1XVAA

Methyltransferase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
292
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINE N-METHYLTRANSFERASE
publication title Crystal structure of glycine N-methyltransferase from rat liver.
pubmed doi rcsb
molecule tags Methyltransferase
total genus 79
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1996-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1xvaA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xvaA02
3HVKA 5EZSA 1P1CA 2NYUA 3LECA 5DSXA 3TLJA 1XJ5A 2Y1WA 2ZWVA 4RTPA 7MHTA 2VDUE 3MQ2A 5HILA 3IV6A 2AS0A 2PLWA 2YR0A 4OA5A 3A27A 2VDWA 2ZZKA 2I6GA 1TPYA 8MHTA 4PCLA 2Z6UA 3M6WA 2AOTA 5EQJB 4AX8A 3P71T 3QV2A 4RV9A 1N2XA 5HIMA 5K03A 2ZFUA 4DZRA 5K0GA 3X0DA 1ZG3A 3CVOA 4QDKA 5E1DA 2OB1A 3JWJA 4F84A 3C6MA 4GC9A 3OCJA 3C6KA 5HFJA 4AZSA 2YXLA 4QVGA 3ER9A 2BR3A 2IBTA 2IBSA 5DT2A 3RIEA 3IEIA 3BGVA 1YFLA 3P2EA 4BY9E 5K0BA 3QOWA 2O07A 4CWAA 5EVJA 3TKYA 4F85A 5EEHA 4X63A 2ZIFA 2BM9A 2FYTA 4CXMA 4YUWA 4HH4A 4E2ZA 3HA7A 5KYGA 1IY9A 4OQDA 2PV0A 4E31A 3G2OA 4P7GA 4Z2YA 3EVDA 1XTPA 1KYWA 3FPJA 4FP9A 4CTKA 1AQJA 3PLAE 3A25A 4GF5A 1KPIA 5ICFA 1X1BA 2B3TA 4V0QA 4IV0A 3HCCA 2XYQA 1Q0TA 2YXEA 2C7OA 3AWIA 3AXTA 3LSTA 3EVCA 1I4WA 4P7KA 4LECA 3KQYA 4EMSA 1G55A 2UZ4A 3DULA 2ZBQA 1ORHA 3GRVA 4HGZA 3G88A 3G2MA 4DKJA 3DH0A 2O57A 2R3SA 3B3JA 5CD1A 4GUAA 5E9WA 2G72A 4QPNA 5EC8A 3DP7A 1XDZA 1ZGAA 3R0QA 1L3IA 1SVUA 3P9IA 3P9CA 5DM2A 3U81A 3EPPA 1KYZA 4K6MA 5FA8A 2Z6QA 4PYIA 3R9XB 3MGGA 1F3LA 2PX5A 3S68A 2PWYA 3TM4A 3GNLA 4RTMA 3BT7A 2AOTB 4EK9A 1NBIA 3F4KA 5E1OA 4X60A 5LSAA 2ONYA 3QOXA 4AZVA 3LCUA 3LBFA 2NXJA 4GOOD 4Y30A 5CVJA 2OXTA 4LG1A 1O9HA 5FQOA 2P3OA 5M5BA 3PFHA 3SSMA 1EJ6A 2NP7A 1JQDA 2OO3A 2QY6A 1F38A 5DLYA 1B42A 1FP2A 4BLVA 4F86A 1UFKA 2O0LA 1EIZA 1QAMA 5LQJA 2PSSA 3SGLA 1NV8A 1BOOA 2BR5A 2IP2A 1MJFA 4KDRA 1NT2A 3P9NA 3KPWA 5C1IA 2C7RA 3A4TA 2NXCA 3PX2A 3CJQA 3LL7A 3BUSA 2OPBA 2AN5A 4M37A 4P7FA 5E1MA 3UJ9A 3PFGA 4R05A 4X1OA 3G5LA 1WXWA 2H00A 3NJRA 1TW3A 2HWKA 4P58A 5FUBA 3GO4A 5JUWA 4PNEA 4MQ4A 3DTNA 1D2GA 5FTWA 3TKAA 1QYRA 4PYNA 2VDVE 3TR6A 4GOLD 4YUZA 1Z3CA 3FRIA 3FPHA 1JSXA 5GP1A 1JG2A 3G7UA 3OPNA 4V0RA 3KPVA 5E8RA 9MHTA 5EKUA 4AZWA 2IDKA 2A14A 2EG5A 4RVFA 1XCLA 1WG8A 3LCCA 4C07A 3V8VA 2XVAA 3ERCA 1JG3A 2AR0A 3DMHA 3CC8A 1OR8A 3FUUA 3NVMB 4R6XA 5CVVA 3T0IA 4E2XA 2IDJA 3A26A 1AQIA 5GOZA 2V74B 1RJFA 4GC5A 3KQPA 2CWWA 2FK7A 3B5IA 3B3FA 5DTRA 2N47A 3PVCA 5DX0A 3BGDA 3UJBA 3OE4A 3EVGA 4FT2A 3ELYA 2ONZA 4EQZA 2P3LA 3HTXA 5LQUA 2P41A 3HVHA 2YXDA 3UJCA 5LQAA 4E30A 1MHTA 2ZBRA 5LR6A 5EKXA 3KR0A 3L8DA 5CCXA 2HV9A 3VSEA 2VZ9A 1WZNA 1RI5A 3VYWA 3EVBA 1RI2A 2Y1XA 3FPFA 3M6XA 5DRTA 4MHTA 1ZGJA 4WVLA 4A6EA 3HCDA 4PYQA 2ZIGA 5FULA 5IKMA 1Y8CA 5E2BA 1X1AA 1QAOA 4MTLA 5T6BA 3NMUF 2C7QA 2IFTA 3E23A 3DLIA 4IV8A 2GLUA 3GWZA 1SQGA 2FHPA 3THSA 2EJUA 2PGXA 3GRUA 2YVLA 1H1DA 4P7JA 3EEOA 3SXJA 2XYRA 4EKGA 1XDSA 5K05A 2GPYA 2I7CA 4YUXA 2NXEA 3B3GA 4C05A 4RTSA 2I62A 1YF3A 3LPMA 3HVJA 3DXYA 4PGGA 4PYOA 5U4XA 3UA4A 2QM3A 2YQZA 4GBED 5DM0A 2P3QA 3LKDA 3OU7A 2PXAA 2ZZMA 2HR1A 10MHA 4OA8A 1YB2A 4NECA 2PX4A 5GIOE 3GJYA 2G70A 1L1EA 4RWZA 1N7JA 3UA3A 1YFJA 1V39A 3EMDA 4RX1A 1KP9A 1DL5A 4M38A 2IH4A 4QTUB 2B9EA 2F8LA 5HEKA 1R00A 3JWIA 3AJDA 3UBTA 4FSXA 3G8AA 3M6UA 1PRYA 2PJDA 2JHAA 2WK1A 2YTZA 3HCBA 3KPYA 4RTQA 2JHPA 1RJGA 2FRXA 3GRZA 3MTIA 3DUWA 2BH2A 2AVNA 2PT9A 4YUYA 1P1BA 2FPOA 1JR4A 4GOMD 3D2LA 5LQKA 1XXLA 2CMHA 3Q7EA 1G60A 5CIYA 1VBFA 3K6RA 4YV0A 5K8VA 3CKKA 5DX1A 5H02A 2GAFA 1P39A 3E7PA 4CKBA 3FTFA 5E1BA 1RJDA 4RTNA 4FGZA 4C08A 3JWGA 4QTTB 5E9JA 4YUVA 5EEGA 1UWVA 4POOA 3P8ZA 3AY0A 2IGTA 3LCVB 3MB5A 1JQEA 4PYMA 4WXHA 4C03A 2CKDA 2QRVA 2KW5A 3ELDA 4FZVA 3A7EA 4PONA 3UJ7A 4YMGA 3KQWA 4HRAA 5BXYA 5HIKA 3LDUA 3PTAA 4GOND 3G2PA 3PT9A 3A7DA 3CJTA 5GWXA 4FT4A 2OBFA 5BW5A 5CCBA 1XVAA 1RI3A 1R8XA 3DXXA 2VS1A 1DUSA 4RVGA 1X1CA 3EVZA 3P2KA 2JHCA 3FTCA 5EHIA 1SUIA 2EFJA 3KQMA 2HNKA 1JSZA 4Y2HA 4RTLA 5EGSA 2CMGA 1D2HA 3KQOA 2IPXA 3LDFA 4KIFA 5GM2A 2Z6AA 1KHHA 3V97A 4HTFA 4PYKA 4QDJA 5ICEA 3I64A 5CM2Z 5HIIA 4RTRA 2UYCA 1G6Q1 3BWYA 4DA4A 1EJ0A 3O7WA 4ZTBA 2PKWA 5DRYA 2P7IA 4C04A 3KPJA 4E32A 4E2YA 3RW9A 3B89A 3NVKI 2UYOA 3ORHA 2JG3A 2PXXA 3MCTA 1FJXA 3KKZA 4PINA 1NE2A 3FUXA 2G8NA 3SSNA 5K0LA 1EQAA 1L9KA 2P8JA 2ZSUA 1T43A 1KXZA 3ELUA 3HCEA 4B17A 1FP1D 1SG9A 3KPUA 4ER7A 4PYJA 4OQEA 1AV6A 4QPPA 1G8AA 5HIJA 2O06A 1JTEA 2ZW9A 2PXCA 3I58A 3T7SA 3EGIA 4DM3A 4DMGA 3PS9A 2EX4A 5DXAA 1NKVA 4YMHA 2P35A 2IH5A 4XUCA 2XYVA 1NW7A 3BKWA 2QRVB 2G71A 4RTJA 3M33A 2WA2A 3SX0A 5T67A 1NW3A 3M70A 3P2IA 3GU3A 1Q0SA 2PVCA 2B25A 2QYOA 3EVFA 3G89A 1DCTA 5HOQA 2AOXA 4L7VA 4E33A 3CGGA 3EVAA 1YZ3A 1KPGA 4G56A 3HVIA 4KDCA 5FCDA 4BP1A 4CKEA 2YX1A 3NTVA 4PYLA 3R6TA 3NDJA 3OU2A 2VP3A 4U7PB 4ATNA 4PGHA 2IIPA 3O31A 5FHQA 5KQSA 4ISCA 2I9KA 2WA1A 3E8SA 3HM2A 2OY0A 3LKZA 5EOVA 5C0OE 1VP3A 2OYRA 1QANA 3KR2A 4HTFB 4YV2A 2PWPA 4RTKA 4PIMA 5DSTA 3ER8A 3FRHA 1HNNA 3FPGA 1VP9A 1NW8A 1RI1A 1QZZA 4M7RA 3MAGA 5GM1A 4MWZA 2C7PA 4OX9Y 3M4XA 2GA9A 2JJQA 4QQNA 3FUWA 4HG2A 2JH8A 5EZQA 4OBXA 2CL5A 2HTEA 5K01A 3HA5A 2NNWB 1X1DA 2OZVA 3GDHA 3LBYA 4O29A 1O9GA 1WS6A 1X19A 3GGDA 3TPZA 4IKPA 4CKCA 2UYQA 3IYLW 4EVIA 4ER0A 3ELWA 2ZIEA 4R8SA 4C06A 5KQRA 5K0CA 1R18A 2K4MA 1NBHA 5FWAA 3UJ8A 3O4FA 3T7RA 1L3BA 3EMBA 1YUBA 4LWPA 3GCZA 3KQVA 5K0JA 2AOWA 4MIKA 4E70A 2ZWAA 4RSRA 3HEMA 4PIPA 3SSOA 3TM5A 2ZTHA 2PBFA 2ZVJA 4RTOA 4XUDA 5BW4A 1G8SA 3OU6A 5DWQA 5K0NA 5BP7A 2DULA 4BLWA 1IXKA 2V7EA 5EMKA 5E2AA 2FK8A 5FADA 1ZKDA 1QAQA 5HZMA 4LWOA 1XCJA 2ZLBA 1JQ3A 4KRGA 1SQFA 2P1DA 5E8JA 1TW2A 3NDIA 5D1NA 5K0FA 3P9KA 1M0EA 5C9ZA 3NW9A 2GS9A 4PCAA 4AZTA 2B2CA 4H0NA 1WXXA 3SR4A 3M6VA 3UZUA 5MHTA 2E5WA 3OZTA 2OB2A 2B78A 2ERCA 2YUIA 3EGEA 5K0EA 5GIPE 4GEKA 1RJEA 5T64A 4QQKA 3FYCA 3OE5A 1RI4A 3G2QA 5DTQA 3TMAA 3FZGA 4BLUA 4UOEA 4ER5A 2AOUA 5ICCA 5DM1A 5EMMA 2DPMA 4A6DA 5K09A 2NP6A 3P97A 4FR0A 1JG4A 1ZQ9A 3C3PA 1O54A 3PX3A 2GB4A 2P7HA 3HA3A 2PX2A 2AN3A 3FPEA 2IH2A 4FSDA 4R8RA 4YV1A 4XUEA 1EAMA 1AF7A 2ZULA 2GH1A 3DOUA 3VC1A 3BZBA 3VC2A 3SMQA 1KR5A 1L3CA 4CTJA 5EMLA 5LQNA 3GXOA 1NW6A 3T7TA 4E2WA 3EEYA 5EMJA 1JG1A 3UWPA 5CVDA 1M6YA 3KU1A 5DPMA 2PY6A 3BWBA 3KR9A 1G38A 2LD4A 3TFWA 3UJ6A 1BC5A 4X61A 5FHRA 2UYHA 3LGAA 2QE6A 3RODA 3SVZA 1ZHFA 3KQQA 5EIFA 4RVDA 3FUVA 2PX8A 2XVMA 3DMGA 4KVZA 5DXJA 1SUSA 5D1HA 5FA5A 3REOA 2BZGA 3THRA 1KIAA 1HMYA 4QVKA 3TOSA 2H11A 1JTFA 3DMFA 4XCXA 3B7PA 1VL5A 4FS8A 1NW5A 3FYDA 2AZTA 3UJAA 4DQ0A 1FBNA 1M6EX 2ZCJA 3BWCA 1KPHA 5GINE 5CVEA 2HMYB 5EIWA 1SKMA 3UFBA 1VPTA 2ADMA 3G5TA 5F2NA 2XBMA 1INLA 2AOUB 3BGIA 3CCFA 3ANXA 2AVDA 3MCZA 4BP3A 3OZSA 5LQCA 3FTEA 5G02A 3BWMA 3CBGA 1VIDA 4RYLA 1R8YA 3KQSA 4C4AA 5ERGB 1I1NA 2PT6A 3BXOA 1BHJA 3G8BA 1IM8A 1FPQA 3DXZA 1WY7A 3FTDA 3HCFA 3IHTA 4IWNA 3NWBA 5JR3A 3EVEA 3E05A 4U7TB 2FCAA 5EPEA 1U2ZA 5F2KA 1VQ1A 3K0BA 4KWCA 5FQNA 2R6ZA 5CVUA 5KS2A 5E9QA 5CUQA 4PWYA 1R6AA 3JWHA 5KVAA 3DLCA 2ZZNA 3KHKA 2JH9A 4KW7A 5EG5A 3UJDA 3OZRA 5IH3A 2G1PA 2NXNA 3EGVA 2ZBPA 2AN4A 4OBWA 1I9GA 3OFJA 5LQRA 1D2CA 3DR5A 3I9FA 3CJRA 5DX8A 1YZHA 3GIWA 3I53A 3ID6C 1ORIA 3AXSA 3LHDA 3FUTA 5F2OA 5EHGA 4ER6A 1VE3A 2OKCA 4KIGA 2ESRA 4DF3A 1N7IA 3MTEA 3MERA 1UIRA 3NWEA 3R3HA 4JXJA 2ORED 3OFKA 5B1SA 5P8WA 3SM3A 2H1RA 3C0KA 1NV9A 1PJZA 3GRRA 4HGYA 4HSGA 3HCAA 2BM8A 3HP7A 5DM4A 3Q87B 2P40A 1VLMA 4GQBA 4AUKA 1BKYA 3KQTA 5ICGA 2AOVA 3R24A 3H2BA 4HC4A 2EJTA 4X41A 1EG2A 3LDGA 4DCMA 4ER3A 4EKIA 4M36A 1XDUA 2BR4A 3C3YA 3PB3A 3TRKA 1P91A 3TQSA 3WSTA 4DCGA 3ME5A 4RVHA 4R6WA 5FWDA 3KR1A 2O05A 5DTMA 3LX6A 3HNRA 3GRYA 3BKXA 3MHTA 1R74A 3I5UA 2Q41A
chains in the Genus database with same CATH superfamily
1LJUA 3HVKA 4K1XA 2RGGA 1RCUA 1ACMA 4B6PA 3L3BA 4QGFA 1RHJA 4UVDA 2B1JA 1EK1A 2PU7A 5T57A 3EGDB 2CDNA 2VP5A 3PR2B 4XSHA 2R1TB 3FDJA 3PUHA 2FWMX 2HWXA 2DR0A 4LX8A 2XSZA 3PUJA 4LK3A 4YCMA 1CU1A 2ZUEA 1UBFA 3TLGB 1FU7A 1WETA 4C0XA 1B6SA 3CVOA 5E1DA 1J0CA 3HRHA 4QSHA 1H6AA 1QO0D 2D74A 2PRYA 3I4FA 5C5EA 2VHJA 3AEUB 4M1SA 2V8OA 3SK0A 2OCIA 1O97C 1VG9B 1F17A 5FXMA 3HDVA 5EUCA 2VJCA 3ONEA 3HYSA 4XYLA 4ZKDA 2QE7A 3F0TA 2JCSA 4YUWA 3Q2IA 5I7OA 2XB2A 3LI2A 4PCUA 3UYLA 1KYWA 1WUIS 3BQNB 4XDHA 4R0MA 5ICFA 2ZXFA 2BLLA 4EFDA 4YAKA 1QB8A 1T36A 4X24A 2F67A 4DR7B 3QG5A 3Q8XB 3WYCA 3OJWA 4P1ZA 5JWOA 5KJCA 2H5JA 3L5OA 3SJAA 2QW0X 3LSTA 4FI3C 2GDJA 3OZFA 5B4TA 3KZ1E 3IEXA 4K6CA 3KQYA 3V5NA 4Z7JA 2ZT8A 3H75A 4E5KA 4D8XA 1VLVA 2PTGA 1BGXT 2WWXA 3Q3GE 4B3DA 1GQRA 4XB2A 3TZCA 4KRXA 1UINA 2M32A 3IHLA 1V5IA 1PEKE 2WM8A 3IPLA 1BE1A 3OUTA 4OJTA 4RIEA 2AJLI 5DLQC 4ZI7F 4PZEA 5AVKA 3H5RA 1Y9JA 3E5NA 3WTBA 3VZPA 3DHEA 4Q9DA 1RAFA 2R6HA 2ZJ6A 5HJ2A 3R7NA 2PH7A 1HYEA 1UBKS 3BJMA 4P3XA 3WWCA 1KAGA 1NM5C 4KVFA 3OKAA 4BQIA 1DC7A 1IQ0A 1NVDA 1NG9A 3ZYZA 3TM4A 4BO8A 4Q9HA 2DF8A 4ZMSA 1M34E 3C87A 4LGCA 2FW1A 4EK9A 4DMRA 3IBTA 2LIPA 4JQCA 5CLQA 1PQUA 2E49A 4MMXB 5FQOA 1UMDB 4QTZA 3ZYCA 2NUAA 5AUNB 4LYAA 1EJ6A 3SSMA 5BV2P 2Z1NA 4CUJA 1SUDA 3GT3A 2XDQA 3IAUA 1DDGA 2J7KA 4L51A 4WA8A 2HSDA 4EARA 1SWVA 3GV0A 3E7FA 1E9BA 4TMVA 4D9FA 5EIAA 3H9BA 2JGJA 2REQA 2C2OA 2C7RA 2PMFA 2ZR0A 4Z99A 4EA8A 4A7PA 5ARCA 3PWTA 3I6MA 1WKBA 1NONA 1YS4A 2FWPA 3LY5A 4PVCA 1SOUA 3G6KA 5AI9A 1LQTA 3LBNA 4IZHA 2PIAA 2NU8B 2FSVC 4GUDA 3WXBA 3AI2A 2GHIA 3LPNA 1A7KA 2MYTA 4KBGA 4YNBA 3ABOB 4MQ4A 5FTWA 4FC7A 1W93A 2Z2ZA 2IHTA 2PGNA 4EFLA 1AGNA 3KBBA 1T6NA 1L8OA 3OJXA 5L3ZA 1IHPA 1O7JA 2F59A 2G0AA 3IXMA 3ZTYA 3IRVA 4YRRA 3T7CA 4QC2A 2C96A 1PQ4A 3DE4X 3DHNA 4H1VA 4N3BA 1W0JA 3RRNA 1QYVA 2EG5A 1TF2A 3SFVA 4EBBA 5B6JA 1RTTA 3A6EA 5KVQA 1TC1A 4C07A 4AKGA 2EYUA 3RFUA 4EQ6A 3RV4A 1P60A 5ESDA 7REQA 3T4PA 2M6KA 3ISTA 4R6XA 5KOJB 4J0IA 1ZI9A 5JSKA 2JBAB 3DMNA 2XECA 3DZJA 2QVGA 3FKQA 2W6JD 3LUGA 4MQFA 5KNBA 1P3JA 1UAAA 1JKJA 1IN4A 2O2EA 3UM9A 4ALJA 2IKQA 4LQ4A 4MGIR 2BFFA 1RBMA 3QVMA 5E7IA 2BM0A 3FVQA 1VLJA 4O4HF 5KWIA 1O8BA 4UHBA 3PUZA 4B4OA 4OXIA 4LZJA 1EWQA 4LXUA 4B84A 3VR6H 5I3CA 4A5SA 3PCRB 4QJ5A 3VSEA 1DCKA 3ZD9A 1X13A 3RSZA 2EL7A 3TIIA 1W0CA 3AONB 2HSWA 3DA8A 5K3CA 4RC9A 5CNMA 1JZSA 3VH4A 4ZO7A 1T9ZA 2TS1A 3GR6A 4LIPD 3ZPXA 4XWAA 1MLDA 5ITWA 1YL5A 2RBKA 1EUZA 1KA9H 1TE2A 3GP5A 4RESA 3N0XA 4YROA 4HWPA 4L4YA 1Z36A 1O89A 4A8PA 5B6PA 4CIWA 2GLUA 3NM5A 1NQ5A 1XYYA 2FHPA 4B43A 3IUNA 3RR2A 2AL7A 2FWBA 2BH9A 2YINC 3ETCA 2D2IA 1WSWA 1OB2A 4XJTA 4MYTA 4G63A 5BMOA 2AE1A 1NF3A 1QU2A 1R4ZA 3HZOA 4RWEA 5C5CA 1Z0IA 2NXEA 3O91A 1RFGE 1RVV1 1I1QB 1TM3E 2C2XA 1QLHA 3AGPA 3I01M 3RTGA 1YF3A 1OXMA 1GJRA 2HJHA 2G80A 3HUUA 4PGGA 4E5MA 3LS2A 2FZVA 2V6GA 3AVPA 4GBED 3IUPA 4GL4A 4JC4A 4IRUB 2P3QA 1IG3A 3H1PA 5DM0A 5GTDA 3D4BA 1CTQA 2XDYA 2NV2B 1Z7WA 4JSRA 3WL5A 4AIIA 1IONA 3ZJ5A 2YVAA 5GIOE 2G70A 1CZUA 1D1PA 1PR4A 1ZL2A 3PEFA 1KOLA 4ZDWA 1Q12A 3E9YA 1YFJA 5FWYB 1DRVA 3NYRA 4LDQA 1TO6A 4G0WA 1C7JA 1U04A 2F8LA 5HEKA 1PX2A 2B9VA 3HZZA 3UGQA 1WXEA 2J48A 3V33A 4LNUA 2WK1A 1PNOA 1RBQA 1ENZA 2CB0A 3P4UA 3FVWA 5HHTA 3LSYA 5LKRA 3ESXA 1JHZA 3VR4D 2FPLA 4XZ3A 3RIHA 4EYGA 1EJBA 1E1CA 3B78A 3OOYA 4BGEA 4LF9B 3QMWA 2N42A 4G97A 3Q7EA 5CIYA 1F20A 1F8GA 4EG0A 3K6RA 4JI3B 4ZJYA 1PBTA 5DX1A 3W9SA 4L3WA 4C9BA 1PGNA 1LLDA 2FPIB 4FLEA 2C4WA 3SYMA 2WINI 3FYSA 1RJDA 5JZBA 3B48A 1VXOA 3IXQA 4IICA 2CDRA 4BPRA 1M34B 4WY2A 4BQOA 4E94A 5BQFA 4F7DA 2X41A 3DDOA 4ZXFA 4D9MA 3UG6A 1U9ZA 3BFVA 4AULA 2JLWA 3ZXIA 2H7YA 3OH8A 1EJ2A 1ES9A 1IHUA 1NR7A 3EE6A 3ELDA 4RV4A 5DCLA 1XWIA 1GAWA 3T99A 4CVNA 5B2FA 2QAGB 3Q5DA 4HRAA 3KOMA 2XVXA 3G2PA 5KAMA 5JI2E 1KHTA 2PH1A 2PZEA 1I2CA 3KFLA 2CF5A 1R8XA 1KR2A 3NCHA 5EIBD 2ZVQX 2GAAA 1YJAA 2QR2A 4IGFA 3DKKA 4ZTZB 1EXWA 2F7SA 1AN0A 1ZNYA 4Z9AA 5A5GA 4KZKA 1OC4A 1XKTA 1ZLXA 2P0EA 4EX7A 3VOAA 1UOEA 1ZFNA 4M89A 4ZVMA 5EUQB 1WB6A 2VP9A 1AQLA 5CT9A 4PTYA 4AMUA 3BD9A 1NVVR 1NXXA 4LS3A 2GN4A 4X6YA 2PKWA 2I4LA 1H8EA 3AOEA 1XZJA 3B89A 2I71A 3ODGA 1ODFA 2Q0XA 5IK2A 4OHMA 5GJVC 3B1XA 2XHZA 2G4CA 3C6XA 5J1TB 2W98A 5E6RA 3S1SA 4MWDA 3ELUA 5TGZA 1SUPA 1T43A 4AWBA 3ZCUA 4ECEA 1CV2A 4K26A 1SG9A 1CRQA 3BIOA 2OHOA 2ON6A 3FNRA 4G26A 1KQOA 4QPPA 1GN9A 3CSDA 3SIRA 5DV9A 1MNAA 4LF6B 5IANA 4BZPA 3NT4A 5KIAA 3B3AA 1OWNA 5J5VA 1BSVA 3F5SA 4KOEC 3WGJA 3I2GA 1TLLA 2M9MA 1BN7A 3FTNA 4J0KA 4K9KA 4BMXA 4C4OA 1QHFA 2HBRA 5F7ZA 1LV7A 2RHTA 2CT8A 2HUPA 3CUTA 4ZCIA 5IYZA 1DC5A 3GFVA 5MN6A 1K0UA 3ND5A 4RKYA 2I4IA 2QSUA 2YWGA 3OKCA 4QRDA 2I6QA 3WADA 2CNBA 2CUKA 3ZBPA 2YW2A 2ZU6A 3Q0TA 1RWPA 2ZRBA 4G1CA 2GXQA 4MZXA 2C5BA 2DLDA 4OAOA 4RKEA 4UTRA 4X1YB 4YRMA 3B13B 1A5AB 4YRJA 3OU2A 5GONA 4ATNA 4ETMA 5AXDA 4BFCA 5C0OE 3I2JA 3F1KA 3HFJA 3RG2A 2JAOA 4HRVA 4HWRA 3KD3A 2AW3A 1RE0A 1R4NB 3X1MA 2A58A 1VP9A 1W47A 3HFRA 3IRUA 3KOYA 1OHHA 4L07A 3E7WA 1Z56C 5ALFA 1EHIA 2PZJA 3IQEA 5T3UA 4D3DA 5JI3E 1DAKA 2C03A 4WY8A 5KYGA 1M7BA 3GRCA 1LUAA 1ODIA 2OHFA 2HO5A 3IHKA 3KWMA 4NCKA 2WBLC 4DREA 2NNWB 5HBRA 2IYUA 4S12A 4H17A 3T9FA 1HSZA 2IIBA 3HJGA 3GLGE 3KQNA 4DLSA 4NJMA 3WGNA 4PO1A 4GVLA 3WGLA 5HZKA 1CY2A 2JHGA 2XE6A 4WLEA 5J63A 2ZK7A 3L8FA 3EZ9A 5ILOA 3L6UA 3M4NA 4NV0A 3U7HB 5JMTA 4I6JA 2GF0A 4OSOA 2RHDA 1QHIA 1UFQA 1MJHA 2ZTHA 4KUHA 1GZ6A 3NH6A 4B79A 4MWEA 1J06A 5JH7B 5K0NA 1DCFA 1D0IA 1V35A 2P1RA 1RZ3A 4MKGA 5DM60 2IHJA 2J0EA 1SCUB 4HB3A 4ZAVA 5SV2A 1F48A 3VKFA 3EJ6A 3PDWA 4ZDKA 1MOSA 5F98A 3O8QB 3LFTA 4HN4B 3LRTA 2UZ0A 1E3WB 2OTCA 2FEMA 3IKLA 3V4FA 5K0FA 2CXUA 3JQFA 2CCJA 4UTNA 1M0EA 2A7XA 3A3OA 3G2IA 1KVQA 3LX4A 1X74A 2B2CA 1BHO1 3JQCA 3O9MA 3DEFA 3DO5A 3HO8A 4WOBA 4BP8A 5J2UA 2GESA 5BYBA 4RD2A 4M21A 1NVGA 1TA0A 1U3DA 3FYCA 5AW1A 3BFXA 5BORA 1XEXA 2FSGA 2L18A 3H4TA 1F2UB 1GNSA 4MS3B 4JEHA 4ZDIA 3PNVA 5J2TB 4UM9B 1U63A 3AM1A 1E4OA 1K7YA 4JP1A 4R98A 3L41A 3LY9A 3AR7A 1PK8A 4OHBA 5EIXA 2FP4B 1A8PA 1C1XB 5ADWA 1W0KD 2OCAA 5FI5A 3M6FA 4DSOA 4PHTA 1IJKA 3KIPA 3VM6A 4CYMA 2BZ1A 4J1NA 2HA6A 4HQFA 4UASA 4X8MA 1WP9A 3EWSA 5JSYA 3SD7A 4DM7A 3OCUA 3TJMA 4PO9A 4G0PA 2PZLA 3A4NA 1GL6A 2ASVA 2MSWA 4Q1AA 2VOJA 4G5FA 3EXIB 1NYQA 2ICAA 3C5HA 3AR3A 3Q1LA 4X20B 2DECA 3GEHA 1G66A 4LHWA 1NVKA 2VAMA 3UHOA 3M1AA 4ND7A 4BMDA 4IYJA 5TF4A 1M6NA 2QTVB 3R23A 3WZLA 1KSGA 2GEBA 4D8UA 1FQJA 2OZPA 1S96A 5A5FA 5HQJA 3RUAA 2I1WA 1T8SA 4RPGA 3F2VA 2HREA 5K0ZA 1Q3KA 1P61B 3E9NA 3PQ3A 1HDZA 2VNHA 4NQZA 4J91A 1T0BA 4O6VA 3CINA 4ZI3A 3OKPA 2OPHA 1MO4A 1QRSA 2NYAA 3WIVA 3BORA 4EG8A 1QYWA 2I0FA 1YS6A 3JQQA 3QHAA 4HUQA 3VR1A 1M1ZA 1WV0A 5G0TA 3NBZC 4HKTA 3TD6A 2PL5A 2GSWA 1U0HC 2C8LA 4H08A 2DTDA 1SBNE 3CRNA 2LGJA 4PIVA 3R7LA 5I8WA 1WLYA 3OHMA 1BDJA 1J2JA 2PWBA 3HEBA 2Q3LA 3GFFA 7GPBA 4D79A 4PC1A 2EWMA 2BHTA 2ORYA 3LOUA 1BA2A 4H7IA 4U7GA 2BUBA 5DCYA 3RGGA 1ODJA 3N2ZB 4LVOA 3TTXA 3WYFA 4D4IA 1Y34E 3BGIA 1QRDA 2LDXA 3NG1A 2H07A 5TEVA 1E18A 2EARA 1EXVA 1JMKC 4QG7A 3SBOA 1FNSA 4PRKA 3BDIA 4M87A 1EA5A 2RGNA 1WCV1 3JQBC 5D5HA 1U4SA 4R1UA 3U3ZA 3G8BA 4JR0A 3EGDA 3IHTA 1HDRA 1X80B 1YZKA 2R1TA 3BH0A 3JASB 4NBWA 1M5TA 1P1HA 1V3TA 2HRQA 4NG4A 4QOHA 3U19A 1V8FA 3CNLA 3GZ4A 3NC1C 2OFFA 3A4IA 3IA2A 3ZLUA 1GAEO 4NJEB 4FMDB 4JLPA 2HZBA 2YJ5A 1ZH2A 2JIRA 5CUQA 3TLGA 4F5WA 2VHTA 1VOTA 3KHKA 2JH9A 1TD1A 4LBWA 3P0EA 4UHCA 5DH9A 5F1KA 2J5RA 1FC0A 1D2CA 3VHQA 4O4IF 2ZPAA 5DX8A 1P80A 2DE0X 3AEUA 2VAXA 3GIWA 4J7XA 1GGHA 1GGMA 3RJ9A 4BNWA 3CISA 3EODA 3QSGA 3WGUA 2BRUC 3CLRC 5LYJF 2OORA 5IAJA 1UPUA 1N7IA 4XIGS 5JO9A 3TE7A 1BNCA 5BY2A 1NX6A 1D8AA 2HJRA 5FWNA 3Q7IA 1KF0A 5FLYA 4J2OA 4DQKA 4AUKA 1Z2NX 3PQDA 2R96A 1ZMXA 5JJKA 3L8GA 4Y8VA 1A27A 4RL6A 4X41A 4JBIA 3IERA 3RREA 4DYHA 1AUQA 2BR4A 3C3YA 1ZNWA 9LDBA 1NLYA 3AEXA 1T10A 2FE4A 3RIYA 1U2EA 3L7BA 5AW7A 3KR1A 2I8LA 2O05A 1CUHA 2OG1A 2VJDA 3DDHA 3HNRA 4MR7B 1VGRA 1R10A 1XVTA 2CYBA 2RCNA 4DR1B 1WDLA 4LV8B 2Y1WA 4D6XA 4TKMA 4XTRA 3ZS9A 3R8XA 3ZGXA 2CHUA 3B6MA 4QU5A 4XFDA 4K6HA 4D41A 2Q6IA 2RHCA 4NPCA 4QBKA 3T3PB 2NVBA 3GP3A 4X7PA 3C1AA 4B31A 2Q5CA 2JC3A 4AX8A 3LD9A 1VLLA 5LDDC 3OEEA 5LC1A 5IJ0A 4FD3A 1ZG3A 2G06A 4NU5A 5HK8A 2D5CA 2I76A 1UMDA 4E3ZA 1B4DA 4FFPA 3KJXA 3WYEA 4M8KA 4MGZR 1E58A 3IO5A 1K5DA 3C5WP 4RLFA 3BCUA 1Z2CA 4KQMA 2CWDA 3RADC 3BFPA 4OCZA 1JPVA 3AP1A 5EVJA 2GK4A 1JVBA 5JLJA 2HA4A 1OKKA 1JECA 5KTRA 4R2WA 2HA2A 1ESCA 3JYLA 1GZ4A 5DYIA 1U9IA 3QFSA 4JLSA 5A3VA 4B6EA 1IY8A 1YONA 2QGFA 4UU1A 1JU9A 3W78A 2OVBA 3RS5A 3CPHA 3KTDA 5K3DA 2NU8A 3MD9A 2V4MA 2WF7A 4M8LA 1NNUA 3W5BA 1JFFA 3EWIA 3KEMA 3N07A 3P9XA 4KAJA 5EZ6B 4DWWA 2H31A 4NZMA 4RNDB 4MLPA 2HI0A 1C80A 3L4SO 3UF0A 2SKCA 2JANA 1YC5A 4HH3C 4I5IA 3AF4A 5FYDA 1A69A 5L8VA 1OGYA 3DLHA 1T1EA 1IWBB 1A97A 4NCIA 3PQ5A 5BW6B 1DAMA 2X2FA 4QFCA 1ZD8A 1RYMA 1BYUA 1YRAA 4MKIA 1F6BA 3G8CA 4IZOA 4P4TA 2ETXA 2IHYA 4BKQA 4EUNA 3ORSA 3P9CA 3KU4A 4IXNA 2Z6QA 4L6IA 1O97D 1CUCA 5KOJA 3GGOA 2JBAA 2WIDA 4A0FA 1DRJA 2EDCA 2V1XA 5E1OA 3BJEA 4G1UC 1KC1A 3V34A 4TZ0A 1Q74A 4PGFA 3LBFA 4Y30A 1C7IA 1O9HA 4GXRA 1RRCA 2DPGA 3ANLA 1SPBS 1OLUB 2BGNA 4H1UA 1B43A 2FMKA 1K9VF 1E2FA 1MO5A 3PZRA 2GJ4A 2O0LA 4P3KA 1SVNA 4ZQIA 1W6UA 3Q5GA 4WLFA 4MV1A 4TTSA 1TXGA 2CVZA 1P0MA 3JQAD 3QA9A 1ZUIA 3EN0A 1PZMA 2EP8A 4Z4EA 4LI3X 1XSEA 2PZ8A 3M2PA 1ZGBA 3TSZA 1DEOA 4B7UA 3OZCA 3KVRA 4MGKR 1THGA 3BUSA 2G36A 2AN5A 2B4RO 2GAJA 3A1VA 1WXDA 3IHWA 3S2YA 1KI9A 1NNSA 1ONOA 2ET6A 2UDPA 3ETNA 1Y3FE 2H00A 3FHCB 3LZDA 4X1OA 3TSCA 4IIJF 4L5AA 4PFQA 4TSKA 5CNJA 4WESB 4N40A 6Q21A 2LCIA 2DLNA 4F2PA 4X95A 1N1MA 2RGXA 1DO8A 3G7UA 2C4VA 3QHQA 1TKCA 4O4LB 3EA5A 3TIXB 4DT1B 3WYDA 2G83A 4UNRA 4ZI2A 1UBCA 1P1IA 2BDEA 3ONVA 3IPRA 3TKLA 4WOJA 1Y5RA 2KBEA 4IF6A 2J07A 4Z1OA 1YCGA 4GRIA 4XYBA 4H60A 4NZOA 4IIDA 1Y8ZA 3T0IA 1LVGA 2CKMA 3WLMA 4QA9A 3DZGA 2J3KA 5H0IA 4GC5A 1PYGA 3B5IA 5FWYA 2PVSA 2O3SA 4AWAA 1X1TA 1VLZA 2H1FA 3V3KA 2O8FB 2QLBA 2Q3BA 3WYNA 4CCYB 3A4LA 3A3NA 3QIAA 2R0QC 2P41A 4UEJA 3N6VA 1ZN9A 3GIDA 3EF0A 3O9ZA 3H2SA 1WPGA 5K6TA 4EUSA 3C7KA 1WKVA 3OPVA 4KI0A 4LISA 4CU2A 3X1DA 5BUCA 4DR6B 5JAOA 5THXA 1F3OA 5C2JB 2R25B 2XTAA 4JSYA 4N54A 3OPYB 4F72A 3I0NA 4G65A 2QPLA 4O4JF 1XHFA 1VBNA 3R3JA 4KQ9A 4PYQA 1Q0QA 2CHEA 4IJMA 4TT8A 2AG5A 4UXJA 5EHNA 4BKPA 4RS3A 1OYOA 3D3QA 1M34A 3DE0X 4MYRA 2ZDHA 1X8XA 4RDHA 3DTVB 1N6NA 1B00A 1OBVA 3R4CA 2PGXA 1Q84A 1H0RA 2YVLA 4B73A 4DMKA 3COYA 4MROA 3UWKA 2QENA 4Q3LA 3IVMA 2P2YA 2QAGA 5EY5B 2Z4TA 5LXTF 2IRWA 4DUGD 4MPRA 3Q3JB 3P4XA 3UJNA 2P67A 2JEYA 4C4XA 5TS3A 3GFQA 1T8YA 2YQZA 1Y7PA 3RFCA 2PMKA 1XAHA 1RKUA 4DSUA 4AM8A 2DEUA 4QUIA 1Q7TA 1XL0A 2JBHA 4N9WA 2PX4A 4RV5A 5JY1A 1VSQA 2BDUA 3JYOA 3AG5A 3T7IA 1OASA 5JCPA 1C4WA 3KWFA 1UK9A 2E4WA 3TMYA 1DL5A 5HTKA 4CCAA 2QVCA 3HR7A 1JPNA 3LK6A 4UMEA 1CUBA 1LBSA 4OKNA 4BVBA 4GKBA 4LZPA 4FYIA 2ACKA 4ARBA 2HADA 5JNVA 1GZHB 3RVJA 4QPJC 2AFVA 5TXGA 3OPXA 4R2LA 3TIGA 5C52B 3W1EA 1UBLS 4PG7A 3SQMA 3F8SA 1FDTA 3DFKA 4EECA 5EIOA 2PLAA 2VF5X 2JDID 4L1KA 1VE1A 3DCYA 4J03A 5KQMA 2O2HA 2QVZX 3K16A 4ARSA 4ES6A 2BHNA 2HM7A 4D9GA 2PS1A 4OH1A 3UGJA 1NXVA 3ICPA 2FZ5A 2ILVA 2QLMA 2EX0A 3LZCA 4KQIA 4XYMA 2ZYGA 3ZHBA 2VLIA 2XUDA 1IM5A 1RHRA 4JSTA 5I9BA 2DB3A 3TQFA 3DXFA 2VDMB 3LDUA 5JV5A 3PTAA 4GOND 4B3RB 4CEIB 1HQDA 3ICOA 2H9IA 4DGSA 3GN1A 2YJGA 4IUYA 4OLAA 4KOAA 3NETA 3T4UA 2QBYB 2IXAA 4IHKA 2FP3A 3HNOA 5THKA 4LJ7A 3MK31 3CTPA 2ZS7A 3R3UA 4FNMA 4X1YA 5GY7A 5CPBA 4ZHQB 2VHEA 1P5FA 1UKAA 1MO3A 1RKBA 4Q4CA 4I36A 1PR1A 3T1TA 4RO0A 1XVUA 3HABA 4OQLA 1ZN7A 1SN7A 4FUQA 2OBNA 1NBME 1U6KA 1UIMA 2WD8A 1FFDA 1RQPA 3AUKA 3GUCA 4X8HA 5CM2Z 5HIIA 1R4NA 2WZQA 5L3SB 4WE3A 5BWMA 4B8YA 3FZYA 4TL8A 1MAHA 4HNRA 1N75A 2RG1A 1AS3A 1QFJA 3DZFA 3IPXA 1NQWA 2RI0A 2KM1A 3NONA 5JCJA 4H1TA 4LYYA 4FM9A 1W19A 2GFHA 3NOQA 1EHCA 2YHIB 2WJVA 1DKOA 2GETA 5E3JA 3KKZA 5TPWB 3CF4G 2UUOA 3ND7A 3SSNA 1R5NA 1SCIA 1AXRA 1IEXA 2WKSA 2ZSUA 3DAOA 2V7UA 1KXZA 1LPAB 1N6OA 5FPYA 4FQ5A 3ZIDA 4PYJA 3TH5A 1EUCB 4XM2A 2DRIA 1WQ3A 1TTTA 3PI7A 1FMCA 3OQIB 5DK4A 1WOMA 5LD2B 3COPA 3T9AA 5K3FB 3VKHA 4LV5B 8ATCA 5K4GA 3V7UA 2CLOB 5EJIA 2D5AA 4M0DA 2G71A 2CFIA 2HA0A 3V1LA 4HDQB 1B16A 2Z3ZA 3M33A 3HKEB 3MJHA 1NW3A 1U8CB 5T67A 5JH7A 2NAPA 3P2IA 1U94A 3I52A 3L0OA 1Q0SA 3U26A 5C8YF 1UXKA 1SCUA 3CZCA 1YJCA 3DE1X 4JP5A 3WB2A 3ZNPA 5HOQA 5IWCA 2QTAA 2JFNA 1GNVA 3O8QA 2DFNA 1E3WA 1B6TA 1JDSA 4X8LA 4D02A 1XZQA 3A28A 2GHRA 4U7PB 1ZD4A 5KZMB 1P17A 4CV2A 3ROGA 4GNRA 1CRWG 2C42A 1IXZA 1DC8A 2QXTA 2RMKA 3K70D 1U0GA 2HWYA 3KJEA 4O2BB 2VEOA 1YU6A 3TIFA 4JITA 2B1IA 1E63A 1HNNA 3KYDB 4MS3A 3T1OA 1F2UA 1L6RA 2J32A 3DNFA 3CLTC 3MGCA 4NLLA 4TWIA 5J2TA 3D3NA 4OX9Y 4BFVA 4W8GA 3OCVA 3Q3IA 1QQ5A 2FP4A 2P77A 3R3SA 1MOPA 1C1XA 4KIWA 4KO3S 4Q93A 4QDZA 3OEYA 1D04A 2XE8A 3IUJA 4ZARA 3TLKA 3OJEA 4EVIA 1V1MB 4H27A 3IT1A 4LX0A 5B6IA 1BYIA 2XI4A 3OZXA 3DBHB 3A1TA 3E8XA 3ET4A 2Q1XA 2RJOA 2AW5A 3MOGA 5I4IA 2OCGA 4ZVVA 3RARA 5GOTA 3EXIA 2RGUA 4X20A 2EKBA 1QIHA 4LRTB 4XM1A 1UDWA 4B4WA 4WBXC 3KZOA 1DEXA 2IS2A 1O6BA 2QTVA 2CZQA 4RABA 4B9EA 2CLMB 1C1HA 1P19A 4JBHA 4KFUA 3PTZA 2QV7A 2ZI6A 2BUAA 3HBLA 3K9QO 4WX2B 5JFOA 3DLAA 3NHBA 2ISQA 2TMDA 3EIHA 4L5CA 1QPBA 4IDGA 4OI0A 5HM6A 1EK6A 1E5TA 3CR3C 1GRVA 1Z34A 4Y6RA 1EX6A 4XA8A 2DAPA 3NCTA 3RU2A 1O08A 1EGHA 1W48A 2QX7A 3EVTA 2DC1A 5KYWB 3P9KA 5EA2A 5IUNC 2XYGA 3GARA 4EHDA 2J9GA 1Z18A 3OUUA 3BN3A 3FPLA 4MIEA 2P6OA 1FJHA 2VK4A 3PGA1 1HDYA 4KQCA 3K30A 4FHZA 4MP8A 4ZVKA 1J0AA 1S3SA 2EBWA 1OI3A 2IYQA 2H5EA 1E2KA 5LOVB 3PQEA 3DKPA 5AUOB 3BBPA 1VGVA 5LP6F 2J3EA 5H1YA 1HX7A 3O3NB 2X4GA 3C7TA 4JNCA 2W93A 2Q0HA 4ZAYA 1Y89A 3OP4A 3OIFA 5CYPA 5BT9A 2WG1A 3L0CA 3ZWMA 2GTIA 1OAKA 4TWJA 3LC1O 1KJIA 1T9HA 2KQUA 5KSYA 2NSHA 1X80A 3JASA 1W4LA 1J39A 2QIOA 4Q9NA 1AKUA 1Q21A 2PSJA 4MICA 1UFOA 5JVDA 1ZJ6A 2YZ7A 4NJEA 4FEYA 4CT0A 3ER6A 2CW5A 2UZ1B 3HB0A 1P2UA 5ILGA 2F62A 2FZGA 3MUFA 4CL8A 5TPZA 5HKLA 1A0OA 3CPSA 3KSRA 2ZPTX 4ZMBA 5JNUA 4G0XA 2PNFA 1SGWA 3UV7A 3M3PA 4QULA 4OMCA 2QOEA 3WLAA 4NTZA 3IEUA 4ZHSA 2J6IA 2GZMA 3DF7A 3KTOA 4B35A 1AKVA 4LRQA 1NFQA 1PKEA 3VMFA 2Q21A 1D3AA 2GEUA 2EZ8A 4DABA 1LJ8A 3PC2A 4WDQA 3RBVA 4O33A 3D4OA 1WE2A 4MB2A 1TLFA 1M6EX 1HYQA 1KTVA 3BWCA 5U4QA 1KPHA 1L5LA 4QXOA 2ERXA 2V9ZA 4EP1A 2A35A 1GPJA 5EJ5A 2ZI5A 3LW8A 2HF9A 4TL7A 1ZEJA 3OCCA 3MGKA 1AZLA 3IP6A 4MR7A 5G0WA 1R9MA 3VJKA 4DSNA 5ICMA 3NIDB 1Y9AA 5EPOA 3WQSB 1GPLA 3QPAA 2WWIA 1BWQA 3HVUA 1BHJA 4K2AA 2FG5A 4YRAA 1X3LA 1HFJA 2KE5A 4UXIA 4F06A 1UUFA 2HCJB 2JD2A 5FEMA 1ZNXA 1BQEA 3CLSC 5LP6C 5A9RA 2QRPA 3K0BA 3KOXA 5FV4A 4Y2RA 1AHHA 4EA6A 3IPYA 1Y33E 1ONBA 3TSAA 4BC0A 4GZLA 3GA5A 1QF9A 4CKXA 3VR2A 1OWLA 3I5AA 3LRXA 3GF4A 5JS7A 3AIKA 1LNSA 3F78A 4IIUA 4PG8A 1XAIA 4LUCA 1EQ2A 4K9PA 1SBYA 1QIIA 4AJJA 4TLBA 3W6OA 1P6QA 1VE3A 3I9KA 4KIGA 2ESRA 4A92A 1XK7A 3EWAA 3QLUA 5B1SA 3C7AA 4BNUA 1QV9A 4BO1A 2NMVA 2FQQA 1UQRA 4D3FA 2W2XA 2BM8A 3LUHA 2D59A 2ZR7A 4ML3A 4DDWA 2FW7A 2H8KA 4ND1A 4Q7JB 4UZSA 2RIPA 5AIBA 2AFIE 2Z0MA 1YJXA 3HJRA 2WWFA 2I1VB 1T5HX 2C0QA 3IOCA 3PC3A 4DMMA 4CIAA 2ZTLA 4XDZA 4F4HA 2JGRA 5M2QA 4A10A 4D6YA 2QLJA 3IVXA 1KE1A 2PRZA 1GTZA 4BGVA 4BNJA 1FMFA 1VE9A 1IZ9A 5IXSA 4B1FA 4D46A 1PK9A 3AKZA 1B26A 3ZDXB 2FNAA 5B64A 3THXB 3GMTA 5FTNA 1QG4A 2ZYIA 3TYXA 2I91A 2BKUA 1XKQA 2PO7A 2XUIA 2IYNA 1L7DA 1CP2A 1SHJA 1QGAA 1P2TA 4FPXA 4UEQA 4ENWA 1DARA 3D8RA 3FSGD 2C1EA 3FFAA 3ZC3A 4ESVA 4HLUC 1DQZA 1O94C 3AHFA 3UK7A 4KBYA 1TO1E 2J67A 2O2IA 3C6KA 1OLUA 1X0VA 1P1RA 3HHPA 5TF0A 3L7CA 3T5MA 4BV3A 5JROA 4ZYZA 1RVDA 5CD1A 1QQAA 4KN8A 2IBSA 5CFNA 4TLLB 4OX9B 5HG0A 3G3EA 2C0CA 2Z6VA 4CEJB 2R8PA 3BFJA 3C1OA 3HA7A 1IY9A 1QFXA 3A6ZA 3HYRA 4E2ZA 4E31A 4I66A 2VZ0A 4R8MA 5L7YA 4F3RA 1U11A 3HY6A 3FPJA 4CTKA 3OLQA 4PZDA 4QJ3A 2K7ZA 4GYYA 1X1BA 5I3ZA 2CEKA 2FF7A 3I6ZA 1KO1A 3GQBB 1NN1A 4IV0A 4Y7DA 3OEWA 4HDKB 4I50F 3W7BA 5JW6A 2BYTA 2JCGA 1OIXA 4I81A 4R84A 4WESA 4F11A 1NQUA 3OURA 1SK8A 3P94A 3JD0A 1LC0A 2PR7A 1UZLA 2Z30A 3B6KA 5AVUA 3WWPA 1TZCA 2FW9A 1AV7A 1EBBA 3AW9A 5JPCA 4DT1A 4O4LA 2HIHA 1XRRA 3DWEX 1JEOA 3O95A 2IOFK 1EVEA 1QYXA 3H8JA 4K05A 4QWMA 2CE7A 1KYIA 5E9WA 3GNSA 3VPGA 1JWBB 2WSYB 4DLWA 2AKYA 3NJ8A 1KYZA 1QV7A 5A3RA 4URHA 2FPRA 3MGGA 2VWHA 1NG1A 3GAAA 9ABPA 1B7GO 1P1KA 2WILA 4ZZ1A 1MFPA 4EPXA 1T6BY 1DP4A 5AIAA 3OP1A 1KFJB 5AVWA 1VHTA 5KSOA 1N2EA 3NATA 2YFQA 3PFHA 4FR5A 1IYZA 4OHXA 4LXTA 1E59A 2DFPA 2PS3A 3G8YA 4RD3A 3MELA 5DLYA 5DTEA 5SYNA 3ZHUA 4CCYA 4EW6A 4AP9A 3T3EA 1XU7A 3QJYA 3QGMA 4CTOA 1EZ4A 1AJEA 3MWFA 4OH7A 1PJQA 5TGTA 4B7CA 1Y9EA 2EKQA 1VFPA 2J9FB 3KPWA 3P9NA 4K9DA 4R9VA 3N59A 4HO1X 1JYSA 3URMA 2F1KA 3IKMB 1EP9A 2Y6UA 3O1HB 3OPYA 3PX2A 4M37A 4ZI7B 3U61B 4R05A 5EXSA 3G5LA 4NR0A 3BXGA 5AJUA 3NOOA 3QE9Y 1CHNA 3PEUA 3DEJA 3FXAA 3R1IA 3UVEA 3ZWWA 5JOQA 1WF6A 2VQ3A 4RMIA 3AEKB 3DTVA 4Y0AA 2IVFA 2RI1A 3R5FA 4PLVA 2JL1A 2EOAA 3S1AB 4TVOA 1VZ3A 2NZUG 4NOMA 2PUEA 4EUFA 1Y8QB 2VAWA 4ARIA 3WNQA 1EWRA 4LXYA 2WKRA 1PTKA 2DFVA 1GGFA 4ADSG 3O8DA 4QL3A 2GK6A 1YZVA 1NVWQ 4HP8A 4TMXA 4O1IA 5BRAA 3T5AA 1TM1E 3C8ZA 4B6SA 5BN1A 1D4AA 2ZT6A 2V74B 1PP4A 4H3KB 4MHOA 2OHGA 1CP3A 2AA3A 2V3CC 3K6JA 1RC8A 2AFIB 2N47A 2Z09A 3PVCA 4GR5A 3Q4GA 3UJBA 2HXSA 2MOKA 3ELYA 1RZRD 4FU0A 2G0NA 4F8YA 2VBFA 2FZKA 3B20A 4IDEA 5ALTA 1I7SB 4V0LA 2VC2B 4I5FA 4XR4A 4Z1MD 2IC5A 2E4ZA 4BMSA 5HW0A 2OVFA 2VYVA 4U2DA 4BBZA 2WFAA 1ZGJA 3ZXUB 1S2NA 5ER9A 2FXVA 4XJSA 5C80A 2IHUA 1FRQA 2FN8A 4XCQA 1UBEA 4DCSA 2F3QA 4M0LA 2IFTA 1QQTA 2GNPA 2XNKA 4K0RA 2CLDX 1L5WA 3BREA 3I04A 4QXRA 2D5IA 3UW3A 3ZS8A 4WIAA 5DBHX 3MWLA 5BWBA 2XCQA 1L8XA 4GZMA 3EDCA 3KT3A 5K05A 1EK5A 2IEAA 4CEIA 4E51A 3IPCA 3FBTA 2WPDD 1Q91A 2VPXA 1A7UA 1V4BA 2VUUA 2XT0A 4FZJA 4HLQB 4O4HB 3UHPA 4BFLA 2QBYA 4DJAA 1DI0A 3IAFA 2L82A 3UEOA 2O8EB 4ZHQA 3DL2A 3EEIA 3LO5A 821PA 2J59A 1DU4A 1UMKA 4RPIA 3VDNB 1CSEE 3AF5A 3UJHA 1EM8B 1I80A 1Z5OA 1CQJB 3UA3A 2W11A 4LVCA 3UGKA 1KOFA 3H19A 4RK6A 5L3SA 2P69A 5KCMA 1JQKA 2NPOA 2J3QA 4JT4A 3G0BA 2YYSA 16PKA 1JG6A 3OWXA 3RNOA 1J8QA 2PQ0A 1U2TA 4J16A 1PRYA 2QX4A 1JXOA 4NH0A 3WA7A 3RS3A 4RFVA 3FZNA 2HQ1A 4JBLA 5C5DA 4S1OA 3H9JA 4X85A 3V55A 3U7QB 3PA6A 1HO3A 5BQ5A 4CMCA 2QSZA 1EGAA 1NVXQ 4V02A 1C1YA 3PR3A 4EEZA 2YHIA 4KRFA 3ZW8A 4MIYA 5TPWA 3PGKA 4H15A 2W83A 2WSBA 4MGEA 3Q41A 3TFQA 1V26A 2YWJA 3SS9X 4NU8X 1N2HA 3BE4A 1P39A 4LPKA 3RF6A 4YLYA 3AP3A 1EUCA 3OFND 1L6IA 3PDCA 2XUAA 2P27A 3JWGA 4MVJH 2RHHA 3OQIA 4B81A 4PANA 5K3FA 3D81A 4WKPA 2W6NA 1B3BA 1I24A 3PIDA 4KQWA 3I76A 4WUTA 4I3HA 5LU9A 4P54A 3UJ7A 3HKEA 1RXEA 1IVSA 1I5RA 3OHPA 3CJTA 4R9UC 3MFYA 2WV7A 5A6VA 3TOXA 1DQSA 3BA6A 1A82A 3QWHA 4UJ3A 5CFMA 1LBHA 3OE1A 1YCHA 3OT5A 3RWBA 1EZZA 2D06A 4EFMA 5LMUB 1P74A 1TEHA 3O47A 4Q03A 2WG2A 5CDSA 3UPDA 1I6MA 4S35A 3RHSA 5HKOA 1YA6A 4KIFA 1D6NA 2EF1A 5GM2A 1E1DA 1SBCA 1XZAA 2FZWA 2Z9CA 3WNBA 3C14C 3BMCB 1TJ3A 3V97A 4O2BA 3ZGNA 1YZYA 4QDJA 3KETA 5L6LB 1KOGA 4W82A 2XGMA 4BVFA 4PGMA 4GMFA 2UZ3A 4YMTA 2JFZA 4J2TA 5B58T 1ISJA 4CMBA 1BROA 4XIFA 1I3CA 3KYDA 2ADFA 4OMFG 4AC9A 2JGKA 2OR3A 4DCOA 4E32A 5DN6D 5BXQC 5AI4A 2FB9A 2D0IA 1VECA 5I47A 2AMYA 2UYOA 5T8KC 4S1VA 5IF3A 5K8UA 3BIXA 2XRFA 2X8AA 4K1LA 1JXQA 2WLTA 4N01A 1H3FA 4MJLA 4P3OA 3FFXA 4Q1DA 1EQAA 1L9KA 1V1MA 1HLPA 1YDHA 3DAYA 4Z2AA 3IBFA 1Z2OX 2YVUA 3KPUA 2BGKA 4B17A 5FDFA 3DBHA 5ABPA 1Q1NA 4CMJA 1QQ7A 3ICCA 3L79A 3NDRA 3WNVA 4BVJA 3FPBA 3NAQA 3QPVA 2RE8A 4DMGA 4KVGA 3PS9A 3H97A 1I2AA 2XADA 4GI1A 4I4TF 1J0DA 4ZALA 1NUTA 4NYMR 2XF8A 2QRVB 3TVYA 3DD1A 2OBXA 3MJ4A 3ROQA 1WVMA 4M46A 2J08A 1T5TA 1D5WA 2VRCD 3EXG1 2C2HA 1ZUHA 3VDXA 4I1PA 4LZOA 4MYCA 3ZV4A 4X92A 1QH9A 1GDTA 1AS2A 3LQ1A 5EJ6A 2P9CA 3RC1A 1M2GA 3QYPA 5CVCA 3TCNA 4MWCA 2CFRA 4H7DA 4ID3A 5KYWA 4DAOA 5A4KA 3F96A 2REXB 2PGLA 2WJPA 2BMAA 4KB5A 1QFSA 2BV3A 5FHQA 2Q1UA 4KQ1A 3RT7A 2K6GA 2PKXA 3UATA 1SG0A 4K3VA 3JCZA 3WX0A 5BSTA 3S2FA 4XH9B 1YAHA 1EGMB 3NBAA 3WL6A 5LOVA 2IEYA 4EJ6A 4L9AA 1SU6A 3I34X 4BNZA 1V6SA 1YVUA 2PUWA 1EVZA 1H6DA 5GM1A 1UBMS 2QN6A 2JJQA 3FUWA 1HWYA 4F1WA 1MPXA 4W5NA 2JRCA 1MTZA 1T9AA 3BVPA 1QYDA 3PSHA 4RHCA 2BF4A 2CL7X 1KAMA 1QIGA 1T9KA 1WS6A 1YBMA 1VKHA 1X9GA 2H9AA 2UYQA 1C14A 3OOJA 3PQ6A 4PG5A 3WMFA 5GZ3A 2P9HA 5DNYB 2CXRA 4BE7B 5FWAA 4URFA 4ZGWA 2FRDC 5JZVA 1FLVA 1LDBA 3GCGA 1Q22A 3GCZA 3UFXB 3U4CA 4OI2A 1NBMA 1OLOA 2UZ1A 3SSAA 4LGYA 2VPTA 3M1LA 3PT5A 4GBJA 2WIJA 1PN3A 1XVLA 2ZVJA 1U99A 3EOAI 2DULA 5BMVF 4BKRA 2O6HA 4RGYA 1ESDA 1J00A 3SI7A 2P9GA 2RH4A 3ZXXA 4BWFB 4MDEA 2WHQA 4DB2A 4S04A 4ZYWA 1FRVA 1N2IA 2HA7A 3CLTD 5GV7A 3C3AA 4BNYA 5H8WA 3IEKA 4CKEB 5KREA 3H2JA 4YRIA 4F1KA 3KZNA 3FDXA 3NW9A 2VTVA 1LZLA 1VHQA 1N3YA 2RDMA 3CB4A 3IUYA 3T7AA 5I7FA 1ABBA 3PEVA 3W5CA 1AKYA 2GX6A 2R7MA 2YUIA 5AOAA 3EFBA 1RABA 1BHSA 4M86A 5I6DA 4CL3A 5ADHA 1RI4A 1N32B 2NO7A 3E1KA 3G68A 1HZZA 4L0CA 1XZ8A 3ESCA 1XT6A 4F5ZA 4NPAA 3K92A 5FD8A 4G0ZA 5A7FA 3LYUA 4GP9A 2VUIB 2ZTVA 1EXNA 3KXLA 3GZTB 4MVCA 2O8CB 3CNBA 3QFRA 4L73A 3ACBA 2C9YA 2RGEA 3P5SA 3OJOA 3PJGA 3PX3A 2AK2A 1QZ3A 4V3CA 1VG1A 3IFSA 1QOPB 2X7JA 3U17A 1RWWA 1V7QA 2BBSA 4R8RA 4A0RA 1IOWA 2O7VA 4C30A 1MD9A 4MV5A 1NPDA 5BVGB 3VC2A 5JBIA 5CTAA 3S2SA 1C7EA 1II8B 1BEZA 1QLWA 3HZRA 3QYJA 1RAGA 1EFRA 1DC6A 4IJWA 3FI9A 3NNSA 4X7MA 4NMXB 2RKOA 1ESMA 4FQ7A 5JXHA 4UUBA 2Q2QA 3NGXA 3HUFA 3KL2A 2R8EA 3NKFA 4ENQA 1M8GA 1SIBE 1WW2A 1RYZA 2QDXA 5FHRA 2XXJA 3GJQA 3T0FA 2F9FA 4PR3A 3UXYA 2FGKA 1ZM2A 3ZHCA 4CZ2A 2BY4A 1B2RA 2IGBA 3GK3A 3LLMA 1FSZA 1ZS9A 1QMPA 3BDAA 1F6WA 3MRSA 4KVZA 4Z53A 4QASA 1ZHOA 4QSMA 3REOA 3SNHA 1KIAA 4QVKA 3IKJA 4GMHA 3VKUA 1H0KA 4WUVA 4Z3DA 4UBOA 5LB4A 1NW5A 1ZD2P 3TNYA 3IP9A 2X1MA 1JG7A 1M6HA 2WT4A 1G16A 4HADA 4LJ9A 1COWA 1U7ZA 4LJAA 4QFMA 3JSXA 3O0DA 2YJTD 3B51X 1L4NA 4G23A 3K53A 1VPTA 2BGMA 3RJTA 1T5OA 3TMKA 3RT9A 4B46A 1K27A 1CDOA 3CCFA 1ZJZA 1KZYC 3UANA 4AQYB 5ALWA 5LQCA 1R9JA 1AMUA 3FTEA 2JAUA 3B6ZA 3BWMA 4HXYA 1BVUA 2ZG6A 4R31A 4YCJA 4C4AA 3C45A 1EB9A 2YBEA 3UPUA 1DOZA 1NUUA 2Z8YA 3BD6A 3AI7A 2XLCA 1IM8A 4EH1A 3W8EA 8MHTA 2NU7B 2E4VA 3THXA 1JH8A 1RLUA 1RWOA 2FE1A 3EUFA 2Q5IA 4QO8A 5SY9A 5JNWA 3MOIA 3A6HA 5FQNA 1OA1A 1WDWB 3FBGA 2UUBB 4L9RA 4KYTA 2FMFA 1NLUA 1Y7IA 4PZCA 2QL7A 1KMHB 3RYCB 2EFGA 5IH3A 4GLLA 4HGNA 4JT9A 1IUOA 2A0WA 4TM8A 1KKLA 3OD5A 3F9RA 1CY1A 2QAJA 1N6HA 4G89A 4RDXA 2X0KA 1GTJ1 3I53A 1M5UA 1P3DA 3EQ2A 2JJ1D 2RCYA 4ER6A 1UP6A 2NTVA 3QLVA 4NEGA 7ABPA 4DF3A 4CEJA 2OWEA 3KBOA 1ZVJA 2ORED 2ZPUA 2Q3MA 1F2VA 2C9ZA 1KKMA 1TAHA 1CE8B 4OGFA 4AN1A 3V4RA 1QJCA 2X9QA 3SZOA 5FA6A 4GRDA 5HIAA 2O3UA 3BRWA 1DXOA 3GQBA 3VMMA 3DPIA 3MSXA 3RAJA 1U2PA 4HDKA 4K9OA 3N0VA 3H2BA 1MJ5A 4QYTA 3N8IA 4M36A 4YP6A 3O2QB 5B57C 1G0OA 1JGTA 3KSDO 5DZSA 1K98A 1QTQA 2W4QA 4DW8A 2C98A 4EGCB 4D98A 2CHFA 4FMCF 3MMZA 1FVOA 4CF6A 1W36D 2YQ4A 1RXWA 3MTQA 1EDBA 3G9ZA 1DXYA 3PP8A 1P1CA 3N05A 3Q5EA 4WLNA 5DSXA 2BGIA 3EBLA 4FE3A 5EJMA 3UJPA 4RTPA 1D2RA 4O4IB 5HILA 2HQOA 2FLVA 1DLJA 2AS0A 1BZYA 1N2SA 2I1QA 1ZUNB 2PUHA 3AIMA 3IMGA 3R9KA 4C0AC 4URVR 3NR2A 4DM4A 1Z7YA 4BO7A 1D8TA 5LYJB 1WTAA 2RONA 3IB6A 4JELA 5G1NA 4X3OA 3HDJA 1GUYA 1DEKA 1HG0A 2ORVA 3P71T 1E77A 3S44A 4G4IA 5KAPA 1GAQA 2R6JA 1NHWA 4X8OA 4M1MA 4B3MB 2DYKA 2GYUA 3DB2A 1G291 3U40A 4FMPA 4TKLA 3EAFA 3QPDA 2QUKA 3MGBA 5JEEA 3GZNB 2QZPA 3HI6A 4YONB 1ZXXA 2POCA 2LDBA 3DYVA 3M9XA 2JVJA 1EX7A 1UKVY 2P3SA 2C9CA 4NPHA 1YZUA 5EE0A 4CU5A 3ZLTA 3I12A 4IEFB 2IK8A 2J9FA 2BKXA 4G36A 1XLVA 4B0OA 2WWGA 1G8HA 2FOIA 4ZI7A 2C3MA 2Y1CA 4HDSB 5IDQA 2FMIA 3H9QA 3WDKA 2OLKA 1HMPA 1GNLA 4HMPA 4MZDA 1A72A 1TJNA 1VJDA 2FR1A 4FN5A 4CL2A 1WB4A 2WQ6A 4YAEA 4JR2A 4D2IA 4Z3KA 4HNVA 3GPIA 3AEKA 4O3MA 4Z9XA 3IX7A 3AUAA 3ICQB 4E5SA 4J3FA 1JZTA 1G55A 5JS6A 1KETA 3A9TA 3S1AA 3DULA 3U4IA 4HEA6 4TVBA 3A04A 1DTWB 1K66A 4JBYA 4UREA 1DWOA 5HCIA 4DEYA 3ZHTA 2Q9UA 2R3SA 2FW0A 1IY1A 1ZUWA 2ZM6B 1SVLA 2X9GA 3U81A 4NFLA 1LI4A 3H1FA 5DM2A 3ZU2A 3EPPA 2GEVA 4FDUA 5LQMA 2HA3A 3CZRA 3ICEA 3ZV7A 4BV2A 4YJDA 2G88A 4FD2A 2ZJBA 5ARBA 1T34A 2XWJI 1NVEA 4HWOA 1AK9A 2DT5A 3LCUA 3UMBA 4C5BA 2AFIA 4GVXA 1Y7LA 3U44B 1WUHS 2GBGA 3RUIA 5IVPA 1CFZA 4WFIA 2X0NA 3TLZA 4F86A 2HQSA 1KERA 1BW9B 3V42A 1XTKA 2AN9A 3DQPA 3M6MD 3NAGA 2BUCA 4ND2A 1QM5A 5F9MA 4OSEA 3K2BA 4B3SB 4MRVA 4EDFA 1THTA 4I6EA 4E15A 2BEVB 5HSGA 4W1QA 1A9QA 3NORA 4OREX 3DE2X 3OIUA 3EC2A 2O3TA 2NZ2A 3D5EA 1KAHA 2BE9A 3TRFA 3U13A 4EGQA 1PHPA 4S24A 5FI3A 3C7CB 4PHCA 2JLCA 4ZRDA 1G3IA 3R09A 5ALIA 1E2QA 1FFHA 1IE3A 4ZOCA 1YQGA 4DEXA 1IBLB 1Z0AA 3GO4A 1J56A 4D92A 4ZDJA 1HQKA 2WM9B 1XROA 5AICA 1BQ4A 3K2EA 1CB7A 1NN5A 3OLWA 4H35A 4JLOA 4MRMB 4PYNA 4EENA 1T1RA 1ZCBA 3TR6A 3WG9A 1FFCA 3RVLA 3ZJTA 1EVJA 1ULBA 4FE7A 3ZWKA 2V96A 1Y0BA 2HSJA 4IVRA 1AGRA 1OWPA 2X40A 1MORA 2WVJA 2IDKA 1A77A 3DBOB 3LT2A 1ZOIA 3V8VA 1D6SA 1FFWA 2EGGA 4KLZA 2IE0A 4O4HA 4M54A 2LZ0A 3MRVA 1MH1A 3ZKWB 2O8EA 1W1WA 4FIZA 4NNJA 3IJRA 3NBMA 4R83A 2R9VA 5GOZA 1G2PA 1EM8A 1CQJA 1WW3A 4HQOA 2P6UA 3UBMA 3K8QA 1ZGGA 1QGZA 2PJUA 3HL0A 4QDOA 1J7KA 4L2IB 2J41A 2WJJA 4IIJB 3O84A 4JA2A 5EKDA 2J6HA 1OXUA 2VATA 4CQMD 2YXDA 4MWSA 3UJCA 1I2BA 1K86A 2GPTA 2NV6A 2OV6A 3AOEC 2BLNA 3U7QA 4GWLA 1EFPB 2R4QA 3L8DA 3WAGA 1SUAA 4R51A 4TRRA 1EH5A 5EFOA 4MVJM 3ZWDA 4WVLA 3IDFA 3U4QB 4J1SA 5CEFA 1WZCA 1VKJA 1ZSNA 2PGJA 2PIDA 4GMDA 3E9EA 3V48A 2X1HA 3QPCA 1U81A 4Y6QA 2NOAA 2AQHA 2EAUA 3BZWA 5CD9A 2ZSHA 1UJNA 4OVKA 3MG9A 4J0DA 1DIBA 4KACA 1XUOA 3U39A 2O23A 1JHVA 2Y2VA 4FCTA 1GKYA 2ZJFA 3HV0A 1RS0A 1JKXA 2E48A 4IRXA 4UUPA 4BFTA 3RQSA 2QJRA 3TLXA 1G6KA 4FTWA 1E9FA 1IB0A 2FR8A 3W2EA 3GA0A 4DILA 1AXGA 2GMWA 4JQZA 4B4UA 2Q4RA 4QM7A 1HL7A 1NAHA 2F17A 5C46F 1PJAA 1V45E 3S8EA 4INZA 5ITSA 3CNHA 4YWHA 4MB6A 4NEHB 4FX5A 4DDVA 4YRNA 3E2IA 1J9ZA 1QIEA 2H1CA 3JQGB 3JZMA 3L7MA 3OU7A 5KNDA 1VPLA 1TM7E 2Z4RA 3FBWA 4Y9TA 2IV7A 3NBUA 2CHQA 4RWZA 1F7VA 4KLNA 4KO4S 3ZXYA 4MKZA 1MRZA 1VXRA 2QTCA 3BMCA 4O4JB 1ESEA 3THYB 2X2EA 4DWJA 3VTKA 4K8RB 4G0NA 1KY3A 4BZQA 1BMFD 2C97A 1H4VB 4HRYA 1BH6A 1P2FA 3QQ5A 2H51A 2IYXA 1K3UB 2R85A 4WXPA 5DHQA 2IITA 4QOEA 3RJ5A 3D2LA 2LW7A 5K3AA 4JJ8A 1NE7A 1VBFA 4NMWA 1FNMA 3Q8MA 1SR8A 2NUPB 3GGGA 3GRFA 4GKVA 4NOKA 4XPZA 2KWIA 5LXTB 1RAHA 4G0UA 1Z7BA 1JL3A 2HHCA 4FGZA 3VR3D 3PLNA 1JDUA 3P27A 3SJUA 1ZXBA 4YUVA 2O8VA 3BRQA 4KXVA 4M76B 3W06A 1B23P 3GLUA 4KPGA 4LN1A 4O0LA 3NBQA 3DMYA 5C8VA 2QRVA 4WJKB 5HOEA 4QNMA 1QVWA 1CZLA 4LQDA 1ND5A 4F1JA 2XTMA 1GLVA 1NVTA 4MW9A 4TV9F 2C78A 5SY4A 1W8IA 1TIKA 2QMYA 3H2KA 5LDHA 1K2VN 3NX4A 5FPHA 2GUWA 2N9UA 1U1GA 2WUGA 4G5RA 4MJXA 1DUSA 4BIIA 2F6RA 2XMBA 1OYWA 2QPAA 2BGTA 5HYVA 2YKGA 3V80A 3KLPX 4GPIB 5A5VA 2Q9CA 2W2LA 3BCRA 3D5TA 4L5JA 4MQEB 3MAAC 1SUIA 5IM4F 4D9NA 5EGSA 2FUCA 4CF5A 3JQFC 4EELA 4LXQA 4BVGA 1RM5A 2YHUA 4ZVSA 5E0KB 4BJ6A 1ODTC 1R0RE 2V4ZA 4Z4QA 1ZIPA 3RU9A 3V7WA 1ECJA 5D3QA 4YI3A 3CKLA 3V4PB 3ECSA 3AEZA 3INNA 3FH0A 4ZEWA 4KR9A 1I6KA 1JWAB 1C9EA 2PDAA 3U1BA 1O1YA 2XQFA 3HBAA 2W6CX 3AUSA 4DIUA 5KJ1A 1GPMA 3A1UA 3AEQB 2JI6A 6ADHA 3I3SR 1R3DA 4KV7A 1JA9A 4J6EA 5JS8A 5DK6A 1KZHA 3HCEA 4HX9A 5J4KA 4US1R 3QEBZ 1NI3A 2BFEB 1XTUA 1Y3AA 1MKYA 1XHEA 2HOQA 3GEGA 3HP1A 4TROA 4F71A 1SBZA 2LIVA 4ILEA 5FO1A 1NTRA 3A1FA 3D1JA 5TY0A 3EGIA 4PAGA 4V03A 3UFXA 3P5BA 1NKVA 1N0IA 4EHKA 5JDIC 3UMCA 1UC4B 2QM8A 2A0YA 4X3CA 2CJXA 4UARA 5EUBA 3IAS1 2XW6A 3SX0A 4MR9B 9LDTA 3TL3A 2QZSA 1M6VB 5J9FA 3HJNA 2Q7DA 4F04A 4BUCA 2XJ4A 1J70A 4AN0A 3FGOA 3E3MA 4P8RA 3VH3A 1S9DA 1TADA 3H11B 4ZCLA 3H86A 3UO8B 1FJXA 1WBBA 3COVA 1RBYA 2RGWA 3KUKA 4B75A 4CKEA 4EDHA 2ATVA 2ZS8A 2BAGA 4PRYA 3C41J 2VP3A 4GI7A 3HKDB 2D1QA 4E4RA 2O0HA 1AC5A 4YRCA 3BHNA 5CA1F 2YZGA 2NUTB 1TU3A 4YV2A 1TUBB 5ADVA 5DCWA 1E20A 1A9OA 2FJ0A 4PIMA 3TAXA 2FDXA 2RHRA 3QKRB 1L5MA 4RGBA 4MV8A 2WJYA 3OWHA 4LWZA 1RHQA 3B1JA 1EFDN 3ROXA 3SEFA 3PNPA 3EIXA 1N9KA 4LQCA 1A2OA 1EX9A 1UEXC 2D2EA 2GA9A 3OZGA 2HGSA 1W4RA 3IODA 4F56A 2WEKA 1VMKA 3L84A 1VBMA 1NIPA 4L76A 3HA5A 3PRJA 3VFDA 3JRXA 1EHYA 1VJCA 5DP1A 4HGQA 1XP5A 2RGNC 4CODB 4L0DA 3IYLW 1U3TA 1ZI6A 4F97A 5BSVA 5C8YB 2JGLA 3BXHA 3FDZB 3NKVA 4Y2VA 3A6FA 1EXDA 4NDZA 1P29A 3VSBA 5BVGA 1U65A 1OBCA 3D7NA 3JZDA 1II8A 2HIMA 4LHXA 3SSOA 2B5VA 3WK9A 3F67A 1V1JA 2H4ZA 3I3OA 4PBTA 4UAVA 5AJHA 3NJ4A 4XUDA 1ZOPA 1GPNA 4JD5A 1ULUA 1KO5A 4YYEA 4Q7MB 2MWMA 4BLWA 1I4EB 4DJJA 1YJ8A 3NEPX 3PHGA 1MAWA 3BJIC 5GVRA 1DO0A 1GQ2A 2EC5A 3E6AA 2LCFA 2QRMA 3FKJA 4X5OA 4ZEXA 5HZMA 2ZLBA 1PVDA 2OORC 1HM5A 2JLQA 5EMNA 5K99A 2XMZA 1WQ4A 3WHIA 2JGNA 3FY4A 5AYVA 1Y3DE 4UMVA 1R1DA 1UXJA 3UMRA 1XYVA 1V9CA 1UWLA 2XT6A 5ISMA 1DAEA 1H05A 2ZQZA 3A6PC 1CNFA 4UULA 2C2ZA 2QN8A 5H9VA 1UZMA 3DFUA 3AVTA 1MB4A 1Y82A 2E5WA 2I6UA 1SUCA 1EXMA 3B5JA 2GCGA 3I9LA 3K05A 4NY1A 4QQKA 2JZOA 2NU9B 4A8TA 2G67A 2H4YA 2N1MA 4PC7A 5DTQA 5G0VA 2P91A 2B30A 2VQDA 3W5JA 4Y2TA 4YAOA 5ICCA 1ESNA 2C0PA 1CCWA 2COKA 4MCHA 4NJOA 5AI0A 2EZ4A 3LIPA 3V9PA 4JYBA 3TPCA 4J49A 1KVTA 3OQPA 5FL7D 3VV3A 2HCBA 2AZDA 2O0JA 4ZVUA 1RFLA 4GYKA 4TXNA 1BVYF 2HK6A 2PX2A 3H04A 5B37A 1ADJA 1RQXA 2NU7A 2DQYA 4R8VA 5DN9A 1R0KA 5GPBA 2C20A 1FX0B 4S1TA 5D85A 1XTZA 4IBOA 5FFNA 3SMQA 4JUCA 4U0KA 2DUWA 5EMLA 5LQNA 2XT9A 3RVBA 2YVKA 4L28A 1Z07A 1KMHA 1DC4A 2QQ0A 3D8TA 3JY6A 3UHJA 3RYCA 5K3EA 2NT3A 3Q7RA 4I3FA 2B20A 5KO2A 4OQYA 2R60A 3I9MA 2JKYA 5I7UA 1L5FA 1L4LA 3UJ6A 3QKTA 4NULA 1JIQA 1GY8A 1VL8A 1HC7A 2LCQA 3ZIAA 1NJFA 4M9UA 5LIPA 1PL7A 3LYLA 1ADGA 3N3AC 3EC1A 2WQ7A 4R3NA 5HK9A 3L7AA 1CE8A 3LDHA 4KQGA 1NKTA 2EFDB 3PQCA 1U9IC 1WMDA 2M6RA 4Q34A 1TQHA 3ZV5A 5A9SB 1G19A 3AP2A 2YZKA 3UAGA 5I7WA 4LI0A 1XDWA 2O7SA 4KMMA 4ZA2A 2VWQA 4OK5A 3L4KA 3ZHQA 4DQDA 1EIWA 2CCGA 1FJ2A 4TQUS 4BNDB 3R0XA 2D1TA 5ESWA 3ZK7A 4B40A 5HQTA 1ML3A 1VHLA 2BFDB 3VSDA 1CR6A 1EX1A 4C7KA 4YP7A 3N86A 3GH1A 2GVNA 4KGDA 5MGNA 2PHZA 2XSZD 3WGKA 3KXDA 1J07A 4BFXA 4YXFA 1Q7CA 3SHQA 2C58A 5AVYA 3KELA 1R8YA 2E1RA 5AVJA 4ZYXA 1U2DA 4PNZA 1UBJS 4O4IA 4WXRA 3FCAA 4EPWA 1ZUNA 4AY6A 4J75A 3ASYA 5LYJA 4TZTA 5T5QA 2L19A 2X22A 5ALDA 5F2KA 2QE7D 2GCIA 2N3ZA 2H2WA 1MV8A 1WDMA 3CW9A 4K88A 3HADA 4RIIA 2IT1A 1Y9DA 1XOIA 5F9FA 1QS0B 3LZ6A 1UK6A 3NTUA 1WMEA 1IK4A 5IN5A 2OK7A 1HEUA 2QT1A 3L40A 4Q82A 2FSPA 3T1NA 2X2PA 2QVXX 3DUFB 3TTSA 5EXXA 4GGOA 3NV9A 5JSFA 4PICA 5JSQA 5ERXA 2GKGA 5CH3A 3GZNA 4U2FA 1GFSA 1KDPA 3FUTA 3DO6A 4JYCA 4N5HX 1NJSA 5ALNA 1H85A 1UOPA 4NNOA 3QBTA 4ZO6A 5I7AA 4RH3A 5L3VA 4LPSA 4U2KA 2YYZA 3PQFA 4EFNA 4HDSA 3T06B 4DUPA 1KQGA 1OLXB 1XZHA 4JODA 2VZEA 2R8XA 2FA9A 2KI5A 4A26A 3WLTA 4P36A 4RADA 4U9IS 4QDUA 4ER3A 4CGZA 3T34A 3OZAA 1FF9A 1SC4A 1TM4E 2ZJ3A 1J23A 3AFOA 1KZ4A 1YGYA 4ERNA 5JAUA 1LBQA 3STXA 1N2BA 1QPZA 2FN4A 4FYMA 1GITA 2C1XA 5DTMA 3ZHRA 1DTWA 3DGFC 3GRYA 3LHSA 4FVTA 4BTLA 3HY3A 2WUWE 1AQNA 1YDWA 4KG7A 3CRZA 3DZKA 3LECA 2JI7A 4TXHA 3ISVA 3WLKX 3BJRA 3FSRA 2VDUE 1I4LD 1DMRA 3GOQA 1BCSB 3WWYA 2YR0A 4KYVA 4OA5A 5EL0A 4DPKA 1GSIA 3A3YA 3GAZA 3IT2A 4DIOA 1TPYA 2IX3A 3H1AA 4YRDA 4EYEA 2XR1A 4KX3A 1KJYA 1N2XA 4TQ9A 3DV0B 4OJYA 4YT8A 1ZL0A 5ECWA 1SC3A 1HY3A 4QDKA 5DJ5A 4J7CA 1XG5A 4CETA 3U44A 4Z0HO 5AKKA 4LYGA 3ER9A 3HN7A 4TTRA 2RAUA 4M9RA 2A92A 3ES9A 1BW9A 4OP3A 4HPJB 2GKSA 1V96A 1IUNA 5KDDA 1L9XA 5C37A 3U5TA 1OQAA 2OXRA 4JYAB 1KBZA 1QX3A 1XTSA 2B1GA 2BEVA 3ICVA 2NADA 4JLBA 4BNXA 3GUHA 2YIMA 4MI9A 4GFDA 1UXGA 3NXKA 4MRSA 1XMQB 2R7NA 5KTNA 1AQJA 2IPAB 3D7KA 2FSHA 1XEWY 3C8DA 3N2LA 1KVSA 3AHIA 4XD2A 4P3YA 4M8NE 3OOHA 3Q9UA 2EZUA 2B8JA 3PG5A 1SIWA 5JSZB 2AUNA 4Q3EA 4MQ5A 4EHBA 4GDFA 3EAGA 1J1ZA 2QXYA 3EF1A 3HR8A 1TCUA 4P31A 2PUJA 1TJYA 3VNSA 5KNBD 2Q2VA 4LZLA 3S5JA 4FYWA 2QAGC 4B33A 4DKJA 2IHVA 3B3JA 2C61A 3FYUB 4O1HA 1IIRA 5IBQA 5KHOC 5CH5A 3DCIA 4QPNA 4Y2GA 3G85A 3CH4B 3BPSA 3O4VA 4LXIA 1C29B 1IFXA 1ZGAA 1L3IA 1SEPA 2W6OA 4HLNA 1UJ6A 4W7IA 3E2MA 3ZKWA 5HCUA 4J29A 4MAMA 1PFYA 3ZOZA 2WMNB 4M83A 3TUJC 4BLOA 4QYXA 4DZTA 4A3SA 4LAFA 1L5QA 2DOKA 1W52X 3M83A 3ZWPA 4RMGA 5AW3A 4B8ZA 1BE6A 5CVJA 2DT8A 2V1UA 1WU8A 1TVMA 4N0QA 4L2IA 2FVYA 3QVVA 1HE2A 4N0MA 2OO3A 2AHRA 3M1IA 3OESA 4IIJA 4IIFA 1U7TA 5HS4A 4I50B 1R88A 5FT9A 1LV8A 1QAMA 3LUPA 1AQUA 3N1UA 1NV8A 2LXNA 3ADDA 2WY2D 1EFPA 1H5QA 2Q8QA 3QA3E 1NBWB 3RLFA 1JALA 4Y18A 3T94A 5JG7A 1C3LA 4MHSA 3P32A 5FUMA 3U4QA 1E3EA 4X0EA 1LH0A 4G8DA 5IDYA 4DPMA 3PUVA 1NUAA 4W1RA 4RK5A 1HF3A 1XWWA 3GLKA 4LY3A 2H4JA 4YO7A 3I8XA 3LMKA 3N7UA 1LNQA 1Z2PX 1OY1A 3CZMA 4NMLA 1V5GA 3V1YA 1FNBA 4H4EA 3ADPA 3GVPA 1Y1QA 4JA0A 3DTNA 4I2VA 4E88A 4XGQA 5CVTA 3SMVA 1VL2A 3JZAA 2HRDA 4MGHA 5IDWA 1A2KC 4MUGA 2IHKA 2JA1A 3SS7X 1CX9B 3WLNA 2ZBDA 5JANA 4D45A 1G98A 2ZR9A 4IMJB 4ZRMA 1L7RA 1OGJA 5ESXA 2BOVA 2ZROA 1XBTA 2ASEA 1X38A 2CNWA 1LI5A 2DQ4A 3EH1A 4XX0B 5DF1A 4CNQA 1DVRA 4K8OA 3WGTA 1AVTA 3X2FA 3L8CA 3PL1A 1XMSA 4F4JA 5T3YA 3JQGA 3A1NA 5DW3A 2VQEB 1ISIA 1T6XA 2PA0A 3K9CA 2PUAA 3SICE 4TL9A 3AY3A 2O2JA 2E3JA 3AVYA 2EQAA 3F3YA 4RPJA 5C4IA 4JXXA 1YMVA 1VRCA 3THYA 4JKOA 4UQPA 1YT5A 4O4JA 1VL6A 4EPTA 3D6UA 3MJRA 2ALJA 1FVXA 2D3TA 4ILKA 4DUYB 2WF8A 2CYCA 4QX6A 4HUJA 3PF8A 5IX8A 4J8PA 3DPSA 1U0SY 4WNCA 3LQYA 4FYVA 2WHPB 5EE9A 4ALIA 4R9SA 2Y77A 3P2OA 4RM3A 3VZRA 3P26A 2C00A 2WV9A 3V8RA 4L4SA 3QM1A 4KXWA 4D8YA 4ENPA 2R8BA 2NUPA 2Q6VA 3R6GA 2BI7A 5LXTA 4EG7A 4XASA 3RJZA 3NGLA 3MXTA 3PEEA 5G4KB 1J25A 4Q9AA 4CHGA 1FQOA 1XCPA 4W5WA 3Q10A 1BS1A 1GGNA 1PS8A 1TIPA 2Z1DA 2CB9A 4TS4A 4F9EA 1CVRA 1I6WA 3OETA 1ECBA 4B76A 4N3AA 1VI5A 2X0FA 1SQGA 3STYA 4D57A 1ICEA 4YJ3F 4U63A 2A0FA 1WHSB