4ZZIA

Sirt1/activator/inhibitor complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
335
Chain Sequence
GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCQYLFLPPNRYIFHGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of a small molecule SIRT1 activator-enzyme complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NAD-dependent protein deacetylase sirtuin-1
total genus 105
structure length 335
sequence length 346
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4zziA03
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4zziA02
4BVEA 1V5FA 4GP9A 3EA4A 2A1TR 2JLAA 3F6EX 4FEEA 2EZUA 2B4YA 2FR8C 4Y6OA 4JUDX 3EYAA 2H2HA 1EFVA 3FLMA 3FSJX 5IMSA 2JI9A 1YTLA 4K9QA 5EJ4A 1UPAA 4K9MA 3GLSA 3PDHA 4JD5A 2NXWA 2WVAA 5EJMA 4KGDA 2VK1A 1Q6ZA 4BVGA 4J1TC 1UPBA 4BN4A 2H2IA 4K9NA 4J16C 2C31A 3F6BX 2EZ9A 1OVMA 1EFPA 5K6RA 1SZCA 4L2IA 1Q14A 4I5IA 4HDAA 5EJ5A 1D4OA 1OZGA 3RIGA 5K6TA 4GG1A 4MQ5A 2EZ4A 3GLRA 4KXQA 4UTRA 1NM5C 5MGNA 1M2GA 2VBFA 4UUAA 2IHTA 3HWX1 3IAEA 2IHVA 4MZXA 4F56A 2QQFA 1POWA 1YHYA 4FZ3A 2EZ8A 1PVDA 2WVGA 4K9PA 4UUBA 4BV3A 2AG0A 1YHZA 4FEGA 4RMGA 3GLTA 2DJIA 5DGTA 4UU7A 4JU8A 4D5GA 2OD9A 2H2DA 2Q29A 3CLUD 3CLTD 3OE1A 2FSVC 1T9AA 2OORC 1YI1A 1M2NA 1OZHA 1Q1AA 2H4JA 4UTXA 5BWOA 4HD8A 4IAOA 2HJHA 1ICIA 1YNOA 2BRUC 2FWNA 5K3SA 1Z8NA 5EJ9A 4JU9A 4MPPA 4Y6QA 3RIYA 1PO7A 4GM1A 1DJLA 4C78A 4L3OA 2QQGA 3D7KA 2OD2A 4QELA 3JWPA 1U2DC 1ZPDA 4RJJA 4R8MA 1PTJC 4MPRA 4JUCA 2NYRA 2PGNA 4K9OA 4D5EA 2Q5QA 4COKA 5EJ8A 2V3WA 4ZZIA 3CLSD 4BVHA 4X3PA 2VK8A 3ZG6A 1SZDA 4FVTA 4ZP1A 1M2HA 2JI7A 3LQ1A 1PYDA 2Q5LA 3K35A 2A1UA 4MPJA 2EZTA 4JT9A 4BVBA 4TWJA 4UTVA 4RJKA 2H4HA 1PI3A 2Q5JA 2WVHA 5DGDA 5DEIA 1S7GA 4IF6A 3ZGVA 2Q5OA 2W93A 3E9YA 4F4UA 4TWIA 5EJAA 3CF4G 4O8ZA 2JIBA 2PANA 2VK4A 4UTNA 3PKJA 1U2GC 1MA3A 2FN3A 2VJYA 1YBHA 1O97D 1PNOA 1O96B 4UTZA 1UPCA 4Y6LA 2OD7A 2AG1A 3HWWA 4GM4A 4GM0A 4JUAA 4G1CA 1POXA 3D4BA 1V5GA 2VBGA 4QPZA 4BVFA 5EJ6A 1XLTC 2UZ1B 1MCZA 4GPEA 4C7BA 4Q9DA 3FZNA 2H2GA 4K9LA 5D7NA 3IAFA 4BN5A 2Q27A 4JT8A 5BWLA 1PT9A 3EY9A 4JUBA 4RMHA 3D81A 5MFPA 4JSRA 2H2FA 4RMJA 4BUZA 1HZZC 1PNQA 1YC5A 4BV2A 1M2KA 1U31A 4QQ8A 4RJIA 1BFDA 4V1CA 2PGOA 2Q28A 1J8FA 3GLUA 5FYQA 2IHUA 4IG9A 3U31A 1YC2A 5BWNA 1E3TA 2H59A 4V1CB 1QPBA 2OO5C 5AHKA 5K2OA 4X3OA 1U28C 5MFZA 1V5EA 2JI8A 4RMIA 5FEMA 1N0HA 1T9CA 3JR3A 1T9DA 1Q17A 5MF6A 4V1CI 2FRDC 4K9KA 2VBIA 2X7JA 1JSCA 2H4FA 3CLRD 1YI0A 4KPUA 3ZGOA 2JI6A 1T9BA 2UZ1A 1OZFA 4UU8A 1Y9DA 3PKIA 4JUFA 2JLCA 5EJ7A 1M2JA 3U3DA 1S5PA
chains in the Genus database with same CATH superfamily
4U8GA 3K4QA 2DUNA 1I36A 3T3GA 1QZTA 1UJBA 1P0CA 2WUDA 2DT5A 2JJYA 3MJVA 3KKLA 3VVLA 1K98A 1T24A 5A5FA 1T2UA 1SEVA 5T64A 2VHWA 2AXPA 5E8JA 2J3EA 1T8SA 4UOZA 4DV6B 1VHLA 2GTIA 1VSTA 3JQQA 1JI0A 1XZBA 1UZAA 3KUCA 1F8XA 3M3PA 3PFGA 2W2KA 5KHLB 2VSQA 2VAPA 1UJ4A 2NTYC 2OGWA 2C8JA 5TF0A 3BHMA 4MR7B 2QLBA 4PS1A 1JMYA 3HEAA 5K6TA 3L01A 3AJRA 1BJKA 2OC4A 3AO0B 3I6YA 4TXMA 5E2BA 2G1JA 4LVNA 4ZRMA 5IWAB 2XZLA 2ZYGA 4C7OB 3HJTA 1JSRA 3I12A 4I1YA 4E4RA 1ZGZA 3ECCA 5IYZB 1GQ2A 3QFTA 1SB8A 1AOXA 4FI3C 4XSVA 2A0WA 3D8SA 4CM9D 4HWGA 4AAYA 2GD1O 1RI1A 1T2AA 2BIFA 4MVJI 1P62B 2FW1A 3DHEA 4OXXA 4DLPA 1XVTA 4F4JA 3Q87B 1KXZA 5FI1B 1RZRA 2UXBB 1HPLA 1VG9B 3TW8B 3WIDA 1JSZA 3IO3A 3IELA 3OZBA 5F5LA 4HZIA 2K6GA 3F78A 3BMQA 2W2TA 3KAQA 1V43A 1SWVA 3Q3CA 3TK1A 3TPZA 3UT5B 4DQDA 2Q6OA 2EQAA 5HRUA 4MWCA 1L5GB 1PS0A 2X23A 4B40A 3U4QA 1RADA 4JZYA 2ZTSA 2YWGA 1ODSA 3BJEA 2F3SA 5EXSA 2CN1A 3WE7A 5GZ1A 4JLUA 1P17A 1N6NA 2A9JA 2V3WA 3C6ZA 5K0BA 5TNXA 1XMIA 1U3UA 1Z83A 4WBNF 2AJLI 1M2WA 4LOJA 2YWJA 3F9IA 4BQIA 4ZHQB 1CY1A 3I62A 4KGVA 3W2HA 3FWKA 3WP1B 4OQFA 2JD1A 1ZMBA 1ZD1A 4IIBA 3QUBA 3G9QA 4XI9A 3KVOA 4MMZB 3TB6A 2AFIB 2Q3EA 2QIPA 3ESDA 4GGMX 4WPGA 5F2OA 4B3GA 1ZEMA 3OHSX 1GADO 1YQ9A 1GL9B 3OU7A 3UT5A 4CM9A 4TKZA 1KHTA 3IUBA 4F1WA 2XQIA 3VKWA 5DLYA 1P5RA 2X0IA 2ZRLA 2FH5B 4K6KA 2C4WA 2AOVA 1WVGA 1JYEA 4X95A 5E2AA 4Z53A 4KI0A 2VO1A 1ZH2A 5AT1A 3HZHA 1CZUA 2E2WA 2VCHA 1LQTA 1EDDA 4FHCA 3ABZA 3VR2D 3R44A 4IG4A 4Z4EA 4REQB 3W5DA 1MC1A 1X94A 2Q0QA 2OGZA 3KR1A 4L0MA 4ZQHA 1U2PA 3C6KA 3GVIA 3OAAA 4W5WA 3GEPA 3NOVA 4M55A 5ICGA 3NU1A 4EUHA 2LPMA 4RLQA 1TUIA 2Q9AA 1OBVA 4X9XA 1J8FA 4JCOA 2IHUA 3GN2A 2V7TA 4HX5A 4QXRA 5BRNA 2HYDA 3REQA 1RNLA 3Q8WA 4B71A 2R62A 5HF5A 5I7OA 4X7MA 4F21A 1DFIA 3K6RA 3KE8A 4YQZA 4YAEA 3CUEF 4Z0TA 3AONB 3BTSA 3OTIA 2IOHA 1RSZA 4I9GA 3RV4A 5LZ2A 3K0HA 3MJFA 1ZWLA 2VT6A 3CLRD 4LJKA 2P5YA 1UEXC 4JB2A 1KYQA 2O14A 2Y1KA 2DCMA 4JOQA 3SLKA 4DLKA 5BR4A 3RK0A 2CWWA 5T7BA 2O1XA 3FNRA 1LJLA 3ELBA 1A4RA 1Y4SA 3INGA 5AICA 4JI1B 3F6PA 4DC1A 3SS8A 1ODIA 4DV4B 3T95A 1ZJ6A 2WHYA 5DMXA 1WPRA 4CKWB 1HRKA 2P4UA 2WYIA 3O73A 1EXWA 2RGAA 4K9MA 4KN9S 1N5JA 4EX7A 1JFSA 3IQZA 3MTQA 4Y1RA 2CL6X 1V1MA 1FLVA 1WDWB 1Y1PA 2Q8NA 3NUGA 1YUMA 2GEKA 4RBNA 4E5YA 3IT0A 4K0KB 2XX3A 5CDHA 5K3DA 2WM2A 4JJ4A 1EFCA 1XNJA 2O1SA 2HWXA 3ICPA 1FQKA 1GU7A 2QK4A 2VG8A 1WXEA 3OOHA 5L3SA 3EXIB 5C7OO 2O2HA 1N32B 5JCZA 1XI2A 1RRGA 5HZGA 4INPA 4K6GA 4KPYA 1CFZA 3SM3A 1EWRA 4INJA 2FP4A 2HSZA 4CKWA 1PVDA 1Z38A 1O03A 2QP3A 1NRJB 4HDNB 4WKPA 1GU1A 5AW5A 5K03A 1VBMA 5JZOA 4C2AA 3ZU5A 1G5IA 4CCYA 4MCHA 3NP7A 3DZ8A 1JBKA 3IS3A 5KYYB 4DBVO 3P26A 1YZFA 4ND5A 5JZSA 3U6BA 2I3BA 2A9PA 3GFPA 1XXLA 4KQGA 4RHYA 1N4AA 4AKSA 3SKYA 2DTEA 2ORWA 2HT6A 3DQPA 4LCBA 3DLCA 4OO3A 5F1KA 3WNVA 4DR5B 4JVOA 1C8LA 4IFEA 3BT7A 1Z28A 3EUEA 2P7IA 4RJJA 3DE7X 5D01A 4MVJF 4G5HA 2OP0A 1CRWG 2YZ2A 5KTPA 3PHLA 3G1UA 2EFCB 2HV9A 3LOUA 4MWEA 3V4FA 4RH0A 3JYHA 4TWAA 5BQ5A 4A0RA 3U39A 1GPH1 3GEBA 4GYWA 1F2UA 2ZREA 3ZGNA 1EIZA 1DXHA 2VHYA 4IIUA 3T9FA 1T43A 3QU2A 3DOFA 3L6EA 1PU2A 2R48A 2KMLA 2WWHA 3AY3A 4NMWA 4UC0A 4MYRA 2F1RA 4C7XA 5A0TA 5DTMA 2VJBA 1AGPA 1D4AA 1LBSA 2Y2VA 5K3EA 2O8FA 3FHJA 1AQYA 3CZAA 4RKQA 1OTXA 5DSXA 2OFFA 2C3PA 4Y9SA 3AB3A 1TQ4A 2Y77A 5C34B 3EOZA 4ZOLB 5G2OA 5BVHA 5BR8B 2BMFA 2B98A 3DL7A 3T5PA 4KQJA 4OGFA 2ORYA 2P0YA 1T36A 4ZDJA 5DM2A 3FPKA 1MJGA 3MRVA 2NAPA 1CVIA 1JDZA 3AT1A 3C85A 3MB8A 4IZIA 3F96A 2I34A 4XPZA 3ADBA 5D3KA 5FAXA 3BXPA 3CRQA 1T91A 5DHUA 5IAKA 1JR3E 1QANA 3DE3X 4XIJA 1ZU5A 1JZTA 2ROQA 2CSXA 1MVLA 1HETA 2P5SA 2WU3A 3FJ1A 2G5GX 5E7JA 2X0FA 2RJNA 2BL4A 3JD4A 1JLKA 3M1AA 4LJ8A 2JIRA 5HKLA 4E3WA 1DOZA 5C52B 4G9BA 2P6NA 2XZDA 3QVXA 1XK7A 4UQLA 3U44B 1M8FA 1RBQA 4UHEA 1G1AA 2ZW9A 4V1CA 3A2MA 3SBXA 1NI5A 4EY8A 3DP9A 5BSUA 1IAQA 1QFJA 1T10A 2VT7A 2W6OA 1ULBA 3F47A 3FKJA 3H11B 1MNQA 3TD9A 1KMMA 1NNI1 3TVDA 5HZMA 1U28C 2FUNB 4CKBB 4E08A 2BFMA 1E94E 1LF5A 2R6R1 3DBIA 3FPGA 4JYBA 1M6EX 2FP3A 1DO2A 2CNDA 3T1QA 4E2FA 2AW5A 4EPTA 3DJFA 2Y92A 1Y7IA 1Z9BA 3S2EA 3S2GA 3SJ7A 3TKAA 1KYYA 4Q1EA 3U3XA 4CV0A 1P2DA 3RAEC 2N1BA 3OLZA 2WPDA 4UW9A 1RYBA 3GCWA 3VNUA 2F3RA 3H16A 2I99A 3S7TA 2XQFA 3GLQA 3FKQA 1GWNA 3QLUC 1P75A 5ECDA 4D9MA 6NULA 3H84A 1ZMXA 5DCUA 1W88B 2Z1DA 3GHHA 4Y1RB 1LKZA 1RQNA 4AULA 4D44A 5JAMA 3WGUA 1JUDA 3CZQA 3RU7A 3IULA 5ALGA 2UAGA 3IAHA 4B3MB 2H1OA 3I76A 2JASA 1II8B 3PR3A 3COVA 1JQJC 1PL6A 1SCJA 4HH1A 4MV0A 4JLNA 4OHXA 2EZ9A 3X1JA 3V8RA 3IFSA 3WIOA 5GAJA 4ROSA 1KHHA 3FXAA 3V80A 4ZPJA 1MJGM 2BFBA 4EHAA 2WE8A 3AGPA 4RPGA 4JOBA 3R9KA 2W6CX 3GLRA 3HCWA 3O92A 5JXIA 2OHIA 4D0SA 4UUQA 1QGUB 4B9EA 2H3EA 2BTEA 3GGCA 4BFZA 2XNSA 5I7UA 2AOTA 4K6CA 3B1ZA 1FL9A 5C1PA 1IDN1 1RQLA 1EB9A 2Q29A 1NU6A 4L8VA 1I7PA 2ZP1A 3OCCA 3DOEA 4B85A 3BCHA 2CLOB 1M2NA 2HQSA 3QA9A 3QFHA 4R2HA 1C4OA 1TFUA 4MIKA 1HYQA 3SYLA 4D43A 1Q3KA 1V39A 2FFAA 2FG5A 4OUDB 1X9GA 4HNTA 5GIPE 2P9HA 4JP3A 1VJRA 4PLVA 4ASUA 1DQPA 1XDUA 3VV3A 3C4QA 1YACA 7MDHA 1Z4NA 2Q1UA 2UU9B 3C3EA 2H1HA 2CGEA 2WINI 3QFCA 4CYMA 1R74A 2PK3A 5LZ9A 1PZEA 2GBIA 1FFYA 3SQLA 3HCDA 4MVJH 3A14A 1J9GA 3IHTA 1U0LA 1ZGJA 3IT3A 3UWOA 2G17A 4CMHA 2ZXFA 4E7OA 2MIIA 4KBYA 1RPTA 4C5BA 1NRWA 4DRXB 3DL4A 3IPLA 2G80A 5EZYF 3O6VA 3B2EA 4NCJA 3OIFA 4RHTA 3TLGA 5JWOA 3AEUB 4J76A 3WIUA 1CDEA 1OX4B 2P65A 2SKCA 1F9AA 1DQYA 4B48A 2C9CA 3RQIA 4OL9A 1C30B 4XFKA 2DY1A 2R5NA 1QGAA 3REOA 2O5EA 3BH0A 2PBLA 2ZS7A 5KWVA 4WD3A 3F5MA 4S1OA 3OZTA 2HF8A 3OCXA 1KOJA 3C3KA 3R0ZA 4KGZA 5JSKA 3VBEA 1MG0A 2FPUA 3ZHTA 1SVSA 1KAGA 1ZN7A 1GA6A 4S35A 3T5BA 3TRFA 4R8KA 4E33A 4PXYA 4IY1A 4J43A 3I0ZA 3TB4A 2UVQA 2XB2A 1SC9A 4Q19A 2VZLA 3HXTA 4EPXA 4C89A 3D5EA 3BM5A 2V58A 2G9NA 5KC8A 1L1FA 1GUZA 2GK7A 2JGKA 3TGPA 3WK6A 2CT8A 9LDBA 5B1HA 2IGTA 1JN0A 4JJGA 3A1DA 3ZXYA 2ZS8A 4KMSA 5KJ6A 1UOPA 5TIIA 4U39A 3UBMA 1PFVA 4CDRA 1V4VA 4ZEMA 4B4WA 4PLYA 3WA7A 3RUAA 3I6BA 4KO3S 1ZS9A 5FFMA 1DRJA 4OYRA 1T0IA 4LPSA 2D1YA 3UKOA 2FDRA 2GF9A 4B2IA 4JITA 4RZ2A 4YUXA 2IXEA 5JS7A 4HUJA 3UUGA 4B2LA 3BVPA 3NCHA 4CTJA 1KNXA 1OAKA 4RZUA 4YRTA 2IYPA 1CHNA 3IESA 4DQXA 1KK1A 3LC0A 1M6YA 2GJKA 3CH5A 4DWWA 2BFAA 2IWHA 1UAGA 4EMBA 1N9GA 5BY2A 2JLSA 1RLIA 4Q66C 1E2LA 2JA2A 2P27A 4O1IA 4RKWA 4RIFA 3MC1A 2WJPA 3WDSA 3HYCA 2CDAA 3IOYA 2PUBA 3TOSA 1AXEA 1IRXA 1VHQA 2EYUA 3ICOA 2HIHA 3JD3A 2G82A 5FA5A 1LJ8A 4XGNA 1JXMA 2JKZA 3A27A 5B7NA 3HYNA 5IW8A 2F8MA 4PZUA 1KVUA 2XTZA 3RC2A 4UBIA 1U2EA 1WOYA 2GHIA 4F9EA 5DM70 3H86A 5IASA 5IXJA 4O3FA 4OHUA 1WMFA 4YI3A 2I91A 3T3OA 1I7NA 3FY4A 3K9LA 1PF7E 3M3HA 1NNSA 3B13B 4GQAA 2I7DA 4RJ2A 2OXFA 1XZAA 2Q2NA 4Z9BA 5TV2A 3SNKA 3G2JA 4DCJA 4ZCIA 3CVUA 3SE0A 1O5OA 4L5JA 1VMEA 3QU7A 3RM3A 4CXMA 5KYXB 3TOXA 4URUR 3ZXUB 3VDMA 4EJSA 3RVSA 2PT6A 2Q4RA 3QEAZ 3N86A 1RAHA 3FPBA 1L5RA 1NN5A 3UATA 1R7RA 2C8KA 4KIUA 3F67A 4R83A 2CLIB 2PL1A 1DC5A 3FRJA 3AI1A 5L4LA 5JAPA 1VL8A 3NIWA 2IIBA 1JHRA 3IEPA 4MVJP 4D25A 4U7PB 4KLCA 4H9GA 4DR3B 3IPXA 2JAWA 3JZIA 3OZFA 5AVUA 2YJ3A 3NH6A 4ZRNA 5F4BA 3OIUA 4IMPA 1HMYA 5AVVA 2VPTA 3J81k 2ZUFA 2D6FA 1LFDB 4RD0A 3ILYA 2AOXA 4ZK2A 1U7ZA 2D1FA 4TSKA 4B47A 4LYDA 3S8YA 5DP2A 4EPVA 4HMPA 1GPUA 2W6NA 1VMIA 1U7HA 1VCMA 2JJ1A 5D3QA 3UPDA 1QO0D 1W5FA 1JALA 1EYZA 2G4VA 3ZTYA 4HNVA 1YBHA 1WCXA 4I1IA 1GEGA 2WWWA 3DC7A 3RYFA 3VFDA 5HK9A 1R8SA 1ZBQA 2O07A 3WRXA 5JBQA 2YRXA 1WETA 4DMMA 1MTZA 1UOQA 1GYPA 2G1KA 4MLZA 3V2HA 5HR5A 1W5TA 1J20A 2GJ9A 3OA0A 4RPJA 3VPFA 3LPCA 4DG9A 5D51S 4KWEA 3VKVA 4CWAA 4D2IA 5B3JC 3PEEA 4PSVA 1E5VA 2CCKA 3RARA 2Z6QA 3ZVRA 4BKOA 3K32A 1M2KA 1FXWA 1KVQA 4G9GA 5KOHB 2I80A 2DHQA 1U7WA 2ZBFA 3CWZA 4Q3KA 5J2UB 1NY6A 5T4BA 3ROTA 4N76A 4O08A 4P3YA 3UG7A 1XXHE 4AJOA 1T8YA 1GSHA 3UC9A 4V03A 3R1IA 4GOJA 5E6UB 1SXJE 3N8GA 1JR3A 1SOMA 5HSGA 1WDKA 4HTFA 3K73O 3G0HA 1K4MA 2JFVA 4L4RA 3WWZA 4FZ5A 1Z5WA 4HLDA 4JKIA 5IDVA 3SC2B 2O54A 3BSFA 3T38A 2CV1A 2CVZA 1KQFA 2Q2VA 2XIJA 1HYBA 3WGNA 1B8OA 1RRMA 2QRQA 3DVRX 5DHTA 3C98A 1BX1A 4QRDA 2FMKA 3NC4A 2H9IA 1N7GA 3EYAA 2O3JA 4Q3LA 1EVEA 1W4LA 3PLNA 1GSOA 2H29A 3LL7A 5LQJA 2Q3LA 5DN9A 3RD5A 2A58A 4XWYA 2VTBB 4IMJB 1DTEA 2FPOA 1F6BA 2OZVA 3I2IA 3O9VA 4RFSA 5F52A 3ZHQA 5HX7A 4BVGA 1F4PA 5AVWA 3TIVA 4RF5A 5AJYA 5B7QA 3GC6A 4P0TA 1T1JA 2HK8A 3MFQA 4MDYA 4GXNA 1E1CB 3MCUA 2ECQA 1P19A 4W7HA 1RJEA 2WM3A 2DX7A 1F2DA 4E11A 1QCCA 1B7GO 1Z5VA 2COUA 2FVXA 2P8SA 4UUAA 1LH0A 1PLLA 4DIFA 1XN4A 2AUNA 2RFLA 3RUDA 2QQFA 1Q0PA 2ZT5A 3G0DA 2FPSA 1HTWA 4KR7A 3ORFA 3MWGA 4N1AA 3UB4A 2FZKA 1QC5B 3JAWA 3WYDA 1U8TA 1T4MA 1U0OC 2AZ4A 5HYVA 2WDZA 3KLOA 2FSVC 3O4FA 4H7KA 3TRJA 3EZ7A 3U9TA 4U63A 2ZXEA 1F1BA 2C9ZA 3NNNA 5HFAA 5T5QA 3KKQA 1W4AA 2BFEA 1GIAA 3EQ7A 2GD2A 3RIYA 1W4BA 1YRBA 4GM1A 3NG1A 4OU5A 4Q7EA 3LBIA 1QGOA 4L28A 4MW0A 4U7JA 3HNOA 1W1IA 4FINA 3JYPA 4JGIA 4LHEA 4WX2B 5ENVA 1P5JA 2BJVA 3INYA 4RANA 4DIOA 3JPWA 2OXEA 1EWVA 5TVKA 2C20A 3DZBA 2BM1A 1ESEA 5H81A 4KK3A 3EGXA 1T25A 5AW8A 3T99A 3CRW1 4X1YB 1A9RA 1C8BA 1N5LA 2I2FA 3GQBA 3FFXA 5CNMA 5D00A 3RSLA 3ZE9A 4BU0A 1KK3A 2R97A 4HB0A 4BO5A 2WT9A 3Q15C 3ZWYA 4RZSA 3GF4A 3JYQA 5LP6C 3PFNA 1QNFA 3VHLB 3GEEA 1V8OA 4HTAA 5B12A 2XNDD 4G89A 2YOHA 1PI3A 2P62A 4P4GA 4WNAB 2C4NA 2UXCB 3VPHA 2QNIA 4KIWA 1BG6A 1UK8A 3IV7A 1L6RA 4MV9A 5D2CA 1C41A 2C4UA 3A3NA 3X1YA 1XQVA 1VLQA 2R6HA 4R68A 2AF3C 1ZOSA 3LBHA 4YACA 1G8HA 2FRXA 1YJ8A 4GPEA 4Q1DA 4UM7A 2NZUG 3O91A 3QBJA 1ORIA 3F9RA 2O23A 1Q91A 1ZD3A 4A8JC 1DDOA 1YIDA 2XRMA 3N8NA 1TK9A 2WMDA 3COYA 4J7XA 3IHWA 3W3AA 4PG6A 1DKNA 2GERA 3AWDA 4PRKA 4WNAA 4BO2A 1A4IA 4ENTA 1CQPA 4ARZB 2WSSD 1P7ZA 2XB8A 4XUEA 3SAJA 2IHJA 3D7SA 3A32A 1TJPB 1GV1A 2FZGA 3IV9A 4HN9A 4OLAA 1OV4A 1CUGA 1U0SY 2X9VA 3RTBA 3OH8A 3WGTA 2WJWA 5DBOA 2A9OA 4P4LA 2NV2B 4KXUA 4YT4A 3IIEA 1J90A 2B6HA 4EB3A 2JLWA 3R4VA 1YS1X 3OCZA 2VRNA 1RYFA 2GO1A 3ZD7A 2H5EA 2H4FA 1C3VA 1DJOA 1X7WA 2J5RA 4EQZA 1XG5A 2LZ0A 1BKSB 1G4HA 1NI4A 1IG0A 1COZA 3B6MA 2O2DA 3LT0A 3NDPA 2BGUA 3JASA 1QIHA 3G68A 4B32A 4YAWA 3ZWQA 2W11A 4GE0A 2XGGA 4YYEA 4JSTA 4Y7DA 4BNZA 3OUTA 4LYAA 3LA8A 2UUPA 3CX3A 5FUBA 3GRRA 3NBUA 2I4IA 3UOAB 4A2CA 1UWLA 3BHNA 4NICA 4WXHA 1ZD9A 1SOAA 3K2BA 1UPAA 3PCTA 1CUDA 1ZCJA 3NHPA 3MXOA 4XW2A 3QLJA 3LLSA 3W3AD 1N2CB 4OHRA 1ZC3A 2JGLA 2YJ5A 2Z3VA 3RVNA 5IVHA 1YR6A 1JHDA 1XJ5A 2OGTA 4QBHA 4IZOA 1QGYA 2OMKA 2D0IA 3NKVA 1ATIA 4U6SA 6ABPA 4LJLA 1XZIA 1HQYE 2C5GA 2VTDA 2W48A 1M0EA 1WY5A 4GQIA 1TIPA 3P9IA 4WNIA 1VPLA 3HWX1 3URKA 1D6MA 3OF5A 3H5RA 3LKVA 4HUTA 5P8WA 2FCAA 2HF7A 3X1DA 4G0NA 4GKKB 1TQ2A 2XE7A 4YRCA 3D8NA 4DABA 5CA0B 3Q9SA 4JYZA 5BUQA 4H77A 4N48A 3PQ7A 1MH9A 1JFRA 4EO4A 3N2LA 2AXNA 2W6QA 3VJLA 1ZLXA 1EZZA 3BB4A 1E0AA 4ZRDA 1VHDA 2UYQA 4I55F 2CXHA 2EFDB 2UZIR 4HXEB 1F4VA 3KFXA 1C0PA 5CBPB 421PA 4H35A 1NF9A 2D54A 2NYVA 3QX3A 3AOEC 4E5DA 4DZRA 3NEPX 3MELA 4CIYA 4E2XA 4FYYA 4KRXA 4M7WA 1X1CA 1WSDA 2N42A 2WIKA 1D5WA 1C7QA 1E7WA 4QGHA 2Y1FA 2CBXA 3AWIA 2WJAA 2HQRA 1JQLB 4PLHA 1G5RA 4GICA 4RCVA 3TG8A 3KQHA 4WKGA 4JT9A 2RHDA 3KWMA 5H59A 1LFAA 3GR6A 2VPIA 3L0OA 4W5TA 4JEUA 2GEFA 1Y3BE 2C00A 1WEKA 4NPAA 4EHDA 2VPWA 1C0KA 2PH1A 2Y1EA 1KI9A 1S2OA 1O96A 4HLUC 2LP4Y 4Q00A 1ZR4A 3WMEA 1EI9A 1IWOA 3DCYA 1E1KA 1Z26A 3F6YA 3F7MA 3I45A 5DK4A 4X41A 3SHTA 1LV7A 3FOBA 1VIVA 3BFKA 2MTBA 2QMZA 3QUTA 2GSWA 2FN8A 2JFYA 3IIIA 4LDZA 4M0CA 4N0PA 3CRMA 1V5GA 3GBPA 4WLUA 1L8XA 2D0PB 2E82A 3TWOA 1XELA 1D1SA 5KYKA 5IJZA 4J2TA 3HV0A 2E48A 3IPYA 4JLJA 3HDHA 1B8VA 2JJ1D 3DMFA 4X66B 5KJEA 5KNCA 3GGJA 3NZEA 3O84A 3OFNA 3ONWA 4MWZA 4ZVUA 5CG1A 1MFPA 4XE5A 4I19A 4A1FA 2DQZA 2E4YA 4OK3A 3IMEA 1I1QB 2C4HA 4LXGA 4PO8A 5GVRA 3U62A 5FWXA 1IEVA 1XTSA 5JMWA 5L3RA 1K7FB 2OV3A 3BIJA 4FKBA 2JI8A 1OD6A 4R3NA 3IKVA 3IKLA 1J2JA 3JW8A 3NC1C 3O1HB 3V32A 3DUWA 1P74A 1PR3A 3GU3A 1IJKA 1G17A 1GPBA 2QXYA 2XADA 2VAMA 1FU7A 4BBAA 5BWBA 3FCYA 3M6FA 5HJ5A 3ZHVA 4GEKA 2YV1A 4LJAA 3UJPA 4ZOCA 4URVR 4BXOA 1XZKA 2OPHA 1C1DA 2ZJ0A 1TA0A 1BFUA 3QG5A 2X6QA 2B5WA 3GLIA 4BDTA 4NH4A 3A4NA 3M34A 4I46A 3DL0A 2PTGA 3GFQA 2FPMA 1T3HA 4BWFB 1T1GA 2H85A 2W90A 4TXHA 3ZCVA 4JLSA 4KR9A 4JELA 3H0EA 3Q8XB 4LDNA 5FJJA 5JNWA 3T4UA 2XVYA 3QX8A 4RPHA 3TMKA 3JTEA 1B3RA 1RDFA 2J9XB 2WOOA 4HJRA 1LPSA 1UFKA 3F5SA 5M7EA 3LW7A 4PFSA 1S9HA 5EUQB 3SIRA 1EFRD 3L05A 3I05A 4UFOA 3ZC3A 4URXR 3GGSA 3H5NA 3KB8A 5CMLA 2VNKA 2LIVA 3BXZA 3C39A 4KDFA 1JU4A 1T2FA 5IBQA 3THWA 2N3ZA 3IXLA 4Z1MA 2ZWAA 1X7DA 3NHKA 3F73A 4RNCA 3LQ4A 1Q50A 4XKJA 5B30A 1IEQA 1MGOA 4G23A 4N3CA 1QORA 3P5BA 4PFQA 1QSGA 2R2AA 1ZK0A 1PJ3A 3EE6A 3G2IA 4DJAA 5ITZB 4YUYA 3K5HA 3KELA 1Y8QA 3L77A 3KETA 3V1UA 1D9XA 1KKUA 3B3QA 2B9EA 3KJGA 1OWMA 3R3UA 1R15A 5KDLA 3WTCA 1RR6A 2QRJA 3IP7A 5DNVA 2HWUA 1SZPA 3FDZB 2GBGA 1RFGE 2JRCA 4BMDA 1XTRA 4M88A 2EKQA 2JBAA 4Q15A 1EFTA 1NNLA 1ZN9A 4Q9NA 1N2HA 1VL6A 4PZ0A 4RFVA 3QTLA 4CLDA 4PLPA 3TW0A 1HI9A 3GX1A 4DV0B 1VCIA 1XGKA 1T4BA 2PO5A 4NBVA 2XMPA 3PNVA 1EFRA 4L4UA 3M49A 1CUHA 1CE8A 1NJ1A 2B8JA 3WA6A 4DDHA 1WA5A 4KTVE 1SU6A 1BDJA 2F43A 3RQSA 1KZ4A 4QRIA 4F2PA 4M0EA 2IBTA 1VGQA 4U8HA 1TTQB 2ETVA 3BB3A 4WKOA 1DC3A 3HXPA 4UQOA 3CIFA 3H5IA 1IYZA 2FPPA 3Q6NA 1KR5A 3GUVA 1SGWA 3ZY4A 1KDOA 5GOZA 3LQYA 3BX1A 2C7GA 3V9AA 4QOIA 5J5VA 2H1FA 1MQ8B 1UBGA 1VOTA 3B48A 3IP3A 3RT7A 2MR5A 2JARA 4Z86A 3NWOA 3ITKA 4U5XA 1KC1A 3G13A 3ONEA 5B6PA 5LWHA 1ULHA 2QUHA 1UIRA 4UHBA 1XL0A 1TJ5A 2G8NA 4HEA6 3KYCA 5A4MS 2GBFA 2PSEA 4FMDF 1VECA 2NU8A 2J8ZA 3NATA 3IOCA 1M34B 4YX9A 3EEQA 4J1TA 1RW4A 4B7UA 1DE0A 4CRWB 4AL4A 1FEZA 1UDAA 2C92A 4MKRA 3BE4A 1YCHA 1RAFA 4NE7A 1DMSA 1K2VN 3DYBA 1QX3A 5C7YA 2V45A 1E6WA 5DXAA 1RS0A 1PT7A 2I9PA 5AIAA 2ECFA 2P67A 4OJQA 2RBEA 3R7DA 2ZSIA 2VUSA 4B81A 2WIJA 4EJFA 2EDCA 4KI7A 5AKJA 3CUUA 3B8EA 3D3KA 2FZEA 3NHRA 4QQRA 3CWQA 1X13A 5DXFA 3S2SA 4RZHA 1N5IA 4FYWA 1GCIA 1CIVA 5EQDA 4F9GA 1DS6A 4EYKA 1ZGHA 1G8SA 1QB8A 4OJTA 1S5PA 2VI5A 1HK7A 1MX9A 3TH5A 1C4XA 1F3LA 4QJ5A 1OQAA 2FWPA 5LB4A 5FB3A 4C7KA 2B21A 3EZ2A 1X14A 2XRFA 4PN3A 4YMVA 3HYRA 2BELA 4KV9A 4W5QA 2B2XA 1XRMA 5KOHA 1CY4A 1XOIA 3ETEA 3FOWA 2RBGA 3RTCA 1B26A 3LT4A 2TMYA 1JA9A 1YKFA 2GZ3A 2XXBA 1VCHA 2RGDA 3FBWA 5TPWB 5IK2D 1RXWA 4IHJF 16PKA 1A96A 3RUEA 4D45A 4KKXB 2UUBB 3D2CA 4C03A 1A72A 2QG4A 4L72A 4RXMA 4W9NA 5J43A 2VJMB 1OKKA 4ZO6A 3IUYA 4V0KA 2HLNA 4WCVA 4JSYA 4A92A 3C7DB 3TTTA 4AN1A 4HLCA 3TM5A 1I9CA 2IZ6A 3AHEA 2ZG6A 3ACBA 3FAKA 4QU5A 2BKAA 2GOYA 1TYCA 3HJUA 1LVHA 3UMYA 4WK6A 3LU1A 3CUTA 3OIVA 5JXJA 5K0ZA 1HURA 1Y4ZA 4HD8A 5IU6A 5F12A 4PQRA 4RE5A 5EZYB 3CCCA 3I2HA 4DXAA 5KQPA 1AZLA 3W5SA 2QDKA 4QPPA 3ADPA 1OXSC 1H2XA 3W4IA 3D59A 1J0CA 4RFSB 2HCRA 3AVUA 1YS9A 4RPIA 5DVZA 4JLVA 1Z2NX 4LEIA 3BKWA 1KP3A 4M9XA 5GP1A 1E8NA 2LKCA 1YRLA 4G1MB 4B3CA 4JI2B 4ZZIA 4CLOB 4OYYA 1SVMA 1LS6A 1S1MA 2RHCA 2PV0A 4W6ZA 1RHMA 1J42A 1NW7A 4LOAA 4B5LA 4OHFA 4EG8A 1L8AA 1X80A 3I5MA 3ZCUA 2IVZA 2JZCA 1JFVA 5CH3A 3VR6A 1VE1A 2QR3A 4ZEXA 5LP1A 4G0VA 1XMVA 1V5IA 3L40A 3Q2OA 1AG9A 2WJ6A 4Q3NA 1ZNWA 1HGXA 3CU5A 4AQDA 2RC5A 1UPTA 5M3BA 3OLYA 3TJMA 1SKYB 1FIUA 3E3NA 2Z5FA 4D41A 1MF7A 4ZQFA 4E5UA 3T7DA 4PCUA 4WUTA 5EIFA 5DISB 3SJUA 1ZHOA 2NOAA 2FN3A 1CVRA 2QLJA 1OBFO 2BFEB 1O58A 2ZI5A 3L6BA 3NAGA 3P1JA 3OECA 4C6HA 5KDDA 2W42A 1NG1A 4LOIA 3N05A 5JY1A 1LBEA 2C4VA 4GR5A 1H9BA 3IUPA 4MP3A 5FPTA 1P77A 2R8RA 3KT3A 3UGQA 3CB4A 4PSCA 2V3VA 3VR1A 3ZD8A 3EGWA 1F2TA 3T9AA 2X1VA 4NV0A 3VH2A 4L6IA 5ABPA 1AMOA 4O33A 4L02A 4MGEA 4BKUA 5E1BA 3W06A 3GLUA 3B5IA 4MS4B 1Z47A 1IONA 8LDHA 2PZEA 4HYYA 5KQGA 3WJ2A 1SUSA 2JIOA 2BH9A 1B2RA 4JL8A 3B89A 1H4TA 1MEOA 3LWNA 4I9UA 4IM7A 3RHFA 3W5HA 1E2UA 2WILA 4V1CI 4INAA 4EW2A 2V7GA 4M53A 5FQOA 4EJ0A 1MENA 1Y8AA 3H5VA 1SHUX 4TTJA 3IEVA 1QBKC 3CKKA 2O8BB 4EGFA 3VISA 2ZI7A 1N2BA 3D0KA 5B6IA 1WTCA 1VYHA 3WNCA 1W8IA 3EXEB 5EMLA 3O90A 3U7JA 1A98A 1CD5A 1E2JA 3KZNA 1U6KA 2GXAA 3Q5EA 3C3MA 1JFFA 1XDBA 4EKGA 3ZIAA 1O6ZA 2B4KA 4FUQA 1TQDA 3KQYA 4YAUA 1KMNA 5HIIA 2AKYA 1ZK2A 4E22A 2R00C 3FSEA 4NSNA 4JR1A 2GO7A 4H4CA 7ABPA 3MTDA 3IVMA 1U8YA 3A6LA 4M8KA 4NCIA 1PFYA 2Q45A 5FUWA 3CPEA 4B6PA 4CMIA 4BN4A 2HK6A 1D1TA 3JQAD 5COAA 4RJLA 1ZGBA 4WINA 1YQWA 2VSNA 3VSBA 2IK8A 2WFLB 3AV0B 1Z34A 5CW1A 4EELA 2B8WA 1CY2A 5J4HA 1D4OA 4OQPA 2ACWA 1K6EA 1YBMA 1QHFA 3RIGA 1UAYA 2I3ZA 3DMDA 5CD1A 4YP7A 4QSMA 4XRGA 1W9MA 1Y7TA 1R3UA 2HU5A 2OOKA 1OI7A 2CFTA 3RT9A 5JADA 5CT4A 2Q1SA 1KQNA 5CLLA 3RUIA 4Y0AA 4PWZA 3U3OA 1P1JA 4N03A 5EERA 5GTDA 1WDMA 2HNBA 2FZ4A 2YRFA 4UEQA 2WHXA 4YEDA 1SUFA 1Q44A 1SUDA 4CQMA 3HDJA 1RQXA 2SECE 2XY4A 2R8ZA 4OH1A 2QE7A 3LKBA 4UTPA 1JDTA 1HR0B 3VYWA 2Q4TA 1IOLA 1U02A 1ZD4A 1XPUA 2M1XA 4BRZA 4EY3A 1U2DC 5A5DA 1XKTA 1YK1A 2YMLA 3LK6A 3QV2A 4LRXA 3SCZA 3ZDQA 4W5RA 4TTSA 4CLOA 3HY6A 4FSXA 1XZFA 3DV2A 2H0QA 3PITA 2ZSKA 1J2YA 1WXFA 4Q1AA 4UE2A 2OQRA 5AKEA 2AX4A 4ZZ1A 1HBJA 2FEXA 4RYDA 1JR2A 5G53C 1VIAA 5IXYA 3QENA 1H1TA 1P7YA 3M4ZA 2AR0A 4TKMA 4KLAA 3ESQA 1K7EB 4DG8A 5IABA 3HB9A 2A14A 3NWBA 4RM2A 3MMNA 2OQVA 1B1CA 3WGQA 2IDJA 2A7QA 1J9ZA 2D8MA 1IZ8A 2QGZA 4BNUA 3R9XA 2AC2A 3QPWA 2WTUA 4U6QA 3ZV5A 3GJ8A 3CQ9A 4QJ3A 2PLFA 4MINA 1ZXXA 2XSZD 4O0LA 3LDHA 5EOVA 4DCPA 3NAQA 3ZLTA 2B8EA 2BR5A 3ZH2A 1EUDB 4QOGA 1UMKA 1VE6A 3MN1A 4WZAB 1YF3A 2WB2A 1I13A 4LCEA 4HNUA 3H1AA 3D3EA 3GNQA 4TSRA 5MFPA 4TKUB 5E9WA 4NOKA 4QXMA 5FUYA 4FCVA 4HFNA 4MW1A 1TZ2A 1ZD8A 4TGLA 1M2VB 5IULC 3CR8A 4XLLA 1S8FA 2FMUA 3KAKA 1ZCAA 2GWHA 3KT6A 3L49A 1TK2A 2QNRA 2R7KA 4IZHA 4RQBA 4CLEA 3UA3A 3EIOA 5EHXA 1V41E 3L7MA 1EGMB 4IKPA 1NLUA 1LDBA 2VJDA 2FRDC 1J07A 1FYEA 3CUYA 1QJCA 2B61A 1RC0A 3EQZA 3DTVA 3LGSA 4GZ6A 4BGVA 4RDIA 4BP1A 2FJ0A 4WVFA 4JLPA 4D9NA 3PFWO 5ITVA 4RDHA 1P9LA 3HJFA 5LU9A 4OAOA 3RIMA 1AQLA 1X15A 3OIYA 3P45A 2A1TR 1TA9A 3CEMA 1QCYA 2XHZA 4B73A 7REQB 4LOKA 3KSRA 5DPMA 2WKPA 1UKZA 5JSUA 3OI7A 4YRMA 2G4CA 2QSZA 3V34A 5FOQA 1X1AA 1FJ2A 2HIAA 3F7TA 3HNPA 1D1QA 4EI9A 4ZT2A 2BR4A 4OXIA 2B8TA 3RYHB 2I2AA 1Y7HA 1AQUA 4KSCA 1RWOA 3OMLA 2R79A 4RLSA 4D3YA 1B1AA 2Q8PA 1Z6XA 2YW2A 2H1VA 1YR8A 4FDMA 4S1TA 3K0KA 4YDRA 2VZEA 3KQOA 4OI2A 3VR5D 3QU9A 5FR2A 5FBWB 4PY2A 3D8UA 4DMKA 2HJVA 2R7NA 1GRVA 4JLMA 3SF0A 2HLDA 3HP1A 1PDVA 1UT5A 1QWSA 3UH0A 4C76A 1P5ZB 4QPCA 4UTRA 3UYKA 4WXYB 1TADA 4M8IA 4J90A 3K20A 1IVNA 1XV5A 2EZ8A 4A82A 5BP7A 2W4MA 3FVRA 4ZVQA 4B6SA 2CNLA 1GNTA 4Q0MA 1QYDA 4GC5A 4DFDA 1G7SA 5BUZA 3WL6A 3G2LA 1GPWB 2QD2A 2L0XA 3DOOA 4N3NA 4HAOA 4EVIA 4OLJA 5LIPA 4GSKA 2HU2A 2JJMA 4NBRA 5K09A 3UK6A 4HDSA 4BEVA 3FMPB 4E15A 2B7LA 1GNPA 1QCDA 2GN0A 1K06A 4GI7A 3G85A 2QPLA 2H2WA 4I1OA 2BKEA 3ELYA 1V8BA 3L6UA 3SMVA 4UREA 3O8CA 2YKGA 4MMYB 3HRKA 3MFYA 2WD8A 1ZYUA 2PJZA 4Z4HA 5LKAA 1IMJA 2DBZA 3AI7A 4MUKA 5EVJA 5ADWA 1XAHA 3CUSA 4XVQA 3FWZA 2X19A 3VYUB 2QJWA 5KC9A 2ZYRA 2OCKA 5KTKA 2W7TA 4XSHA 3NFYA 1SHTX 1XPJA 1OYWA 4LVOA 1NASA 2Z9DA 3C4VA 5KMGB 2H51A 2HW8A 2H4XA 1ZICA 3LCVB 1I7SB 1N5RA 1AKUA 1MW9X 2CHVA 3NRBA 1RC1A 1MO4A 1PYOA 2WTEA 1Z06A 3H17A 8OHMA 4I1RA 3T7KA 4DV5B 4WZAA 1N3BA 3HUFA 4GS5A 1QHIA 1NW4A 3EG9A 4QLOA 1FRZA 4NJMB 3PQ8A 2JBAB 2VLBA 2IA5A 3K6SA 1L8OA 4GR4A 4PGFA 2DSNA 4IS2A 1RAEA 3QVOA 2W2KB 4B4DA 1JR3D 1A9XB 1DIAA 1TF7A 3EXHC 5AM5A 1DG9A 1GM5A 3UOGA 4MA4A 4ODIA 2WU0A 3FCAA 3GDFA 4NABA 1W2WB 3QKRB 2ZWPA 2OO7A 3IQGX 2FSHA 1MX1A 1O87A 2HRRA 2YYZA 3SF8B 1TUEA 2IH2A 2C3OA 2MSWA 1RZVA 1JYFA 3EJ6A 3MRSA 3TFOA 4QUBA 1MEJA 3LYUA 4U2CA 4QDTA 1NSYA 3F3YA 4D9FA 4EJ6A 3I6QA 3C6MA 4OJMX 3F3KA 1CYDA 1B00A 5C7IO 4GOXA 3EHEA 1WOMA 3F49S 3PE4A 1KZ7B 1PW7A 4OBEA 4W9NC 1NF2A 3JVEA 5B3KA 5LDDC 1OT5A 2FLWA 4IHQA 4F97A 5B57C 3ZCXA 3ROZA 1I2BA 2ZRMA 3FFBA 2JFNA 3WAJA 3DKRA 3AVYA 3GAMA 4EPYA 2HHAA 2Q3JA 1GDHA 1JAHA 2IW3A 1RI5A 3KD3A 3NVMB 5AP9A 2XMCA 1W35A 3GJ0A 1FA9A 1PS8A 5LDHA 2HR1A 3S8EA 1H9AA 4GZ3A 1VBNA 3O83A 3M6MD 2H08A 4G5OA 3WGZA 2WF7A 4BJHB 4EHHA 5KWSA 4KZPA 1LEHA 2FQXA 1BCSB 2JEOA 2XV1A 4QQNA 4RDXA 4N3AA 3F6SA 4LMBA 5EIXA 5SZHB 2D0OB 3LUFA 1MX3A 2SICE 2XMDA 3F9CA 2CKMA 4PHGA 2AEEA 3CEAA 3LCCA 4DG5A 4TLLB 3PA8A 2HSWA 1E61A 5IJ0A 2ASVA 3KEMA 1L5MA 4FR2A 1YHZA 3BD6A 3PA6A 1L4LA 4C0WA 2FGKA 1LWOA 4WVLA 4BGDA 5AKGA 3HU3A 4R5MA 5AOCA 4EP1A 2ZTVA 4Y2UA 3SXUB 3D6AA 2C42A 3OCYA 1WAMA 1PV4A 2XYHA 2AS0A 2J09A 2Y2UA 1KJ8A 1KEEB 1ZRNA 3UFXB 3VMFA 1CEYA 3UJCA 4Z9YA 2OM6A 1J0EA 5E4FA 4BV9A 3ZDEA 1MC4A 2RG7A 1BA3A 3JAKB 4WZ6A 4HGZA 3PD0A 3CVJA 3FETA 2RK6A 3G2OA 5ADHA 4BNDB 3REQB 3QE0A 1MO5A 5K3AA 3SC2A 1PFUA 2OB1A 1KY4A 4D46A 4DVGA 3GEHA 4B8ZA 1TM4E 3EDQA 1ONOA 2VPZA 1N5OX 3R77A 4F0JA 3CBGA 1K92A 3ZUPA 3EGDB 3FCCA 1NURA 2CXRA 1P1IA 3AGQA 3OE7D 5DI3A 2JGNA 2NGRA 3LCRA 2DPXA 1LVUA 1JZSA 3UMCA 2AJCA 4E0BA 5K9ZA 1YWGO 5L8VA 1NMXA 3FIUA 4G4SP 1OGJA 3TF5A 3TINA 4XTCS 4CL2A 1KVRA 1ZVKA 1AK2A 3I73A 1GN9A 3LO5A 3H3JA 4YFYA 3PS9A 3N3BC 5CPBA 1UPCA 5CFRA 4LQDA 3G6KA 5BWCA 1V8DA 2VBGA 3UJAA 4A23A 2FV8A 4CEJB 3NVDA 5CCBA 1BOFA 1Z4PX 4G5FA 4QC2A 5DU2A 3IE0A 3EGDA 3VZPA 1CIJA 1W0JD 4HUQA 1Q1BA 4G6ZA 4L15A 1MDBA 5TMBA 4F8EA 3KSUA 4DJJA 3Q7SA 3VPSA 2WD9A 1ZKDA 1IHYA 4CMGA 3DAYA 3G2MA 5EPUA 2HL6A 3WZMA 3C24A 2EG9A 3K9WA 3P9CA 5BURA 1PK8A 4FEAA 2C2ZA 2IITA 4MB6A 1UJNA 1PWHA 2PGDA 1Q0UA 5CDFA 2ZBUA 2C1ZA 3VU9B 4JT4A 2BN4A 3LSYA 2PXAA 1E0KA 5F3RA 3JS5A 1R16A 3SHQA 4QLAA 5FOUA 2KW5A 3CX4A 4UUNA 5K51A 2PKEA 4LHZA 2ZU6A 3B7GA 3KWJA 1TW2A 1MB9A 3B6IA 1DIHA 5BN5B 1RFLA 3GGGA 4HAIA 5LQAA 1E6MA 1JKIA 4UDNA 1GG9A 2VHXA 3KO8A 2VWQA 1Q74A 4NI5A 3JQ8A 5HBRA 5KNCD 4JX8A 1R6AA 3TGLA 2W2VA 2ZTUA 5EESA 4ENQA 3ER9A 4Y2VA 3DZFA 4IIEA 2PX0A 3N2NA 1KRWA 4TL7A 3PDJA 2PQ0A 2ZTHA 4JNKA 4RACA 4YONB 5U4QA 3WLRA 3IA2A 4DQLA 2J1LA 2W00A 3F2VA 2GN2A 5EEHA 1VG0B 3EXG2 3LQKA 5KYWB 4DAOA 2AFHE 4MVXA 1OVMA 1C9EA 2IUEA 4YCDA 1Z12A 1MOZA 2VUHB 3HJHA 4B6QA 3TSOA 5BN3A 1KK2A 2E6KA 3ZD6A 5I7HA 3I9KA 3ESXA 1U2RA 2BKUA 2AF4C 3BL8A 3HEMA 4L2IB 4AMUA 5CA1A 1YBAA 3EOAI 2GRUA 1X74A 4UBOA 3NBQA 1CJCA 1T36B 4GX5A 3J81A 1Z5UA 4A26A 1Z7EA 2HU7A 3O4GA 2DGDA 4G5QA 3S68A 2IYRA 2C2HA 3M9LA 4DXHA 2EP8A 1JQKA 1MORA 4QBGB 4Z0HO 2G3YA 3LWBA 2CFIA 3GB9A 2ID9A 4TL9A 3RC9A 2JGMA 2HA7A 2PJRA 4LDRA 3H0KA 4ZAZA 4EI7A 3RANA 1GAWA 4KCGA 2XH8A 3FFWA 1L7PA 4PYNA 1SQ6A 3VHXA 1CUYA 4OD0A 5CD9A 3TNLA 4DEVA 2E5LB 1VP9A 2QSJA 1E4EB 2IDMA 3LPMA 2HJWA 1Q92A 2PX4A 3F8TA 1ORTA 2CXSA 1DX4A 1US8A 4EW6A 1Q3TA 4IJUA 3O31A 2NWQA 4YCLA 5KNDA 1B6SA 1DJNA 2YXNA 3DM9B 1ZFNA 5LMCA 2C2KA 2IYYA 4GYKA 1XIVA 2HCBA 2ZQ5A 1DBWA 2XJ9A 2FEPA 4GIBA 4AQYB 3RJ5A 3HNRA 4ZAYA 2EV9A 1PEDA 2L17A 3CVOA 1PDOA 1DWOA 1STOA 2XXJA 4XIFA 3QH4A 5CK5A 3WKDA 4DDKA 2P4EA 2HBZA 4E31A 1XVUA 2JHAA 4JI0B 1A2BA 1PKXA 2BW0A 2PXHA 3DNFA 5ALJA 2P91A 4JXZA 1RKXA 5A05A 4MWTA 2Q6TA 2QX9A 4DV2B 4Y6LA 3LUGA 3OFVA 5FI0B 1EGQA 1ZNZA 3PJDA 4NS1A 1PG2A 4PCAA 1H6BA 4N4AA 3QYAA 2Z9CA 2MMCA 1XC7A 1ZOLA 4NIMA 2XQGA 2HQBA 221PA 4Y1FA 4CM8B 5DBHX 5AHXA 4AWXA 1V0JA 2NXCA 1A5TA 1EEXB 3FTDA 1XD9A 121PA 1X92A 2BEVB 2WWFA 4RLHA 5D1HA 3QF4B 2Q28A 3IEXA 5GZ6A 4O1MA 4RY2A 2ZBEA 1RWVA 3ZV7A 5KTYA 3OM9A 5A7HA 1LSUA 3SSNA 2JDID 3ZJVA 1H8HA 2X5NA 1HO3A 1V1JA 4TV8B 1XCPA 1E1LA 2OFWA 4WXMA 1USUA 2W6ID 1V3UA 4X8MA 4AF6A 2W8ZA 2CXOA 1UP6A 1FPMA 1ECFA 1NKTA 1NW6A 3TZQA 3X1KA 4LSWA 2RC6A 2NN3C 4AP5A 1N5MA 2VRWA 3RNOA 3SJAA 3SHFA 2ZS9A 1MJ5A 2CY0A 2ZSBA 2O3UA 2ZK7A 1G20A 4WZBE 5DBIA 4HGOA 4NTZA 4O4JA 3NIDB 4GKBA 5ALXA 3TW4A 1L4BA 5DGIA 3U4CA 4D8WA 3BH7A 5K05A 2BFCB 3TL2A 2KE5A 2P77A 3E3AA 4IGIA 2FPIA 3BAZA 4CW7A 1M1XB 2YW9A 3O8OB 4WA8A 3WYGA 3KPUA 3D6FA 2P9BA 3VR6D 2GPTA 3PFFA 5AJXA 1KDRA 5KEIA 3C1TA 1QUFA 2ZQZA 3QMPA 5DBFA 3II6X 2DLDA 3NTXA 4IIXA 2QMHA 2CDBA 1L3IA 1R5JA 2GTHA 3KOYA 1K6JA 3FOCA 4HH4A 2B1QA 4BJ1A 1Z2AA 1B14A 4BNYA 1BX3A 3CHYA 1FJHA 1R0KA 4H1UA 2OGUA 3WGIA 1POWA 2ZITA 3O2JA 3VZSA 1LTHR 1EIWA 3ZDAA 4K6OA 1P3DA 2ZRAA 2RI0A 3R5TA 4X1KB 2TYSB 3ZXIA 4ENUA 3ANSA 4Z3OA 1O3YA 1TC1A 3QX9A 4FSHA 4BQFA 2IHBA 3SYNA 4DC9A 3HM2A 4JXXA 2QORA 1CS0A 4C3VA 3S81A 2OBMA 2Y1WA 3UN1A 2UYCA 3RB8A 2ZSDA 2MHCA 1FTYA 3HE3A 4L8LA 4BNHA 4I1SA 4X45A 1XHLA 2V6JA 3JTMA 3DS8A 4N40A 1AC5A 1R9JA 2HTFA 5ES4B 4UE6A 4MR8A 3HBLA 1LX6A 2G08A 1DJPA 2AB0A 4QX6A 4X1KA 1C9DB 3U7HB 3KOUA 2JCGA 2R1TA 4NMLA 4EMSA 3L9WA 2JI7A 1FFEA 1NIJA 1ZGAA 2V9CA 3AR8A 2FR8A 3FOZA 3WL4A 3N39C 3MAAC 2UYHA 4RTOA 1F51E 4V0LA 4AUNA 1ZD2P 3IXMA 3U1TA 1FOEB 4XQEA 4D3XA 2C3YA 3O8BA 2ZM6B 3A04A 3CURA 2NSHA 3QXGA 5C1DA 2CC2A 5IXSA 1INLA 1MA3A 1RRVA 1JJ7A 4BUJA 4P86A 2E55A 2GK3A 4QEDA 1UFRA 3L1VA 2EDAA 3PZBA 2B92A 5H02A 5MF6A 3FAZA 4FC7A 4Y0VA 3HU1A 2GZHA 1D7AA 1P4JA 4J0HA 4AJ2A 5JTUA 4LIPD 1NWHA 1W44A 3CZ4A 1RYMA 3ZHSA 4BN5A 4EHJA 1CJMA 3TECE 2ZRIA 1MV8A 3DUFB 4EM6A 1SKYE 4J7UA 3ZGLA 1NNEA 1VLLA 2QVLA 3O2QB 1DU4A 3TSZA 1N4DA 2M6SA 4R81A 5IC4A 3CUWA 4BWGA 5IBCA 4NLLA 3JYLA 2IYOA 4QUGA 2Q2WA 1K63A 1SCIA 2W9XA 1N2ZA 3ROGA 4Z4CA 5CVJA 2ZT8A 1X9HA 4ZI7B 4ECAA 2I4OA 3IBYA 2GAJA 2IE0A 2ISSD 1P0QA 2A7XA 4G8DA 3WNQA 2CLKB 4H7DA 4JHXA 5AHWA 2PUWA 3R3JA 1CV2A 2JLCA 1U7XA 3TNFA 5A03A 1WUIS 3M6WA 4LC9A 3E8XA 1FS6A 3LM8A 2B0JA 5EG5A 4UAUA 1QVZA 4CN9A 4QUKA 5AKZA 2G9VA 5JXWA 3QMVA 2ZE7A 3FNHA 3WL7A 2PN1A 4N39A 4RK7A 4BMVA 1C7FA 1N3IA 4D8XA 4CNQA 3O8OA 2ZR0A 3PIDA 1TAUA 1J8QA 3AL2A 2C5HA 3E9NA 2FPPB 2DM6A 3JZDA 4FGUA 4PR3A 4L78A 3AESA 1ZOIA 1W581 2YXDA 2PGJA 3IP1A 1ITZA 1UEJA 4DDTA 5JROA 3CKLA 5CLFA 2GGSA 3B6EA 3MMXA 2XT0A 3Q85A 4F6RA 4KITB 3DVAB 4E6EA 3H9BA 2FSSA 2GPAA 4JP2A 5KYVA 1BDMA 4HV4A 3A1WA 3QEMB 4NG4A 4UOQA 5LFAA 2R3SA 1QTIA 3KUKA 1MB3A 1E2GA 4P58A 1IMOA 2WVGA 5JAOA 1IOWA 4LX8A 3MJRA 1KZYC 1EAMA 2FHPA 1X7YB 1XZLA 4GWGA 5ALNA 1A27A 4GRDA 3RU2A 4TLAA 1EE2A 1RJ9B 3U60B 4UBJA 4LJ6A 1JQ5A 1JH8A 3ASVA 1XQ1A 5D6OA 1P1CA 3V5NA 3UC5A 1TMKA 3DJYA 3WNBA 1Z73A 3JRXA 4UHDA 1EFVB 3R8CA 1E9BA 3N1UA 1K5PA 4P80A 5G4KA 4QDJA 1GCGA 1OTHA 1PJTA 3JQ7A 1XDWA 5JNVA 3FSGD 4RY0A 4HAWA 3HP4A 2IYVA 1VSVA 4LE2A 1YDWA 3GRPA 2WT8A 4OU4A 2H65A 4YPFA 1JEDA 2RAUA 4UU0A 5GPBA 5JZ9A 2P6MA 1PNVA 3L8GA 4PZDA 4NPCA 4KXYA 2WZBA 4CJXA 1BYUA 5LBTA 4EY6A 4LRWA 3L0IB 1S2LA 1G7TA 4TSFA 1JDPA 1MV5A 4E32A 1PX2A 2ZAIA 2GJSA 1K3UB 1YZLA 5CH5A 1HNZB 2PWPA 3MJHA 3OT1A 2ZJ2A 5AI0A 1C4WA 3EQ2A 2ACEA 4CV1A 3CVVA 1AKQA 2ZUSA 3HH8A 3NMUF 3MSXA 2AR9A 3O4VA 3GDGA 4L7QA 5F21A 2VJCA 1R00A 1QRAA 4JOSA 4Y2JA 1GTL1 1DMRA 2XTMA 3KXLA 2Y99A 5AVXA 1HT3A 3LLCA 1IZZA 2AHOA 4X97A 5UKDA 3ICEA 3CSSA 2ODBA 2ATXA 4IDDA 3AY7A 5FWYA 2C5FA 4GT1A 3U44A 2F55A 3ZZ0A 3BMNA 4OI0A 1NPTO 2WW8A 5E1OA 1H2YA 2Y0EA 2WKSA 2XDAA 3B20A 4JYCA 1GA1A 2OM2A 3QPAA 4OGGA 1TZBA 3WHPA 3IT1A 1G9SA 2HPZA 3CW8X 3DEZA 3ZY2A 2ADOA 5HIMA 5FDFA 2QVBA 5K8JB 2FQYA 4UCQA 3WYEA 3E61A 3HCAA 1IQRA 3PB3A 5FYQA 3VO9A 4HXGA 5IPFA 4F4IA 1AM4D 1XCMA 2M98A 1LSOA 2Q1YA 3GVCA 3LAWA 3AB7A 4KE9A 5A0VA 2XSZA 3WADA 2UKDA 4E88A 1ZU4A 2LXNA 1LF0A 1Y5NA 2WR8A 1JJBA 2X1MA 3B9PA 4XXHA 1FP1D 3LX8A 1ILWA 3W2EA 1SVNA 2FEOA 2NAFA 5U4XA 5K01A 3HLYA 3WFZA 2VBIA 2VP4A 1U0NA 1A88A 1SHZA 2QJTA 5CCDA 3RC8A 3EVCA 2X0JA 3ORYA 4TX1A 1UZMA 5TXGA 1RM4A 4Q37A 3RFVA 4R2JA 5AJWA 4CQLB 4DLNA 3ADCA 2QTVB 1U04A 3NKFA 4YYZA 3CH4B 3DMTC 2QTAA 3MEQA 3UF0A 4JXJA 1G5FA 2C5BA 3A2KA 4Y0NA 2X8JA 1TQ6A 2QD1A 1EK0A 2DOKA 4K6MA 1ST2A 3WTBA 4H3HB 4RV4A 2OYRA 1V2HE 1V6CA 1IULA 5ALWA 3F97A 1QR6A 1DTWB 1MXFA 3R0VA 1RAAA 1QB7A 4U7GA 5EP1A 4JEHA 2NU6A 3TLKA 2CXPA 1YZGA 1YL7A 5FRDA 5JU6A 4J7AA 2QN3A 5ALKA 5BW4A 5EIBD 4ZVVA 1ECBA 4UEWA 4F86A 4KE7A 3KDPA 4RA6A 2BP7A 2EEPA 4KDEA 3UXEA 4PN7A 2QPAA 4QDXA 1B0AA 4R2WA 5FFFA 2CB0A 5HILA 3GJ5A 4OFZA 4PICA 1YL6A 4L4YA 3ZCQA 1KBOA 4PG8A 2J0EA 4D0GA 2VBCA 2YNMC 4BCCA 1M73E 3F98A 4CEHA 3HI4A 5F7JA 2XEDA 1MZVA 4RIEA 3MT8A 3T7CA 3YASA 1I2AA 3GEIA 1QG2A 4ZT5A 3ZQKA 4BECA 1K7YA 1EH5A 3UTDA 2AKEA 1JTVA 3K1AB 3BWVA 3L02A 4YECA 1FVXA 4Q01A 1L5LA 3UTCA 5CEEA 1HY3A 4BQPA 2A94A 4CIAA 3FHCB 4F4FA 4LHYA 3ZK8A 1GARA 3L0ZA 4UHKA 3C1OA 1F8YA 1LGYA 2GDJA 3K2IA 5LN1A 3A1CA 1O94C 2VPPA 7GPBA 4KR0A 4CKEB 5CA1B 1RWNA 1CJUC 3MGKA 1BWSA 3ETLA 3OT1B 4YASA 3WWYA 3VR2A 4PWYA 1RBMA 2XD4A 1NWCA 1FP7A 3VPCA 2Y71A 1W2HA 1YJQA 3HZOA 2BMWA 4KUGA 3V8QA 1MRZA 3K1AA 4GPZA 1QGZA 4A2QA 5H8WA 4KMMA 3KHUA 2BGMA 2F1IA 2QMEA 1VM6A 2VK2A 4FW9A 5DV9A 1GZ4A 3DO8A 5FULA 2PEZA 2VA9A 3OPXA 4L5IA 1A5AB 1E2QA 2WT4A 1XF9A 3DAOA 5KBYA 3BZBA 2ODPA 2Z04A 2ZYDA 1QWOA 3DA8A 4BNWA 5J47A 3EFEA 2RHLA 5JYEA 2VCEA 2FWJA 5G0WA 3DDHA 4ZVOA 2E4XA 5PNTA 3KEGA 1GITA 3S3TA 2GN8A 2OV2A 1UXHA 3OQVA 2FMFA 2CDRA 4DJEC 3AH8A 5DNEA 4ZAXA 2WV9A 1HV8A 4OFBA 5E3IA 4ZQBA 8ATCA 3RVBA 3WIEA 4EG1A 4YMGA 4ZHSA 1IY9A 2I1VB 4JQYA 4R69A 1NBHA 4KVZA 3IO5A 3DTVD 2QTLA 2Y1XA 4FFBB 4HB4A 3PGLA 3OZGA 4J91A 3I1IA 1KPIA 1EP2B 4KYUA 3SYKA 2XUFA 2HMTA 4OA8A 1KO8A 3PT5A 1UANA 2WWXA 3N0WA 4QASA 3SDZA 1QG6A 3HB7A 5CT9A 2CMGA 5PGMA 2NX2A 3PVSA 1O08A 1CEQA 4MKIA 3WQBA 2C9MA 1JE1A 2FYTA 3AYZB 1GKIA 3P71T 3PGKA 4NFYA 4P2GA 4YP5A 5FBZA 1KF0A 1OZFA 2AIRA 3G5AA 3LT2A 4YXWA 3GIWA 4LJ5A 1UKYA 2FTKE 4Q3BA 4GMKA 3UWKA 4V0NA 2XUQA 4YK7A 1MPTA 5ALEA 1W94A 3K1TA 3PR2B 1ISPA 3N8IA 2YQ4A 3DZKA 3TM4A 1XQXA 1UQUA 4WFIA 4LAFA 3BREA 3PX3A 4JJEA 2MYNA 3GW8A 2ETXA 5SY6A 3QE4A 4LI0A 3THWB 3PQ5A 1QE3A 1I2ZA 1M0SA 2G04A 2H57A 1I2DA 2WIBA 2ZT6A 1XEXB 2D2EA 1DWQA 2H6EA 3I04M 3NS7A 4JQCA 4PLTA 2G25A 5DP1A 5SV2A 1W36C 2JIZA 1IXKA 3ON5A 1OXKB 1CZOA 1X1SA 2BEKA 4WK4B 2VF4X 4HGNA 3UENA 1GY8A 2BP7B 2YTZA 2J6HA 3KOXA 1EUDA 4BRSA 2PM8A 1LNQA 2YJTD 1JIVA 1I01A 1NVUQ 1U4NA 3DQQA 3TKLA 4CMEA 3L6OO 6GPBA 3L0YA 2HJGA 1HDIA 1DPFA 2Z1MA 4MQFA 3TNYA 4RSHA 4UAVA 1NXWA 2IEZA 2HEGA 1A7JA 1KBZA 2DWCA 3FZQA 3IVRA 4EF6A 5BT8A 1ABBA 2VAVA 3PQFA 1TECE 2CLSA 3UWPA 3WLOA 5JALA 2YWFA 1CFJA 3L8DA 1SXPA 4M9SA 3EA5A 1RYEA 4XJTA 4QUIA 5C8DA 5MGNA 5MN5A 2WJHA 3VUEA 4ZJZA 4O4JB 5EWMA 1UXJA 1Z39A 1LNZA 4ZJYA 1NQXA 3HDYA 2OWEA 4J0GA 3CG0A 4LF4B 3D3JA 4DNPA 3H2BA 1SUAA 1PIWA 3AY6A 3MVEA 1T1SA 2PX2A 5ENDA 1PQUA 1LPOA 2REXB 3HVJA 3WGOA 1QRUA 4QYXA 5FWXB 3AUAA 3SD7A 1HFWA 1CNFA 3S5JA 3MJ4A 5I48A 4H4DA 4XOIA 5ICFA 5KVQA 1WVMA 4ZGWA 4FFOA 2Y93A 1KGDA 1N1DA 2BC9A 1M2HA 4V24A 2F17A 4D81A 1EB8A 1Z68A 4HL6A 4DXDA 3W7VA 1ZI8A 2OV8A 3BCRA 3RTEA 2P9GA 2UYOA 2REOA 5DHSA 3WYBA 4KVAA 2FPLA 2GN6A 2R8OA 3E6AA 3VVMA 4ZIRB 3WDLA 4LZZA 4OKSA 4AB1A 4BNGA 2JI4A 3IKTA 3LLUA 1N1GA 4A3SA 2GLXA 1G2OA 3G82C 4R2LA 2PWYA 4YUAA 2VJYA 1BWQA 3HDVA 4OP3A 4AICA 3WLNA 4AG3A 5FLEX 2A33A 3P9RA 2JLRA 2JLVA 2DFPA 1SXJC 1WTAA 3BD9A 5BORA 2HDOA 2HQ1A 1HC7A 1Q12A 1WSAA 3MILA 2C99A 2I4NA 1NXSA 1Z6GA 4YWJA 4MV5A 5IDQA 5HF8A 1RP1A 3V2UA 2FE4A 3O26A 5JVDF 4AJJA 1BXZA 2QZSA 3V7NA 3ACCA 3T3PB 5JZBA 2QDXA 2BGJA 1OWLA 1JEOA 2ATCA 2HLHA 3BL6A 4IDEA 3TFQA 2K87A 3LIPA 3FB1A 3NWEA 4ETMA 3OZUA 5K0JA 1BW9B 3UMBA 4JBWA 1MXHA 2M1ZA 4J8PA 2VS1A 1WF3A 4EHLA 5BV0A 5JNTA 1FUUA 3BORA 4UPEA 5JR3A 5KX5B 1WV1A 2WTNA 1I0LA 4H18A 3MQFA 5BOVA 5AESA 5CX1B 3UJBA 4MQBA 3Q3GE 1MJFA 2EJBA 4U0KA 3R3YA 2OY0A 5JJCA 4FYHA 3DFMA 4C0KA 3VDRA 3DV0B 3RT1A 3CR7A 1M75A 1R8JA 3AIIA 4UU8A 4ZVMA 1PTJC 1T0UA 4FGLA 1EQUA 2JRLA 4GHWA 1ELOA 2EW8A 3V33A 4EW3A 5E8RA 4ZD6A 1TD9A 2VOJA 5EIWA 4RWZA 2XBLA 2V8BA 1UBEA 4QYSA 1RHRA 3BS4A 4KLNA 4QGFA 3ZE8A 3ZX4A 4DQKA 2YDXA 3ONFA 4PANA 4ZN6A 1M8KA 2PS9A 1Q11A 3P97A 2IUTA 2NTNA 4MYTA 1GYRA 3UB3A 4KGDA 4AJLA 3PWTA 4NBUA 1GA4A 3MD0A 1I6LA 3R5KA 4KZKA 4NBWA 1QGDA 2GCOB 1K9VF 4LZLA 4G0PA 3TLMA 2NYAA 4OX9Y 4B43A 1G3IA 1K86A 1UKCA 2GHTA 3GDHA 4MEAA 4OQDA 4W7IA 4AYXA 1A5BB 3DXXA 3EG9B 1QM5A 3ZZNA 3FDXA 1JKFA 1NVVR 4B09A 4YJ2A 3H7IA 2BJWA 3JQ9A 5GWXA 5KNLA 1N36B 1FMFA 3Q4GA 3WVNA 4A10A 2ZVQX 1DXYA 3R20A 2FQQA 4UUBA 3FNGA 1ECJA 4P8RA 3FWPA 1QAMA 3OJLA 4RIGA 4XGIA 5DZSA 5C7LO 3CKMA 2ZGVA 1XNGA 1KFKB 3A8TA 3GCGA 5KOYA 1P0FA 3EG5A 2P2YA 4ZDWA 4LF7B 1QVVA 4P33A 3NBYC 5EE5B 5HCIA 3VZBA 5I4KA 3U0VA 1IBCA 1GFZA 2PFSA 1XN1A 5BNFA 1Z0KA 2OR3A 2FP4B 4Q6WA 2EX1A 5ALLA 3VZCA 1JWAB 1ISGA 3P9PA 1WXXA 3UMGA 4R1MA 3LVFO 2PUVA 4MEBA 4JK3A 2WFAA 2PZGA 3IHKA 3RS0A 3RBZA 1E3DA 1P9NA 2BFNA 1Y5IA 1LK5A 4MW4A 5C46F 1T5DX 1K4YA 3P5SA 1WMBA 3WZLA 5LJIA 2AFIE 5EZ6B 1AY0A 4PPGA 4EQ6B 3HPQA 4KRFA 1BWPA 4RKFA 4BFTA 2IS4A 3L2OB 3GXBA 1KYIA 2ZJ8A 3LT5A 2GCEA 2WVJA 1XTJA 2E18A 4R6XA 5DWDA 5EJAA 3TSWA 4C0SA 1T13A 1N9ZA 2CJYA 3LHDA 1JIJA 4G63A 4TLCA 2GRAA 4IFTA 1SKMA 3MWDA 2ZAMA 3OJOA 1DQNA 3VSDA 4AQ7A 4KWHA 4MS4A 1P9OA 5G40A 3WP0A 1POXA 3PJFA 3RAFC 2MT9A 1E2IA 2BZSA 1YFZA 3HB0A 4H3SA 5IUJC 3A70A 4LI3X 4MKHA 1TLFA 3SOPA 4BFLA 4LMRA 3QIVA 2GESA 3FGOA 1XWWA 5AI4A 2RIRA 3OQNA 1RABA 1RXUA 4NCAA 5E3HA 1V7CA 4EL0A 1YA6A 2Z58A 3UKDA 2QXTA 4ARSA 5LIRA 1IIRA 1S2MA 3W79A 3HU5A 4UMFA 2A0YA 5ECGC 3FHTA 3ID6C 1YC2A 3BUSA 1HFJA 4FW8A 4HNRA 5GGXA 3ZWDA 5ADUS 5K2OA 2A3RA 4L85A 3F6CA 4FK8A 2ZR8A 1H9CA 1KI8A 1CUJA 3HGTA 3NEJA 1BKDR 2GA9A 4BP9A 4A2PA 2E1PA 1F14A 2CXQA 1L5KA 1GZDA 2UVDA 1EX9A 2R68A 4ZCMA 2BGGA 2WA2A 3PRJA 3UMVA 2CV2A 1XT6A 2BSQA 4U2EA 1RPZA 4P7GA 1R88A 4Z9FA 3RSGA 1FQJA 5AVRA 3QUSA 2IS1A 4Z7OB 4ESEA 5IVKA 2H18A 1F6WA 3PUVA 3Q1KA 5EGSA 3H87A 4NFHA 5ELLA 2QHXA 2QSYA 2ZE8A 3IP8A 3UQZA 4CFYA 1JH9A 5K8IA 3PFKA 3TJZA 4EK9A 3GLSA 1XU7A 1R18A 3CJQA 2P4SA 4FE3A 5E7QA 3UAXA 4ETIA 1ZA2A 5BV2P 3LF2A 4WWHA 4A0GA 5FTLA 3VPXA 1FNMA 2OV6A 1U0BB 1P4GA 2XUZA 4ND7A 4BRUA 5IFKA 5JASA 1NVWQ 2R8PA 4RZQA 2FPGA 2VP0A 1EVZA 3D5QA 2WF8A 1N2CE 2YWCA 2OECA 4Y2GA 4TYMA 4JXKA 3ROMA 2ZULA 3F5DA 1XRJA 3L1JA 5JE8A 2W0SA 3AKZA 2GVZC 1OYVA 1ZKMA 2WZQA 2XODA 1N0VC 4LRUA 4PRLA 3UW3A 4CL0A 4DUGA 3AW8A 2MYTA 3A3OA 2EEZA 3RRMA 4D74A 4ZYUA 1R0CA 2YIDA 5DYWA 4CVNA 4RMNA 2M6KA 1OPXA 5JCOC 1CR6A 4CQLA 4ARVA 4ZWNA 5C8YF 2XTJA 2VWGA 4BLQA 3VYRB 3CX6A 3MUNA 3JD0A 4XARA 4YBRA 2TS1A 3GFFA 3QKIA 1WZ2A 2X9GA 1UJCA 2OLEA 4Q24A 5A4JA 1Y5MA 4AECA 1Y9JA 1VSUA 3I42A 3PFCA 3RAPR 1QG4A 3THOA 5JYCA 3CLVA 3QKTA 1KQPA 1FTGA 2MMGA 4HN4B 2C04A 4L5BA 4LXUA 3W8FA 3MBIA 3K9BA 3GNLA 3GOHA 3W77A 4I8IA 3TL6A 3TTVA 5C18A 3RJ9A 2VSXA 3WOHA 4EMTA 1XVIA 2UZ3A 5KVAA 4DKXA 3O8RA 5BVGB 1SFRA 1XZEA 2XOKA 2BF4A 1JPVA 2QTWB 3ZQUA 1LSSA 1MB2A 1GFSA 1KZGB 3P0EA 1OLUB 4U3JB 1PZFA 2B4TO 4QHYA 5AXDA 3HBMA 2AWNA 4ZI5A 2H5JA 4FWTA 1UMDB 5EIOA 4D4HA 4FD2A 2C5EA 2BCGY 4C5CA 2Z6UA 3H5LA 3FPHA 5TC4A 5CVTA 4IF6A 2O8VA 1VTKA 2YUTA 2MYUA 3LVQE 3BOSA 2Q50A 3D7LA 4HH0A 5JEDA 1BOOA 3MWDB 2XVXA 4TKUA 3VKUA 5FWYB 2AK2A 2REQA 1KIAA 1S2GA 3W9SA 2B0CA 3Q11A 4IOLA 1EFHA 5HNKA 3AK4A 3LIIA 3AF1A 4G1EB 2O8NA 5BN3B 2JGJA 2Z5LA 3AEUA 4KSYA 1E2NA 1J00A 1SG6A 4OXYA 1A1VA 3STHA 3QYFA 4M7RA 2NUPA 2QZ9A 1D0IA 1WE2A 3WLHA 3LRXA 2O7NA 3C74A 4ZU6X 2Z4SA 1A76A 3DHWC 3GMDA 4ESVA 4DN6A 1BMFA 2J48A 3M4YA 2O2YA 3V6LA 1JJVA 5K5EA 4ZCPA 2AG5A 4B9AA 3LY9A 5DNYB 1XTKA 5BSWA 1JA0A 1ZWKA 2H59A 2PKRA 3ZK9A 4MCAA 2RHTA 3FH0A 3H2ZA 3ZJTA 4HP8A 4K86A 1NSTA 3AUTA 4Z3KA 2CCJA 2EWMA 3PYMA 2FF7A 3FUUA 1FU4A 3PD7A 1PNRA 4EAQA 4ZMSA 5JECA 3KTAB 1LX7A 3KJQA 4BX0A 2PYZA 2Q3MA 2WAMA 1ILEA 2QI9C 4FE7A 5M29A 4ZHQA 1E0JA 2JLAA 3MGAA 3WQQA 5CFLA 3ZI0A 3NBMA 3A1TA 1QR2A 2YHSA 3KIPA 1NBMA 3CF6R 3DPSA 5LZ7A 4G84A 1K2WA 3RK4A 1P4RA 4LYJA 1ES9A 5TEWA 4Y9UA 4QJBA 5K0TA 1V25A 4KOAA 5EWLB 1ZM3A 4I5DA 2Q5IA 1EXNA 1MBZA 5CFZA 1WCYA 4II2A 3WL8A 3WLMA 4DBLE 1PG5A 1UOOA 2EFGA 4R2MA 4BYMA 2IZ1A 2Y1GA 3MW8A 4M89A 2BKLA 5L3VA 4Y9DA 3ZDDA 5EWJA 1TYEB 1K7SN 2RH8A 1H2RS 1DP4A 3MCTA 3H13A 1O57A 3H19A 4RY9A 1VE7A 4X61A 1ZLYA 3ZJ5A 1NM5C 4J3NA 4P2BA 1IB6A 3JQBA 1JKJB 1E6LA 4DB4A 1M34E 2XNKA 1A8QA 4NJEB 1J97A 1U94A 2OYCA 5IJAA 4YT2A 2O2CA 3KEFA 4NE9A 1XWFA 2R1UA 2Z3ZA 3HVKA 4HBZA 2PZBA 3N2YA 2V7VA 1WCIA 1X3LA 4IJ6A 4MUIA 4KMRA 1VCOA 3TEFA 1TCVA 1WPGA 3HL4A 4Z4IA 3KKOA 2ZU0C 1B41A 2G9UA 1WRBA 1UWKA 2I9KA 2BDTA 1FUIA 3IBSA 1M8GA 3ABQB 2WG0A 4OXRA 4RXUA 4ZVPA 1BJRE 3B1XA 3PCRB 3RYTC 2BH2A 3O5AA 2QQGA 1M2OB 1XEXA 2ERXA 1ACMA 3D2BA 3BK7A 3G1TA 2BMDA 4KIJA 5ILQA 2IHNA 4GDMA 5H16A 4YRJA 1J6UA 4IGFA 4C0LA 5LJLA 4M9QA 1Z2OX 2FW7A 1NBIA 2HEIA 1OLUA 5FPPA 5AWFC 1CUIA 2R87A 4FMCB 1F0KA 3L06A 1MLDA 3WR5A 1SZDA 2B83A 3EY4A 2OBLA 4BP3A 5KQSA 2PTHA 4R0VA 2P69A 1Q0ZA 4UJ5A 3EBLA 3P94A 5HPYB 5IN4A 1OH5A 2AFRA 1N8SA 1WW8A 3PXBA 4NJMA 4ONEA 4Y2PA 4BO4A 2HA6A 2YJ6A 1KFBB 2I2BA 1L5OA 1SCQA 2FEWB 1C50A 2CB9A 3AIOA 3C5WP 3TZLA 1VA4A 4MUHA 4QLBA 3CA8A 1BSVA 4Y9TA 3ZYCA 1EX1A 1N25A 2RAFA 4TMXA 3O8QB 2WIDA 3RSZA 3K09C 3WSVA 4BLVA 1HWYA 1OH8A 3GRKA 2UZAA 1PHRA 4KQMA 3RS9A 3URMA 3VMMA 4BFVA 1AE1A 3RRFA 2PPVA 1NQUA 2WLSA 4JUAA 1ABFA 4X7RA 4CG3A 1SUIA 4P84A 4QHSA 2B6NA 2IV3A 2UZ1B 5IARA 1BX0A 3LCMA 4JBGA 5EHZA 4BC0A 4D8VA 3I4FA 2Q41A 2BM9A 3I9LA 5I4BA 4N0EA 4PGGA 3DLBA 3X2SA 4LJSA 3I2GA 3MLEA 2FWIA 2G7MC 2YHUA 4YMLA 2E4WA 1TXGA 1DQZA 3D8RA 1FRVA 3E0XA 4JBXA 5IZ4A 2IKSA 3LPDA 2WICA 2OBBA 3OWHA 4UUMA 2PMCA 3UG6A 3RWMB 4TWBA 4AZ3A 1TF2A 2OZLA 4BPBA 5AHKA 3QM1A 3KNZA 2V0NA 5BQFA 3KT0A 3CCBA 4QPDA 4EUKA 2XWSA 3EAQA 2B3TA 2DECA 2VZ9A 1K9SA 4MW5A 5IJXA 4C05A 5HCNA 4F5ZA 1EG7A 4ZVNA 3F71A 3ZI4A 1TU3A 3BL5A 3FPAA 1M1YB 4BMXA 3TI7A 1GTG1 1H2FA 3DYIA 3KE9A 4XSGA 3OCJA 5D3MA 2XGOA 3GROA 3BJZA 4INOA 2VDRB 2F00A 4I6JA 4BAGA 4RTQA 1KP2A 3D4OA 1PUJA 4JT2A 1O0CA 2Q1TA 1P4HA 1YMVA 1BXKA 5E6UA 4GNRA 3WBKA 1F48A 3FOAA 1II0A 1IOZA 1VBFA 3DLAA 3H7AA 1QFMA 2ZRGA 5BNTA 4YDSA 1SEPA 3EVNA 1L2TA 4R1PA 5A9SA 1CYEA 3IVAA 2X6TA 1OF1A 1NQWA 4QL3A 1VIMA 2IIQA 4Y2QA 1HNNA 3S2YA 4B6RA 3O9ZA 1XDDA 2VK1A 3VR3A 4M1TA 4CF3A 2OAQ1 2RGCA 3Q3IA 2B82A 3W6ZA 1TB4A 1JV2B 2VNIA 5KX5A 3RHSA 3K2QA 3OQIB 2CVOA 2GD6A 5EJ5A 1J5PA 1SQ5A 2PDAA 2J08A 2IBMA 3LQRA 2J7KA 3IUQA 3MS2A 2OXCA 1RRKA 1KI2A 1E5TA 1PS9A 3RGWS 3KKZA 4R5HA 2JAQA 3AYXB 1A97A 1QH0A 4IF4A 4ZI3A 3K0FB 3KVNA 2XTAA 4OBXA 1CZKA 1SXHA 4AUKA 4XPIA 3BE5A 3VAYA 5AW1A 3AINA 1T1IA 2F62A 1U0FA 1JPUA 1JG7A 2FPXA 5IEBA 4C7JA 2HX1A 3TZEA 2HLDD 3TE7A 3U17A 5CM2Z 5BW8A 3W78A 1TI7A 5EJ9A 1B0UA 3FLAA 1VRWA 1VYVA 2I8CA 1V9SA 2IOFK 2P1ZA 3CEHA 2J3DA 4I9FA 3DLPX 3H9UA 2PGIA 3QY0A 4U7FA 1X42A 2HHJA 1CDDA 1L5YA 3L7CA 4IDOA 4UPVA 4AY3A 1QPZA 2CXUA 4RHFA 3EXIA 4BO8A 3WMWA 1XRNA 3OOEA 3GN1A 2KPOA 1CK4A 3GAFA 2PUHA 4IOJA 2VSOA 4XPIB 4C3OB 4AMZA 4UEOA 1LRKA 2Z43A 4YR7A 1H0RA 3P52A 1PDWA 3LQ1A 1M54A 5TEVA 1PV2A 2V65A 3GFTA 3BFJA 4CV2A 4H0NA 3MGBA 1R4MB 5SYNA 3STWA 1K3TA 3ZDYB 1KDVA 1ZISA 5AD1A 2FW8A 2C7PA 1REQA 2AUMA 1ZESA 2C78A 5HK8A 1DRKA 2IY7A 4ZYVA 3L7BA 1ZJ4A 1ZUNA 5K0EA 1G64A 3N2IA 4RH3A 1KQ3A 4YLGA 2XF2A 1AURA 1WP4A 2DUUA 3CISA 2IXDA 2FR1A 3A1SA 1XLTC 1N3LA 1NN1A 3QQ5A 4KN5A 1I10A 1HE1C 2I67A 2WYHA 1Z07A 4CR7A 5HKBA 1XA0A 3RVOA 2EVWX 4L9AA 1CB0A 2GFHA 5HQ3A 4JJKA 1LQUA 3CN7A 2CMHA 3DH0A 2OZLB 1NXTA 4NF2A 4JLWA 4QU9A 1M1UA 4DRZA 1TUGA 4K26A 5AJHA 1E1RA 1U90A 1U0EA 3K71B 5JSZB 3SX4A 2BMVA 2MCFA 5JJBA 3ZJYA 1VE9A 1R0BA 2F9FA 4NC9A 4WECA 1OXUA 1UBTS 1PFGA 2J9RA 3PC4A 4ROTA 4Y2RA 1AU9A 1PWEA 2DJ5A 2IY9A 1XJ0A 4OATA 3NBKA 1RJWA