3KQHA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 142
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqhA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA01
4BFWA 1TTTA 2QE7D 2ZS7A 4DZZA 4EJSB 1ZM3A 3KDSE 5IDVA 1W2GA 4EDHA 4KODA 1E4VA 1XMJA 2V4ZA 3L82B 1Z06A 4LJ8A 3SE0A 2GJ8A 4DLZA 4QNRA 1XNJA 1N2CE 5D3MA 2E1RA 3UIEA 1SGWA 2NO1A 1MRSA 4GNKA 4CYMA 4EIWA 2EFHB 1NY6A 4L5BA 3IIMA 4TSFA 2VHUA 3RHFA 3HYRA 5FPYA 4GZMA 2WBLC 5E7JA 4PPQA 1DADA 4D0LB 3FFBA 2QMUA 4UJ5A 2FH5B 5G53C 1ZNXA 1U8YA 4PFSA 5SZKB 1KJYA 4ACBA 1N6RA 2I3BA 3AB3A 4JT2A 4CT4B 2CCJA 2HJVA 3H84A 4MYTA 4DDVA 3DOEA 1W1WA 2RB4A 4ITRC 2XTNA 4JVLA 3ZZ0A 1GFIA 1S8FA 1I4LD 4UNPA 1IAQA 3SBDA 1QVAA 4AG6A 4D2IA 3RWOA 4HZUA 2OCPA 1KJZA 1E0AA 5DI9A 3TH5A 5FOUA 1QG4A 1G5RA 1U99A 1E9SA 1DTSA 2IYTA 1AGPA 3A6PC 4PHFA 4MRSA 1KTVA 1TF7A 2ZE5A 4HAUA 3FB4A 2ZRPA 3B9QA 1D9ZA 3CX7A 2ZSDA 3UMFA 4RFSB 2Q0HA 1CULC 1CIPA 4LHXA 1L8QA 2VP4A 3GD7A 4Q4HB 2FGJA 3IO5A 1J8YF 1M7HA 2Q6TA 2RGDA 3MG9A 1G291 1DG1G 2WPDA 2DFTA 1CJVC 3E70C 2W6JA 4JVNA 1Z07A 2WKRA 2ZAOA 3D8BA 1NG9A 1AM4D 1RW4A 2XNDA 4GDFA 1UM8A 3UG6A 3CKLA 3UMRA 3KJGA 4B2PA 5FPKA 5FTKA 1VHLA 1DG3A 1WA5A 1MKYA 2IBMA 4OQNA 5IF9A 5IT5A 4NYIQ 1P73A 5LDDC 2QTVB 2QBYB 1YHNA 1ZM7A 3CX8A 3AH8A 3OIYA 1T5IA 4DJTA 2JLSA 3O47A 1G16A 1G7RA 1BH2A 4TT3D 2WWGA 4D4KA 1A4RA 3T1QA 1OF1A 2ZRIA 3IIKA 3QF4B 1U9IA 2WWIA 5KDOA 4OHWA 4LX0A 2GZDA 2FZ4A 1KO7A 2LKCA 3ICQB 1CEEA 2WWFA 3GJ5A 3QBVA 1P9WA 2OBMA 2RKOA 3EAQA 3RS4A 4EJSA 3TSWA 2CLSA 1P2TA 4Q9LA 4R9UC 3A4LA 3L2OB 3IPYA 3NHAA 4XTRA 1Z0AA 4ZCMA 4CF7A 2F1IA 2GHIA 4WOPA 5A0FA 2KSQA 1G21E 4DDWA 2F9LA 4V0ME 3ZS9A 3RWMB 1GOTA 3LDAA 1G8YA 2ZEJA 4HDQB 1RIFA 2O8BB 4KYUA 2X8AA 2F3RA 4MKFA 4NL4H 3RC8A 3X1WA 3BWDD 1OV4A 2ZPTX 4ARZA 4B3GA 1YVDA 3F5FA 4TLCA 3FVQA 5EXSA 2D06A 1SVSA 4JLPA 1NI3A 2R6AA 4V0LA 3MFYA 3B6EA 1OXTA 2QI9C 3JZAA 3FDIA 4BLSA 1Q0UA 5E95A 2IS2A 1II8B 1UDXA 4M1WA 1JR3A 1KMQA 3ASZA 3GJ3A 1F2TB 1OXUA 4DLYA 2IC5A 4JLJA 1XBTA 4G1UC 5EP4A 1IN8A 2XOKD 3U6KA 1N6LA 3B5JA 1DAGA 1G3IA 1WBBA 1N25A 3G0HA 2HXYA 4URYR 4BE7B 2Z4SA 3CIOA 1N0UA 2XSZD 5JZVA 2PMDA 4CVNA 2QROA 3QIAA 2RHDA 1PZNA 4ZCLA 4C0HA 5KPJA 4BRUA 2V8OA 3IIJA 4HLCA 1SVOA 4Q4HA 4YONB 2AXPA 1OJLA 4HI0E 3SS8A 3LVRE 1JI0A 4WZ6A 4A8JA 1XMSA 4CIDA 1KK1A 3MUFA 4U5XA 4B73A 4D4JA 4IFEA 1RZ3A 1A1VA 4TTQA 5FPTA 1UKEA 1SVMA 2QSZA 3U7HB 3A36A 1OKKD 1V5WA 1TAGA 2P0EA 3T12A 4M4SA 2OLKA 4B3XA 2H18A 1R6BX 2WAXA 2B7BA 2Q9CA 4M8NE 4XD7A 2QTFA 1GL9B 3DOFA 1G6HA 3AKYA 3ICEA 5CYPA 3OAAA 2BM0A 4BPBA 1S4QA 3QF4A 4OK6A 4DB4A 3OE7D 2DPXA 3LQQA 2QENA 1ZUIA 2ZITA 3C7KA 3P1JA 4IDQA 3U3OA 3AP1A 3B9PA 1NNEA 3BGWA 4OI2A 2GXAA 2JA1A 3T5DA 4HLUA 3AUXA 1W4RA 1UKYA 2ZJYA 4TMTA 4DSTA 2W2TA 2IW3A 3AEZA 3TAUA 2J1LA 2KE5A 2PBRA 1KI7A 4UNQA 3H86A 4P4TA 4AK9A 1ZYUA 4TQAA 4UXIA 2E87A 2O8BA 5G3ZA 1CKEA 1MRNA 1KO8A 2FFBA 1G6OA 4IVPA 1BO6A 2IEYA 1EWRA 5FBQB 3RABA 5EP1A 1C1YA 2BHRA 2ZAMA 3AF4A 2XB4A 4OQLA 4URWR 4D6PA 1DE0A 1E9BA 1KY2A 3OEHD 2O8DB 4FCTA 4HDCA 3LVQE 2EFGA 3AP3A 3H1TA 521PA 4CEHB 4MGKR 5SZIA 2H57A 4AKGA 3CH5A 5GJVC 4PXAA 2A5JA 4A0HA 2HYDA 3TRFA 3U3KA 1E9RA 3THWB 2R65A 1WBDA 4JJZA 4QGGA 4POAA 4M21A 3UATA 4TL7A 1XEWX 2ZS9A 3TUIC 3Q3JB 2R6FA 2IS4A 1AZTA 2BMJA 3IQWA 1FFHA 3SNHA 1E4YA 2XITA 1IJFA 4UXJA 5LB2A 2XB2A 4O25A 5JJLA 3AF1A 3VR4A 3FYHA 1RPZA 1N6OA 5F2EA 3QSYA 1NN3A 2R8RA 2VSFA 3BFVA 4C2UA 1ZVQA 4GOKA 2IWHA 4A0RA 3IEVA 1K5DA 1W4BA 5AJVB 1KMHB 2AHOA 3BE4A 3M0EA 3ONWA 3PUZA 4IW3B 4JLOA 3LD9A 5JWHA 1HT2E 1HV8A 2WTUA 3AVXA 1QRAA 1F60A 3MLEA 4JBYA 3WP1B 1IOZA 2X77A 3KKPA 1G7SA 4V02A 1JEDA 4MGIR 2XEXA 4OBEA 2OG2A 3W9YA 3RVBA 1NVXQ 1XRJA 4ON9A 2BJWA 3ZD6A 2JAQA 3QXJA 4LC0A 4FW9A 3SHFA 2O0KA 1XPUA 3HPQA 1Y3AA 5BYJA 1K6MA 1CJMA 5GJCA 3LWNA 3C41J 4DSOA 2BEJA 5DISB 4C0QC 3PQCA 2ZJOA 2HUPA 2TMKA 4H9GA 2ZJ5A 4XOIA 3AF3A 1OFTA 4JYCA 3QJYA 4BZPA 5HZKA 3R7WB 1NMYA 1QHGA 2C9YA 5SZJA 2ZRJA 2XAUA 3OFND 2IYUA 2JJ1D 4Z1MD 1MO4A 2YV5A 4TLAA 4DKXA 4F92B 2CVHA 3K0SA 2F1JA 2IYQA 1ZNZA 4BLRA 2J87A 2WOOA 621PA 4ABYA 2PX3A 5JHHB 4QG7A 2BMFA 4LV8B 2L0XA 2OZEA 4JZKA 3HYTA 3VKHA 3NWJA 4XSHA 4PAQA 4GL2A 3LXRA 4YMVA 4TZ6A 1R7RA 2CBZA 1T91A 2QG6A 1EFTA 2O8DA 4HAZA 4U02A 3GJ4A 3B1XA 1D2MA 2GEVA 221PA 3L43A 4TT3A 4QHTA 4S2EA 1NSFA 1T3HA 2AK2A 2WKQA 3TE6A 4CDGA 3DKVA 4M1KA 1GNQA 2YOHA 1CR1A 1U98A 2KB0A 4YXWA 4E03A 3THWA 4Q7JB 2H7VA 3QG1A 2B8WA 4A1FA 4V0KA 4F91B 1KHTA 1XF9A 4BGDA 2HF8A 1YZTA 2CMKA 1HE1C 2CNWA 1E96A 4LJ7A 3X2SA 1N5LA 2F6RA 3QOFA 4AY2A 1JJVA 4M1YA 2FJUA 4TYQA 4LGMA 4TSFD 4QOSA 5AUOB 2FE4A 1U81A 4ZDWA 1UPTA 3CM0A 5FUWA 2Q3FA 2FSGA 4NKRA 5H8WA 3AVWA 4WZAE 4NDZA 4RD1A 2A5FA 3BS4A 4LJ4A 4EKDA 4BQSA 1M34E 1YR9A 3U3RA 4A2PA 5SZHB 1DEKA 4PR0A 3D7MA 3FE2A 4FMDB 4DSUA 2ZI6A 1DO0A 2G1KA 3K9GA 1KSHA 3SJCA 4FI3C 4GT1A 3FPAA 1XEXB 2O5VA 2QSYA 4OK3A 4G01B 1Z47A 1FQJA 1XFAA 3SBEA 3CF2A 5KUTA 3LNCA 4H1UA 1IY0A 3X1XA 3KL4A 1GAJA 1KO4A 2CE2X 2D7CA 5HPYB 2B8TA 4CT5A 1U0HC 2EFDB 4D26A 2J0QA 1OH7A 1G1MA 5EZ6B 1U9IC 4RCZA 4IXMA 5EQTA 3KJIA 3W3ZB 3QE0A 4D82A 4PC1A 4LUCA 3B13B 2OILA 1R0XA 4B48A 2ORWA 3BORA 1QHHA 4MKIA 3A1SA 2ZRMA 1NN0A 3C5CA 2ZR9A 3R7WA 1W48A 1VYUA 2RHMA 4BLQA 5FOXA 5L3QA 2FX3A 4D0NA 2V1UA 4A2WA 1NJGA 3V4RA 3AVQA 3CBQA 2ZJ8A 4PAOA 1TU4A 2A5GA 2DFLA 2WPDD 1G4AE 3P26A 1SKYB 3O8CA 3SQXA 2W6JD 4OI4A 2CCKA 2F55A 2MSDB 4I99A 3T1VA 4OL0A 4A82A 3AVOA 3SOPA 4NMMA 4TLDA 5CLQA 3VKGA 3CNLA 2ZYVX 4Q48A 4ZCIA 1ZC4A 3MJHA 5BN5A 1TEVA 3U2QA 2JIZA 3BFKA 6Q21A 1QZXA 5AUNB 5C46F 4R2IA 3NBYC 4JLKA 3CONA 1NIPA 2CXXA 1E6CA 5B30A 4NTZA 3FTQA 1OPXA 2EYUA 2BKEA 2GZHA 1W5SA 2WM9B 1TF2A 2N46A 3DEFA 3NC1C 3SFVA 2RGEA 1AA9A 3A58B 3QNUA 5JSZB 1Q20A 3T34A 2IUUA 1TQ4A 1OSNA 1RYFA 3I92A 2CVFA 4C4PA 2IF2A 5FR2A 1Z08A 1EXMA 3AV0B 1XMVA 4IOJA 3MGCA 1E9DA 1KDPA 3KXIA 5KSPA 4ZKEA 1L4UA 3PJRA 3GLIE 4IFBA 1XCGB 4PZYA 1GKYA 2O8EB 1OH5A 3CLVA 2RH5A 1ZD1A 4JYBA 1HURA 1YZLA 1TUEA 3RC3A 4A8JC 4M9QA 3R20A 4P31A 2OXRA 1RRPA 5M04A 3KQNA 4FCVA 3CZQA 3B85A 1FUKA 4RZXA 5F98A 4NONA 4PSVA 4B44A 4DXAA 3OEHA 3QENA 5HZHA 2W2XA 2ZS8A 3H4MA 3QPWA 1T0JB 2WMNB 3KB2A 2IWRA 2ODBA 4KYIB 2VTKA 2AD5A 2WMOB 1P6XA 1Z6GA 3HDTA 3CO5A 3NH6A 1KDOA 1Z3IX 3RAPR 3FMPB 2NGRA 4QC2A 4RKEA 5CIQA 3OIUA 1OLOA 1T8TA 2EFCB 1X8KA 2IHYA 2QA5A 4G5SA 4NYJQ 3LA6A 3PCRB 5FUYA 4ESHA 1W0KA 2DWOA 2GJ9A 2ZJAA 1SHKA 2R9VA 3FGNA 4NYMQ 2ZQ5A 4DIEA 2P5SA 2WICA 4KI0A 4Y0VA 5D3MB 1G7TA 5LBIA 5EE9A 4JT4A 1XX6A 4LHZA 2HT1A 1YR8A 4HLUC 4P0TA 3KUDA 2GJKA 4O2RA 1E1QA 2ZI3A 3VX4A 3ZGXA 1PUIA 1AS0A 3GEHA 1DOAA 2P6NA 3LW8A 4J0QA 4RD4A 1PLLA 5JBQA 3KXKA 4B6FA 1Z6AA 2X2EA 2QL6A 1EX7A 3LBHA 3GJ0A 1FX0A 1E0JA 4UNRA 4MDEA 4M9ZA 3GQBA 3MD0A 4OQMA 4W7SA 1WE2A 3IPXA 2QMOA 3ZVNA 2RGAA 2O8CB 1XJQA 2ZU0C 4BLOA 4JIMA 2P6UA 4D0GA 1DAHA 3IUYA 4DSNA 1IN4A 4BZXA 2BVNA 2P6RA 5IHPA 4QBIA 4KO8A 1P4SA 4AIIA 3QXSA 2HCBA 1ZM4A 1FPMA 2IYSA 2QUZA 3OAAD 4XSGA 4FWTA 4HZUB 1WB9A 4HDOB 5TVKA 2J0UA 5G40A 1IY2A 2VP2A 4LBYA 1M6NA 3SJAA 1SXJC 1XDBA 2ZYUX 2YC2C 1KDRA 1N6NA 2UVQA 3SJBA 4TMXA 2ANBA 2CHQA 1XU4A 2VP6A 3W8NA 2FFAA 1WXQA 3THOA 4DCUA 5EJEA 4Q1BA 2JJ1A 4YLGA 3ND9A 1G3UA 1X86B 1Z0DA 4DDUA 4D4MA 3PFIA 1NBME 2C99A 1W5TA 3S1AB 3GLHA 1MO5A 2PCJA 4PO8A 4GZLA 2O8EA 2C5LA 1FW6A 2GKSA 3K0FA 1T3LA 5FL3A 3CNOA 3PUXA 1P2VA 2UZIR 4RJLA 1E94E 3D6TB 4W5JA 1L4YA 5J4VA 2I1QA 1SKQA 3MMPA 3CR7A 5B64A 3ADKA 1GNPA 4G5QA 4XWAA 4IHQA 3B78A 4FMCB 1N6KA 2Z43A 5CK5A 1R10A 2VHCA 3ECCA 3NKVA 4MA4A 3OHMA 2ATVA 4PHTA 1I2DA 2YOGA 3K09C 4EPTA 1N6IA 3NBXX 4ZI2A 1SXJD 2ZI4A 3T35A 2QPOA 1GM5A 2I4IA 1P7CA 2IT1A 2Z5FA 5L3VA 1OIXA 3QVUA 1G5PA 4PZLA 4TTPA 4PHGA 2OFXA 1T5LA 3JZMA 1NY5A 4TYNA 3NXSA 3WHLA 3WMGA 2DB3A 1T0HB 2ZR0A 2WJGA 1L2TA 3RRMA 5UKDA 4Q4AB 1NF3A 1GKIA 4QGAA 5CB6A 2PX0A 4ARZB 2H16A 2GAOA 3QKUA 4TYPA 3V9PA 1KI2A 1GDDA 2GETA 2J45A 4C30A 4JMPA 1W46A 3NDPA 1TQ2A 4I81A 1LTQA 4Q9HA 5JS7A 4Q1AA 4QJ3A 2O8CA 1J99A 1VCOA 2VH5R 4MUBA 2JLWA 4Q1EA 1U94A 1ZMXA 4WA7A 1JR6A 3CRMA 1P75A 3LBNA 1I4TD 2Z0MA 4M1SA 4ZPXA 2G3YA 3R8CA 4ZI3A 1XTQA 3CW2A 4B35A 2WSMA 421PA 1OHHA 2E9SA 4DEXA 2FGKA 4FN5A 2IXFA 1UBGA 1FTNA 3M1IA 5HE8A 1ELOA 5FTMA 2JASA 4AD8A 2NO6A 2WWHA 1R4AA 4Q4JA 2ZRGA 4IDPA 3K0EA 1XTIA 3PV0A 4OHVA 2KI5A 4XVQA 1P5ZB 1N6PA 1O3YA 4NYIR 3NTUA 4IVRA 3GLGB 2V3CC 1GSIA 2ZANA 1PLKA 4CRWB 4XH9B 4C0BA 1I2MA 3IQXA 1U8AA 1KAOA 3S1AA 3WHKA 4A8JB 5DNYB 1QHSA 4TLEA 4K81B 4EAQA 2JATA 3AF0A 1VG1A 3TKLA 5LB4A 5LD2B 3SHWA 4EPVA 2GCOB 3FMOB 3NDBB 5EUMA 5CDFA 1DPFA 1R0YA 1DS6A 1E2KA 4B47A 4W5WA 4P4SB 1Q1ZA 1GWNA 5FTLA 3PR1A 3GFTA 3EA0A 5FOWA 4AYXA 1YZQA 2QTHA 2JGNA 1O87A 2C9OA 5P21A 1T4GA 3IEUA 2CJWA 2RGGA 1UEIA 3NG1A 1ZW6A 3CWQA 5KO2A 4YXWD 4AKHA 4IOKA 1Z6XA 1CLUA 2V54A 3ZDQA 1ZM9A 4Q9JA 4BFTA 5HCNA 1KKMA 1OIWA 4ACAA 1GP2A 2B6HA 1HE8B 2CNWD 1KK3A 1D8TA 3IBGA 2ZSBA 3BRWD 4IOMA 4URVR 4ZDJA 2PEZA 5K8TA 2WWYA 2ODWA 2VSOA 4RD2A 5KOYA 4RY2A 4Q4AA 4N0EA 3IILA 3UXMA 1OFUX 2ODEA 1WQ1R 1YQTA 3CX6A 1E2GA 1II0A 2Q3HA 2V1XA 3DZ8A 1RE0A 4TLBA 3PENA 2VPPA 2VP0A 3CRQA 1JALA 4LYJA 1YRBA 1Z0IA 2VP9A 3DM5A 4JLVA 3THXB 1R5NA 3KQUA 1J7KA 3K53A 4QFMA 1KGDA 2ZJ2A 4JVSB 2AXNA 4JLBA 4FD2A 3SZRA 2OFWA 3CZPA 2G77B 3D31A 4US2R 1EFUA 2D74A 2OE2A 3HR7A 4UKDA 2J0SA 2IYZA 1SXJB 2OO7A 1VPLA 4Q47A 1ZIPA 3P32A 4I1UA 4NHOA 1AZSC 2HLDD 1WF3A 4D4LA 2O0HA 4GSYA 2ZRCA 1ANKA 2WWWA 3QY0A 3REGA 1FNNA 4LI0A 4A92A 1NRJB 4MRPA 3UPUA 5DGXA 2C98A 4AURA 3GLGA 4JLAA 1JB1A 1J8MF 1A7JA 1OIVA 3VR3A 2C78A 4DHEA 2ZRBA 3TR5A 1NLZA 2R2AA 3VAAA 2A5DA 2W58A 2VYFA 3B1WA 3MRSA 2VBCA 3B1ZA 4KFRA 2GK6A 5EE5B 3EPLA 4QXAA 1CR2A 3EWSA 2WIAA 2ZUBA 3TBKA 2REOA 4EQ6A 5ELXA 1EWQA 2GEUA 2IL1A 2PH1A 2GVDC 2SHKA 2VA8A 3B82A 1J2JA 1M2OB 5DI3B 5JMTA 1CU1A 3LX8A 2G88A 2GCOA 1G17A 4R71A 2QU8A 1XJ0A 4FMDF 4AG5A 5JCZA 2G0TA 2JIZD 2HCJB 4P4SA 1IJEA 2FWRA 1QF9A 4HATA 3AVVA 2IUSA 3CB4A 3K70C 1T9HA 3I5XA 1Q21A 1XXHA 5BQ5A 1FP7A 2EVWX 1FUUA 1JJ7A 4EPWA 2O52A 3TW8B 2R6DA 1Q1BA 3I4LA 5FL7D 1OFIA 2BKUA 1P62B 4N0DA 1VKJA 3TLXA 4EUNA 2VO1A 4LJ6A 2FMXA 5KDDA 1HQYE 4RSGA 2ORVA 4WXPA 2RCNA 3DL0A 3JVUA 2FSIA 2JLUA 2WV9A 3PVSA 1NG1A 4DRZA 3X1ZA 1JPNA 2ZRFA 4AYTA 5IK2A 5GJBA 5EXXA 3B1YA 4GBMA 4A6XA 2XZPA 1KSJA 2VF8A 1E2JA 1ESMA 2ZRLA 4B3FX 2JLQA 3UK6A 2AKAB 3FKQA 2WZQA 4NBSA 3THXA 2GJAA 1D6JA 3DZDA 1VCIA 3NBZC 3E5HA 1OE0A 2ZRAA 3VTKA 2ERYA 1EESA 2A7QA 4GPTA 1WP9A 2BEKA 4IJMA 3LAWA 4V0NA 3K70D 1E32A 3BXZA 1AJEA 1YR7A 3AVPA 1E0KA 2JLVA 1SXJA 3NHBA 2ZSFA 4C9BA 2J7KA 4DDTA 4AKEA 2JLRA 2UKDA 3JVVA 1IHUA 1KYIA 5DSZA 3W90A 2A5YB 1W0KD 1VG8A 3GLFA 2A30A 1N5JA 3AP2A 4TL8A 4DLWA 1OW3B 3CNNA 4EPXA 1S96A 3VHXA 1FMLA 1E1QD 1X8LA 1P3JA 2YHSA 4BFUA 2P3SA 1ZM2A 3SC3A 3R8FA 3QPVA 1XD9A 2R6CA 3K0AB 2NMVA 4IXNA 2ZVPX 1DARA 3SDZA 2YVUA 1FQKA 4BEBA 1H65A 1YZUA 3QKSB 2V6IA 4KSBA 5KSOA 3TGPA 5DI3A 2QAJA 1I4DD 3TR0A 2QORA 3T1TA 4MRRA 1RKBA 2NTYC 3ADDA 3IDQA 1ZRHA 2W0SA 2D2FA 2ZSEA 2J0VA 1U8ZA 4U7DA 3K09A 4PQYA 2QPTA 1IXSB 1HUQA 1LVGA 2C8VA 3TIFA 2PMKA 1Q44A 4W5HA 1X1SA 1U0JA 2CL7X 4B76A 4Q4LA 2B7CA 1CRQA 1H8ED 2FSFA 2ANCA 3TMKA 1QHHB 3V4FA 3R9WA 3AM1A 4AKIA 1UBCA 2F1HA 3HU1A 3MAAC 1JXOA 3H2YA 2QAGB 3WNCA 5L3QB 2CK3A 3U3MA 3H0KA 1KNQA 3G5UA 4Q1DA 2AKYA 5TMPA 2WWXA 1B23P 1NVWQ 1PVOA 2JLZA 1NVVR 1QG2A 1M8PA 3FWYA 3Q5DA 4L8GA 5FBWB 1V43A 1AQYA 1W0JA 2D3WA 2FPLA 4IDNA 5DN6A 3LBIA 3F8TA 4TQUS 3U6BA 1MT0A 1AK2A 1E9CA 1KI3A 1LS1A 5FOSA 1TUIA 1G19A 2CCGA 2A2ZA 2QN6A 4LK2A 3LLUA 1E2LA 4BFZA 4HUQB 1XCMA 4IEEA 1Z29A 1LFDB 4BWYA 1N3BA 1NVUQ 4NZYA 5CM8B 4G0NA 3HU2A 3NC0C 4JLDA 2CLCX 2DR3A 4B33A 2OAP1 5TB5A 2H17A 2W6IA 3DO6A 1UKZA 3QXHA 4HYYA 3DMNA 3HPRA 4TYYA 1BYIA 4YDHB 2AD1A 1ZNWA 2C95A 2HV8A 4HB4A 4BFSA 8OHMA 3FMIA 4D80A 2GTPA 1XTSA 3GJ6A 2OSBA 1F5NA 4GOXA 2C96A 2EFEB 4PAMA 3QF7A 3CH4B 5G3YA 4C0LA 3LQRA 3QBTA 4OYHA 721PA 2MSEB 3GJ7A 3K0AA 2J7PA 2ZXUA 1KZ7B 2C9CA 1UKVY 2FN4A 4LJYA 3NEYA 2K5UA 4US1R 1X1RA 3PXGA 1KJWA 2AFIE 4II7A 2EYQA 3I8SA 4ZKDA 3WBKA 4RD0A 3QKSA 4NP6A 4RZ2A 1G41A 4NCHA 4R7ZA 3X1YA 2VQSA 4QNMA 4FMBB 1BKDR 4BEJA 4V0MA 4A9AA 5JI2E 1F2UB 2OLJA 3ADBA 4I4LA 4JL5A 4Q66C 1Q3TA 4CEJB 4D25A 2DFNA 2QRNA 2V9PA 3P4YA 4RZUA 3K70B 1W4CA 2GESA 4L9SA 1EG7A 5FTNA 2QT1A 1JEEA 1JAIA 2OESA 4M1TA 1OHHD 3Q9LA 4LY6A 3E1SA 4NCKA 5KU1A 3AQ4A 2A3RA 4M9XA 2HLDA 2RGNA 4LDJA 1R0WA 2FDCA 1RJ9A 1E9FA 4G5OA 5AJWA 5FOTA 1E3MA 3VNUA 5KYKA 2V7QD 5JRZA 4PANA 3I72A 1YZGA 2GNOA 2BC9A 3GJXC 5BN4A 1P9RA 2QAGA 2GZAA 1M74A 1BOFA 4OQFA 1Q3HA 1XJCA 3IHWA 1KO5A 4FWIB 5DO9A 4AWXA 2GF9A 3CF6R 1NMXA 4LBVA 5L8VA 3CRRA 5CB8A 3B60A 1FX0B 4KV9A 1UAAA 4YMTA 1YR6A 2FU5C 4QKQA 4M22A 4JL8A 1ZU5A 5JECA 3EIQA 1D9XA 4YMWA 2C77A 4A15A 4WW0A 1ZCBA 4KBFA 3QI2A 3R9IA 3Q5EA 2CHGA 3GEIA 2FSHA 3MWKA 2O8FB 2JCSA 1Z2AA 4HUQA 3W5IA 1E1RA 4PQRA 3ZJYA 4OHZA 4JVMA 4ZIRA 5B57C 1TEXA 4Y0AA 2J0UB 1ZU4A 4IRUB 3VHLB 2JDIA 4PPNA 3VX3A 1AGRA 2AX4A 1A2BA 3WMFA 4MH0R 2QT0A 4P3YA 2ZTSA 5JCPA 2ZJBA 3C5HA 5FL7A 3TSOA 5JEDA 3U7FB 2ZE7A 4LC1A 3BB3A 1WRBA 1PV4A 1AIPA 4HB3A 2IEZA 2GRJA 3RRNA 2QP3A 2QNRA 2BMEA 5JJIA 4DCTA 3FHTA 3NVAA 3GLHB 4FIDA 5J4HA 3RSOA 4JSYA 2EW1A 1IXZA 2G6BA 3RNLA 3TQFA 2C2HA 5EXTA 3CF0A 3K0FB 2ZRDA 1E98A 1G8HA 4F38A 1UEJA 2NPFA 4GMXA 4A4DA 4QHYA 3EC1A 3EA5A 2QP9X 3UG7A 3EIEA 4KVAA 3THYB 4NCNA 2Y8EA 1Z22A 3N5CA 5LD2C 2W83A 3GFPA 3L8ZA 3AVTA 4WZBE 2ZIAA 2Q3MA 4DCNA 3QPUA 5AJXA 3U61B 1PLJA 4LCBA 1F2UA 1ZC3A 4CEJA 1KOFA 2Q9BA 3B7GA 1JR3E 5J4KA 3PITA 3RS3A 2G1JA 4ZO4A 4DLUA 3TW4A 2ZI7A 4B43A 1KI9A 1VCNA 3GP8A 2GCPA 1TMKA 3EZ9A 4M1OA 3QKTA 2C03A 4RFVA 4KU4A 2PCLA 4JJKA 5BYKA 4KJZA 3WP0A 2HXSA 2XXAA 3K8YA 3N2EA 1PUJA 3OF5A 5FI0B 3FHCB 4MKGA 2ONJA 5DHAA 4NH0A 1KY3A 2RAPA 1EFRD 4M0LA 2NQ2C 3DDCA 4KFUA 4US0R 3GEEA 2EQBA 1AS2A 2J5XA 3ZIAA 4KFSA 1G64A 2YOFA 2HDNB 4B3CA 2EWVA 1X8JA 2JJ2D 2OV2A 1UBEA 2PZEA 4KHZA 4MGZR 4TMWA 3VQTA 2Z6VA 3HJNA 3EZ6A 1CP2A 4Q18A 3EZFA 1ZINA 4NCIA 5C1BA 1A5TA 3REFA 5B2ZA 4TYWA 3U44B 3I62A 1WMSA 3TUJC 2X1VA 2X2FA 1HEIA 2ZE6A 3BB1A 3RS2A 2IXEA 3EPKA 2O8FA 3SYLA 2OCAA 4HAXA 4Q19A 2GCNA 2NOAA 3EZ7A 4XJXA 2F43B 4C0JA 4B74A 4MITA 4Q03A 1CTQA 1KZGB 4DT1A 2WSSA 4IDOA 1UF9A 4DUGA 1VTKA 1H8EA 2REBA 3HP1A 5DLQC 2XJ9A 4JSTA 4Q4JB 2VRWA 2LKDA 2WVJA 4QBFA 1N5KA 1NP6A 1GTVA 2ORIA 4E5UA 1DAMA 3KTAB 2AN9A 5FUVA 3BD9A 1JNYA 1DAFA 3TQCA 3GCGA 1T3SA 5JI3E 3IKJA 1IM2A 2DWQA 2J3EA 4A0FA 1QHYA 4MDFA 5IK2D 5FFMA 5J40A 3PG5A 5K8UA 5FBRB 1ZCAA 2BOVA 4X8OA 4R2HA 1GITA 4WXRA 1Z0FA 4TQ9A 2R62A 1C9KA 3WYGA 3THYA 4PSAA 2FFHA 3ZZTA 2N1BA 2P2LA 5KNCA 1U2RA 3CRW1 1M7GA 3KXLA 3P20A 3TK1A 5GJWC 3B1VA 5FUXA 3ND8A 1ZUNB 3LW7A 1NBMD 4LBZA 4BFYA 3R9XA 2DY1A 5GADl 1R0ZA 2CJWB 2DFKB 3FKSA 3ZVLA 1SQ5A 2IUTA 3LXXA 1SXJE 2GBLA 1IONA 2FOLA 4F4JA 3A37A 3QKRB 5CJPA 2QQEA 4ZV4A 3HWSA 4ASUA 2ZRNA 1ZBDA 1CRPA 2OHFA 1IXRC 2JEOA 3BH6A 1NLYA 2AR7A 1LNZA 5JWRA 1E2IA 4OJQA 5EUQB 3VU9B 1KSFX 1G8PA 2WHXA 2GXQA 3WNBA 1IBRA 4DLSA 4CGZA 1UJ2A 3GJ8A 3KJHA 3UWOA 4DLRA 3BAFA 5FBVB 2R6GA 1AQUA 1COWD 3RLFA 5AUPB 4DLTA 1II9A 3KQHA 3MWJA 3LX5A 2IS1A 4F4IA 3RSLA 5H68A 3KFVA 3NH9A 4DLXA 3U44A 2ZETA 4QJ5A 1CXZA 3WRYC 121PA 2IS6A 5E4FA 1S1CA 1FMJA 2ZM5A 2ASEA 2YINC 4V03A 1RC8A 3RRZA 3EC2A 3GLIB 4MYHA 2F43A 2PJZA 1KKLA 1KAGA 2PT7A 1J90A 2OBNA 3DKPA 3MWYW 4BZQA 2OEPA 4I1VA 1E2NA 1XP8A 3W6OA 2QM8A 4MQBA 4KCGA 2OFOA 1SULA 2NO9A 2REXB 1XZQA 2IYRA 1GG2A 3OEED 4IDHA 5A5GA 2ZYTX 2FG5A 3F3YA 4HAWA 4Q1FA 4C0KA 3I5YA 2DCUA 4I1SA 4B3BA 2V6JA 2V7QA 2VHJA 2CL0X 3LRPA 4LYFA 2DHRA 1OH6A 1W2HA 3KTAA 1KK0A 3O8BA 1U0LA 2NIPA 3TUZC 2CK3D 2VHQA 4NPHA 2IYLD 4F4CA 2WJIA 1F48A 3HU3A 3AF2A 1GRQA 1G5TA 2KWIA 2BCJQ 4ILEA 4EQ6B 1W0JD 4LPKA 4JBXA 3VKWA 1Q57A 5DN6D 5L3SB 2OXCA 3KJEA 2EWWA 5KPDA 4S35A 1VIAA 3Q7PA 4RD6A 3U7EB 2HEIA 2G0NA 5TXGA 1EFCA 1M1YE 2YWEA 5EP2A 1DVRA 3EWAA 1D2NA 3OESA 2ZI9A 4JLMA 5TY0A 4PHHA 1LB1B 3BIFA 1G9XA 3EARA 4WIAA 5E7MA 1WDTA 2DBYA 5KNDA 1E2FA 3W5JA 2ODNA 1A82A 1NKTA 1XXHB 1S9HA 1VDZA 1QVRA 2W6ID 4QJ4A 2YZ2A 2QEQA 1ZUHA 3B8HA 3QKRA 2RGNC 2XTMA 4P32A 4URZR 5FPHA 1IQPA 4QGFA 4TZ0A 2Z4RA 3RDPA 2GK7A 5BXQC 1XPOA 4TN1A 1TX4B 2QY9A 3L0PA 1E2HA 2J9RA 4HAVA 4XIGS 2O0JA 4YQFA 4URXR 2VLIA 4HZIA 4L16A 4PQFA 1T6NA 4UNSA 1LF5A 5J4YA 5AR1A 3VU9A 1W4AA 4OHXA 2QAGC 4BUJA 1TQDA 1DAIA 3K0CA 1ODFA 3Q8XB 4Z8XA 2ONKA 2J7PD 1IY1A 4Q02A 5J47A 1CR4A 3VR6A 1S3GA 2H1LA 3BB4A 2VEDA 5DYIA 4K8OA 4DVGA 4XWOA 5F9HA 1VMAA 1E99A 1FTSA 1ZD9A 2BDTA 2XX3A 2A9KA 3KB1A 4QHSA 1KI8A 2CL6X 3BH0A 3C14C 4XVUA 5CIWA 2BIFA 1CJKC 4LZZA 3AKCA 5BN3A 3ZD7A 2NPIA 5BWMA 4YMUA 1NLFA 3VR5A 5CJ2A 1YZKA 3RANA 4DCSA 5FR1A 3WYAA 4PZZA 3GLIA 2NZJA 4HUTA 3L8YA 3D3QA 4EPYA 2CEAA 1MOZA 2F9MA 2BBSA 1HYQA 2G9NA 1A2KC 4L9WA 3VFDA 2HF9A 4D81A 4OJKA 3BK7A 2ZRHA 5EE3A 4FXPA 3TVTA 2QRZA 4NU0A 4LSGA 3LLMA 3L0OA 1LF0A 1DO2A 4JKIA 3BOSA 2BBTA 3GLFB 3DVLA 2X19A 1VECA 1Z0JA 1K5GA 4URUR 5EXPA 2H92A 1EFRA 3AVYA 3QEOA 1SVKA 3CPHA 4B75A 3SEAA 1E9AA 1RVDA 1KIMA 4HLDA 4BFVA 2XZOA 2P67A 4TL6A 1R5BA 3ZYCA 2JJ2A 2VP5A 3I32A 5J5CA 3F0TA 5JHGB 5HKKA 2YC4C 2QGNA 1G3QA 1NL3A 4IOLA 1KNXA 1FOEB 5L3SA 1ZNYA 1RRGA 2WIBA 1XCPA 4JS0A 1LV7A 4Q5IA 4QM7A 4RFSA 2QPAA 4WBSA 1JQJC 2H5EA 4KXFB 5JFGA 1BIFA 1YE8A 1E1RD 2ZRKA 5C4MA 4RVCA 3WXMA 1EK0A 1EGAA 2R44A 3A1UA 1DAEA 2MMCA 3KX2A 1OB2A 4PC6A 2GXUA 1CF4A 2JDID 3KQLA 5KHOC 1IN7A 1OXXK 2EU8A 3I73A 4JLNA 3PUYA 5HE9A 4KLZA 4EPRA 1QDEA 3QQ5A 2GVZC 1XEWY 4LWZA 3T5GA 4KITB 3AGPA 1DBSA 1DELA 1G4UR 1TQ6A 4B71A 3A4NA 1P2UA 4UJ3A 2QBYA 2ZREA 1E2MA 1LS6A 1H8HA 3X1DA 3O8DA 2OCBA 1YZNA 2AFHE 2CE7A 4HSEA 1X6VA 2PEYA 3PUWA 5TDHA 5AK0A 5KNBA 3CUEF 5E3HA 3GFOA 3RYTC 2GXSA 2CHVA 3DM9B 5HR5A 5CK4A 2WJHA 1Z63A 2W0MA 2YWFA 3I61A 1ZJ6A 2PZFA 1Z0KA 1KSGA 3CRVA 2IXGA 4C7OB 3KZ1E 4G5RA 1BS1A 3RS0A 4QBHA 2YKGA 1GRRA 2V55B 2HJGA 3SU8A 1C4OA 5D3QA 5B58C 2QQ0A 4C3ZA 2GA8A 3QXCA 2IX3A 1YU9A 4OK5A 3K9NA 1QHXA 5CLLA 1OYWA 4M9SA 5A4JA 3KKMA 2ZVQX 3A1WA 1NBMA 3OZXA 1KK2A 2QP4A 4PX9A 2WAYA 4G3XA 3C4JA 5TV2A 3KUCA 3AVUA 4GP6A 2IA5A 4YDSA 1AKEA 5CITA 3UKDA 4OI0A 3U4QB 3VNVA 5FTJA 3QXXA 2J41A 1UFQA 4KLNA 4CW7A 1W7AA 2ZYWX 1N0WA 4TMKA 1XWIA 5C18A 3ZVRA 1II8A 3W3AA 2OAQ1 1XPRA 3PEYA 1VYTA 1X3SA 2F3TA 2G83A 4LHWA 1W47A 1E79D 1F2TA 2FPMA 2QE7A 4K46A 5EE0A 2B92A 3ZIAD 5LPNA 1SVLA 1CJTC 1CJUC 1SKYE 1COWA 1VG0B 3CR8A 5HCIA 4KSCA 2MMGA 1E2PA 2PLRA 4L15A 2DYKA 3NBFA 2YYZA 5TARA 3J81k 4PC3A 3TSZA 1R8SA 2XJ4A 2YWGA 3PUVA 4PO1A 4AI6A 2MSCB 3A1VA 3A8TA 4ZDKA 3P27A 3ZQ6A 4LYHA 3KFXA 4PPGA 1GL6A 4C0SA 5JRJA 1YRAA 5ANRB 4M2LA 1TPZA 3ZZUA 1GL7A 1LW7A 2GJSA 2RGXA 2WSSD 3BH7A 3M4YA 5K8IA 1S3SA 1DAKA 4HEJA 3OEEA 4BASA 2GBLC 5FOVA 1TADA 2OBLA 4DUGD 2P65A 4IKEA 1QBKC 1RJ9B 2OCYC 1RRFA 3IO3A 4DB2A 2D62A 5F3WB 5AWFC 3EASA 4XVRA 1HY3A 2ERXA 1AKYA 2YWHA 3NIBA 1K8RA 1YJ5A 1TF5A 1OXSC 1Q1QA 3EZ2A 2FF7A 4OKSA 2NO7A 3AKDA 4AC9A 4Q7KA 1TNDA 1BMFD 2VL7A 1GVNB 3GLHE 3BC1A 4M1MA 1US8B 3KKOA 3OIVA 1Z2CA 4A36A 1NN1A 1VIYA 3PEVA 3QEJA 3O8RA 2D4HA 2KBFA 4C7OA 2P5TB 5FI1B 1RRCA 1D2EA 4FCWA 3KKNA 4LRWA 2AL7A 1GILA 4YC7A 2CDNA 2WKPA 3ETLA 1VCMA 5FBLB 2C04A 5KSZA 4GP7A 4WAUA 2XNSA 4A2QA 2Z83A 4C0AC 4LJ5A 4F93B 2JLYA 4KFTA 2QMEA 4PO9A 4MUAA 5AUQA 1XTJA 1KI1A 3DHWC 5C4GB 3TNFA 1XEFA 1MH1A 4ZIRB 4TWZA 4C2TA 4Q9KA 1OXVA 2QM7A 2NZ8A 1R8QA 2PL3A 3FKSD 3VMFA 4Q1CA 1ESNA 2AWNA 5JEEA 4E22A 5FPSA 2IYVA 1W49A 4GMDA 2FNAA 3SFZA 4E09A 4IEIA 3U4QA 2WJYA 4IVQA 4X8LA 4LJAA 1JBKA 4ASUD 4DIDA 4LYAA 4HB0A 4PSKA 1BYUA 4HAYA 3RRYA 5DIFA 4CEHA 2BM1A 2FV8A 5GVRA 2BMDA 1NVVQ 2CLDX 1EFHA 4LHVA 2ZJZA 3WNDA 1P60A 3FMFA 2IK8A 3IHLA 2JJ8A 3MJRA 1F3OA 2F1RA 3I3SR 4TMVA 1AN0A 4Q21A 4RKFA 1HH4A 3L0IB 5H70A 2H8KA 1FZQA 3QUSA 1MV5A 4MYUA 1PJRA 4BLTA 1P9NA 1KI6B 3BERA 4O2LA 3VR2A 1KO1A 5C2JB 1SHZA 5GVSA 5H1YA 1OB5A 1RYHA 1RFLA 5EE1A 1CBUA 1S9DA 3T1OA 3WY9A 2QMHA 4EFMA 4MGYR 2PT5A 1SZPA 3SR0A 4LOAA 5BW8A 3T61A 3C8UA 4NCJA 4FMCF 5EZ5A 1N0VC 3U5ZB 3Q85A 1F6BA 1KMHA 1W36C 1G3RA 1M7BA 2BBWA 1G20E 2XXAB 1MABB 3ZLJA 1IN5A 1XMIA 3BBPA 2GWHA 2JLXA 1S2MA 4DC9A 1Z6YA 1OFHA 3EIHA 2QGZA 2VHTA 3ZH9B 2A78A 2BCGY 3EPJA 1Y63A 4H1VA 4X8MA 2F7SA 1UADA 3I8XA 4F7WA 1LY1A 2GF0A 2XOKA 2GAAA 1XD2B 3RS7A 2AK3A 4Q01A 2D2EA 3K0CC 1ONBA 4ZDIA 3NEJA 1Z28A 1US8A 2VF7A 4TMZA 5DYGA 3GPLA 4RD3A 1GKUB 4U00A 5E7IA 1E0SA 1JPJA 3PEUA 4NE2A 1XTKA 3TJZA 1UDWA 4EJSC 1NSTA 2XSZA 3QG5A 4MRVA 3WYFA 4GFDA 2N42A 4RZ3A 3SI7A 3A4MA 2ZUDA 3ZS8A 5CDFE 2XTZA 3EPHA 1MR3F 1GZSA 4UQOA 4GI7A 5EP3A 4E07A 4ESVA 5DH9A 2NO0A 4MYCA 4ERNA 821PA 4DT1B 3MWLA 1QHNA 3KQKA 2IYXA 3EW9A 1HT1E 3EXAA 3WBJA 1GRNA 2HT6A 3MCAA 4WVFA 4O3MA 4DEYA 1P61B 1J70A 2XNDD 1OKKA 1W36D 3WMEA 4EFLA 2IYYA 3VR1A 3ZVMA 1R5OA 1N5IA 1P2SA 4L4UA 1L7VC 3W34A 4MKHA 1MO3A 1ZD8A 1E2QA 3LO5A 1NIJA 1ZAKA 3W6NA 4QM6A 1NJFA 1Z83A 2OUKA 3IBYA 3IGFA 2YNMA 4QRHA 3OE7A 3AUYA 1NKSA 2ECKA 1G3MA 1SVIA 2FEOA 1VYVA 4QL3A 3TVDA 4BLPA 1ETUA 5CYOA 4CEIB 4A0GA 4N3NA 3L0SA 2ZSAA 4NYJR 4OHYA 1CR0A 4X8HA 4NYMR 4P33A 1G18A 3SN6A 5KTYA 2Q9AA 3E2IA 2NG1A 4LBWA 1JQLB 2GDJA 4Q7MB 4B32A 3G82C 4RCYA 5J4LA 1KI6A 4B34A 3LFUA 3CWZA 3LV8A 1QHIA 1IN6A 2FEMA 2BV3A 3U60B 4N1AA 2OT3B 4Z8YA 2B21A 3EG5A 4GOJA 1S1MA 4W9MC 4MRNA 3Q7QA 5DE3A 2ZU6A 1HQCA 1HTWA 5KDLA 5JJKA 2VIIA 3SQWA 3V00A 2YJTD 3N2IA 5L3RA 1MABA 1XEXA 3ASYA 3KKQA 4FINA 2ZR7A 4M53A 2RGBA 4TTRA 1T8UA 2IYWA 1Q1EA 2FA9A 1VHTA 4G5GA 3UWKA 3CPJB 2FFQA 3SJZA 5FH9A 3GLGE 1E79A 1JR3D 1R2QA 1WCV1 2W2VA 2J59A 1JECA 4UNNA 3PEWA 1XD2A 3HR8A 3K9HA 1E69A 2LCFA 1FP6A 1G7CA 4XWKA 1G8FA 1P72A 2IHBA 3AGQA 5G41A 4JKYA 5HKKD 1GUAA 3DMDA 4PC7A 5IRCD 3ADCA 2FPKA 3I1FA 4TL9A 1NMZA 2RMKA 3SYNA 2ZUCA 4B2LA 3EX7C 2WJVA 2Q21A 1EX6A 1OH8A 5JS8A 4O0MA 4AYWA 4KBGA 2GILA 1MO6A 1OT3A 1E2DA 2DWPA 1HA3A 1Q12A 5HTKA 2D7DA 1E2EA 4LHYA 4BECA 2KJQA 1XB2A 2PLFA 1D5CA 2FZLA 2BWJA 3MSXA 1SVWA 1XXHE 1UBFA 4LJ9A 4XTCS 3AKEA 2RGCA 3BJIC 3K9LA 4HB2A 4PPFA 1FL9A 4QBGB 2ZROA 4V0OA 3RS5A 4JL6A 3Q72A 2I1VB 3LH5A 3U3JA 4OI1A 5KSYA 5JWOA 1GIAA 1U90A 2BBOA 4Z51A 4P4UA 3UMSA 3TAHA 1N6HA 1Z8FA 2AWOA 2KBEA 3GMTA 3SYKA 3P4XA 1NN5A 2HYIC 1H8HD 1S0UA 1ZIOA 1JAHA 4XD7D 4CZ2A 4EFNA 1BMFA 4Q9IA 3T15A 4KVGA 2WJJA 1XD8A 2VSXA 3BFXA 4KAXA 4UXHA 1G8GA 3K1JA 4DLVA 2UZ3A 3LY5A 4QGHA 5AJZA 4BFXA 3PIRA 3FOZA 5JSZA 4R98A 5DHFA 3ZQJA 2ATXA 4CEIA 4PC2A 2XGJA 2BJVA 1B0UA 4I1OA 5AJYA 5JLJA 1YKSA 4YMSA 1GNRA 4OQXA 1W44A 3FHOA 3W6PA 3U7GA 3A1TA 1KDTA 1XZPA 3OFNA 4BRWA 4Z1MA 4Z54A 4A6PA 1TU3A 4B3DA 2PJRA 4Q7LA 2PZGA 3WRXC 2GEDA 5F9FA 2IF0A 5CM9C 5K8LA 2WOJA 4GRAA 4HLQB 3OIWA 3DPUA 4LV6A 2W00A 1CS4C 1FNMA 1VG9B 3C16C 2QZ4A 3CPEA 4DWJA 2ZI5A 3T06B 1XTRA 3QVVA 1W36B 1ZP6A 3C15C 2XZLA 1Z6TA 1OYYA 1Q22A 1TL7C 4JBWA 4DBLC 1Z5ZA 3GLFE 2OM2A 3UANA 1E9EA 4Q00A 4B6EA 3FFAA 2LWIA 3B2EA 4PTLA 1JXMA 3N70A 4DCVA 4LPSA 4LV5B 3W8RA 4B2IA 2J46A 1KI4A 2ZE8A 3M6AA 1AS3A
chains in the Genus database with same CATH superfamily
5IVHA 1YIDA 2JGJA 1CYEA 3L3BA 1J06A 1M8FA 2C7VA 2PKRA 2JK1A 4XYGA 4X63A 4I8DA 2D7JA 3KQPA 4YR9A 2HU7A 2Z8ZA 3KDSE 2VJQA 5I7SA 1IHXA 2I6SA 1U3GA 1W2GA 1GJRA 4LY0A 1E4VA 1XMJA 3DP7A 1Z06A 1DXHA 4DLZA 4AKSA 2HI0A 4QNRA 4QYIB 5KJEA 3UIEA 1SGWA 2NO1A 3IR6A 3CVYA 3SAJA 5C8XA 2EFHB 1NY6A 2CXNA 1PS8A 2WIFA 4L5BA 4TSFA 2Q1SA 3MCWA 4FOSA 5LIPA 3HUFA 5SYMA 2Q4DA 4D0LB 1XLTA 1YC5A 4ZHQA 4ZRDA 3MMNA 3BWEA 5DSXA 2X8WA 4M76B 2P78A 2CUKA 2DUNA 3EQ2A 1WPRA 1ZISA 1NW3A 1KJYA 5K0EA 3PXAA 2I67A 4ACBA 4YRKA 3NETA 4RVDA 4AJHA 1V4NA 3WDKA 5BWBA 5CHYA 1W35A 1LSSA 2CCJA 1O6BA 1D4ZA 2GD0A 1LD3A 3JQ8B 4DDVA 4H4CA 3DOEA 4MCJA 2RB4A 3AHJA 4ITRC 1DEOA 2AOUB 4FYXA 3EG9A 1N2JA 2XTNA 4X1KA 5FX2A 2C0PA 1GFIA 1LDGA 1S8FA 2D5AA 4J16C 1DEAA 1TOAA 3HVJA 3SBDA 1QVAA 5EIAA 1QGUB 1WCIB 1WWKA 4J0KA 2HJRA 4B4VA 4D2IA 1F9AA 3HNOA 4ZI7F 5ADUS 1KJZA 5DI9A 1IH8A 4R3WA 1MW9X 3NTLA 2IYTA 2B4QA 3ANSA 1AHHA 3K92A 3OJEA 4I9FA 4IZ6A 4PHFA 4WFJA 4MMYB 3RHZA 2X1MA 2HFJA 2RHHA 3AIOA 3KAQA 1PFQA 3O21A 4IF4A 4HAUA 1QKKA 2ZRPA 5I7WA 1NF8A 1O54A 1XE3A 2XQGA 3RTGA 3FOEC 5D84A 2ZSDA 3UMFA 1E18A 2Q0HA 2AEJA 2VP4A 3JV7A 3TW6A 3WLFA 3I64A 2A0KA 2FGJA 4FJ1A 4BP9A 4IHAA 1J8YF 3O95A 5BWCA 1VE9A 1UBKS 1HLPA 2J09A 1DG1G 2P1DA 1M0EA 1CJVC 2FUKA 3DCYA 2I2DA 4RX1A 2C3PA 2W6JA 4JVNA 3U13A 2WKRA 2ZAOA 4YRGA 3H2SA 1KMMA 1RCFA 1XVIA 1U0RA 2PH7A 1QIGA 3CKLA 4S1NA 3KJGA 1RLOA 1UBRS 2G1AA 2WT8A 3FZGA 3E9DA 3UMRA 5FPKA 1VHLA 1DG3A 1WA5A 2H11A 3FZYA 2PRKA 4WFKA 2VUUA 1PGNA 1Y5NA 3OCYA 3RT9A 3RT7A 1X7YB 3OQ6A 1MC8A 3CX8A 3VSBA 4DJTA 1T5IA 2PPVA 5BVGA 1T2CA 2JLSA 1G16A 3LUPA 1BH2A 1FBNA 1LWOA 2WWGA 4NESA 3HCEA 3T7JA 3A6FA 1MIOB 1OF1A 2ZRIA 1YNSA 4N3GA 1U9IA 2WWIA 4IDEA 3T1QA 1XNGA 3KHSA 1V5FA 2H31A 1XRQA 4OHWA 5H3HA 4UD6A 4O8ZA 5CT4A 2LKCA 3UF0A 3ICQB 4Y9TA 2PS1A 4L27A 5FYDA 3QBVA 2H9IA 2QHXA 3TSWA 2CLSA 5E1OA 4HDRB 5HJ5A 3C6QA 1XRSB 3CXUA 3UGTA 1Z7EA 3L2OB 3AW8A 3IA7A 1X9GA 3H5OA 3NHAA 4XTRA 2F1IA 2VTBB 3NIFB 4DIUA 3GLRA 1EFVA 1MAHA 1NW6A 3KO8A 1Z5UA 4N4AA 1GKLA 4KR9A 3LZDA 3VR2D 3ZS9A 3IV7A 4I55F 1C1HA 1V6AA 4NBLA 4DKJA 4HDQB 2O8BB 2EBWA 4KYUA 2X8AA 2F3RA 4MKFA 3U1BA 3RC8A 3X1WA 3BWDD 4CM8B 1IQUA 3G7UA 3Q3VA 4LFCB 2V6MA 1EUZA 4QPZA 4ARZA 3PI7A 2H4ZA 3OZTA 1JI3A 2RH8A 3VYTB 4CUJA 2ZCJA 3FVQA 2O7RA 4JSRA 5KSWB 4JLPA 1TI7A 1CJBA 1JIIA 4RJKA 2IOHA 1N33B 2GJ4A 4KLCA 4RXUA 1NVAA 5F2OA 1Y89A 3NNNA 3PHBE 4A1OA 1BRTA 4YGXB 5JVDA 3I04A 4AF8A 3JZAA 3FDIA 1ZGHA 2CNOA 2P5UA 3JD2A 4G0XA 1SZJG 1PIWA 4WZBA 1JAXA 5KYYB 5A62A 2ZUSA 1WUJS 3U0VA 1VIMA 5AM2A 1VKNA 4EGQA 3RIEA 3PEEA 2IS2A 4RSMA 4MWOA 3LYLA 1XZMA 3K8QA 3WHPA 1XC7A 4DLYA 4JLJA 2RARA 3U6KA 5K2OA 1HKHA 1RXIA 4F3TA 1PX0A 5EWMB 3M6LA 3CZCA 1BEZA 2AJLI 4DAOA 3HKEB 4CM3A 2EQAA 4DY4A 2EZUA 3OKCA 1XDUA 1P0QA 5B53A 2XSZD 1RMQA 2BFBB 3QIAA 3DXFA 5T8KA 2GSWA 2OO5A 1V1MB 2O1WA 1O4VA 3T3MB 3IIJA 4HLCA 1C0KA 2VJCA 1OJLA 3ISTA 3U16A 4Y8VA 3G7NA 3L5OA 3GF4A 2NLOA 3KQSA 3W4KA 2BTQA 1QIKA 2W6MA 3BXEA 3KEQA 3MUFA 3ZLUA 4B73A 3VH3A 5JADA 2D00A 2H1RA 2EP8A 4NQRA 4X66B 4O4JB 3E8SA 3JQ6A 3S2ZA 4LMPA 4YRNA 3B2QA 3NYWA 1TAGA 4NK5A 4B7ZA 4LZLA 2PXHA 4TRNA 1NXTA 1R6BX 2WAXA 4P53A 5FA5A 2Q9CA 4PIVA 3L0ZA 1IOVA 5I51A 3GZ4A 2QTFA 1GL9B 1IDN1 1JDSA 1Y5LA 3ICEA 4PWYA 1RQGA 3B6MA 3DLCA 2ZIVB 2FMFA 3NBQA 4R6WA 4LDZA 1XK6A 1S4QA 4RJ2A 4OK6A 4EG8A 3ONVA 1ULSA 2AUTA 2DPXA 2KQUA 2WILA 2ZOSA 3QHQA 3C7KA 5AOBA 2NNWB 3SX2A 5I4KA 3AP1A 4RMHA 1A77A 1S8OA 3BGWA 4FVTA 3G7SA 4S1VA 5B3KA 3UJAA 3ZV5A 4QVIA 3KZMA 3EH2A 3AUXA 5C53B 1WW2A 3OOSA 1AXEA 3ZCRA 5EHNA 4MWSA 4DSTA 2RJ3A 2W2TA 3KD2A 3VZRA 4DM7A 4R8LA 2MJLA 4GX1A 3AEZA 2X4LA 4COOA 2J1LA 2KE5A 4J8PA 2XA2A 3CISA 3ME5A 4F56A 1UMCB 3MM4A 4OFBA 4JKOA 4P4TA 1ZYUA 3KYDB 4UCWA 1LPBB 4X93A 3RQIA 3WGLA 5HUJA 3MTEA 1CKEA 1MRNA 2VP3A 4CG3A 1G6OA 3BXOA 3VYVA 2V7WA 5EIBD 3VMMA 2FPWA 3R6LA 5FBQB 2O3UA 3FGOA 4MVYA 2WA1A 4POOA 5AW1A 5IAGA 5LMUB 1O8CA 3K20A 3FN4A 2BHRA 2ZAMA 3AF4A 2XB4A 1XZHA 4EUKA 3HRHA 1TK9A 3K1AA 4JJFA 1DQPA 3JSAA 3E2PA 1UPBA 4KR0A 3B9BA 1C30A 1FW8A 4RMJA 3LVQE 2HPZA 2BYTA 3AI1A 4EVIA 3N7TA 4KZKA 1JEAA 1H3EA 5GJVC 1A9RA 1JHYA 3LXUX 1SU8A 4IIYA 4PXAA 3ZLTA 4HBGA 2A59A 2YVKA 2HYDA 4R2XA 3HDHA 2HB6A 3P4UA 3KVOA 1F51E 1CUAA 4KPFC 3RO7A 1SN7A 3GUUA 3DL7A 3W9SA 1RWXA 1L4KA 2XRFA 4EW1A 4M21A 3D8SA 4QUJA 3WB1A 4IXTA 3AR4A 1RJFA 1FFHA 3FJYA 2CD9A 4FNGA 3PXCX 3UQZA 2PRZA 4O25A 3NTQA 5JJLA 3AF1A 5E2AA 5SY9A 2BFEA 3FPLA 1L4FA 4YAWA 5DBOA 3U80A 4B6JA 3CJQA 2OY0A 4BGDA 2I7TA 2I6QA 2OZLB 3LY8A 4OQQA 4K26A 3RODA 4HC4A 2HWUA 4QO7A 1BS2A 3S1SA 4L57A 1DEHA 4GOKA 4J0DA 5JDIA 3HO1A 3ROZA 2GLTA 1ZZGA 3P2IA 3BXFA 1JGTA 1PQ4A 4FBGA 5BR8B 1K5DA 1Y1SA 4MGEA 3IEVA 4OLJA 5AJVB 1PBTA 2YWCA 5EIWA 5FP0A 4EM6A 4YECA 3BE4A 3ONWA 3QX9A 4JLOA 1Z25A 4XWGA 5JWHA 3MLEA 4JBYA 1X2EA 4W63A 3WP1B 4DR3B 1JPUA 2M6RA 4RY0A 1HNNA 5IDYA 3FJ1A 3OU7A 1JEDA 1FDVA 3B89A 4MGIR 2Z3ZA 3A04A 4LOLA 5E2IA 3S5UA 3UWPA 1OUMA 4RDHA 2UVDA 4UHHA 4H4DA 3V1TC 2Y67A 3OE1A 4BB0A 1NUSA 2O0KA 3HPQA 1Y3AA 1AF7A 1K6MA 5BYJA 2BFFA 4MYDA 2HW8A 2LBPA 4ARVA 2DETA 2HUPA 3WAKA 1ABBA 2ZJ5A 4ARBA 3U5TA 4BZPA 1YO6A 4Q12A 2G63A 1CQIB 4ZVPA 3D1VA 4DQVA 4F3RA 1UK7A 4Z1MD 5JU6A 4BRZA 2CVHA 3HK2A 2AOTB 3PXUA 1ZNZA 2OP0A 4NBTA 2W2LA 1DZIA 5FPPA 2PX3A 1LXCA 1DUIA 1U3WA 3ZJVA 4QG7A 2BRUA 1RCTE 2P6MA 1IUNA 1Z39A 1ODSA 2L0XA 3KVNA 3HYTA 3OWOA 3OJOA 4XSHA 1GNLA 1JEOA 1G5FA 5D6OA 4MP6A 1PWYE 1A5ZA 1R7RA 2CBZA 2EJTA 2B9EA 4BEVA 4C7BA 1M1YA 4L0DA 4JR2A 2FEXA 3RH0A 3GJ4A 1UQUA 1U63A 4TT3A 5FBWB 1DDOA 2AZDA 5JAMA 3WZMA 1ZICA 3NHJA 2WQ7A 2QD3A 3ZTYA 1AHNA 2GPJA 2QSUA 3DKVA 1GNQA 3HCAA 1P0PA 4M1KA 3Q7IA 4BO8A 2VNSA 5LXTB 1QIDA 3B3GA 1YRLA 4ZODA 4A1FA 1RI2A 1K2WA 1YQEA 3EWIA 3L7BA 3JS5A 4RMGA 3C45A 4OQPA 2Y05A 4H6WA 5L51A 2ZWPA 3TOCA 2TMDA 4DL9A 1E96A 1BQ4A 1V11A 1GKKA 3X2SA 4M1YA 3ZD8A 3ONFA 2AFHB 4ZO8A 4XM0A 1NC1A 4LGMA 2JW5A 1U81A 4G84A 2E37A 1UPTA 3GNLA 3SLKA 3VYWA 2X0JA 4OLFA 4XCQA 4KOEC 4KMOA 4F9EA 4UPDA 5JXJA 3DVRX 4B4WA 5DHUA 1M34E 1YR9A 2CN1A 4AVYA 4UM9B 3FE2A 1H9BA 3AEQB 4EMUA 4QJBA 3A3YA 3OPQA 1KSHA 4GRDA 4GT1A 3FPAA 2JJQA 2O5VA 3OUUA 4KH0A 4QDOA 1SOVA 2DSNA 2PX5A 4MNTA 3DEAA 1J8FA 4PLFA 1XFAA 2PS3A 3KKEA 3SBEA 1CDEA 1EXNA 5KUTA 5HFNA 4H1UA 1IY0A 4I3FA 1RC1A 2QTLA 1KO4A 5NULA 5KTRA 2B8TA 3DWGA 2ET6A 2BUCA 4X24A 1UBMS 1SHTX 4DIKA 4RL4A 1OH7A 1DC6A 2PJDA 1TC2A 2QUJA 4RCZA 3P2MA 4IBOA 1QCZA 4G6ZA 4IXMA 3ANXA 1YCHA 2WF7A 3QE0A 3WJAA 2B37A 1QNLA 5AXBA 3LKZA 1OU0A 4U9IS 5CT5A 3KUKA 4W7HA 1Z13A 4P84A 4B48A 1M2HA 2ORWA 2XKKA 2O3TA 1QHHA 3HA2A 4MKIA 3A1SA 4U7PB 1NN0A 2PNFA 5HIAA 2C3MA 5A3SA 3KOMA 2AE1A 4G8JA 3R7WA 4BE9A 2I7XA 1LSUA 1VYUA 1YC2A 4PW0A 2RHMA 5EC8A 1KJQA 2ATCA 5FOXA 1P3Y1 1T2AA 4KK3A 2IBTA 3FRJA 3NFYA 5CA0B 3CBQA 4PAOA 5D86A 1NPTO 1R0CA 3AYZB 4BB6A 3STHA 2A5GA 1G4AE 3RSCA 3SQXA 3GJTA 2CFCA 4I5EA 4U2CA 2JC3A 1DC5A 1M1NB 2CCKA 4F6RB 1HDRA 1IPFA 1Y5IA 1K75A 2QYTA 4AMUA 5M2QA 5C34B 3GVIA 4C14A 2J3QA 2XKJE 2VTEA 2R85A 3BXXA 4PG6A 1XZDA 1JWAB 4I3HA 3PC4A 4UQPA 4JJIA 5BN5A 3NKFA 5JSKA 3U4HA 4EYKA 5CLFA 5AW7A 2A0FA 1U28A 3OX2A 1NJ2A 3ELDA 1H93A 2HSDA 4LMBA 3GN1A 3DUFB 2NYRA 5TQJA 3CY6A 3KYIB 5KX5F 3WB9A 1BGVA 1MIHA 1BTOA 1NIPA 1ZCFA 1KERA 1MJGA 1T9KA 2FPPA 2R6R1 5K3AA 3RU9A 1IWBB 2ZRQA 1W9HA 2DCMA 2VTVA 3DEFA 1U8EA 3FTQA 3SFVA 3WMRA 4TX1A 1PGQA 5A4KA 3H17A 1VL2A 3QYPA 5JTTA 1OSNA 1RQXA 2GHTA 4UARA 3G68A 1T0UA 2GN6A 5HCUA 5HJEA 2GEKA 4NU5A 4RZQA 4UE2A 4C4PA 1MX9A 1XZLA 2IF2A 4MV0A 4ZO6A 4NF2A 2QL5A 2FW1A 2XQVA 3COZA 3V32A 3KOUA 1XMVA 1E9DA 3WQSB 3HO8A 2VDKB 2F00A 1Z0UA 2L17A 4ZKEA 3FUXA 4IFBA 2L18A 4BLUA 1F1JA 1CRLA 2BH9A 2CWDA 5FQOA 1OAOA 2O8EB 5TGZA 1OH5A 4JYBA 4PAGA 1Q1NA 4J6EA 1TUEA 4BX8A 4ZALA 5F21A 4EVQA 1MGPA 4ZZIA 4N3AA 4YPOA 1RRPA 2BFPA 1SCDA 1O95C 3B9RA 1KRHA 3IOCA 3IALA 3CZQA 1O6FA 2WNSA 1SXQA 1WB4A 3FWHA 2VT2A 4DXAA 2PK3A 5EWLB 1A0OA 2XCLA 4ARAA 1AKRA 5FA6A 3NOQA 2VT7A 2X0KA 3ADPA 3W79A 4GW3A 1AKWA 3B5IA 3HB5X 3I53A 3ZY3A 1ZSNA 3TPFA 4UEOA 5IJ0B 1K3TA 4GO1A 5JXGA 3SHTA 1JG3A 2CSUA 4RUKA 1KDOA 1Z3IX 1XZBA 2FW0A 3RAPR 1OOEA 1TJ3A 2H2AA 4HPWA 5J2UF 5FJJA 1KAHA 1RYMA 5IWCA 2NXJA 2Q7DA 2QA5A 1X8KA 3DD5A 3OPYI 1FSPA 1JU3A 1RPZA 5ALJA 3PD1A 2DWOA 2WYUA 1SHKA 4ZC8A 4PZPA 2ZQ5A 4X54A 5F7JA 4DIEA 1XZJA 4CM7A 1HC7A 1HE3A 2UZAA 3RF7A 3N2GB 1E3QA 3TLGA 5LBIA 4JT4A 1XX6A 2XHEA 2Q6OA 2RKBA 4P0TA 4TTAA 3WL4A 2GJKA 1E1QA 1ZITA 1YCGA 3ROPA 3ZGXA 1V3TA 4YRSA 4YRZA 1T9CA 1AS0A 3TX2A 4KSYA 4D42A 1INLA 3GDHA 1JMVA 4B6FA 1OI2A 4F6CA 4BQFA 1MPXA 5B6IA 1JG4A 3STXA 4WN9A 1EX7A 1GGEA 3EMBA 5FAKA 1FX0A 1D07A 3ODPA 5IJXA 1B1AA 1DNPA 3O8OA 3CPSA 4QUKA 3MD0A 3V2GA 5BXYA 5DNVA 4ZV9A 5L45A 5KVAA 1DCKA 2RI6A 2NN3C 2O8CB 1SPBS 1W52X 2BDEA 1XJQA 3PT9A 3QKWA 5GGYA 4BLOA 2P6UA 1NE7A 4ECAA 2WM3A 3S7TA 4D0GA 4BU0A 4NEGA 1KH2A 4KWEA 4U6QA 1GPMA 2BVNA 2IBSA 3JARA 5J23A 1NAHA 4KO8A 4TTSA 1QC5A 2Y68A 3IUEA 4MW2A 1PWZA 1TM4E 5KMGA 1ZJZA 3WWYA 4XSGA 4QNNA 3OC0A 3FTFA 1WKBA 1IM8A 1ZRMA 3PHJA 3EVBA 1IY2A 1V1RA 1IE3A 4I9UA 3SJAA 2QRKA 3PTZA 5EJMA 1KDRA 1FUIA 5JXIA 3SJBA 5BWNA 3ELUA 4FP9A 4BNUA 4A0QA 1YUBA 5EJ9A 4BDTA 3HNPA 5CCBA 1W6UA 2DSTA 3U4GA 4BP1A 1E5QA 2JJ1A 2UZ0A 1V8OA 2DPYA 1G3UA 1SB9A 3DFMA 4MYSA 1RYNA 4F3NA 2C99A 1ZN2A 4KWCA 4H16A 1A1SA 1DJOA 2QX4A 1FRZA 4A7PA 2PCJA 4U7FA 2PV0A 2ENWA 4TUYA 2C5LA 1FW6A 1G55A 1NBAA 1OVGA 2Q2NA 3COPA 4MJXA 5PNTA 1T3LA 4GKVA 1FRNA 5FL3A 3ETJA 5DMXA 5TQ0B 5F7OA 2ZJ6A 1FRVA 3D8HA 2UZIR 3L8GA 3MWFA 4KN8A 4MVJI 4WA8A 1E94E 5J4VA 3ADOA 1T4CB 4I50A 1M83A 4NJMA 3MMPA 5A7HA 1RAGA 1U4OA 3ADKA 4I3GA 3E9QA 4B4KA 1YZHA 5T4HA 2QF7A 1NVMB 2OGTA 3B78A 4FMCB 5EPEA 3VYSB 3NOXA 2HHCA 4PYNA 1GYPA 3AI7A 5CK5A 1DJMA 2RC5A 1KP3A 2XT6A 2XWPA 3ECCA 3NKVA 3OHMA 4NE7A 4OMCA 4YNBA 3WLNA 5EJ6A 1IXYA 2YOGA 4EPTA 3B1KA 1N6IA 1DQZA 4RXMA 3IVCA 1RC0A 4Z4FA 2YVAA 4QFCA 3VDMA 3QWHA 3T35A 4J7AA 3U1VA 3V4OA 1KORA 3RUDA 2QPOA 1K98A 2CGEA 3TBFA 1EFPB 1H0KA 1P7CA 1U2ZA 2IT1A 2X0NA 1HK7A 3H4TA 1G5PA 3S99A 5L3VA 3MTGA 1I3CA 4GOOD 1RYDA 4UCFA 1PL0A 2OFXA 5LWHA 3JZMA 4TS1A 2F3QA 3OURA 1FMTA 3ITEA 3TLCA 4R1OA 1L2TA 3NIDB 4FYHA 5DW0A 2GD1O 4Q4AB 2WF5A 5I9BA 1A98A 4QGAA 2PX0A 2Q6VA 3OIVA 3LVBA 4GI1A 3RV3A 1KHHA 4DMMA 2JIRA 1O5IA 2X5NA 4PFJA 4TYPA 5IYZA 3V9PA 1KI2A 2FPIB 4C30A 1NRIA 4RXTA 2HGZA 4WCFB 4CQMB 4RA9A 4R8MA 4B6RA 1VJRA 5B58T 3CLRD 1W46A 3UHJA 5A3JA 1HLGA 4I81A 4R1SA 4FOOA 1IB0A 4ZAVA 2YWBA 4G24A 2AQIA 4C4XA 4B6SA 3O9VA 4RTKA 4PIMA 2QX9A 1H5QA 1VCOA 3GRYA 4EEXA 1W1IA 2VH5R 1TMYA 3H2HA 5HHTA 1LQTA 3AETA 1ZMXA 3KOWA 1KPHA 1P75A 3LBNA 3P5BA 2EBHX 1U6IA 1AHPA 1M3SA 3U4IA 4O4HB 4EABA 3TZCA 2G3YA 3R8CA 4ZI3A 3CW2A 3VNBA 2WSMA 4U7WA 4XDGA 3REQA 3UC5A 1NQOA 1M75A 1OGYA 3NC4A 5EMLA 4DEXA 4EKIA 5BR7A 3G2MA 4Y2JA 3LP6A 2CY0A 1FTNA 4JP5A 5HE8A 5SICE 1B14A 4IX1A 1X94A 2ZK7A 2ZT6A 3WBFA 2HNKA 2ZYHA 1HSZA 4AD8A 5HUHA 4C21A 1CEXA 4IF6A 1C81A 3HEBA 4P5DA 4QOJA 3PV0A 4OHVA 3FM9A 1ORTA 3ZHZA 4XVQA 2AC7A 1P5ZB 1Z4QA 2EW8A 2XUKA 3QMPA 3SBXA 5LDHA 1YBMA 2WAMA 4JB3A 2RK4A 4LHEA 1YQUA 3R7FA 2DERA 4XH9B 4EBBA 2AMFA 1A7UA 1GTJ1 1TRKA 3BMNA 3H1EA 3I1JA 3S1AA 4A8JB 1H2YA 4RV5A 5P8WA 5DNYB 2JGKA 3OX4A 1A9YA 1T25A 3TKLA 4EUSA 4RTQA 3QVGB 4RC9A 1F20A 4OMFG 1FDRA 1LLCA 3IS3A 3V3KA 3NAQA 1PD1A 2WDZA 2INGX 4OL9A 4BNKA 2GBGA 2ES4A 1EM6A 1EQ2A 2UV8A 2GYWA 5ALHA 1O77A 1DS6A 2QUAA 1Q1ZA 2F8LA 2W6CX 5CR9A 5FTLA 3PR1A 1TU0A 4P38A 1K92A 2DE0X 2OK7A 1RJGA 1YZQA 3ZE6A 1MOSA 2JGNA 1KS9A 2ACWA 3QBDA 3NG1A 1T6BY 2CJWA 4LXXA 4E2WA 2NTVA 2EHDA 2O2GA 1ZA2A 4XRGA 4AKHA 2FK7A 5CT9A 3JQ9A 1MB9A 2ZAIA 2H2FA 3BMQB 1ZM9A 3IP7A 3R1IA 5HCNA 3C8DA 1KKMA 1QDUA 4ACAA 1NF9A 1MZPA 3N2NA 1HE8B 1UPFA 3ICCA 4GBJA 2X76A 5G0WA 3QWAA 1QTNA 3U9TA 4J7UA 4IOMA 4ZDJA 1SA0A 1YL7A 4I9HA 2IV3A 2NVUA 5K8TA 1X1TA 2WFAA 3QPBA 3L18A 3C7AA 3GNQA 1BQEA 1H1LB 5KOYA 4YHHB 2R11A 4HMQA 3M3PA 4R1UA 4G0UA 3BWVA 2M6SA 4AUKA 1F0KA 4FQ8A 1P77A 1WQ1R 2UYHA 2VPTA 4ZT3A 2GTHA 1XSEA 4IJVA 1RE0A 3AHEA 3JALB 4TLBA 5CTAA 5ABPA 3PENA 1NXVA 1G98A 1R6DA 2VPPA 1YMUA 2VP0A 2YFQA 3FMGA 4LYJA 5COBA 5CXXA 1MXHA 5KYWA 3KV1A 2G5GX 5DTJA 4D9CA 1JQDA 1LVUA 1UKBA 4LKOA 1J7KA 2NQTA 2OV4A 3K53A 4O2AF 5I4BA 1X2BA 2ZKLA 4MS3B 4JVSB 2AXNA 1BZYA 4FD2A 1B0AA 2P27A 3CZPA 3SZRA 1MA0A 1WUTA 2QTTA 1OA0A 2D74A 2OE2A 4UKDA 4DWOA 1E6KA 1DOHA 2IYZA 3BWXA 3CG0A 1JLHA 3LLCA 2OO7A 4M99A 2HSWA 4MIYA 2FN9A 2RBGA 4ZEXA 5JT1A 1RWMA 3TRDA 1UOQA 3JR7A 2ODTX 4YRMA 1Z4NA 4OSEA 2GS9A 4NX2A 4R1NA 2JKVA 3EMDA 1ANKA 1UMDA 1FSGA 3PZRA 3QY0A 3BM5A 1T1IA 3GEGA 4WUTA 2QTMA 5T57A 5H3LA 5EQDA 1D0VA 2GNAA 4IH4A 5DGXA 3U4AA 2BGNA 5BMVB 1JB1A 5KCMA 1WB6A 1OIVA 4HNQA 4UMDA 1C1XB 3TR5A 1Y33E 4CI9A 3HJUA 5EE5B 2I33A 2VBCA 3SJ7A 3FNRA 4A27A 4Y2SA 1Y3FE 2WMDA 4QXAA 3B2NA 3VPHA 3HB0A 6YASA 5EJ2A 1MVLA 3WK6A 4EQ6A 4ZICA 2PH1A 2SCUB 3OCZA 1BDHA 1I6LA 2IXTA 1J2JA 2VA8A 4ZVOA 1CU1A 1NSYA 4BKMA 4PRZA 4W5RA 4R71A 4RV4A 2QU8A 4E7OA 1ISHA 4FMDF 2Z8YM 1YR2A 4YS6A 4AG5A 4YAOA 4HTAA 5C1OA 4AY5A 1Z2NX 1KZ4A 1R1DA 1U9ZA 2G06A 2HD4A 1E1CA 4EB6B 3INTA 1QIEA 1WIWA 1WNTA 1V39A 3CIFA 3LYAA 4FD3A 2C7PA 3UWSA 2JZOA 4RANA 1WXGA 5BQ5A 1QK3A 5K3SA 3RVKA 1JKJB 1N8NA 4EPWA 3G88A 1SCQA 2FWPA 3CF4G 1JHMA 3LUCA 4RQBA 1V7PC 5DDIP 4ZQIA 1P62B 3D43A 4LJ6A 4Q15A 1Z8DA 1VMIA 1XO1A 4Y30A 2DU8A 4UMFA 2M1ZA 3NKLA 1ZKDA 2ORVA 4WXPA 3DL0A 1EAYA 1JIKA 1GLVA 1NF2A 2FSIA 2WV9A 3E4DA 3JVUA 4KTTE 5DBGA 4I1YA 1LW6E 3LPCA 3X1ZA 2VDMB 2ZRFA 1NNUA 3P96A 5TSDA 4PGMA 4LX8A 5AK3A 5C8YF 1A4IA 5EG5A 2BF7A 3V8PA 3ANMA 3DAYA 4GBMA 2OKCA 4OY3A 4EA8A 3S8YA 1ESMA 1Y9EA 1QQ5A 2ZRLA 1EI9A 1GSAA 1PWXA 3FNEA 4TRMA 2QNIA 1XVLA 1TUBA 1NVKA 1TZMA 3COVA 3H5LA 3A9CA 1DIRA 4NBSA 4M54A 3VU8A 2FOIA 1U2GA 4G1MB 2P90A 1M6WA 4IFIA 2GCIA 4EG3A 2B1QA 1WZIA 5MDHA 1EXWA 2ERYA 2WU8A 2A7QA 1A8QA 3QU5A 4G8DA 2BEKA 4D3XA 1IOLA 5K8VA 1V9CA 4RS3A 3BT7A 1XDGA 3F6BX 2O05A 1YR7A 1QMGA 2I4OA 1FRFS 4WNCA 3RSHA 3S55A 3T94A 3ESRA 3W2EA 1ULTA 2W8ZA 2ZSFA 5CRIA 5BNFA 1WTCA 2JLRA 1VBFA 3FYSA 4HAIA 4PNZA 4QIHA 4EW3A 1UJ4A 1KYIA 1ZW1A 5IAJA 3K15A 5KWIA 3SQDA 2CSXA 2HH9A 2X8BA 5I3CA 3M8KA 4ZOEA 4UBKA 4UEQA 1N5JA 4XB2A 5L7WA 2ZFUA 4L75A 1OW3B 4EPXA 1FC0A 3TMYA 4QDTA 3JXEA 3P0EA 1X8LA 2YHSA 4RYDA 1J2RA 3B20A 1ZM2A 3O5AA 3SC3A 5CEEA 3R8FA 2A9FA 3D6HA 3QPVA 5AHOA 3R0QA 2NMVA 1FEZA 3OFSA 3QKIA 4H1TA 4IXNA 2VJOA 5CT6A 4K03A 1TFRA 3SDZA 3KE8A 1B26A 1FQKA 2X86A 3WKBA 4AZ3B 4DDKA 1CIJA 3T7IA 6NULA 1H65A 3F9CA 3QKSB 2JHPA 1PGOA 1R6AA 3RVNA 1F5SA 1GQSA 4UTNA 4ZARA 4Y67A 3RFXA 1R18A 1SUIA 2Z9BA 5CVEA 4LNUA 4GE3A 2PKXA 5B1HA 4Z7JA 5AW4A 3CZ5A 4IAOA 3FNBA 1RIIA 3TR0A 5FOQA 2GUGA 4RO0A 1UP4A 3N0XA 3I30X 4KE7A 3OZFA 1YJCA 1T8YA 1RKBA 1DRUA 2NTYC 1L7OA 3RFTA 4NVRA 5M5BA 1EVYA 4MV1A 2QLNA 4H6VA 2J0VA 4DR5B 4KRYA 4MPDA 3DAHA 4I5IA 3GR6A 3A10A 1XRRA 5JFTA 1K86A 5ADHA 1LVGA 3DE7X 3EE6A 1ZWLA 3CLTC 4TSKA 5FFNA 2FETA 2PMKA 2X3FA 3TIFA 1NHWA 1YZVA 1D04A 4DABA 3PWTA 2ZYIA 1PHPA 1QKJA 4PBSA 4Z86A 2BFDB 2FSFA 4XW2A 4Y1RA 3TMKA 1PNRA 4IIJA 3AM1A 4AKIA 1AHIA 1N57A 4GC9A 4AIRA 4DR2B 3HY6A 5CBPB 1R8JA 3WQRA 3HU1A 1OX6A 3HP4A 3M2TA 3MAAC 3H2YA 5F2NA 1Z3CA 2P3OA 1J8VA 3R3WA 3BWBA 4G4SP 4TM8A 3WNCA 3KQWA 1I14A 3UN1A 3ZQKA 2ARKA 3C1AA 4X20A 1P33A 4FOTA 4CKBB 1BHJA 3WGKA 3PNLA 3EQZA 4M8KA 3CLKA 4RGQA 3RWBA 1NVVR 2DVMA 2OAEA 2JLZA 1PVOA 3TB6A 1T9GS 3D6AA 1ZO8A 2QMQA 3FWYA 2RKWA 1V43A 3PDIB 3Q3IA 1W0JA 3NWEA 2D3WA 1X74A 2FPLA 4W9NC 4EVSA 1ML4A 1ZWKA 1EGQA 3D4LA 4RF5A 4XUEA 2WYWA 1J9EA 2DF8A 1AD2A 1KI3A 4ND4A 4CQNA 3M4XA 1G19A 2QN6A 1ACJA 4OGFA 1R15A 3LLUA 4E7PA 3HVUA 3NYQA 4UDNA 2K7ZA 5BRJA 2NV2B 4MV4A 2A1UB 3PNPA 5KNCD 3T0GA 4D8WA 4JOQA 2VCHA 1LFDB 4ZOBA 1X9IA 3DV2A 3ILHA 4BWYA 1BX0A 2WZDA 1S7CA 4UATA 3UA3A 3V97A 5IG2A 2I9KA 5TB5A 1KZ9A 3EFBA 3DMNA 1GZVA 1D4OA 3D8UA 5HJ7A 1BYIA 1JZSA 1GA6A 1XHFA 3CO0S 3L77A 3W5CA 4FEAA 1N78A 2HV8A 4KV7A 4HGYA 3FMIA 4WSOA 2CUTA 2I55A 4MWCA 4D80A 3GJ6A 3M70A 3WB2A 3Q3GE 3BRWA 1Z0SA 3FSRA 1F5NA 1SHLA 2BAGA 4GOXA 4PAMA 2ADOA 4C0LA 2CFTA 3JVEA 1ZNQO 4ZI7A 3IMGA 721PA 2XNKA 1ITZA 3DYBA 2MSEB 4RTNA 1HE2A 4YR7A 1NU8A 1L5QA 2NNLD 3GPDG 2C9CA 4EGSA 2B20A 2R5FA 3L6EA 4US1R 1X1RA 1DWQA 4PHCA 3BICA 4Q3DA 3CW8X 5IWAB 2R7LA 2X2PA 3EGEA 1M2FA 3V3TA 1WTAA 3DE0X 1E6LA 1VHJA 2HBRA 3L01A 4X1IA 4E0BA 4MS4A 3CZMA 1OBFO 2WA2A 2QMZA 4FMBB 4FI3F 1F4VA 3HDGA 4V0MA 3RIXA 3ESYA 3CJTA 1F2UB 2OLJA 3CH7A 3GDFA 3SBOA 4I4LA 5EJFA 4Q66C 1L7AA 1Q3TA 3FCAA 3P9SA 4EJ6A 1JG2A 1QCYA 2RHJA 2DFNA 3BSYA 5LYJB 2XWBF 3K31A 3K70B 1VA5A 4JHXA 2GESA 1BXGB 4LTMA 5EGNA 4ZJUA 2CXRA 1O0SA 2F3UA 2QT1A 1JEEA 1WDMA 1CIVA 3N3BC 4LY6A 4OUKX 4MVJP 2X5KO 2X14A 3IPAA 2HLDA 1X1EA 3QSGA 1R0WA 4NI5A 5HRAA 4GM1A 1P18A 1E9FA 1YB5A 5FOTA 2V97A 4XX1A 4YT8A 3ZWCA 1ZK1A 3VDQA 5BYAA 2ONZA 5KYKA 4GQBA 1F8YA 4DNXA 3IAEA 1K8QA 4EITA 5G2OA 2IJGX 3CN7A 1WCWA 3IE0A 5K0CA 4OLBA 4OQFA 3IHWA 4FWIB 2M2IA 3SIPA 2GF9A 3CF6R 3MWEB 4NABA 3WZLA 2PGOA 5L8VA 4OLAA 3CRRA 5CB8A 2AN3A 1S02A 4CR8A 2V65A 3G5LA 4MS1A 4R3NA 4B3JA 4YMTA 4QKQA 1ZHOA 2Z5GA 5IDQA 1B3BA 4MARA 4DCGA 2F4VB 2G28A 4YMWA 2C77A 4BCDA 3SKYA 4JHLA 1MAUA 1Q6YA 3UEOA 3LT2A 1UDCA 3R9IA 4EZEA 4JJEA 1R00A 4HDSA 4YRJA 2AQHA 3GEIA 3KL2A 3MWKA 2LV8A 5KVVA 5BVGB 3H7IA 1E1RA 2WU3A 4AB1A 1VLZA 4DRYA 2HN9A 4MV6A 5DOVA 1WPXA 4OHZA 2F17A 1OC4A 1K6JA 4L76A 1K89A 4Y2YA 2OXFA 5FHQA 5HXAA 2I03A 1TEXA 5LLTA 2EKZA 2J0UB 4X61A 2FWAA 3KYCB 1A69A 1MHPA 3UK7A 3Q2KA 5JCPA 2ZJBA 4P82A 2GN2A 2O2YA 1VE3A 3VISA 1RMYA 3GT4A 2P9FA 1WW8A 4DILA 4EI7A 3A05A 1XG5A 1ZOSA 3MRXA 3OMLA 3VPDA 4WT7A 1PV4A 4HYQA 4YBZA 2H9YA 2XVZA 1I4EB 2C5HA 4EGFA 3QUBA 5IVKA 2QNRA 1Z38A 1GPLA 2BMEA 3JQEA 3MYRA 3ETGA 1TLLA 1V25A 2I3ZA 1WZUA 4JC8A 3EEOA 3IH5A 2WYOA 2WVGA 1QYIA 3GLHB 5GAJA 3O7WA 3RSOA 3VZCA 4C87A 2R6HA 3RNLA 3BJMA 4DPLA 3TZHA 3C3CA 2ZRDA 3Q4GA 2E18A 4C5BA 5KTMA 1S89A 2BHTA 4E2ZA 1G8HA 4CQMD 2NPFA 2G5TA 4FHEA 5KOJA 4G1BA 4QHYA 2O4CA 2QP9X 3UG7A 1TMOA 4DIOA 4BZZA 1XWWA 1L7MA 4CV1A 4NCNA 2H4WA 3B6IA 3CVWA 2MSLA 3L8ZA