4ZZIA

Sirt1/activator/inhibitor complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
346
structure length
335
Chain Sequence
b'GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCQYLFLPPNRYIFHGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title Crystallographic structure of a small molecule SIRT1 activator-enzyme complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 105
structure length 335
sequence length 346
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4zziA03
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4zziA02
3PDHA 4UU8A 1PNOA 3FSJX 2BRUC 4ZP1A 4JUCA 5FYQA 3RIGA 1POXA 4K9LA 1YI0A 4K9KA 4UTVA 2VBIA 5BWLA 4UU7A 3PKJA 4QPZA 4MQ5A 1Q6ZA 3GLTA 5K6TA 2IHVA 2OD2A 1QPBA 4KXQA 2H4FA 3D4BA 2Q5OA 1S7GA 3CLUD 2Q28A 3F6EX 3U3DA 1HZZC 4C78A 4BN4A 4QQ8A 1PVDA 2EZTA 1Q17A 4BV2A 4BVHA 2Q5QA 3CF4G 2FSVC 2X7JA 1UPBA 4BVFA 4R8MA 1N0HA 3CLTD 2JLAA 2EZ8A 1Y9DA 2VJYA 1O96B 5EJ6A 4JSRA 3LQ1A 3CLRD 4JUBA 5AHKA 3OE1A 4IF6A 5FEMA 4V1CA 1SZCA 2EZ9A 4F56A 4GG1A 1J8FA 5EJAA 5BWNA 4BVGA 4TWJA 3GLRA 4JT8A 2PGOA 1POWA 4QELA 4FEEA 5EJ4A 4D5GA 1U2DC 5MFPA 3JR3A 5D7NA 1JSCA 2VBGA 4L2IA 4RJIA 3PKIA 1M2JA 4HD8A 2WVGA 4JUDX 2Q5LA 1YC5A 4MPRA 1V5GA 2H2HA 5MF6A 1YHZA 1BFDA 1YNOA 3EA4A 4UUAA 2UZ1B 2OD9A 4BV3A 3GLSA 3JWPA 4JU9A 4RMJA 3EYAA 4UTRA 1T9DA 2H2IA 4JUFA 1Q14A 4GM0A 2VK8A 4BN5A 2EZ4A 1YBHA 2EZUA 4GM4A 4RJKA 4UTXA 4V1CI 1PT9A 2A1UA 4O8ZA 1DJLA 4V1CB 3FLMA 2JLCA 2PGNA 1SZDA 2OORC 2NYRA 1M2GA 3D7KA 4GP9A 4JUAA 1U28C 2W93A 2OO5C 5MGNA 1S5PA 4BVEA 3GLUA 3EY9A 4X3OA 4G1CA 4C7BA 4FEGA 2H4HA 4RJJA 4MZXA 5EJ5A 4F4UA 4I5IA 2QQFA 3E9YA 2FRDC 2JI9A 2AG1A 4GPEA 4JU8A 2FN3A 3K35A 5K3SA 4Q9DA 1T9CA 4X3PA 1V5EA 3HWX1 1PO7A 2QQGA 2HJHA 4TWIA 2JI6A 4KPUA 2PANA 2A1TR 5DGTA 4BVBA 1V5FA 1EFVA 3F6BX 4Y6OA 1YC2A 4JT9A 1OZFA 2Q5JA 2IHUA 5EJ7A 2WVHA 2VBFA 4MPPA 4ZZIA 5IMSA 4J1TC 5EJ8A 2WVAA 3U31A 2B4YA 3ZGOA 4MPJA 4COKA 1ZPDA 4UUBA 2H2DA 1PYDA 4KGDA 4K9PA 5EJ9A 2IHTA 1PTJC 2Q29A 1PI3A 3ZG6A 1UPAA 4HDAA 4L3OA 1NM5C 2C31A 3ZGVA 4UTZA 2H59A 2AG0A 1UPCA 5DEIA 5K6RA 4IG9A 1M2NA 1M2HA 1OVMA 4FZ3A 2UZ1A 1E3TA 5MFZA 2JI8A 4RMHA 4K9QA 4J16C 3IAEA 3CLSD 1PNQA 1Z8NA 4Y6LA 2FR8C 1D4OA 1EFPA 1U2GC 1YI1A 4UTNA 4FVTA 1T9AA 5DGDA 4Y6QA 1XLTC 2DJIA 3D81A 1Q1AA 2Q27A 2JIBA 2JI7A 4D5EA 1OZGA 1YTLA 1MA3A 4GM1A 4K9OA 2H4JA 1U31A 5EJMA 4BUZA 2H2FA 4RMGA 5BWOA 2V3WA 4JD5A 2H2GA 1MCZA 5K2OA 1M2KA 1OZHA 1T9BA 3RIYA 2OD7A 1YHYA 2NXWA 3IAFA 4RMIA 2FWNA 3HWWA 3FZNA 2VK1A 1O97D 2VK4A 4IAOA 4K9NA 1ICIA 4K9MA
chains in the Genus database with same CATH superfamily
1NZDA 2JK0A 2QR2A 1SM4A 1FNMA 3G1WA 3N2EA 3BWVA 1GYPA 4KMRA 4P3PA 4C89A 4DLLA 4UU8A 1VQ1A 3ZNPA 3GUZA 3RU2A 2B9VA 2P4EA 3GG9A 3GLGB 3EPPA 4S1NA 3EEYA 2BRUC 1GXSB 2UZIR 3U9TA 5FBVB 1ZMTA 1WMBA 2VT6A 4QYTA 1GCGA 1CNMA 1ZVQA 4EY6A 1E0DA 4PC6A 2E5LB 1F5SA 2PA0A 1FFXA 5AOAA 3F7MA 3VR3A 4JI4B 1KI7A 2EIXA 3WTBA 1YULA 3VDQA 1YZLA 4FN5A 4FI3C 4YXWA 4TZ0A 1L7QA 5LP6A 3TBKA 1ZM3A 3QX8A 1FYFA 3E18A 4NPHA 5IFLA 1M5UA 2FV8A 2G1JA 3JQFA 3HJTA 3WKEA 4BXOB 1KY4A 4ZTBA 1U7DA 4CQLB 4HFMA 5EQFA 4ARBA 3WYNA 2Y77A 4RVOA 1ZLYA 2QUBA 5D5QA 5JROA 3ICQB 1SCIA 6GPBA 2B1JA 2QRLA 1D1SA 3L0OA 1B1CA 3TOVA 2P7IA 1LDBA 3CZAA 1U1FA 1JGTA 1LW6E 4KGXA 4OH7A 3UJ7A 4EG5A 1HOTA 4DN6A 2WM2A 2E0IA 4DG5A 2JFPA 4LF6B 2O05A 5FOTA 4A36A 1WQ3A 4G9GA 4CRWB 3DWIA 1YR7A 2IX3A 3IHWA 3IR7A 4QFBA 4MKRA 4GWGA 3SD7A 4MW2A 3EAQA 2Q5OA 4ZXFA 1Q1QA 3AGQA 3QPCA 3CZ5A 621PA 3OTIA 3CW8X 3T0IA 5FUQA 3ABRB 2AKEA 1E0AA 2QG9A 1KMCA 2XPCA 3U4IA 5SZKB 1BXGA 3UOGA 3RFXA 1CJSA 1Y80A 3A4MA 3BM5A 1GQRA 5G0VA 4G4IA 1ZI6A 3IUJA 5H7XA 4YRGA 2P41A 4ZCSA 1H2ZA 2E89A 1QIEA 3H05A 2G71A 1KO5A 1PT5A 4IM7A 4WN9B 3EZYA 1HZZC 4XM1A 3OLZA 4ZDIA 5I7UA 2RGDA 1DOHA 3SHQA 5FLXA 1QP8A 2ENUA 1FJ2A 2I3ZA 2O7SA 5CYFA 4RM3A 2AOXA 4B3CA 2C2GA 2O2HA 1DBQA 2Q7XA 5JFGA 5DFAA 5KPDA 5FWNA 4BFTA 1IY1A 3L02A 1LI4A 3HACA 1BH2A 5HKBA 1IY8A 5A5FA 5KDOA 1JU4A 4C0SA 1RXYA 1A5ZA 3R4CA 2Z2ZA 4C87A 4G5YA 4KR7A 2Y1XA 1RT9A 5A7FA 4I55F 1HQCA 1EX9A 1CZOA 1P45A 1QUEA 2V98A 3LC0A 4IV0A 4L4ZA 5M34A 1NJSA 3AI2A 4HYYA 4JOCA 4F4DA 5CFNA 3MFYA 1OIWA 2CUNA 3CLRD 5AHKA 3V1KA 4DNQA 3F78A 4O4IF 1KL7A 1TXGA 3TOXA 1U94A 4IF6A 2UUPA 3MQ2A 4ZVPA 1WMSA 1XLWA 1ZQ1A 4KQ2A 5EMHA 1TYCA 4GE0A 4ILKA 2BKEA 3MIZA 4YK7A 2FPGB 4IJMA 2ZSAA 3V1TC 1EA7A 3F2IA 4EY7A 3KPJA 2HMVA 1U7XA 1E9SA 4G0PA 3WDLA 1DZ3A 4WUVA 3A28A 4K8RB 4O4LF 3OF3A 4CMEA 1PHPA 1E1CA 1HBJA 3G0IA 2RIRA 1XCOA 2WHQA 4DZTA 1VOTA 4D9CA 1T8RA 1UZUA 1KHTA 2OHJA 1X0VA 3TLAA 1B0PA 1A9SA 4R31A 2HHJA 5CM8B 2I6FA 3PEVA 2CVFA 4FU0A 1YQDA 1D0SA 4O3MA 2ZVPX 4GMXA 1P4HA 1WPRA 3GF4A 5CCDA 2WJVA 3GAZA 3OLYA 4DUPA 1X8KA 2JIQA 3HCAA 4GAEA 5AVQA 5JPDA 4E14A 4B3JA 2OESA 3SSMA 1PL7A 1T4MA 1Z2OX 2R8PA 3QXSA 3CT6A 3D3WB 4GOJA 4IIBA 3S2SA 1VC2A 5AW5A 4WXHA 2FTKE 5ALSA 4NDAA 3DTNA 4QOJA 2UVQA 3IE2A 3L7OA 4FCTA 4F8YA 1HLGA 2QV0A 3KDSE 3TXXA 4CM5A 4BKQA 3OQBA 2YJTD 2GAAA 3AY3A 4QQRA 1S3SA 1HG0A 2VDJA 3CFYA 4JJ8A 2PX8A 4X8HA 4QA9A 1JS1X 2W6CX 3JALB 3KTAA 4BBZA 3ROGA 5I4KA 3UPDA 3SS9X 1PGJA 2NU8B 2PPVA 2ZAGA 2O2EA 3WDKA 3OETA 3LUKA 3G8YA 2YASA 2B0JA 2JJYA 5TS3A 1PUXA 2Z4TA 3D6VA 4BUCA 3O8OA 2PFSA 5EQDA 5KVSA 1RI5A 2J6CA 2NADA 1QK5A 5LQJA 5F52A 5E6UA 1XPOA 2HO5A 1MC8A 1KS9A 2ZSFA 4W5OA 1E3IA 1LB1B 1I7NA 1M74A 2MSKA 2PLFA 1EWRA 1UEJA 3BD9A 3ECAA 2JCXA 4P32A 5TQ0A 3IDSA 1Y34E 4NESA 5A1JA 2CMHA 3T15A 5JVDA 2ODBA 3C3DA 4RHCA 5EESA 3W8NA 2YZKA 1T5LA 3F5QA 3K0HA 3QP9A 3S2IA 3WLRA 2IITA 1FTQA 2C4HA 5BNWA 4R2IA 1FFHA 4HDKB 1GHTA 4MWOA 3PJFA 5JTUA 2W8ZA 4NMXB 4CKBA 3JQAD 2W90A 5DYIA 2O14A 3S1AB 2DFKB 2JDID 4DSAA 1V16A 3R5JA 4RE5A 5DIFA 4XUEA 3I1YA 2OYCA 2XDYA 3NDPA 4Y6SA 2BCEA 1JR3A 1GDDA 3NFRA 3DBHA 4F45A 4MSUA 2YXPX 3DEHA 3TXAA 1MC4A 1MQ9A 3V1LA 2P90A 2PZ8A 3L0CA 2GAIA 5LLDA 1HT1E 4Z99A 4YN3A 1Y6RA 3ZS9A 3UH0A 3A6GA 2D1RA 5AKJA 2C2WA 2NVUB 2GDJA 4PYJA 2CFTA 3H83A 1DTWA 3B6EA 1YS7A 2G6BA 3B1XA 4PICA 3GLKA 3H6KA 2RH8A 1JT9A 2FW6A 4PC2A 1IZ8A 1ESNA 2YCBA 1E1MA 1Q16A 1X74A 1IY9A 2ZYUX 2O5RA 4LZJA 5EPOA 3PX7A 4PM4A 4OIMA 4UBLA 3EBLA 3BKWA 2EZ4A 3LCMA 4RD6A 5AHRA 2FPMA 1F6WA 4MOWA 3PP8A 1CZLA 5TVGA 3ZHUA 2R6R1 3WVNA 1VGVA 2XUIA 1YT5A 3IP9A 4M1ZA 3CTPA 5CDFA 3STXA 1V8PA 5JD3A 3NLLA 3C6YA 4FLEA 5SY6A 2ZIAA 2H57A 4DLKA 2OGWA 2ZVDA 4JC8A 3X2SA 1OKKA 2G9RA 1JEYB 2O3JA 5AOCA 4I5GA 4KJZA 2YJ6A 2IYFA 2H7VA 2A0WA 4QAQA 2R7NA 1LBIA 2AMJA 2YHIB 4IMPA 2I1WA 3RHZA 3F3YA 4EG8A 3VU3A 2BKAA 1SCKA 3IYLW 4OFZA 1JMKC 1LPPA 4GO1A 4QTUB 1GWNA 3GJ3A 4M46A 1QRAA 4LJ9A 2FJ0A 2EGGA 2R8BA 1LV7A 1WCYA 1P4AA 5HMMA 4PSAA 2GEDA 3ZR4B 5CXQA 3QYPA 5B55A 2ZBRA 1GR0A 4C20A 5K0TA 1I10A 4R83A 4UE2A 1TLFA 2CL0X 3N2LA 4YQYA 3V1NA 3ZPXA 3W0LB 3C7TA 3R5KA 2F67A 3VOBA 3ZU5A 1KYYA 2XLBA 1E3SA 2J07A 3ILXA 2H1CA 3NO4A 1UKYA 3K0CA 2VPTA 1H8HA 2AJTA 4X3OA 3ESXA 3AJ9A 3VDRA 3WRXC 1ZH8A 4I2NA 3DFIA 4KI0A 3FMOB 4EPWA 2M6LA 4OGFA 3HDJA 1SVUA 4FYYA 4PS0A 3RRNA 4M0DA 4X66B 4PPGA 1QTQA 2AN1A 4A03A 2AFIA 4HSEA 5E6SB 2VTBB 3CRNA 4Y1GA 3IBCA 3NNNA 3OFJA 1SR8A 2C9MA 2PGXA 5JHGB 1QH9A 4D2IA 2QNRA 2X8AA 3JQ8B 3E9YA 2RI1A 1UBGA 1W49A 2GA9A 3OQPA 4O2AF 2ZSUA 4GPEA 4B35A 2BDTA 2DTEA 4JU8A 1AKQA 3SYKA 2A78A 4E7PA 3HKDB 3P5SA 3VR5H 1GNPA 3UHJA 3AO0B 4U5XA 1XMOB 4AFNA 3FWNA 1J2YA 3BWBA 5U1PA 5CB4F 2YUIA 5FJJA 1Z34A 4S12A 3ETEA 5B5SA 1RI2A 4KXVA 2W42A 4X3PA 4JQYA 3PGLA 2X0IA 1SUEA 1PO7A 4BX2A 2HOQA 1NTRA 2HJHA 4I1OA 2FE4A 3PKZA 1CQPA 3D5EA 2R25B 4B76A 3CX7A 1X7YA 1S01A 4RENA 4E22A 1G8YA 5LPNA 3MBOA 3TQOA 2JFGA 2CZCA 5JCJA 4NYJQ 3I0NA 4MARA 2GBPA 1LRLA 1TM5E 1ZINA 2FWRA 4JGBA 4KFRA 3KEOA 1ZIOA 1QIMA 5D85A 3ZHOA 4DLPA 4JI0B 1IMOA 2WWTA 4KXMA 5GONB 4H4CA 3W6OA 3MWJA 2IEAA 2ZI5A 3OT1A 2D59A 5IVIA 3TB4A 2XUHA 3E9EA 1E64A 1XEWY 2CNDA 2M1XA 5IM4F 3IAM6 2V6IA 4OF4A 3Q1KA 1QHHA 3R6DA 1I5OA 4ID3A 1PEYA 2G7MC 3PENA 4FD3A 4HEA6 4ABYA 3ADBA 3PHJA 3TLGA 1X39A 2ISCA 3O2JA 5IAGA 4B47A 1A0OA 2ZSKA 3ZVMA 5TGDA 1W5FA 2AN4A 4WZ6A 1F8UA 1Z18A 3GOQA 1XMIA 2CK3D 1JEDA 1PR2A 2PJZA 2YBDA 3M3PA 3NHZA 4CMAA 1P4SA 5P8WA 1XPRA 1CRPA 4AKSA 2XUOA 3FG9A 2ZUBA 3IQXA 1ISHA 1E3LA 1TPYA 3K16A 3UJ6A 1TVMA 1F2UA 1H0KA 3EGIA 4QXMA 3ISVA 3JQ7B 1OLOA 1M2OB 1BVRA 1P1FA 4FZVA 4IYJA 4XSHA 4BB0A 2Q3BA 1JVNA 1Z15A 1Z39A 2A1UB 3BZWA 4BNFA 3ZDCA 2WIGA 2IF2A 2FPPA 4BC0A 1MO6A 4R2MA 1OF1A 1Q0HA 1X70A 1TFRA 2QGNA 4DMHA 1U81A 2GPNA 5JNVA 1UK8A 3JRNA 1WV0A 4FEAA 4K03A 5A9TA 3ERCA 4G8DA 4XD2A 3AKDA 4Y2SA 1PT6A 2XZPA 1ZCZA 1W93A 4MDHA 3LKZA 4PO3X 5G4KA 5DCWA 2ECOA 3TDNA 5A4IS 4MV8A 5DTMA 1U5BA 1HFJA 1YB1A 2WMYA 3A2LA 1W46A 3LQFA 2ZI6A 4D3ZA 4BNLA 4R1UA 1TRHA 4WLNA 2EIHA 1Q2UA 2IQ5A 3SEZA 3UUWA 2VYQA 3FCYA 5BURA 4WK6A 5KNDH 4TVOA 1X8XA 1ONPA 3QTBA 2PAAA 2X0EA 5B7QA 4EHDA 2YVQA 4OHXA 2ZRPA 3BE4A 2BFWA 3FCCA 2BGGA 3DKPA 1EIWA 4WOPA 3HNOA 1SUIA 1M1NB 1QQ5A 1J99A 3RAFC 3VR1A 1EGVB 5JHHB 1ZD1A 4WK0B 3X2EA 1R7RA 1VTKA 2UZ1A 2FWBA 3AFMA 4WGFA 4OHWA 1WDKA 4TSFD 4ND4A 4NX2A 1C9JA 1BH6A 1FQOA 1LK0A 2VOJA 3AV3A 4UREA 4YROA 1JEOA 1UXKA 3B85A 3WLAA 5CIYA 3FOZA 2CNBA 3W8FA 1Z4QA 3OUZA 4E30A 2IZ6A 4M0CA 1W19A 1WWKA 2A5DA 1JDUA 3OEHD 3IBGA 3WRYC 1KA9H 1GG2A 2JF0A 3A70A 3G5MA 1A5AB 3O3OB 1SCAA 2F59A 4U6NA 1N5RA 5CVDA 3WICA 4HQLA 2HHHB 3BGDA 3WHPA 5AVSA 2IYUA 3GQBB 2I4TA 3ONNA 3W77A 1MVNA 2XMBA 4BFXA 4CODB 2AVNA 3Q87B 2DXIA 3SF8A 3WLIA 4BIMA 5DM0A 1NJFA 1RAGA 3T7SA 5BPHA 1K6IA 3BIXA 4XR9A 1G5RA 3QWHA 3CRVA 5C3UA 1UDAA 1RFGE 3BA1A 2OWEA 2ZS7A 3CINA 2VDUE 4NNJA 2C0CA 2VRCD 1CY7A 2OT3B 2PXAA 1RKBA 1Y9ZA 2UVDA 1N2CB 2Q27A 3DOOA 4OAPA 3ER9A 1GPDG 3SDZA 1C9YA 1OAAA 3KL2A 3DHNA 1J90A 2BISA 2WABA 3AEQB 1FOEB 1U7UA 3EDCA 5DV9A 3SR3A 3CCCA 5C80A 3F73A 1YTLA 2QM0A 2J32A 4NCJA 4WK2B 4YCDA 3COYA 4FIDA 2D5CA 1QRDA 2BMAA 2G06A 4EATA 3HVUA 4D42A 2H51A 1ABEA 2AC4A 4QNNA 1YU6A 4NV0A 2GBFA 1UP6A 4BNIA 1FUIA 4XB2A 2CD9A 1DHTA 4ENPA 3QUBA 2JDIA 1R64A 4QODA 3VPHA 1WCXA 3MJCA 4CEJA 5B58T 3M81A 5T57A 1ZR2A 1ZOIA 2J7PD 2OQRA 4MV7A 5D1NA 3WG9A 5CNMA 1TEHA 1Z22A 4ENRA 1ZZEA 4PG8A 1EZ4A 2YN2A 5J1SB 1BVUA 2XAAA 4YS6A 5TE9A 4ERXA 3HVRA 2Z95A 2W6QA 3KTFA 2IUYA 3MJEA 4F06A 4PRKA 4PFSA 3Q6IA 4NE9A 5DDIP 5IC6A 2QN8A 3ENVA 3T9FA 4DARA 4MVWA 4LF5B 2CKDA 2CE2X 2CB9A 4OL9A 5KDDA 3H65A 4YQFA 5LR6A 2IZ1A 5KVQA 3VC2A 1QP7A 2W7TA 4KWTA 2HJWA 4ZARA 4B3TB 3BJMA 1PG2A 3AR5A 1J2UA 1A5TA 2JRLA 3WNVA 1CV2A 3KXPA 1SIOA 2DE0X 3Q2OA 4Q48A 3WO1A 3AF0A 2OXCA 4HYEA 4N8DA 3OCWA 1HLDA 4TM7A 4D46A 2SKEA 5A3JA 4NRDA 1TPZA 3KJGA 2CVQA 4OB7A 3NX4A 3KBBA 1UP4A 2W98A 4CL8A 4URYR 5DIZA 2YXNA 2H5LA 2F00A 5HSGA 1ZHHA 3G9XA 4Q37A 2RJNA 3FSJX 2PUEA 2YFHA 4GFDA 4ZOLB 1Z7BA 4XRRA 3O8QB 4YRTA 1N77A 2Q7DA 3PHCA 5ELMA 1BEUB 2JHAA 4NWIA 1PR6A 4RKQA 4TTQA 1JVSA 3I2JA 3OZCA 4YJ3B 1PJAA 3MYRA 3LXRA 3ENNA 4LYAA 3W6NA 1FDUA 4MMZB 5K3AA 2VP0A 2IYAA 2Z8YM 4UTVA 3CB4A 4OMDA 3UHFA 1T10A 4BNWA 2H29A 4N76A 2IS4A 3U1BA 2EX4A 3SSNA 1XZDA 2CVHA 3EFBA 3R7FA 1RZVA 4RY2A 3JRXA 2GVNA 3HNRA 3ZVLA 3U16A 2W2QA 3DMYA 4NKRA 3EG5A 3ZVRA 5CEEA 3CLHA 1K7YA 3AVXA 1JHPA 4P54A 2DFTA 2F3UA 3AI1A 3L8EA 3EIEA 4O59O 4I14A 5LA6F 3U3RA 5FQOA 1JIQA 4LHWA 5EIXA 3GPDG 4RFLA 3G89A 5AICA 2P3LA 5F4ZA 1VL1A 4HKTA 1KQ3A 2J9XB 2YYYA 2IHVA 4IMJB 4CXMA 4AJJA 5CAEB 3FJ1A 4GSLA 5KREA 1GTVA 1UQUA 4CMHA 2ODAA 2FAXA 3DOFA 4IJVA 4M8NE 2IDJA 3ZX5A 1QGAA 1N2OA 3OMWA 1WNFA 4CL2A 4KXQA 2IGBA 3KVOA 3UB4A 3CEHA 4QXRA 5HS4A 4ZYVA 3ABSB 1O54A 4B3XA 5HUQA 1JHRA 2ZR0A 1YK0A 4YX9A 4IUBS 3AVWA 3R5FA 3ROKA 3FPJA 2OL4A 3LE8A 4XYGA 5E8RA 4KXLA 4L51A 3I32A 2Q0HA 5CH8A 5DLQC 4AT1A 2GZAA 1UJ6A 1YA8A 2QUZA 4KBYA 2HKIA 3U0BA 4D96A 2X3UA 3KT3A 3EEIA 5EERA 3FDZB 4QOEA 5FI1B 2CXTA 2RONA 1SB9A 2HPZA 1JJIA 1LU9A 3RASA 4QQ8A 4I5FA 1PVDA 1ZCAA 2DUWA 5ICFA 1O8BA 3E81A 2B5OA 2GCOA 2R6CA 3FNFA 3H1BA 5JCOA 2D5BA 3GVHA 4DAOA 4W5HA 4Z9XA 2SKCA 3QPVA 3MJSA 3VH4A 3ZHQA 2Q4DA 2EU8A 4IIVA 2QZPA 3DHEA 1QIHA 3KYCB 4OMFG 3D2CA 2ILTA 1PSWA 4O4HA 4RH0A 4BZQA 4KDEA 5KYWB 2JJ2A 3BH0A 5EZQA 3QKRB 4MP8A 1SBTA 3EVBA 1B6RA 1YR3A 4F6LA 4CKWA 5LKAA 3QYFA 1SIUA 4UE3S 1L8AA 1AV7A 3M9WA 4YRIA 1Z0JA 4ALIA 4AMUA 2Q4BA 2DBQA 4REQA 1SCUB 2CE7A 2IF0A 2RG7A 5HM8A 1XIVA 4KQHA 4Q3DA 4INOA 2I3GA 1GZ7A 1MT0A 1SCJA 1IXRC 4OQFA 1RM4A 2BTEA 1ZGCA 3OJEA 3RE1A 2IKQA 3U80A 4ZHQB 2YWJA 5CVEA 5EMLA 5CGQB 3MGCA 1RW4A 1SAYA 5EUCA 1B8OA 3UIEA 4HS9A 3D6HA 1DT3A 1ECPA 1NJ2A 2R44A 3P27A 3NV7A 4RELA 1P2VA 3ANNA 3SBDA 3TSZA 2SCUA 3MVEA 2M98A 4M1KA 4PVCA 3TQRA 4D3SA 5UKDA 1ZNYA 2C5FA 2CK3A 3EH2A 3IKLA 2X14A 3TB6A 1IFXA 4Z3DA 4DPKA 1ID8A 1V35A 5K3CA 3MPUA 3ZI4A 1JA9A 1RWBA 1YRLA 3L7YA 3H4TA 2Z3ZA 5H68A 3W4IA 1RKVA 4TYMA 3D6AA 4JA0A 1X7GA 4KIWA 1FY2A 4BMOB 1N3IA 1UJ4A 4RSRA 1V7CA 2FVYA 2Q6LA 3B89A 4M9SA 4YRBA 3S8EA 1NP6A 4LOJA 2QTRA 1E62A 3ESAA 1E3DA 2Q9CA 5CA1F 1M5RA 1ZD9A 5A3RA 4TLLB 2Q4OA 2B2NA 1II9A 4L4RA 2FEWB 3W2IA 4C4YA 2F62A 3W05A 4DMMA 3VTAA 2A4MA 4LV8B 3TKAA 4R4JA 1EVZA 3FOAA 1QONA 1I6KA 1UK7A 3ORYA 3ZHZA 4YFYA 3LXMA 1L7AA 4IDDA 5LUBA 2V4MA 4C14A 5BPFA 3MTIA 2DEUA 3HQ4O 3ZWNA 3JR3A 4BO3A 2RSLA 2ZJ4A 1NYRA 3CB2A 5A9SB 2D3WA 3OY2A 3RC7A 4LF9B 1A9QA 4FFMA 1B16A 3EGXA 1XWIA 4FGZA 3NORA 3URMA 3VDNB 3MCZA 1NU6A 3IP1A 4WLOA 1ISRA 2FWJA 4BMDA 4NP6A 2PG3A 2NXCA 2R7AA 4G0OA 1SVNA 4BAGA 1OC2A 2BF4A 4R9VA 5CXXA 5EZSA 5EMJA 2YBEA 2EG5A 2IYLD 4TTIA 1I3OA 3NC1C 1Z25A 2H16A 3GCDA 4XWWA 4MV1A 1ECCA 3QVOA 3KC2A 3L82B 2Z83A 4XQEA 4BQFA 4TSFA 4WKPA 1EP1B 3IDFA 5CTAA 3AF5A 5KKCA 1XX6A 2OQIA 5DMHA 4IXDA 4NPCA 1HT0A 2P68A 4R2HA 2GBIA 4RCYA 5ED4A 4OBXA 2R8XA 3KOYA 5JXWA 4XRGA 4YMGA 1ZK4A 5E3JA 2YJZA 4WFIA 1KP2A 1U9IC 3OEHA 1QVAA 2G4LA 4L5IA 4YCAA 4ZQFA 6LDHA 4EI7A 1UBLS 4PX2A 2C2XA 4O2RA 5J2TA 1U1CA 1QGOA 3A9VA 3BTVA 5LP6F 1WMDA 3OJLA 4LK3A 2IPMA 1ND6A 1QB8A 1YMQA 3H5VA 4N3NA 4N3BA 4DLBA 2AEFA 4AS1A 1DXQA 4M4SA 3W5AA 1RC1A 4B1FA 4E5MA 3K0AA 1N36B 2NXEA 4AX8A 1JEQA 1XHLA 3A26A 3R8CA 1AHIA 1R4AA 4YT8A 4ZODA 2QT9A 3WADA 1D1QA 3HUFA 1V1JA 2CLKB 3D2LA 2G9VA 1KJIA 4OUDB 2RHGB 2VRCA 3QMWA 4TRRA 5KNDA 2XKKA 4OHOA 2Q50A 2R1TB 3GLGA 2I2BA 3O95A 1GXSA 4IS3A 1AURA 2PFGA 4PYRA 4QJBA 4TRNA 5DNWA 1O6ZA 4YQEA 1BAPA 5DLPA 4V1CI 5HZHA 1FW8A 1QO7A 3ANYB 3HFSA 3EPKA 1UDWA 4ARSA 3UJHA 1PK9A 3D7RA 3NJ8A 5CMLA 4A4DA 1C8LA 3SSOA 1RQPA 3L49A 3DAFA 1NVGA 1ZNWA 4CQLA 4Z4EA 3KSDO 3FOCA 5D6OA 2ADMA 3FLMA 1JTEA 1HNNA 1PGPA 2P6MA 2OYSA 2ZJAA 4MMYB 3GRKA 1R5NA 4X90A 4B3RB 1LFDB 2PRZA 4OQXA 3DC2A 3OQIA 3R9WA 3I23A 2GF2A 3RG8A 3IVXA 4FFPA 1O03A 1SZDA 5K2MA 4NE7A 3ND9A 1VYVA 4DYDA 5ES4B 4YRSA 5KOJB 2HNBA 4TMKA 2B7BA 2J6BA 2QQ0A 3L0SA 1ODFA 9MHTA 3E3AA 1FCJA 2ODNA 1IHXA 1MTZA 3GRZA 1T8UA 1I8TA 2V7PA 4MGIR 3H6GA 4OA5A 4P34A 5J5CA 4H2DA 1ZR4A 2G0TA 3AIOA 3CSSA 2VJCA 2JKVA 2PJUA 2WFMA 3JVVA 1MU0A 1AXRA 3L3BA 3LX5A 3G68A 4OO3A 1IN5A 4PPYA 3NOOA 3T7KA 3SN6A 1OFVA 1M34B 4TOIA 4WN9A 2XCSB 1LPOA 1HFEL 3CF0A 4M9XA 2V45A 3FYSA 4A8HA 4B0PA 1ZC3A 3RUFA 3DLBA 3KKLA 3SF0A 4YAUA 1RYDA 2I6UA 3UM9A 2FEKA 1D4ZA 1BJKA 3NT4A 821PA 4OQLA 3VVLA 2H63A 1JWLA 1N9KA 1H6CA 1KAOA 3B1JA 1H4QA 3R8FA 2AMLA 1Y7TA 2FRDC 3Q2KA 5JC1A 4HJXA 3WB0A 1XAIA 4Y2QA 2Q0QA 3OMXA 3DWGA 5I7HA 4OHCA 3AUAA 5KYVA 2R2GA 2ODQA 3KHSA 1LD3A 3KKMA 1MRSA 3OAAA 2FR1A 5ICGA 1SBCA 1BNCA 3PS9A 3C0KA 3S2UA 4CCAA 1GGKA 2ZAYA 4WSOA 4A23A 1WXIA 2B20A 4J43A 1ILWA 4FFWA 5EEHA 1V5EA 2ISSD 3ONWA 1HO3A 4L8YA 1SH7A 4Q4JB 2B30A 3TTSA 5G40A 1PS0A 4PXYA 2RGGA 1M0WA 5AI0A 1VE9A 3OLWA 5DMXA 4DCGA 3FOEC 2I65A 3FYTA 2JD2A 1EHYA 1YOVA 3NUGA 4JT4A 1BYIA 1Q7BA 2NTYC 2W6PA 3EXHB 4JP8A 4OJTA 5IBQA 1UMCB 1O89A 2WUGA 3DL2A 3RIHA 5I5EA 2I29A 4OMCA 4Z8YA 5JSQA 1B4DA 2O6HA 4ZVVA 1H66A 4HYTA 2C9ZA 4R3WA 3RARA 3UCFA 4EK9A 4HPJB 1TQHA 2ZTMA 1UKZA 3OJFA 5HQJA 2VCEA 3E9QA 2WB2A 2XVAA 3WJ7A 1VPVA 1EK2A 4BYGA 3NATA 3DZCA 3HL0A 3Q7TA 2Y6VA 4KQ1A 3HYNA 3NIGB 2Z43A 4QX6A 1CF9A 3BILA 3SK0A 2FPXA 5AJHA 4A8JA 5CDTA 1JA0A 1VHTA 1RWQA 4U9IS 3SBOA 4F9TA 5BYAA 2YDYA 5ICSA 4ZCPA 1WDWB 1U8UA 5JVDF 4MPPA 3RRYA 1XZCA 1CS4C 3C1AA 5K3BA 2FMHA 4MI1A 1KU6A 1QOPB 1BG6A 3IV7A 3B36A 3JWHA 2AQKA 1MDBA 1QWOA 2NU8A 3IDOA 4C0BA 3VBEA 4Y9TA 2VI5A 3MT9A 2QR3A 3FD8A 4WINA 4D9IA 5T7BA 1CUJA 3LFTA 5CLGA 2O3UA 4F38A 3OIWA 4JODA 1KFKB 4PZ9A 1XZBA 3NHKA 1PJ4A 4H4DA 3E61A 3ROFA 1GCUA 4LKOA 1VJGA 3IKMB 1GOTA 3WLLA 3BWCA 2AR7A 2E87A 1IMJA 2ROQA 3N28A 3S68A 3T0GA 5BO5A 4K6FA 2ZZNA 1I1HA 3WKBA 3K32A 1Y63A 4FE7A 3HA2A 3TJRA 4GWLA 5SV2A 3MJVA 2Q1SA 1NW4A 2UYOA 4JC4A 1JHDA 3D8TA 5H02A 1H65A 2XKAA 3DBVO 4DIEA 4JBXA 3VU9B 2H5JA 1IWBB 2IHJA 3KXIA 2H65A 4GX1A 3PFBA 3QUSA 1DIGA 2C31A 3VV2A 2NT3A 4YUXA 1JTVA 1KJNA 3KWFA 1IL0A 1WEKA 1IZZA 2B4AA 4WNIA 5DF1A 3ESBA 3V1UA 2CHEA 2OFWA 4G8BA 2II6A 2AJDA 4ZI7B 4JI6B 1P7YA 5K6RA 1RBQA 3N5CA 2RHTA 3R6WA 1SCBA 2QN9A 2J3JA 4NDNE 4RZSA 2AXNA 4RGYA 1AUVA 2FW0A 4TL7A 3TPZA 3EXAA 4WVFA 1BKSB 2AXEA 5KJ1A 4JENA 3GUCA 1ECBA 3A37A 4MYSA 4R8RA 1ISIA 5CUQA 5IG2A 1WHSA 1CY8A 1YF3A 4BJ6A 4RSHA 3FBWA 4BNUA 3Q8XB 2NP7A 3C1UA 4JY7A 2V03A 4L4SA 2QN7A 3B2NA 2FR8C 4MX8A 3SQWA 1OREA 1EGHA 5TMEA 3FTDA 4IGFA 2WNSA 2O8CB 2PLRA 3JRWA 3RYFA 2I34A 1QQTA 4KMSA 5G4LA 2PE5A 2POCA 4QUIA 1C0LA 2PTGA 5CK4A 4TXNA 3S2EA 4US1R 3AU9A 4LSZA 1UDXA 4LZAA 2X8LA 1ADJA 2R65A 4AN1A 1Z4OA 2JFXA 1S2GA 3I2FA 3K4PA 4WNCA 2OTCA 4HDRB 4CIXA 4CQMB 4UXJA 1CUHA 4D8YA 2C7OA 1JEYA 3I39X 2B2CA 3N8IA 4CPDA 1OAKA 2DWPA 2H48A 4JXJA 1FNDA 4TV8B 3AOGA 3VKVA 2YHIA 2B7LA 2JLSA 5E38A 5JW6A 1ESZA 4HK4A 4FMDB 8ATCA 4YXFA 4IINA 3NALA 3L7MA 1XBTA 3KVRA 3QMMA 2ZI4A 4I4TB 4KAXA 4A0QA 2GYWA 3HXTA 1V26A 5CYGA 3ADKA 4HMOA 2J5RA 1YAHA 1NY5A 1MV8A 3RAPR 4F6RA 4BKOA 5IT0A 1NF8A 4FYIA 2ZTVA 4W8GA 4F9GA 1SEPA 3ISJA 4LX8A 3R7BA 2ONZA 3QKUA 4E4YA 1BU8A 1F12A 4O02B 3ENQA 3EUAA 5EJEA 2H00A 2FUG1 4XSVA 3UFBA 1NPDA 4RAOA 1RWXA 2OR3A 4BV9A 4BY9E 3F98A 4WCDA 1DZIA 2CFIA 3G3EA 3IUSA 5EXXA 4BO0A 2OD7A 2H9AA 1QJ4A 1NMQA 3ZV5A 4YV2A 2NUPA 4DIFA 4RVCA 5BN4A 3K94A 1YK1A 2IU3A 2ET6A 2LUOA 1PZMA 1O77A 2H0QA 4HGOA 5CD9A 3VPFA 1R66A 1O0CA 1GKIA 4BFCA 3OU7A 2DBVO 2WKSA 2VJMB 4N7JA 4OHFA 4JQCA 1U8YA 2OXIA 2MSDB 2CFOA 1TT5B 3AJ8A 3DOUA 4YH1A 4FGSA 3IJPA 1N2BA 1EB9A 3JQ8A 3QKSA 1KDVA 3U44B 1XDSA 3T5GA 1LNQA 1YZ3A 3FPEA 4FHEA 3K05A 2VYFA 5B7PA 3HKDA 1C3LA 1W4CA 4AJEA 1CYDA 2RD2A 1A82A 2QX6A 2ZDQA 3EFEA 3L43A 3LPAA 4IIDA 1ZAKA 4UDOA 3H5OA 5CBPB 1NIPA 2ZULA 3GEEA 3L8DA 1T1GA 3KR9A 5DBHX 2ZT6A 3O31A 4JKYA 1PS9A 1UQTA 1MAHA 2JGEA 4YNBA 3ZCUA 4CFZA 5BV0A 1P3JA 2AFIE 4MVJM 1W9MA 3RS3A 4PX3A 4ZI3A 1Z5UA 2OCXA 4K9LA 1NXTA 2C92A 4IHJF 4GOKA 4WOJA 2R1UA 3VO2A 5DX8A 3VC1A 4AMBA 4CGYA 1PJSA 4D6PA 4LQLA 1U2RA 3MHPA 1FRNA 2VXBA 3HPRA 3T4UA 2VBIA 3AJDA 4CWAA 1DINA 2VPYA 2PU7A 3GJQA 4B3DA 1W76A 2HUPA 4K6KA 2OHFA 4CUZA 2HPAA 3B6ZA 5GONA 5A3VA 3DDSA 4I1YA 1I7PA 3DW1X 4MAMA 2I67A 1DPGA 1BN6A 1C7ZA 1NW8A 1P29A 2NV0A 3OTGA 4JVLA 4KOAA 4OFXA 4XTCS 5BV8A 3DVAB 4EKGA 4K6HA 5HDQA 1VDZA 2LW7A 2PQ2A 4HWOA 4DCMA 1WSBA 4RA9B 2R00A 4LVOA 2JAQA 1SMKA 4LZWA 3TXYA 3VISA 1L7MA 2B99A 2UUBB 4D57A 4Q16A 4YREA 4KNWA 3TRHA 4F04A 3FH0A 2BMWA 2BEUB 3M6WA 2HC9A 3NBXX 1LLDA 5D3QA 4XWAA 2Q28A 1N9ZA 5A05A 3DMGA 4H08A 1GFWA 3C3PA 3H11B 3ONDA 1G3IA 1OLXB 3KFVA 3PPIA 4DV0B 1P74A 2NZXA 3SVZA 1RWVA 2VZ0A 3JQ7A 1GQSA 3B6JA 3TS1A 4XDHA 2PNJA 4N3AA 1RM0A 4OJKA 2VDNB 5FH9A 4C78A 5ALZA 3PWTA 4LTDA 1R6UA 1U0FA 3D59A 1Q17A 4G0VA 3AK4A 3TSWA 2XY4A 3D8NA 3DZ8A 5ALMA 3HI4A 5CW2A 3RO7A 3EGDB 1FSGA 2P62A 2AD5A 3LPCA 1Y7PA 1RQXA 1V6SA 3LY5A 5EE5B 3BPSA 2DCUA 4YCNA 4J91A 3GFGA 4OU5A 5DNYB 3ORQA 3HO1A 2CLDX 3OWOA 4FNOA 4QAJA 2XXAB 1GZ5A 2NLOA 1ZSVA 2JH3A 1I4TD 1VLJA 3VTZA 2FUKA 2J0VA 5EWLB 1DKLA 2XR1A 4W7HA 3H1PA 3STTA 3T9CA 3ZBQA 2YWBA 2C1XA 5IN5A 1GG9A 3ASUA 3NR2A 3LV8A 2AK2A 3TZ6A 3WX0A 1XPJA 1UM9A 2PKQO 1CZKA 3AR3A 3RTDA 4U2CA 1R15A 2WAMA 4ONEA 1I2CA 1Q3KA 2P4SA 4JVMA 4LTNA 2WWVD 1NJ6A 1CEQA 3TM4A 4RLSA 1Y8RA 2G70A 3DZIA 4MWSA 5SZHB 1YQGA 3KSUA 3ND8A 3ED5A 1J1ZA 1TKCA 3LXXA 1ZK3A 4PZPA 4UKDA 4MCJA 1X7XA 2KB0A 3AM3A 3ULKA 4AUMA 1DBIA 1EINA 2HADA 2QU7A 4CL0A 1Q22A 1QK4A 1SBQA 3ONEA 5IU6A 1EFTA 1ZH0A 1LI7A 5BR4A 1W36D 1LSJA 1NBMD 2W2MA 2DQ4A 1TM7E 3QVGB 5LZ2A 3GQBA 4FDTA 1JNYA 4FR0A 1ZN9A 1HYEA 2QTHA 4KBFA 4OV6B 2CW5A 4B48A 4JA2A 3TQSA 1VFNA 3H6HA 1AKEA 3QLUC 2IOFA 3OCXA 1TB4A 1V5WA 3ADPA 3GDFA 3HG7A 5D8DA 3I09A 2KBEA 4DPMA 4LWQA 4M8LA 3A1NA 2Q8PA 3WO0A 2X41A 3SY8A 1IQRA 5G2OA 2GBGA 3LUDA 4K7JA 4LZZA 1DELA 3LUHA 2I76A 4OU4A 1PFUA 3E70C 1M54A 1F0NA 3ACDA 3IODA 4WKGA 2VDWA 3NHFA 3W3AD 3BD6A 4ENWA 5ISMA 1N1DA 5GWXA 2PGIA 1FMLA 1RACA 3IV6A 1S7CA 4L5AA 2WF9A 1XO1A 4FE3A 3ZDBA 1W4RA 2LV8A 3SAJA 3D43A 1U2GA 1YIAA 2X1VA 2OQVA 1L7EA 2GEKA 2EJBA 3B7PA 3H1GA 1AKYA 3LPDA 4Y2JA 1PWYE 3GL9A 1YCFA 5ALJA 5ESDA 2AFHB 1X1AA 2R3SA 3M5CA 2E4UA 3PWSA 3SSAA 3WK6A 4NYJR 1QFSA 3KOOA 1TVKB 4G5OA 5KYGA 4CM8B 3FKQA 2QK4A 3U3XA 5LYJB 1CERA 1R0LA 1R12A 2CHVA 3BULA 5B2ZA 2O1WA 3L7AA 3P2KA 3HUDA 1AQIA 2Z6VA 3T3DA 1BDHA 1E7WA 1FVFA 4TTRA 2NO7A 1MVOA 3PNMA 3TD2A 5K99A 3WDMA 3UWSA 4NG4A 2NXNA 3ZCPA 3PJDA 3U5TA 2OM6A 3OM1A 4BMXA 2WIKA 3U7RA 4MZDA 5CW1A 4DV4B 1U1GA 2D2FA 2OCDA 1ZD3A 3UNXA 4E5DA 4KXWA 2OKGA 2QRKA 3NC0C 2OD9A 1NMXA 1UFRA 5IKXA 2ZJYA 1UK6A 3V97A 4BV3A 4K6MA 4RMNA 1SUWA 2JVKA 2XX3A 4ZYUA 2UU9B 4U63A 2CL5A 3KT6A 1JWBB 1U02A 2D0PB 3DPSA 5I4BA 2BFMA 4WADA 3JTEA 2ZIWB 3NBZC 1W7AA 3QX7A 5IX8A 3GJYA 1JNXX 5E7IA 3V7NA 1DAPA 4DV7B 5F7ZA 3RC3A 1YCHA 4BP8A 3DZKA 3NIFB 3D8BA 3CX6A 1Y5IA 3OD5A 2Y1WA 2EZUA 2GB4A 3IKJA 4YJ3A 1J0XO 4X3CA 3W2FA 4G0YA 1IONA 1OXMA 3ELDA 2C58A 4WTOA 4NFSA 3UENA 4HNUA 4HEJA 1C9KA 4MAFA 4OHBA 5AM0A 1YBVA 3JWIA 5GP1A 4CDRA 1C0EA 2GRJA 2ORVA 3K8ZA 1KKUA 3HN7A 1ESEA 1Y5LA 4TSKA 1ODIA 5EKTA 1DRJA 4DCCA 5HFJA 3WZ2A 4XB6B 3WISA 4J90A 1N92A 2W2LA 4HPXB 2G77B 5FTWA 5L6LB 1FP2A 1OX5A 4O2BB 3JYPA 3CZPA 3F7OA 3KFLA 4HLCA 1RLMA 5L7TA 1WSAA 1OH6A 3D3KA 1Y6ZA 3H4MA 2VKTA 4FHZA 4V2UA 2QORA 4A15A 2AZDA 5DHTA 5JAZA 1ZQ9A 3EEOA 2BI7A 2QMOA 4GKBA 3HO8A 1CUUA 1K88A 1LFAA 4MI6A 1Z17A 1ZMBA 5D86A 1P5HA 2CLLB 1SVIA 3UWKA 4K6GA 3REQA 3FTEA 1G9SA 4E5PA 1N5MA 4N48A 3CHYA 4O4HF 1QDEA 4AYWA 5BY2A 5HOEA 3D4IA 3FFXA 3JD1A 3BQMB 3UKDA 5B3KA 2PJRA 4ZT6A 3HJUA 2NO1A 1BHO1 3V4PB 5SYAA 3LWZA 4CM3A 4NBVA 2DWUA 2LDBA 2QG6A 2VBCA 3OZAA 1RLJA 2Q2WA 4UHDA 5EIFA 3KSMA 3DTTA 1FZTA 4TTSA 1JA1A 2O7VA 1JHQA 1OILA 4HLUC 2OPHA 3I34X 4ZJPA 1CR4A 4FEGA 1Z0UA 1GCIA 1YV9A 3KYBA 3NPAA 1HG1A 4NH0A 2AYYA 3DMDA 1U4OA 4RGBA 2N0SA 4N6GA 3ZZMA 3GJ8A 5KU1A 3C3MA 3IPAA 4MZXA 4F4UA 1WPQA 2R7KA 3I5UA 1NXQA 2W00A 4FW9A 1H2AS 3LW7A 3OMLA 3QY0A 4X71A 4FE4A 1ZJ4A 3EF1A 1DQPA 4E6PA 2GEBA 2XB2A 1UXHA 3R9XA 3QKRA 4HAVA 5FOQA 3QF4B 2YRFA 4RTPA 3BFKA 4M0FA 3OPXA 4RZIA 2MSLA 4U39A 3CBQA 1XA4A 2HWWA 4U2GA 4N5HX 1AKUA 1RTKA 1E9CA 5FB3A 1GL3A 1LJUA 1SCUA 3BTSA 1WD5A 3EZNA 1EFUA 2CY0A 2RARA 3F9CA 3ZTTA 4MCIA 3H2IA 2WWRA 4AXXA 4DJ5X 5NULA 3GRUA 1IN6A 3PQDA 1Z6AA 1U9YA 4LDPA 2J5XA 1L5QA 1XAHA 2G0AA 4Y1RB 3OPYI 1U7ZA 2XQGA 3DE6X 4UTOA 4KN6A 2JCGA 5B3LA 1GA6A 4B46A 1IZYA 2BHRA 3GZ4A 2WHXA 3HFJA 3EZ6A 4P7JA 3A6ZA 2AOUB 3D8UA 2HMYB 2OMKA 2AVDA 3PC2A 4K88A 4TSRA 2Y1LA 3D5TA 3ZD6A 1L5LA 3W5BA 3R0JA 4Q82A 5CB6A 5JD5A 1OR8A 1BWPA 3MT8A 4ZV4A 3Q2IA 1N5DA 3FWZA 3R74A 1UBKS 1PFYA 5CFMA 4QUDA 2QI9C 1I0LA 4EHLA 4Z6KA 1B23P 2QPTA 1G41A 1BXZA 1SG0A 3R41A 4UAGA 1ISPA 2C59A 3UUFA 3ZXXA 4B4UA 3RRZA 1IBLB 4C01A 1DAOA 1TAUA 2HK7A 3P9SA 2OFFA 1SXJC 4Q34A 1XTIA 4XE5A 2OCGA 5EE0A 3JAKB 2O5VA 2BFDA 5A04A 1MORA 4XSGA 5HCNA 5KYNA 3GFBA 2PK3A 4NBUA 2DR2A 1QCCA 1RD4A 1E0JA 1Z7EA 4RC9A 2BGLA 3AW8A 1CJCA 5BVHA 5T64A 2ONCA 4FYHA 3OZVA 4FHCA 1J49A 1Q0TA 2FW8A 4R0VA 1RXWA 1N6HA 3RJZA 2WHPA 4LYEA 1OXSC 1TM1E 2IPNA 2FNAA 2C61A 1GAJA 2QBYB 4Q1CA 3I6ZA 3T8YA 2ZANA 2ZTHA 3O8CA 1YZQA 1DI0A 2GHRA 1RAHA 4CE6A 4IOJA 2KWIA 2UZ3A 3KJEA 2YY5A 2IY9A 3IT3A 3K1TA 4IEEA 5AW8A 2RHCA 2WWFA 4AF6A 4NHOA 4DV1B 4RAQA 2X0NA 2C7VA 4U3JB 2H1OA 2C5BA 3ICOA 4LY0A 5LZ4A 4AN0A 1EJBA 3CF2A 1V8FA 2JAXA 3HHPA 2EXXA 2NACA 2ZI9A 3I8SA 1DBVO 3HUEA 3BMCB 4RZQA 3EIXA 2GVZC 1Z3IX 1B93A 2AL7A 3D9QX 3ITKA 3ZG6A 3SR0A 3AVYA 1RRMA 4CU5A 5JALA 4Z4IA 4LC1A 2FSFA 1U0JA 2BV3A 2OUIA 4PF1A 2LCQA 3X1ZA 5L53A 5DHSA 5B4UA 4I81A 3DJFA 3FYDA 2YWRA 1O5TA 1V45E 3PXBA 3D3NA 2FPIA 5FUYA 1R6BX 1LX7A 4QO8A 1ZUWA 3VAYA 4YAIA 3BS4A 4ZAYA 2JVJA 3B52X 1NBMA 2VRNA 3C5VA 4FR2A 4YRNA 3B1YA 5JYCA 2NTJA 1NOIA 4Q15A 3U1VA 3PNQA 4XGKA 4HB4A 4EJ2A 1OHHA 1T13A 2AW5A 4UMEA 4ROTA 4DDVA 1KP3A 2V9ZA 3C24A 4GBGA 4J16C 4BGIA 4RULA 2BI4A 4KO8A 1AK1A 1M1UA 1PNQA 2BHNA 2P0YA 3O3CA 3VJKA 4BRSA 1KETA 4B3GA 1Z5GA 2Q9AA 4P5DA 4F1JA 2IX9A 2GAOA 2OBMA 3IEKA 5DM70 3W3AA 1O4WA 4CHGA 1NHWA 2NVBA 5LQCA 1CK4A 2V65A 4JJ4A 3A58B 2VQ6A 1GRQA 3FWKA 1VLQA 3SFVA 1W2GA 1NQTA 5A0FA 3TR6A 4V24A 3VPXA 3U7QA 5EGNA 1L8XA 4NCNA 1K7EB 1LJ8A 2JRCA 1E32A 3GEMA 4KBGA 1RIFA 1XMSA 3PXXA 4NNOA 3VHXB 4CKCA 4QPPA 5TSDA 4DMRA 5I51A 1L7VC 1P18A 1MEOA 2Z08A 4DR4B 4JLNA 3IOEA 4DLNA 4LXIA 1RYMA 4X1OA 4WUTA 2JI7A 1J09A 2WZQA 3L0PA 4D5EA 2VP9A 5LSAA 1NA5A 3EMKA 4ECEA 3ONVA 4HO1X 3ILVA 4KTVE 4PFJA 2WYWA 5SICE 1VPEA 2X2FA 5EJMA 121PA 5KOIA 3ZOKA 3O73A 3QYJA 3H9UA 4HN4B 4GE3A 2VHCA 2JLXA 5C51B 2BLNA 2XXJA 1NT4A 1RYFA 2YVAA 1UBOS 3CSUA 1ZMXA 3FPKA 3H2ZA 4H7IA 3G59A 3QPAA 1WF6A 5AVJA 5EXEA 4YJGA 1JQDA 3BSFA 1G21E 2VC2B 4LSMA 1RRFA 4BMSA 4K46A 4K0KB 1R2QA 3V1YA 4PAWA 2L18A 3OQ1A 4FCWA 4X7RA 4E21A 4QWMA 5B3AA 1S8AA 3CR8A 5FHQA 2GN1A 3PL5A 4A0SA 3B1ZA 4MW4A 5IC4A 1GTMA 2RAVA 1BU5A 2YV5A 4Z86A 1ZO8A 2P69A 3NIBA 3ZZTA 2FN9A 1OXBB 3AP2A 1L0BA 2Y8EA 3M9XA 3IDQA 4K3UA 4TXMA 3C70A 5DT2A 1F60A 4C43A 5LZ9A 2ZJBA 2WMOB 1RXVA 1OFHA 1UZNA 3PWZA 4QPDA 4BMZA 1U7WA 1O5IA 2VHXA 1DX9A 1X7HA 3JVUA 3RS9A 2Z5GA 3D4LA 4FDVA 4LWOA 4K9MA 5ALQA 2B35A 4M49A 1U3CA 5I5GA 1F0PA 2AMVA 1LPBB 2ES4A 1GUBA 3TTUA 5COBA 4US2R 2CMGA 4KZKA 3KOZA 5J1TB 4AMZA 4Z7JA 5F3RA 5MN4A 1JHXA 5IZ4A 3I45A 5FWAA 1XL0A 1M72A 3ER6A 4LDAA 4MS4A 5F4BA 2IV3A 2X5KO 5EQJB 1T2VA 1JG1A 4AJKA 5C2JB 4J94A 3PRHA 4JUCA 3LVBA 4GZLA 3N59A 1YI0A 4MHOA 1VECA 4Q9HA 2XE7A 3WFJA 5L4NA 1C30B 3GFOA 5BT9A 1GU7A 3SQLA 1KFJB 1B0UA 1OFGA 3UO8B 1ST2A 4MS1A 1K97A 1MF7A 3EB9A 3NAMA 3G8BA 4Y9RA 1EVKA 1N3LA 1Y98A 1DQZA 3EXHA 4OB8A 4QPZA 4TKUB 1UMCA 3CG0A 2PTHA 5KYUB 5KTPA 1Z0SA 2C5LA 1QIIA 3ORRA 3BT7A 1E2PA 1SA0B 3R9KA 3T1VA 4IIHA 1IWOA 4EYSA 3L07A 1SK9A 3HGTA 3TKLA 3WBBA 1S8NA 2EDAA 1XKQA 4HVTA 3WMRA 3ED1A 1DKUA 1CY1A 3K0SA 1YA4A 1KQFA 2W5UA 4MW5A 4G5GA 3D4BA 4LZLA 5EG5A 5A7GA 4M7WA 1KK3A 5GAJA 3HY4A 3S3TA 3DHWC 3E2PA 2FH5B 1ZEMA 3I9LA 1GITA 2R6FA 4OYRA 3R7AA 3U3MA 1DMRA 4ECAA 1HNXB 4PR3A 1VB3A 1YDHA 5CDYA 3AKEA 3E9DA 4WH0A 4MDYA 3NTRA 3U81A 3U3DA 2Q9UA 4M8IA 3RVRA 3IPCA 1R9NA 4E08A 2FWAA 2BFOA 5CFPA 3DDZX 4Z5XA 5C81A 2A4KA 2F1RA 4CV1A 3G0OA 2D5AA 4U6SA 5FO1A 4FCCA 2RK3A 4AICA 4G0NA 2GSWA 4JYCA 1CRLA 3E05A 4FTWA 2AXPA 5DLYA 3PJEA 4BVFA 4XVQA 4I50B 3LQQA 3OE4A 2CBXA 5KU7A 5JRJA 4TQ9A 5EWMB 3QVKA 5DM2A 4R41A 1UFVA 5LQKA 3HXOA 3ZZ1A 3K53A 1F2TB 1L4UA 3Q11A 1D5CA 3VU9A 4BAZA 1E58A 1NVFA 5CT8A 5TQJA 4LAFA 2VNHA 2E4ZA 2XCIA 2G7ZA 1IBKB 2Q3EA 3HCDA 4MVJH 3TL6A 1JILA 1CFJA 1DG1G 1XA3A 2NNWB 2QTVA 2WYIA 4XM2A 3Q7QA 2NYUA 1W59A 1IDN1 2EZ9A 4RQUA 4UUNA 3L8HA 2P78A 1JDVA 1SU8A 3M3HA 4LJAA 4P86A 2HLPA 2I4RA 3F6RA 1L7XA 3HBJA 2IBMA 4UVEA 4OXIA 1Z37A 4I8XA 4YP5A 4KQEA 3ZZNA 4B80A 4F3YA 4CKEB 4R0NA 2ZJ6A 4EO9A 1ZBDA 3C3EA 3H7IA 3LZCA 3KQMA 2I22A 2Y3IA 4K26A 5ITWA 2FUCA 4EGFA 5BWNA 1W8DA 1TTTA 3BMOB 5F7JA 2VXCA 5BV2P 5IHXA 1AQNA 1QGYA 5HIMA 2Z56A 1KKMA 3T99A 1GEEA 4DS3A 5JQGB 1EDZA 2EL7A 2UZ0A 2XMSA 4EY3A 2P67A 1MXFA 1W34A 4E31A 5CX1B 2VDLB 2A9FA 1J2JA 2HL6A 4FGKA 2H07A 4G1EB 3QMVA 5IARA 3JQ6A 4QU9A 3LYHA 2WOJA 3DBRB 3EEFA 5FDFA 5AW2A 1EFRD 3O6VA 4UHFA 4BJ3A 1JJAA 4DLZA 1SCDA 2XSZD 1CUGA 1UKAA 3E9CA 3LIPA 5G41A 3TI7A 2NAFA 3T3EA 4A82A 5A3SA 1P0FA 1BWRA 1Z2NX 3EK2A 1WLYA 1JPNA 3FSEA 4RGQA 1AGXA 1M76A 2MWMA 3V8RA 5CP8A 5J2UA 4X8OA 5GZ1A 1I3LA 3FVWA 4KHZA 1ZY2A 2EFJA 1KVSA 3KUDA 3AQIA 1QU3A 4I4TA 4J1SA 2V4ZA 3ZVNA 4FP9A 3K6SA 4ND8B 3O2SB 4KQXA 3OOYA 3UWDA 1AS0A 4B84A 2JNWA 4LKRA 4TLBA 3U37A 1DCTA 1FJXA 1GP2A 3UH1A 4E4RA 3VPCA 1E7SA 2XADA 1TD1A 1ZN8A 2K7ZA 1KGSA 2QJOA 3HDTA 1Q1GA 4JUDX 2AOWA 5BSMA 3TAXA 3TZEA 3ZV7A 4BVKA 5A5VA 1C0PA 3DTYA 2HXYA 4KYTA 5K09A 3I3SR 1YC5A 4OKNA 4C4PA 4CKYA 3CSDA 1V9SA 3BF8A 2BGKA 2R68A 3DT9A 3QE2A 3NU1A 3ZGZA 2Y27A 2E6KA 3E2MA 4KH0A 1M8FA 3SXUB 1P91A 5HNKA 1NY6A 4NECA 4QE3A 4DG8A 4RO0A 4FBGA 4FMCB 4UHEA 2IS1A 5JAUA 4AK9A 2QLNA 1U3GA 4QDUA 1UBMS 1XF9A 1JX6A 1UBCA 2Y05A 2XITA 1CR2A 3R3YA 3ORHA 1W87A 2G0NA 1NBWB 2VJMA 4I6JA 4X85A 3DDWA 5KKNB 1YFZA 1J1UA 3I04A 4Q21A 5ADHA 1IPFA 5TRTA 4CV3A 4INPA 4Y8VA 2HY7A 3ZEAA 1FNSA 1JDSA 1O95C 1V2HE 5JV5A 2O52A 1L5HB 3RKSA 2O8FA 2OZKA 5SZJA 4R16A 2DHQA 4N54A 4LOKA 1MGPA 4PGGA 2HUNA 1NYTA 1C1XA 3JWPA 2PLNA 1SHZA 3ASYA 4I6EA 5GONF 4C7KA 2LWIA 3MXOA 2V7TA 5KNCA 2K7FA 1EX7A 4QXOA 3ADDA 3PEWA 5AUNB 3E9NA 4OP1A 3DF7A 4YP0A 2FYTA 1KC3A 2PX5A 3Q9UA 1Q14A 4O5AA 2PX3A 4W9RA 1SXJB 3RVMA 4ODIA 1JPUA 1M1YE 1NFFA 1RQ2A 4E13A 3AUSA 2NPFA 3VSDA 4IH1A 5IAOA 4CEHB 2H1WA 3VR2A 3ZWVA 2FPKA 3K0BA 3WL5A 3FPFA 4RLFA 5AVOA 3U7FB 2O19A 3LS2A 5ECGC 3W7VA 4WT7A 4P82A 1W6UA 4E6EA 3A3NA 4QG7A 2FUG6 5FT9A 3B82A 3S27A 5AO9A 4TMTA 1NX9A 5JG7A 3STUA 2ZDHA 5GJCA 2FX2A 3MK31 1WZUA 3QK7A 3ZDYB 3E8MA 3RUPA 2REXB 1I80A 3LM8A 3O1LA 3RS0A 2QMHA 2QRUA 4UQLA 2YWXA 2FHPA 4URFA 4Y2HA 2FSHA 2XKJE 4OX9B 2O54A 4DA4A 5FA5A 2QY6A 3R24A 3P0EA 4ICIA 3D1JA 5EKXA 2O5CA 3G8DA 3KWLA 3QKWA 4A16A 1OB2A 1RI1A 1T6BY 3W5HA 3W8EA 4R2XA 1EJ6A 5DI3B 1GIAA 1LVHA 1DNPA 1YXMA 4S04A 3AERB 3ITDA 4AZ3A 2DSNA 4DWWA 3OU2A 1ZCJA 3QTLA 3FRIA 1UOEA 3WR5A 4B44A 1CUDA 3U7EB 3KKQA 1NIJA 4GPZA 2O3RA 4Q3BA 4G2TA 1PD1A 3SEFA 2UUAB 4TYNA 4BUJA 2NO9A 3H11A 4GHWA 2QP9X 4BKMA 3GAMA 4CIBA 4HVCA 1EP2B 2CVPA 3PIDA 4IZ6A 4C4SA 1AH2A 5AJWA 1KK1A 5MDHA 1NRJB 3SQDA 3O8BA 4DV3B 3X1WA 5B6PA 4BFSA 4LV6A 1QF6A 1XYGA 2BMFA 2HRBA 4AO6A 5FJIA 3UMJA 4NBKA 4E1BA 3AI3A 4FFLA 3WK9A 3O9ZA 1FMFA 1ZA1A 3FPCA 2OZPA 3RWMB 3OTWA 3C43A 3K73O 1U3FA 2I03A 4FZ5A 1OV6A 4X95A 4NCAA 1K8RA 3PFGA 1ZJJA 4YJFB 4RY8A 2YICA 3GA5A 3BE5A 1WTAA 4DKJA 1PJ8A 3CH6A 3I42A 3KSRA 5AW4A 2L2QA 3BN3A 4US0R 1K8XB 2EATA 3CUSA 3GEGA 3QH4A 4EGAA 3ZD8A 1E1RD 2FZLA 3FWPA 3THWA 2VJKA 3PVZA 1XEXB 5SY9A 3UC9A 3WGMA 4CFSA 1E77A 4Z3OA 3SLGA 1QH1B 4CLRB 3LTNC 3HGMA 3HU2A 3TQTA 3AUYA 4NARA 2GA8A 2ZS9A 3SMVA 3DKIA 3WBFA 1TVEA 6CHYA 3NIWA 4G63A 1PQYA 1QANA 2ZBPA 3G82C 3AF3A 5BUZA 1USIA 2B78A 5HF8A 1SY7A 4HS4A 1CUZA 3VJMA 4DSUA 5FX2A 4PCLA 3EQ2A 4UFOA 3FKJA 2DUNA 3NG1A 3IUMA 5HCIA 3ML1A 3GJRA 4AKIA 4UARA 3U62A 2XMPA 3AUJB 2XDWA 1LDEA 1R4ZA 5DXFA 1RXEA 1OXKB 3B3FA 1P8AA 2F8TA 1GO2A 2VQ3A 1YU9A 3AC0A 3BDAA 3ND7A 3F6BX 2PGLA 3F5MA 4RVFA 4LRUA 9LDBA 5JJ5A 1EAMA 5BT8A 4Y6OA 4IJUA 1YC2A 1PJTA 3NRCA 4W7SA 4CLHA 2AZMA 4QOHA 3TBHA 1XJCA 4NF2A 3TEMA 4A6EA 5DVZA 3IUQA 3RSOA 5IF9A 4QM6A 1DUVG 1RLTA 1XU7A 1RPNA 2P5SA 3QIAA 2ZRFA 1WTCA 4MA0A 3BWXA 1NNUA 1YZYA 3ZLVA 4HATA 4RQTA 3V2GA 1ODJA 2PBFA 1TADA 1EUZA 2H6EA 3R7SA 1P0IA 1CY6A 2WVAA 3RVPA 1W94A 4KQFA 4TL6A 5BWMA 4BMNA 1V4VA 2FMTA 4F5DA 4CM9D 2ATVA 1NWHA 2C8LA 3UMRA 5AESA 2QSYA 5AK0A 4JLUA 3IB6A 2ID8A 3WMXA 1GZ6A 2ZAMA 2GK7A 2WICA 3PRJA 1ISGA 4LNAA 4OHYA 4QU8A 4XVRA 2JFUA 1MW8X 1UBUS 5ANRB 2A59A 1ZN2A 4PAGA 3ZKWA 3F5DA 4EJFA 4PLGA 2BFEA 1NE2A 2RAPA 4GNRA 4KV9A 5J40A 4KGDA 5E3HA 3PQ4A 3RLIA 1QGZA 4PFQA 4BAUA 1EEHA 3TSAA 3WDSA 4LG1A 1IH8A 4Z4CA 3I9JA 5TNXA 3TRKA 4AMVA 5B64A 1CETA 3GMIA 2BUAA 1R6TA 1KARA 3E22B 1DQRA 2ADOA 2QQEA 1X3SA 4A2QA 4K0RA 4D74A 3S4YA 1KH2A 2PKYX 3OFND 3QBEA 4YJ3F 5E7QA 4LYJA 5U9CA 1Z13A 4UUOA 1AA6A 4RBNA 1UAYA 5DBIA 4E32A 4EA9A 3KAKA 5LD2C 1A04A 2IEIA 2OV8A 4MINA 1HDRA 3DT6A 2IIPA 3NHYA 1E2BA 4U7WA 3MUFA 2QJWA 2J3HA 5GJVC 3LYLA 3W2GA 1QO9A 3JYHA 1VIAA 1JQEA 3B6MA 1X1DA 1XV5A 1EFRA 5B58C 4QUHA 2XSZA 4WJZA 2KM1A 5KIAA 4MVJA 2HJRA 4E07A 1UINA 4B8YA 1H3FA 5IJAA 3U09A 2BFFB 4G0WA 1ZJWA 5CB4A 1IXYA 1E4EA 4L15A 3Q8MA 1TTPB 2AC2A 2LRHA 4FVTA 3BDVA 1YE5A 3GARA 2D62A 2E55A 4BLWA 3RVOA 5DTJA 4EUFA 3IXMA 4A0FA 2AH5A 3NP9A 1FU8A 3AHGA 4DT1B 5KYKA 2ZYSA 5DW3A 3SEAA 3V4RA 3GVPA 2P1RA 2Q3LA 4RVSA 4WAUA 5BN3B 2P9YA 4H15A 3FYUA 4RA6A 1QTRA 2JGFA 2EBUA 1TIKA 3KRTA 1N8SA 4NY1A 1ZVKA 2QUJA 3DL4A 4DANA 3O83A 4JI5B 2O2DA 1F06A 2IWHA 1TD9A 4RFSA 1DVRA 3EASA 1AT1A 3PTAA 2LP4Y 3PQ3A 3RFFA 5B12A 1P7CA 3PR1A 5KQGA 2FMFA 2WUFA 3MCAA 3VJLA 2FSGA 2BMEA 3COVA 4TTPA 2JFOA 3HZZA 1VKNA 4KPUB 1USVA 1F1JA 1O96A 3I4CA 4LBWA 5FOVA 2JS7A 3FETA 4NBNA 4NU5A 2O1SA 2YVUA 1EFVB 4YMHA 2CHUA 4M21A 2K2QB 3KD2A 4QBFA 5JS1A 1M8KA 1OB5A 1PIWA 1VRWA 3D8RA 1GNSA 3OM0A 5TX7A 1OBHA 1PW7A 4NZPA 1MCZA 5K2OA 1Z6YA 1SKUA 5F5LA 3TG8A 4CI0B 4DQVA 1XPUA 4DIKA 1IIBA 2QROA 1G7RA 2P3OA 3DGFC 3LA8A 4MH0R 5JANA 3NM4A 3UJCA 2ZG6A 3SGLA 5C8DA 3GD7A 4RNDB 5HQ3B 2C4NA 2BJHA 1XWWA 4YHBA 2A35A 2DKFA 3PYXA 2HPHA 1NI5A 3KCNA 1ACMA 1TCCA 1G2OA 2HTFA 3UKJA 4F4JA 2YHUA 3AM4A 4IIEA 2BLLA 1RBMA 4BQSA 2O2XA 5LUAA 4A5OA 1GV0A 2ZRIA 4ITRC 4FBLA 5IAAA 4Q18A 3LHDA 3WI7A 1KMIY 5DCYA 4ZRNA 1KDTA 3BXHA 1EWQA 5DKFA 4TVKA 1CD5A 3C3BA 1ECGA 1D7OA 2I7TA 4OQEA 3JYOA 1UC5B 1K2VN 5DLEA 2WFAA 4AYTA 4KLRA 3BGVA 4I8DA 3PF8A 4OGLA 4D4LA 1C3OA 2YYAA 3GXOA 4ARAA 4BNVA 4FB4A 5H9VA 2YS6A 3FNGA 3A1WA 3CZQA 1EE2A 1E7MA 1V8DA 2Y76A 4ETWA 3GIDA 5L7YA 1Y3FE 2JFBA 1E1DA 1G17A 1VG9B 5LP1A 4WJLA 4IIFA 3RIGA 1MX5A 2P11A 2DHEA 3CVUA 2C4UA 3N2IA 5B3JA 1KVUA 3T3HA 1WU7A 3NPMA 1LLFA 2JHPA 2DH5A 2ODPA 221PA 2C9DA 3FVRA 3NJRA 3IEXA 4BATA 1QMPA 3DVRX 4ID9A 4HH4A 3BFXA 4URZR 4E1VA 1P73A 1N9GB 3M7IA 3WGKA 4QKQA 2EP8A 1O6CA 1Z3CA 1YHNA 2OCKA 3NH9A 3GGPA 4PIMA 4QQNA 4DNXA 1T5TA 1NVAA 1CVIA 2RGNC 3G8CA 4V39A 2GKGA 5G0SA 3LSYA 4RANA 4KIFA 4D9BA 3VR0A 2ZWPA 5FUXA 4GPTA 3HJNA 3P9CA 3EVAA 4Z0TA 1JQ3A 2WQ6A 3EG9A 2X8JB 1GRCA 4HCJA 4KDRA 4P8RA 4X84A 4B81A 4EJSA 1EU1A 1WPGA 1KPHA 1M6EX 1CJTC 3GDWA 4E5UA 4I55B 2H4FA 1ADFA 2G80A 1ZUNB 2GPYA 1AB5A 1Q7TA 2GAFA 3AR8A 3G0DA 3JAKA 1GLVA 3JSAA 4GXNA 1WIWA 2J3LA 1CCWA 2I1LA 2PFKA 5DCUA 2ZZKA 2EKQA 2AI3A 1TYBE 2Q3CA 1S02A 2CDCA 2DWOA 1P2UA 4AY4A 3RI3A 2NU6A 4D45A 1E7YA 1RJFA 3SJZA 2OBYA 3W5SA 3ZQJA 3E7XA 4QIHA 5A4JA 1N75A 2OHOA 1Z4JA 3KNZA 2DQZA 4O4LB 4QUAA 3TRDA 1EUYA 4YO7A 1Q74A 1EDBA 2C95A 1XSEA 2EZTA 2PKXA 4X1KB 3A2NA 3QLVA 1E5TA 2GAJA 1KO7A 3TL3A 1E1RA 1JEAA 2YJ4A 1CNEA 2JAWA 3HB7A 4KLNA 4PO9A 4ZYZA 2N42A 3OBIA 4TT3D 5J5VA 1M0TA 1ZOLA 1ZXLA 3ABQB 4A92A 2FG6C 2RGBA 4ZCRA 3KAQA 1S4QA 3R4VA 5EHGA 1VE6A 4GVLA 4IUCS 4WQMA 2WTNA 5GVSA 5JD4A 3NASA 1M6VA 4MR9B 2ZT8A 1NWCA 2QJFA 3F8TA 3P4YA 1FUEA 2XUPA 4TN1A 3S2ZA 2FW9A 1F3OA 2XF8A 3QUQA 1RBYA 4RS4A 1GPH1 2ZBDA 5TB5A 4K1LA 1SZCA 1PFWA 2B9EA 3M4YA 1YB2A 2CJFA 5IJ0B 4AJOA 2BF7A 1TYZA 2ZYHA 3C8ZA 4QOSA 3T9DA 5KSPA 1ADCA 4H3SA 1FLVA 2C7QA 2Q5IA 2J5QA 3QV2A 4BRUA 4ZO6A 3TLXA 4YJKA 5HZKA 3AUTA 4AX4A 4EF4A 4X60A 4Q3NA 4GG1A 3EWIA 4BLTA 3HJAA 4QUGA 3F74A 1Y48E 2IP2A 2SKDA 3E2IA 1NUUA 2HNKA 3EGVA 3M5PA 5F51A 5HIKA 5U4XA 5ENVA 2FZEA 5GJWC 4CW7A 1RCTE 4XWYA 5EEGA 3PFWO 3Q7RA 3GFPA 4R1SA 3NKFA 2VDRB 4ENVA 2GZSA 2HIGA 4DMUB 2I4IA 3DOIA 1Q44A 3KQKA 4MUFA 2GOYA 1IUOA 3K9LA 4K3VA 3NP7A 4XQ9A 2YINC 1N0VC 3KKNA 4KE8A 4JV5B 4YAJA 1O6FA 3GLRA 3BOSA 3DEJA 2PYIA 4IDOA 4CM9A 3JR7A 1IEXA 4HNGA 2Z2XA 4Q24A 1EYZA 1NW9B 2JL1A 3RSQA 3WAKA 4H0FA 3RBZA 2IT1A 5BNZA 2P1DA 4QEDA 6Q21A 2J46A 1X7WA 3RCBA 3E5NA 2R79A 1QGED 2YUTA 1GGVA 1SZPA 5FF9A 1DOAA 1UR5A 4X61A 1SXJD 4C6TA 4C6RA 4RKFA 4TLCA 1IG0A 2QS9A 4JEMA 1XROA 4OK3A 4RKEA 3QM1A 4X6XA 3AY0A 3LRTA 5FAXA 2DBZA 4JASB 2GO7A 2JJ1D 1RZRD 2MIIA 4KU4A 3I4FA 1G7TA 3GJZA 4YMIA 3A6FA 4M0PA 4F2WA 5KWIA 2YZ2A 1RWMA 3I2KA 1IQPA 4JAVC 4MWGA 3PKIA 3ICEA 4BASA 1O08A 5J4VA 3V46A 3ZK7A 1MOQA 4C7XA 4R5MA 4EG4A 3G2PA 2JH8A 3O91A 3EQ9A 1QS0B 1ATZA 1RR6A 3OFNA 1OI2A 1RAAA 3WGTA 2J4DA 1GAEO 5I4IA 2Y0CA 4IO0A 3PFCA 2ZRBA 4WIAA 3L5OA 4S05A 3RYHA 2C4MA 4UQOA 4MPRA 4YALA 4N0MA 1WZIA 1PJCA 2BKVA 1L7PA 1BW9B 3HZHA 3H84A 4NU6A 5KS2A 1JFTA 3RRMA 1CR6A 5EYPB 2ZJ2A 3FM9A 1B8NA 4GRIA 1BFDA 4KNYA 4DLWA 4AIRA 1Z83A 4FT4A 4R8LA 3GP5A 3AEXA 4ZJUA 2OV3A 4HL6A 4JIMA 3IVCA 4GOND 5ES3A 4ZC8A 3MHTA 4UUAA 1BJTA 5LQMA 3R40A 1DEXA 3CEAA 1SBYA 3I2HA 3KR1A 4JYZA 1KS2A 3PR2B 1COWD 2XOKD 3C4JA 3A06A 3O94A 5JASA 3AHHA 1XMXA 3IP7A 1YB5A 1H1DA 1RYHA 1NJ1A 2FFBA 5JWOA 1S1MA 1YKSA 3VZSA 2YFQA 4BNYA 1VIDA 1KXJA 4L5YA 2P75A 4KNVA 5ALRA 4KR0A 5I8PA 2G4VA 2ZIUB 2LGJA 3KEQA 3IIIA 4OVKA 1NV8A 1UKEA 3OP4A 4PYQA 5L3QB 2I6GA 3EGOA 3GYGA 2VK8A 4RCZA 2XE6A 2J5KA 5ALFA 3ID6C 5EHIA 1JG7A 1HE4A 1YBHA 4KW7A 5A6SB 1X7ZA 3SOZA 4ZQEA 2LR0A 3AIMA 3F90A 4QBGB 4RUKA 3VDMA 3H5IA 1DJNA 5SY4A 3RS8A 3UW3A 1RJEA 3AW9A 4L5JA 3VI4B 4BV8A 3HP1A 2NZVG 2O2SA 2WSMA 4PGFA 1U8EA 3FUUA 3TR5A 2VWPA 2R6JA 4W63A 3IMFA 1T2DA 4OXXA 1YVDA 1DMSA 1HF3A 2WLSA 1ISSA 1QNFA 3JX9A 3L4EA 3KALA 4MRRA 3KO8A 2HMWA 4Y2VA 3M0EA 2P65A 4EABA 1EESA 4IUYA 3CE9A 4UNSA 4C5AA 3DXZA 4TT8A 1XRSB 4K81B 2F1HA 4H4EA 1PDWA 2B61A 3VZQA 3BCHA 1PKXA 1Z6TA 3PGVA 4OBBA 3WGNA 2VNIA 1OT3A 1XCJA 4O2AB 1RKUA 4DXHA 2ZATA 2BZ0A 3KZVA 1I30A 4DDMA 1EXNA 2FWMX 2O5EA 4IKOA 1P61B 2PX6A 2ZUSA 4A91A 4OI2A 4BZPA 1ZHFA 4B75A 1C7QA 5ECWA 4DR1B 1S2LA 3EWSA 3UATA 1XJ0A 1EE1A 1QVRA 3KETA 1M9NA 2VDMB 3LYAA 4P4LA 3WL4A 4E15A 2IYYA 3RUIA 1V1MA 3BK2A 3BREA 4H35A 4LMRA 2JW5A 4MB0A 3VPDA 4MV6A 2EP7A 1YFJA 3G9TA 2VDQB 4UCWA 4EBBA 3BJEA 3J7TA 1QRUA 3EH1A 2KPOA 2I2XB 2PWYA 5K0NA 1Z07A 3RC1A 3SC3A 2NU7B 1L2TA 3PQFA 3PZRA 1K2WA 4YTEA 2IZ0A 4RJJA 3LCJA 4IRUB 1GNLA 1XR3A 3DAGA 1PBNA 1RCUA 3ANLA 3DKKA 5LP6C 4ZEWA 3ZDZB 2VTDA 3DEKA 3JQFC 3EXEA 4P3OA 4AECA 4B32A 1KR5A 5EWMA 4BP1A 2GMWA 1F5NA 5T4EA 2KJQA 3ZWWA 1F2TA 4BE9A 3G2OA 2ID9A 2OZLA 4KUEA 3VKFA 1K3TA 2LXNA 4CL3A 5DE3A 1GU1A 1N6NA 2FZVA 2QXUA 4DNOA 1R0ZA 2H92A 2PD3A 1WSDA 2O6LA 5EPUA 4LXTA 4KQJA 1DJPA 4Q4AA 4QT0A 4H7KA 1U8ZA 4M1EA 4IIJA 1U0NA 3INTA 1NP3A 3OCVA 4G65A 3I5AA 3LHFA 4JNKA 4PONA 2HWUA 4EEXA 3EUEA 1EE9A 5FWXB 3WQHA 3SKYA 3D5QA 5TARA 1QDUA 4V0RA 2V3VA 1VE3A 1PX0A 9LDTA 3W2HA 2HFKA 1P0CA 2A1TR 5DGTA 2D1SA 4BVBA 4DUYB 3DE1X 3A7EA 2IFTA 3BMOA 5HK8A 1U8TA 4QUBA 5J2UF 3A9TA 4DABA 1YRBA 4FMDF 4RSMA 1KFCB 2Q1UA 3MRSA 4I4TF 5JBQA 1MJGM 1XRLA 2DU8A 2ZUVA 4Q7LA 4DA9A 1M73E 4ZZ3A 2B94A 4MGHA 4A0GA 2COEA 3FCSB 3G1TA 4WCFA 5DOVA 5HK9A 1G8HA 4H7JA 4Z4FA 4JT9A 1BE6A 1VL8A 2IL1A 1MO2A 1T6YA 3BQNB 3G0BA 2YIMA 4HH1A 4KSYA 1QC5B 4OP2A 1RHQA 1SUAA 2RGUA 3DBRA 4MK4A 3UUGA 1YJ5A 5TIIA 2QMEA 3LL4A 4Q1BA 4V0MA 2C83A 3N58A 2A86A 3RHTA 5ITSA 1PNTA 5JAPA 1JYEA 4LWZA 3LL7A 2VSFA 3DEAA 1E2QA 1TGYA 4WMLA 4XDZA 5HUHA 5ITZA 4QNRA 5IMSA 2VAMA 2BEWB 1VLHA 2C2OA 3T3OA 4TWRA 3LT1A 4KQ9A 2GESA 1U0GA 1S3GA 1I2ZA 3A36A 2R85A 3B70A 3EIOA 4W82A 4QTZA 2R1VA 4RX1A 4LBZA 1Y4AE 2PSSA 1NVKA 4P4TA 5CDSA 1ZRSA 1QFJA 1GUZA 3A32A 2Y0DA 3IP3A 1YDFA 4MPJA 3FB4A 4DQUA 1QYXA 2Q2QA 1XTTA 3BHMA 3CKKA 1C9MA 3EVCA 4UBNA 4CMEC 4F8EA 3WIUA 4AQ7A 1WM1A 3ZBPA 2DSTA 3ZLJA 3HCWA 4BEBA 1NL3A 4FD2A 4IILA 4HAIA 2X8BA 2JIDA 1MLDA 3PIRA 4RTJA 1NXXA 1Z0IA 2VATA 1T15A 3FWYA 3BD8A 2D2EA 4FUTA 3ELYA 4GOOD 4KQIA 2D2IA 3N39C 3R6LA 1PI3A 2YR0A 3J7AC 1T0HB 1VLMA 1WB6A 2QPOA 3V55A 4BNHA 4JS0A 3GJ6A 4XI9A 2PR2A 1UMDA 2A58A 4YMTA 2ORED 3EISA 2YNMD 1VSBA 1MABB 4M60A 1GPJA 3OKFA 2QE7D 3KQHA 2VP3A 1YFLA 4JVOA 1UAAA 3T3PB 2BT4A 4DBLC 4I5DA 2PRJA 4U2FA 3E8XA 4LDRA 3IELA 3UW1A 1L7OA 1CR1A 4HGNA 4M1TA 4O8CA 4PX5A 4FZ3A 4Z9YA 3A3PA 2WBLC 4XUGB 2OPBA 3TVYA 2XW6A 1APBA 2WG0A 3ON5A 4RMHA 1QAMA 3EC1A 1VIYA 5JAOA 1V11A 5DHAA 1G6KA 1G66A 1KGDA 1E61A 1IHOA 2ORYA 5IAKA 1Q7RA 1YMVA 4FOOA 1KEUA 3AR6A 4U00A 1YQXA 3CH7A 5EXTA 1QRSA 2CF5A 3OIVA 3E27A 4R05A 2WKQA 3KT0A 2C7RA 3L0YA 4LISA 4ZEOA 5A4DA 5BRAA 3H75A 3CPHA 4PV7A 5A4KA 1ZD8A 4L8LA 5JNLA 2JJ1A 2BBTA 3A2MA 3FFBA 1RZRA 1QLJA 2OM2A 3WP1B 1RYZA 2WHRA 1Z5VA 2F8LA 3A6PC 5AKXA 3AXTA 3THOA 4Y6QA 2FMUA 2C5SA 2JAUA 2P1ZA 2RHOA 4NBLA 3AWIA 4N40A 1G7CA 3A9CA 4F6CA 3FVTA 1F8YA 1LC0A 1XRMA 1L5ZA 1C9NA 4OJNA 5DTEA 5HA5A 4DFDA 3THXB 1O87A 3DPIA 3HRIA 4B87A 1TF7A 2TYSB 3BBLA 3QVWA 2PZJA 3TQFA 3V5NA 3NNSA 2XNSA 3NDIA 4V0NA 2SICE 3GRAA 3W5CA 3SQNA 1V8ZA 3FNQA 3KR2A 4MTCA 2HIAA 2ZIFA 4QTXA 4R2WA 3EODA 2V8OA 4UEWA 5TPZD 5B4TA 2TMKA 2Q2VA 1EGAA 2CCJA 2RH4A 2XV1A 5DI3A 5CVTA 1VIVA 3FRJA 4Q3KA 3H3JA 3HMKA 3SX4A 1JBQA 4YACA 4IEFB 4EGJA 1VE1A 1KNXA 4FW8A 5GOTA 1B7GO 1HETA 3QA9A 4C7OB 1PFVA 3KJIA 2CUTA 4BP9A 4MR8B 5B1SA 5BRNA 4BLRA 1I7QB 3F0TA 3EPJA 4RIIA 5A3QA 2YY7A 2ZB7A 3WIVA 2XOKA 2GM9A 4B2PA 4MQMA 4CM7A 4ZD6A 2A8YA 4PQYA 3LPLA 5GZ6A 1EUDB 2GTHA 1EVYA 2R6ZA 4X6UA 5C53B 2ZI3A 2OOSA 3M6FA 4HXFB 4HDSB 3GLIA 1VJ0A 3HWWA 3FZYA 1DAEA 3GWGA 3WKDA 4CU2A 3UJBA 2G67A 3TE7A 4HRYA 3RPEA 3WL7A 2ZRNA 5CB0A 2DHDA 4DG9A 3SVLA 4CIDA 3LBNA 4IEIA 3UT5B 2ZIXB 3OZEA 4DLTA 2AFVA 4Q7QA 1OH5A 3E3NA 4DQDA 2XUGA 4OBEA 4TTVA 4B5LA 4RH1A 2CXOA 4BWVA 2FKAA 2WHYA 3LY7A 3N2KA 4YJFA 2JZCA 3L06A 5LA6B 2A3NA 4BEWA 4I5EA 3AHDA 4N5LA 3WB9A 1N2EA 2OUKA 4KG7A 1FJGB 3I12A 2PUJA 2J85A 2ZVJA 5FNVA 1ENZA 2VA8A 1I1QB 1SKYE 3CW9A 3H4VA 1O94D 3C3AA 3A31A 1JR6A 2CWWA 1DFGA 2QIPA 4HUJA 2QT1A 4ROSA 4RNCA 5FYQA 4ZVUA 3SBXA 3SZOA 1L9KA 1P60A 2IYQA 4LRXA 4TS9A 5B37A 2NZ2A 3OKAA 1IK6A 4YUWA 1V3UA 2JEOA 3BRSA 4UHHA 5ED0A 1WHTB 2E49A 4YO8A