3KQHA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 142
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqhA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA01
4P4UA 5K8TA 2OCYC 3EWAA 3CIOA 3UIEA 5JRZA 1T9HA 3NHBA 4OYHA 5JJLA 3GP8A 2F3TA 2ZRNA 2ODBA 2B21A 4H1UA 1XTKA 4NU0A 4MDFA 4KVAA 2CNWD 4HEJA 3WYGA 2ZYWX 1Z0KA 2JEOA 1KI7A 2BJVA 3CRQA 3CWZA 4TT3D 4EFNA 5J4YA 2ZRJA 1XWIA 4HB2A 3VR6A 4AG6A 4GMXA 4Q01A 3FKSD 1NVVQ 3RDPA 2WWXA 1M7HA 2C9CA 1SQ5A 5IF9A 1OHHD 1G18A 2YZ2A 1SGWA 1DPFA 4HATA 3HR8A 5C2JB 3L0PA 1WRBA 1JR6A 3IQWA 4TYYA 1NN5A 4BFWA 3VR2A 1IN4A 1E9BA 2AWNA 3N2EA 4OI1A 3PENA 2QTVB 1OB2A 4V0MA 4BASA 1NNEA 3F8TA 2RGAA 1OXTA 4DCNA 5ANRB 2O0JA 2C95A 2CDNA 2GJAA 3KFVA 2J41A 2OFWA 1E2NA 4V0LA 4XTRA 3CX6A 1X8KA 1W36C 3KQUA 2DFKB 1TQ4A 3RS3A 3JVUA 4NP6A 1T4GA 2ZJBA 1QBKC 1L2TA 1NBMD 3KTAA 2FSHA 1BYUA 2D2EA 2OAP1 1MR3F 2FN4A 4MYTA 4FMCB 1QHGA 1R8QA 4YONB 4G5QA 1OH8A 4AKEA 3TLXA 3CB4A 2XAUA 3HYRA 4W5JA 4ABYA 1AZSC 1E1QA 1JXOA 2FE4A 1Z08A 2KE5A 4L8GA 5E4FA 2VP0A 1G64A 2ZEJA 3I62A 1U0JA 2ZRBA 2QMEA 2WWYA 1COWA 2ANCA 1N0VC 1J2JA 1GITA 2C5LA 4JBXA 1SVLA 4WXRA 2FNAA 3KFXA 3W6NA 1E2IA 1MOZA 2LKDA 4DLYA 1TEVA 1H8HA 5HZKA 1DAGA 2C77A 4DIEA 1OFHA 2HF8A 1DG3A 1KJWA 2XTMA 3MFYA 4DLRA 2XXAB 4EJSB 3D3QA 1P61B 2WWGA 4RJLA 1LW7A 4OHXA 3DDCA 2GETA 1NL3A 2F1JA 3T1OA 5IK2A 3CRMA 1Z47A 1CR2A 2QL6A 1T3SA 3AKDA 1GSIA 4MYHA 2QSZA 3VU9A 2BCGY 3WY9A 1J8YF 4L9SA 3T61A 1IXZA 1XD2A 1Z29A 4OJKA 3RWOA 4JS0A 4B3XA 2CL0X 1ZCBA 2GJSA 2ECKA 2C99A 1HQYE 3P20A 1N5LA 3Q8XB 1E96A 4LGMA 4Q9LA 5KNCA 3T5DA 1W36D 1WBDA 4YXWD 1YR9A 3EPLA 1QHXA 4M0LA 4CF7A 3U3RA 4CRWB 3ZLJA 4EAQA 4URXR 1EG7A 2XEXA 1XD2B 2CE7A 3NDPA 3R7WA 1E9DA 4I99A 4O0MA 4B48A 1W4AA 4TL9A 5EXXA 1G6OA 2CNWA 1XCMA 4X8HA 1E2DA 1U2RA 1XXHE 3TIFA 1EWRA 4BWYA 1DADA 1G16A 1CJKC 4I1SA 2GVZC 2NIPA 1FFHA 2F9LA 2FGKA 1ZBDA 4PSVA 5FOWA 4MRPA 3MUFA 4AC9A 3RANA 4LC0A 2NO6A 1N5IA 3FKSA 2G1KA 1A5TA 5AK0A 1YRBA 3U3MA 1FUUA 1OHHA 1NSFA 1W0JD 5BYJA 5CYPA 1P62B 3UMSA 2IK8A 3KKQA 1NIJA 1PZNA 2AR7A 4Q4HA 3EZ9A 3QSYA 3LV8A 2VH5R 3CO5A 1E32A 6Q21A 3KDSE 2ZR9A 3WNCA 1P60A 2EWVA 1FOEB 3IUYA 3AB3A 3IQXA 3UMFA 3GJ3A 4NCJA 4ZIRA 4B44A 4JLDA 5IRCD 1DE0A 2IYTA 1LTQA 1BYIA 4I81A 1RPZA 4IDPA 4Q4HB 2DWPA 2FEMA 5GVRA 3UKDA 5FBRB 3W8NA 4AYWA 4RD1A 4BECA 3ASZA 4RKEA 3KZ1E 3ADBA 4OJQA 3KQKA 4NPHA 2PX0A 4ZIRB 3BFXA 1VMAA 2PMKA 3FB4A 4PO9A 2IXEA 3LQQA 1F2UB 1NBMA 3HYTA 2ZRPA 4G01B 2X19A 3BORA 3AQ4A 2A3RA 3IEVA 3IO5A 1EXMA 4L15A 4P3YA 4GPTA 4Q4LA 3BERA 3TVTA 3T12A 2G0TA 1YKSA 5EP3A 4CEHA 2HF9A 1W2HA 1RC8A 4C0JA 3QIAA 1AGRA 4TTPA 3QF4B 3ZH9B 2Q21A 4ZV4A 3MGCA 5KHOC 2RB4A 1E4VA 1KI2A 3TAUA 3KXKA 1U8AA 4XWKA 3LX5A 4C0LA 1SVSA 2GWHA 4U02A 4CEHB 2BIFA 221PA 5BYKA 4RZ3A 4TL7A 4OK3A 1OH7A 1YU9A 4LWZA 2V55B 4R2IA 1ZM7A 2CLSA 1OV4A 4IDNA 4B3GA 4LV8B 4D82A 1CULC 4WZBE 3BAFA 3I1FA 4RD4A 1YR8A 2BOVA 2ZJZA 5JRJA 1O3YA 1S2MA 2WJYA 3T06B 5JCZA 3AVXA 4J0QA 3NG1A 4I4LA 4N1AA 1QF9A 4DSTA 2GESA 2CBZA 5KPJA 3MJRA 2E87A 3AF1A 4MGZR 3CF0A 3DEFA 4GSYA 4M2LA 1VYUA 2GJ8A 4TMWA 4NYMQ 4YXWA 2MMGA 5BXQC 5G3ZA 3UANA 1FZQA 4FCTA 3X1DA 4LJ8A 2WZQA 3FDIA 2H16A 4HDOB 1G21E 4KBFA 3QNUA 3QXSA 4KLZA 3BE4A 1W36B 4F4CA 4GRAA 1Q22A 3MSXA 4JLPA 5CJ2A 2EFHB 1R5OA 3EIHA 4RCYA 1TF5A 1EFRD 4B74A 2FU5C 3W3ZB 5FBQB 5LDDC 3AVTA 3EA0A 5FFMA 2V1XA 1ONBA 2KI5A 2N42A 1R5NA 2Q9BA 4QG7A 3GJ7A 4DBLC 2AX4A 2IHBA 1W0JA 1Q1BA 1OIXA 4XWAA 4D26A 1Y63A 2CCGA 1U90A 3W9YA 4YQFA 3V9PA 4CVNA 2O52A 4V0ME 3CPJB 4ASUA 3NH9A 1UKZA 4UXIA 5FOTA 3IO3A 2JDID 4A36A 3LY5A 1XCGB 3O8CA 2VP9A 3PQCA 1QG2A 2ZUDA 4A82A 4DIDA 2RHDA 3QEJA 4KLNA 1YZTA 2DCUA 2Z0MA 3K0CC 3KJIA 1XD8A 4B2PA 1VG9B 2WKPA 5A5GA 2N46A 3GFOA 4PPNA 1W7AA 3VQTA 5DHFA 3IIMA 1II8A 3KQLA 4PC3A 1YE8A 4M21A 3BB3A 2V4ZA 1SXJE 4Q7MB 4HAUA 4HYYA 5JWHA 5TB5A 3H4MA 4MRNA 1DAEA 2GXAA 3R8CA 1N5JA 1JPNA 1WCV1 1X86B 5JHGB 1XEWX 2CL6X 3U6BA 2KWIA 3GJXC 3EPKA 3RC8A 1I4DD 2JAQA 1CR1A 1R0YA 1NP6A 2HUPA 4JKIA 5E7MA 1EX7A 2IYZA 1TEXA 2G3YA 3OIWA 1CJUC 3DM9B 4RD0A 1M7GA 3IGFA 3MD0A 4DC9A 3U44A 4M8NE 2MSEB 2QMUA 5G41A 3FMPB 4NYJR 5H68A 5CIWA 5DLQC 3SE0A 2OLJA 4TYQA 4Q9JA 4TSFD 4QBIA 5LPNA 1Q57A 4LUCA 3VKGA 2XSZA 3WHLA 5KNDA 5AJXA 2IWHA 4MYUA 5KOYA 5KSZA 3AGQA 3U44B 4FI3C 3QG1A 5FTKA 2BVNA 4DB4A 4M1YA 2GEUA 4XIGS 4GL2A 3NEJA 2A2ZA 3B9QA 3A36A 2ZVQX 4WIAA 2QAGC 2V6JA 2NPIA 4CEJA 1JAIA 1V43A 4GDFA 3K8YA 4D0LB 2ZR0A 4C3ZA 5K8UA 2FSGA 4LJYA 3UPUA 1E9SA 2D62A 3HJNA 5FPYA 2EVWX 1FMJA 3BXZA 3B78A 4JLMA 2PJZA 4Q1FA 4JZKA 4CEJB 2YWHA 3H0KA 3SJCA 3MJHA 4FN5A 4G5RA 1AA9A 4PX9A 4V03A 2H92A 4DUGD 1G19A 1NY5A 2IHYA 2Q3MA 4LHXA 1E2EA 4WVFA 1WBBA 1XPUA 1D2NA 3C15C 1GKYA 5HR5A 4BFVA 1NSTA 3LLMA 2SHKA 1ZUIA 2F1RA 3ZZUA 4V0OA 4M22A 1EFRA 3TNFA 1KNXA 2Y8EA 2O8BB 3TRFA 2ZU0C 1BO6A 3UG6A 3OE7A 3W6PA 5BWMA 3GLFE 1II9A 1EFTA 4K46A 4PANA 2DBYA 3PUYA 1Z6GA 1NMYA 4D0NA 2VLIA 1IN5A 2FMXA 2D3WA 3GLHA 3R9WA 2WWFA 3OEED 4PSAA 5KO2A 4MGIR 4DLXA 3B1YA 4L9WA 5CYOA 3KJHA 3SQWA 1E69A 4Q4JA 1KNQA 3NTUA 3CX8A 3ZQ6A 1G3UA 1Z22A 2JDIA 1SKYE 5AJZA 4OI0A 2CK3D 4TYWA 4JVSB 2ZUBA 3TQFA 4IEIA 1KI1A 3SYNA 2BMEA 3BOSA 4NKRA 5AJWA 4GFDA 3GLHB 4NL4H 3P1JA 4URZR 3P26A 4UJ5A 2REOA 4HDQB 1F3OA 1QG4A 5C4GB 4URYR 3WP1B 3U60B 1GP2A 4Q4JB 1KKLA 3TR0A 2Q9AA 4QHSA 5J4HA 4P4SA 5KDLA 2IEYA 1UKYA 2RGDA 5C46F 1DOAA 2QM8A 4C0KA 1KK0A 2H18A 3RS0A 1D9XA 3RYTC 1BH2A 2W6JA 3IPYA 1WE2A 2ODWA 2KBEA 3WMGA 2NPFA 2VEDA 2O8DB 1XZQA 2B7BA 4P4SB 5BN4A 4Q21A 3KJGA 2WJHA 4QRHA 1RRGA 3B1VA 2LWIA 5JEEA 3VNUA 3C4JA 1XFAA 5C18A 2FFHA 2A5GA 3AVYA 1MV5A 1XTJA 1BOFA 4B35A 5JS8A 1VCNA 2H1LA 4R98A 1XPRA 2MSDB 2GBLC 3NVAA 3P32A 3EW9A 1IJFA 2VSFA 4TSFA 3LXRA 1EWQA 3BJIC 1Q21A 1KO8A 4EPRA 2G9NA 5KNBA 1E99A 3LWNA 1DVRA 1G8PA 2GAOA 2W0SA 3DZDA 3LBIA 2JLSA 4XWOA 4TZ0A 1YQTA 4R71A 2OCPA 5HTKA 1CR4A 2C9YA 1U81A 1KDOA 1R0WA 1QVRA 4MRRA 4O3MA 3FYHA 1NVXQ 4MUAA 4H1VA 3U3OA 1G5TA 3TKLA 4TL8A 1UAAA 1J99A 3AKCA 3AKYA 3CWQA 4V0KA 2V6IA 4DT1A 4QC2A 3LRPA 1UBEA 3VKHA 3U7GA 3K0CA 3VX3A 1F5NA 1GTVA 3KB1A 2ZI9A 5TARA 3QXCA 3IKJA 4V02A 5B64A 4S35A 5L3SB 4B71A 1E0AA 2F1HA 3RS4A 2ZSFA 3G82C 2DFTA 5AUOB 3LVQE 4OKSA 4B6EA 1N2CE 5DYGA 4TMTA 1KSFX 4LBYA 4HZUA 3WNDA 4E09A 2J0QA 3PEUA 1WP9A 1XRJA 1ZM2A 3O8BA 4M9ZA 5FOVA 1Z0FA 4IFBA 1OKKD 4WOPA 3MAAC 2OCAA 4OHZA 4QNRA 2FPKA 1W0KD 1FNNA 2P2LA 5G40A 4OQXA 2DY1A 3ZZ0A 2ONJA 4GOKA 2OBNA 1N6LA 4POAA 1MKYA 4PPGA 3SFZA 2JLYA 4HZUB 4MQBA 1GNQA 4DXAA 4NYIR 4P31A 5SZJA 1U8YA 5JWRA 4A0RA 1WB9A 4PSKA 4KFSA 5TDHA 2QENA 1HE1C 4GZMA 2O8FA 3T5GA 3SNHA 4URVR 3GEIA 3JZAA 4K8OA 2ZRKA 3N2IA 2R65A 1JR3D 3I32A 4C2UA 5EE3A 1WQ1R 1PLKA 2IF0A 2QP9X 2RKOA 3BGWA 2GK7A 3TMKA 2VBCA 1Z0JA 5EQTA 2CK3A 1XEWY 5FI1B 2O8FB 2FPLA 5A0FA 2D06A 4RFSA 1E9RA 1NN0A 1U0HC 2JA1A 2MSCB 2IT1A 2GA8A 4D25A 4HB4A 5AJVB 1SVIA 4P0TA 1M34E 3C14C 5FTJA 1NKSA 1E9EA 5KPDA 3SR0A 5JI2E 2VSOA 2RGCA 4C7OA 1IN8A 3AVPA 4RFSB 4AYXA 4M53A 1KK1A 4G5GA 5DSZA 2JLVA 1PLJA 3O47A 4PZYA 5B30A 2RGGA 3VHXA 2C9OA 2ZVPX 2VP4A 4JT4A 5JJIA 4MYCA 4WAUA 1IHUA 2CEAA 3SYKA 5BN5A 2G1JA 3CRW1 1DELA 2JLRA 4BPBA 4C7OB 4PXAA 1E2MA 5M04A 2GEDA 1QZXA 1DTSA 1TQDA 2D7CA 3HR7A 5E95A 3LAWA 3AH8A 3ZYCA 4JSTA 3PEYA 1XEXB 2XB2A 2WKRA 4K81B 1KK3A 3TSZA 5HCIA 1G8GA 3A8TA 3A1UA 1G17A 1HURA 4JT2A 5E7IA 4AD8A 5TMPA 4JLJA 4BFZA 1A82A 4RD3A 4BRUA 2AHOA 1KK2A 4Y0VA 1DBSA 2FV8A 4F38A 1D9ZA 4OK6A 3FFAA 1JPJA 1ZD9A 4ZKDA 1GL9B 5IDVA 1KAGA 4JSYA 3RSOA 1GNPA 3FE2A 2P6NA 4C0AC 4TLAA 1W1WA 3QKRA 2QEQA 2HYDA 1I4LD 2WSSD 4LZZA 3FGNA 3U3JA 3QI2A 4LJAA 2E1RA 3OFND 4LHZA 3T1VA 4PTLA 4P33A 3U2QA 1EESA 2ZJAA 4MDEA 2WJVA 1KYIA 2IYWA 3CNOA 2IYLD 3QKRB 3RLFA 4W9MC 1KGDA 1UM8A 1VIAA 2H8KA 3MLEA 3CH5A 1HTWA 5JI3E 4KYUA 2JJ1D 3GLIA 4PQYA 3VR1A 3ND8A 2QT0A 3GQBA 1K5DA 5FPSA 1NRJB 1ZYUA 4BZXA 1OKKA 4CDGA 1E1RD 4URUR 4GP7A 1E9FA 2W58A 1A7JA 4P4TA 1T5IA 2NOAA 2ZAOA 3T15A 2ZITA 3GLIB 2H17A 1TU4A 2JJ2D 2GK6A 3SEAA 2FFAA 1SZPA 1S1MA 3RS5A 2ZJOA 1UJ2A 4Q18A 3T1TA 2FSFA 5KSOA 1RFLA 2GBLA 5HKKD 1D6JA 1YZGA 2PZFA 3ZVNA 4E22A 3GLHE 1KI6B 1CJTC 3PFIA 1XZPA 3SFVA 2P6RA 1JXMA 2VHCA 4FMCF 1SVMA 1XU4A 4A0GA 3L8ZA 3THOA 1LY1A 3TSOA 4TZ6A 1QVAA 4ZPXA 1JR3A 5FUYA 3SBEA 1GVNB 2OSBA 2HT6A 2NO7A 2ANBA 4RKFA 5L3RA 3ZIAD 5L8VA 3DKPA 5KUTA 3ZVMA 1VECA 5EE9A 4B3CA 2P5TB 2WWIA 1HY3A 4KXFB 4V0NA 3L2OB 2IYSA 2X77A 2WIBA 1ZC4A 2ZYUX 1AK2A 1E2QA 4D81A 4RZXA 2OO7A 1TAGA 1XX6A 1E0SA 4IW3B 4L16A 4QGFA 4Q9IA 3B8HA 3VR4A 3L43A 4I1OA 3PCRB 2EQBA 1Z63A 5JLJA 3MCAA 3K0SA 2BEJA 2ZRDA 3FMIA 2H7VA 4PC7A 5GJVC 2CHGA 1W48A 3AF0A 1E94E 2IWRA 2C78A 2YOHA 3SC3A 1TU3A 5J4LA 1X6VA 2HLDD 1UKVY 4OHYA 2QTHA 4AKHA 3TSWA 3DM5A 2VTKA 1GILA 3BFVA 3OAAD 2H57A 4DB2A 3BS4A 3MG9A 1TUEA 3CR7A 4XVUA 3FOZA 1N0WA 4HUTA 3OHMA 4Q5IA 3M0EA 1TQ6A 4Q66C 5FTMA 1VTKA 2UKDA 4ESHA 3C5CA 2YKGA 2VF7A 4PPQA 4JVLA 2WKQA 4KVGA 4KFUA 2IBMA 4F93B 3TJZA 1KOFA 3SS8A 2V8OA 3CF6R 2UZ3A 3IIKA 1GKIA 2J46A 5E7JA 2BDTA 3ZS8A 4YMSA 1Z8FA 4DSNA 3QPUA 4HDCA 4RFVA 3B5JA 2P5SA 2QN6A 4IOLA 4ZCIA 5DNYB 521PA 3WMEA 3OFNA 4Q00A 1HEIA 4R2HA 4UJ3A 4CYMA 5J4KA 1L7VC 5EJEA 3KKMA 3Q3JB 4JKYA 3G0HA 1QHIA 5TY0A 1E2JA 1UEIA 4BZQA 2FDCA 4E07A 1FUKA 5LB4A 1OXXK 1RVDA 3CH4B 3HPQA 3P4YA 4LYFA 1E79D 2JJ1A 4Q03A 1HA3A 1Y3AA 1U99A 2A30A 1Z07A 4URWR 3DO6A 3C8UA 4HAYA 2WTUA 1E1RA 4TT3A 1PVOA 4BE7B 3RVBA 1KDPA 4R9UC 5KSYA 1XEFA 2FH5B 1NVUQ 4WW0A 4EFLA 2HXSA 4JMPA 2JJ2A 5EXSA 1OF1A 1XMSA 4ZI2A 1UBGA 4B34A 4ON9A 1VYTA 4G3XA 3H2YA 4LYHA 1OW3B 1YZKA 2IYXA 5J4VA 3IHWA 5EE0A 5TVKA 5HKKA 3EC2A 4NZYA 2BMFA 5BQ5A 4ZI3A 4EDHA 1ZIPA 3DMDA 1P2VA 4Z1MD 3U5ZB 1VDZA 3SQXA 3K9GA 3K9LA 1Q12A 4MKIA 1IAQA 3ZDQA 1JQLB 1GOTA 3KQHA 2JIZD 3GMTA 3MWJA 2EYUA 1G41A 1IY0A 1GL7A 3E1SA 4JYCA 2CMKA 4NBSA 4JBWA 5DISB 3RRMA 1F2UA 3UWOA 2GF0A 2QBYA 1N6OA 4DDTA 3K0FA 3U4QB 5AUQA 3VNVA 2WVJA 621PA 1MRSA 2FX3A 2FGJA 3IHLA 2OG2A 2W83A 1NN3A 4H9GA 4AWXA 4NYMR 4XSGA 2GF9A 1E2GA 1IXSB 1RIFA 4PO8A 4Q4AA 1R6BX 1WF3A 2GCNA 2X2EA 4EPXA 2K5UA 1XMIA 3WMFA 2QBYB 1XTSA 3K0FB 3EX7C 2F3RA 4ILEA 4FMBB 2ZUCA 1VHTA 3QF4A 2ZE7A 4GMDA 3EC1A 5JWOA 1S9DA 1Z0IA 2HXYA 2WV9A 4PC6A 4Q4AB 4AKGA 4JBYA 5DGXA 5J40A 4LV5B 3AVOA 4PAOA 2HLDA 3FFBA 2RGEA 3CPEA 2WOOA 2AK2A 3UWKA 1LV7A 2CLDX 2I3BA 4OQMA 5JZVA 2A5YB 1J90A 5EE1A 4LBZA 3RRNA 2RGBA 2OUKA 4YMTA 3A58B 1XJ0A 1Q44A 1XMJA 2AN9A 1G8FA 1Q20A 4IRUB 3SBDA 3WNBA 2RGNC 4AIIA 4DSUA 3WRXC 5CLQA 1JALA 3ECCA 1A1VA 4B3FX 2JASA 4LPSA 2FSIA 2OILA 3CKLA 4OI4A 4Q19A 3CBQA 2QSYA 5FTNA 4YC7A 2CCJA 1GL6A 1LVGA 1WA5A 2PL3A 4KI0A 3TH5A 1XTQA 1M8PA 3K9HA 4W5HA 5CM9C 2J0SA 2YC4C 5IT5A 2P3SA 2Q9CA 3CNNA 4IVPA 4C2TA 2IC5A 4C0BA 1SVKA 2QM7A 3CX7A 4KCGA 4IVRA 4FW9A 2FWRA 1VCOA 4BLTA 3B7GA 3R20A 3LW7A 4FIDA 1S9HA 3SJAA 4A0HA 1UADA 4FINA 2JGNA 3LW8A 3B60A 3HDTA 4YMVA 3GLIE 2VHUA 3CM0A 3B1ZA 1E98A 1E79A 1XMVA 1SVWA 1S4QA 2C8VA 2AXPA 2GKSA 2OXRA 4GBMA 1D8TA 3KQNA 5EE5B 2ERYA 3CR8A 5JMTA 3TR5A 3K70C 3QEOA 5DI9A 4BFYA 3EZFA 4DLSA 1ESNA 3A6PC 2ZE6A 3Q7PA 1CTQA 2PX3A 4ESVA 1S0UA 3KUCA 4IXNA 1W47A 1XJCA 3BWDD 2W2XA 3X1YA 4LJ5A 4ZDJA 3L0OA 3RS2A 1GZSA 3BH0A 1VIYA 4QL3A 2PEYA 4US0R 1IN7A 4OQLA 5EXTA 2ZJ8A 1CRPA 1FP6A 4LC1A 4QHTA 1RJ9A 2ZE8A 2UZIR 1DG1G 1P9RA 2ONKA 3E70C 3GJ0A 3NC1C 4LYAA 3TUJC 3NIBA 4PAMA 1X8JA 1ZUNB 4M9XA 2CHQA 1FW6A 2VSXA 2BM1A 1CU1A 2Q3HA 2QY9A 1WMSA 1TF7A 1RJ9B 5JHHB 2DR3A 4JIMA 2AXNA 2JLZA 2IYQA 1CJVC 1IXRC 2R9VA 4TTQA 1BKDR 2Z5FA 1G7RA 2J0VA 2YOFA 3A4NA 1KJZA 1J70A 1WDTA 1E2HA 1OSNA 2YINC 4DLUA 4EIWA 2W2VA 2QZ4A 4HLDA 2IUUA 1AQYA 3LDAA 1IJEA 3QKSA 3QQ5A 3RABA 1GIAA 3OESA 2ZS7A 2GXQA 2ZSBA 2ZJ5A 1CIPA 1TX4B 1ZMXA 2C96A 1TTTA 2W00A 2C03A 3K70D 1KO5A 1G9XA 5FL7D 3QKTA 1KJYA 2BBSA 1G1MA 3BFKA 3A1WA 3L8YA 1AIPA 4PC2A 2CHVA 2QAJA 4US1R 1I4TD 5G53C 4D0GA 3QKSB 3DL0A 2GAAA 3WYFA 2BBTA 2ODNA 1ZINA 2WOJA 4AYTA 3F3YA 1ZU4A 3NEYA 5D3QA 3RRZA 2QE7D 3I61A 1N5KA 3DKVA 2BKEA 1XD9A 3A37A 1G20E 1KIMA 1FX0A 1OJLA 5JECA 3N70A 1M6NA 2REXB 4O2LA 4D2IA 5EP4A 2I1VB 4HSEA 5HZHA 4LCBA 5FBLB 1JI0A 2I1QA 3PITA 4Q1EA 3SYLA 4MRVA 2L0XA 4PQRA 4RCZA 3AP2A 4NCNA 4CT5A 2QUZA 2QNRA 4DCUA 1FX0B 3EWSA 2C04A 2VF8A 2FZ4A 1V5WA 4JVNA 5K8IA 4YDSA 4D6PA 1UDXA 1W2GA 1OFUX 2JLQA 1G291 4DJTA 4HUQB 3QBVA 4Q9KA 2EFGA 1XB2A 2BJWA 3KL4A 4NTZA 1FQKA 1WXQA 2CL7X 2ZRAA 3H86A 4F92B 5G3YA 3CF2A 4LX0A 4M1SA 1CLUA 1TMKA 2V54A 3OIUA 1KI8A 2ZETA 2O8BA 2IYRA 1CJMA 3ZD6A 2Z43A 3K1JA 3DOFA 1KY3A 5KDDA 2HDNB 1I2MA 3P4XA 4IDHA 4DWJA 1XTIA 3EZ7A 3VR5A 2PT7A 2YOGA 4MH0R 1ELOA 4QOSA 1T0JB 2R6FA 1U94A 3L0SA 1S96A 2XJ9A 2ZPTX 1QHYA 1U8ZA 4OI2A 3TAHA 2DWQA 4DUGA 3E5HA 4ZDKA 3SJZA 4MRSA 2XNSA 4BEJA 3NKVA 2ZIAA 3WHKA 2OZEA 3EZ2A 2AWOA 4NMMA 2ZU6A 3V4RA 1DAKA 1J8MF 2RGNA 3OZXA 1VG1A 1ZRHA 2IEZA 4RY2A 5FOSA 1QHHA 3AP3A 3SJBA 2EWWA 4M9QA 3I5YA 3X2SA 1OLOA 2XX3A 3CUEF 4MGKR 2CJWB 2R62A 2WPDD 5TXGA 2P65A 2ZSDA 4A0FA 3ICEA 1AKEA 4B43A 2CLCX 2QT1A 1RRCA 2QPAA 4KYIB 2XGJA 1QHHB 2O8DA 1J7KA 3SHFA 3DZ8A 5DH9A 4QKQA 1NBME 1US8B 2KB0A 2D2FA 1N3BA 2G88A 5D3MB 4AI6A 5DE3A 3W3AA 2GRJA 1Z83A 2QG6A 5LD2B 3KX2A 5DN6D 1OYYA 2F6RA 3X1ZA 1Q1ZA 1C4OA 1FQJA 2VP5A 3BH6A 4M1TA 4LSGA 3LX8A 3IPXA 5DI3A 4E5UA 2VP6A 1E2PA 2VHJA 4OHWA 2B8WA 4B33A 4TLEA 5H1YA 4KO8A 2P67A 3ZS9A 3KB2A 3I4LA 4RD6A 2WBLC 4EKDA 1FTSA 1GUAA 2YNMA 1GRQA 1N6IA 3LVRE 3KKNA 4LPKA 1FMLA 1G3IA 3AF2A 4PC1A 5JS7A 1AN0A 2QE7A 1CBUA 5DI3B 3K70B 4F91B 1NI3A 1T8UA 2NG1A 5F9FA 4BGDA 2QROA 4ARZA 4BLOA 1IBRA 2J1LA 1KHTA 5GVSA 1RYHA 5L3SA 4LBVA 4OL0A 5CK5A 5AWFC 2IW3A 3GLGA 1OB5A 1I2DA 2HEIA 3THYB 2EW1A 1ZU5A 5GJWC 4CGZA 3C5HA 2DB3A 4ARZB 1SULA 2PMDA 2WWHA 3EPHA 2OT3B 3GJ8A 5KSPA 4KHZA 2DHRA 3RC3A 1K6MA 2OBLA 2OXCA 3GLGB 4M4SA 5BW8A 4D4LA 2Z6VA 4XJXA 1VYVA 2EFDB 3AVQA 3EAQA 1JJVA 3PUXA 3TVDA 1ZM3A 3LA6A 2X8AA 1YR7A 1MT0A 3HPRA 1UKEA 1AJEA 1NF3A 1GDDA 1EGAA 2G77B 3O8RA 4PHFA 2A9KA 1P75A 5HPYB 5FPHA 2F43A 2Q0HA 3D8BA 3LBNA 3W34A 1SXJC 3V00A 4MITA 2XXAA 2R6CA 1S8FA 4TLDA 1Z3IX 2XB4A 1PV4A 3MWLA 5F3WB 2GTPA 1VPLA 2QMHA 1E4YA 1X1RA 3LH5A 2QTFA 2EYQA 1R2QA 4U7DA 4Q7KA 2R6AA 2F43B 1OXUA 2QGZA 1KDRA 3OEEA 2ORVA 5FOUA 4Q02A 4DVGA 1G3MA 1GKUB 1XXHA 2BV3A 4HAWA 3QENA 4GNKA 1LS6A 1VG8A 3SU8A 2ZSEA 3CLVA 1YVDA 4DSOA 1E2LA 4QBFA 4DDUA 4D80A 1IOZA 4AK9A 5JBQA 5GJCA 3WP0A 2F55A 2VL7A 2WPDA 3CW2A 2ZRIA 2IA5A 4EPYA 1LFDB 4BLSA 4AKIA 4FCVA 3TK1A 1CKEA 2E9SA 3ZVLA 5E3HA 4M1OA 1XXHB 4TQ9A 5C1BA 2AFHE 1T8TA 1S3GA 1P5ZB 3L82B 1KSGA 4JYBA 2WIAA 4CW7A 1E0JA 1N6KA 4M1WA 2D7DA 2WICA 2F1IA 5HE8A 2GEVA 2PLFA 2O8EA 3LLUA 5DYIA 1ZP6A 4XVRA 2ZI4A 1Q0UA 3O8DA 4G0NA 4IXMA 5SZIA 3K0EA 2BBOA 2IXFA 4RZ2A 1XEXA 3PV0A 5HE9A 2BCJQ 3EPJA 4C0QC 2XNDD 4CZ2A 1RRFA 4IOKA 2UVQA 3T1QA 2AD1A 4NHOA 2FJUA 2BHRA 2RGXA 4M1KA 2OHFA 4BLQA 2O8EB 2ZJ2A 2R2AA 4KFRA 4IVQA 3CZPA 4DRZA 1NVVR 4QGGA 3SN6A 4LJ4A 4M9SA 1SXJD 2R6GA 4X8OA 1RYFA 2R8RA 1PLLA 4JL6A 1NG9A 3ND9A 1LS1A 1YJ5A 4XSHA 5DO9A 1N6RA 2VQSA 3D31A 2JATA 4YMWA 1Z2CA 3B85A 3D7MA 1T0HB 3HP1A 1ZM4A 3F5FA 5H70A 2WJGA 5C4MA 4A2QA 3ONWA 1W4CA 1E9AA 3PUVA 1OH5A 4OQNA 3OEHD 1U98A 2Q3FA 2QPTA 1M1YE 1T6NA 2O8CB 5CLLA 1ZAKA 3I8XA 4L4UA 1MO3A 2P0EA 5AR1A 2G6BA 1QDEA 4HB0A 4BUJA 2JLUA 2WMNB 2ODEA 1KO7A 3EA5A 2OBMA 2ZRHA 1MO5A 1R5BA 1YZUA 3KKPA 4DCVA 1P4SA 1VHLA 2GZAA 3GJ6A 2GZDA 1P9WA 3BB4A 3ZJYA 3MMPA 3TUZC 3N5CA 5JCPA 2W6ID 2GZHA 4N0EA 3BD9A 4UNPA 3VFDA 1YHNA 1FPMA 2WAXA 3PVSA 1FTNA 3R8FA 1R8SA 1W0KA 2ZREA 1KI6A 1IM2A 1OIVA 2OM2A 2R6DA 3NH6A 3Q5EA 4JL5A 4GP6A 1LNZA 2QGNA 3A1SA 3U3KA 4BLRA 3QPVA 4QHYA 2ZM5A 2ATXA 4II7A 1MRNA 4FWIB 5F2EA 4FWTA 4QXAA 3H1TA 1QHSA 4WZ6A 3THXA 3AV0B 4E03A 5EUMA 1UBCA 1AS2A 4A8JB 1JQJC 4LRWA 2DWOA 3TBKA 2PBRA 2ZANA 4TN1A 2VYFA 1UEJA 4B2LA 2TMKA 4UNNA 1MABA 2OV2A 2VHTA 2ZXUA 1FL9A 2PCJA 3JZMA 1GFIA 4Q1BA 3WBKA 3THXB 3PG5A 1XJQA 4JLOA 1YR6A 2J45A 4ITRC 5FUWA 3MWKA 3ZGXA 2G83A 2IUSA 2KBFA 4TLBA 5KU1A 2Z83A 2NGRA 4PAQA 4YMUA 4WXPA 1MABB 1G7CA 4JLBA 1Z6TA 5LB2A 4S2EA 2NO0A 3AUYA 4KJZA 2FZLA 1DARA 5JJKA 2NZJA 3DHWC 1O87A 1W46A 1C9KA 2WWWA 3QF7A 3NHAA 2RCNA 4QJ4A 1G4UR 2XNDA 4TWZA 5L3VA 1GNRA 1T91A 2QQEA 4TLCA 1G5RA 4KSBA 2QU8A 4UQOA 1N6NA 1P3JA 2OAQ1 4Q1AA 5B2ZA 1VCIA 4DCTA 4UKDA 1SXJA 3MWYW 4HI0E 1HE8B 1B0UA 3NWJA 3A1VA 2HCBA 3K09C 1Z6YA 4TYPA 5SZHB 3GD7A 2J9RA 3LD9A 4OBEA 2W0MA 3NBYC 4PR0A 1E9CA 2WJJA 3R9IA 5FPTA 1HUQA 2RH5A 4JVMA 4XH9B 1SXJB 4F4IA 3KTAB 1GRRA 5AJYA 1IY2A 1M2OB 4LY6A 5J5CA 2WM9B 3Q5DA 1G3QA 2QPOA 1LF0A 3GLGE 2VO1A 3LNCA 3OEHA 4TQAA 4JJKA 2WSSA 2B8TA 3KXIA 3Q7QA 2GJ9A 2YYZA 3QXHA 1P9NA 1KTVA 2IS4A 1NLYA 2HYIC 4DCSA 3TGPA 1JJ7A 3QBTA 4LOAA 1T5LA 3LXXA 5KYKA 1OXSC 2GILA 3UK6A 721PA 2O0KA 3SZRA 1M74A 4LI0A 1FNMA 4LHWA 2FFQA 1U9IC 2GNOA 4MGYR 3J81k 1Z0DA 4PZZA 1SHZA 4B3DA 1NJFA 2LKCA 2V9PA 2W6IA 4PHGA 4Z8YA 3VHLB 3M6AA 4Q1CA 2X2FA 1NJGA 3AP1A 421PA 2WHXA 3FPAA 4A92A 2HT1A 3I73A 1W5SA 4IOMA 3QE0A 4QJ5A 4WA7A 3VU9B 1JB1A 2ZRFA 1KAOA 3OIVA 3CPHA 2BEKA 2ZTSA 1OFTA 2YWGA 3WRYC 2D74A 2VRWA 1EFHA 2FA9A 3TW4A 2IUTA 5CDFA 4NH0A 3W5IA 3P27A 3U4QA 1R0XA 1R0ZA 1Z28A 3FTQA 2XITA 3ICQB 2AD5A 2C2HA 2JCSA 1CR0A 3R7WB 5H8WA 2BMJA 2ZRGA 4GZLA 5CITA 2XZOA 3ZIAA 3GFTA 1ZNYA 3GLFA 2A5DA 3ZZTA 1XCPA 4B76A 4GI7A 1H8ED 1TQ2A 4LYJA 3H84A 3PEWA 2VA8A 5HCNA 4ASUD 2NQ2C 2ZI5A 1G4AE 2JLWA 3TUIC 4CT4B 3T35A 8OHMA 3GLFB 1Z06A 3IDQA 1UBFA 1L4UA 1GWNA 5FH9A 2NTYC 1IY1A 1G8YA 3B6EA 4RSGA 4NONA 2CVHA 3B9PA 1RZ3A 1VG0B 3WBJA 4A15A 3L0IB 3GJ4A 1BIFA 1R4AA 4EPWA 3AF4A 1DAIA 4G5SA 4ZKEA 3ZQJA 1Z2AA 3QOFA 1LF5A 4B47A 4TQUS 1SKYB 4B2IA 1P73A 1OH6A 2AKAB 1AGPA 3FMFA 2NZ8A 3OAAA 4HAZA 1NN1A 3THWA 2IF2A 4YLGA 3FKQA 4KSCA 3IIJA 5A4JA 1HH4A 2JJ8A 4ZO4A 5B58C 3QVVA 1W44A 3IBGA 1VCMA 2EFEB 4PHTA 4UXHA 3IILA 4IHQA 2FPMA 4U5XA 4ZCMA 4ERNA 1S1CA 1T3LA 2BMDA 1SHKA 2CE2X 2REBA 3X1XA 4DZZA 3THWB 4AY2A 2J7KA 1Q1QA 121PA 1AM4D 4BQSA 1NIPA 3RWMB 4TTRA 4MKFA 1ZCAA 5LD2C 1P2UA 2ZROA 3I72A 2XSZD 1W4RA 4PHHA 4NCKA 2A78A 2G0NA 2V1UA 1PJRA 2I4IA 4D4KA 2KJQA 5AUPB 2ERXA 5FPKA 4C4PA 2ATVA 2VP2A 2IXGA 1KO1A 3EARA 4BFSA 3FWYA 4IDQA 1ANKA 3QJYA 3EXAA 3G5UA 4EPVA 3W6OA 4B6FA 1IONA 1TL7C 4JLAA 4TL6A 4KAXA 3QXXA 1DO2A 4IFEA 4US2R 2DFLA 1DEKA 5GJBA 3B2EA 2HCJB 5SZKB 1DAHA 3LO5A 2N1BA 1CP2A 4HLUC 1KKMA 4BLPA 2PLRA 2NO1A 2ZQ5A 4UNSA 4HLCA 3K09A 821PA 4U00A 2WSMA 1RE0A 2YWEA 1F48A 5FR2A 4PQFA 2PJRA 4A2WA 4Z1MA 3PEVA 3AVWA 2BM0A 1MH1A 2R44A 1JR3E 1EK0A 4BFXA 1KDTA 2JIZA 3BC1A 4NE2A 4M1MA 3SI7A 5JFGA 2AL7A 4W5WA 5AUNB 2ZE5A 3OE7D 1ODFA 3LQRA 3FHOA 3M1IA 2Z4SA 1G6HA 5CK4A 1KY2A 1NMXA 2XZPA 3KJEA 1LB1B 3TW8B 2J0UA 1P7CA 3M4YA 1CS4C 1H8EA 1A2BA 2EFCB 4D4JA 3SOPA 2O0HA 3AEZA 4O25A 2IS2A 4LJ7A 2IX3A 1G5PA 4BZPA 3C41J 1KSHA 4WBSA 2YWFA 5TV2A 4HLQB 1UFQA 3PIRA 2J0UB 4MKHA 1AKYA 4A2PA 1ZJ6A 2WJIA 3RAPR 1NMZA 1U9IA 1CF4A 2ZR7A 4XOIA 4Z8XA 4DEXA 2AKYA 1NLFA 3PUWA 4TMZA 3RS7A 1ZVQA 3VAAA 5B57C 2J5XA 2ZI6A 3NBZC 4LK2A 4EJSC 1E0KA 4OHVA 2PEZA 2YJTD 3RNLA 1XPOA 4IEEA 4QM6A 3CONA 1HYQA 4DDVA 3AVVA 1ZD1A 2P6UA 3K53A 4GOXA 4QFMA 2W6JD 4DHEA 1BS1A 4N3NA 5CB6A 2D4HA 1F60A 3I5XA 1HV8A 1YZNA 1XNJA 3HWSA 4IOJA 3TQCA 4A6XA 5FI0B 4P32A 1II8B 3GEEA 4X8MA 1IQPA 4FCWA 1N0UA 1II0A 1Z5ZA 2BBWA 2KSQA 1XDBA 4HB3A 2ZYVX 4KFTA 2WAYA 2GXUA 4F7WA 4RVCA 1FP7A 2FEOA 2XOKD 2CVFA 1JNYA 4HUQA 4MUBA 4FXPA 4TMKA 5FTLA 2XZLA 1YZQA 3GJ5A 3W8RA 2QP4A 3LBHA 3A4MA 1KSJA 2HJVA 1K5GA 2OLKA 4C9BA 2QI9C 1G3RA 2PCLA 2ZJYA 1CEEA 1JEDA 1XF9A 2F9MA 1ZD8A 1ZW6A 5KTYA 2YV5A 4HAXA 4PZLA 1SVOA 4FD2A 1U0LA 3REGA 3EZ6A 3IBYA 1BMFD 2NO9A 4AURA 3I92A 2V7QD 1ZNWA 3EG5A 4A9AA 2RMKA 4Q7JB 5FBVB 2QRZA 5F9HA 3AKEA 4IDOA 2ZAMA 4QJ3A 1Z6AA 2B6HA 2VPPA 1GM5A 4KITB 4MA4A 4ZCLA 3PJRA 4QBGB 3C16C 2A5FA 4TMVA 4C0SA 4Z54A 4RD2A 1DO0A 4HAVA 4UXJA 3UMRA 1ETUA 2DPXA 2BKUA 3HU1A 1DAFA 4LJ6A 1TPZA 3AM1A 1AS3A 1G8HA 3RSLA 2CJWA 2X1VA 3A1TA 2GDJA 5CDFE 4B3BA 5DHAA 2ZS9A 4KODA 4XTCS 3MRSA 1X3SA 1KZGB 1AS0A 3KUDA 3B13B 2FFBA 2DYKA 1XP8A 1W49A 1W4BA 4HZIA 3OF5A 3W90A 5EUQB 2ZRCA 2AFIE 4IKEA 2CXXA 5GADl 1US8A 2YVUA 2GCPA 4NYJQ 4AG5A 4B75A 2A7QA 2PH1A 5D3MA 1E3MA 1OYWA 1DAMA 3OIYA 3FHCB 2H5EA 2PZEA 1W5TA 3GFPA 3RHFA 3D6TB 3FHTA 4KU4A 3B1XA 2F7SA 4Q9HA 3PXGA 1OE0A 3B82A 4Q47A 2FF7A 2C98A 3U7FB 3AGPA 5EXPA 4PO1A 1A4RA 3ADKA 1KZ7B 3AVUA 2J7PD 1OPXA 2ORIA 4A1FA 2FG5A 1D2MA 1GRNA 2HV8A 2OFXA 4I1UA 5FUVA 4A8JC 5DIFA 5KDOA 3AUXA 4LV6A 5JEDA 3F0TA 2GVDC 2IYVA 2ZYTX 3B1WA 3ADCA 1Q3TA 1KMHA 1EFCA 3NBFA 1E2KA 5EZ5A 1T3HA 4NDZA 3BH7A 3CRVA 5FL7A 5CIQA 3ZVRA 3HU3A 2YHSA 2IL1A 5FBWB 3NC0C 3QUSA 1RRPA 2PZGA 2BC9A 1G7SA 2ZI7A 2DFNA 3QG5A 1SKQA 3W5JA 1HQCA 3CZQA 1KMHB 4HLUA 2QA5A 4ACBA 3THYA 2RHMA 3DMNA 4QGHA 3IEUA 2GCOA 1DS6A 3V4FA 1N6PA 2W2TA 4PPFA 2MMCA 1Z6XA 2B92A 1VKJA 2FOLA 3BBPA 1XTRA 3TE6A 5FL3A 2XOKA 3C7KA 1QHNA 5L3QA 1B23P 2OFOA 4I1VA 3QXJA 4FMDF 4KV9A 1K8RA 1TNDA 1X1SA 1N25A 3KKOA 5P21A 3S1AA 1RKBA 2GCOB 5JSZA 3UG7A 4XD7D 4LDJA 1ZC3A 4NCHA 1S3SA 2XJ4A 3CRRA 1RW4A 1NLZA 1UDWA 3DPUA 4BFUA 2ZI3A 3FVQA 4ZDWA 2ZS8A 5L3QB 4QM7A 3BIFA 3SHWA 1NKTA 1CXZA 3S1AB 3FMOB 3UATA 5JSZB 4JJZA 1BMFA 4DLVA 1QRAA 4WZAE 3VKWA 3K9NA 4W7SA 4N0DA 2V7QA 3QKUA 1UPTA 4EUNA 3LFUA 5CJPA 1F2TA 3ETLA 1R7RA 1YZLA 2LCFA 4FMDB 1P2TA 1ZNXA 2J59A 4JLKA 3BRWD 3DOEA 4EJSA 2YC2C 3NBXX 4QGAA 4Q1DA 4DLWA 1HT1E 4LHYA 5F98A 1F2TB 3NDBB 1KO4A 1P2SA 1JBKA 4DT1B 4BRWA 5FUXA 3ADDA 5EP2A 3ZD7A 2JLXA 1PUIA 3RRYA 1D5CA 4G1UC 3U7HB 2NMVA 1ESMA 2WMOB 5ELXA 4EQ6A 1L8QA 1MO4A 2QP3A 2IYYA 4EPTA 4BFTA 3GCGA 3PR1A 4O2RA 1TF2A 2XTZA 4C0HA 4TMXA 3HU2A 1E6CA 3VX4A 1GAJA 4Q7LA 5CM8B 1YRAA 4OK5A 1JECA 1KI3A 2GJKA 5FR1A 3Q85A 1L4YA 3CNLA 4DLTA 5CB8A 1EFUA 2J87A 3U61B 1M7BA 2QQ0A 1Q3HA 2EU8A 4EQ6B 4CEIA 4DLZA 5J47A 2Q6TA 3R9XA 2Z4RA 4UNQA 3Q9LA 1ZIOA 2V3CC 4C30A 4ACAA 3NXSA 1G7TA 1OXVA 3PUZA 1NY6A 4IJMA 4PFSA 4F4JA 1C1YA 1E2FA 2QRNA 3X1WA 1ZM9A 5IHPA 2J7PA 2OE2A 3I8SA 5EP1A 3UXMA 3WXMA 4TYNA 2VHQA 3A4LA 4GT1A 4CEIB 1CRQA 4LHVA 3U7EB 1OFIA 3K0AA 1Q1EA 5DN6A 1OT3A 1TUIA 1ZUHA 4A6PA 1JEEA 1P72A 4B32A 2QAGA 3EIQA 1NG1A 1P6XA 2XTNA 3EASA 1AZTA 4JL8A 3I3SR 1OIWA 4RZUA 4G5OA 1TADA 4KBGA 5UKDA 4DEYA 1KI4A 3VR3A 2ORWA 3K0AB 5FOXA 4Y0AA 1JAHA 2QAGB 3GPLA 1XBTA 1IN6A 2BWJA 2OCBA 1E1QD 1ZNZA 2A5JA 4QNMA 3T34A 1PUJA 3AF3A 2IS6A 2O8CA 3QY0A 4Z51A 4YDHB 4DKXA 2AK3A 3BK7A 1COWD 1D2EA 3VTKA 1KMQA 4R7ZA 5EZ6B 2ZSAA 3E2IA 4D4MA 4B73A 2OEPA 3SDZA 2ASEA 2B7CA 2HJGA 3DVLA 3REFA 2IS1A 4X8LA 1R10A 1UF9A 4Q48A 1H8HD 3GEHA 2PT5A 3ASYA 4NYIQ 4UNRA 1HT2E 1X8LA 1F6BA 1A2KC 2J3EA 2ZRLA 1H65A 5BN3A 4XD7A 1Z0AA 1EX6A 4L5BA 4LJ9A 2CCKA 3U6KA 3WYAA 4NCIA 3JVVA 4LBWA 5IK2D 4OQFA 5LBIA 4GOJA 2QORA 4JLNA 4QBHA 3VMFA 3EIEA 1NVWQ 2RAPA 3KXLA 2ZRMA 4BEBA 4JLVA 1N6HA 4CIDA 1GG2A 3QVUA 3BB1A 2QMOA 3QPWA 2IYUA 4DDWA 1MO6A 4ZDIA 1KI9A 1AQUA 3Q72A 4A8JA 5K8LA 4EFMA 2VIIA 4MKGA 2O5VA 4XVQA 4A4DA 2OESA 2GXSA 2GHIA
chains in the Genus database with same CATH superfamily
4E6PA 3IJEB 1TIBA 3WIUA 4D44A 3UIEA 5HIAA 5JRZA 5IPFA 1T9HA 4F7DA 1WSAA 4XJTA 3ROFA 1ODTC 4XI9A 2DP4E 2H6EA 2B21A 3E3LA 3EPRA 2NTJA 3MXTA 4G0QA 4FYIA 3MA0A 1WW8A 1Z2OX 2CNWD 3JZIA 1DQPA 4PONA 4Q9AA 5B1SA 2YWDA 1L5FA 1ZK0A 3CRQA 3FDFA 3FFXA 3KQTA 1V16A 3R2JA 1DWQA 1QGYA 4Y6SA 2WYIA 2VUIB 1XWIA 1GG5A 3VR6A 5HM6A 3F6PA 2PIDA 1QV9A 1WOYA 2QTVA 4QU9A 4NF2A 5L3ZA 1YT5A 4RF2A 5CYGA 2JIDA 2H11A 3G2IA 4RXTA 5D2CA 1T3GA 5KINB 2H2WA 4DQVA 4ROTA 1TTQB 3BCHA 1GZ7A 4FEAA 4HATA 4KOAA 5C8YA 3IQWA 1V16B 1NFQA 3NGXA 4BFWA 4DR4B 3N2EA 3PUJA 3ECSA 1UZLA 2PSHA 2QTVB 4JELA 4AMZA 4BVAA 5JDCA 3N86A 4V0MA 4RANA 2HGSA 4BASA 4DJEC 2O7VA 3AHJA 4KGDA 4ZCPA 4DCNA 3V4OA 3OZUA 4O08A 5SV2A 5TIIA 2JHPA 4BX8A 1K88A 3HNRA 3K9FC 1JDZA 1WULS 4V0LA 3HCRA 4ZEWA 1RLUA 1XIVA 2ETVA 1X8KA 2WR8A 3CX6A 4GBED 2OPHA 4L9RA 3RIGA 1IEQA 2WZBA 2OYSA 4DAOA 5KHLB 4RGYA 3R6DA 3LRTA 3Q1KA 3JVUA 3O3OB 2ZIXA 5LMCA 4J7XA 4KW7A 1NWCA 1QBKC 4IR7A 3NS7A 3SZ3A 3KTAA 4CTNA 1LX7A 1MR3F 3QE4A 4MWCA 4DYDA 1JHOA 4MYTA 1ZH2A 3L7NA 4YONB 5I7HA 3ZWVA 1TKBA 5JS6A 4CN9A 1IWOA 3E22A 4NCBA 3HYRA 4MO9A 1AZSC 1E1QA 3SQNA 4JBLA 3BWVA 2FE4A 2ZIXB 2KE5A 3KZXA 3R0QA 1TVMA 2VP0A 3COZA 1NZJA 1DJPA 3BZBA 5J59A 4ENQA 2Z6QA 2XQGA 1O8BA 4HTFA 5LLTA 3EUEA 1UWVA 1P5RA 5IXYA 1ZWKA 3GC6A 3W6NA 4MQUA 2MYNA 3RC7A 1ULHA 1E2IA 4XYGA 1D2CA 4DLYA 1TEVA 2ZIUB 3E22B 1J9GA 1JVBA 3OPVA 4RIGA 4UTOA 2C77A 1XDSA 1IIBA 1OFHA 2HF8A 3MFYA 3PLNA 4GI1A 5BQPA 1FS6A 1PT5A 1KETA 4CCYA 4Q7QA 4ZTBA 3I1YA 3D3QA 1P61B 1P9LA 4GPD1 4XQ9A 5AW9A 3QE3A 1LW7A 3E7PA 1G20A 3OOHA 5FAXA 3QFSA 3W2FA 3DDCA 2GETA 4DMFA 1QFMA 4HXEB 1L7OA 1NL3A 2MDTA 4DLKA 2F1JA 2VI5A 2NADA 3CRMA 1NURA 1UT5A 1AK1A 2JG3A 2O2DA 3V1NA 2X8LA 2CDRA 3SEQA 4F21A 4CLXA 2NU9A 1Q7RA 1UPXA 3C3EA 3R3VA 2Z95A 3WY9A 1J8YF 2X9NA 3CMCO 3T61A 3UJ7A 3CJTA 4TOIA 4J16A 3M89A 1G20B 3C4QA 4OJKA 2OFFA 1T26A 3HDGA 3NR2A 4JS0A 5I9TA 2GJSA 4DB4A 1H1TA 2ECKA 1HQYE 1YQWA 2YHUA 4LZNA 3I42A 4Q9LA 4K88A 1RZRD 2YZ7A 3LF1A 4HSGA 4OXKA 2NU9B 4L3WA 3X0DA 2PHZA 4EGAA 5MN4A 3VKFA 3UHFA 1KORA 3U3RA 5CA1F 3HBJA 3NTQA 4MAMA 4UEOA 4EJ6A 1QAOA 4MWTA 4RTPA 3E5MA 4ZU3A 1KZ4A 4EO7A 4EY7A 4X6LA 3WS7A 1R16A 2BFFA 4W1SA 1U3WA 3OQHA 1M8JA 4Y9SA 3UJ9A 1HDYA 2AXEA 1W4AA 1BA3A 1H23A 2CGEA 1XVVA 2HFKA 3V2UA 3PKJA 4X8HA 4ALIA 4XPIA 1YU6A 2NP7A 1EWRA 2WA2A 3ZDBA 1CJKC 3IEPA 2NIPA 2F9LA 2FGKA 1ZBDA 4L8LA 1XK6A 3MCUA 5FOWA 4CM1A 4AC9A 2HQOA 3UJ8A 4LC0A 4WK6A 2XZDA 3U4HA 2BFFB 2V7PA 1UFKA 3K8OE 1OHHA 4G41A 1EXNA 4D5GA 3X1JA 1IU9A 5BYJA 1KWKA 1NUQA 5EVCA 4XPIB 1P62B 2SICE 2ABWA 1M5RA 1OWLA 1VKZA 1NIJA 5HUJA 1MT3A 1PJQA 4MZDA 2CNNA 2AR7A 2DFPA 2UV8A 3QSYA 1GQ2A 2PGDA 3LV8A 3MHTA 1C2YA 1VJCA 6Q21A 1YE3A 3ANYB 1EFKA 3WNCA 1IRXA 2EWVA 1DIOB 1UMDA 3IUYA 3Q0IA 3T52A 3IQXA 3UMFA 1EUQA 5LBTA 3R6LA 4FB5A 3SIXA 2WUGA 3E3OA 5AOAA 1A3CA 1ML3A 3VKUA 1KZ6A 3P94A 5FULA 3SX0A 1JIUA 2AFRA 3PQFA 4GKVA 2I22A 5FBRB 4HADA 5BSEA 3W8NA 1RC0A 1C41A 5FX2A 1UMDB 3E9CA 3H3FA 4OJQA 3TQQA 4ALMA 3ZQ4A 1R8XA 2IZ5A 4P7JA 4JEHA 3R8XA 2IXEA 1YD7A 2I80A 3C3MA 2ZRPA 3STTA 3Q40A 1TJ3A 4EX7A 1CEYA 4IYRA 4OLHA 4KLRA 4E5DA 3BULA 3H87A 4WXMA 1YBFA 2MYTA 2A0WA 4ZVPA 1Y5RA 5KNDH 3IO5A 1EXMA 2CVPA 4QZVA 1XAIA 3LHKA 1WEHA 3P97A 2G0TA 3T3OA 1YKSA 1ADJA 2HF9A 3FCUB 3LCCA 3PNQA 4R1PA 4C5AA 1RC8A 3KQSA 1MG0A 2FWAA 4O4IF 4W7HA 4KX5A 2I6SA 1ECPA 4ND6A 3RM3A 1ZH0A 4DADA 2CXQA 3QF4B 1KFEB 4UBMA 3ZH9B 4RUKA 1XROA 5IJ0A 5KHOC 4AO7A 4FX5A 3FWZA 2HW8A 4H6PA 2QX7A 2XHEA 1B93A 1U8AA 2P4EA 3OLVA 1KH1A 5D87A 5BV8A 2X7JA 1AUVA 4JXKA 1YU9A 4PG4A 3E7DA 4LWZA 2V55B 4R2IA 4R3NA 1ZM7A 4RK4A 3VBEA 1SU4A 1PX0A 2XB8A 1YI1A 3D8HA 5CX4A 4BUZA 3WGKA 3FUXA 4GR5A 3OZIA 4RZQA 3J80A 1CULC 2WSIA 4WZBE 4W5OA 3BAFA 3I1FA 1YS4A 5AI0A 2ZJZA 4LDZA 2OQRA 3ADOA 3OPNA 3AVXA 4DW8A 5AVUA 3H5AA 4RPJA 4QBKA 4ZHQA 4N1AA 3GLUA 4DSTA 2DXIA 1UR5A 2VDLB 3O1JC 3DFKA 1DX9A 3M7IA 3GH1A 4LJLA 1XRLA 4FYWA 5CFRA 1QORA 4EQZA 4MTCA 4HDSA 2E48A 5FFFA 1EHYA 5EIBC 3UANA 1FZQA 1EVYA 1ZJ4A 4LJ8A 2IH5A 3R3JA 4ZHQB 5KCMA 4JUAA 2N47A 3QXSA 5K0SA 4KLZA 4RGVA 2AYYA 4GRAA 1LXCA 2ZJFA 4BNFA 3A6JA 1GDTA 4HDSB 4DNFA 5CJ2A 2EFHB 3TLJA 4IICA 1X80A 5TC4A 4DMUB 4UREA 4ARAA 4D9NA 3O9VA 4NV1A 4F71A 3B5IA 1EFRD 1V3TA 4LDPA 3FUUA 3URKA 5DASA 4AX8A 1GARA 2FDRA 4JR2A 1DCMA 1ABEA 1RR6A 3NUZA 5AXAA 2NU7A 4J0FA 2D1FA 1QDLB 2PL9A 3WG9A 2VDQB 4XWAA 4BMVA 1Y63A 2QD2A 1OGIA 4BB0A 4ZYZA 1X1QA 4YYEA 4YQFA 1YAHA 3R7SA 1Y1SA 3H42B 3HYCA 3I1JA 1C14A 3UQZA 4CM6A 1M8KA 3LHFA 4C5CA 4P0PB 1K6XA 3WZLA 1USUA 2NU7B 2VYVD 3STWA 5BNFA 4AICA 3RODA 2X0RA 4UBKA 5H16A 1QG2A 2ZUDA 3IYLW 4A82A 1J4AA 2C88A 1BHJA 2RHDA 2VTEA 3HACA 4BBJA 3QEJA 5ITWA 2B4AA 3N0VA 3WBBA 3PDJA 3TPCA 1Z15A 3F1LA 3I3OA 1SBNE 1XD8A 4IRMA 2WKPA 3T9DA 3ET4A 4BIIA 4G9GA 3T5PA 1J0EA 1SZDA 4B3TB 4N12A 3H05A 3H1FA 4NFYA 3UGKA 1G66A 1QO7A 2V7TA 1KRWA 1EDEA 4DIFA 1WXIA 1HNNA 5JWHA 1QYRA 2TS1A 2EG5A 3VI4B 5FORA 1KXZA 3R24A 3OT1A 3GPCA 2VCYA 1ZXXA 3F2VA 5JHGB 3C3BA 3G2MA 5J4YA 2B35A 2PFSA 3MINA 3OUUA 3P9CA 3F6YA 2RFLA 1O6BA 5DTJA 4AUKA 1T0BA 2OHOA 1YFLA 4M7PA 3RG2A 4PS0A 5E7MA 4J7UA 4DXDA 2IYZA 4IWXA 2PXXA 3G13A 1PD0A 2AG8A 1CJUC 1SPBS 2HF2A 5ALQA 1M7GA 1QPGA 3CUSA 3IGFA 4RE6A 4DC9A 3OT1B 2YY7A 4JITA 5G41A 1T35A 3SAJA 5H68A 5DLQC 2OLJA 3MINB 4QBIA 3F7OA 3A6DA 2UUOA 1PS9A 4U7JA 1UZAA 3VKGA 4M8KA 5KNDA 2EARA 2IWHA 5TMBA 4YROA 4H3HB 3E9ZA 1KEPA 4FI3C 2IU6A 4M1YA 1SIWA 1CEXA 1ZNQO 3NFYA 4FS8A 4TV9A 1NRXA 3HU5A 4XWWA 4HAOA 4FKBA 3SHVA 1V5GA 1WUTA 1NW9B 3ON5A 2ZULA 4WIAA 1PK8A 1W34A 2D5IA 1N1DA 5TJ9A 3ONDA 4GF5A 4DY4A 5L4SA 1ETHA 2YJ6A 1WV0A 3K8YA 4D0LB 5JYDA 4C3ZA 3CZRA 4PG8A 5K8UA 4TV9B 1S6YA 5FYQA 1TVKA 1SJ9A 2D62A 2J08A 4F8YA 5C53B 1AVTA 2FR1A 1X77A 1AXGA 3D3KA 3JQ9C 2EVWX 4OA5A 1EB9A 5EESA 2VWGA 1PTJC 1Y5LA 1P8JA 1XOIA 1Z6ZA 3H0KA 5DCYA 3W1WA 3CE6A 1FIUA 1HDEA 1SKAA 1QTIA 3ULKA 2VDUE 1T9DA 2ZB2A 4M54A 5TVGA 1TVKB 3VPFA 2R1ZA 1PDOA 3NAZA 3OU2A 4PY2A 3IVCA 3NBMA 4RH3A 4H7HA 4FZJA 2QM0A 4OQZA 1YA8A 2GAJA 4ZP1A 1MMFB 5CFQA 5K4GA 1WEKA 1QKIA 3LLMA 2PE5A 1REQA 2SHKA 1ZUIA 3RT1A 5KX5F 5KB3A 5DCWA 2Q45A 2INGX 3LP6A 3OQPA 1HDIA 2I66A 4G4JA 3TNFA 2Y8EA 2ODTX 4J0KA 1R5JA 1XZMA 2FFJA 4FDLA 4E5KA 2WF7A 2O8BB 4ND5A 1UZUA 3G49A 3GLFE 4QPNA 1TZMA 4PANA 4MWGA 1MC8A 1Z6GA 3G0OA 3I01M 3W77A 2VLIA 3F6CA 2ZBUA 2J09A 4ILKA 1REQB 2PO7A 3L79A 1A9SA 2OBFA 3PX3A 4PSAA 2CKMA 1HFWA 3UT0A 4C2BA 3C6BA 3CUTA 4LSWA 4RXUA 2JRCA 4D92A 4L9WA 1I32A 4MSUA 1XMQB 3UTDA 4DREA 3IT2A 4OI0A 3KD2A 4P3XA 2UXCB 2CK3D 3HXPA 3BOSA 1G1AA 1T2AA 3BIOA 1XC7A 2B3TA 4NL4H 5HGXA 5K1ZA 3EGCA 1Y7IA 3P26A 4PGHA 2B2XA 3N0TA 3ZVKA 4ND3A 4DGQA 5ED0A 4WOCA 3R7DA 1RKVA 3CW9A 1NVGA 5ALFA 5L7YA 3T38A 3PLAE 3SR4A 2Y1XA 1D6SA 2Z5LA 3QVLA 5J4HA 1YCFA 4KXQA 4TUYA 2LXNA 4WCDA 4LNUB 3ABSB 1RTTA 1T9BA 2A0FA 1CUJA 2J4CA 3KHSA 5DMXA 5EMJA 9LDTA 3KOYA 5IUJC 2GPBA 2PUEA 2OMKA 2W6JA 3CA8A 2JFPA 2WILA 3QW4B 3R6TA 1UJ6A 1E7SA 2PQMA 1RCTE 2VEDA 2JIBA 2BYTA 4P84A 4TUYB 1AXRA 2N75A 2P9HA 2ZYAA 2D4AA 3B1VA 3BIWA 2IYFA 3M1AA 4NNJA 1Q1NA 3K71B 4DR3B 1YA6A 1HDOA 3C4JA 4ZO7A 1XFAA 3CUVA 3GP3A 4EZEA 1Y3BE 3HFRA 2CSUA 3C24A 3SIRA 4ER3A 4EEXA 3QBDA 1BOFA 2CYCA 3LQYA 4AUMA 4HP8A 1XPRA 2B1QA 4DC1A 2GBLC 3WDLA 1QIJA 2ZYSA 3PQ7A 4DRYA 4TSFA 2I78A 2JZNA 3LXRA 1U0BB 1MOSA 5JS7A 4HDRA 3K4PA 2IODA 2EKZA 2ST1A 2PNFA 1H3NA 4MCIA 1E99A 3WISA 2EJUA 5C52B 5E1DA 4NZZA 3ED1A 2FVXA 5ENVA 1ECCA 4TZ0A 4D3ZA 2BUCA 2O0LA 4MINA 5IWCA 4KQGA 4D98A 1FXWA 1U81A 1R0WA 4PN7A 4ENPA 4HDRB 4MRRA 4AO8A 4DPMA 3OP4A 2OBYA 1R88A 3KLPX 2BFEA 3LBAA 5LUBA 4C06A 1BDIA 1G5TA 4DIKA 4TL8A 4YDRA 4MW2A 2K6GA 2F4VB 2BHSA 3B1FA 2JK1A 2B1IA 1E7WA 2B4QA 2H63A 2K87A 2R1VA 4TRRA 5T67A 1H2RS 5C7IO 2FI1A 3N3BC 1ISFA 4G1VA 4ZZ0A 3VX3A 1Y7HA 3MT8A 3U48A 2ZI9A 4Y9UA 3QXCA 4V02A 4EITA 2VCHA 4B71A 4UM5A 4ZOLA 3DTNA 3CKKA 4YRTA 2F1HA 1E0AA 3D0KA 1DV1A 3MJTA 5B6JA 3ER9A 5ERGB 2DFTA 2BFEB 3LVQE 4XKJA 4MWEA 2GEBA 2K2WA 4U7PB 1JHQA 1J09A 1FSSA 4TMTA 3TBHA 4E09A 5DGTA 3TDKA 3PEUA 5CGZA 1F14A 1BXGA 1WP9A 2PH7A 4WQMA 1Z0FA 3TXYA 3LT2A 9MHTA 3KR0A 3MAAC 1QNLA 4QNRA 4ZOLB 3TI9A 1W0KD 3DDWA 4GD3Q 4MVWA 4L27A 5F2NA 3JWEA 1ZH4A 1UQTA 1N6LA 1V8ZA 1Y33E 3PQ5A 4Y6GB 5BNTA 1WABA 3IAS6 3O8QA 4K3UA 1Q2XA 1GNQA 3WK9A 2C4KA 1PJAA 1JZQA 4E5MA 4OXRA 5TGDA 4WESA 1UP6A 3L6BA 4KGXA 2DWUA 5EKUA 4GZMA 3PUHA 3T5GA 1OVGA 1WDWB 4OVKA 2BKVA 2EQ5A 3E8SA 3ITEA 3JZAA 4BMNA 1DQSA 3O8QB 2F3PA 3RRBA 5FWAA 2BZGA 1K7CA 3ER6A 3A2NA 1IY8A 4ZAYA 3RGWS 1X9IA 2RKOA 3OPYI 2QP9X 4YK7A 1BE8A 4WESB 5EE3A 1YDWA 4G8DA 1Y1RA 3TMKA 2FE1A 1THMA 2IGTA 1XEWY 3I12A 3IULA 3ZCUA 1HNZB 2IYPA 1U2EA 4U8HA 4XLZA 3ILXA 4RHEA 1KGSA 3RS9A 4TX1A 1XA0A 4TRJA 2MSCB 2GA8A 4UHCA 4HB4A 3TNYA 4CKEA 3A3YA 4FHGA 2JGRA 1M34E 3QHPA 2YV1A 1E9EA 4CQMA 1B6GA 5BWBA 4D9MA 4ML3A 2VPTA 4PYLA 5C5EA 3DTYA 3KHUA 2QVXX 3DPSA 4J9VA 4C7OA 1IN8A 1JHAA 3AVPA 3C3WA 3JQ9A 5FNVA 4M53A 2H48A 5DSZA 3ABRB 3VPXA 5LQNA 4H1TA 3C5EA 1PTJA 2CF5A 3FPFA 1XZGA 2WA1A 1EWKA 4UHJA 1W0CA 2QGFA 3LQ2A 1IOWA 2J48A 1IHUA 2CEAA 3HJAA 1VCHA 4R2XA 3SYKA 2FPXA 1PWEA 5EJ8A 5KJCA 1A8IA 2HB6A 3IOEA 5TT0A 3NIDB 5GTDA 1OBCA 1GR0A 2NWQA 3V2IA 1Z74A 3TLAA 4OIMA 5FNVB 4XPZA 5HDQA 5FV4A 3NBKA 2IYNA 3R3UA 4EUSA 1DTSA 2GD6A 5JVDF 3O0DA 4TS3A 3RSGA 1HETA 5JPIA 1YIDA 1FDTA 1YR1A 2QVZX 5EFZA 1TDJA 3SQMA 4EA8A 3R1IA 3TSZA 1XRQA 3DTVA 2BFPA 4MUIA 4DCGA 1SCNE 2D6FA 3ZWPA 4JT2A 2E37A 1UBUS 4BRUA 2E0IA 1DBSA 2FV8A 4DBZA 4F38A 3FFAA 4OK6A 5AVWA 1ZD9A 4BJ5A 4ZKDA 3UC5A 1KAGA 4JSYA 1QJ4A 1PKEA 3CBGA 4P8RA 3E8XA 4HWKA 3EIOA 3IVAA 3DTVB 3NJ4A 2JD1A 3E82A 4WEQA 5DXFA 2SNIE 4C0AC 3DVQX 5DP1A 3QKRA 1Q92A 5JCJA 3DXFA 3JR7A 5LC1A 1LDEA 4IGAA 2Q5LA 3I9V1 1PX2A 4HBZA 3TTXA 4UFNA 3FGNA 3KO8A 1G8AA 3FNRA 5HOEA 1GTRA 4C21A 3BYZA 1P4AA 4YCBA 3O91A 3T1VA 3U4MA 2QMYA 2G36A 3B3GA 5KVAA 3DHVA 4YP5A 4C04A 2ZJAA 5D86A 1MH9A 2WVHA 1D1QA 3KU4A 4Q0MA 4QWMA 1C9YA 1IBLB 2CD9A 3QKRB 3RLFA 1UAAA 1PS0A 1KGDA 1UM8A 2H8KA 2RHBA 1PQ4A 4HVLA 4DANA 3DW3X 4KMMA 1Q14A 4MVJG 3NM4A 3VR1A 4FGLA 4GH5A 2ZBGA 4ZAGA 5I7SA 4BO2A 1NRJB 4WOBA 4TMYA 1M2VA 3D7SA 3NHPA 5JRDS 2O4UX 1O96B 1FJXA 1EUYA 3JZFA 4BBZA 1VJRA 1QYDA 5ALRA 1IUNA 4EUKA 3WVNA 2CLHB 1T5IA 1Y37A 1Y82A 3LLSA 4GICA 1L4MA 3SEAA 3KK0A 3DKRA 3JR3A 3PK0A 4WLFA 5IKOA 5AKYA 1LCIA 1ZIXA 1LKZA 1UJ2A 2HNAA 1T4CA 2RB5A 4JBGA 1IEXA 4YI3A 2GBLA 1M2VB 5HKKD 1YZGA 3AG5A 3ZV4A 4C4RA 3VPDA 3ZVNA 4JI3B 4E7OA 1L7MA 3LUDA 4FYYA 1XZPA 4QTUB 2G4VA 5KVVA 1CY0A 5DEIA 4LC9A 4H7FA 1FX1A 3THOA 3WA7A 1G4HA 4JEIA 1JKJB 5CW2A 4YA6A 4HWRA 1T8WA 1NSYA 4L5JA 2C9DA 3PD0A 1DBPA 1DQZA 4WLOA 1GVNB 2UZ4A 1X7ZB 2HT6A 5L3RA 5CXSA 1PZGA 1KR5A 5KUTA 3WLHA 1EZ4A 1JR4A 2BD0A 2WWIA 4KXMA 4G56A 4V0NA 4J1SA 1SEVA 1WZUA 1Y98A 2IYSA 3L2OB 4BJ6A 5A1JA 1VL8A 2X77A 4EZIA 2ZYGA 1OLUA 4NULA 4NOKA 2VH2A 4B3HA 4RVOA 3G0IA 2ZGVA 4AIRA 3MFQA 1PV2A 4YJFA 3T0FA 1QE3A 2V8BA 3MELA 3OJCA 2QR2A 1INLA 3B8HA 5DJ5A 4S1NA 2EQBA 2HD4A 5FIUA 2X5XA 1Z63A 2WPNA 1YVRA 3P71T 3JQGA 1YL7A 3P9ZA 4N49A 3EXIB 1OBFO 2ORED 3VSCA 5HQTA 3NORA 1OLUB 5GJVC 2CHGA 1SCAA 5FA8A 1NT2A 3AF0A 4BZWA 2A14A 1KDVA 1XDGA 4DARA 4K9PA 4R9VA 1P2FA 3F4KA 1DXYA 2Q9UA 5JSUA 3GHYA 2Z2ZA 1X6VA 3ZV3A 4HNVA 5J4LA 2IBTA 1Z37A 4AKHA 1Z13A 1XL1A 2QRGA 3I9NA 1ILWA 4IIHA 1IUKA 3KSRA 5DCLA 1XLVA 1WUHS 3KLNA 3VAZA 3H0CA 4DB2A 3BS4A 4KZKA 1TUEA 2JFZA 3CR7A 4MAFA 4TKVA 4XVUA 5I4BA 2AJDA 1N0WA 1XALA 4Q66C 5FTMA 1DBVO 5B3LA 5COQA 5CXXA 2JAUA 2YXLA 2VF7A 4JVLA 4COKA 4PYNA 2PYIA 4KVGA 2VUUA 3BRQA 4FFNA 3UHAA 4Z4FA 2Z4TA 4QQKA 3OX3A 4PYMA 3DNFA 5E7JA 1PNRA 4CV1A 3ZS8A 4BBPA 1Z8FA 4DSNA 3QPUA 4WMLA 4HDCA 4RFVA 4POOA 5HJ5A 1I3CA 3HJHA 5H4GA 1L5RA 4KYTA 5EWLA 1VPWA 2YVKA 1X7XA 1NFRA 2HIGA 3K8QA 3OF2A 5AKIA 3I39X 4G4GA 4LDNA 521PA 3VU0A 1NQTA 3ZV5A 1MC1A 4Q00A 1HEIA 2XNKA 5EJEA 2OAGA 1QHIA 1NA5A 3HADA 2VZ0A 1QFXA 4F2PA 3SM3A 1FUKA 1P5HA 4GNRA 4M0MA 1ZMBA 5LB4A 5TJHA 1RVDA 4X00A 1I0LA 4LYFA 5EWLB 2JJ1A 3Q5GA 1V2HE 5AM1A 1RYEA 1X7XB 1MX3A 1NE7A 2ZFUA 3ZK8A 3ZTYA 4DMCA 5AW2A 3GPIA 4W63A 2XBUA 3ML1A 4HAYA 1QRTA 1VKNA 4TT3A 3U7JA 3MYYA 4MQEB 1I7LA 4GX2A 1PSDA 5CNMA 4ZAWA 2FH5B 2QN7A 4MICA 1QP4A 1XFDA 2JHCA 2XUIA 5DLDA 1QPBA 2IHKA 3H2IA 5AYVA 3PHLA 3LUBA 3GGOA 4P6VF 4ZI2A 1UMKA 1UBGA 1H4TA 3O31A 4H7JA 1VYTA 3A4IA 1X7WB 1OW3B 1YZKA 1SK9A 3QOXA 4BHTA 1CUFA 3BX1A 1N78A 4M8IA 5KVSA 3DKKA 4P3KA 3CEAA 2BGJA 4AY4A 5CFLA 2A8YA 3T95A 1GUYA 4EDHA 3CZAA 1P2VA 4KPFC 2AJBA 3QUQA 1VDZA 3JAKA 3SQXA 1IAQA 3ZDQA 1JQLB 2LZ0A 3ICVA 3KQHA 3MC1A 2XMDA 4KIUA 4ZALA 1NX6A 4WN3A 1G41A 1IY0A 1GL7A 1Z2DA 2YXNA 1I1OA 4LXUA 3E3MA 2Q2OA 4JBWA 4U7WA 5JY1A 1RXYA 3IUJA 3KT6A 1S2DA 3QELA 5IARA 4KQWA 3RC9A 2AN5A 4DDTA 5M2QA 5AUQA 3U4QB 1WCXA 1ZBQA 4I3GA 2FPSA 3Q3VA 2FX3A 3JAKB 2VJOA 4YJ3A 3IHLA 1FLVA 2OG2A 1NXPA 3BCSA 1YDEA 5JYCA 2NV6A 1NN3A 3PWSA 1M2HA 4H9GA 1L7RA 1UK8A 2IZOA 3DMYA 5HJEA 4IQ8A 3IQZA 4X1IA 4EPXA 2VVTA 3JWIA 2ZTMA 2P79A 3FTPA 3GT7A 3QELB 1IUPA 1XTSA 3EX7C 2TMYA 3AZQA 4ILEA 3AIKA 4FMBB 4HEHA 2FKAA 3IERA 1MUUA 2GKOA 4GMDA 1B0AA 3LPLA 1JEYA 3EC1A 2I2CA 4UUQA 5K3FA 5I7RA 4IMPA 3PWKA 4X1IB 2F64A 2DKFA 4X65B 1IQRA 1JLMA 3OQBA 1P45A 4R31A 5LJLA 3CPEA 2V74B 3R0VA 1V7PC 5LQUA 1Y8QA 4EG3A 1LV7A 1PQPA 2I3BA 4FB4A 1KEEA 4EHKA 1E5TA 2A5YB 2D1RA 3ENKA 4Z7OB 5EE1A 2X2OA 2RGBA 2OUKA 2V59A 5K3FB 1ZHHA 3IURA 3A58B 3TXAA 3H7AA 3WB9A 1JDNA 1I1HA 1XMJA 2AN9A 1G8FA 3SBDA 2VYNA 3PIDA 4YP7A 4KH0A 4AIIA 3WAJA 2WQZA 3T7IA 3IP6A 5CLQA 1HLFA 1P18A 3CVVA 3GEPA 3RVQA 1Y8QB 1KEEB 1QMGA 4ZHQF 5DBFA 2QQGA 1RHUA 2FSIA 3A6LA 3CKLA 3EDMA 4Q19A 1NHWA 2QSYA 3LCJA 1YFZA 4MJXA 4RVDA 4YC7A 4A7PA 1LVGA 1WA5A 4KI0A 1U63A 3TH5A 3AJ9A 4RXMA 2ZB4A 5BW4A 4YCCA 1OC2A 1JJIA 3SF8A 2OCIA 1T6YA 2Y0PA 1IDOA 3R23A 3RK4A 3TD9A 5JAUA 2P3SA 2Q9CA 3CNNA 2JRLA 3E9YA 4IVPA 4Z86A 5AJHA 5ALOA 4ZV7A 3UFXA 1SVKA 4C0BA 3Q7TA 2F3SA 3CX7A 3KLOA 4G24A 2Y77A 1E63A 1I6LA 4P82A 4FR5A 3WSTA 3OTOB 2XWSA 3GMSA 4FW9A 1P3Y1 4NH4A 2A1TR 2YWCA 1EHCA 1VCOA 2PH5A 3LFHA 3R20A 4BLTA 5JXGA 2TRSB 5TT1A 3SF8B 4YMVA 1QLJA 1G8JA 4GOMD 3UFXB 2VHUA 1W88A 1ORHA 1E79A 2OXRA 2GKSA 2IY9A 4J75A 2AXPA 4UHHA 4YRDA 3RTBA 3WFZA 4BQRA 1RKQA 2ZUTA 3TZBA 5JMTA 4F3CA 1OI2A 3GAFA 3K20A 3GB9A 3EZFA 4DLSA 2D5BA 4FBMA 2PX3A 2X13A 1XA4A 1TA0A 1W88B 1P2BA 2W2XA 4LJ5A 2VTBA 4BXOA 3L0OA 1SB9A 2CKDA 2O0MA 4US0R 3R5TA 4II2A 4OQLA 5EXTA 2ZJ8A 5ULLA 5JSQA 4QVKA 4EZBA 1ML4A 3QVJA 4IV5A 1C3OB 4Y18A 4YUAA 2PXCA 3GT0A 1NDQA 4D79A 5C7LO 2Y92A 2EAUA 2X9VA 2ZW9A 3D5QA 5B12A 1NT4A 2I54A 3A4VA 4P0QB 4AZTA 3TUJC 3NIBA 2VTBB 1LV8A 2PKXA 2QR5A 3LT5A 4PAMA 2C97A 3PS9A 3TD2A 3W5BA 1HFKA 2BM1A 4JJEA 2Q3HA 3A1FA 4MO2A 4K5QA 2OOKA 4N54A 1FSPA 1XZNA 1SHTX 2R8OA 4ZU6X 1KY5A 3KZNA 4CF4A 1GXSA 2IYQA 2EBHX 4XSVA 4CN8A 3Q3IA 5AW8A 2QLFA 1LI7A 2BMWA 4N5HX 2CV0A 4TTQA 1C2TA 3OVMA 2CJFA 1G7RA 3GCWA 2YOFA 3DLTA 1WDTA 1J70A 2YV2A 3DBHA 3IOMA 3CVUA 1E9VA 3TOZA 4BVKA 4GG1A 4MUKA 3CF4G 2WIJA 3K0BA 2P9FA 1KE1A 1QRRA 1GXSB 3IAXA 2IUUA 3WQQA 1KS9A 2DHQA 3X3HA 4IDGA 3RABA 3QQ5A 4ZU1X 2ZS7A 3FLAA 2GXQA 4RKRA 3KSUA 2W00A 3DBHB 2C03A 4MHOA 3V1TC 3K70D 4LKRA 1M72A 3PHIA 4B0PA 4OX9B 3BFKA 1YKFA 3L8YA 3A1WA 5J1SB 3ZZ1A 4FNOA 3WLPA 4D8XA 4RMJA 5H02A 2ZG6A 3O2SB 1CZOA 4TV9F 3MK31 1VSQA 3SDSA 5HA5A 5JS1A 2L2QA 4BN0A 1KJ8A 2WB2A 3VC2A 3R3YA 1M5UA 3HY4A 4P58A 1Q7BA 3OA2A 2BKEA 5ESDA 3HSSA 3IMFA 3TN7A 2RSLA 1KIMA 1FX0A 1T0UA 3C3XA 2F3UA 4URFA 3IUSA 2HPZA 4K40A 4TLMB 4D2IA 2XMGA 2I1VB 1LK0A 4HSEA 4IS2A 2D1TA 1ZN7A 1CY7A 3VO8A 5HZHA 4LCBA 4MVJE 4D99A 2I5PO 2CHFA 1JI0A 2ZUSA 3ENNA 3WZ2A 1PGNA 3PSAA 4NFLA 2HO5A 4Q1EA 1VPEA 3SYLA 2UVPA 5CEFA 2L0XA 1ZGGA 3CIFA 3AU9A 1MJGA 1H0RA 1BZYA 1HPLA 1I30A 1RXSA 1M1YA 2AW3A 1C1XA 1FX0B 2I3ZA 2VF8A 2XMPA 4RIHA 4W99A 5KAPA 4JVNA 1CQIA 4PZ9A 3NIFB 5FBHA 3I01A 4ALNA 4BMOB 3PCXA 1HDZA 2YRXA 1OFUX 4NARA 1N8SA 1TYZA 4WK4B 3IALA 4HUQB 3EEBA 2D3TA 2EFGA 2A58A 1DOHA 1XB2A 2UVPB 1VLJA 3QBVA 4Q4DA 3CN7A 3PYLA 1L5LA 1M1YB 1B6RA 4GM1A 4I4TA 1EXWA 2V54A 2PUTA 3EVEA 1KI8A 1NOIA 1CQIB 2ZETA 4ID9A 2QRLA 4CGYA 5AXDA 2VSQA 5CLGA 5J43A 1PYOA 3V1LA 3HCDA 3K1JA 1E3SA 4HWGA 2YJ5A 1DQRA 4WHMA 1YKGA 3OZTA 4N5DA 1I2MA 2CVOA 4PLPA 2ATIA 1EK6A 4I4TB 3AT1A 4BWVA 1PVVA 1ZGZA 5JNWA 3EBPA 4KE7A 3V80A 2R6FA 1U94A 3KR2A 4MEAA 2ZSKA 2BJHA 2ZBRA 2BDUA 2ZOSA 3FSJX 3NLLA 4ITUA 3DJFA 3TAHA 3W5VA 4U9HS 3E5HA 2Q07A 4IZ6A 2HA6A 2DQ4A 2XNSA 5H5JA 3CZ4A 4RPKA 2AWOA 1WW2A 2ZU6A 3ZZMA 1LRKA 2B9EA 4KQCA 1DAKA 1J8MF 2ZP1A 1WZEA 3OKPA 3OZXA 3ESAA 2CB0A 2PX6A 2VJCA 3QW2A 4IO1A 3D1LA 2JIMA 2G4LA 4J76A 4MR9B 3SSMA 3ZX5A 3ZHQA 1KYYA 1QHHA 3AP3A 2EWWA 1M54A 1O94D 2O2EA 4M9QA 4BCBA 4MGKR 4CT0A 3O2JA 2AHRA 1HGXA 2FZWA 4TUYF 1BHO1 1SZJG 3A6GA 1GTG1 2ZBFA 2QJOA 1E4EA 1JL3A 4MWOA 2CLCX 3V6LA 4DSZA 5LLDA 2Q1TA 3DV0B 4P92A 3WWPA 3QMVA 3LL4A 4RNDB 2XGJA 1QHHB 3WADA 2Z8YA 4LTMA 4OXYA 3PRJA 1J7KA 3WJ2A 4EHDA 4UD2A 1X7HA 2A86A 4ZT6A 4X7MA 1E4EB 1V1MA 4ZYYA 2MR5A 1WDLA 1Q6YA 1V8OA 2GRJA 4GYYA 2QG6A 3S4YA 1WUJS 2DQKA 1Y5IA 2QTBA 3P4UA 4IH9A 3DDZX 3UJ3X 2HKIA 4Z7QB 5KWSA 5EN4A 4EDFA 1V1JA 1FQJA 1Y8AA 3BH6A 4LSGA 1CB7A 1O4WA 4Y0NA 1MPXA 1JKMA 3WK4A 1E2PA 4MKRA 1V1MB 2O57A 3CEPB 5H1YA 3EF0A 3A05A 4FYMA 4KO8A 3NCTA 4B33A 3OH8A 4RD6A 2WBLC 4JSRA 1GUAA 1FXWF 5L6MB 3X1MA 3A6FA 3WGOA 1TCAA 2ZBPA 4LPKA 2CXUA 1FP2A 3AJ8A 1BTOA 2QUBA 3FR8A 3FUCA 3I9LA 4IHJA 4PC1A 2QE7A 1CBUA 2A1IA 4KUGA 2EX0A 5F9FA 3EVZA 3Q0EA 1RLJA 1UXHA 3PHHA 3QX8A 4LF4B 3KQWA 4I8DA 4WK2B 5DNCA 5GVSA 4GX0A 1O89A 4JT9A 5CK5A 4CKYA 5IP5A 1ULZA 2FPIA 4ZOLF 1MIHA 1RAHA 3D6AA 3H6KA 4IHJB 1YH3A 1FDUA 4LQDA 3VPAA 4X3PA 3M4JA 4L8WB 1EGHA 5GJWC 3WLKX 1KC1A 3OMLA 5IVHA 1SRQA 1ZJYA 3OZVA 4JUIA 1E4OA 4Y2RA 2FMUA 3EPHA 1LVHA 1Z16A 5HKBA 2DLDA 3GJ8A 4YT8A 4KHZA 4UBJA 2CN1A 2FPIB 1IG0A 3P9SA 1P29A 2VQEB 4AZ0A 3F3SA 5GAJA 5TGTA 2Z6VA 4J4HA 1X15A 2E49A 2EFDB 3IODA 3TVDA 4D6XA 3P9NA 5LYJA 1Y4UA 3H04A 2ISQA 1K8ZB 2CEKA 4ALLA 3L4BC 3RNOA 3USES 1C80A 1XZEA 2G77B 3H3JA 3QBJA 5HRAA 3BPSA 3ERCA 4G63A 4L95C