA 2ZYIA 1U0OC 2VJCA 5DI3A 1E5XA 4KWCA 3UUWA 1RBZA 3MAAC 4Z4GA 3WSVA 5DBGA 4P38A 3K70B 1MFPA 1ZJ5A 1VLHA 5JIBA 4DFDA 4JYZA 2POQX 3FYSA 2Z1DA 1CK4A 1O94D 1YULA 3OM1A 5I48A 4QFBA 3OIVA 1UK7A 3ER8A 1JECA 1RHRA 1VJTA 2RARA 5JWHA 1L0BA 1MU0A 4MK4A 3H5NA 3NNSA 2ODEA 2O2DA 3DZIA 1LW6E 2B9VA 4B2IA 4CZ2A 4HSGA 1EQAA 4DMFA 2WWTA 3AUYA 4U6QA 5C35A 5CVDA 5EOVA 5EWLB 3N3BC 5FHRA 3EZ9A 4DIFA 3PBKA 3I3OA 5K8VA 4FFPA 3ZZ0A 3B7PA 4IDQA 4F7WA 3VR3A 3ZXSA 2Q5FA 5DTIA 4CKBA 5B3LA 4B3FX 4DIUA 1YZYA 2DSNA 3H9BA 3WWPA 1C8VB 3H2SA 5F73A 3VAYA 1YB4A 4AX8A 5AM1A 3TDKA 2V74B 3B1KA 1V26A 1INLA 3ZCVA 3KJNA 3FUWA 3E9EA 1O4WA 4WGFA 1U1FA 1UINA 1O2DA 5FR1A 5G53C 3WWYA 4AW9A 2FXVA 2WJ6A 3GLRA 2J85A 3OA2A 3S4YA 3TZCA 1Z62A 1HEUA 2XWQA 3G2NA 4HWGA 4MPDA 1P7PA 3QVXA 4IDOA 4YDRA 3OQNA 1JFRA 2ZKLA 3PFNA 2ZE5A 3F4LA 4LRQA 1SBIA 1R8SA 3DTYA 1W35A 1P0MA 3EVFA 3OX4A 4MLZA 4OGWA 3MAGA 3RD5A 3A3OA 4C14A 3MWJA 1EDOA 3NUZA 4O4IB 5CYPA 4C2BA 3P2YA 2BEKA 3W9UA 2CBGA 2YIVX 1WULS 4EHFA 1XFAA 1RKVA 4WWHA 5D01A 2ZBEA 1VP3A 3ZD7A 3KSBC 2FLWA 4B31A 2G9UA 1KPHA 3EFOB 1ZD3A 1FLNA 4QYXA 4K0RA 4RFSA 1O9GA 3ZEIA 5LXTB 3Q6NA 3E15A 1YOVB 3N8KA 1NJ1A 2P7HA 3WKEA 3HR4A 3OT1A 1QQAA 1GUYA 4R1NA 3M83A 4C1BA 2CXUA 2D4HA 3CCCA 3P94A 3SLGA 4CTKA 1WDMA 3B82A 3ADDA 3M6MD 1M2GA 1LLQA 1FMTA 1KGDA 1GTVA 3IQFA 3GMTA 3PSAA 4JYMA 4EARA 4IWXA 2HMTA 2G0NA 3OTHA 1QOZA 4FYVA 3ZU5A 3ZIUA 2O0LA 2JBHA 5DM0A 1ZJ4A 3DLAA 2WQZA 4JJ7A 4XM0A 2VJYA 3T3HA 2V7QD 2JI6A 1J2YA 2VZEA 1CX9B 2XE7A 4IO0A 2LZ0A 3EBPA 3TW0A 1W85B 1ZUWA 5KPDA 3U1BA 3IT1A 3RTBA 2KM1A 1Y3DE 2X1HA 3RC9A 3DBHB 4WZBB 2IV7A 1LPPA 3EEBA 3LECA 1JV2B 4OX9Y 1PT5A 4W9NA 4HB2A 3B60A 3X1KA 3IH5A 1DINA 2HC9A 2FXIA 3RVBA 1OFTA 5K4HA 1DIBA 1EVKA 5L45A 1POXA 2Q8NA 2VVTA 3O9ZA 3H5VA 4I19A 4D79A 1CIJA 2FGJA 2ZSAA 2XRZA 5DHTA 1E1NA 1V9SA 5DVZA 3UQZA 4B6FA 4MIOA 2ZIXB 2YV5A 1Y81A 4W8GA 3F73A 2BFWA 2VJKA 3EUFA 2FN7A 3O3OB 4D9CA 4DNPA 2YMLA 2RK4A 1WVMA 2ZU6A 3GJ5A 4JKOA 4M86A 3WP0A 3HRHA 3EF0A 3EXHB 4Z9XA 5EKSA 3KKQA 4BMYA 1M72A 2FZGA 2OCBA 3TR6A 5D2CA 3K96A 4DZRA 5BSEA 1FLDA 3ZWWA 1KP9A 3LCMA 4KRGA 3LYUA 5I5GA 3BD7A 2QRKA 3I73A 1NW4A 1VCOA 1QS0A 1U28A 1LLDA 1SXQA 2PO7A 4ZJUA 1KQOA 1YACA 3C39A 4WLUA 2KHZA 5AXDA 2FEMA 1XDBA 1DBQA 1Z4OA 2EEPA 2RHGB 3CZPA 3R0VA 4ZYWA 2V4UA 3GZTB 4UU0A 4UZEA 4HGQA 3IE1A 5I7HA 2O2JA 4UAVA 2WJVA 3GRUA 5FTKA 1EXNA 3PCXA 5GM2A 3TVTA 4OHFA 5D85A 4M0KA 5I7AA 4Z4IA 1ADYA 2PUHA 3F8SA 4KQ2A 4YMSA 1EA5A 1G17A 2YS7A 2DWUA 1US8A 2ZJ8A 3IEVA 3C8UA 5LUBA 1JHOA 2I3GA 1VSVA 2VTEA 3K0AA 5B5SA 3LWDA 2P3SA 3ICPA 2PANA 3JAKA 3P1JA 4LTMA 4O8ZA 1FFWA 1OGJA 4UARA 2JK0A 5FUBA 1T9GR 1G0NA 4C3UA 1KY3A 3PF8A 1IVSA 2G1AA 1YFJA 1UM9A 4OAOA 3O8RA 4FS8A 6REQA 1FQJA 1YBVA 2AUMA 2DU8A 2Q4TA 3LC1O 4E5NA 1H22A 1SAYA 3HABA 1II8B 1SELA 2JD2A 5D5PA 1RYEA 1KZ7B 2WNSA 1O94C 1MOSA 2EQ5A 1VG8A 1M8KA 4O3FA 1CERA 1K5DA 1RM5A 4Z3KA 4YJ3B 3HO1A 1VMKA 2KPOA 4TL8A 1HX7A 3H4MA 3EIOA 3P71T 4ID9A 4FDMA 5JZSA 9LDBA 1QO0D 4EI2A 2XT0A 1Q17A 2FI1A 1UC9A 5JTTA 3R0XA 2OD7A 4G5RA 1PAUA 4JT4A 4I7EA 4HB4A 3SKVA 2AD5A 3K32A 2R48A 2R6ZA 2VHVA 4ZZ3A 1RBYA 1Z4IA 2WICA 4YAWA 1R74A 2Q3BA 3KQOA 3ZU3A 5COBA 3AF5A 1TVKB 4YDSA 4E13A 2OESA 2AFVA 2R3SA 2DFPA 5ALXA 4OKSA 4CHTA 1QC5A 1AKEA 2GASA 2OXTA 3S7TA 4CBVA 2XXAA 1OE0A 5LUAA 1DC6A 1E3EA 3OZVA 4MW0A 1DEXA 4NBNA 5CK5A 1L7OA 2TMGA 5KWJA 5AVJA 1N6PA 3HLTA 5HA5A 2MINB 3ZWMA 5D3KA 2E6UX 3KKKA 3ZK7A 5AK6A 4IRMA 2O59A 3OIWA 4KAAA 3QU4A 1W52X 2H8KA 2O2EA 1SBHA 2DERA 4B3DA 4F8YA 2FZWA 2JJQA 1T24A 3LK7A 4YRTA 3VISA 3WQQA 4WLEA 2ZB4A 5CTJA 2Z2IA 3DE5X 3ZN2A 3SR0A 5KTNA 2PUVA 4S1PA 1E77A 1SXJA 1TA4A 2G4LA 3R6DA 3A0RB 4YH1A 2BGRA 4LXYA 3ZGLA 3OG9A 1UFVA 3I6BA 1ZDMA 5BNZA 5B6PA 3IQEA 4PR3A 3RSOA 4EF5A 2DLNA 3TSOA 2IC5A 1YFZA 5EIOA 4BGDA 16PKA 4DXHA 5GV8A 1OI2A 4JT2A 3JD2A 3W3ZB 4DSZA 1WB6A 3CCFA 4IS2A 2CXHA 3IAM1 3PVSA 3VYWA 3R9WA 5TF0A 4RTKA 3BWEA 4XGQA 3LT2A 2QE7D 3TAXA 3WYNA 4C6HA 4QAJA 3AESA 5CIWA 5JAZA 4BBPA 4GM1A 4TSRA 2PU5A 3VR5H 4DA0A 4D43A 1GV1A 2IZOA 4M22A 1Y7LA 1K7FB 4FYWA 4XDZA 2W2TA 3STUA 4OYRA 1S2GA 4OQXA 2DLDA 1EUDA 1AMUA 3TLXA 2QZPA 3HFJA 3MMSA 3HB4X 4UVGA 1ULZA 3A14A 5JSFA 2NUAB 4LI0A 1E79D 1R3DA 2GFHA 2PT7A 3VC7A 4B8WA 3W4JA 5KU7A 4DR6B 2JRLA 4B7AA 1ESDA 4WVFA 4WZAA 4YUAA 4GO1A 4ZICA 3G82C 4MP6A 1W1WA 1JT9A 4RGBA 5AJUA 3T9EA 3TXXA 3VTZA 2C7VA 1VMIA 1HRKA 2BFEB 4ID3A 4F5EA 4D5EA 2YC2C 5HTOA 3HSKA 4UBOA 1XMPA 1M7GA 2DBQA 5CM2Z 3SE7A 1KWGA 1H5QA 3CR3C 3G1UA 3CB2A 4RACA 1UBLS 3F5FA 4Q7JB 1NJ5A 1YS9A 5CDFE 3H2YA 2Z5LA 1S8OA 3LPMA 3QNWA 2QL5A 3UW1A 1ILWA 3R7AA 2I4OA 3V2IA 2Z6QA 2IXAA 5KTOA 3F5DA 4PNPA 1JMVA 2VP9A 1LI7A 3IQZA 1HTTA 3ZBQA 2DFKB 5D3MA 2PFKA 3KAKA 4I81A 4TWJA 3BMQB 3CZ4A 5FORA 1L4FA 2JATA 2RKBA 2VYNA 4LV6A 3ZDRA 3O2NA 4GXNA 1NXQA 2G71A 4UEKA 3HUEA 4UU7A 1R6UA 1U7XA 3H7IA 4Z1MD 5AVQA 3K0HA 1NL3A 5K1ZA 1OBCA 1QMPA 1Y1QA 4WTOA 4L9RA 1SKQA 4QM7A 3TVYA 1YBMA 1FYVA 3LT1A 3IKMB 3C6KA 3LVQE 3WADA 2HU5A 5FADA 3PQ7A 5ADUS 3QG5A 3ICVA 1VGVA 3WZMA 4NC9A 3WDKA 5K01A 1ITZA 1NR7A 1YHZA 4TGLA 2G5CA 2VS1A 5JARA 1CJKC 4E2YA 2HNAA 1QVZA 1DFHA 1FS5A 3B6MA 4CM8B 1V9LA 3LHSA 5DNCA 3CZAA 4Y67A 4ZAXA 3ZNQA 4LTNA 1CZUA 1XZQA 4PFSA 5H16A 4Q93A 2ZSDA 3QUCA 1P4HA 4J0DA 5G3ZA 4C1NA 2XCRB 4IIJA 1HFEL 3L0BA 1TOAA 4IIJF 3TFWA 4FXOA 2IPNA 4IZIA 4X7MA 1NFQA 5C53B 4F84A 4H6PA 3A6KA 5LZ7A 2YJ6A 5L7TA 4EK9A 4HFJA 1Q0HA 5ICEA 2W2QA 4F85A 2HRQA 3UAZA 4RLHA 5ICMA 2IQ5A 3VZDA 4RVUA 3S44A 1XWWA 2D7JA 4EFLA 1H4VB 3G5UA 2ZEJA 3PXEA 3QLVA 2YHBA 4FI3F 4QDKA 1MC8A 4HX2A 5J5CA 2VUHB 3S2GA 1N9GB 2Q5QA 3CUSA 2HJ9A 3NAGA 4ZMBA 4ARIA 2YICA 1A8HA 2Z2XA 1HBJA 4CLOA 4LZAA 1ZJYA 2X19A 1FUIA 1NRXA 3AFGA 3Q85A 3FB1A 3AUUA 3MOIA 4WOPA 5JJ5A 3CGGA 2BBOA 1A2QA 2ZREA 4Y2TA 3VUEA 2DWPA 2E1PA 4CDRA 4I6EA 1AN9A 4WA7A 1A2OA 3O8NA 1CRPA 1AB5A 1JBEA 2W70A 4F9FA 2XX3A 5HFAA 5KB3A 3PCRB 4ZEVA 1XNRB 1JKJA 4JI3B 1JYSA 1RACA 1G3MA 3PG5A 4UCFA 3TI7A 1YVRA 2AWOA 3GMDA 4YAFA 2XVMA 1MAVA 1JHUA 4PHCA 5LOVB 2PUCA 2X0IA 3NM4A 1O0SA 4B3BA 5IM4A 2V6GA 3ZWQA 3QXSA 3BXFA 4KNWA 4DANA 4CF7A 2QG6A 3KOYA 1E2IA 3K6SB 5IM4F 3VJRA 2FPSA 2O8CB 2PBRA 2Q6TA 5CM9C 3SU8A 1NUAA 2OQ2A 1W36B 2OWEA 3N2IA 3U44A 1QP4A 1B0UA 1FJ2A 4TMFA 1XCMA 2DR2A 4JYAB 1YZTA 1HOTA 4I1RA 4EDFA 3WTBA 1CS0A 3AHCA 3O2SB 3VR4A 4CCYB 2A78A 1JQ5A 2GLUA 2W6IA 3AJDA 4KQ6A 4LBWA 4YMWA 3MD0A 3RU9A 3HJNA 2QKYA 1P4SA 2AT1A 1QWSA 3FNHA 3X2FA 1ZR4A 5J2TA 3OWHA 1G3RA 5LA6A 4MWBA 3FZYA 4FX2A 4QYIA 4WCVA 2CNWD 5J2TF 4QOJA 5LA6F 3Q5EA 1K2VN 4F2GA 4WINA 1HUQA 3ND9A 4JI0B 4U8HA 3ZI7A 3STYA 3AU9A 4BFZA 1ZVMA 4QYTA 1ZA2A 1ZU4A 4ZKEA 4C6TA 3PLAE 3RIXA 2GESA 3ZOKA 4G0UA 2BFBB 5HCIA 4X41A 5AVTA 4DCJA 2AYYA 4AG6A 3B78A 3U7FB 2Z2ZA 5L4LA 4N48A 4M53A 1M2FA 3NHUA 4ZEMA 2E1RA 3GA0A 1Y82A 1M0SA 1QRTA 4U6SA 4CQMA 4KMSA 3CTPA 3PHGA 1JW9B 1NBWB 4QDTA 5A05A 2FUG1 4IHAA 3WGLA 1MD9A 2HJRA 5JD6A 5HUHA 1QHHB 2FX5A 3AR7A 1DC7A 3DDSA 3LMKA 5ALTA 2I9PA 1LTQA 2VYND 3NFRA 1FSGA 1TMYA 1MABA 3HRKA 4ZCTA 5AJVB 1FDTA 1MX5A 2Q27A 5ELMA 3FOFC 4JJAA 3J81k 4AL4A 3LY5A 4GZMA 4JLWA 5DYGA 1NQVA 1G3IA 3NBYC 4ZVUA 5GOZA 1UT8A 2K87A 1I7LA 3JATA 4AF7A 4DZTA 4K3UA 2GAFA 1PR6A 4JH0A 1SQ5A 4KJXA 3VTAA 1B0AA 5KTMA 1PLLA 3B7GA 3IBGA 5KCZA 3ZY6A 3UAGA 2RBKA 3MMNA 4XYGA 1KRHA 3DDCA 5LMZA 4BB0A 2OCKA 1E61A 3DMHA 4RHEA 4BVGA 1RKQA 3B6ZA 3NV7A 1FVFA 1PJ3A 2IKSA 3OJWA 3UXMA 3QLJA 4OA8A 4AJLA 2ZIUB 2WG0A 1FP1D 3S2FA 1NXVA 2WT8A 2GLXA 2OOKA 3E2IA 3EAGA 4RD0A 2IW1A 3F1LA 3IVMA 221PA 3VGPA 2JHAA 1AV6A 1B42A 2ETXA 1QIHA 1YQTA 2V7PA 1H05A 2I3DA 3AJ9A 5J4VA 3NEPX 1JZTA 3DDWA 1MT3A 1HV8A 4HO1X 4C4YA 3NP7A 1M8JA 1R37A 4GZ3A 5KOHA 4DCNA 3GJ3A 4G5FA 3QI7A 1C7FA 4WZZA 3QY0A 5DOVA 3TJZA 3AF6A 5ITZB 4LUCA 5F5NA 1TO1E 2D3TA 2H1LA 4E88A 2OO5A 4R6XA 2BLLA 2EX0A 2FZCA 4L4XA 3VMFA 2WM2A 3IUMA 1E9DA 3NWBA 5DLEA 3ZLUA 3HWSA 5AW5A 1A9XB 3K7EA 4ZZ0A 2CVZA 1VFPA 3BQ9A 4MQEA 3MQ4A 3PITA 3LC7O 1N33B 3LNTA 2PKYX 1DBPA 1BD3A 1H93A 1TO6A 2AR9A 4G4IA 4L6CA 4O4HB 4S1NA 4JSTA 1JLKA 3AVQA 3U09A 2CY0A 4XJTA 2R84A 2GDZA 2G82A 1U6IA 3A2MA 1R27A 2WFAA 3D7NA 3EN0A 3OE5A 3R5HA 5C3UA 5BPHA 2XYRA 4FGLA 3KNZA 1CUIA 4PFQA 1X38A 4F86A 1KMCA 2ZETA 5DRYA 1A9QA 5JPDA 2HWWA 3BWVA 3NHZA 3D2CA 1RWBA 4XX1A 2Q6VA 1MHPA 3VZBA 4OTZA 4B74A 2H4XA 5BT8A 1Y6RA 5LD2B 1IXSB 3GLUA 4MVJE 2GXSA 2HGZA 3A28A 1CRWG 1HE3A 4ZDWA 4C4ZA 1CE8A 4CEJA 4E08A 1I36A 4KVGA 5CVJA 2WWYA 3NC0C 5EEHA 1OU4A 1MQ8B 4WY8A 2ORYA 1QLJA 4GMKA 5AVOA 5DCLA 4QUAA 5DHSA 4V2UA 4KE9A 1BGXT 1GTZA 4R71A 3NHFA 2RFLA 5JSUA 1KXJA 1E1RA 3ZJVA 1N8NA 4U9UA 2W6ID 5LZ9A 1AZSC 1TJ3A 2QAGB 4NVRA 3HY3A 4II3A 1L1QA 1V5GA 1ZYUA 2DE0X 4R41A 1DCKA 4MJXA 3CX4A 4BZXA 4BFLA 4F72A 2R8XA 4MUBA 4LXQA 3EHDA 3MA0A 1BWQA 3W3AA 1ZHOA 4TYMA 3KOMA 3CR8A 4GUAA 4GOXA 2JJ1A 4D4KA 6Q21A 1Z6QA 4KMMA 3NHYA 1P2GA 1Y4ZA 3I64A 1KKMA 1YZ3A 2A94A 3B89A 1L7QA 4OXNA 4UE6A 4X90A 1QGAA 3UKJA 4ZO9A 10MHA 4FZRA 1K97A 3NPMA 1OJLA 3IDZA 1ZIYA 4CI9A 3QP9A 3KD2A 5AJWA 1KZHA 1Y6GA 1P29A 2HJVA 2P1DA 4GBED 4BPBA 1UDWA 4KR3A 1T36B 4C4OA 1E1MA 3IALA 4MV1A 5EE0A 4EPYA 4CQMD 4YAIA 2FPIB 2X0NA 2Z56A 3BF7A 1L8AA 2DUUA 1EVIA 2NVUA 4L6IA 4AKEA 2IHZA