3BRSA

Crystal structure of sugar transporter from clostridium phytofermentans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
276
structure length
271
Chain Sequence
QYYMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEEDYLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKEIKDAGIKLIVIDSGMKQDIADITVATDNIQAGIRIGAVTKNLVRKSGKIGVISFVKNSKTAMDREEGLKIGLSDDSNKIEAIYYCDSNYDKAYDGTVELLTKYPDISVMVGLNQYSATGAARAIKDMSLEAKVKLVCIDSSMEQEGIFEAMVVQKPFNIGYLGVEKALKLLKKEYVPKQLDSGCALITKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title Crystal structure of sugar transporter from Clostridium phytofermentans.
rcsb
source organism Clostridium phytofermentans
molecule tags Transport protein
total genus 100
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brsA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brsA02
2E4WA 3EQZA 1JYEA 1U04A 4MR9B 4EYKA 1BDHA 3A10A 4RK0A 4E7PA 3RH0A 3EDCA 4MS1A 2JVKA 2GX6A 1U2QA 2M98A 3K9CA 5DGCA 1D1QA 1C0EA 3Q7SA 2MYPA 5HKOA 1FSPA 4JA2A 5DTEA 3SQNA 3KYIB 4P98A 4F11A 3OQOA 1JHZA 3KHTA 1OXKB 2J48A 4NCBA 2R48A 2IPMA 1SD5A 3GRCA 4XASA 3EQ2A 1QPZA 4DADA 1JDNA 2VK2A 3E61A 4Z4CA 3LUDA 2HQOA 3EAFA 4S04A 4FB4A 2LBPA 2WWVD 2MSWA 4W5TA 4PEVA 2FN8A 5F64A 4Z4GA 3OO1A 4O5AA 1DJMA 5FBHA 3OM0A 1NATA 4N03A 1B00A 3O75A 4EGSA 4NICA 3O2JA 4Q7EA 4Z4FA 3CRNA 1MB0A 4WXEA 1PNRA 1DCMA 2HJ9A 3GYBA 5ABPA 1BDIA 5EWMB 1ABEA 4MLCA 4ML3A 4EYQA 4MR7A 4G86A 3IDOA 1JLKA 4YLEA 5GOTA 1W9HA 3DGEC 4L4UA 1ZVVA 4KREA 3CKMA 3KS9A 5B3JC 2WJWA 1M5UA 1VPWA 1M2EA 5IEJA 2JK1A 1A2OA 1PEAA 4KRFA 1JL3A 1KGSA 3L6UA 5TE9A 1NXTA 5TPWA 4KQ9A 3T95A 2FVYA 3BILA 3QX8A 4G0YA 4W5OA 3GBPA 2ID7A 4Q6WA 2YHAA 2RDMA 3CS3A 1ZN2A 3HS3A 1TJYA 1NXPA 2E4ZA 3URMA 3HXMA 2N9UA 5TPZD 4D6XA 1Z17A 3KG2A 5JS1A 2QW1A 5EWMA 3LUJA 1P2FA 1RNLA 3T6KA 1YMUA 4JOQA 5KQMA 3NNDA 4JAVC 1LJUA 2M1ZA 5HM6A 3O1IC 2PUGA 2FTKE 2HQRA 1BA2A 3JVDA 3QLUC 4FE4A 1ZGGA 2E4YA 4FE7A 1Z2DA 4F12A 1Z2EA 1QQBA 3MM4A 1ZH4A 2CHEA 2IDMA 5I4CA 2L17A 1GLGA 2CHFA 4YV7A 3BRQA 3NHZA 4H3HB 4IGAA 2X7XA 5JS2A 4KNYA 5JNRA 1APBA 4YR7A 3LUFA 1JFSA 2QXYA 3RVJA 2FN9A 4XFKA 2QV0A 1JDPA 4WXMA 5CNIA 4MAAA 5DLEA 4YP9A 3H6HA 4JP1A 3QLVA 3KJXA 3G1WA 3A3KA 1MAVA 5IEBA 5IX8A 4F3TA 2JVIA 3VNBA 1TMYA 1Z25A 4IRXA 1DCKA 5E3JA 3EODA 3MMNA 2FQWA 4CBVA 5HQJA 4RXUA 3OQNA 4RS3A 1U0SY 3M9WA 4HNQA 3FFXA 2PLNA 2XDYA 4RK4A 4TN5A 4N47A 5T7BA 5TPZA 3O2SB 3Q7TA 4Z0NA 1JF8A 3MA0A 3MF4A 4KFCA 3H5IA 2FMKA 3KKEA 3M6MD 2ZWMA 3FGZA 1USKA 1QP7A 1F4VA 1RZRA 3H1GA 4KMRA 2PUBA 1RXEA 4MQEA 3N0WA 1ZY2A 2GI4A 4LX8A 1VKRA 4YWHA 2WRZA 3HM9A 4H3KB 3Q41A 2DRIA 1U2PA 4RXMA 4ZPJA 4N0QA 1MIHA 1VLZA 4TLLB 3O74A 3IPAA 3L49A 4HNSA 4MR8B 1JBEA 3T8YA 1VRVA 1SXIA 3LUGA 4WUTA 1ISSA 2AYXA 2R4QA 3BBLA 3E3MA 4MYRA 4EY3A 1SXGA 1Z12A 2ZAYA 2JVJA 4MS4B 1J56A 1A04A 5KWSA 2QVGA 1MVOA 4KPYA 2I6FA 3SAJA 4MLDA 4LE2A 4W5QA 1YS6A 2PL1A 5D2CA 4ZJPA 1GCAA 4G0XA 1ZDMA 4XLTA 4RK1A 1GUDA 1L5ZA 3O21A 3R0JA 3GT7A 4MR8A 5TQ2B 4LE0A 5CNJA 2P4UA 3RVMA 4ETNA 3UKJA 4WWHA 3C97A 2E4UA 1IIBA 4MR9A 3CZ5A 5JNWA 5TQ0B 1DG9A 8ABPA 4LRQA 4MS4A 4RDCA 3DBIA 2GKGA 1CHNA 4LDZA 4Z4HA 4XXHA 4UHKA 3F73A 1L5YA 1EWTA 2VUHB 1LBIA 4W5NA 4MQFB 2WMYA 3FDFA 4ZYLA 3KYJB 4RKRA 2IOYA 3NNNA 1QO0A 3F7NA 3OQMA 5FWYB 1NXVA 3EJWA 5TQ2A 1USGA 5JNUA 5FBKA 2HPHA 2IPAB 4IMJB 1M5TA 1NXXA 3H5OA 1QMPA 3N6VA 4JB2A 4RKQA 4KK3A 4LE1A 4GNRA 4RXTA 3W9SA 4EYOA 5TQ0A 4KQCA 1DBQA 3I5AA 3HUTA 3N53A 4NCAA 4MRMB 1EHCA 2FQYA 2P9HA 1C4WA 1QKKA 1QNLA 2CWDA 3KLOA 3C6QA 4N41A 3N0XA 2F8TA 4H60A 3HJFA 2NUBA 4MQFA 4YCSA 3CG4A 3RVNA 3SG0A 3T38A 4IMIB 3BREA 3QELB 1YK0A 5FWYA 1QQAA 2LP4Y 3FFWA 2E4XA 2L19A 1URPA 2GWRA 2RJOA 2JCGA 5BR1A 3CHYA 5CNKA 6ABPA 2WJAA 3TB6A 2WY2D 3H1FA 5BQ3A 1EAYA 1E6LA 3O1JC 3RVPA 1TVMA 2L18A 1SXHA 3MQ4A 5DCLA 3HEBA 1QP4A 3ILHA 2WB4A 1TLFA 4PYRA 1Y1LA 4N0PA 5B3JA 2NT4A 3IP6A 3OM1A 1NY5A 4MRMA 2FXIA 4F06A 4B09A 5JNSA 3LFTA 1D5WA 2A9RA 2PUEA 2PKXA 1EWVA 1ZH2A 4ZMSA 4O1HA 3JS5A 1ABFA 3LUAA 1CYEA 2NZVG 3G85A 1DC8A 1FFWA 1ZESA 3H6GA 2MYUA 2A9OA 5IUJC 1TM2A 2QR3A 2HQBA 3HDGA 4QYMA 4UHJA 1Z26A 1E6MA 4O1IA 3KSMA 5BRJA 2QVCA 3TMYA 2FQXA 1S8NA 2FMIA 3OLWA 2QZJA 3GWGA 3SM9A 3QLUA 2FEPA 4Y9TA 1RPJA 3H1EA 3IP9A 3HZHA 1EFAA 1DBPA 4EVQA 4QPJC 1JYFA 5C5CA 4KVFA 3P9YA 2PUDA 4RV5A 4NQRA 4L85A 1XHFA 3HK2A 3Q9SA 1P8AA 4KK4A 5HSGA 4RZSA 1Z15A 4JASB 1ZAYA 2FMHA 3DZDA 3KLNA 3UK0A 2HSGA 3GL9A 1PNTA 3GV0A 4G0PA 1W25A 1YK1A 2R47A 3IP7A 1JFTA 4Z4IA 3CTPA 1HEYA 3LKBA 3Q15C 4RK5A 1ZGZA 4OLBA 3O1HB 2PJUA 4MPTA 1FFGA 2MYTA 4EVSA 1NTRA 5CNMA 5KC8A 2QU7A 4RSMA 2BGGA 4W5RA 9ABPA 4P1ZA 4EYGA 1D1PA 2FMFA 3JY6A 3QX9A 1GUBA 1CEYA 3M9XA 3CFYA 4OATA 4ZMRA 2PAFA 4QICA 5FWXB 2H0AA 2VYCA 4DN6A 3Q7RA 1YMVA 1ZITA 1BAPA 2Q5CA 1E6KA 4EVRA 1YIOA 3IPCA 1OXBB 1D4ZA 4G97A 1DRJA 1DP4A 3ROFA 3ROTA 2CD7A 2MSLA 3KCNA 3B2NA 3LOPA 3LUHA 4RWEA 2MYNA 4TLMB 4ETMA 5IULC 5T3YA 4Z9BA 5IC5A 3I09A 3HVRA 4N76A 1BDJA 3IP5A 4EUKA 3EULA 3OMXA 4JB0A 1DZ3A 1A0OA 1YS7A 5PNTA 5IUKC 2A9PA 4Z9AA 4QYWA 3K4HA 3RVRA 1FFSA 4PZ0A 3DLHA 2FLWA 5FWXA 1MB3A 1UDRA 3CG0A 2A9QA 4OG2A 2IPNA 4MR7B 3NBMA 3LUKA 1R8JA 4MGEA 1RXIA 3LKVA 2GBPA 2PMCA 2YHBA 4LDAA 2RGYA 1AB6A 1KMIY 3DGFC 3NHMA 4IILA 3D02A 3N75A 4KZKA 4XARA 3RVSA 1KRXA 3QLTA 3CLKA 2W42A 2B4AA 1WETA 1USIA 1Z18A 2E4VA 5TPWB 2LIVA 3LTEA 1NXSA 1P6QA 4E7OA 2JRLA 1Z13A 3RVOA 2PE5A 3KTOA 1GCGA 1ISRA 3OO0A 3QEKA 5KQLA 4RY0A 3NNSA 1PUXA 3JPWA 4YRZA 2ID9A 2TMYA 1M2FA 4LZLA 1YTUA 1Z16A 2IKSA 2B1JA 4DQDA 2OENG 3N0RA 4WZZA 3A0RB 3CNBA 2PUFA 1SRRA 3H75A 4OLAA 1DC7A 1U8TA 3HO1A 4D74A 1JX6A 4F8JA 3LUCA 4PE5B 3HSYA 2JBAB 2V0NA 3F6CA 3TX6A 1DBWA 3I45A 1F51E 3RQIA 3JVIA 2OQRA 3QLVC 3C3MA 2AYZA 3F6PA 3JTEA 3GBVA 1LBHA 1JFVA 4TMYA 1D2AA 2FW0A 3QELA 4MS3B 2H3HA 1EWKA 4G0MA 2O20A 5KI6A 2PL9A 7ABPA 1ZHHA 3BRSA 1RZRD 3HDVA 1LJLA 1AB5A 2VUIB 4RY9A 4D6YA 2PUCA 1T34A 4PICA 4Z99A 1PEYA 1NXOA 3A0UA 3H5WA 3ILYA 4HNRA 4M88A 1PHRA 3N8IA 4G0ZA 4RK7A 3HUUA 5IUNC 4YGXB 4WT7A 3D8UA 1JH9A 1E2BA 1H9CA 1NXWA 3RVQA 2JBAA 3C3WA 4RY8A 3FFTA 4GPAA 3VNAA 2LUOA 3I42A 3TO5A 3MIZA 4OBBA 5ED4A 3H5VA 3H5LA 1DRKA 3EGCA 2FKAA 5JNVA 2F8SA 4MS3A 4S05A 2MSKA 2IPLA 3MYYA 4KV7A 3S99A 3GA5A 4MQEB 5KQGA 5C5EA 2FSPA 2KYRA 6CHYA 1K66A 1K68A 2NT3A 3HV2A 2LPMA 4G0OA 2QSJA 1YVUA 3LMKA 1LK0A 1FQWA 4NV3A 2JB9A 3SNKA 1XHEA 5GQSA 1XWWA 3OLVA 2FEWB 3QEMB 4Q6BA 5EWJB 4RK6A 3C3KA 5KQPA 5JNTA 3OLYA 2R25B 5EWLB 2NZUG 4OTZA 1KRWA 1QP0A 4Z4EA 2PUAA 2FEKA 5IBQA 5BRAA 3H5TA 3JPYA 5DKFA 4G0QA 3OLXA 4ETIA 3UUGA 5KC9A 1P6UA 2FLKA 3TD9A 4XAQA 1I3CA 4MS1B 3RVKA 3CZCA 3OLZA 3RVLA 3DLBA 3HCWA 5CHYA 1JWLA 3QK7A 4YS6A 1QO0D 2L2QA 3CU5A 2IYNA 2RJNA 3QEMA 4HYEA 4RU1A 5EWJA 3FMVA 1DCFA 3SY8A 5EWLA 4IF4A 3OMWA 3O2QB 1BVHA 4YO7A 5TQJA
chains in the Genus database with same CATH superfamily
2X6QA 3IURA 4WUVA 4A03A 1HE4A 4H6PA 3OWXA 1J22A 3O90A 2WA2A 3ZD7A 1SY7A 1D2RA 4GGPA 1XZJA 4J0HA 5EJEA 2IEBA 5LMZA 3O95A 3WIDA 5IS2A 1XTJA 4JUDX 4M9SA 2WHYA 3A1WA 5HFJA 3IUEA 1U6IA 1LB1B 4IX9A 3ZNQA 2HD4A 1XZIA 3CLUC 1W76A 2Q8NA 3IQIX 4M0KA 1OKKA 1ZCBA 2P0AA 4MA4A 4D1YA 3IIMA 1JHZA 2J4DA 2DX7A 1FMTA 2I03A 5EKXA 1C9MA 2VK2A 1ZI6A 2WNHA 2O4UX 3FDXA 3LGAA 1XU7A 5T5QA 1D0IA 2JGIA 4TMZA 5E6UA 1E2UA 2O0LA 1D8TA 2LBPA 3A6LA 3COSA 4J1QA 1VJTA 4RD0A 2G36A 5EC8A 1KIMA 3HPRA 1VIVA 2ZVQX 1SCNE 3FLBA 1HC7A 4Z4QA 3OM0A 3WGIA 4LYJA 5EMNA 2XZOA 1KI6B 2W6JA 3F5DA 2YIJA 1E2DA 2R6HA 3IUMA 3GVCA 1DG3A 2PHZA 2ZSJA 3LT1A 2BFMA 3Q72A 2EARA 5A4AA 4KR3A 1TO1E 2P6NA 1CJBA 1WXWA 4UDOA 1E2NA 2Q5QA 5L7TA 3FUXA 1I4WA 4JYPA 1UFVA 2FCRA 3ZJ4A 1O5OA 5JHHB 3CKMA 1G5QA 2IF2A 1FZQA 2WJWA 2V5VA 3MINB 2PMBA 3NRBA 1PVOA 4RKEA 1CEXA 1N3IA 1GUFA 1IEXA 4ROSA 1KGSA 2G5TA 4CV2A 1OGIA 4ZIRB 5M04A 3WWCA 1F2TA 5ILOA 2VLBA 5DXJA 3BILA 4L57A 1WXGA 3N2IA 4Q6WA 1HGXA 1F7VA 2YYYA 5CDUA 4RVOA 5MFPA 5FLXA 3LNCA 1XMPA 5A9SA 1YE3A 1TRHA 3JARB 5CCBA 1IXYA 2JHPA 1XDDA 1DTEA 2N9UA 1H2YA 2J0SA 2WUGA 4JYMA 3WADA 3DYIA 4EX6A 2B61A 1G8HA 1RNLA 4TRJA 3PXDA 1NNSA 5LBTA 1O94C 1VYUA 3UAGA 4FMDF 3IEXA 4YAGA 3LCUA 3LP8A 4PO9A 4C88A 1NW5A 3GLFA 5LQSA 1INLA 3GJRA 4C0BA 2I9PA 2YXBA 2E4YA 2POCA 3QNWA 1W75A 4AG5A 3G79A 1SCIA 5CBPA 2WZQA 4HQKA 3EZNA 2PWZA 4LY0A 4K9PA 5KNBA 3P9XA 3P1JA 4BO7A 4ZT4A 2G0TA 4UDNA 1GT6A 2ZDHA 4IDOA 3AYZB 5JNRA 1CNEA 5T64A 3DBLA 1WJGA 3ER6A 3KSBC 2CHQA 2FN9A 2TRSB 2R6ZA 3MOSA 3G2JA 4FOLA 1ZI8A 3MMZA 1ODTC 1R4NA 2XYGA 4J2OA 4M53A 3DD1A 4MAAA 5BYJA 1Y8CA 3EXFB 4BCBA 3DZIA 1TM3E 1XALA 3DMTC 2VQFB 3LHKA 2W8ZA 4RJ2A 4DSOA 1GGHA 5DASA 1VKNA 4R2IA 2WQ6A 5EIHA 1AS2A 1WF6A 3QX7A 1UZMA 3MNFA 5LXTA 2D1QA 3W3ZB 1YHZA 1SOVA 2WFAA 1EFPB 1U9IA 2XYRA 4A0SA 3U3OA 3OCUA 4CUJA 1L4MA 1COWA 1M1XB 3EZXA 3S2ZA 4JJ7A 3TOXA 1QRUA 5DTMA 3JWJA 2ZUFA 2VJMB 1BD3A 2FDXA 5IH3A 5HZMA 3EIOA 1PQPA 2WWGA 1YDHA 1U65A 1LF0A 2PO7A 4E3ZA 1DKMA 1MO3A 1FYEA 1C14A 2B6HA 4OGGA 3H1GA 1KDVA 1SG6A 1G21B 3LP5A 1KZ6A 1OQAA 1J7JA 1UK8A 1VKRA 1XRJA 4BLVA 3WK6A 1L4YA 3BWDD 1VFPA 1ZOOA 1XDBA 2ZR0A 4KAFA 3H0EA 1GKIA 3QU4A 2RGRA 2V7XA 4I6EA 2R8PA 3MVEA 1GQQA 1N2IA 5AKXA 4QGBA 3K6JA 5FJJA 3RBXA 3MBOA 3SS7X 3CINA 5TEVA 4GG1A 3VR4D 2BE9A 4MJLA 5KO2A 4IIJB 4A4DA 5L7WA 3J81A 1AS0A 2R4QA 1HQYE 2FWIA 3NIDB 1YL7A 1LLUA 1R4AA 4I36A 3RM3A 1EM6A 3IR7A 5DNWA 5D3MA 1FW6A 4Q7LA 1PE0A 1VE3A 3OPYI 2BKEA 2ZAGA 4EGQA 1IQUA 3IKMB 1T1GA 1RE1A 4L9SA 1H2WA 1M2HA 1ZXLA 4O8CA 5IK2A 4J16C 3DJYA 4TQGA 3E2IA 3UMVA 1AZWA 1TYCA 2BAGA 1U2SA 3FRIA 2XUKA 3PXEA 3TPFA 5BN3B 1GPBA 4RK1A 5KS2A 1Z7EA 3CVUA 5KMGA 1IN8A 2WWWA 3EFOA 3OJCA 4OEHA 1J8QA 2ONJA 3OAAA 4LE0A 3WR5A 5DEIA 1JJAA 2E18A 3WOHA 4B6RA 5I47A 2YTZA 1M1ZA 1O4WA 1OFHA 3DV9A 1Y7IA 2O2HA 2YNMC 3C3YA 3LHFA 4Y9SA 1E5QA 3KQUA 1Q1BA 2IIQA 3CZ5A 3ITNA 3LPCA 4M98A 3Q3IA 4K8RB 4MS4A 2D4AA 1PW5A 2VHCA 4OO3A 5C7YA 1KY5A 2H4HA 1ITZA 2Q27A 4HDAA 5BR4A 1L5YA 2PMDA 1RJDA 2PUWA 3AMVA 2YIDA 3L6RA 4WCFA 4BFZA 1S6YA 5IAJA 3GN1A 5ALMA 4DIBA 2XLBA 5J4HA 1A71A 3K1TA 2QL9A 5KIAA 3T1YB 2BV3A 4QSMA 2HLHA 1I6KA 1Z2OX 2NSHA 4EHHA 5K3DA 3N2GB 4GI1A 4H31A 3HP7A 2ZSEA 2NTNA 4DMCA 4RABA 4FQ7A 1NN5A 2BC9A 3SC6A 1TCUA 1VSTA 3DCIA 3S1LA 1IQ0A 5EZSA 3PX2A 1A77A 2QLTA 1RLMA 4ZK2A 4ZT6A 4R9UC 3N6VA 4ETMA 1KAHA 2GPNA 3CVXA 2QL6A 4LXHA 3ZHSA 1NUTA 2I67A 1E1MA 3R20A 4OHZA 4M9QA 5AVXA 4JP2A 5DN9A 1TJ3A 3K1ZA 3IA7A 3OIFA 3HUTA 4G8DA 4QVKA 1E59A 1GDHA 1QB7A 2FQYA 4HR7A 1KAEA 2X19A 1PJZA 3CW9A 2P6PA 1J9EA 1EB8A 3QENA 4OREX 3HJFA 4IIBA 5AW1A 5HWSA 3NI2A 3FB4A 4H0FA 4AMUA 2O8CB 3U4QB 3O8OA 4C2UA 3QELB 5CX1B 4N5LA 3QU5A 4RPLA 1DAOA 1VG9B 4QUDA 3CSSA 4UMVA 4V1CI 3W06A 4DMHA 2DFTA 1JKIA 3BWCA 2VDLB 5C5DA 2OC4A 5LNK6 1NQTA 1XPOA 1GRQA 1QGZA 2W0SA 4L8FA 3Q7EA 2JLYA 4PS1A 1D5CA 3ROGA 2HXGA 2WB4A 1ZH6A 3KJHA 5DNEA 2A3NA 3CVYA 5J47A 1EVEA 3L7LA 5I7FA 4F06A 1UXJA 3ZGOA 3NBYC 3W79A 4O63O 2PKWA 4E4TA 1C0IA 2G82A 3KU1A 1JFFA 3JARA 4JP8A 1VE9A 2RGXA 3CLTD 4ME6A 3RTBA 3ZV7A 3FSGD 3FSJX 5B64A 1KEZA 4Y6LA 2BFEB 4N40A 3NJ8A 1FLNA 1TTPB 1Q74A 2VQ6A 5FA5A 3EIHA 1Q15A 1W581 2JFXA 3AEUB 1AZSC 3GNSA 4WKPA 4DSNA 3G9XA 5DGTA 4ZCSA 1XELA 1TKRA 1R10A 5U1PA 1YF3A 4LG1A 3VGPA 2WPDA 2P2GA 1LXCA 5ALFA 2H9AA 4YECA 1ADYA 3SYTA 1RMTA 3MT0A 2BONA 4H6VA 3GFTA 2HLPA 4R1QA 1P62B 2IHVA 6NULA 3CLHA 4AT1A 4WEOA 1AG9A 2WQZA 3QFRA 3FYHA 4LSGA 4P3NA 1YCDA 4XQ0A 3F67A 3IUYA 2X0NA 2WW8A 4WCVA 1K5DA 3OZUA 4QPJC 1W4BA 2VYVA 4FIZA 4F7DA 1U9JA 2QRUA 3UV3A 4UVHA 4DG5A 3IAM1 1FUEA 1JHYA 2OGWA 2ZYDA 5D1HA 2VDUE 1W5AA 4P7KA 4BFVA 3AILA 1EEHA 3KUKA 1CUDA 2Z5LA 4KOEC 2CVFA 3C5CA 2OECA 3TGWA 1OI7A 1P1RA 1T9GR 1UUFA 3N5CA 4DWWA 4HB3A 3MG9A 4IQGA 4G0PA 4M86A 3IP7A 3IAXA 2DM6A 3NFRA 1CZHA 3CX8A 5FAXA 1Z4MA 3CTPA 2SECE 4TV8F 3GQBB 3W5VA 4ALIA 3LBNA 5IU6A 4FFNA 1GG2A 3F49S 5DVZA 5KOYA 1DHRA 1V1MA 2PRIA 3BD7A 4DR4B 1UJ2A 4RSMA 4EECA 4F4IA 2A9VA 3KFVA 5IJWA 2YDYA 4IWNA 5C8YA 1X14A 4BS9A 2OBFA 4P38A 1KK3A 2WIKA 3CFYA 3Q5DA 2PAFA 4G5OA 4AB1A 3OQIB 3D7NA 3TL3A 4DN6A 2XWQA 1C29B 2UVDA 2XUZA 2ZXEA 3N2KB 5EGNA 5A4FS 3OZDA 5CA1B 1NZDA 4CFSA 3AFIA 1JR2A 1THGA 2ZATA 4HRAA 4XR4A 1F6DA 4FJ0A 3TI9A 1NSFA 5I9BA 1KJWA 2VKQA 4GECA 3B60A 1Z38A 3O93A 4YUZA 4BNLA 2Y9MB 3AIOA 5ELMA 5AM3A 1H93A 5IC5A 4BQEA 2QUJA 3P94A 1LA2A 1OIXA 1G17A 4UU7A 4QQKA 3AKEA 3OMXA 2WYHA 2H1OA 2D5AA 3I34X 3KLBA 4LY6A 3OFJA 2EG9A 3C6YA 3DAOA 4HXFB 4Z7JA 1Y8QB 1ZUD1 2Q46A 5FTLA 3QM1A 3L07A 3UTDA 4QDZA 4NK5A 3LLSA 3VVMA 1L7PA 4MVYA 5SY4A 4W9MC 4QTTB 2CVZA 5EUBA 4OMDA 1BXGA 6PFKA 1GAJA 2R8YA 3A70A 3R7SA 4HDSB 3GOQA 1SZPA 2D2FA 1YCHA 2E0IA 2DUJA 3QLTA 2D3TA 2VPZA 3L1HA 4NABA 1MAAA 1POWA 1ZGCA 4PXYA 2E4VA 2ODWA 3H4IA 1KDYA 3WGJA 1PGOA 3OFVA 4DDVA 1KJJA 3K35A 1VL6A 4X8MA 4AS1A 4INOA 3QE2A 2P6RA 3RIEA 1NMSA 1VZ3A 4ZCPA 1HORA 3HDJA 2HQ1A 2Q49A 3V80A 3DE0X 4LDNA 3SJZA 2WNIA 1PUXA 4KH1A 3VAYA 3PPXA 4WMLA 4BP8A 4JMLA 1U0BB 2BEUB 4X41A 3Q8WA 4WZBA 2HC9A 4LZLA 2MTBA 2Y2UA 3K4PA 1GN8A 3Q3VA 2A14A 2O48X 3P2YA 4HZIA 3AI3A 4FYHA 4DC9A 1HNWB 1NVTA 2QAGB 4CDMA 2PUFA 1VE7A 4R5HA 1SRRA 1IVNA 2QRVB 4L50A 5ESRA 1DIOB 1U0FA 4MEJA 1E9FA 2YYZA 3FI0A 2WZDA 3G2HA 4EG8A 2Z3VA 3HUDA 2Q29A 4RPCA 1J8VA 1XZLA 2JHAA 2BMFA 3HSYA 4RE6A 5T4EA 4AJ1A 1X3SA 5FO1A 1ZD9A 2Q5EA 3KWFA 3E5HA 1R4MA 2OQRA 1A3CA 3NWOA 5EE1A 3WI7A 3U40A 3U26A 3MMSA 4D5EA 1F8FA 3MGAA 2JFOA 1YB5A 1O89A 2O8CA 4F71A 4B33A 3QELA 3N2NA 1W4AA 4MV8A 1FC0A 5JT1A 5DNCA 4JH0A 1G6OA 1M1NA 1IUKA 3KVRA 3L93A 2VWQA 4I4TB 5AXDA 4YUXA 2IYVA 4M1TA 5BWLA 1BIFA 5JECA 1OZ0A 1THMA 1WVIA 3MAGA 3KC2A 1RKUA 3U0VA 2E82A 4YV1A 1YJAA 3T0GA 1OVGA 2PZJA 5EYPA 4U3JA 4O4LB 3DEAA 3SZLA 2ZAMA 5A4MS 4O0MA 2H7CA 1SQ5A 3LQYA 2COEA 2A67A 4FGJA 3IUNA 4TT8A 2WKRA 2R6GA 1SEVA 1X7DA 2VT3A 4N6NA 1Q12A 2VZ0A 2WYIA 2P6OA 4L78A 4XLZA 4JCOA 3AZQA 5E9AA 5F5NA 4J3FA 3VHXA 2QE7D 3NDRA 5K0LA 2F7SA 3ESCA 3QYJA 4N01A 5FO0A 2F90A 4CG3A 2MSKA 4W9NC 3VO1A 1UDAA 3RCBA 5BSVA 2WE7A 2FSPA 3AEUA 1SU8A 2AJTA 2ZWAA 4AG6A 2VP4A 9MHTA 1N92A 4FC6A 4IKEA 3SNKA 1R9NA 4EFLA 3HN7A 4TKVB 5JAIA 1E2LA 2V0GA 1TU3A 2OHGA 3FNQA 4Q4JA 3ZE6A 3TTWA 3I76A 3U4DA 3DDUA 1ZM2A 2OVBA 4IIJF 2II6A 4H59A 3ZXYA 3RRFA 3CSDA 4ALLA 1NR7A 2G8LA 2ZVDA 4C4SA 2VSOA 1WG8A 2A8YA 2DH6A 2GEDA 2ZBDA 2QJFA 1BQ4A 2HH9A 3AJ8A 4X7BA 5KEIA 1Y3CE 4IYRA 5I48A 5K0ZA 5KC9A 5ALJA 2AMLA 1F8YA 3Q3HA 5JJ5A 3PEYA 4HCJA 3TFOA 2NX2A 5D3KA 1R0BA 1ZIYA 2Q3FA 4YMGA 2Z4TA 2OZKA 4NS1A 4PRZA 2OBBA 1ZD8A 3E7FA 3TRKA 3K05A 3FZQA 4R51A 2ZRJA 1XZBA 2J5QA 2RGDA 3ULKA 4H7EA 4EFKA 1FDOA 2YJ6A 4E5VA 5A0VA 2XX3A 2XMSA 3MELA 4RIGA 3ADPA 3AT1A 5FBRB 2QVLA 3T7DA 3OPQA 5IBPA 4PAOA 3MUEA 3V4SA 4MGZR 3AYXB 1BVHA 3OPYB 1L7MA 1K5GA 1MQ9A 2HN9A 2UZ0A 1U8ZA 1YS2X 4PFJA 3VI3B 3SDSA 2YW2A 4EUEA 1PDWA 4BNGA 4S1PA 5ECGC 4B35A 4OX9B 1VKZA 3FUWA 1GNSA 4HNAB 3FJ1A 1BC5A 3ZY2A 5K0CA 1MABB 5CLIA 1YQTA 4XDHA 5KVVA 2IYWA 1SUPA 4CZ2A 1JZQA 4B4UA 1AM4D 4B80A 5K4GA 1KYTA 1U2ZA 1W85A 1G66A 3ACCA 3FETA 2WEKA 4P98A 3NASA 2Z1MA 3PE4A 3REGA 4F6LA 1W0KA 1NBEA 4YR9A 1SG0A 3EE6A 2OCIA 1FL9A 3GLUA 3I9OA 3EGDA 1D6MA 3DPIA 5CA1A 3MJRA 4FMBB 4YBZA 4AUKA 4EY8A 2WHPA 1O95D 1CUUA 3ZV6A 3AHJA 3LYLA 4DYDA 2HU2A 1FFBA 3L05A 2DPLA 3HDTA 4LBYA 2SCUB 4ZEWA 2CLHB 2QRKA 4PX9A 1QLWA 1ACMA 1RXSA 3BQMB 2JI6A 3P5SA 3B8HA 4HO1X 4N9WA 4YMWA 4H7DA 3WNBA 2N3ZA 1D4OA 4C7OB 4LYDA 4MVJP 2XMZA 1Y8ZA 5DM0A 3VPCA 3VVLA 5EY5B 3TL6A 4FLEA 4U8GA 4C2BA 1BFKA 4HRVA 5A03A 1QKIA 1GZUA 2OZVA 3KQMA 5EWMB 2DETA 1Z0SA 3RLIA 1H5NA 1SQ0A 4F93B 3IDOA 4DFDA 2G0NA 2ZWIA 1AUPA 4ZHQA 3AB8A 3ZDFA 6YASA 1K6EA 4DB4A 1I1QB 1NYRA 1V7PC 2H00A 4HDSA 3GJ4A 1JBQA 3ELUA 4AFNA 2WZBA 4R54A 1JL3A 2G5PA 5AI4A 4BBZA 4MK4A 1XDGA 2PKEA 2WD9A 2DP4E 4YP5A 1PS9A 1EKXA 1T29A 5T57A 5LLTA 3OTQA 3GAMA 2VTKA 2FW1A 1BMFD 1JTEA 3L1UA 3Q4GA 3ORSA 4V1CB 1KORA 1IM2A 3EUAA 3F98A 1NXPA 4WESB 5GVRA 3SFTA 1TDJA 4CMEA 1KFCB 4ESOA 5C8DA 3E48A 1NVBA 3PDUA 5KNLA 2G71A 1P2FA 2OE2A 2XYHA 1Z8DA 1GQ2A 4M1YA 3FTCA 2FOIA 3L0PA 4BNVA 4CM6A 4UD6A 3HJTA 4JBIA 1TT5A 3BQ9A 3MPUA 5BNTA 2R6AA 3O1IC 1M0EA 2QRVA 3QLUC 5JSUA 1GNVA 1RHMA 4QJ3A 1X0VA 1QQBA 2YXNA 1KMMA 4MQ6A 1C9JA 1ESZA 4XWWA 2AFIE 5EJAA 3ZHRA 1QE3A 2OGUA 4HEQA 1A5AB 4UARA 2HIHA 4JUCA 1CY8A 3VHQA 3UB4A 3REQB 5DSZA 3ICEA 4DJEC 1JLLB 2UZIR 3ZJTA 4COOA 5KOJA 4R2JA 2A5GA 2C57A 2QXUA 4ZYVA 2BFCA 4RTOA 3NB0A 1DAEA 2XW6A 3O4VA 3PC7A 1AT1A 1C3OA 4JBNA 2NUAB 3SX0A 5C9ZA 1OILA 2WM2A 5DLEA 1EUDA 3MRSA 2HJGA 3M4ZA 2EATA 2NNWB 3OG9A 3QLVA 3WXBA 1T2UA 2A1TR 3EIFA 2VPPA 1VMEA 3U49A 2CFRA 2LZ0A 3R44A 4NIMA 5GJVC 4BGVA 3GC6A 3RTAA 2I5PO 3M81A 3P7MA 1M75A 3ZK8A 2C29D 2NO9A 3MMNA 2C5BA 3PKJA 5ENZA 1MJNA 1MGPA 1ZMRA 2WG2A 1WTAA 4CBVA 7REQA 3T3EA 1B3RA 1BS2A 2XCLA 5E0KB 5JRDS 1OFVA 4UHBA 1ILEA 4HD8A 1NKSA 4IJUA 3U9SA 4BQIA 1MCZA 1XA0A 2BGTA 5CT8A 5CB6A 2I1LA 4EW2A 1T4DA 3AF3A 1ZJWA 3FH0A 1AD2A 1ATIA 1E5TA 2PUBA 1CVLA 3GRPA 3WRYA 1I2ZA 3NDJA 4MUGA 3IVGA 3OE7A 2F1IA 1C8LA 4PHHA 5BUQA 3E7XA 1GILA 1EU1A 3BE6A 3BE5A 1NW4A 2CGEA 3R5SA 3ETDA 3LI2A 3U48A 3C24A 5TRTA 4U0JA 5EXEA 5F7XA 1Z8HA 3BMQB 4TLLB 1KP9A 1H5UA 2Q3BA 4J0EA 4LWOA 3WBBA 4AICA 3O3NB 1KJ8A 2NU9A 4CM3A 3DQQA 3ZCTA 4YAEA 2D8MA 3DTVA 1PR2A 2QPLA 1KR5A 2G67A 4QG3A 4C7XA 2Q3EA 4H08A 4MYRA 2W6NA 4PZ9A 4EY3A 1Z12A 2OXCA 4UUPA 3JSXA 2YRFA 4D26A 3W2EA 3V2GA 3VTAA 2CNDA 1FNMA 1SK8A 2J4FA 4B45A 2BKVA 1UZLA 3NC0C 1RJFA 2VA8A 3G1UA 4L22A 2QBYA 1R2QA 3FSRA 3IDQA 4DSAA 3MJ4A 3WK8A 4RDXA 2PLFA 4TSFD 1Z29A 3V6MA 1NJ6A 4DLTA 1FE8A 1WKBA 3FWNA 3W1WA 2EGGA 3BZWA 3MCVA 3SS8A 4UTRA 1JEDA 4IG4A 3USES 2OSVA 5AW6A 3F5QA 1LRLA 1MX5A 4E94A 3L4JA 1RHUA 1YUBA 3F4KA 1BYUA 4RWZA 1Q7GA 2P4UA 3IAAA 5HQTA 1IOWA 3W5UA 4AQDA 4O3FA 3PUHA 2H5IA 3DV0B 2W70A 3U3MA 3CNHA 3T5PA 2B83A 2RAPA 3DBIA 3EZGA 1NXQA 2WM3A 1FU8A 4JUBA 5IJAA 1AGNA 1PBTA 1WZUA 1EWTA 1CZRA 2NU7A 2LTAA 4QUHA 4GI5A 3DVLA 3NTXA 3GJ7A 5G0UA 1PRYA 3T9CA 1L7RA 5LBIA 5MGNA 7MHTA 5EIWA 1QVVA 3KKQA 3I9MA 3G5TA 4G6ZA 4AL4A 2F43A 2I4TA 3VGJA 1HLGA 4CIBA 2XQIA 1IPEA 1X1EA 4IQ0A 5JNUA 2C3PA 3DBVO 1JIUA 3FCUB 2OCPA 2BKLA 2ETXA 3HVJA 4G84A 4JL5A 5BNIA 4EA6A 1M5TA 1N1MA 2PLWA 2PXCA 1NE7A 2HI0A 2YYSA 2GH1A 4JB2A 4V0SA 2CLKB 4EYOA 4ZJUA 3W2HA 1OCEA 4NFYA 2H85A 3UEOA 1UAAA 3ZVNA 4NECA 5H81A 1UC8A 3OLCX 1HRKA 1QANA 4E08A 1VHWA 3T38A 2PN1A 3VKWA 3SC4A 1UEXC 3DOJA 5FUMA 3JQFC 3LGSA 4M46A 2RGUA 4EARA 5GZ1A 3AK4A 4I4TF 1CQJB 1CZUA 3DFFA 3RR2A 3PEWA 5AICA 1GXSA 1XZAA 5H1YA 2JLSA 4AMGA 2WV9A 1HUQA 1WOYA 2ZK7A 3MJCA 3Q87B 4Q4HB 3BTVA 1UKAA 1LPPA 2QYOA 3JQGB 3PIDA 1MG0A 3GI1A 1QP4A 3QUBA 4PYRA 2C4KA 1E2PA 2I6GA 4O4LF 2MSNA 1E6EA 4BGEA 2VI5A 1O6GA 1WZ2A 4CTJA 5ICMA 4QQFA 4Y3UA 3C7DB 5EHQA 1Z68A 4DG9A 3TKAA 5DI3B 2FUCA 1SC1A 3BK2A 3AOEA 1I4LD 4DPKA 3N59A 2VRCA 2H18A 3G85A 1DC8A 3P0JA 1FFWA 4B47A 3R9KA 1Z4IA 2CVOA 4Y9UA 2CC2A 5TMPA 1VCMA 1Y9JA 3M6IA 2E48A 4B7AA 5FNZA 1SIBE 1UWCA 3SE0A 4C6TB 1GVNB 3OSUA 4F5WA 2AXPA 4D9GA 5SZHB 4NJEB 4KLNA 4BXOB 1J39A 1JRLA 2XHZA 3Q5EA 3ZU3A 4BX0A 2WYWA 5HRUA 3KKMA 4IDAA 4AMZA 1E5LA 1GGJA 1V37A 5FBZA 4EG0A 2Z3WA 2JIRA 3HKDB 4G36A 3HZHA 4GZ5A 3DOCA 4EKGA 4M55A 4JC8A 2QR2A 3D6AA 4OV6B 2PUDA 2NVUA 4BFTA 5K0TA 4GT1A 1HSZA 2ZCJA 1PJAA 2O2SA 1P8AA 3FCAA 2C1EA 4KK4A 4L8YA 4OP2A 4MQLA 3RSHA 1QTNA 4JASB 3PTZA 4GXTA 4DF3A 1HTBA 1CY0A 2FSFA 1G5PA 3T1OA 2RBKA 3ZJYA 3FCSB 4EL0A 2B5OA 1PNTA 4MYHA 4BFWA 3WL6A 1U3VA 2WVHA 1D0VA 3GFQA 3AUTA 2VDPB 3K8OE 5JSZA 1GKUB 2HHLA 1A8QA 1KK0A 2XD9A 3FVWA 4FLFA 2YS7A 5IDWA 4HMQA 1KYXA 3CH5A 4HDQB 2CV2A 2WOJA 1UINA 1LJ8A 3CTMA 2O7NA 3EIQA 3LHSA 4AS3A 3MTAA 4UTZA 5UKDA 2PR7A 3CW2A 2FMFA 3ZJVA 3CCCA 3I92A 3KYCA 5HBRA 4KNWA 4ZMRA 3ONWA 3NKFA 2EHJA 3RRMA 1A7JA 5FWXB 1KYYA 3NORA 1Q83A 1E63A 5FPSA 3Q7RA 1HYGA 1JEQA 1YMVA 2V03A 5AVTA 3Q5GA 4EGFA 1QFXA 2E85A 2P7HA 3BMQA 1Z8NA 1K8RA 3F9IA 4P81A 3L0ZA 4I46A 2BBOA 1H42A 3RFVA 4Q05A 3DVRX 1T0IA 4M0LA 4PG8A 2MSLA 2TMDA 3LOPA 3B2NA 3H87A 1NMQA 2FR1A 4G1MB 4XYEA 4CIWA 5EJ6A 3ZXXA 4EFNA 1NBIA 2WKSA 2YHSA 2GUWA 1TECE 2VP9A 2OCDA 3EMVA 3KT0A 4GNKA 4H7JA 1S0UA 3ZC3A 1NIJA 3QFSA 5JYCA 3KQVA 3FZYA 3STUA 4ZEXA 1Q1ZA 1YS7A 4UUBA 4Q9NA 4QGAA 1QPBA 3B1ZA 3RVRA 5IJ0B 3FMIA 1YS4A 3BSFA 1CS0B 3C1AA 4CIXA 4FYMA 1B0ZA 2MCFA 1RAEA 4Q3AA 3CKYA 1Q1GA 1QH8B 3KFXA 2YWRA 4JYCA 1IONA 1KDZA 1XJQA 1R8JA 1CT9A 1UR5A 3BS4A 4JBHA 3KQOA 3U4HA 4ZN6A 3KYDA 2H29A 4IILA 3BDIA 3GMDA 4XARA 2XITA 5C4MA 4P31A 4DVGA 5HZKA 3D8HA 3F74A 4IQ8A 3J80A 1V3QE 3GGOA 2J87A 5AJHA 1FLAA 2D5LA 3GDHA 1NXSA 2HRCA 4QNNA 2IPXA 4J9UE 1P6QA 3D4PA 2WWRA 1EFRD 4RLHA 2N1BA 3KVYA 1SBQA 2PQ2A 3GUVA 4K3UA 4LXQA 2JFVA 4LPKA 5AVUA 2DQ4A 2H54A 4F3YA 2P30A 1A9XA 3MWFA 3BEOA 4IIYA 4L3VA 4CCWA 4TGLA 4MQ5A 4L16A 2ZEJA 4FFVA 3QVLA 2CJFA 1JAZA 3E27A 3FJYA 3L43A 4OA8A 4OM7A 4YN3A 1P29A 3CKLA 5A7GA 4DIMA 4YAOA 1QHSA 1U3WA 2ZSDA 5IAEA 4WW0A 2ZIGA 4G4SO 3WLIA 5IVHA 3TDNA 2ZW9A 2BBTA 3R7WB 2AOXA 3DTYA 3ELYA 1I9CA 4LRYA 5T4FA 1CUFA 1DINA 1NBHA 1UMBB 2W5UA 4IUYA 3HBMA 4CTMA 4F8JA 3BIWA 3LUCA 3ZPXA 3HP4A 5J4KA 3F6CA 4UBLA 3I45A 3OT1B 4KH0A 4L5CA 4PFQA 3ZBTA 3RKSA 1QXSA 3U44B 3JTEA 4P35A 1ZONA 3GBVA 4HDKA 3IEKA 4JQCA 1RYDA 4QGHA 4DM7A 2Z5GA 1T2DA 3CUWA 2ZJ8A 4WNAA 4EKYA 2QX8A 1PL0A 1I5RA 2ZI9A 3OJOA 4BDSA 5JD5A 4ZVTA 3SU8A 5HDQA 1JH8A 4M1QA 3PICA 1EQ2A 1YZYA 4YCBA 4JI0B 2HJHA 1YVPA 4TKLA 4E33A 1DCTA 4KG7A 3G5LA 3NH9A 5CLQA 3FCCA 3ODPA 3AESA 4JDPA 2RH5A 3H5WA 4MOWA 5JXJA 3L1KA 2C7RA 1RP7A 4H27A 3A6ZA 2B69A 3QF4A 1RWVA 3RS5A 1VSVA 2IQ5A 3R5HA 1XZ8A 2PD4A 1PWYE 2GKOA 3RPEA 4EBBA 4XZ3A 3PQDA 3UYLA 2PZKA 5C8ZA 1U02A 4WFJA 2ZT7A 5KZMB 3O8BA 1Z35A 3LX4A 5FPTA 1VLHA 2IY8A 1EA7A 3HBAA 2Q0HA 3BMXA 3BC1A 5BO5A 1GU7A 5FP0A 2CLCX 4CGZA 2GZMA 2EGHA 2J1LA 3I52A 5AI5A 2O6LA 4KV7A 2QXTA 3JZMA 4QU5A 4XRRA 2X6RA 2POQX 5C5EA 5COBA 4HB4A 2XCOA 1TM4E 4L0CA 3LL4A 3AONB 4B4WA 1U2GA 3ADBA 1CR6A 1US8B 2K2QB 1NNUA 4ZQHA 3B1WA 4HQ0A 4CQMA 5HJEA 4CMHA 3B9RA 4KJZA 3D8SA 4S35A 3K3PA 4Q6BA 2R84A 1QAQA 4NJEA 3E9CA 1P0QA 3F7OA 2O1XA 2NZUG 1RVV1 3I1JA 1HNXB 1UXKA 1E0DA 2J7PA 2QE6A 2Z2JA 4FFMA 5AUOB 4HQNA 5FUQA 3M6AA 3I9NA 2WSSD 3BXGA 4AX4A 4ER3A 5FLKA 1M83A 2DLNA 5ADUS 1H2EA 4HFMA 3H0CA 2CLOB 2ONCA 5CH5A 4EMTA 4BNTA 1C1DA 2YH2A 3KB2A 3PXGA 3CR3C 1LZLA 1QCCA 5IW8A 2VSFA 4MVJM 1ST2A 2BFFB 1N2OA 1U7TA 3BB3A 3WRXC 4E11A 1R0SA 3A1FA 2B92A 4HYYA 5CB4A 3IC5A 3KSZO 5C2JB 3EDMA 1DCFA 3MW8A 4D4LA 1MA3A 5FPYA 3FUTA 1T2CA 4NNOA 4O2AB 1WBJB 1X1QA 2IDKA 1YNOA 3M2TA 1JG3A 1JAXA 1AUXA 4H1VA 3QITA 3OEEA 1KFBB 2YVAA 2OO5A 5CJJA 2BFPA 1GD1O 3IJRA 1JYEA 5E4FA 2Z5VA 2IBMA 2H1LA 3A10A 1EHIA 4UXHA 1NULA 4Y2HA 3MOIA 3BJRA 5KNBH 3HKCB 1KYIA 3E5RA 2W8BA 3W9UA 4HWPA 1UFKA 2JW5A 3GT3A 2M98A 3QG5A 4N5IX 3H42B 4B9EA 1GAEO 1P7CA 2I7CA 1IG0A 3EPLA 2XXAA 2PKQO 5C1PA 3JAKB 3EEBA 4PF1A 4GU5A 1K1EA 1FK8A 1SUFA 5DJ5A 3OSZA 3TZBA 3VTFA 1FMJA 2Y77A 1J9ZA 3LLUA 2F64A 4JR2A 3ENVA 4RTLA 4J4HA 4S04A 1V7QA 4EFMA 1KEKA 3D31A 5K3AA 3OM9A 2D4HA 5A05A 4CWAA 2IVZA 1PFKA 5B1SA 5F64A 4V03A 3HCOA 2BFWA 1P0FA 2QI9F 3B9QA 3C16C 3K5IA 5FBHA 1PAUA 4MV9A 3T7TA 1FDRA 2BKAA 4RGYA 1VDZA 1USVA 3GRVA 3PD7A 4XPIB 3UCFA 3FUCA 4Q9AA 5D1NA 2ZIZA 5FOSA 1DI0A 4HWSA 4NH4A 4EI7A 3KSDO 3A3YA 1N6PA 4LXGA 5GONB 2V1UA 2G9UA 1O95C 1DC5A 1V9SA 2EL7A 2Q6TA 2VJOA 4FZVA 5IJ0A 2Q2VA 3SGLA 1I4DD 4PLWA 3CISA 1KY2A 4RDIA 4ML3A 3TRDA 4CR6A 1EVYA 1QH8A 3P9ZA 1P5ZB 3VZRA 5HG0A 5KWJA 1GPUA 3WGNA 3O38A 4YJDA 2GUGA 4HXYA 1XCLA 2YQ4A 3AG5A 3F8TA 3F4LA 5LYJF 4KWCA 5EHIA 4DA8A 4PRKA 4U7HA 1OAKA 4YY3B 4OSEA 4F2PA 3GLKA 3K0CA 3LCMA 4M0UA 4LTDA 4YP6A 1LNSA 2ID7A 4DOMA 5HZGA 3BM5A 3GJQA 2P11A 1RQXA 4Q7KA 3ODGA 3PJFA 4P2GA 3SR4A 3B82A 3ZK7A 1ODIA 3RTCA 4RY2A 4DR7B 2E4ZA 1V26A 1KXZA 2JGNA 1DFGA 2FF5A 3FCYA 1TUIA 4R2WA 5CP8A 5DNDA 1LV7A 1GTG1 1BFUA 2QIPA 3ISVA 4W7HA 3SJUA 4IXTA 4D6XA 4DLVA 2BMWA 5JLJA 1AQIA 2DPYA 2O2XA 1CHDA 3T9DA 3C6XA 2DJ5A 5IF3A 2LKDA 2KJQA 3C8ZA 2NO0A 1XA4A 4B3TB 2FTKE 4UPDA 1HQDA 5GM2A 2UXBB 3ESYA 3UMRA 3U7GA 2PXHA 4YXWD 2WINI 2JCVA 3F2IA 1E1KA 1PLJA 3B3FA 2P9YA 4EJSA 1E1QA 1FDWA 3NBKA 4AI6A 1UJ6A 4WV3A 1K7EB 2B2XA 4AVYA 2AJDA 4YV7A 4EB3A 1J1UA 4IJKA 4CQLB 3OT1A 4OBXA 3RVBA 4EH1A 3EPHA 1SA0B 1IEWA 4QXPA 2BE7A 3KJZA 2P3LA 3PI6A 4G67A 3X1DA 4AKSA 2O3QA 4ZZ0A 8LDHA 4Y2PA 1STOA 2HAEA 1LVUA 1R1DA 4E15A 4Y7DA 2H1CA 4DQUA 1JHDA 3DSRA 1XAHA 1JDPA 1RQNA 1ZD5A 1QIHA 3O4FA 3FR8A 4IFEA 4YP9A 8AT1A 4QYIB 3T4PA 4D3FA 1X7XA 1OZHA 1WHTB 3DFUA 3A05A 4HMOA 5IFKA 2QX6A 1QGAA 3AM1A 2HSDA 1FEZA 3D2AA 1SBYA 1D2GA 2ZIXA 4FBGA 4XUGB 3REOA 4JP3A 1ORWA 2REBA 2BELA 3E05A 3QUAA 5FUWA 3NBZC 4JI6B 1E1CB 1UM8A 5FI5A 3HLTA 1Y7PA 4NOJA 5T7BA 3UXYA 4P3OA 1UOOA 2WSMA 1XRLA 1XBTA 3S3TA 2OBMA 4Z0NA 2IYXA 3CV3A 1E79D 4LHZA 4B6JA 3B1YA 4HDMA 1UBCA 2IYTA 1MX9A 5C81A 3RSFA 4QHYA 1ZJYA 2Q6KA 1ULSA 3WGUA 4ALMA 1X7WB 2AI1A 2ZYSA 4ENRA 3L4EA 4YWHA 3HM9A 2CNWA 4HWKA 4HJRA 4HH4A 2AG0A 2P2SA 1THZA 2I2BA 1F4PA 3IAHA 5J5AA 4B6SA 5H9WA 3DMPA 1B0PA 1KQFA 3O74A 5C35A 1I3KA 5ISMA 1IZZA 4A8PA 3EW7A 4D9IA 2R44A 2EKBA 2I66A 5D6NA 5H7XA 2EDAA 2DTXA 2RGWA 3DZ8A 2YOHA 4MLZA 4XYBA 4NZNA 3WFIA 3P2KA 1RXVA 1J56A 2AIRA 4PYJA 3BIFA 4KPEC 2XQVA 1U4SA 3GRKA 3SJCA 2HZBA 1G8SA 3SAJA 4C0QC 2J3IA 5L95A 1KDRA 3CCFA 2XF8A 3K9BA 3LCCA 2QM8A 3QJYA 3ZW9A 1NI5A 4R1OA 2X5XA 3RUCA 3GP8A 1HYQA 3ZV3A 2GVDC 1VI6A 2V6GA 3YASA 4XLTA 3IPLA 2Z6AA 2OHVA 1NV9A 3L0CA 3NETA 2LXNA 3FPEA 2BFBA 4RTJA 4CLDA 2QN1A 3VR5D 1C9DB 2XADA 1JQEA 3H86A 1PGPA 1XCMA 2YMPA 5DV9A 2ODNA 4NBWA 2K5UA 2QSUA 4ESVA 2E1RA 2HEGA 3AU8A 3DXYA 2G1UA 3R0QA 5TQ0B 5DO9A 5C7IO 3L46A 4RDCA 1J23A 4FFWA 1RM5A 4UHHA 4DVJA 3HKCA 4MIKA 4Z4HA 1ZUHA 4M6WA 4XQ9A 2YIMA 5AKIA 2O52A 4U2DA 5C80A 5L3SB 3K2BA 3FYTA 2H2HA 1SXJD 4RHCA 2WMYA 3TLGB 3IV9A 2JLQA 2YMMA 3UMSA 1E3IA 2P9JA 1QF9A 5E6SB 5JDIC 4DGQA 1XQ9A 1G8AA 4WGFA 3T7KA 5DYWA 3DKRA 3SHOA 3OVMA 4X6LA 4IH1A 1PD0A 1ZG3A 4XIYA 5D00A 1DMRA 4G8JA 3EQ9A 2HPHA 2GA8A 3MQ2A 2HCRA 4X7RA 2B3TA 5I5GA 4EGJA 3GNQA 3NTVA 1QMPA 4HOYA 4RKQA 5FUVA 3FPHA 1U1GA 1RABA 3MTEA 1SPXA 5BSWA 2PZ8A 3DR5A 2ZJAA 5K4HA 2IYLD 5ITZA 3IS3A 2IZ1A 4YRAA 3LQ1A 4AMVA 3HU5A 2F8TA 5FRDA 3WDSA 2IX3A 5IRCD 2HMTA 3VDQA 3L5OA 4FNOA 1ORTA 3QVGA 3EXEB 3WNCA 3WL3A 2Z4SA 1H1LA 3G2OA 4JHXA 5B1EA 2AR0A 1ADGA 1WF3A 3FFWA 2DCMA 4CV1A 3JAWA 2Y1KA 2JCGA 4IV0A 1PJLA 1N0VC 1X42A 1JHXA 2WJAA 2DKOA 4YUYA 1ZJ6A 4BWYA 5CDSA 2WMDA 2XWJI 3BE4A 1ACLA 2M6KA 4JVLA 1KZYC 3QTLA 2ANBA 4YMHA 3HEBA 5JRJA 1QIKA 1VRCA 3AKZA 3V9PA 5DIZA 4R7ZA 3VZBA 5FADA 3M8KA 3P9KA 4NKRA 4W99A 5ALTA 3RSSA 3VR3D 1G20E 1HZJA 1Q0SA 5DYIA 4D0LB 5HF5A 2QQ0A 4LJAA 2WICA 1EUCA 5KTRA 4YRIA 2UYOA 2OCKA 2HT1A 2C5HA 2PKXA 3GW8A 3OHSX 4FR5A 4TL6A 1FX0B 821PA 3U09A 1SZDA 3FDZB 4BNDB 2D6FA 1YZKA 3C48A 1VHLA 3JXEA 1LEHA 4PZLA 5FTNA 3AKDA 1WUTA 4XWOA 4G4JA 4OXYA 4C5BA 1P2UA 3GK3A 2DWUA 4N5NA 5G0TA 3G0CA 1G1MA 3CLSD 3ZHTA 3AUUA 1WA5A 3UB2A 4HPWA 4EUFA 4LJYA 2QPOA 3N76A 1M1YE 2WP8J 2ZBUA 4YRJA 3SIRA 5HRAA 1H4SA 2O06A 3FRHA 4H15A 2WU0A 3VV3A 3B9PA 3W1VA 1YHYA 4GPZA 2FEPA 2VP6A 1A8SA 2W98A 3COPA 4DEVA 4UASA 4HB0A 5I7HA 1OY1A 2YIVX 4TTAA 2IGBA 2R7AA 3MWKA 3IBCA 4PX2A 5C5CA 3U4CA 3Q85A 2EJWA 4UNRA 1IY0A 2PMKA 3MLBA 4KVZA 4DB2A 3C3DA 4F85A 3H99A 3OD5A 5IKOA 1D7AA 4KQFA 2FAXA 1HPLA 2NV6A 4MO2A 3T3MB 4JJ6A 2Y66A 4FZ5A 2OORC 3IUJA 4EL5A 1OT5A 5AVYA 5IM4F 4FFOA 3ZI4A 3QVUA 5F5XA 4X3CA 1DDIA 2VBFA 1VGRA 3G8CA 4TMWA 3ZQKA 5KSWB 4KWIA 5K6AA 3L6DA 3D0KA 4O2AF 3ND5A 5I7UA 1E1CA 2PGDA 4C3OB 3GHYA 4Z0TA 421PA 2BDTA 4D0GA 3N7UA 2FX2A 3P0HA 4M8KA 1X80A 1ZGZA 4YUVA 4C43A 3ZU6A 3G9TA 4MPTA 5KU7A 4EG1A 3NVKI 2GR9A 2C4WA 1G9XA 1CQIA 1KZGB 1Y9ZA 2NM0A 2Q9CA 2QU7A 4QUKA 5DF1A 1F48A 1WQ3A 1Z0IA 1O7JA 1AZTA 1E8NA 1GPKA 1II8A 3CF2A 3NKLA 3SQLA 2C9DA 5CA0B 1PWEA 5FUXA 3GLHE 3M9XA 2I87A 4A92A 3RC3A 2QIOA 1LY1A 2WT8A 1DKRA 1ZOLA 2HWXA 2H2FA 1GA6A 1DO0A 2ICAA 1QZZA 3DWIA 2WG1A 3TQSA 3UWKA 2CW5A 2OAQ1 3ASYA 2KB0A 1HE8B 4RANA 4QPNA 3O82A 2OXFA 5AKYA 1QR6A 4LJ5A 2CXNA 1H4VB 4US0R 1VMKA 1OXBB 3E4CA 3C5WP 4PZDA 3EOZA 1LS6A 4JJ4A 3ROFA 1OXTA 2IHTA 1XLWA 3HYRA 1ATZA 5IAGA 1S4MA 2QD4A 3K9GA 5AW7A 4QGGA 4XPZA 3TH5A 3PPYA 4FX2A 2GPAA 1MW9X 3DO6A 3HV0A 4TRMA 5JZMA 3D0QA 5JTUA 1K4YA 2GARA 3NTQA 2AN4A 4IGFA 5GONF 4TWIA 5IUKC 2KMLA 3KOOA 4IFIA 1QYVA 1YRYE 2KQUA 2D1YA 3E22B 3KWMA 5EUQB 5EMJA 5IT0A 4O3MA 1DGQA 4WNIA 1MH1A 2IEAA 3ZD6A 3WYGA 2ZPUA 4PFSA 3VDXA 3MQFA 4L5JA 5J63A 4HS4A 1LFAA 2PO5A 2GBPA 4REMA 4EDHA 1PV2A 1QCDA 2RI6A 5ALHA 2RKWA 2V0CA 3IFSA 2IUEA 1NFRA 2VXYA 3OZBA 4B8ZA 4JR0A 4GKBA 2HHAA 3IOCA 1M8PA 4CN9A 1MENA 3NHFA 4A73A 1ISIA 2C97A 1V35A 1V43A 1KAGA 3KTOA 1XQYA 1CJVC 3ADDA 3G9UA 4KX3A 3NXSA 2JI8A 2CMHA 4ZO7A 5L3SA 1V8FA 1ZNYA 1CCWA 2X5KO 1EM8B 4FWTA 4FDTA 2ZANA 1VLMA 2IXGA 3H2YA 2ZTSA 4ALKA 1RYHA 3C5VA 1MZVA 4RH1A 3UMJA 3W4IA 1DOHA 4JT9A 2UVPB 4EKIA 4D92A 4S1TA 3UMGA 1YTUA 1H94A 4TYYA 2OHHA 2OYCA 3DE3X 2YJ4A 4XQEA 3T9EA 2HADA 3JQBA 4IIFA 2VNKA 3IQGX 2G4VA 1PQYA 4YYZA 2OV4A 4Q3DA 2XB6A 5COQA 3HH8A 1OHHA 3IULA 5FPKA 3GQVA 1UIRA 3ZU2A 3C98A 1TQDA 2AS0A 3EY9A 4NP6A 3TXAA 2H4YA 1P77A 5C7OO 1OA1A 1FQKA 2FMXA 1E4OA 3WJ7A 1QFZA 4X63A 4O4IB 5JQGB 4C22A 3GDWA 3KTAB 1WP4A 3SSNA 3T4UA 3D0RA 1YGPA 3GUUA 1EWKA 4GKVA 4HB2A 3DE2X 5F73A 5GGYA 1R6TA 2Q3HA 4KXUA 3CJQA 3IBFA 1CUHA 2HA6A 2Y6UA 3OWHA 4MMZB 5AW9A 3AZOA 2JLAA 4HVCA 2HU7A 2DECA 4D6YA 3TDMA 2HDOA 2HMAA 2YY7A 3I73A 3MGCA 4Y1RB 3UPUA 3H3JA 3G02A 1QWSA 4ETWA 1C1YA 4G0ZA 4RK7A 3D8UA 1C80A 4Q1FA 2WPNA 4U7FA 1G16A 2JBAA 3KKZA 4C6SA 3ONDA 4JI4B 5GJWC 1KYWA 1M0TA 2M1XA 3OM8A 1XYYA 1R0CA 2G72A 1PN3A 4R8VA 4X20B 3TW6A 1EBFA 4RBNA 4LQLA 1E98A 1FX0A 1ZUNA 2BF4A 1V16B 5JVDB 3DVAA 4RHEA 4RAQA 2OZLB 3EH2A 4WFKA 3S99A 1UMCB 1JDSA 3NAGA 1E2IA 3NAQA 5KQGA 1TCVA 1K68A 4FYIA 1AF7A 2LPMA 3LBHA 4G0OA 1C7EA 1H65A 3KKOA 4LI0A 4PQRA 3VVBA 3NTLA 4IDCA 1OKKD 1WV1A 2XNHA 4BAUA 4XKJA 4L9RA 1HFJA 3AL0C 1J7KA 2XY4A 3SVTA 3OJEA 2R25B 5EWLB 4AJKA 4ZYWA 4OTZA 1RXWA 4F9EA 1MAWA 1E2FA 2WTEA 3CWQA 2JKYA 5DHFA 4OOEA 4XX1A 3BUSA 1RJEA 3AM4A 3BL8A 2IHYA 3FMGA 3CGWA 1RI1A 2XB8A 5AVQA 3GRZA 1KP2A 2W6JD 3UAWA 4DC1A 5CLFA 3BHIA 1HDIA 5EERA 3S40A 1W46A 4RPKA 4GM4A 4IHJB 4JEHA 4CI0B 1Y37A 1Z4JA 4QSHA 2Q5JA 3ZHXA 1E92A 1ORVA 4NU6A 1J2JA 1GPMA 2I2DA 2ZRHA 3L8DA 3WGGA 3WLEA 3OBIA 2HGSA 3FPGA 3PZRA 4KUEA 4F1JA 2QMHA 1RVDA 4CCAA 2YUIA 3WLRA 2X77A 1U28C 2O5RA 3OF2A 4JLSA 4EI8A 4K6FA 1TTHA 4YO7A 4KIUA 2HTFA 2PRYA 1S8FA 3BIOA 3B13B 2P2NA 1HDCA 1NX9A 4PVDA 4W4TA 2X8JB 2C04A 4FR2A 5F2EA 4K3VA 4DNQA 2OC9A 1JJBA 1YDWA 5JAZA 4CKBB 1EXWA 2Y1WA 2BFAA 2VAMA 3VR0A 1AO3A 2XUQA 2BFDA 1MT0A 4FB5A 5BWBA 1FSPA 4F11A 4D8TA 3QKUA 1KMHB 4K0RA 5HUHA 1GAXA 2EC5A 3IXQA 2MR6A 1GRRA 4G0UA 2H7XA 5JASA 1XTSA 4F60A 4QAJA 2PTHA 1QPZA 1I80A 2QLMA 2XWBF 4BNZA 1Z5WA 1ULBA 2Q4OA 5I7SA 5IVKA 5I7AA 1QYXA 1NLZA 1RLIA 2A0XA 2JI4A 4P4SA 4TVBA 4MVJI 1RDFA 5KSYA 5JSFA 1QIJA 2KSQA 2GXSA 4LUCA 3ROPA 1IPHA 4A6DA 5KNBD 4J76A 4C0JA 3A58B 3PB3A 4KLAA 2K2WA 4M0PA 2BGMA 3KB6A 4LISA 3DKIA 1SUWA 3N0VA 4FZJA 4IUCS 3EVFA 1YFZA 1N7HA 3T1HB 5AVJA 5D5QA 4EYQA 4YLEA 5IVPA 1E18A 2ZUUA 2QI9C 2WUWE 3M4NA 2IV7A 2NU8A 1I3OA 5ARDA 2D7DA 2Y1DA 4W5HA 4KVGA 3T3GA 1XJ5A 2EWVA 5KNDA 4HWGA 1Q7BA 2BJWA 4WKOA 5KDLA 3KAQA 1NONA 4G24A 1R7RA 4X8LA 3BMCB 2I9KA 1B73A 4K28A 4UUNA 1P74A 4IIHA 1COWD 3K1YA 1W2GA 4X90A 3WLSA 3HS3A 1C7ZA 2BGIA 2NZWA 3CPSA 3BK7A 3HRIA 3IV6A 3MB8A 3T5BA 1QZUA 1XLTA 2A0KA 2JPDA 3KG2A 1EM8A 4JN6B 3HJBA 1BXKA 4NMXB 1E1DA 3RT7A 2EZ8A 5E7IA 1NVUQ 1Y8RA 3HCNA 4PXSA 2FPMA 4K6GA 5JHGB 1LJUA 1EK0A 2M1ZA 1PR3A 4LXYA 4JOBA 1JI3A 2JGEA 3DB2A 2YBEA 4FJ1A 3HXOA 3R9XB 1DTWB 1HBJA 1P9NA 5KYNA 4LXXA 3PDIA 3DDCA 2JATA 1NQWA 1WMDA 3A26A 3B70A 5E7MA 4JI1B 4BCDA 4E2ZA 5ED0A 5JANA 1F60A 5TY0A 3H1TA 1M2GA 3EC2A 4BO3A 4Z7OB 3CUTA 3C6ZA 1FSZA 3LWZA 4RIFA 3K16A 5L4SA 2O2YA 4ID9A 3I72A 3RRBA 2DSTA 2XRYA 1I5OA 2FWBA 3LWBA 3PNKA 4O4IA 3T34A 2GM5A 4AROA 1XTQA 5ALIA 4BFLA 2DHEA 1B2LA 5ECWA 3U2QA 5I4BA 4AJOA 1QC5B 1XD9A 2WFLB 4YHBA 2OA0A 5JSHA 1MAVA 4UZSA 1OXVA 3ZGZA 1AE1A 4KTTE 5ESXA 4Z2AA 2O0KA 1CRZA 5JCJA 2GDJA 4Y1RA 1RHJA 5IK2D 2IPOA 2D0IA 4J0GA 1ZL0A 1NLFA 1N2GA 3OQNA 1HE1C 3X1YA 3D54D 1GG9A 1UBSB 4K2HA 4JC0A 2OPHA 1B76A 1P4AA 2FPIB 2WI8A 3OAAD 1J2TA 3CO5A 2EWMA 3PX7A 4J6FA 1TMGE 2Q4TA 3MA0A 1FVFA 3AEKB 4WD3A 1V3UA 1X13A 2IXAA 5HFNA 3P9CA 1ZA1A 4LZZA 1WDKA 4ZZ2A 2PIDA 2YZNA 3LY8A 1F4VA 1XEXA 5CA0F 3MCZA 1IAVA 2Z43A 5ECYA 3VOBA 1QGED 2VH5R 1ZY2A 2GI4A 1XRQA 1FFEA 3O26A 2AFVA 4JU9A 4KJXA 4K9QA 4UQPA 3AUFA 2AW5A 1R3UA 3O7WA 4W1SA 1T36B 1FP1D 2FFAA 4MVJH 2XDQA 1NX6A 4J91A 4KAJA 4GLLA 3RI3A 4EJMA 2AXEA 3A6GA 4Q4DA 2VXOA 3CVOA 4AG3A 5JFGA 2ZBPA 4XIIA 4ZHSA 3I4LA 3DAYA 5GGXA 1MD9A 3FOFC 2PKRA 4MA0A 2H16A 4ZVMA 3KP1A 4CMIA 1LBQA 3ED1A 3OQJA 2OXTA 4QE3A 1WTCA 3CRRA 1MX3A 3LWDA 5TC4A 4MIEA 5J3JA 5BQOA 1GO2A 4KQMA 1UDXA 4K40A 4BMXA 1NQ5A 5U4XA 2VLIA 1ZVMA 3TQCA 4DUYB 2AOVA 4IHJA 4TXJA 3K30A 4D42A 1BN6A 4Q66C 2B98A 4IF6A 3D0OA 3QA9A 4XVCA 4IZOA 5KB3A 2AMFA 1DUVG 4QLAA 3UCEA 2VCEA 1FFYA 1L5ZA 3BZBA 1CUGA 1Q7TA 4RORA 1LH0A 2RB5A 3L0IB 4QO8A 4FN4A 3TF5A 4IJ6A 5TQ2B 4ETNA 3M49A 1S2GA 4QXMA 4UZEA 3WLOA 3VPFA 2QV7A 1CDOA 2E4UA 2QPTA 3D6UA 4V2UA 1IIBA 1NYLA 3FTPA 4RVHA 1BEZA 2G08A 3B3AA 2G7ZA 2NZ8A 3GPDG 3HKEA 3LS2A 3OUTA 4RACA 5FD8A 5I7OA 4QELA 2J46A 4RE5A 2P7IA 1CHNA 1II0A 1ECBA 3PQ2A 3NQ41 3WSTA 5GZ3A 5K99A 2ZIFA 5KREA 4JLAA 1DBIA 1BHJA 1U8FO 3I64A 2EERA 5F1OA 4WECA 3SZMA 4B0OA 2BJHA 3BSSA 1WQ4A 4C0XA 2O2EA 4CL0A 4MRPA 1CQXA 1GPH1 4ALJA 5IXYA 5L4NA 5LU9A 3ENNA 4DIKA 1OH7A 5KVQA 1WMSA 4BFXA 3GJ6A 1OPRA 2WPDD 3FAKA 4I5DA 3GEEA 3ZE2B 3Q12A 2QW0X 3LA8A 4Y9DA 1OI3A 3WQQA 1TA4A 4Q4LA 3I5AA 4YA6A 1UOEA 4OBEA 4G81A 4HX9A 1A9ZA 2RHLA 3VPBA 1V5IA 1PZXA 4MEAA 1XRMA 1Y1QA 3MBKA 3ID6C 4LRTB 1SAYA 4BMPB 2HJVA 5JQGF 3EISA 2C7PA 4PSCA 1T25A 2FJUA 4J7AA 1Y4DE 1G4HA 1YK0A 5FWYA 4KO8A 1JIQA 2VYVD 4M99A 5KHLB 5GWXA 2WJYA 1PT6A 1RWKA 4P54A 1N0HA 3TW4A 5EHZA 5FOXA 1JKJA 4MCAA 4C78A 3EN0A 1E62A 1SC9A 3Q0EA 2GZDA 3Q8KA 2QMEA 3PNVA 1C4XA 5I9SA 4DDHA 2BUBA 3L1IA 1EJ2A 3V34A 2XIQA 4EELA 1NUPA 1HYEA 5C1BA 4Z51A 1NI4B 4II7A 1JLSA 1YRBA 1E3JA 2FJ0A 3IP6A 2I3AA 3EEYA 1NY5A 4MRMA 4EZBA 3K70D 2C2YA 4D43A 1L4NA 3LFTA 5C46F 3WS7A 4JD5A 2VKTA 3WGKA 4DR1B 3DMYA 3FWHA 1SVWA 3M6FA 1UKCA 5JVDF 2BGRA 5F3WB 3LAWA 4RZXA 4R1UA 1JEYA 2C1XA 3GOHA 2Q41A 3W04A 3O9ZA 2J45A 1DIBA 1VXOA 2VDVE 4FI3C 2WF6A 4YCMA 5IF9A 1X8JA 3I6MA 1U8AA 1W4RA 4IXMA 4AZ3B 5JBQA 2JASA 4EEZA 3BWBA 4COKA 2WU8A 1HDOA 2GJSA 3PYXA 3RAJA 3D6TB 3OTHA 4EABA 1M34A 3QBEA 2FUG1 5IZ4A 2FMIA 1UBFA 4G9EA 4QT4A 1J25A 1M0SA 3I53A 3BT7A 3CNNA 3QXJA 1MRNA 4TOIA 3HY6A 3B5JA 3HWSA 1CZOA 2OHFA 4ESHA 3CLSC 3EWNA 3I39X 3T5MA 4I3GA 2VAPA 5BN4A 5GINE 3ZU5A 2GBIA 4K9KA 3BFPA 1TZJA 4PIMA 5DE3A 1Z2CA 1P33A 2VTBB 1GAQA 2GPJA 5JDCA 5KNCH 1U1CA 2OUIA 1XMIA 3JD1A 4I6JA 1X7HA 4R1MA 4MPDA 4P83A 4RYDA 4D2IA 1CV2A 3QKIA 5KYYB 4ARCA 4DDKA 3ANXA 4X6UA 3T0IA 3EIXA 2I3BA 4DCNA 3B1XA 1TU4A 2EBFX 5EG5A 5GVSA 4JGIA 1DQYA 3HXLA 1YZGA 5FI1B 2GXUA 4BCCA 2JAXA 2CVPA 3U3XA 2PX4A 2WD7B 4FEYA 1IFXA 3AV0B 4ARUA 4C30A 3I6YA 1TF2A 1Y82A 3SVZA 2CT8A 4WBNA 1FTGA 4E5DA 4PCVA 1KP3A 3HCBA 1VCHA 1BCRA 4ND8B 3D43A 3EGVA 4IKOA 1RWOA 1CC1S 3C5EA 3MUOA 4X65B 1BAPA 4E6EA 2VHJA 4TV9B 4Y6RA 2ERCA 5ELLA 4QGSA 4CKWB 4DSUA 3WRWA 1FSGA 1GSAA 2JAOA 3EJ6A 2FR8C 4M22A 5HTKA 1H2HA 1P9LA 4RWEA 3TB4A 2GRAA 3UHJA 4LMBA 2RG1A 1CUWA 5K0NA 5HQ3A 4Z9BA 3QY9A 3X44A 3AEQB 4LZNA 2WFZA 4A23A 4DCCA 4H16A 3R5XA 2O5EA 1TYBE 1XXHE 1U8XX 2VSYA 5LCXA 4L4XA 1G7RA 2ZI6A 4D9HA 3PJRA 1UBHS 2C5SA 2IFTA 2IYUA 3H1PA 3O84A 3ORYA 5LJIA 2R60A 4I5IA 3PUYA 2IYZA 2FPRA 2PT7A 3NC4A 5JADA 4G0VA 1WMFA 2HHHB 4N49A 2QRZA 3OPXA 2AKEA 3F6RA 4IRUB 4FGWA 1PI3A 3NEYA 3IKJA 2EF1A 2A9KA 2FHPA 2CEKA 3F3KA 3D02A 3LD9A 2GEBA 3PHHA 2ECFA 3R6TA 1U2EA 5FDFA 2XCRB 3ZBPA 2YR0A 2EIHA 3JASA 4I9NA 3OA2A 3W6ZA 2W4IA 3SBOA 4D44A 5FL7A 1SELA 3AUKA 5KKCA 4I8DA 1ODFA 3R7DA 2CZGA 4K9OA 4CODB 4TZKA 4PN7A 2DFDA 3ANYB 2WVGA 2A5FA 1UBNA 1LW7A 3SC2B 4C4PA 3TS1A 4HBGA 2UKDA 3RRJA 3KKLA 4QTYA 1PL6A 3GEDA 3HWWA 4I1IA 4AQYB 3ZGYA 1X9GA 2NV0A 3BDVA 3D8NA 4FGUA 1UT8A 1N5RA 3FYCA 3G2LA 1D6JA 3DQPA 5IZCC 3I04M 2O8FA 1CJMA 1YL5A 3LX6A 1E3DA 4DQDA 1P81A 3N0RA 3NTUA 4EY7A 5J2TB 4GOXA 2GFHA 3BB4A 3L92A 3OCVA 5GMOA 3GZJA 3WGVA 3H75A 2COUA 1L3BA 1AQJA 2YRWA 1JX6A 2C2OA 4IDEA 1NYQA 3QHAA 4BNKA 2JH9A 3QU2A 1NQOA 1H69A 3A7EA 4EAAA 4JNKA 2WTUA 4RD2A 4GEGA 1U6JA 4K5QA 4O4HA 2Z08A 3RQIA 1SR8A 2Q1UA 1W0CA 1YUNA 2FZ4A 3WP0A 3I0MA 1YRWA 2IF0A 2IIBA 2OKCA 3GBSA 3GPBA 3E7WA 1WB6A 3KQYA 4GZ6A 4YJFB 1C9EA 5F2NA 3NWEA 4QFMA 5LP6A 4FDUA 2O8DB 4FYXA 1FP2A 3H05A 1E61A 3NM6B 4B6GA 4BO9A 2DT5A 3AI7A 3AGPA 1TQ2A 3OEWA 1T10A 1OREA 3ILYA 3RS4A 1HEUA 1VIAA 2J9YB 2Q8PA 3L0YA 5LBUA 2XE6A 3SKVA 4BQRA 1M6VB 1LV8A 1NV8A 4YRTA 3LKDA 3A6DA 2CL6X 2CCKA 3VFDA 5DXAA 3NGXA 1L5HA 4BNYA 1NVKA 2A0FA 1G42A 2C2MA 2WTBA 4Q3KA 4CF5A 3MS7A 3I2FA 4P93A 3GWZA 1RMQA 1UPCA 1F2UA 2VL7A 5A3SA 3W2IA 1TRKA 4GOLD 1E9CA 2OG2A 4JS0A 2QDKA 3SP1A 4UFPA 1QOQB 3K9FC 3V3KA 1L8XA 1ZW6A 1QTIA 4Z8XA 3SYRA 3U3DA 4QDTA 1LS1A 521PA 1SVOA 4GAEA 1PWZA 1LK0A 1XN1A 3K0FA 2IWRA 3EIUA 2R5NA 5GQSA 1XZHA 1ZJZA 3BXEA 3RLFA 5T4HA 1W0KD 3HBJA 1OWPA 4AZVA 1CRPA 2AEJA 1ST3A 4DV7B 4D3SA 2X86A 4LXIA 4TYQA 2C31A 3UOAB 1OX4A 4KVAA 1L5KA 4CEJB 4LC9A 3FHOA 2ZIVB 3AQIA 4LRSB 3KPVA 2FFHA 1M2OB 4EGCB 3QWHA 3QI2A 3OLXA 1U1EA 4ETIA 2D0PB 1MO4A 2XKJE 2JLRA 4DQKA 2D7JA 4RF4A 1MAHA 4AW9A 3RC1A 5GJBA 3K0BA 4WRRA 1KFEB 3H0KA 4TWAA 3QIAA 4D45A 5LKRA 2Q6OA 4KXNA 5CFRA 1UAYA 3IEPA 3QPUA 1T9DA 1G41A 2X0KA 2C4MA 2YV5A 3ZBUA 2WLSA 3ZWYA 4DE5A 5I4KA 4UTNA 2G04A 1QO0D 3GMIA 2CV1A 4XSHA 1PBNA 5BUSA 3KL2A 1GY8A 5IG2A 4OM8A 1M5RA 2P35A 1NR5A 1KMQA 3PQ6A 1XVAA 5TQJA 5KTYA 1MRSA 4Q5IA 1OJ7A 1QONA 1NP6A 1OIWA 5H3HA 4POAA 2ONKA 4FDVA 3DHNA 2QG4A 3J7TA 3UJ6A 2A57A 4YIKA 4MS1A 2EJBA 1K5PA 5BNFA 4PLTA 2J0UA 4DSZA 3HDQA 5LZ4A 3P9NA 1VPWA 4H7IA 3VTKA 2QLFA 4YJGB 1CQWA 1O57A 7YASA 3I37X 1JE1A 4B9AA 3OCYA 2EV9A 2VCHA 2N46A 4U2KA 3I12A 5IXSA 1R6BX 4ZVKA 3MWEA 1F9EA 1K98A 4JJZA 5CLHA 3V4OA 3KR1A 2Q5IA 1QX3A 2PBRA 4X8HA 3UJDA 3BF7A 3DVQX 3MILA 3ZVRA 2BEWA 2FYTA 2OVFA 3O9MA 4RD6A 3UT0A 1WCIB 4EHFA 2GVNA 1DE0A 5DP1A 2FWNA 2EOAA 2WJZB 4V0NA 5A6SB 1O2DA 1QRRA 4BLSA 4UD2A 4DIDA 4YCAA 3KE8A 3SDBA 3UH0A 3ZIAA 1PFQA 2KHZA 4N03A 4NMMA 1OWMA 3OX1A 3O75A 1MO5A 1Z6QA 3V7WA 3OQBA 4HQFA 1JU9A 3MWJA 5F2OA 1MB0A 3D2CA 4WBXC 3FWYA 2VNJA 3GT4A 4NX2A 1NR1A 1X7ZB 5BSUA 3OX3A 1MUUA 2E49A 3HB7A 4AP9A 4US1R 4A2CA 3RADC 3EDQA 1VL5A 2ACVA 2QYHA 4WJZA 3KYBA 4CUZA 4ER5A 5BVHB 2A0WA 2GBLA 1HG0A 1U0OC 1NBMA 4NBRA 1U0EA 3L4BC 3B85A 2A0UA 2A6PA 1J97A 1GNPA 1U94A 2AEMA 3VUFA 3PIRA 1DB3A 2ZIAA 3ZNOA 5I7EA 3QX8A 3RRZA 4LWZA 4TTVA 3N8HA 1ZUIA 2VJPA 2PV0A 4MPJA 5FQNA 1ORRA 2VSXA 1TJYA 1LI7A 2QORA 3D6FA 3KZXA 4ZDIA 2GZHA 1W4LA 3E58A 3HXMA 1G0NA 2XE7A 2FRDC 1TUGA 1IMJA 4IKPA 5G2OA 2IYFA 4ZCLA 4B32A 1DADA 1WB4A 3ZGLA 5DM60 3ZY6A 5G4KB 4MP8A 2B5WA 2GZ1A 3EDRA 3LHIA 3THYB 1U9IC 1T6XA 1V3VA 2HHCA 3NIFB 1YNSA 2ALJA 4CKYA 2QQFA 3OE7D 1ZKMA 2PQ0A 4FQ5A 4Y2VA 2GD2A 5TT1A 2YASA 2A1IA 3U4IA 4N65A 1J0DA 1GYQA 1FPMA 2CHEA 4J75A 1QHXA 1PL8A 4OXIA 1EE9A 3LQFA 1ZMXA 3D3JA 3QA3E 3QLEA 5F7ZA 4RNCA 5AESA 1WAMA 2ZTVA 4H3HB 1Z07A 4V0ME 4XSVA 1V11A 5C3MA 2F1KA 2R1VA 5CG1A 3AVYA 1I1HA 1PTJA 1XE3A 1QKJA 1JKMA 3DTVD 1GPAA 1QQ6A 2DQZA 1IMOA 3EIWA 4GZMA 4RVDA 4KN9S 1Q2UA 2GN2A 4BO4A 3FVTA 1DAGA 1GQRA 1JLRA 3LVBA 2E55A 3B3JA 2CKMA 2VF7A 3G1WA 3GY0A 3PNBA 1OFUX 2X2FA 3KOMA 3UMCA 5K0JA 3GUZA 4GBMA 3K2EA 4RA6B 3GHHA 2CSUA 3DZCA 5L3VA 3UG6A 4B1FA 2XODA 3STVA 4LMAA 4ZGGA 2FW8A 3ABOB 5CH8A 2OCYC 2VZ8A 2HUPA 5HTOA 1J9GA 1U0GA 5JISA 3NEPX 1Z6PA 5E1DA 4RF2A 2X0IA 4DIFA 2K7FA 3GFRA 4CM9A 3IVXA 5DK4A 5IN5A 4KYIB 2XDAA 5AHOA 2Q4BA 3T52A 1EXMA 3FX2A 4JYZA 1SH7A 2DFLA 2FRXA 3KJQA 4JBLA 4YMLA 2JEZA 1AHNA 5D6OA 5DHTA 5BSMA 5BYAA 4WSOA 4B3HA 3OUUA 4BQPA 5HJ5A 1L7QA 4L75A 4CLRA 2FX5A 2VYNA 4INAA 4QTZA 2WD8A 2JRCA 3DE6X 3HN2A 3DLTA 4TV9F 4ZPJA 1R0XA 2NW6A 1EFKA 2V45A 1TEXA 4YH1A 4DQVA 1MX1A 5A2QA 3RRNA 1GSHA 5HJ7A 4CG2A 1MQAA 3H13A 4GR9A 4WK4B 2OV2A 5J1TB 1V48A 3ELWA 4GLJA 4HRYA 1XQWA 3FF1A 3LUGA 2P3OA 3S81A 1XKXA 2IUYA 1DXQA 2JIBA 4L08A 3VJMA 5BQXA 3KM0A 4WCFC 1NZJA 4V3CA 5F5LA 3V8PA 2HK6A 4DPLA 1DKOA 2DR0A 4P36A 4F38A 2FSHA 5CAEB 5CXUA 2AKAB 1G5HA 1DX9A 3S0JA 2VH1A 4MH0R 4W5QA 3HRKA 1F8GA 1YS6A 3FZEA 3KZNA 3V8MA 4AJEA 1W88B 2C03A 2Q2OA 2R6CA 1E4VA 3E82A 3G17A 3GN2A 4MVJF 4UAUA 3EC1A 3RUIA 1XX6A 4MKRA 4YV0A 3EA0A 3K09C 3ISTA 4HGNA 1FX1A 1C30A 1UOQA 1CDZA 3Q9UA 4NYJQ 3VO8A 4BMYA 5CFQA 3LP6A 2H52A 4WK0B 4RV9A 2QM3A 3AH8A 1LU9A 1R0YA 4O2LA 4ZO9A 3ILSA 2PSJA 3R1IA 4XM0A 3ZWQA 4TWZA 3BD8A 1KQOA 4Q1CA 1IB6A 1KVQA 1UDBA 3WTCA 4HNTA 5KOHB 2HBQA 3A4MA 2XBUA 2XZDA 1M67A 3FYUB 3LPLA 1N5MA 1VPDA 1NT2A 4L9AA 2UZ1A 1UBOS 3FPKA 3DJFA 4DJFC 2GBFA 1T5OA 2JEYA 1H1DA 3ND9A 3NAMA 1L5MA 4XVHA 3IMCA 1WLSA 3PX3A 4MKIA 5CTJA 1UMDB 4YFYA 3T35A 1FNBA 1DAHA 3O92A 4JJGA 1GUAA 4KE6A 2TS1A 4M0DA 3R8FA 1TMOA 3WQBA 1HFKA 3HG7A 3FNRA 4MP6A 4RTPA 5L51A 2VRCD 3RS8A 5J2TF 4I8IA 1NXVA 3M3HA 4D9JA 2OTCA 4UTXA 4R8RA 2D62A 1GGNA 5M2QA 3AGQA 4PQFA 1R6UA 1L7EA 1TO6A 3A04A 3Q3GE 3VHRA 5AVRA 4BO5A 4JLPA 5KTPA 3B52X 3KBBA 4ANFA 1E3WB 4QOFA 4FNGA 3TTVA 1W7AA 1DQZA 3CEHA 3CEMA 4H60A 3EUFA 4MQFA 2Y1FA 3HVHA 3CZAA 4DLBA 4IHAA 2UXDB 4B2YA 1X7ZA 1CIVA 3G2IA 3QMMA 1FRVA 1DIGA 3F9CA 1LSUA 3LQ4A 2JD2A 2HOQA 4PR3A 3ICCA 4IDNA 4HZGA 1K8YB 3H11B 1G5TA 3NHLA 3OZIA 4G85A 2QYSA 5C32A 4LI3X 4Q3CA 1AQ6A 1Z4NA 2BHRA 2Z8YM 1JVBA 3MMXA 2ISCA 2V7TA 4KBFA 2IUTA 4IV8A 3A25A 1GQOA 3QGMA 3DXFA 3ZZ1A 4F2HA 3SC3A 3WISA 1L6IA 1D5WA 2BP7B 2RHBA 3UPDA