1XVAA

Methyltransferase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
292
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycine N-methyltransferase from rat liver.
pubmed doi rcsb
molecule tags Methyltransferase
molecule keywords GLYCINE N-METHYLTRANSFERASE
total genus 79
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1996-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1xvaA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xvaA02
3LHDA 1P1CA 4U7TB 4BLUA 4YMGA 3KKZA 4RVFA 1UFKA 2P40A 2FK8A 3EVEA 4Y30A 5T64A 4IV0A 3R24A 2AN4A 1Q0TA 5K05A 3PX3A 4QTUB 2H11A 4H0NA 3QOXA 4R8RA 5G02A 2VZ9A 4M38A 4Y2HA 5C9ZA 3UZUA 4R8SA 4DKJA 3THSA 3DMHA 4OQDA 1RJEA 3MCZA 1RI3A 3G88A 3EPPA 5DTRA 5FUBA 2FHPA 5DSTA 3UFBA 3DXYA 1YB2A 1INLA 3LX6A 2G1PA 3CC8A 4C03A 1OR8A 2IDJA 2NNWB 1EJ0A 3ELUA 3E05A 2P35A 3KPYA 1F38A 3EVZA 2AR0A 2PY6A 3LL7A 2NP6A 2BM8A 2N47A 2HNKA 3DR5A 3JWIA 4AZTA 4UOEA 1KPHA 2NXJA 2PX4A 1ORHA 5FQNA 3UJBA 4A6DA 3HCFA 2P7IA 4AZSA 2PXXA 2QY6A 3BWYA 3EGIA 2B9EA 2C7OA 5HIKA 1Y8CA 2AVNA 3NWEA 3FTCA 4GEKA 5EIWA 5DM0A 4E32A 5GIOE 3FPFA 4PIMA 1VBFA 3KQTA 3KQPA 3OZSA 4HRAA 4RTLA 5BW4A 1RI5A 3BKXA 4HGZA 3V8VA 2NP7A 3GRYA 3P2EA 3IHTA 1AF7A 3PT9A 2HTEA 1NBIA 5EPEA 4YUVA 4DM3A 5LQCA 1AQIA 1NW5A 1UIRA 1KXZA 2WA1A 2CKDA 3FPJA 3FYCA 3HNRA 4GOND 4IV8A 2GAFA 4KDCA 5DXAA 3SR4A 3HA3A 4OA5A 3P9NA 3LCUA 3LDFA 5BW5A 2PWPA 3GIWA 4DF3A 1D2GA 4CTKA 3EEOA 3NDJA 4GQBA 3SMQA 2AZTA 3P9KA 5LQJA 2OB1A 5FA5A 2OYRA 3LKDA 2HWKA 4YUZA 2IH2A 4MTLA 3NVKI 3CJQA 3MERA 1N7IA 4PINA 2AN3A 2GB4A 1VLMA 1YZHA 4ER5A 5HOQA 2YVLA 4E2WA 2PV0A 2CL5A 5DPMA 4YV0A 3MB5A 3CVOA 1B42A 2ESRA 4YV1A 1JQEA 3HVIA 1L3IA 3LBYA 3R6TA 1YFJA 3ME5A 2DPMA 3NJRA 1VP9A 1ZGJA 1WXWA 4K6MA 5BXYA 1ZG3A 2EX4A 2ZCJA 2PJDA 4AZWA 4C04A 4X63A 4RVGA 5EKUA 1RJFA 2DULA 5DT2A 5FTWA 4CKBA 2UYCA 3X0DA 4V0QA 3EMDA 4PONA 4ATNA 2AVDA 1G6Q1 5HFJA 4KWCA 4F84A 2PVCA 5EC8A 2OO3A 2B2CA 3LBFA 2PLWA 5LQNA 3KPVA 3GXOA 2QE6A 5K0LA 1ZQ9A 3PFHA 1WZNA 2QM3A 4FGZA 1G55A 3TKAA 3PTAA 2P3OA 3BWMA 3A25A 3FPHA 3GRZA 4DMGA 5E2AA 4C4AA 3UJ8A 5FA8A 5DXJA 3I5UA 3EEYA 4GBED 5DRYA 5F2NA 2UYOA 3KPJA 3ID6C 4M36A 5IH3A 3ER9A 4OQEA 4PGHA 5HIJA 1EAMA 3PX2A 3LDUA 1L1EA 3UA3A 4BP3A 3AXSA 1JG1A 1XTPA 2OZVA 3SVZA 4KRGA 1L3BA 3OU2A 1H1DA 4PGGA 1L9KA 4R6XA 3LECA 2YTZA 5EQJB 3DMGA 5CVVA 3OU6A 4GUAA 4BY9E 4EMSA 4BLVA 1VP3A 2OB2A 2P3LA 2XVMA 5LQRA 3R0QA 4R6WA 3UJDA 3GRVA 3SGLA 2KW5A 3VC2A 2QRVB 1R18A 3H2BA 4QVGA 3NDIA 3HP7A 3M4XA 3T0IA 3KR1A 4PCLA 2BR3A 3GU3A 1JG4A 2YQZA 3LDGA 2AOUA 4DZRA 5CCXA 4QDJA 3FUWA 2OXTA 3NMUF 5IKMA 2AOXA 4E30A 2PGXA 2LD4A 2BZGA 3NWBA 2YX1A 2EG5A 5HZMA 4KDRA 1ZGAA 3FUTA 3I9FA 1IY9A 2IPXA 1Q0SA 1FP2A 3M6VA 4LWPA 3A26A 5DM4A 3SM3A 4X1OA 2IDKA 2FCAA 5E1OA 5CCBA 1G38A 1KYWA 1QANA 3I53A 4DCGA 1DL5A 1JSXA 3IEIA 3TM4A 1U2ZA 5DX8A 4OA8A 5EZSA 2O57A 4PYMA 3FTDA 5FADA 4EQZA 1X19A 1N7JA 3A4TA 3UJ7A 1X1BA 3FPGA 1RI1A 4C07A 2UYQA 1G8AA 5E1DA 4RTMA 5DTQA 1HMYA 5GWXA 3KR9A 4MHTA 1FBNA 4R05A 2JHCA 3BXOA 4ZTBA 2AOTB 3G2QA 3FYDA 1YZ3A 3P9IA 3LCCA 4RVHA 4FP9A 3D2LA 4X41A 2IH4A 3MHTA 4RWZA 2XYQA 2YXEA 3OFKA 3NW9A 5K0NA 3PLAE 5E8RA 1XCJA 4PYJA 3VSEA 4PYOA 5DTMA 1PJZA 3SSNA 3UA4A 3BT7A 3HA7A 3HCCA 3OU7A 2IBSA 4IWNA 3UJCA 3UJAA 3RW9A 2ZBPA 1NV8A 4KVZA 1JSZA 2ERCA 5DX1A 3PVCA 4GC9A 1NW7A 3GDHA 2ZIGA 4PYKA 2BM9A 4HSGA 3TFWA 4RYLA 5ICGA 1D2CA 1EJ6A 2Z6AA 1KR5A 2OPBA 1AV6A 2P1DA 3P2IA 1FPQA 1SUSA 3B89A 3G2PA 2JH8A 1HNNA 2XYRA 2GH1A 5GM2A 2EJTA 2Y1WA 3OZTA 5DWQA 5LQKA 2C7QA 3CCFA 3R9XB 2AN5A 3BUSA 3FTEA 4E70A 1EG2A 3MCTA 2CWWA 4GOLD 1NW6A 4RVDA 4DCMA 2ZLBA 3B7PA 2I62A 5E8JA 4EKIA 1P1BA 3UJ9A 5K09A 1WS6A 3VYWA 1SQFA 1XDUA 4POOA 5KQSA 3I64A 2PSSA 3P2KA 1VE3A 2ORED 3G7UA 2ZFUA 5EIFA 1JR4A 5GP1A 4P7KA 2ZWVA 2P41A 2OKCA 3B3GA 5LQUA 3BGIA 2CMHA 3EGEA 3HVHA 3SXJA 4MWZA 1JTFA 3LSTA 1JG2A 5FHQA 3JWJA 3EVAA 4YMHA 2O06A 3CJTA 4ER6A 3GRRA 5K0FA 2PKWA 2IH5A 4M7RA 4QPNA 2Y1XA 2B3TA 2ONZA 2YXDA 1I9GA 2O0LA 3NTVA 5C1IA 4YV2A 4RTOA 3QOWA 2EFJA 2ZVJA 3JWHA 2PX8A 7MHTA 4L7VA 2ZSUA 2B25A 3B3JA 3UWPA 5E1BA 1SG9A 3EVCA 1DUSA 3TRKA 2AOUB 4YUYA 5ICFA 4RTKA 2AOWA 5KVAA 3KQVA 1KHHA 3DMFA 2FYTA 3M6WA 1YF3A 3ER8A 4RTSA 1BKYA 3BWBA 1O54A 2JHAA 3G5LA 1NW8A 1VL5A 3KQSA 3KQOA 4QDKA 3TR6A 3TQSA 4FSDA 5GOZA 1AQJA 1NE2A 3HA5A 3P8ZA 5K0JA 3CBGA 3GGDA 2PX5A 3HCBA 1KIAA 1TW3A 5EZQA 2FRXA 4RTNA 4XCXA 1BHJA 4RV9A 3FPEA 2R6ZA 5EHIA 4F85A 3EVGA 3P71T 4YUWA 2P8JA 2V7EA 4HH4A 3TM5A 2NXEA 3KU1A 4O29A 4QQNA 1IXKA 1KPGA 3M33A 1G60A 4XUDA 5E9WA 1QAOA 2NXCA 3FRHA 4HTFB 4PYQA 3MTEA 5EG5A 4BP1A 2WA2A 2PWYA 2Z6UA 2GA9A 1NV9A 3LCVB 3AJDA 3O31A 5FQOA 4ER3A 3LKZA 1YUBA 5MHTA 1QAMA 2H00A 4XUEA 3KR0A 3G2MA 1FP1D 3AWIA 5K0GA 3U81A 5BP7A 2OBFA 4GOMD 3A7EA 4PWYA 3ELWA 1RJGA 4E2YA 3E7PA 1JQ3A 3E23A 3KR2A 2ZTHA 4PYIA 4QVKA 1EIZA 3K0BA 2WK1A 3HVJA 3G8AA 3O4FA 3EVFA 2C7PA 2G71A 2I6GA 2ZZMA 3SX0A 2PT9A 5C0OE 3SSMA 1ZHFA 3E8SA 1R8YA 1QAQA 1WXXA 3KPUA 2JHPA 5KS2A 4CKEA 1X1AA 2PXCA 3HM2A 3C6MA 5CVUA 3DXXA 3OPNA 5EOVA 2I7CA 4QPPA 3DTNA 2Q41A 4P7GA 2ZBRA 2Z6QA 2C7RA 4AX8A 3O7WA 4X61A 4LG1A 3KQYA 5HEKA 5CUQA 5DRTA 1WY7A 4CXMA 1SQGA 2HV9A 1TW2A 3CJRA 5JR3A 3UBTA 3GCZA 3GRUA 4V0RA 5U4XA 5EKXA 4P7FA 3TKYA 2JH9A 2PT6A 5D1NA 4Z2YA 2P7HA 3A7DA 4NECA 3MAGA 5T6BA 2ONYA 1O9HA 4WVLA 5CVDA 4RSRA 2V74B 4FR0A 3DLIA 4XUCA 3REOA 1L3CA 4PYNA 4DA4A 2HR1A 1R74A 2JJQA 2IFTA 1XCLA 3DULA 3C6KA 3B5IA 3F4KA 3HCEA 1O9GA 3SSOA 3AY0A 2ZWAA 1PRYA 3GO4A 5B1SA 2NYUA 3MTIA 4GOOD 2ZIEA 4P58A 4E31A 2G70A 1EQAA 3OE5A 3P9CA 2YUIA 3FTFA 2GPYA 5FULA 1M6EX 5GM1A 4CKCA 4MIKA 2ZZKA 4FZVA 2E5WA 1XDSA 1QYRA 3EGVA 3KQWA 1Z3CA 4FT2A 4KW7A 2P3QA 3MGGA 4FSXA 5EEHA 2FPOA 3C0KA 3I58A 3PS9A 3RIEA 4HG2A 3DXZA 1X1CA 2VS1A 5E9QA 3R3HA 5CVEA 3MQ2A 4KIGA 4PYLA 2BH2A 5E9JA 1SUIA 2BR4A 5K03A 2EJUA 3HTXA 1JG3A 3FUUA 3KPWA 3BGDA 4BLWA 2PBFA 3IV6A 5KQRA 4CWAA 4QQKA 4PCAA 1P91A 5EMKA 3RODA 2AOTA 3HVKA 5EGSA 5FHRA 3L8DA 3DLCA 1KP9A 3TOSA 5GINE 2VDWA 4E2XA 1XJ5A 2AS0A 1JTEA 2A14A 1IM8A 1RI2A 3A27A 3HCAA 3KQQA 3M70A 3Q87B 3QV2A 2ZZNA 3C3PA 1I4WA 5K0CA 2PXAA 3ELDA 2HMYB 5DLYA 3G8BA 4RTJA 2BR5A 10MHA 5HIMA 2I9KA 2JG3A 5LR6A 4DQ0A 3TLJA 1NBHA 3DP7A 3T7RA 2R3SA 5DM1A 5DSXA 3OZRA 4RTQA 4RTRA 3FUXA 1V39A 1M6YA 1YFLA 2VDUE 3AXTA 4KIFA 2H1RA 4RTPA 3GJYA 2VDVE 3G2OA 1F3LA 5E2BA 3G5TA 1T43A 2ADMA 3JWGA 2ZIFA 5FWAA 1JQDA 3CGGA 4HTFA 1WG8A 1UWVA 2ZBQA 3NVMB 4LWOA 9MHTA 5M5BA 5FCDA 2XYVA 2FK7A 3OFJA 3ORHA 4F86A 4MQ4A 5EMJA 5GIPE 3LGAA 1R00A 4OX9Y 3EMBA 3T7TA 1X1DA 5ICEA 5JUWA 5K0EA 5K0BA 3TPZA 2IP2A 5CD1A 1MJFA 2ZULA 2QRVA 1VPTA 4ER7A 4EK9A 5EHGA 1I1NA 3BWCA 3KHKA 1VIDA 3B3FA 5T67A 1NKVA 1N2XA 2PX2A 2AOVA 3DUWA 4IKPA 4A6EA 3G89A 4AZVA 4EVIA 2G8NA 3P97A 5E1MA 3THRA 1DCTA 1D2HA 2O05A 3FZGA 1BC5A 4LECA 4FS8A 2IGTA 2YXLA 5EMLA 1KYZA 2O07A 5KYGA 4ER0A 2IBTA 2B78A 3IYLW 5H02A 2QYOA 2VP3A 1XDZA 3K6RA 2G72A 2XVAA 3Q7EA 5D1HA 5LQAA 4PIPA 1QZZA 1R6AA 4OBWA 3FRIA 1P39A 3CKKA 2K4MA 5EVJA 5CVJA 8MHTA 3BGVA 5P8WA 1NW3A 1BOOA 4CTJA 3C3YA 3OE4A 3WSTA 4C06A 5CIYA 5F2KA 1R8XA 3UJ6A 4PNEA 2OY0A 3ELYA 5DX0A 2GLUA 3GNLA 4QTTB 5FWDA 3GWZA 3ERCA 5CM2Z 3PB3A 3DH0A 1NT2A 5EEGA 4HGYA 4M37A 3BZBA 3LPMA 1XXLA 1MHTA 5EMMA 3OCJA 4C05A 3S68A 2CMGA 2NXNA 3DOUA 3HCDA 4ISCA 3HEMA 1TPYA 2UZ4A 2XBMA 1VQ1A 1SVUA 3EVBA 1SKMA 2F8LA 1ORIA 1RI4A 4OBXA 4X60A 3FUVA 4C08A 4EKGA 1KPIA 4E2ZA 5ICCA 2GS9A 4FT4A 5F2OA 1ZKDA 3EVDA 5HIIA 3TMAA 1FJXA 4GF5A 1G8SA 2YR0A 3BKWA 3V97A 1M0EA 3PFGA 4GC5A 3ANXA 4YUXA 5LSAA 4WXHA 4B17A 2UYHA 5K8VA 3T7SA 2ZW9A 4P7JA 3KQMA 4U7PB 5HILA 1XVAA 4JXJA 5ERGB 3M6XA 2IIPA 3M6UA 4HC4A 4RX1A 5DM2A 3VC1A 4E33A 5K01A 4AUKA 4G56A 1RJDA
chains in the Genus database with same CATH superfamily
1AY0A 4U7TB 1P2VA 4G8BA 4JBGA 5AOVA 2X15A 5FUXA 4BNXA 3IAM1 3O4RA 1OUMA 2QU7A 2V8OA 4NVRA 2UKDA 1WXHA 1GQYA 3BMOB 2I7XA 3JAWA 4LV5B 1UOEA 2H5JA 3H5OA 3OEHA 3LTEA 4FYMA 421PA 2EWMA 3MLAA 3ZHSA 2VSXA 4K2AA 3P94A 1XQYA 1Y8AA 5G02A 3ET4A 2REOA 2X0DA 3BAZA 4Q01A 3T3DA 5GTDA 1C3JA 1L4UA 4N0DA 3FBWA 4Q6BA 3TLXA 3RC1A 4YS6A 4EO9A 3ECCA 4Q16A 1XT6A 3QJYA 4I50B 4AJ9A 5AVRA 4D41A 1VIAA 1VPEA 3K2BA 3NIWA 3FDJA 5CT9A 5HDBB 2BSQA 1ZPDA 3U3RA 3E4DA 1OXUA 3JQDA 4GH5A 2BLNA 1BIFA 2FFAA 1XE3A 2HQ1A 3IAS6 4LOIA 4M99A 2QM0A 3K70C 3DTVA 2VXCA 5FFMA 3K1YA 1CSEE 5GJWC 2N47A 1JW9B 1LBHA 1N8NA 3DDNA 4OHXA 5EAIA 5B4TA 3HVRA 1U3CA 2PX4A 1ZM3A 4L5JA 3G1WA 5FQNA 1UMCA 1KYYA 2P9ZA 4IW3B 4E51A 1PJCA 3KYJB 2X0NA 2QRUA 4NH0A 2N0SA 5IJWA 1ZCZA 3AU8A 1OLXB 3FHLA 4J0HA 1UKVY 3AFNA 2JGMA 3TZCA 1PT7A 2OCLA 1A5SB 2FKAA 5GIOE 1G7TA 2ECKA 3I9V1 4BRSA 5BWOA 1GWNA 4LHWA 1KKLA 2VLBA 3L8ZA 1B3BA 1E1CA 3MW8A 5FPKA 3RAGA 4NBUA 3VAZA 1DAHA 3JVDA 1BD4A 4OSEA 3UMBA 2AG0A 2W11A 3W7AA 3MPUA 2OQRA 1BQ3A 4OA5A 1Q0UA 3WK8A 3VR2A 4ZQBA 3WLOA 5F76A 4UM9B 1D03A 1A5BB 2YXPX 4DF3A 1D2GA 4MDEA 2QRGA 2TRSB 4MOWA 1TRHA 2VYQA 2OYRA 4J3JA 3R3JA 1VCMA 1X7WB 1XF9A 1Y7IA 4X97A 4QPDA 5EFZA 1W0CA 4D9JA 4GOKA 3IQFA 3QLVC 4EJFA 3W2IA 4JROA 1D4FA 3KKLA 1NJ8A 2E4YA 2X8AA 3L0SA 4JX8A 5DTEA 4HX9A 5BNTA 3G0IA 5J2TB 1N0IA 2XCLA 4GR4A 4N3BA 4YVFA 4CQMD 4NZOA 4H35A 2PMEA 3AETB 3T35A 1N0UA 1VHLA 2VG8A 3T7EA 1QVZA 4XQEA 4KGVA 2GZRA 2Z8XA 3PNQA 4ZI3A 5IAOA 1S3GA 1J99A 2E89A 2YIVX 1G19A 1W7AA 3BL8A 3IVMA 3UO8B 4RIEA 1YB1A 1QCCA 2HQOA 2Y9PB 4U02A 5ALOA 5EKUA 1LX6A 3K0AA 2BCEA 2P2YA 4HATA 4V0QA 2Q0SA 3L7LA 5DLPA 4PCVA 1I5RA 3WB2A 1GAWA 3CXRA 3QEOA 1SVSA 2WWGA 2OP1A 3KPVA 5CTJA 2A5GA 1G55A 3OZEA 1E2NA 2ZANA 3L6BA 1S7GA 1U1GA 3GMTA 2PBLA 1YVDA 1FUUA 4I14A 5ESDA 1PGPA 4JNKA 1QHGA 4MJ7A 4XZ3A 3ZK9A 1KEPA 1VL8A 3IIIA 3OBIA 3OI7A 5BN3A 1Z6YA 2FSVC 4MR7B 5DRYA 2XCSB 1M75A 4JZKA 4M1OA 1W93A 2IF2A 3TD9A 2ZRQA 1IMJA 2C77A 3BHMA 2IZ0A 5HIJA 4Z7NB 3EISA 4GMFA 3TRFA 3HDVA 1FFXA 1V4VA 4WBXC 3A36A 4KBYA 5CRIA 3U4GA 3DMGA 2VSQA 2XQFA 2ZUBA 1NXQA 1ZAKA 3H1BA 1NA5A 4BO3A 5KJ1A 4ARIA 4F3TA 4LHVA 4MPRA 4J94A 3OTHA 4LWQA 5HUJA 3O1JC 1KF0A 3PNKA 4DHWA 4C7JA 4ENRA 3IH5A 1JQKA 3K6JA 4IUCS 4QYTA 4P38A 1UXIA 2BTEA 3CLRC 4GSKA 1ONBA 3OMXA 3ZU4A 4C0WA 3VO9A 3PD7A 3QM1A 3H8SA 3DE4X 2IW3A 3PNPA 1KDZA 1GT6A 2VDWB 5B2ZA 4MKRA 2D0IA 5K3CA 4JJAA 2YX1A 1EXDA 2Q7DA 1Z83A 4JVNA 2WOOA 4X90A 3NHMA 4GX2A 3I9FA 4JYCA 3LVQE 3VV3A 4XYBA 5DHTA 2R4TA 3WISA 3WK6A 1AH2A 4D8WA 1BMQA 2O5CA 1EUCB 4V0MA 3HDGA 5K3FA 2CDRA 5KNDH 1NNSA 1CIPA 2I6FA 1Z6GA 4WZZA 3SPXA 1WD7A 1Z6QA 3I6QA 1NF3A 3GQBB 3K5HA 3L0YA 4FE4A 5FF9A 4RM3A 2GPJA 4JB8A 4D3XA 1SVLA 5K6AC 1DFIA 1H93A 1S2LA 4YJ2A 3QE2A 4D43A 5I7WA 1PYDA 5IBCA 4ZGWA 3G0DA 3B78A 1W36B 2VT3A 3MEQA 2GAJA 3LYUA 3Q8LA 4OGLA 2QX9A 3CTPA 4O59O 3RTAA 4MHTA 4WDQA 1EFDN 2UVQA 3A3OA 3WHLA 3NCHA 2GN0A 4CCYB 1AGRA 4DR3B 3O4GA 2WUFA 3VH4A 4Q7EA 5LD2C 4RV4A 1W85B 2PD3A 3KVOA 1AU9A 4L8YA 4MR8B 3JRNA 1HE8B 1XCJA 3H3XA 3NOOA 1FS4A 2RK4A 3SSNA 2H57A 1U0BB 1P4RA 1PFGA 3HA7A 4FX5A 1N6OA 1T8YA 1SB8A 5SV2A 3D3NA 3NASA 2YWDA 4RESA 4HLQB 5A1TA 1M2FA 3KVYA 3AUSA 1X0XA 3QBVA 5DYYA 4QXOA 4UVHA 3HJBA 3HM9A 2D2IA 4XVRA 2I0FA 3QSYA 4P34A 1HT1E 3U7EB 4A2PA 2BM9A 1P17A 2PLFA 1EGVB 2K7ZA 2O52A 2Q5QA 3H4TA 4J43A 2YS7A 2YZMA 4PHCA 5JRJA 1VKHA 4XXHA 1OFIA 4Q48A 5A05A 1CZUA 1WZCA 3FDFA 2ZM6B 2V9CA 4U6SA 1RWMA 1WCXA 2JJYA 2QMQA 2ERXA 2NSDA 3BXEA 3TOXA 5LQKA 3K05A 3ZXXA 5IAAA 1QK5A 4BO0A 1ZISA 5JJKA 3BFVA 3YASA 1N9GA 3TEFA 2C5AA 4ND1A 2BGRA 4BV3A 3ECAA 3P96A 4MKZA 3D8HA 2H2DA 4BHTA 1L7BA 4MUNA 3ZN2A 1UOOA 2XUAA 3D4IA 2ZBUA 2PKRA 4Q4HB 4QKQA 3FGPA 2QVLA 3O38A 3TBKA 3Q5DA 1G2PA 3WADA 4PX3A 4I46A 2P41A 2VK2A 2AFHB 3I37X 4PEVA 5EPOA 5TR9A 3ZJ5A 1RACA 3GZNB 3I2YX 1WPQA 1NJ1A 3LUAA 5I9BA 1A0OA 1Q15A 2YOHA 1JG2A 3FMIA 4IG9A 2EZ8A 4MGIR 4R0VA 4RK7A 1YOBA 3KTAB 4KPUB 2EEPA 4D6PA 1SOVA 3JVVA 2AXNA 1HTTA 1BOFA 1SOUA 2G9ZA 1PT6A 1W8DA 2EFJA 3L77A 3O83A 2ZRIA 1V6CA 4OG2A 1R4ZA 1QYWA 2GO1A 2XHZA 3O2SB 4CDMA 1JYEA 1H6CA 5ABPA 5D86A 1CUZA 3A3PA 3RRMA 1X9HA 2YNMD 1MGPA 2SNIE 2GM5A 1PFVA 2D5BA 3BERA 3BORA 3BA1A 3KQVA 3HKDA 2FYTA 1R0ZA 4Q7MB 5NULA 3VVBA 5K6TA 2FFBA 1BKYA 5EKDA 1O54A 3HYLA 1I5OA 1IK6A 4M86A 4UD2A 3E9EA 4YONB 3O8CA 4TS3A 1YONA 1U0LA 4Z1MA 4EG6A 1I6WA 1CUHA 1X1SA 2JB9A 2WM2A 3KVVA 1P2UA 2XNCA 3HR4A 4FFPA 1QC5B 2G09A 4ZI2A 4RTNA 3RYIB 4O4IA 5KYYA 3H42B 4RV9A 2F17A 5EP2A 4F85A 4PZUA 4U8GA 1Q57A 2GYWA 1USVA 2BMDA 1L5GB 4JUAA 3UY4A 1DIHA 4M8SA 4O29A 3WLAA 3EX7C 1HNWB 4YDQA 1KPGA 3LMKA 5EJ7A 2FLWA 1Z5WA 3T3PB 2NXCA 5IZCA 2WZQA 4OIMA 2FZWA 3RYHA 2ZTMA 2Z6UA 1NY6A 2FF7A 1FX0B 5J2UB 1MXFA 3WGZA 4DY4A 2X2OA 3RVJA 2QD4A 1RBZA 2X9LA 2ZWPA 1EP3B 3JYLA 2HO4A 4K6HA 3LK6A 4LISA 3V33A 1VHDA 3EXFA 2IYQA 3OPYI 3AX6A 1A9QA 2FQWA 1JPNA 4JOSA 4LGMA 1XF1A 1QB8A 2GPAA 2EARA 2JD1A 2J5KA 3AU9A 3KR2A 3OECA 4RPHA 5KHAA 3ZCRA 2EAUA 3GVIA 4UU0A 3G7NA 2AKYA 2AW5A 4LDAA 5D3MB 1DXHA 1F9AA 2IQ5A 4MAFA 5HK8A 1YD7A 3OSUA 4I19A 1JT2A 1NM5C 5K45A 4G25A 5TARA 2ZAYA 3OWOA 4EL0A 1ICIA 3GAMA 4ID3A 4LQDA 4TVBA 3DXXA 4E11A 3DAOA 2JASA 3H75A 1IDN1 4KUHA 2D00A 1K8ZB 3RM3A 2P2CA 3GZNA 4HN9A 1H0SA 4NAVA 1AD2A 1PJBA 1PNOA 3N05A 3O7WA 3GP3A 1GOTA 1ZXXA 4ZODA 1CFZA 5CM9C 1Z06A 2I2FA 2PN1A 4NE7A 4COKA 5BYJA 2B36A 5JWHA 2HN9A 2HIMA 5HJ2A 4JAVC 5CA1F 3ZVNA 4Q1AA 1ZEMA 2QBYA 1A5ZA 4Z2YA 1F6DA 3I2IA 4P3NA 3PE6A 1MJHA 4R1QA 5ITSA 4NK4A 3CLTC 1HZJA 3EQ9A 2CL7X 1IPEA 1ZU4A 2BGNA 2GLXA 2G28A 1PWXA 2RHGB 5EQDA 3SSOA 5DM60 3GLTA 3X3HA 2IYAA 2H4JA 3ZW9A 4BFCA 3HU3A 4J76A 2VSYA 3T7DA 4D9EA 4CKCA 4LZZA 1UJ6A 3O47A 3C3KA 3OZUA 4S2UA 3ANLA 3TQCA 2WT8A 3WGOA 4W5TA 1KDOA 5BWBA 2WD7A 5KDDA 4AZWA 2YDYA 1A5TA 2GBLA 1N25A 2R8OA 3A31A 3GEDA 4RJTA 3IXQA 5T4BA 5JVDF 3HEAA 1SUIA 2X8JA 3AHFA 4ZXFA 1C1HA 4RQAA 2FEOA 3R5SA 3PR3A 3PFIA 3EULA 4H6VA 3OOEA 4JR1A 3ZVRA 4TLBA 1UIMA 2XWBF 3IDAA 5JS8A 3LUDA 4IIJB 3ZDAA 3C5HA 1UFOA 3KQQA 4OH7A 1WQ4A 2H63A 4CMIB 4UFNA 4AJIA 2QDKA 4L1KA 1V5IA 2QV7A 4G1UC 3T3GA 2C2XA 1XJ0A 4JOQA 1RAIA 4KRXA 4KDFA 4UDOA 5TVGA 1XEAA 4RTQA 5C5DA 4H1UA 1VE5A 3TPCA 1V39A 5EWJA 4B7XA 1YFLA 3PC8C 2UUCB 3AXTA 3DOOA 4LMRA 2M32A 1W88A 3W5HA 1F3LA 2Z2ZA 4O2RA 2VCYA 2CE2X 2H85A 3JQ9C 1UWVA 2ZBQA 1E18A 2FK7A 2H2FA 2E18A 2E4XA 3IVRA 1Y9JA 2GHIA 3RHSA 3ZE6A 4D2IA 1S5PA 1O8BA 2VK4A 3UJ7A 1NTOA 3W8RA 1Y6GA 1N77A 4L15A 1PSZA 5CD1A 5DCLA 3PJGA 5JY1A 1DRJA 1C9MA 2R5FA 3IHWA 4FK8A 2G5PA 3W5CA 2OP0A 3FPLA 1PKEA 3C43A 3HSSA 3VR4A 3VGPA 3NXKA 4HUQB 3QNMA 4EUEA 5LZ7A 1Q0RA 2I7VA 1VHJA 1NN1A 4LECA 5EINA 4U6QA 4Z7QB 5EMLA 2O07A 4B3GA 1XTKA 4QD3A 1EUCA 3IYLW 2ZJ4A 4JC8A 4FD3A 1MTOA 3PVZA 1RC8A 2WYWA 3NV9A 1AV7A 3HGTA 1JKJA 2YY7A 3FA2A 3UXHA 3D3JA 3JTEA 3LIIA 1P7PA 1P39A 1LEHA 1CC1S 2HEGA 2HAEA 4YJFA 4BAUA 1W6RA 5I7AA 4ZQEA 3LUPA 3TK1A 5C8YB 4F56A 1ACJA 3AHIA 1NLUA 3C24A 1PFUA 2ZQZA 4N8EA 2GT1A 2VP6A 1OILA 3MTBA 4RHUA 1Y8RA 3I9MA 3JVIA 3WICA 4PNEA 1P81A 3GNLA 3QXGA 4RY8A 4F9GA 1AGNA 2WF6A 1LBIA 1YE3A 4RH3A 4MMYB 3RS4A 2VQEB 3X1ZA 1FIUA 2VK8A 4B71A 3WKAA 2FWRA 2ZT5A 5BPFA 4W6QA 2IS1A 2C2ZA 3OUUA 2Y05A 3WWDA 2X41A 3V2GA 4H7PA 3L4BA 2W8BA 3HCDA 3NS7A 4E4TA 3HEMA 4Q7LA 5M04A 1OZ0A 2IUFA 3BRWD 3DMPA 4RA6B 2UDPA 2WJWA 4AVYA 2EZUA 3ZZNA 2YWFA 1QOZA 2Q4OA 3B1KA 1XLWA 2XYPA 3CGWA 4NS1A 1BMFA 1JDBB 5LIRA 2PYDA 2HJHA 2GCGA 1GZUA 1L5HA 1UMDA 1SVIA 3ILYA 1DAPA 2F48A 2FPGA 1GU0A 2YMQA 3BKWA 2OHFA 3FYUB 3JYNA 5H80A 3TH5A 4RHXA 1JHZA 2B21A 3CX8A 3V97A 3D6AA 1XD2B 1T8WA 1J97A 3KOXA 2UYHA 4ARCA 1RWQA 3L0ZA 4HYYA 1N2CB 1II0A 3T7SA 3KZCA 5HZKA 5HILA 2BUAA 4L3WA 4CEIB 5FUQA 3AVTA 2VUHB 2B3DA 2JLBA 1CF9A 3V7FA 4RHCA 1U8YA 5DBGA 2YBDA 2ZGVA 3RQSA 1I0IA 2MTBA 4BIIA 1OPRA 4BEWA 1H2WA 2IXDA 4EG3A 5DNEA 2O20A 3BBLA 3O84A 2HSEA 1TCCA 4W99A 1CDDA 4CIWA 1ZOSA 2Y1CA 4G84A 2E1RA 4H1VA 3FOWA 4BWGA 4IFIA 5AUOB 4L5YA 1YIAA 4BBPA 3I62A 3NT4A 1JG6A 5CT6A 3WLLA 1ORRA 4G0ZA 4XM2A 3THSA 4BRUA 3EEFA 3Q1KA 1ZMRA 4Y2PA 1UJMA 5DBHX 4DB4A 2IUUA 4LDJA 1Y1LA 3FFTA 1ZIXA 2GOYA 2O1XA 2XSZA 3IE0A 3L43A 1C7FA 4O2BB 4BS9A 1JA1A 5IN5A 1ATZA 4RELA 1KZ9A 2IOFA 3IHLA 4O2AB 1RXIA 4NU5A 4B40A 2E4AA 4D7AA 5LXTA 4W9RA 2JFXA 1J2JA 2IC5A 1FMTA 5HRCA 4EZIA 2BGMA 2XIJA 2Y1DA 4ZDIA 5KO2A 2HNKA 3DR5A 4BKMA 1GCAA 5HM8A 4BXOA 3AVYA 1KYIA 1KPHA 1ORHA 5LBTA 3H13A 1HGXA 1SNYA 1UF9A 2QSUA 4GQIA 3RV4A 4IZOA 3WL5A 2I80A 4NATA 1I2BA 4YASA 3RBXA 2ZWMA 3ZY2A 1HOXA 2KX7A 3HFSA 3MS7A 3PVSA 4TZTA 3PQ3A 4W7HA 4XIIA 1YI8A 3VX4A 4FU0A 1C3VA 1JKFA 1T3SA 1R2QA 2OVBA 1TVKA 3VU9B 4BV2A 3HB4X 4YUVA 3ZE0B 3F5DA 4M7WA 3R7LA 2ZRHA 4ADSG 2HLNA 4X6UA 1ZKMA 2H4HA 3L7JA 3VR5D 4DYVA 1NQOA 3Q8MA 4BPBA 3HRKA 1WEHA 2LRHA 3HUEA 4B84A 1H5NA 4A36A 1XDDA 4H60A 3VKFA 1FVOA 3RYCA 1Y5RA 3HE3A 1A9TA 3HDHA 2QRNA 4INAA 4S1PA 5CLHA 3SBXA 1BXGA 1YE5A 2QGNA 1PEAA 2R96A 2XJ9A 1K63A 3C4VA 1JIVA 3MFQA 3EUWA 4YUZA 3NVKI 1A9SA 4TLCA 4ENPA 1GJRA 2GERA 2ZSJA 3C85A 1LRLA 5REQB 3PUHA 1G98A 5IDWA 2WT9A 4KR6A 1YZHA 1BHO1 1K7CA 2YVLA 1WXDA 4HN2A 3HDTA 4WXRA 5JS2A 1OAKA 3ZEIA 1S1MA 1YRYE 2PX6A 4Z0TA 3DWIA 1B42A 5BSMA 2XUZA 2YL2A 4NHOA 3CT6A 4C0KA 3ASVA 3IRVA 5FUWA 3NBKA 4DSOA 1DAFA 3DR3A 2BMVA 5IK2A 3SC2B 2QVYX 1R9MA 1E9RA 1NVVR 1GFZA 5ALXA 3QGMA 3RANA 1LWOA 1T9GR 2WHYA 3GBSA 3VR6D 3ZWXA 4BUZA 2WJ6A 1E61A 1UBMS 1DKPA 2NVWA 2XKJE 3K0KA 2P9CA 3EC2A 4I8DA 4MP6A 2PZLA 3R4CA 4GI1A 4BQRA 4OHWA 3AUYA 4D4KA 1PS9A 3CVVA 3GLIE 1R37A 1XTJA 3PNOA 3RK4A 5DF1A 1PTJA 3LF2A 5I51A 1PJ2A 1MX5A 1TYZA 2HHAA 1NSFA 3F6RA 3GUZA 4K9OA 4MGZR 2PFSA 2CD7A 3LT0A 2V6FA 3IDZA 3QYPA 1TLTA 4HEQA 4TL9A 3RSOA 3WIBA 5F2NA 4DLRA 3PD1A 2Z98A 2V0CA 4DSZA 1K68A 2ZDQA 3D6JA 3VYVA 3ESCA 4KX3A 3PYMA 1U80A 3P26A 4JC5A 4Q34A 5IM5A 3C39A 5K8TA 1Y3CE 3AXSA 3Q8XB 5KHOC 1OH5A 4LV6A 4EKDA 4Z0HO 5BSTA 3G9ZA 2JJ1A 1H1DA 3B6JA 2R1ZA 4QASA 3PFWO 1JWAB 1SA0B 2CJXA 2WI8A 3A10A 5DSZA 1Q17A 1RS0A 3S1AA 4D0LB 2RC6A 4X66B 2XVMA 3EC1A 2FG6C 2ZRJA 3CW2A 1CE8A 3ZWQA 5JEEA 3BGWA 4Y6PA 3UB4A 2TMGA 2J3QA 4FB4A 4ALNA 3EOAI 1YZKA 4FZJA 3T1YB 3HJFA 3QHQA 2WDPA 3OPVA 4FCVA 5FWXA 1WSAA 3CURA 4KWTA 1YOVB 3DCYA 3EUEA 4WXMA 2C94A 3OOYA 1BX3A 4QHTA 4K81B 1RTKA 2IA5A 3F3SA 1L4NA 3UPUA 1HQDA 3WIOA 4H3VA 4Z6KA 5CCEA 1XTQA 4K9RA 3M6VA 1W47A 2F62A 1SURA 2JIQA 3HG7A 4ERXA 4FFRA 2YY5A 4COOA 3IQHX 2IY9A 4QYMA 2TECE 2QQEA 2NO0A 3ORQA 5BOSA 3U09A 3S2FA 3A6FA 3LXXA 3EAFA 4CQMA 3QX3A 2HK7A 2H4ZA 3TQIA 1E9SA 1IRIA 2FCRA 3PFKA 2C5HA 1G8AA 3EAGA 4C07A 3NAGA 1NNI1 2G9UA 3SZOA 5KVCA 2W6JA 3JWEA 2DLCX 3LXRA 1K92A 4ZV7A 1ZM2A 4BO8A 2RH9B 1FMJA 4IVPA 1QNLA 3GR6A 2GR9A 3DNFA 1E5LA 2XAUA 4H7HA 3GBVA 3HXOA 4RWZA 3Q8KA 1K4YA 1QGED 1J0XO 3KYDA 3PLAE 3RRJA 4LJAA 1U0HC 2WTEA 4TOIA 4Y2TA 3VH1A 4XYGA 5FNZA 4CMEA 1PJZA 3RYTC 4JVOA 4V02A 3TLYA 3OU7A 1WXEA 2P4QA 5IH7A 3OLCX 2IBSA 3F5QA 3I1JA 1BGXT 2C1EA 3AF6A 1XG5A 3GT4A 4DKXA 2ETVA 5HS4A 1JSZA 2OWEA 1CRPA 1JDJA 1NJGA 1NPYA 2WMYA 3DZFA 3H99A 1JHRA 3LWZA 1JKIA 3LU1A 4OCZA 1R16A 4P08A 1UXOA 4PYKA 3QFCA 1MBZA 2VJPA 3H5LA 3AQIA 3NM5A 5ANRB 4Y9UA 5KJEA 4TMFA 1KR5A 2QMHA 3S40A 4C7VA 1T9BA 1UDXA 4HJXA 1ZVKA 2QA5A 3V42A 1GEEA 1WL8A 3PWKA 3ZG6A 4FN5A 1DC8A 2MHCA 2SKCA 1BE1A 1QPZA 2EDAA 1OCEA 3Q9SA 3RRZA 1PQPA 4P4SA 1Y3HA 2EFCB 3DE7X 1K5GA 1C1XA 4OI4A 5JCOA 721PA 2QE7A 4FLMA 1FYFA 2M98A 4QPJC 4IUDS 5DP2A 2IW1A 4KR3A 5I7HA 2H18A 2PS0A 3CX7A 4KYUA 3GH3A 4PG8A 3UJ9A 3BQMB 1JIXA 2F1RA 5BOVA 2H65A 1ZZGA 1LD3A 1JXQA 1PJ4A 1CWUA 3OKPA 1FS6A 4EAAA 1TUBA 2UZIR 4FFLA 4ZREA 5C8ZA 5FUMA 4RY9A 5JASA 1UKEA 2BEKA 2DSNA 4L16A 5JECA 3W7BA 1WLYA 3B3GA 1HEIA 4JDPA 1Y7PA 4N4AA 3N0WA 3MTQA 4AG3A 2BPOA 3A9RA 1UMBB 1Z4JA 1KE1A 4PQYA 3K09C 3V7NA 1GKYA 1W36C 4S35A 3H4IA 4WHMA 5EWLB 3U3KA 3W6OA 4CDNA 4C0AC 1B93A 4F6CA 1JB1A 2B83A 2C04A 1AKNA 2B3TA 1XZPA 2JAHA 2W43A 2QTHA 4Q9AA 4X6LA 3OF5A 3AFHA 1EI9A 2OXFA 4RTOA 4MI1A 3DHNA 1TCUA 7REQB 2NVUA 1IOZA 5EXTA 2VI5A 1I24A 4GLFA 4XCQA 3O3NB 4DWJA 4F12A 3UK0A 4ZAZA 1V35A 4LC1A 5EUMA 4DT1A 4Z7OB 5CNMA 4O3MA 1HT0A 1PYOA 1PZEA 3WVNA 3M6WA 3CPSA 4I4CA 1ZMBA 3GRFA 5IDQA 4R1MA 1JLKA 4OHBA 3TW0A 5KTRA 2P68A 5KSOA 1NW8A 1X92A 1TCVA 2Y6VA 5L51A 4AWXA 2DQSA 2ZXUA 5D5QA 1XVTA 4DV5B 3CBGA 5LFAA 3ET5A 2HH9A 2CBZA 1TZBA 1GR1A 4NNPA 4XA8A 1N8TA 3I04A 3OUTA 4GVLA 1A8PA 4HRXA 3DAFA 1NG1A 5TMBA 1ZRNA 2PCJA 4YJ2F 5ADUS 3U4MA 4FJ2A 4X93A 4J2TA 1ZC3A 1UZLA 3E5NA 4YQYA 3SIPA 1K08A 4F8EA 5LL6P 2W93A 3AJ8A 4BJ5A 4KXQA 1DKOA 3FRHA 4QRDA 1WULS 5F9FA 1XYYA 3QELA 4QO8A 3RC7A 2B99A 3UMYA 2V6GA 1QAMA 5KNCA 1ZFNA 1M2EA 2PFKA 5EZ5A 1NU8A 3LOQA 2PDAA 4B80A 4ALIA 5B4VA 3BG5A 1G63A 4D9BA 3A2KA 2WC1A 3E7PA 3E23A 4BGEA 1UQUA 3HFRA 1CULC 5K3AA 1LDBA 3EIEA 3HVJA 1W2HA 4V2UA 2YHUA 3VDQA 4BJ3A 5B7PA 4AO7A 2RBKA 5T4EA 2OWDA 5LYJF 2KLBA 1NFFA 4BEVA 1C7EA 5M2QA 3JD2A 3JAKB 1ZH2A 3NIBA 4CF7A 1RRPA 5I9LA 3C3MA 3FHCB 4HLUC 2D6FA 2XD4A 1EHCA 4I0WB 2F64A 1UZUA 1VFPA 1DU4A 1KSJA 2HK9A 1UL1X 2GTHA 1SB9A 1L5KA 3DTNA 4F4DA 5CB4F 3L4SO 2OBMA 3A6DA 2YV1A 3Q98A 3RFTA 4AX8A 3DJYA 4NMLA 1Q1BA 2P90A 3B13B 3ICCA 3NIGB 1ZGHA 3V4VB 1SCNE 2HIHA 3KFVA 3WRYA 3U7GA 3KQHA 4X65B 4JJIA 1WB6A 1JMKC 1O1YA 4AY5A 4HFRA 4NQZA 1FVXA 4I1RA 1F0NA 1U28C 5LMUB 4ZP1A 1CY4A 2P9QA 2CDAA 2EFHB 4ZN6A 1PG0A 3HYRA 2YJ6A 1Y4SA 1TYAE 1GZVA 2PMBA 1KO1A 1SK9A 4DLUA 4DUGD 4PYNA 1UADA 3N39C 2QB5A 2NT4A 3JARB 5HQ3A 3I4CA 1T9CA 3BD9A 4LXXA 3Q7TA 1HBJA 4ZEVA 3OIDA 4TTIA 2UZ3A 1N36B 3P9CA 5BQOA 4XWKA 1YQ9A 2UVDA 3E9NA 1UQRA 3HLYA 2QK4A 1RKQA 2GPYA 2ZM5A 5JFOA 1UAYA 1L6RA 1GUDA 2G8LA 2YINC 3B9BA 3KOZA 2ZIAA 3E22A 2P0YA 3KDPA 3OAAA 1MF7A 3R75A 1U9JA 1X3LA 3B7GA 3F78A 2VPTA 3I58A 1CS4C 4YWHA 4PPQA 1KY4A 1HDOA 1Y7HA 3OEYA 3VU3A 1TIPA 5E9JA 1U3UA 4K5QA 5AM0A 1YK0A 2ZSKA 2O8FB 4MGYR 1I0ZA 4PGAA 1A04A 3T5GA 3FROA 3QEJA 1I3CA 1G66A 3BD8A 1T2DA 4QQKA 2JFYA 3P4YA 4G2TA 2J8ZA 2ATCA 3TMKA 1BVRA 3ZGOA 4YXFA 5JH7F 2FPKA 2RGXA 3SC6A 1P1KA 5GINE 2QTMA 1PQUA 4LMBA 4UU8A 5D01A 1ABBA 3RNOA 4UEWA 3BDVA 3Q87B 1Z2NX 2HF8A 3DB1A 1ZK4A 1DKMA 4N49A 4OXRA 4QDTA 3ELDA 5KOJB 5K9ZA 3F2IA 1WMBA 8ATCA 3CRQA 4ZK2A 5AK5A 3IQXA 3BTOA 1GARA 1CYEA 3AHDA 3FYSA 2ZJBA 1Z4QA 1HDYA 3MB8A 2OC9A 5D7BA 4IQGA 3F98A 3KAPA 2P5UA 3U4DA 1WCIA 3ITEA 3VYSB 2W6MA 1KMNA 3AI3A 3CGGA 3MOIA 4NDNE 5C8DA 3R6GA 4M2LA 1JHPA 1I33A 3L6UA 3CWZA 3CZMA 2O7RA 4P86A 2E4VA 4Y7DA 1DAMA 5EUQB 4BB5A 2I6UA 4L08A 4JD5A 3KETA 2Q6IA 5T8KA 1WTAA 2VUUA 2VVTA 4HMOA 4Q3AA 5EYPB 1GUFA 3ZEAA 2OV8A 3FCOA 3OKCA 2JVKA 4UUOA 4N3NA 2DBYA 1X1DA 2MMCA 3GMIA 3M49A 5CX1B 3GLRA 1YZYA 5FXMA 1JP7A 1JU3A 2RMKA 3N58A 3JRXA 3T99A 4ER7A 5GJCA 1O5TA 1I1NA 1YKSA 2QNRA 4P3KA 5E3HA 3I2HA 1B8OA 2QN1A 4L9RA 4BJHB 2FPRA 2MR5A 5FB3A 1J70A 2GEFA 5CP8A 4A6EA 5DYWA 4ZI7F 4DIEA 3MWEA 4L5BA 1JA9A 5I9MA 4AZVA 1EINA 3M5PA 1MDFA 2NV2B 2N3ZA 3PQ6A 5KSWB 1BC5A 3VPAA 1FDRA 3UAYA 3MT8A 1QVAA 3OCZA 3ANMA 2J87A 5H02A 1L7VC 1M76A 3GRCA 3JXEA 3K31A 4PIVA 3WO0A 4BX2A 4C7BA 3RT1A 4DV1B 2GNAA 2O3SA 4ICIA 1TECE 3PI7A 4A0GA 1EEXB 1ZIYA 3NONA 3PDIA 2Q1YA 3KUCA 3RJTA 1THMA 4MA4A 4OBWA 2JKYA 4RF4A 1QGUA 5TLSA 4E1BA 1URPA 1Z2OX 2Q4EA 1K98A 4IIUA 4D57A 4ITUA 4D9IA 1VL1A 4N5LA 3GEPA 3P52A 1GL9B 4XGRA 2C8KA 4DNQA 4KREA 3OPXA 2GZAA 3O0DA 5CIYA 5I7RA 1S4MA 1R8XA 2QP4A 2HF7A 3OOSA 2FZGA 5DX0A 1X1RA 4R2KA 2XOKD 3RC3A 3VHQA 3RKUA 3DZKA 5AUPB 2ARKA 3ZCQA 2J7PA 1FBTA 2JLQA 4JJZA 4KE7A 1D2AA 1P29A 3EDRA 4ZTZB 4MR8A 3UICA 2ZATA 1MIOA 4NJOA 4DCGA 3P9ZA 4OB7A 3S8MA 1JEQB 2C58A 4ABTA 2IKSA 4IEFB 2WKSA 4BYGA 4F1KA 2O2YA 4GPD1 4HXYA 4AZ0A 1NBMA 2BKUA 3FPCA 5I4BA 1FDWA 2EC5A 3GUYA 3HVUA 1RI4A 4OBXA 4EI7A 4O08A 4HDAA 2G1AA 2EG9A 4I2VA 1GRQA 3AINA 4AUEA 1EWTA 1QQ6A 5IEJA 1FJXA 3REGA 5HR5A 3OJXA 4MH0R 5HKLA 1P3DA 4Z3KA 1L4GA 5ITZA 5B2FA 3MPOA 3A1WA 3D54D 5CNIA 3UWSA 4JJGA 3QKSB 1UK9A 2X22A 4IIVA 5E4TA 3PQ5A 4BMSA 5D51S 3TDNA 4EATA 2TMKA 4V24A 1AHNA 1I3MA 3RV3A 1BEEA 1DBQA 4HQRA 3UAZA 4HZGA 3QLTA 5LP6F 2VF7A 2H9IA 3C7DB 3ZNPA 3CUEF 4FE7A 4GGMX 3ZX5A 1F14A 4G5RA 1R8SA 2DECA 2PX3A 1EGAA 3CO5A 3L8CA 3PUIA 4NOKA 4WEOA 1DDIA 4UW9A 1KVRA 4PC6A 2OV6A 1ODKA 3MOGA 1JHOA 3I04M 5K05A 3RAEC 4QTUB 3WV4A 2OD9A 2PX0A 4HADA 2PH7A 2X86A 3C8HA 2FX2A 2LDXA 2IXGA 2DAPA 4NC9A 4KQFA 3KNZA 5I01A 1UBJS 1JDZA 3T9EA 3B6MA 1PDOA 2MJLA 1KZGB 1O94A 1Q92A 4IUBS 4L27A 4UUMA 5EFOA 4BKRA 1FQWA 4AWBA 4DILA 4G1CA 4C03A 2YJ4A 3DEHA 3V7WA 4ARZA 2ZT8A 1C0PA 4Q9LA 3ZWNA 2VPZA 2QJFA 2QYHA 3RK0A 3V1KA 5HK9A 4RPGA 1NN3A 4B3IA 4OLJA 4YFYA 3IO3A 3S44A 3VNRA 3WL4A 4EDHA 2EGUA 5FPSA 4ZVUA 3C41J 1BDIA 4OU4A 3ZYCA 4TS9A 4BVGA 2NXJA 2HUPA 3T9FA 1F48A 4EJ2A 3RIMA 2JIMA 4D81A 3N3BC 1NP3A 3D7LA 3OQJA 5LVAA 4RO0A 1W9MA 1FLAA 1K89A 3EGIA 4MINA 4IHKA 3ZXSA 1R9JA 1XCGB 2HT6A 3ETDA 3TL6A 1STOA 3E35A 4WNAA 2C2KA 4WA8A 5HZGA 3EGOA 3W2TA 2AR7A 5B3LA 1CLEA 2EIHA 3G2IA 3FI0A 3O8DA 1XEFA 5K99A 1Y3IA 3PE3A 3TVTA 3ESQA 1IDOA 1QIMA 1KP3A 5JZSA 2WMOB 4MS3B 4L73A 4DLTA 5GJBA 4BVKA 2R85A 3FYCA 6LDHA 3BN3A 2ZUWA 1XRSB 1CJKC 1HRDA 1A76A 4N40A 4HGOA 4PG6A 1YMUA 1T6NA 2ZWIA 3P45A 1RW4A 4A2CA 4E12A 5I45A 1IATA 2XE7A 4EGSA 4NJEB 1EXVA 1AXRA 1LSUA 4CTKA 4A91A 4PLWA 3KIPA 3SMQA 4A8TA 1ZGZA 5F3RA 1FRNA 4CIAA 1MAAA 4MTLA 4QJ5A 5LOVA 1PGJA 1ULTA 4B3FX 5ALIA 1DCMA 3IMEA 1QM5A 2AEFA 3RPEA 5DNCA 1RWVA 1AUPA 4S2EA 3SHFA 3R2JA 1WVMA 2H9YA 3D0RA 1U3VA 2O3UA 2XQIA 3INYA 1V71A 4RK4A 1I3KA 3CVOA 3PQ2A 3SFZA 3ZE7A 2HJWA 4DV7B 2C97A 3DL4A 2Y0DA 2R7KA 1VYVA 3PEVA 2CNWA 4I08A 3D4PA 1IVNA 1UBGA 4L2IB 4C87A 5BRAA 2VOJA 1UPAA 4P84A 2OMKA 2FETA 3VU1A 3JQ8B 4F71A 1RR6A 3PNLA 2HRDA 2ZB7A 3H5RA 4KPUA 2IE0A 2P9BA 5D5PA 4F2HA 1Y8RB 3EMDA 3DWGA 4HR7A 1PZNA 2PZFA 1WXGA 2V5VA 5H1YA 5U1PA 3N07A 1JHUA 1EU1A 4Y6QA 1LS6A 2YDXA 3S28A 3H9EO 3NJ4A 2DHQA 3OTGA 3GRZA 3PRHA 4KXVA 1F6WA 1LPSA 4MVJF 4LSZA 2VH5R 1SULA 1XOIA 2DQZA 3IBCA 5CH8A 4AQ7A 1E2DA 1MRZA 4J1TC 1MAHA 4YJ3F 2F4NA 3NVDA 5K0ZA 2B34A 4IG4A 3F97A 4L57A 2XOXA 1X70A 5M34A 2QGFA 2UXCB 3FZEA 2AXPA 2VEOA 3VR0A 3QW4B 3QKWA 4WKGA 1Q74A 4Q24A 2BFPA 2O2JA 2ZJ1A 3IXMA 3ZWCA 3V3KA 1ZR4A 2HSDA 1U28A 1REQB 4FUQA 3FYTA 4AJ2A 1TQ2A 1UM9A 2FMHA 2XBUA 3OD1A 4R6WA 2IELA 5FOTA 3RVPA 2VP0A 3DKPA 1XCMA 3OMWA 4JBHA 2QXYA 4PZEA 3TD6A 1G20B 3EGXA 4QOFA 4XTRA 5TB5A 1M33A 3B1ZA 4NENA 4JEMA 1X0VA 4I55F 2YQZA 3PR2B 1Z6PA 1LRJA 4PBTA 2JBAB 1LI4A 1KWKA 2DLDA 3ZWDA 3ADDA 2ZI4A 3ITDA 1Y81A 3RASA 2Y1LA 1U1EA 2CW5A 2GASA 5BN5B 2YZKA 3UIEA 4CJXA 5CH3A 4C20A 4D46A 2BMFA 5CFLA 3D3WA 3MTGA 2ZREA 1IY9A 2BDTA 1OWMA 1Q0SA 1ZD8A 1BFUA 2UAGA 3EZ2A 3IIKA 4KLCA 4PR0A 4AX4A 1Z2EA 4JUFA 4EH1A 5F9MA 4LNAA 4IZIA 1B76A 1HK7A 3D7SA 4MVJA 3ZCXA 3LUGA 2CYAA 4MKHA 2D74A 4OA8A 3SLKA 621PA 5EHZA 1NNLA 2PQ0A 2GEUA 3KUXA 3L06A 3AVOA 3OZGA 2I8AA 1BMDA 2DH5A 4OF4A 5E1DA 1DB3A 4RTMA 4BC1A 2FN8A 3LYHA 4IRMA 4YAJA 2C29D 3N59A 4UM8B 3SNHA 3ZCVA 1GO2A 4XOUA 5HMMA 2NNLD 4FP9A 1A72A 2GPNA 4A6PA 4E4YA 1YI0A 4R83A 4W8GA 5AKXA 3TECE 1DFHA 4AL4A 5T6MA 1TX4B 1JWLA 1KQPA 1VJCA 1Z6ZA 3KKMA 4KLAA 4UCXA 5JD4A 3NTOA 3RWBA 3ZD8A 1I6LA 3UJCA 2PUEA 1N6KA 2JRCA 9LDTA 4URVR 1U7PA 2JC3A 4ODIA 1OBFO 4ROTA 2MSLA 3PPIA 4J9UE 2DKFA 3E7FA 2NT3A 4PPGA 1Z35A 2AEJA 2ONKA 3BXXA 2WW8A 4U2GA 3ZWKA 1HO3A 4XUCA 3VHXB 3AVUA 2Q3LA 3JZFA 4K9LA 3TUJC 3NPAA 1PEYA 1WUJS 2PRKA 4KBGA 4HDRB 5I5GA 2J32A 1SCAA 5K03A 3DOCA 3RF6A 3CCFA 2XZLA 1A3CA 5TQJA 2IUYA 3NQ41 3TSAA 2HU5A 4JSTA 5D87A 3X1DA 2GBLC 2ZTSA 5E2IA 4OHFA 4A16A 4RVDA 3ZW8A 2FR0A 3CVJA 5ESWA 3ZGXA 3W5JA 2IOYA 4JODA 3KEQA 1FDOA 5IUJC 4GPEA 4HCJA 5FOSA 3U49A 4ESHA 1CU1A 1WLSA 1PJ8A 2I6TA 3EH2A 4TN1A 4UCQA 1GKUB 3WL8A 3CM0A 5BQ3A 4I9UA 3T9BA 1L4BA 1VLLA 3K9LA 4TSFD 3NEPX 2F6RA 2NG1A 3HVHA 3LLSA 2FZCA 2EFGA 3I8XA 2IYLD 1JDSA 5IF3A 3Q3VA 2LPMA 4MDHA 5C51B 2AKEA 1IUPA 4KIUA 2HJRA 2B20A 4Z2AA 1G6HA 3W4IA 1VG8A 1UCFA 3NTXA 2C0QA 3NG1A 2CLKB 3VOSA 4FOOA 4EW1A 2ZVJA 3IB3A 5IARA 1RXWA 2HI0A 2P78A 1G6KA 2KLHA 4IAOA 4BTVA 1O0SA 3O90A 4XJTA 4IVNA 1MQSA 1DUSA 2O8BA 1I8TA 1KY3A 3G2KA 5BUZA 4L85A 2GZDA 2ODQA 4DMFA 1H2BA 2I76A 4EF4A 4RMIA 1O87A 4CM9A 2FZKA 1IQRA 1ZN7A 4Y8VA 1HI9A 1TUBB 1O5IA 4BE7B 3SXPA 2C9BA 4LX0A 1O94C 2VHJA 4MLDA 5EJEA 1JXMA 2RB5A 1KIAA 3WNQA 1SC6A 1UZAA 2FRXA 2HHLA 3GK3A 1FJHA 3ABZA 5KYNA 2IHVA 4JP1A 4LAFA 1PNRA 2X6TA 1GYQA 3UHOA 3SCZA 1G59A 1M74A 3H2YA 1FTQA 3S6JA 3CZ9A 1NBAA 2Q7XA 3QW2A 1I2ZA 3NLLA 1XZLA 3BCHA 4G0MA 1Y1SA 5M3BA 1TM1E 4PYQA 2R7MA 1KQNA 5ARBA 5BY2A 1SQ5A 4P4UA 4W1SA 5HQTA 5FQOA 3WNVA 3UAGA 4BNTA 1TEVA 1B0UA 3PDJA 3IA2A 2EEZA 2ZVDA 1T8TA 1Y48E 1TJPB 3N2LA 1T8UA 4N0QA 5AI4A 3TXYA 2P11A 2PL5A 5JXIA 5K0GA 5E0KB 5A3VA 1VG1A 3A8TA 1P80A 2NO1A 4E2YA 4C78A 2G88A 2WY2D 2VHUA 2C07A 4DV6B 4RPCA 4CLRB 4IXTA 1R0WA 4Z86A 4W9NA 5EP3A 4MCIA 1OFVA 4LWZA 5K5EA 1FXSA 1NAHA 1PUJA 3L8GA 4KQIA 5FBZA 3R76A 2Z1NA 4DLVA 3RFFA 3ZS9A 2QOEA 4Q47A 4V39A 1ZVVA 1E2JA 3AR3A 1J22A 4NR0A 4OVKA 2GBPA 4C4TA 5JTUA 1J42A 3UJHA 2O5VA 3FKSD 3WFJA 5EOVA 2XCIA 6CHYA 1PJ3A 1RWKA 4QGSA 4UE6A 1C0LA 1ZOIA 5A3RA 2FUG6 1GNRA 2IPLA 1N5OX 4F2DA 1E66A 4YR9A 3PHJA 4LG1A 5KNLA 3GVPA 1OREA 5DRTA 4UARA 2ZXFA 1N34B 5KKCA 5ULLA 3WLTA 3A04A 3JYQA 1ZJYA 4YRTA 4NU6A 1GNSA 3U1BA 1Q1EA 3GLKA 3H11B 4CRWB 1GVNB 5K3SA 4ERNA 2C2WA 1ILWA 3HBLA 2WKRA 4EB3A 2O6HA 4FLEA 3RF7A 1ONSA 4DA4A 3A2NA 3R3YA 2JJQA 4XWWA 1RYFA 4ZCLA 1PVDA 3B3QA 3F4KA 4K6FA 2GK3A 1O9GA 3BIWA 3GFVA 4IEEA 2B1GA 5IMBA 2AW3A 3IJPA 4UHKA 1U3WA 1C8BA 3O1IC 2G70A 1EQAA 2XUGA 4TKLA 4RJIA 2P2DA 4ZAVA 5REQA 4ZHQB 1AZWA 4US1R 3M1AA 1I10A 3RABA 5HRUA 2C4TA 2R6GA 4EYEA 1WX1A 2QR3A 4DA6A 1GNQA 1CX9B 1ISIA 2P3QA 4KC0A 3C0KA 1SD5A 2HOQA 4CPDA 2VS1A 3ZE9A 1C1XB 4LHSA 4L2IA 3MWGA 2GEBA 3U61B 3IILA 4P36A 1BVHA 2H7XA 1SBZA 2GPSA 2ODEA 2PBFA 2I1QA 2GGSA 3GH1A 3JQGB 4QEZA 1NXXA 2E1PA 3PNSA 1JFVA 4QULA 2X4DA 4NPCA 1Q12A 3T7AA 4MJXA 4I9FA 3OOHA 1T1JA 2WUDA 3GJ7A 3HCAA 3B1YA 1D6JA 1B8NA 3P9RA 3INGA 1K2WA 1RYBA 2I9KA 1JV2B 3KOOA 4R0MA 5JJBA 3VR1A 3A1FA 4V0ME 1DEAA 3DP7A 4EKNB 1DRVA 5HF8A 4QT4A 4TYMA 4KZPA 4E5MA 3LQ2A 1O2DA 2GEJA 3C8ZA 3EXHB 2RI6A 1SC1A 4I9HA 4NWIA 2XXAA 1BX1A 1Q91A 5IVIA 4EJ6A 1UKCA 2XWJI 4HPJB 4TSFA 4YMWA 2PT5A 2X3FA 1MVOA 5EHXA 2CV0A 3T52A 3EZGA 2I5PO 2H17A 3H2HA 3R3XA 4IIDA 3QUBA 2PKXA 2AXQA 3R7WA 4MQ4A 1ZW6A 4H08A 2EZTA 3NAZA 3OO0A 4HDCA 1UJNA 4Q9HA 4B6SA 1L5FA 3WB9A 5K0EA 3WYGA 2NWQA 2IGBA 1XZAA 1L7XA 3IHKA 3LWDA 2C5EA 2HY7A 2O7SA 1PR4A 4QELA 1CZOA 2WF9A 4X85A 1I4EB 3HHEA 3WYDA 3FJYA 2EW8A 3KKNA 2XF8A 3VXKA 1O57A 4J1TA 2IGTA 3DOHA 4G5YA 4BL5A 1MV8A 1FXWA 3I9V6 4H1WA 1XROA 2OMEA 2R8BA 3QYJA 3BK7A 3PPWA 1D1TA 3VAYA 2IEAA 1MABA 2JLVA 1R0SA 1KC3A 1YCFA 1EK2A 2B8NA 3K9GA 3NGMA 1E1YA 1ZLXA 2ZDHA 2G83A 1Q0QA 3IJ5A 4KE6A 4K9PA 3TB4A 2GDJA 2ODPA 4BX8A 2H16A 4KXWA 4EA9A 1G1AA 3OX3A 3I23A 4RHEA 1NPDA 5C7LO 7MDHA 4M53A 4D45A 1RZRA 1PLJA 4AF7A 4PTYA 4IKEA 4TTAA 5F2KA 2LDBA 4A8HA 1V0JA 4C0QC 4QG7A 1QIGA 4ZK6A 3E8MA 4JC4A 2DGDA 1L8LA 2WKPA 3DA8A 2LVBA 4Y3UA 3ITNA 3R09A 5SZJA 4CU2A 1K0FA 5JMWA 2BEJA 3E1SA 1SCJA 1EUQA 3EJWA 3FR7A 3ZCPA 3S8EA 3HLTA 1VCNA 3S68A 3HHPA 4WK0B 1AGXA 1SY7A 3AV3A 3B82A 3GPBA 4ZAGA 5IYZA 3H3JA 4W7IA 1SVUA 3DOEA 2B8JA 3EVBA 3FN4A 3MJFA 2VZLA 3QE3A 3BJEA 3OE7A 1MO5A 1ORIA 2H5LA 4X60A 4REQB 5C7YA 1M8GA 4IUYA 1MW9X 1A4UA 2AG5A 3E18A 2J0QA 3GYGA 4D0GA 3VR2D 3LUCA 5TGZA 3ANNA 1KMCA 1XQWA 3L7NA 1U7OA 2PMFA 2YWRA 3ECSA 2IHBA 2W37A 4JKIA 1J23A 4P7JA 4R2MA 4ZO9A 1T4GA 3F8TA 5CBPA 4CG1A 3AC0A 2AXEA 3M6XA 3AKDA 1U81A 2QTTA 1QKIA 4W9MC 3MIIA 1Z07A 2QTFA 2H2GA 1P1CA 1II8B 1J0BA 3ZBPA 5I48A 3A70A 2IV7A 1L5VA 4G1EB 2ATXA 5FT9A 4BE4A 1QYCA 5KNBH 4IILA 2OZEA 5IM4A 1YRQA 2ZIXB 3SZRA 4R1TA 3C6YA 5HRAA 3A2LA 4CEJA 1FSFA 3E9CA 1XEWX 1KYVA 5DWDA 5FTMA 4L3OA 3VVLA 2A5FA 2AR9A 4C4YA 4KOAA 4U0JA 4DRYA 3W8NA 3WYFA 3DW1X 4RKQA 5DSTA 3UFBA 2VTBB 4BGVA 4AYWA 2YFYA 3TW4A 4JJ8A 1SCDA 4J6FA 4R2XA 4KP7A 1EP1B 4XEUA 1ZCJA 1DC5A 3GNSA 3BEDA 1P4HA 2DPGA 4MQLA 3E05A 1GFWA 2H7CA 5TV2A 2EJWA 3KOUA 3V1YA 4B32A 3SQLA 4BNKA 5A9SA 5AVUA 1S89A 2FWIA 2JGDA 1IB0A 4BNVA 1C7IA 3HO1A 3JWIA 3D6UA 4CF5A 4WA7A 3KV1A 1DBSA 2P1ZA 3QF4B 1AHHA 3IT1A 4G9EA 1A96A 1ZH0A 1J24A 1XKXA 2F3PA 2VAPA 3ST7A 1UAAA 2JRLA 4KODA 4KWEA 4X24A 1DXOA 2PXXA 3VPSA 2G1KA 4OGGA 3NUGA 2H5IA 1ZK1A 4WEQA 4N3CA 2FP4B 1YJXA 3W04A 4J3FA 4K6KA 2A8YA 1RI5A 1SVMA 3FR8A 2NP7A 1AJEA 6ADHA 4IOKA 2CVZA 1NBIA 5J63A 3KE8A 4E6PA 3FTQA 3WKCA 1GITA 3NRBA 1SXJC 1AMOA 3HNRA 3AERA 4U9HS 3PQFA 1MB0A 1Q0PA 5IC5A 5BQFA 3FAZA 2QL6A 1FUKA 3F47A 1XO1A 3GHYA 2JFHA 4KGXA 2PWPA 1G2IA 2ZDGA 4JXXA 3H1EA 3WZLA 2XODA 2W2PA 1SKYB 3NOXA 2QD2A 4FMDF 4IJ6A 3QE9Y 2ZYIA 3W8EA 3KZVA 4XIJA 1XIVA 2B7CA 4Q93A 4TV8A 1CS0B 1XTZA 4K6CA 5EGNA 3COWA 2HTFA 3E2PA 2MIIA 4DR4B 4DTCA 1M67A 2YW2A 1A4XA 2O2SA 3GXBA 5A1JA 5C8XA 4C21A 4ETNA 1QSGA 1M2KA 1N4DA 4C22A 1EVLA 3O2QB 2V59A 3JQAB 3N3AC 4NEQA 4R51A 5TC4A 1GV0A 1KMHA 2WSMA 1IU9A 1HTBA 2V0NA 1QQ5A 4QNNA 3VYUB 4AY4A 4ED9A 1C3OB 4JGGA 2DG2A 4I6GA 3GCDA 5ARDA 3QE0A 4RVGA 4RD6A 4TT3A 4XD7D 5BO5A 3QU4A 2OT3B 1Q2UA 2DUWA 3B2QA 4YJDA 4ATNA 4QRIA 3O8OB 1JLLA 3AGPA 2MT9A 1TCBA 5E4YA 1H2FA 2C4WA 4CQNA 3LBFA 1IRXA 2PLWA 3VBCA 3LQKA 3KSRA 4BLRA 4J0IA 3RHTA 4A03A 1PKXA 1YDHA 3RSFA 2P3OA 1RYZA 4BX9A 2FZ4A 1TXGA 3L40A 5FAXA 3UJ8A 1QZXA 4MW1A 3VMFA 1PWEA 3BMXA 3D6FA 1JYSA 3LVFO 4Y2RA 1U9CA 4DJTA 2IEZA 4AZ0B 3ACBA 2XQJA 3R7AA 5A03A 4M36A 3HXPA 2MYPA 2OHGA 1MJNA 2PUDA 5DGHA 4ZJZA 2C59A 3C4QA 3DBVO 4GMDA 3G6KA 4ZI5A 3UA3A 2OZVA 2PAAA 5HZHA 5CW2A 1MAVA 1KS9A 1UEJA 4R6XA 3OIFA 4KQWA 3ZU3A 1CQIB 4DTIA 5CVVA 2A9VA 4G0UA 1VL2A 3IERA 3U7JA 1VP3A 2FN9A 3PENA 3P5BA 5DEIA 2V7XA 3UJ3X 3VH2A 3OAAD 2IYEA 3CN9A 4X5OA 4P4LA 5JZ9A 2V1UA 1AK1A 3VC2A 5DOVA 3M8KA 2EBHX 2FDRA 1VGQA 1ADYA 4FR2A 4NAUA 1BAPA 4XSVA 4D4IA 3UT5A 1NIPA 2JHFA 4PBSA 1K6EA 4MR9B 3CNHA 1Z5OA 2IYOA 4DZRA 4LIPD 1P6QA 3ZY6A 3B12A 3KCQA 2DFNA 2WU4A 1NR1A 1ODJA 4WTOA 4DHEA 3E9QA 1KH1A 2KMLA 2NO5A 4F2PA 1EFPA 3IUMA 1AS3A 4Q9JA 4HYQA 2BM0A 1Q95A 1ZD9A 2A84A 821PA 1H1TA 1JPVA 1G2QA 4DXDA 3RS9A 3HKCA 3IQGX 1HDIA 2JZOA 5DT9A 2Y0CA 3UYLA 3B6IA 1W5EA 1DWOA 1ONNA 1U2ZA 2QTLA 1EVZA 1T3HA 2RBEA 3PRKE 3PDCA 3ZDRA 5IVKA 1NATA 3CWQA 4B2IA 4OQ4A 2P1RA 1SVWA 1VIYA 2JANA 2FW8A 4MDYA 5K8CA 5DLEA 4AY2A 1NASA 3GPIA 3PXGA 5KYUB 3WYAA 4BO6A 1NBEA 2PHZA 4WERA 2Q2OA 5IG2A 3BC1A 4FKMA 1GILA 2Z08A 3O7MA 1PW5A 5IZCC 2BGUA 1QZTA 2Y71A 2ZPUA 3UEOA 4UQOA 2O8DA 1V6AA 3IKMB 4WCFB 4A1FA 5JC1A 4PGMA 5ELXA 4PC7A 3RSCA 2IYRA 1N3IA 3I0NA 4H7IA 4O1IA 3VSEA 2YC4C 4RGVA 3LQ4A 1M8KA 1LTKA 1XRRA 2KJQA 5DLDA 4LK2A 3T0FA 4H4DA 3KJIA 2CEKA 2CYCA 1J2YA 5AVXA 2OCIA 5AKYA 4QBTA 2BFBB 4ABYA 2R6AA 4LYAA 3ZWMA 2J67A 4F91B 5JXHA 1HKHA 1SJ9A 4REOA 3HGQA 2ZETA 3DV9A 3JATA 4I8XA 4J3NA 4KFUA 2OPBA 1E9VA 1WEKA 3KFLA 5LPNA 1OWNA 1K3TA 3DGFC 5I3ZA 2NO9A 3REQA 1D6MA 2XYRA 3BTSA 5LJIA 2GH1A 3QHPA 1JQBA 3NNSA 1YB5A 3JQFC 3AKZA 3C97A 4MUFA 2CXXA 4K8RB 3FTEA 1TO1E 4GRAA 4K1XA 5KHLB 1YZQA 1X39A 4HS4A 1ZNXA 2AMVA 2ZLBA 1F4PA 1PR2A 1XP8A 3ES9A 4K3VA 3D6MA 3SYTA 5C53B 1P2TA 4KZKA 1W4AA 2WJ3A 3I5MA 1KC1A 3ZV4A 4IDBA 2AI1A 2F8SA 2UUPA 3AF0A 3RS3A 2DM6A 2CXNA 3QXHA 3CZAA 1OBCA 2XDQA 5EXDA 1KDYA 2OAP1 4L78A 3WIVA 2C2GA 3DV0B 4JYPA 3BGIA 4C4XA 4NZPA 5IYZB 4LQCA 3CUVA 3WB1A 5CLGA 3OIUA 4BVHA 3WQBA 1NBMD 4E5YA 4ER6A 4YMHA 5G1OA 2GDZA 2IH5A 1BWPA 2H52A 3TLMA 3EUFA 3ILHA 3PCRB 2P6PA 4YMIA 2X19A 5T4FA 5I7FA 2JIZD 1NI3A 5JAPA 3DKVA 1SC9A 4H16A 4M8NE 3H84A 1RWOA 2CWDA 1W30A 4IBOA 1I0LA 5LYJB 1XMVA 3K8ZA 1SXPA 1T1SA 2EKPA 3GT7A 3BE8A 5ICFA 4P81A 3EASA 2OCKA 5KVAA 3V2HA 2OGSA 2Y99A 4CLHA 2JHAA 3FI9A 1WCV1 4OO3A 3EWIA 2GPWA 3UXMA 1L7DA 4I36A 1V8BA 1X9IA 5B2EA 4C4SA 2XDAA 2VHZA 3HCOA 5GOZA 1SKAA 2ZUCA 3AILA 2Q62A 2IIQA 2HA2A 2V5AA 1SFRA 5ALPA 1U7WA 5K2MA 4DPLA 4ZO7A 1VFNA 3I9JA 2OZLB 4K46A 4MLPA 3PX7A 3STVA 2EQBA 3DE2X 1WVIA 4HH4A 4EKYA 3KU1A 1N3LA 3B2EA 1R5BA 4BGIA 1ZHHA 3A58B 2ST1A 1L7AA 3D4NA 3NEYA 3TZKA 2G07A 4UEJA 1A9OA 3PU6A 2DUJA 1GGHA 1GZ3A 1OZFA 3EFBA 1J49A 3QEKA 4GMGA 4QOHA 5ALTA 1RRGA 3W6PA 3RGWS 4B5LA 3G2MA 1YQUA 3DG9A 2I6SA 4UNSA 4ZOAA 3K2EA 2BKLA 2ZUDA 4PWYA 3K1TA 2A9PA 1FSGA 4OFZA 2PVPA 4V03A 1X7XB 4KU4A 3WFIA 5HSGA 1YJCA 2Y6UA 3WLQA 3WWZA 1JMVA 1EIZA 1G20E 1S6YA 2GN1A 2WK1A 3IEKA 3M6MD 3R6LA 1NDHA 2ZIXA 4UUQA 4Y1EA 4RVSA 1MC5A 4R9UC 4DPKA 2D4AA 2ZZMA 3TYXA 3ZQUA 5A3JA 3SSMA 1UFVA 1IIBA 4G5SA 5IX8A 2NQ8A 1GYRA 3ZOZA 2BLLA 4YQFA 4P54A 4CKEA 5JEDA 2JBHA 2R97A 1RAAA 4RK0A 2PXCA 4RORA 1HM5A 5CVUA 5DULA 4Z99A 5HS6A 2PUCA 1V5EA 3EODA 5LDHA 2V7BA 4LRUA 1L8XA 1MU0A 3VR3D 5B7GA 4Q9IA 1YV9A 3F3MA 2Q6OA 5F51A 3GYBA 5ICSA 3DNPA 4BB0A 5A0TA 2ZKLA 4X61A 1E2GA 5BNIA 3K0AB 5GVSA 2WWWA 2B37A 2HXSA 3KJZA 2G7ZA 3TJRA 1NKTA 4TKVA 4GL4A 3UBTA 5C35A 1PJQA 2VDLB 3EUAA 3GRUA 5JO0A 4ARVA 5KJCA 3BMQB 4FZRA 1KDVA 2WSYB 3L0CA 4P0QB 4UHDA 2M6KA 3CNQS 3LO5A 3VNUA 4K9KA 3LT4A 4WLUA 3MWJA 3OJ0A 5T6BA 4UASA 5JISA 2AJLI 4WVLA 4B35A 3REOA 1J25A 4A9AA 4ZYTA 1E99A 3QIVA 4FFWA 3LDHA 3H9QA 2FN4A 4G41A 3U44A 4BV9A 1AQ6A 2NYUA 2Y4OA 3WGTA 3U16A 5IMSA 2OCBA 5EXPA 2YUIA 2KSQA 3KL4A 1TJ3A 4JEHA 3KL2A 4G0XA 1QKJA 2B5OA 2ZZKA 1NHGA 2NZYA 1N6NA 1QYRA 1CUGA 2ZJ8A 2HGZA 3MGBA 4DDWA 3PLNA 4GW3A 4NL4H 4QXPA 3Q3CA 2I8CA 1TPZA 2RK3A 2GD2A 5K3DA 4B83A 3OFNA 1B6TA 4WW0A 2FF5A 4BZPA 3F7TA 2FEPA 2D7JA 2XE6A 3ODGA 5DHAA 3RHFA 2X4GA 4NPAA 5BMVB 1K1EA 2AOTA 5EGSA 1QP8A 2JDID 2IP1A 5LXTB 2DT8A 1EE2A 4HGPA 5ALWA 1UBSB 3IFSA 4TKZA 4F92B 2FVXA 4GP9A 2C92A 1R0LA 1Y3DE 1RQPA 2V4MA 1J1ZA 2C5BA 4O1HA 4BQEA 3E0XA 3WIDA 1C2TA 3SF0A 4EY5A 2J41A 2OOSA 1FL9A 5M7EA 3OZRA 1T4DA 1KJZA 2G25A 3HYNA 3NVAA 4LYHA 2C1XA 2QAJA 4X1KB 3CCBA 5H16A 1TVCA 4D5GA 3EY4A 5FWAA 1T5TA 2NSHA 4WI1A 2FWNA 3EA5A 5IKEA 3SM9A 1QKKA 4JWTA 4Z4QA 2BFOA 3Q2OA 3V4SA 2ZI6A 1YE8A 3KHUA 2O2IA 1FVFA 5J4LA 2C8JA 2BN4A 5ER9A 3UXYA 5AKKA 4K9MA 4LK3A 4ND2A 3O1HB 3UAVA 4OX9Y 3CIFA 2DRIA 1KJIA 2V4UA 2D4HA 2NUBA 4I5GA 1A5AB 3MTDA 3UMGA 4G9GA 4G0NA 4RVOA 2DY1A 4LPSA 4ZANA 1U2SA 4RH0A 1RADA 5ALQA 1YKGA 1OE0A 1ZJ4A 2DOKA 2BFNA 2PX2A 2WNIA 2C8VA 1NXPA 2C98A 1NQ5A 1T2FA 2CJWB 2JIPA 1Q0HA 2V9ZA 3Q11A 4KX5A 4LVCA 3S5JA 3VJMA 4YMSA 3BH6A 4U3JA 2YZNA 2XLCA 3PGVA 4C7XA 2O7QA 2F43B 3CH5A 2EFEB 4M83A 5COQA 4EG1A 1RKBA 1JNYA 1XKQA 1W35A 4BQNA 1DRWA 1SK8A 4JCOA 4BOYA 2A1IA 3CNLA 4PRKA 4TKUB 3W1EA 1IVYA 1FQOA 2GK7A 3O9MA 2ZWOA 4ZT5A 4HVLA 2CCKA 1L4HA 4IWXA 1Y4ZA 2OE2A 5JAZA 1KFEB 2Y66A 4C14A 2OHVA 2ECQA 4B2YA 1F60A 2HB6A 5C3MA 4KSCA 1QB7A 5G1NA 1PLLA 5TQ2B 3RG2A 4EHKA 1E6EA 3AUJB 2XT9A 1GP2A 5FWDA 4EARA 2SCUB 1F8GA 3EIOA 5KYWB 2OYSA 3HUFA 4QVIA 1ZNQO 2IQIA 1ND5A 3BBPA 4ZHSA 2P4HX 3NM4A 1KE2A 5KNBA 2WICA 3SHQA 5H59A 1JU4A 3B8EA 2O54A 3JQAD 1L4LA 4UM5A 4B8ZA 1WW2A 1UWKA 2IYUA 2P9YA 1JDNA 1OYOA 1H23A 4FJ0A 4D4MA 4E5VA 4N76A 2VXYA 1RMYA 2GJ9A 3HR7A 3DP9A 3OMLA 2JFVA 4N0MA 4HB4A 4TMYA 4L7QA 5FI1B 4D4HA 1F1JA 5MFZA 3DLPX 3TLAA 2X5JO 3EVDA 5HIIA 1EUYA 3WNCA 3OEHD 3K5WA 2BI7A 2CLEB 4JOCA 1EH5A 4CMBA 2OFXA 1UKYA 1JQLB 3E82A 3FWKA 4BGUA 4ZQCB 2YCBA 3VR3A 1LI7A 3PGXA 5K8VA 1H4QA 3AVWA 2H2HA 1GCIA 3KQMA 2GNOA 4JXJA 1YGYA 3USCS 4MPJA 5DM2A 4CQLB 2MSEB 4CG2A 4L28A 4JHLA 4Y6LA 4B87A 3GI1A 2V3CC 1P4JA 5E0OA 2P77A 2J33A 4LKRA 2OHHA 1CZHA 2FLVA 2Q2QA 2V58A 3KDAA 3OICA 3IPLA 3NANA 1CR6A 2HO5A 3F9IA 5L3VA 2PSHA 2W6QA 4OAQA 3OF2A 3K4HA 1SKQA 4BFXA 2R62A 2VKTA 4CLOB 3EG5A 1E2KA 1SUWA 4IZHA 4KLNA 1KZ7B 3QTTA 2G06A 3CRW1 4KMOA 5FUBA 4JMLA 5FNVA 3CVYA 1PZGA 3P9YA 1ZS9A 4K86A 4KNYA 1QYDA 3L8MA 2IYZA 4PNHA 3WXBA 3X1WA 1KO7A 3R6DA 4OHPA 5KYXA 1LUAA 1O6BA 1QR6A 2FPMA 2Q3HA 1YZVA 2RGEA 3FMVA 4IIJA 4RGBA 4C4PA 1ZICA 4J16C 3RFCA 5ENDA 2RAVA 1T5LA 2A9OA 1WBDA 5C1DA 3PYXA 1H0RA 2AJDA 5G4LA 2J3HA 4TXMA 4Q3DA 1QG0A 2GZHA 4Y1RB 1M2VB 3KTOA 1I2AA 1BW9B 3QITA 4M4SA 1CUUA 2Q3FA 3RJ5A 3IP3A 2GXQA 3JD1A 4X0EA 1I2MA 4IDPA 1S9HA 5AKHA 1I3LA 4AZ3A 1IM2A 1RQXA 4HBZA 4QFBA 5A4KA 1KDPA 2YN2A 5HIKA 3VKGA 4B3SB 2JLSA 3ZE1B 5EIWA 4E32A 4EMUA 4BMYA 3K9FC 4H31A 4OM8A 4RTLA 4DUPA 1TK2A 4CI9A 1KI7A 3KXPA 3R0JA 1N5RA 1T5SA 4ITVA 3AYZB 3COJA 2JKVA 2ZJ7A 2O48X 1ABEA 1U2EA 4GOND 4Y6OA 5LYJA 5CDHA 4ZCPA 3AQ4A 2W4MA 3I76A 4FCTA 5KYUA 3BEOA 3EQ7A 5IS2A 2G40A 3A3KA 2RHOA 3GIWA 2A9RA 4U7DA 3HB7A 5LQSA 2V7QA 4QX6A 5C34B 2IH2A 4AURA 5FFNA 5JZOA 2QX8A 1LRKA 2W9XA 4ER5A 3HXKA 4EB6B 2VYFA 3HKCB 4MUHA 3RC9A 4E2WA 2PV0A 4U4AA 3FZQA 1T1EA 4PX9A 4YV0A 521PA 2QROA 3MB5A 3FNHA 5BSFA 5I8ZA 4NK5A 3RB8A 4CCSA 1RBYA 4CM4A 2P9FA 1UMBA 2O8NA 3FKSA 4M1SA 2EX4A 1YL7A 4F3YA 3F7OA 1EFRD 1JKJB 4OOFA 3U37A 4KQ9A 4OGFA 1Q6ZA 1D7AA 2P8SA 4CEHA 4LMAA 1AIPA 4MWEA 5HUQA 3NHFA 4KITB 3WLJA 2I1VB 2WHEA 3KM0A 4ID9A 4MVJH 2VPQA 3E3LA 1X7YB 2ZB3A 5KPJA 3ICPA 4HWPA 3K0FB 3B1JA 1Y1TA 5DGDA 4YQZA 5K0LA 4Z1MD 5G0UA 1PW7A 3HKEB 3TKAA 3WC4A 4CMJA 2JAOA 4P32A 2PA3A 2WSSA 3A25A 3FY4A 4YH1A 3VNQA 4I1IA 3EPJA 1HFKA 1YR3A 2JA2A 3KAQA 1MC8A 1DEKA 4X44A 1ML4A 4OJQA 2BFDB 3WBKA 4R3WA 5FLKA 4FMCB 5CLJA 1ULSA 3H7IA 3ER9A 4YRRA 4BX0A 1C9KA 4BNNA 2J0UB 5KC9A 4PGGA 1A8UA 5FYDA 1DMRA 2NU6B 4RK1A 2B8EA 4GOJA 3C3CA 2FPUA 3C3XA 3OT1A 3CU5A 4CZ2A 4EITA 2OB2A 4OXXA 3K16A 1VDMA 3VGJA 4B3TB 4TYQA 4NIMA 3TAHA 1K5HA 1OHHA 5AK3A 3H2BA 1SGWA 1SXIA 4DLPA 1IYZA 4Q3CA 1HE3A 4FM9A 4FGUA 1Z29A 4FPXA 4LHZA 1WDLA 3UV6A 4E2FA 2XRFA 3H5NA 3NMUF 2XBLA 2AOXA 4RKWA 2Z2XA 3EPLA 5H0IA 3P9QA 3QQPA 4KJZA 1UPUA 3FMGA 3PC8A 5ALMA 2Z1MA 5AVSA 1CK4A 4ZKEA 2FJ0A 5JV5A 5PGMA 1I1HA 2KQUA 4PZDA 3LT5A 2Y1KA 3DZJA 1H1LA 4J03A 2J0EA 4Q9DA 4XTCS 5IVDA 3DM9B 1RCFA 3SS8A 1SIUA 1SXQA 3D3QA