3KQHA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 142
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqhA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA01
4TYQA 1XEWY 1DPFA 1YU9A 2BMDA 3TNFA 4DUGD 1WDTA 2REXB 4M1YA 4B3GA 3WBJA 3LVQE 3FFBA 1K8RA 2BDTA 1Q1BA 4C4PA 3U5ZB 2HLDD 4YXWD 4EPVA 4NYJR 1XTQA 2VEDA 3QNUA 4LC0A 2YOHA 1MOZA 3OFNA 3CF2A 2X2FA 3GEEA 2QI9C 1H8HD 1SKYB 2ZEJA 2R9VA 2ZPTX 4FMBB 5BN5A 5KOYA 4HAVA 4PSKA 2H16A 3MWYW 4DLUA 2O8CB 5BQ5A 4LDJA 2DYKA 2ZI9A 3SFVA 4LCBA 2WICA 4DWJA 2WWYA 4OYHA 4BFTA 1AZTA 1S1MA 4IVRA 2BC9A 1M74A 1OJLA 1OKKD 1Q12A 2OV2A 1MABA 3TAHA 4O0MA 3QSYA 4A15A 1H65A 4W5WA 5SZHB 3PEUA 4AKEA 3CR8A 5IHPA 4IKEA 3OESA 4HAZA 4MKHA 1E1QA 5TMPA 3RAPR 4ZDIA 5B58C 3FHCB 1AKEA 2EFHB 1H8EA 4DLRA 4NHOA 1OHHA 2VP2A 1UEJA 521PA 2VP4A 4W5HA 4HLUA 5EXXA 4AG5A 2V8OA 1SXJC 4JVMA 3F3YA 4L16A 3EC1A 3M4YA 4A4DA 2PCLA 1NVVR 4D4LA 3C5CA 3HWSA 5JS7A 2GJ9A 3AVPA 4A36A 2W2XA 1DTSA 5DN6A 4AY2A 1XP8A 1F2UA 2FFBA 3AF1A 5KDOA 3WYGA 5B30A 2PZEA 8OHMA 1A5TA 1I4TD 1DEKA 1NLZA 1KZGB 4G5QA 3MFYA 3P26A 4A82A 1QHGA 1R0ZA 4EQ6A 1JPNA 3MWLA 4JL8A 1Q0UA 2VHTA 1OSNA 5J4HA 1A2KC 3QKSB 3TSWA 5L8VA 1GRNA 4BASA 2CLDX 4JLOA 1FP7A 5DSZA 4M0LA 3H2YA 2P6NA 2N46A 2OT3B 2ZVQX 2IUSA 1G8FA 3DVLA 4R9UC 2R8RA 4LJYA 3SN6A 1YZUA 1G3RA 4QNRA 1P9RA 1AA9A 1AGRA 1KO5A 2QE7A 4QJ3A 1IOZA 5EE1A 2BWJA 1GDDA 4M1KA 2A5YB 1RJ9B 1IXSB 1NKTA 4A8JA 4MYUA 3NH6A 2WKPA 1G5RA 4YMWA 3KJEA 4M9QA 2ZQ5A 1N0UA 4URYR 3EZ2A 4HUQA 4PXAA 4LYFA 4NCKA 4MRSA 4CDGA 4QC2A 4M9ZA 1GKUB 1M1YE 4PC6A 3KJHA 4MA4A 1R0XA 2GEVA 2GETA 4P4SA 1E6CA 2W6IA 3MAAC 3ZZTA 5HZHA 1CIPA 2EFEB 2YINC 1IN5A 2JIZD 2YC2C 1XCGB 4LWZA 2RHMA 3F5FA 4OQXA 5CK4A 3K0FB 1RYHA 2XX3A 1CKEA 2D3WA 5LPNA 4DT1A 3ZVNA 1B0UA 2HXSA 2ATVA 3KTAA 1OXXK 2WMOB 3KQUA 2ZSBA 1JEEA 1RYFA 2G77B 4LYHA 5DE3A 1WQ1R 2NO9A 4HZIA 5FFMA 2JLYA 3AKCA 3KKNA 2O52A 2ZYWX 1W0KA 2NO6A 2FSFA 4NU0A 2GAOA 4KBGA 4OJKA 4JLAA 5P21A 2Q0HA 3OIVA 4B34A 3QUSA 3F8TA 3EA5A 1M34E 1ZD1A 2CNWA 1NP6A 4Z8YA 2HCBA 4TT3D 2IXEA 4LYAA 1U0JA 1ZU5A 4XSGA 2V7QA 1IY1A 1OF1A 4LC1A 3T1TA 4PO9A 1E0SA 3K0CC 2PMKA 1DO2A 4F91B 3QXHA 1Z8FA 2HJGA 5FBQB 4WA7A 2HXYA 3RSOA 4YMVA 3CNLA 3PUXA 3ZS8A 1OB5A 1N6HA 2ZI6A 3LH5A 4F4IA 4Q1AA 5KSZA 2E9SA 1ESMA 1SXJA 3TUIC 1ZIOA 2ERXA 5CJ2A 1BKDR 3P4XA 3L8YA 1TQ4A 2QGZA 4W9MC 1COWD 3H0KA 2KBFA 3K8YA 2IX3A 2R6CA 3BBPA 4PQRA 2FV8A 1BYIA 2C03A 3TW8B 2J0SA 2JLZA 2OBMA 3WP1B 2J3EA 4KHZA 3V4FA 1CBUA 2DY1A 5L3SB 3S1AA 3AH8A 3TAUA 2V1UA 4FWTA 2VF7A 2JATA 1S2MA 5JFGA 1KI2A 2H5EA 4CVNA 1XNJA 3MSXA 2RGNC 5FOUA 4AKHA 1S1CA 3CIOA 1W44A 4FMDB 5AWFC 1IBRA 2IYZA 3KXIA 1YJ5A 1E2GA 2ZE6A 2WJYA 1FOEB 3PVSA 4IDPA 2JJ8A 2QMEA 4JLNA 1P2SA 2ZRKA 1LS1A 2Z4RA 2ZUBA 3AP1A 1KJYA 4K8OA 5M04A 4URXR 1OIWA 4RZ2A 1KSGA 5EE3A 1U98A 2ZI7A 2CHGA 4FCVA 5GJWC 3VHLB 5JSZA 4FCTA 1CLUA 4CT4B 4DSTA 4NL4H 4PPNA 3A6PC 4L9WA 4L9SA 3W6OA 3GFPA 4GMDA 4AD8A 3AVTA 4IDOA 2L0XA 2X19A 4AK9A 4HATA 4Q9JA 1I4LD 1VKJA 1IY0A 1XU4A 4TMTA 4D80A 5DNYB 4P33A 3A4MA 1YZKA 4MDEA 2FZ4A 3PEVA 5JECA 1R2QA 4TQ9A 1KTVA 4F92B 2GTPA 5DGXA 4U7DA 1QVRA 3EPHA 2IBMA 1NG1A 3OE7D 2V9PA 2D06A 4TYWA 1OH7A 3BXZA 2H57A 4H9GA 3FMPB 1Z0DA 2WKRA 2PLFA 3IILA 4DDVA 5CDFA 4CEJA 3CB4A 3M0EA 4O25A 4M9XA 4RFSB 2ODEA 3ONWA 2VHJA 3RWOA 2OEPA 2IYSA 1G21E 1S3SA 1R8QA 4XWKA 3I8XA 4PANA 3SFZA 1ZC4A 1E2QA 3THYA 2PMDA 3GLHB 1J8YF 5H68A 2GKSA 4FMCF 2AXPA 1OYWA 1GNQA 2ONJA 3RS5A 4Q1FA 4TSFA 3PUVA 1C1YA 3GJ6A 4DLSA 4QXAA 2CXXA 3LRPA 4DT1B 2YV5A 2QRZA 3SJBA 3OEED 4Q48A 2OSBA 3ZD6A 4BLTA 2V6JA 4LHWA 4TL9A 4U02A 1YRBA 1VIYA 3QF4A 4Q19A 1FNNA 2QM8A 1BO6A 4RD4A 1KAGA 1W5TA 3REFA 2Z83A 3R8FA 3P1JA 1G3MA 1UKYA 2IF0A 4TYYA 4QM7A 2ORIA 4WBSA 2Q9AA 2OESA 4A0FA 2ZITA 5H1YA 3DPUA 2VRWA 1HY3A 4N0EA 5D3MB 1Z08A 4Q9IA 5FTMA 3WMFA 4LX0A 3GMTA 1G7RA 4M1MA 3ND9A 5FI1B 1AN0A 3D8BA 4TTQA 1YR6A 2X77A 1OPXA 1XTRA 1UAAA 3B1YA 1J90A 1E79A 4NE2A 4V0OA 3KB2A 4WW0A 4BLPA 2CCGA 2JCSA 5E7JA 2DFLA 4X8LA 4MYTA 3KJIA 1VG9B 2G0TA 1KIMA 3CBQA 3FTQA 1P6XA 2VO1A 2O8DA 1G5PA 2CEAA 121PA 4LBZA 3TSZA 1GNRA 4KJZA 1L7VC 1SVOA 2F43B 4D4KA 1L4UA 1LFDB 1OFIA 4HLCA 3T35A 2DFNA 3K09C 2WSSA 4NKRA 4ZI2A 3SC3A 3FHTA 4AKGA 3SE0A 2C78A 4IEIA 2C9OA 1VIAA 2JDID 1IJEA 3QKTA 2YZ2A 3RNLA 3B1WA 4ABYA 1W2GA 1FZQA 3I3SR 1E69A 1ZC3A 3BFXA 3KQKA 1GRQA 5IK2A 3VR2A 1OFHA 4RJLA 2REBA 4LHXA 1I4DD 1M7HA 1Q1EA 2DWQA 4J0QA 1XX6A 1E2MA 3TLXA 3E2IA 4ZCLA 3UANA 2TMKA 1E0KA 3CPHA 5JHGB 3ECCA 1TADA 1Z07A 4UKDA 4WOPA 5A5GA 5JEDA 5KNBA 3UWKA 3KUDA 1E99A 1KKMA 1FUKA 1RRFA 4KYUA 1UJ2A 4GMXA 4GP6A 5GJVC 2FZLA 5LDDC 4NYMQ 4R71A 2XNSA 4Q4JB 1T3LA 2Q9BA 5EP4A 4RZXA 3AM1A 1X1RA 2OCAA 1ZRHA 4OK5A 4Q4HA 4L4UA 4QGFA 2UVQA 4PAMA 4DCTA 5J47A 1TNDA 2QMOA 4Q7LA 5JZVA 3V00A 2OFXA 4KLZA 3GPLA 1E9FA 3MJHA 3NEJA 5DO9A 1G7TA 1GIAA 3EG5A 1QDEA 4RD6A 4A1FA 1L8QA 5HKKD 2I3BA 1RW4A 2HT6A 2ZE8A 1NI3A 4BFYA 4GOXA 4I81A 1KKLA 3L0IB 3U3OA 1CRQA 2FPMA 1XZPA 3C16C 3CF6R 1KO1A 3AUYA 3RHFA 1SVWA 3KB1A 1T5LA 2P2LA 4B3CA 1BS1A 1J8MF 4Q4AA 2SHKA 4MRVA 2AL7A 5JMTA 2QORA 1Z29A 2DBYA 1WCV1 1A7JA 1CR4A 3B1VA 1AM4D 4QL3A 4B76A 1ZUNB 1II0A 4TLCA 5H70A 4Q03A 5ANRB 3WP0A 3FHOA 4JZKA 2AXNA 2GF9A 2ZRGA 2YOGA 4QOSA 1Z0AA 3BD9A 4PAOA 4X8HA 3UG7A 2IS4A 3KFVA 3PUYA 4MUBA 4N3NA 4URVR 2DR3A 2JJ1A 3RRZA 2VHCA 1E9EA 3SS8A 2YOFA 2YWFA 1TQDA 2ZJYA 3MUFA 1U8YA 3IBYA 1SGWA 1XB2A 4JT4A 3IHWA 4RZ3A 1VHLA 1EX6A 1X3SA 4NH0A 2RGDA 3AF2A 4R7ZA 4AYWA 1SXJE 2ECKA 4PAQA 3DKPA 1E2FA 3AVQA 2IWRA 1BMFD 2W6JA 2ZE7A 2QQEA 3EIHA 2HUPA 3GCGA 4FXPA 1RZ3A 2CK3A 2XZPA 4RFVA 3ZZUA 2YVUA 3OEHA 4PHGA 1UBGA 2XNDD 4JLMA 1UM8A 2I1QA 4N1AA 5JRJA 1P2TA 2J7PD 3LA6A 3QPVA 3R9IA 2OXCA 2Z0MA 4M1TA 4MH0R 2F1HA 4DVGA 3K09A 3B60A 2O8CA 1MH1A 2P67A 1O87A 3GJ4A 4W7SA 3X1WA 2YNMA 3CNOA 1N6PA 2XZLA 1U94A 1M7GA 2V55B 3SYKA 1JR3D 3RWMB 3LX8A 2XSZD 4JVNA 3VR6A 4QHYA 1QVAA 2GF0A 2OXRA 5DI9A 5BN3A 1AQYA 2V6IA 3ICEA 1AS3A 1U8ZA 3G5UA 1WBDA 2NGRA 2YHSA 2J59A 4P4UA 4DC9A 3CZQA 821PA 2IEZA 2B7CA 4TZ0A 4BFUA 1YZQA 5GVSA 1NNEA 2IYVA 1E98A 3NBZC 1TUEA 2W58A 4TTPA 1N5LA 3KKPA 3U7GA 1AKYA 4OQLA 2ANBA 3KXLA 4RKEA 3VNVA 5EQTA 3U7HB 2P6RA 5FBVB 1ODFA 4IOMA 2JGNA 2OBNA 5JWRA 1G9XA 2Z4SA 2ZU6A 1N6NA 1XEWX 4KYIB 2AN9A 3QY0A 3TGPA 4LBWA 5EUQB 1E1RA 3RSLA 2R6AA 3QVVA 4XOIA 3P20A 5FR1A 3VR3A 3X1ZA 1J99A 2VSFA 3DEFA 2J0VA 5FL7A 3ZIAD 1EFHA 2RGXA 1Z0FA 4QFMA 4MDFA 2GVDC 2CJWB 3PG5A 3WNCA 1YR8A 4M53A 4O3MA 3SYLA 1MO6A 1P9NA 4KV9A 1X8LA 5J4LA 4FWIB 1NY5A 1P61B 2B8WA 2XXAB 2Q6TA 5CDFE 3QKSA 1IM2A 5KTYA 2FEOA 1ZU4A 1HQYE 1YZGA 1GL9B 3W9YA 1XPOA 4EDHA 4PZZA 4GOJA 1E32A 1LV7A 2IYTA 2JLUA 1E2KA 4KO8A 2GNOA 1N0WA 3CONA 3QE0A 4NONA 1OW3B 3K70D 1OXSC 3D7MA 3EASA 2J5XA 2AWOA 1E2IA 1ZD8A 2ZE5A 4YDHB 4BGDA 3TIFA 2O0KA 4U5XA 5SZJA 3T15A 1RJ9A 1GP2A 3A58B 3ZH9B 3ZVRA 3RRYA 1GITA 3LO5A 2G0NA 2IEYA 5LD2B 3CR7A 4I1VA 4OBEA 3LD9A 3GLFB 2J0UB 4ESHA 2QAGB 2VL7A 2RGCA 4JBWA 1KHTA 1NVXQ 3SZRA 5JJLA 1JBKA 1E9CA 2ANCA 4OI0A 4WXRA 2XOKA 1NLYA 2JJ2A 4A2WA 6Q21A 1N5KA 3I61A 1IHUA 2R44A 4TLBA 1PLLA 3NDBB 3SYNA 4DCVA 2HF9A 1Q57A 4TYNA 2LCFA 4HDOB 4I1OA 3K0FA 2A5GA 4YONB 1UDWA 1VYVA 1XTIA 2FA9A 2A2ZA 1P75A 1NY6A 4B71A 4G5OA 3Q5EA 2ZSDA 2ASEA 1LF5A 3GJXC 4NCHA 1QF9A 4HAXA 2O8BB 1RE0A 1FUUA 3TUJC 2ZRMA 2WIAA 4AIIA 2GA8A 5JLJA 1IN8A 3SDZA 5AUQA 1P9WA 2YYZA 2X2EA 1KSHA 2C9CA 4A6XA 2WWXA 3BH6A 2RAPA 2H92A 4RVCA 2LWIA 1KO8A 4CEIB 4ITRC 1EGAA 5KYKA 1XMJA 3RYTC 2B8TA 1AIPA 4RD3A 4C0KA 3U44B 1U0LA 2CMKA 4KSBA 1CRPA 4K81B 1CP2A 1BH2A 1I2DA 2ATXA 4JL5A 4NDZA 4ZCIA 3FFAA 4DEYA 1Z5ZA 2WAYA 4RZUA 2ZETA 4C0QC 2O0HA 2JLWA 2O8FB 1U81A 2PEYA 1II8B 2ZRBA 3FKSA 1FTSA 2F3TA 4MGZR 3BB3A 3QF7A 2BMFA 2BCJQ 1W48A 4A2PA 4JL6A 2O0JA 1T9HA 4F38A 2KE5A 3BGWA 1IJFA 1OXTA 2FFQA 1KK0A 1CJVC 3WYFA 2RB4A 1G16A 3PV0A 4OHZA 3LBHA 5J4KA 2QMUA 1E9SA 5JWHA 1FMJA 1P3JA 3AF4A 3LX5A 4EFNA 3IDQA 1DG3A 1C9KA 1T4GA 5H8WA 4MRPA 2H1LA 1RIFA 1W4AA 2XITA 3K0EA 4KVAA 4LJAA 3RLFA 3Q7PA 2VIIA 4YMTA 2VBCA 3CRW1 4HAYA 4C2TA 1GVNB 2BHRA 2ZYTX 3AVOA 1L2TA 1S3GA 1R4AA 3ND8A 4V0KA 4BUJA 5D3QA 3SQWA 5DHFA 1RPZA 2FWRA 5DIFA 4CF7A 2WPDA 1QHIA 1XJCA 5L3SA 4QG7A 1Z06A 2W00A 1MRSA 4MRRA 3IPXA 3EIEA 4OL0A 1XJQA 1T3HA 2Q3MA 2XGJA 1G41A 1XD9A 1OLOA 4QHSA 2JLXA 1A4RA 3CF0A 1SQ5A 1UFQA 2FDCA 1XFAA 1KSJA 4G5SA 1YZNA 1Z0KA 5CJPA 4BEBA 4D0NA 2DWOA 1DBSA 4EJSB 1WBBA 1ZM9A 4NP6A 4IDHA 3ADDA 3U6KA 4LV6A 4A0GA 2EU8A 2KB0A 1KO4A 1OIXA 1MR3F 4UNRA 1G8YA 3ETLA 3AVYA 1XEXB 5A4JA 4UJ5A 5GJCA 1AZSC 3MRSA 1FMLA 1HEIA 1E2EA 3DM5A 2QBYB 2XB4A 3I5XA 1X1SA 1D2NA 5AJZA 4OI4A 1F48A 3A1VA 1N25A 1JB1A 3AVUA 3NWJA 5FPKA 1TTTA 5K8UA 1W0JA 3K9NA 4CYMA 3KJGA 4DIDA 1NKSA 2ODNA 3C5HA 1A2BA 3VU9B 4GZMA 4PQFA 3SNHA 3WHLA 2PZGA 2FFAA 3IIMA 2OE2A 1XPUA 1KI7A 3C41J 4ZV4A 2MSCB 4DB2A 3T34A 3B13B 1P5ZB 3QXXA 3EPKA 1R0YA 5TV2A 5EP2A 1NBMA 2V4ZA 1CU1A 2PT5A 2QENA 1MO3A 3E5HA 4MQBA 2GXUA 2GHIA 4IVQA 1E9BA 1T5IA 1U0HC 2Q3HA 2ZRJA 5TVKA 1F6BA 4RFSA 3SOPA 2D2FA 1ZM2A 2OAQ1 4YMUA 1G3QA 4TMXA 4HB2A 4Z1MD 4TL8A 1JXOA 3GLHA 5C1BA 4EPWA 2FPLA 4UQOA 3WY9A 2FSIA 3QOFA 4GNKA 1XPRA 3WMEA 4A0RA 3EX7C 1C4OA 4G3XA 1EFRA 4YDSA 4YLGA 1N3BA 3TSOA 4MUAA 2FE4A 5IDVA 2WHXA 2OCYC 5FOWA 1SKYE 1CS4C 5IF9A 1BOFA 2VHQA 1J2JA 2UZIR 1W4BA 2FGKA 4MKGA 2MMCA 5KSYA 4NCIA 1W4RA 1JEDA 1ZM3A 3BB1A 5BW8A 2GXAA 1TMKA 3LY5A 4DUGA 1KYIA 4CGZA 3AGQA 4OK3A 5DISB 4PZYA 1ZAKA 1OE0A 3QKUA 3AP3A 4NYMR 1RRCA 2ZTSA 1E4YA 2W83A 4ACAA 2GBLC 1ZIPA 4B43A 1NIJA 4AURA 2RGBA 1UBCA 1YZLA 3NC1C 1GNPA 3B8HA 2HLDA 1ZNWA 3EAQA 4TSFD 4YXWA 1NSTA 3LQRA 4C0LA 5FUVA 3K0AB 2GCNA 3HYRA 1Q22A 5D3MA 5CM9C 3RS3A 2ZR7A 2NZJA 2ZAOA 3W5JA 2QU8A 4JJZA 1FQJA 1OFTA 1H8HA 2RGAA 4FMCB 4HLDA 3HYTA 5JEEA 3ZGXA 5E7MA 4V0LA 5JRZA 2JLSA 1OH6A 5B2ZA 2P6UA 2ZJ2A 5TY0A 1G19A 3QKRB 3GJ7A 3N70A 3DKVA 2EQBA 2ZSAA 1OKKA 4R2HA 2QP3A 3AVVA 4IDNA 3GLGB 3TQCA 1VG1A 2KI5A 2WJVA 4JLDA 2WJGA 2CLSA 2OUKA 5FI0B 3C14C 3ZLJA 1VCNA 2QP9X 5G40A 3RDPA 4B33A 2CVFA 4G1UC 2A30A 1QHNA 2F43A 1XTSA 3AF3A 2D7CA 3FB4A 4WZBE 1D6JA 5CB6A 4PFSA 4QKQA 3W3ZB 3SJAA 4DLYA 1N6RA 2MSDB 2XJ4A 2ZXUA 4AC9A 2WWGA 3WXMA 3LAWA 2B92A 4JKYA 4OKSA 2ZRLA 3MMPA 1Q3HA 2QG6A 1CXZA 2P5TB 5HCIA 3BFKA 5HTKA 1AGPA 1QZXA 1KI1A 3I62A 2Z6VA 3CWZA 4TL7A 4A2QA 3DO6A 3RRMA 2GCOB 4ASUD 1ESNA 3I92A 4OQNA 4DDTA 5EXSA 3ADCA 5GJBA 2WSMA 5E3HA 2WWFA 4RSGA 2E87A 5FOVA 3CKLA 2VA8A 4GZLA 1KI4A 2C04A 5DYIA 2R6DA 1ZVQA 1DAHA 1JXMA 2PX3A 2RHDA 1PZNA 2C98A 3PIRA 3AVWA 2ERYA 4Q4JA 4Q00A 2WWIA 1WB9A 4BFXA 1YR7A 5IT5A 5AUNB 1KI6B 3K70B 3UKDA 4TMKA 2BOVA 4MGYR 4WVFA 3KXKA 1KZ7B 4Y0AA 1CJKC 3DZ8A 3GLIB 4C0JA 3TUZC 4JLPA 1ZM7A 4G5GA 1CEEA 3UK6A 2PZFA 1ELOA 1N6KA 2QROA 2C95A 3B7GA 3MGCA 2FMXA 1PLKA 4R98A 2MSEB 4BEJA 1XCMA 2YWEA 3DHWC 5F9HA 2HV8A 2CBZA 4Z51A 1T3SA 4LYJA 1JQJC 5FPHA 3SJZA 1IN6A 1E2HA 2R2AA 4CEHB 1GILA 4I1SA 5FTJA 2JIZA 4C0AC 3CRRA 5G53C 4BLRA 3CX8A 1T8TA 2QT0A 4V0NA 4EUNA 2GBLA 4A9AA 2NQ2C 3D3QA 1G1MA 1XXHB 5LD2C 1P2UA 3VKGA 2F6RA 3ADKA 1LW7A 4Q18A 1K5GA 4Q47A 2WV9A 3UATA 2QAGC 3OAAD 3CPEA 3A37A 1W4CA 3QXCA 4M4SA 1S8FA 2QT1A 1E3MA 3B1XA 4H1VA 4ERNA 1MO4A 4B73A 4BZXA 5KDDA 1G5TA 3WRYC 3CRVA 2ZANA 4GPTA 3X1XA 2Z43A 2UKDA 4TT3A 1E94E 1OT3A 1NSFA 1CR2A 4PPFA 4D26A 4WIAA 2PX0A 4DSNA 3EARA 4MKFA 4UXJA 2GAAA 2JJ1D 5DI3B 5KNDA 4O2LA 2C2HA 1M6NA 3FE2A 4IOKA 2IXGA 1ONBA 2JLQA 3BIFA 2ZRIA 3LV8A 4B74A 2IK8A 1UBEA 4JVLA 3AGPA 4QBFA 1KNQA 1Z0IA 3PFIA 4YMSA 1A1VA 1N5JA 421PA 4B48A 4G5RA 3PUWA 3Q72A 4ARZB 4D0GA 1F2TB 2HCJB 1D2MA 3KL4A 4LV5B 4Q01A 1Q3TA 1COWA 3HPRA 2GXSA 2IL1A 3CNNA 1XD8A 2R62A 2VYFA 2AK3A 4YQFA 2V3CC 5FBLB 3U7FB 1FTNA 2FNAA 4RKFA 4QBGB 4JBXA 4NCNA 3T5DA 4DB4A 1U9IC 3KZ1E 4BZQA 1SVKA 4RY2A 1KK3A 4PC2A 3BORA 2R65A 4QGHA 2VF8A 3AVXA 3PENA 1YQTA 3TVTA 5G3YA 3IO5A 3C4JA 1US8B 1LF0A 4TWZA 1IXRC 3UMFA 1JAIA 2JAQA 3BK7A 1R5OA 2IXFA 5B64A 1E9AA 2J41A 4JLJA 3PEYA 3V9PA 2CJWA 1T8UA 5EP3A 3G0HA 5C4GB 4R2IA 1R6BX 1ZMXA 1EXMA 2OAP1 1GM5A 3NTUA 4Z8XA 2OBLA 3D6TB 2RKOA 2FN4A 1J7KA 1NBME 1WF3A 3I73A 3WNDA 4ZDJA 2QTHA 3B78A 2XXAA 2WJJA 1M7BA 3LXRA 5EXPA 3WNBA 3J81k 3VHXA 4MYHA 2F1JA 2BJVA 4RD0A 4B3FX 4BRWA 4DLZA 4L5BA 1KSFX 1SVMA 1GRRA 1OXUA 3W90A 3A1SA 3GLHE 4PZLA 5AJXA 4NTZA 2XTMA 1P2VA 1LTQA 1RRGA 4JT2A 2A9KA 5JS8A 4MYCA 2WAXA 2GESA 3ASYA 1G17A 4US2R 5CM8B 2KBEA 3AP2A 5FTKA 1W1WA 5LB4A 4C0SA 4HEJA 2WOJA 1TL7C 4QHTA 4Q66C 4XVRA 5KNCA 4HZUB 1NF3A 5FPSA 5EP1A 2N42A 1FL9A 2J1LA 4BECA 2BBSA 3C7KA 4EAQA 3GLFA 2J0UA 4B3DA 1V5WA 2QAGA 1G8HA 5DH9A 1X6VA 2ZYUX 4QBIA 1S4QA 1KDPA 1SHKA 5CLLA 2V1XA 3QENA 2I1VB 2YC4C 4WZAE 1BIFA 2B6HA 3W34A 3OF5A 1Z0JA 1GKYA 4QJ5A 1NMYA 2VP0A 2GEDA 4DXAA 4D4MA 4MKIA 2ZR9A 3KX2A 1HE1C 5J40A 5JCZA 3IKJA 2ZRAA 3OEEA 1HUQA 1B23P 1FFHA 4K46A 4GT1A 2JEOA 3O8RA 4LGMA 3PXGA 5L3VA 4GDFA 3K1JA 2O8BA 1VECA 4BZPA 1Z3IX 4KSCA 4DIEA 2IT1A 4B3XA 4IOLA 5FL3A 5J5CA 3RVBA 5C46F 2NMVA 3RANA 4CEIA 2P65A 4A92A 3QBTA 3PQCA 4DEXA 4LJ5A 1LB1B 4DKXA 1W5SA 2IYWA 1XF9A 3IGFA 4MITA 4B6EA 2BBWA 4LJ8A 5KDLA 1WE2A 3U44A 3FWYA 3CUEF 3RS2A 2G1KA 1DADA 3SBDA 1R8SA 4Y0VA 2CE7A 1UPTA 3B6EA 2W2VA 3BC1A 3GJ5A 4E07A 5JCPA 3O47A 1KDOA 1KMHB 4GRAA 4Q5IA 5BYKA 2O8FA 1EX7A 2ZM5A 1II8A 1BYUA 1YHNA 1TX4B 3Q8XB 2GJ8A 5EE9A 2XTZA 5L3QB 1E2JA 1N6IA 4NZYA 2EW1A 1U9IA 3NC0C 2FOLA 4UJ3A 3UWOA 2ZU0C 1KJWA 5FUXA 3VQTA 4OK6A 3CWQA 3L2OB 4TL6A 2ZJBA 1ZCBA 1DE0A 1XD2B 1NJFA 4M8NE 5HR5A 1JJVA 5HE9A 4HAWA 1T91A 2VH5R 4KXFB 3X2SA 2ZROA 4LK2A 2CLCX 3DDCA 1DAEA 1KI3A 3CX7A 2WWWA 2OFOA 3OFND 2DB3A 2ZSFA 4KU4A 4E22A 3MCAA 4F7WA 4ESVA 1TF2A 2JDIA 1LVGA 1OIVA 1NIPA 1QHHB 1QRAA 3BH7A 3DOEA 2FU5C 4NYIQ 4PPGA 3BOSA 4URWR 3GQBA 4XVUA 3O8BA 1DAKA 4UNPA 1ZUHA 3L0PA 4C0BA 3VNUA 2OLKA 3K9HA 5FPTA 1KY3A 4A0HA 4AKIA 1GKIA 3VKWA 3VX4A 5JBQA 1UBFA 5F98A 4D4JA 2HT1A 4Q1CA 1E0AA 3OIYA 4EJSA 5AUOB 5FOSA 2HYDA 1E1QD 3U3MA 3ZQJA 4LRWA 1Q1QA 3AF0A 5CIWA 3PUZA 1PJRA 5AUPB 4M9SA 1H8ED 5EJEA 3DMDA 4OI2A 1SVLA 2IUTA 1OHHD 3NIBA 1XEXA 4FD2A 4BRUA 2QL6A 2YJTD 4G01B 4Q1BA 4Q9HA 4EPTA 3THXB 1GTVA 2X8AA 1R5NA 4Q9KA 2QBYA 4XTCS 2GK7A 1NL3A 4HB4A 5DN6D 2WTUA 4CW7A 2IYRA 2EVWX 2WMNB 4JMPA 2W0MA 5HKKA 5EUMA 1NJGA 1U8AA 4DLWA 1TPZA 4LJ7A 3RRNA 3VU9A 3C8UA 3I72A 3UMSA 1GUAA 4TN1A 4JVSB 1IN7A 3BJIC 2ZRPA 4UXIA 2GVZC 4LSGA 1NG9A 3CH5A 3DOFA 5KO2A 2WM9B 2QY9A 4CIDA 5GADl 3TQFA 2NO0A 1G8PA 3B9QA 3WHKA 4ILEA 3GJ8A 4Q4LA 1AS2A 3K70C 4IHQA 2BIFA 3UG6A 2ZI4A 4DDUA 2ZJ5A 3M1IA 2CVHA 1R7RA 5K8TA 1TU4A 3RS0A 4B32A 4AYXA 3HU2A 4EPYA 3UPUA 5DLQC 1M8PA 1QHYA 4LY6A 2AHOA 2QE7D 5C2JB 2ZVPX 1OV4A 1LNZA 5HZKA 3GJ0A 4HUTA 2K5UA 5TXGA 4V0MA 3K0SA 4GL2A 2BM1A 2WVJA 4XD7A 2NIPA 2QM7A 5LB2A 2G9NA 2P5SA 4F93B 1QG4A 1WP9A 3I4LA 1Z28A 1Z6YA 2MMGA 2D4HA 2ZI3A 5CYOA 5JI3E 1W36D 1AK2A 2GWHA 2IYYA 3H86A 1EFUA 3L0SA 4D25A 1XBTA 1E4VA 2AK2A 2H8KA 3EWAA 4IEEA 4IRUB 4OHVA 3VKHA 2XB2A 4MGIR 2FPKA 1BMFA 2C96A 2W6ID 3FGNA 3KKMA 3SBEA 3TE6A 3P32A 5K8LA 1EG7A 4C3ZA 1TF7A 2BM0A 3NHBA 1FNMA 1ZNYA 2A5JA 2CL6X 2XNDA 4LJ9A 4JYCA 1OH8A 4Q1DA 3K0AA 3ZD7A 1KO7A 3A4LA 2PH1A 1XMSA 3UMRA 2ZS9A 2J87A 4AYTA 1Y3AA 4JLKA 1KK1A 1ZP6A 5E95A 2QAJA 4C7OB 2G6BA 3U4QB 2IHBA 4FINA 1E2NA 2FG5A 1W2HA 2VPPA 1GL7A 1Z6XA 4CZ2A 2A5DA 3QKRA 4C30A 1N0VC 3I1FA 1JECA 5CB8A 1W0KD 5A0FA 4M1OA 4US1R 1JR3A 2I4IA 1PV4A 1HV8A 2OHFA 2LKCA 3KQHA 2QPOA 4M1WA 3GLGA 3LWNA 2XSZA 3TJZA 2CNWD 3CW2A 4QBHA 3ZJYA 1CJMA 3OHMA 5AR1A 4PO8A 1W46A 3EW9A 5EZ6B 4AG6A 3PR1A 1EFTA 1F60A 1R0WA 2V7QD 2JASA 2PCJA 5DHAA 4E5UA 2ODWA 3VX3A 2FX3A 1NVUQ 2WJIA 4ZIRB 3L8ZA 1HT1E 2IW3A 1ZBDA 2IWHA 1S96A 3K9GA 2ZUCA 2G83A 1VG8A 3BAFA 4JKIA 4DHEA 4KFTA 2PJRA 3SI7A 1NN0A 1XJ0A 1P7CA 2RH5A 3P27A 2Y8EA 2V54A 1SXJD 2EFDB 2IYLD 3AKDA 1QHXA 3THWB 3FDIA 3EPJA 1SVIA 4PR0A 3ZIAA 2RGGA 3R7WB 4BE7B 4LHYA 4DCNA 2AD5A 3LLUA 4URUR 5FOTA 3ZQ6A 2GCOA 1ZD9A 2BBOA 3Q5DA 2NG1A 4TLAA 1KK2A 1S9DA 5EXTA 3FMOB 3QIAA 2WJHA 5HE8A 4TZ6A 1WRBA 1AS0A 4HAUA 2O5VA 3GLFE 3IBGA 2QNRA 2GRJA 4Q9LA 3AQ4A 2GZDA 4HDQB 2RMKA 3Q9LA 3CO5A 2AD1A 2F1IA 3O8CA 1Y63A 1KI6A 3GFOA 4XJXA 4DJTA 4ZDWA 5L3RA 2FH5B 4LPSA 2BVNA 3GLIA 3T12A 2GJSA 4DLVA 2R6FA 2DHRA 3Q85A 3LNCA 4XH9B 1P4SA 2NTYC 2JLVA 2OILA 2DWPA 2CDNA 3K53A 2H18A 2C5LA 4ZI3A 1D2EA 1E2DA 4S35A 3QJYA 3C15C 2W0SA 1S9HA 4LOAA 2ORWA 2XJ9A 2IS2A 1KI9A 2ZUDA 1MT0A 2XAUA 3KFXA 2FSHA 2JA1A 1EK0A 3CX6A 4B75A 3EXAA 4IOJA 4PX9A 4TYPA 3REGA 4CEHA 2G1JA 4XVQA 2QUZA 4Q7MB 4XSHA 4IW3B 3M6AA 2GZHA 4QGGA 5G41A 2C99A 3U61B 3RS7A 3LDAA 3P4YA 3CRMA 1GAJA 4HB0A 4DLXA 4O2RA 4Q21A 1Z6TA 3IHLA 1XXHA 1U2RA 2PLRA 2QQ0A 1UKZA 3A36A 2C9YA 3PCRB 4ON9A 4RCZA 3LBIA 3THOA 1GG2A 4OI1A 5K8IA 2ZAMA 4BWYA 5FBWB 3HR7A 1ZNXA 3H1TA 2A78A 2ZJAA 1CJUC 1HYQA 3NKVA 4KCGA 3ICQB 4U00A 1DOAA 2J0QA 1G4AE 5FTLA 1VTKA 1W47A 4JBYA 1GZSA 1KY2A 4OHYA 2HF8A 5F2EA 3BS4A 3NBFA 5JI2E 5FOXA 4HYYA 3AV0B 4Q1EA 1P72A 3BERA 1FX0B 3R9WA 1D9ZA 4LPKA 3EZ6A 1HT2E 4BFZA 4DZZA 1X8KA 5DI3A 4HLQB 3HR8A 2Q21A 3PITA 2WBLC 3L43A 1R10A 3N5CA 4M21A 2O8EB 3WBKA 2G88A 4P4TA 2E1RA 1CR0A 2H7VA 3NVAA 4TQAA 2CHVA 2OCPA 2BJWA 4NMMA 4ARZA 4OJQA 3V4RA 1F2TA 2BEKA 1CJTC 5FR2A 4AI6A 3KQLA 1D8TA 2GJAA 1AJEA 1PUIA 1LY1A 1TEXA 2IF2A 2P0EA 2B21A 2QTFA 1OYYA 3QI2A 4HI0E 1XTJA 1ZW6A 2CE2X 3T1OA 2OG2A 2WZQA 1HTWA 3MD0A 5AJYA 4KVGA 721PA 3QEJA 1F3OA 1WMSA 2IC5A 4DCSA 2GXQA 5FUWA 1E2PA 3RABA 4GP7A 1IN4A 2F7SA 5TB5A 1E79D 3KQNA 3Q7QA 3IQWA 3NH9A 4ZKEA 2KSQA 1T0JB 3TMKA 1Z83A 4POAA 2ZRFA 4IFBA 3GEIA 4WZ6A 3U3JA 4QM6A 1MABB 5TDHA 1YZTA 1DS6A 4UNNA 1US8A 1E9DA 4GI7A 5FBRB 3ZVLA 1R5BA 5DYGA 1DO0A 3MWKA 1HH4A 1G3IA 1VMAA 4JS0A 1DAMA 3B5JA 2OLJA 4V03A 1FQKA 3AB3A 3FVQA 3KKOA 4HDCA 1ZJ6A 2C77A 1YE8A 5ELXA 2WSSD 3DMNA 3PJRA 2AFIE 4GOKA 4XWOA 1P73A 3BB4A 4AWXA 1JALA 3NDPA 4I4LA 1QG2A 4DRZA 1G7SA 2F9MA 2J45A 2VP9A 4BLQA 3L82B 4Z54A 3O8DA 5IK2D 3QEOA 1VHTA 5KSPA 1RFLA 2ZREA 1F2UB 2H17A 2ZJZA 1XWIA 1KMQA 3U3RA 3E70C 1YR9A 1Z63A 3RS4A 4PC7A 3QG5A 1VG0B 4V0ME 1TQ6A 3A1WA 3AUXA 3B82A 3WYAA 4EQ6B 1NVWQ 3R20A 3TKLA 2GILA 5CLQA 3IIJA 3UIEA 3WRXC 3N2EA 5BN4A 1NLFA 1G7CA 4GFDA 4IFEA 2ZR0A 5KPJA 1LS6A 1DELA 4XTRA 1IONA 4HZUA 4TMWA 4IXMA 3FOZA 2ZRNA 4M22A 3ASZA 3QPUA 3GEHA 3QBVA 1QHSA 4L8GA 4LBVA 1KDTA 3U3KA 2DFKB 3IEVA 4NYIR 3NG1A 1SKQA 4Z1MA 4NYJQ 3SR0A 2OO7A 1DAIA 3E1SA 5KPDA 2QSZA 4PQYA 1DVRA 1T0HB 4DDWA 3KKQA 3NHAA 4A8JB 2R6GA 1VCOA 1IXZA 3UXMA 1Q44A 4B35A 4BLOA 3SQXA 3IQXA 4URZR 3AKEA 1EESA 3VR4A 2ZSEA 4HUQB 4Q7KA 3ZS9A 4EFLA 1W36B 2BV3A 1P60A 1W7AA 4EFMA 5BXQC 1IQPA 4OHWA 2XZOA 1GOTA 4WAUA 1XRJA 1F5NA 4LHZA 2AX4A 3VR1A 2PEZA 4JSYA 3A1TA 4P4SB 1JR3E 1VCIA 1SZPA 5SZKB 3B2EA 1M2OB 4FN5A 3FMFA 4M1SA 3GLGE 1G6HA 1E0JA 2HEIA 2YWGA 3VMFA 3F0TA 2ZYVX 1Z22A 1ZINA 5FH9A 3B85A 3BFVA 3LFUA 4NBSA 5CITA 4N0DA 1JPJA 3K9LA 1D9XA 1YVDA 5BYJA 3U6BA 4RD1A 3CH4B 1HURA 3KTAB 1A82A 1GL6A 2D7DA 2F1RA 2IYXA 2LKDA 2VP5A 4PC3A 5J4YA 1MV5A 1FPMA 3BWDD 1KMHA 3K0CA 2F9LA 3IUYA 3RC3A 1NVVQ 1UDXA 3JVVA 4TQUS 3X1YA 5G3ZA 4BFSA 4IDQA 4TLDA 5L3QA 5E7IA 1RKBA 4TMVA 4KFSA 3GP8A 4DSOA 5AJVB 2J9RA 1CTQA 4QNMA 3TR0A 2QSYA 2IS1A 5F9FA 4L15A 1MRNA 2W6JD 1ZNZA 2QA5A 1XD2A 1JQLB 3HU3A 3IO3A 3KUCA 4KLNA 2EYUA 2GJKA 3MLEA 1W49A 2CK3D 4B44A 3R8CA 4DSUA 3JZMA 5GVRA 3NXSA 3OEHD 1NN1A 3IIKA 1XCPA 4WXPA 4ZCMA 1V43A 3BRWD 5KU1A 1VYTA 2QPTA 2QN6A 4JJKA 2ONKA 3A1UA 1TU3A 1XZQA 4B47A 3T1QA 4FMDF 1G291 1QHHA 1UKEA 2D74A 1TEVA 3WMGA 3TW4A 2BCGY 5FTNA 1D5CA 4F4CA 1Z47A 5JWOA 3VAAA 2NO1A 2DCUA 2BMEA 1SXJB 1XEFA 4BPBA 5KUTA 3I8SA 5FUYA 3RC8A 3X1DA 2RGNA 3GLIE 3IEUA 4M2LA 4ASUA 3FYHA 5J4VA 1OB2A 3L0OA 4LJ4A 4S2EA 4Q02A 1NN3A 3AKYA 1MO5A 3VR5A 2ZRHA 4OQFA 3VTKA 4EPRA 1GSIA 4QRHA 3H84A 3SEAA 2ZJOA 2FF7A 4FI3C 3MJRA 1JJ7A 5EZ5A 1YKSA 2YWHA 3LVRE 4E03A 1VCMA 2FSGA 1PUJA 3S1AB 1VPLA 1UF9A 4LUCA 4QGAA 1QBKC 2AKYA 1ZYUA 2X1VA 2OCBA 4UXHA 1DAFA 4RCYA 3THXA 4C2UA 1EWQA 4KBFA 3T1VA 1OFUX 3A4NA 4BFWA 2DFTA 3SJCA 3VFDA 1E1RD 3TR5A 1X8JA 1XMIA 1ZUIA 3MG9A 5B57C 2NPIA 1DARA 2EWVA 1Q21A 2QPAA 2GDJA 4EJSC 4B3BA 2IA5A 5FL7D 2A5FA 2G3YA 5TARA 1Z6GA 2B7BA 1XXHE 5CK5A 4IXNA 4ZKDA 1TUIA 4HSEA 4XWAA 5JJIA 3OE7A 4QJ4A 4PTLA 5JSZB 3FPAA 4KI0A 4US0R 4D82A 3W6PA 4NCJA 1CR1A 3LXXA 1G20E 3TK1A 2BKEA 2DPXA 1X86B 4F4JA 1Z6AA 3T61A 4B2LA 1KNXA 3CRQA 1GFIA 2QGNA 4LV8B 1UKVY 4DBLC 3ADBA 1PVOA 2VLIA 1N2CE 2F55A 2P3SA 2NOAA 1VYUA 2PBRA 4CT5A 1SHZA 2WOOA 3IPYA 4JLBA 4II7A 5FPYA 3W8RA 2N1BA 2QP4A 3MWJA 1TQ2A 2GCPA 2EFGA 3HJNA 2HDNB 1EFCA 3EWSA 3ZYCA 3OAAA 4CEJB 1K6MA 1G6OA 1XTKA 2REOA 3H4MA 4ZDKA 3NBXX 4PHTA 2OFWA 1YRAA 4JSTA 4UNQA 2EWWA 2ZRDA 1JR6A 2VSXA 3I32A 3CZPA 3TRFA 2EYQA 3THYB 1E2LA 2XOKD 2QEQA 3QG1A 2YKGA 3QXJA 2A7QA 5KHOC 2JJ2D 2BMJA 4G0NA 1JI0A 1PLJA 4JYBA 4Q7JB 1RRPA 1U99A 3LBNA 2J46A 4LBYA 1Q20A 4MGKR 2AR7A 4HB3A 2ZIAA 1CULC 1GWNA 1KGDA 4BQSA 4XD7D 5C4MA 2FGJA 2J7KA 2OZEA 2ZI5A 2A3RA 3OZXA 1G8GA 1HQCA 4D2IA 5HCNA 3LLMA 2QTVB 2WWHA 4C7OA 3U4QA 1DAGA 3GJ3A 4ACBA 4ZPXA 3QF4B 2AKAB 4P0TA 2GZAA 1KI8A 1I2MA 1S0UA 5CIQA 1WA5A 4PPQA 1TAGA 3LQQA 3QPWA 1N5IA 4PHHA 4W5JA 4P31A 1NMZA 2CHQA 2ZRCA 1UADA 3EZ9A 4C9BA 3B1ZA 4CRWB 4BLSA 4D0LB 2FJUA 2WIBA 3EIQA 4FCWA 4EIWA 4TLEA 2HJVA 2VP6A 3CM0A 3SHWA 3U7EB 3GD7A 1NRJB 2IYQA 4GSYA 3EZ7A 4LHVA 3TVDA 1AQUA 1HE8B 3QQ5A 4LZZA 4KFRA 4BFVA 3HP1A 5LBIA 3N2IA 4ZO4A 4ZIRA 2RGEA 3FKSD 4KITB 3Q3JB 4B2PA 5F3WB 3W3AA 1SULA 4P32A 4GBMA 4YC7A 4FIDA 5UKDA 4LI0A 3I5YA 4X8OA 4PSAA 621PA 3BH0A 2PT7A 2O8DB 4DLTA 4RD2A 3THWA 4PSVA 3R7WA 2F3RA 4PHFA 4H1UA 5CYPA 4LJ6A 2BKUA 4TTRA 2C8VA 1OXVA 2QZ4A 5AJWA 3QXSA 3HPQA 5JHHB 4XIGS 2KJQA 1HA3A 3BE4A 3EC2A 5BWMA 3AEZA 1Z2CA 2WPDD 2HYIC 4IJMA 4B2IA 3TBKA 5HPYB 2UZ3A 1NN5A 4NPHA 1SVSA 2GK6A 3CPJB 2D2EA 5IRCD 1RVDA 2VSOA 5EE0A 1TF5A 1II9A 3NEYA 5EE5B 1E96A 2ZS7A 4EPXA 2CCJA 4C0HA 2Z5FA 5AK0A 3DM9B 1O3YA 2CCKA 1MKYA 2OM2A 1VDZA 2PL3A 2CL7X 2XTNA 2QRNA 221PA 2IS6A 4E09A 3EZFA 4HLUC 4P3YA 3DL0A 1Q1ZA 4KAXA 5KSOA 1JNYA 4A6PA 1IAQA 3QVUA 3W6NA 2ZJ8A 3D31A 5SZIA 1G64A 1DG1G 4Q4HB 1WXQA 1U90A 4I99A 5C18A 3A8TA 1Z2AA 2VTKA 4I1UA 2D62A 3EPLA 2ORVA 2XEXA 3OIUA 1P62B 1IY2A 4OHXA 4EKDA 1RC8A 1W0JD 2GEUA 4PO1A 2QMHA 2ZS8A 4B6FA 1KJZA 3W5IA 2WKQA 2RCNA 2BBTA 4DCUA 1L4YA 1G4UR 3JVUA 2W2TA 3LW7A 2NPFA 4X8MA 3U2QA 1G18A 3SU8A 3GFTA 1XMVA 3PEWA 4PC1A 4FW9A 2FEMA 3W8NA 1ETUA 1FP6A 4OQMA 4Q4AB 3EA0A 1N6LA 5JJKA 1XDBA 3FKQA 5E4FA 1NBMD 3CLVA 2AWNA 1N6OA 1CF4A 1J70A 1KDRA 1ZCAA 3ZZ0A 2AFHE 2EFCB 3OIWA 2PJZA 4JIMA 3DZDA 2ODBA 3U60B 1UEIA 3G82C 4TMZA 4JLVA 3TH5A 2NO7A 2VQSA 4A8JC 3LW8A 3B9PA 1FW6A 3HU1A 1ANKA 4IVPA 2JLRA 2Q9CA 3JZAA 1OH5A 3ZVMA 1E9RA 1JAHA 1EWRA 1FX0A 1G3UA 3KDSE 3NBYC 2IUUA 1W36C 3R9XA 2BEJA 1EFRD 2CL0X 2KWIA 3ZDQA 1KAOA 1K5DA 2VHUA 2J7PA 4D81A 4D6PA 2FFHA 4V02A 2IHYA 1NMXA 1KOFA 2IYUA 2NZ8A 3SHFA 4UNSA 1T6NA 4KODA 3FMIA 3T5GA 2O8EA 1ZM4A 4KFUA 4MRNA 3HDTA 2Q3FA 3T06B
chains in the Genus database with same CATH superfamily
3CNEA 1XEWY 3K4QA 4QWWA 5AK6A 4DUGD 4GSLA 1VFNA 1WDTA 3ZWXA 4M1YA 1G21A 4PR3A 4Q9NA 4CCWA 3QM1A 2P9FA 3FDXA 3PNSA 3E53A 4B1FA 2XR1A 3TYXA 2QRQA 4FYIA 1WOMA 2GZ1A 2QTZA 3Q9SA 4RMGA 3ZWCA 2EKDA 4BO9A 3EZXA 3U19A 3WGIA 4QYWA 4R2XA 1Y9DA 4GPBA 3HO1A 1X38A 1LBSA 1F17A 5FHQA 4MR9A 1LA2A 3UFBA 2H4YA 2VPZA 1X7XA 4D7AA 1FSPA 2R9VA 2ZPTX 4ZT6A 5HKLA 4RLQA 2CXUA 3QHPA 2AJCA 3O1IC 4HAVA 1WAMA 3H5IA 1WEHA 4JDPA 4Q0MA 1JQKA 4ALKA 3N7TA 1QLJA 4GP9A 5JXGA 2ZI9A 5AVJA 3SFVA 3PA6A 2WWYA 2I22A 4AJ4A 2V74B 3AWDA 3TNYA 4R0NA 4U9UA 4AJPA 1OKKD 1PEKE 4QATA 2OV2A 1MABA 4OHMA 4Q6WA 3R5KA 1TM2A 4DARA 1OVMA 2WG0A 1GR1A 2Q7XA 1OI2A 2C5BA 3IV6A 4FT4A 4CQLA 5BN3B 1GLVA 3N76A 4CMEA 3NW9A 3NLLA 3LIPA 4EZIA 3LCMA 1H2AS 3MVEA 1Y8QB 4FEGA 4JLSA 1SOAA 3O26A 1H4QA 1A97A 2ISCA 4R2WA 1TK9A 5EXEA 3WYDA 5CB4F 4WRRA 1IIBA 1OHHA 1E5TA 1K7EB 1NWCA 1RLIA 2EFJA 3EXFB 1VSUA 2Q7DA 2VP4A 3IOEA 1ULAA 1XRQA 4WMLA 4JVMA 3F3YA 4EG8A 1V5FA 4AMYA 3JQGA 1L5SA 3M4YA 3K8OE 4B4OA 2WRZA 3BMQB 4A36A 2W2XA 1H4TA 2AVNA 2WNSA 5DN6A 6ADHA 4D9CA 2B20A 5AM3A 1JHOA 5NLLA 3PF9A 4Z4CA 4EHNA 2R8ZA 4Q3EA 5IABA 5B30A 2FG7C 1XYGA 1PR3A 4GC5A 4WOCA 4ED9A 1Y37A 8OHMA 1BC5A 5TPWA 3MINA 1ENYA 2BUCA 4A82A 5G1OA 1QHGA 1DMSA 1JVNA 1W4ZA 1QKJA 2VJNA 5D1NA 5IYZF 1G0OA 3QKSB 1BXGB 2BGKA 4GI1A 4AFNA 3H04A 3A6EA 4JLOA 2MYNA 3OPMA 2EKZA 1UM9A 3G49A 2XNJA 1OI4A 4DUPA 3FBWA 2ZVQX 5DCWA 1A5ZA 3NWEA 3PUKA 4BNIA 5LDHA 2VWPA 2GJ4A 2PZJA 2ERCA 2R8RA 3DOCA 1OTYA 1NFQA 5AM0A 3SN6A 5M5BA 1P9RA 1AO0A 2EERA 4C4XA 3AFOA 1AGRA 5LBTA 1JDPA 1EP3B 2BWJA 3I76A 4MHSA 3JQ6A 1FE8A 2GYWA 4D8UA 3DQPA 2HBYA 3JYPA 4YRGA 1CYEA 3GCWA 5G1PA 1GD1O 2NQTA 3NH6A 2VDRB 3C5VA 1RAFA 3KJEA 2QLJA 3N8KA 5DFAA 1YZFA 1NONA 3KBBA 2PSFA 1JTVA 3EZ2A 1RS0A 4PXAA 4V2IA 2FXVA 4L7VA 2I71A 5H81A 2VHEA 2QS9A 3QVWA 4QC2A 5TGDA 2D3TA 2P5YA 2HFJA 2OV1A 1YRQA 1OASA 2PT9A 3BUSA 1TT5A 3K72B 3IHKA 2J5BA 2XTJA 3DZKA 1NQXA 3PI6A 5B3JA 3KSRA 1L8OA 1IBSA 3KEMA 4QUEA 1OD6A 5JAPA 3WWZA 4IXWA 2JIZD 2YC2C 4YFVA 2P9HA 3HVKA 4RJ2A 2EBFX 1KE2A 2BE9A 5FNVF 3OX3A 1TZKA 1S7GA 3TCKA 3E9QA 2XX3A 3D6HA 1CKEA 3O6VA 3WL5A 4OBXA 4PE5B 1NURA 5LPNA 3U49A 3GRCA 2W43A 3KTAA 1F3LA 5CNKA 1RYFA 4JB2A 5H68A 1EIZA 3QELA 2H9YA 2JLYA 3AKCA 2ZYGA 1C3LA 4W5RA 2V59A 4G26A 3M8KA 4NU0A 4E15A 4KBGA 4XZ3A 4JLAA 5P21A 4B34A 2ZW9A 1L8LA 3DDZX 3DHNA 1ZD1A 3HP7A 2UYOA 2Z2JA 3F9RA 4TS3A 4MIYA 4PBRA 1N2SA 5CAEB 2JHAA 4F6LA 1XLWA 1OZ0A 1U0JA 2IU4A 4XSGA 1IY1A 2WSLA 4HEHA 2H52A 4KG7A 4LC1A 3NS7A 4PO9A 2V7BA 3K0CC 3RK1A 2CVOA 5IM5A 2W11A 3WWDA 4L72A 4O1HA 3T7DA 1NBHA 1XAIA 2JHCA 2CKDA 4FNAA 4R1NA 1BD4A 5E1OA 3BL5A 4DGQA 1MEJA 1CY2A 3QU2A 2VJKA 4MHOA 3X0DA 3CNLA 4RV5A 3ZQKA 1MAUA 5COAA 1W59A 5JY1A 1T3ZA 3GNSA 2A0WA 5F51A 4Z49A 2PRSA 4NG5A 3LH5A 2WA2A 2NYVA 3IQIX 5A4AA 1U80A 3TUIC 2ZTVA 2I1LA 2L19A 1PK7A 3SZLA 1CNEA 4U7GA 3WWYA 4CM8B 1NZJA 1Y9EA 3WKCA 3L5KA 1G59A 2YS7A 3INGA 3Q3EA 5IMBA 1COWD 3H0KA 3W7BA 4W9MC 3CVWA 1NBAA 1YDEA 5HGJA 2R6CA 1ZGCA 5F9MA 3NOQA 3IQGX 2DPMA 2I4TA 1BYIA 2C03A 5AK5A 5KI6A 3G9TA 1JHUA 4CLDA 2GX6A 1X92A 3OJXA 5A3RA 2FKAA 2OBMA 4WKGA 3WS7A 4JUFA 4BMYA 4JKOA 1TXGA 4KHZA 4N3AA 2WUDA 1OX5A 3STVA 2V0CA 3GIDA 2FZCA 5L3SB 5I9LA 3S1AA 1D1QA 2NU7A 1TKCA 2CBGA 1LRKA 3C1AA 1V35A 5FAKA 1NXVA 2CLLB 3G6WA 2H5EA 2WHYA 3QHQA 5CA1A 1N8TA 3SMVA 4PCVA 5AIBA 1S1CA 1DC4A 1ZXBA 3HBAA 3NHJA 3IBFA 1E2GA 2D2IA 2OV4A 1ISRA 3GMSA 1FOEB 3SXUB 4IIJB 4Y9TA 1MN6A 4M6WB 3W2FA 1ZVMA 3AP1A 2PT6A 2I67A 1BGVA 1WIWA 4NFHA 3WFZA 3NVMB 3OFKA 2R00C 4UTZA 3HA3A 2J6CA 3OX1A 3VHLB 1JLRA 2AMVA 5AXDA 1YE5A 4P84A 4B4WA 5LP6B 3VNQA 2HSWA 3A4IA 3A7EA 3N2KA 2MINA 3AMVA 4GBED 4AD8A 2Q1WA 5I9IA 1TJNA 4IDOA 4HNAB 1SN7A 1RHJA 3LGSA 1C0EA 2EZ8A 4TRRA 4AK9A 4FP9A 1VPWA 1Y9AA 3MJVA 1MPTA 3HKEB 4JUIA 4TMTA 1JL3A 2AJTA 3A4MA 3I01A 5GTDA 3PEVA 3HCDA 5JECA 1HZJA 1XR3A 2RIPA 1G98A 1TM5E 1UKBA 3AZPA 1QVRA 3ANXA 3LUAA 1YA8A 1HDXA 3HA5A 5IU6A 1NG1A 3RV3A 4TVSA 4D79A 4K9DA 3IULA 3S8EA 1T4DA 4IHJB 2E37A 4H9GA 4MQFB 4R6WA 1HMYA 1Z0DA 2FQ1A 1UJ5A 2WKRA 3H97A 4INAA 4OBBA 4YRJA 1O5IA 4JOSA 3A9RA 2VUSA 3M9LA 3TZLA 4REQA 2XT6A 1K3FA 4O25A 4JI5B 4U6QA 3PC3A 4WL0A 5FPPA 2UZAA 2GUWA 2O4UX 2AVDA 4OB7A 1P1IA 1CP3A 4E2FA 1TZBA 4XVCA 3GA7A 3R6LA 1P5RA 1OXBB 1RAHA 2F1KA 1J8YF 3E0XA 1KJ8A 4CMBA 3WAJA 2AXPA 3RS5A 4ZVQA 4PSDA 4TSFA 3PUVA 3FYUB 1RQNA 1WVIA 3GJ6A 4I8IA 2BTEA 3T3GA 2C1ZA 5ALNA 1RQ2A 3R7AA 4RVDA 4ZHSA 3EH1A 3BAZA 4R8LA 2YJ3A 1VJCA 4CIBA 3U48A 1JQAA 4KL8S 3NB0A 4Q48A 1QGED 4G0UA 2EJTA 1YFJA 4BNXA 1E64A 2MSWA 3R8XA 1Y3CE 4LZNA 4LHWA 3STUA 1SUWA 5DNCA 4ZTBA 1UPUA 3SQNA 1N78A 1M2FA 1Y9JA 4RD4A 1BO6A 2YYSA 1L5YA 3OLZA 4JI3B 4BP1A 5CFMA 1W5TA 1F12A 3FWNA 3D2LA 2WV7A 4MPDA 3TFOA 3P1JA 5DN9A 2IF0A 1TK2A 1UKYA 1NOIA 3KOZA 1WXDA 5THKA 4WBSA 5F1KA 2C3OA 1CJBA 5DRTA 3Q8WA 4L28A 3R41A 4G25A 1HY3A 1TVKA 4CLOB 3GK3A 3SKVA 3OJEA 4YCMA 3GMTA 3TTUA 4M1MA 4KXUA 5FI1B 4WCFC 3UAXA 3D8BA 1YZHA 3QY9A 1YR6A 2X77A 2EQ5A 3B1YA 1J90A 4V0OA 1M83A 4WW0A 3ZHOA 2OV8A 2GEJA 4E21A 2JCSA 4X24A 4QUIA 2DBQA 4DJDC 1PYGA 4O4IA 3VNRA 3WVNA 4RE6A 2I33A 3R0ZA 1VG9B 2AJ8A 3CBQA 2JVKA 3FTQA 3RVOA 2PMCA 4RW0A 1TYZA 1VJ1A 4P34A 5EFOA 2G76A 3R0VA 2WP8J 3NFYA 121PA 5HFJA 3O2QB 1GNRA 1ZITA 4KJZA 4EHAA 1FYXA 3HI6A 1A7KA 2A0XA 1Y5MA 4G0XA 3H2JA 5FA8A 5H02A 4YP0A 2V7WA 4D4KA 4IPTA 4HQFA 4HLCA 4HNTA 1UJ4A 4NCAA 1PFWA 1K4MA 2HCTA 3DLIA 4NKRA 4ZI2A 1V4BA 4U3JB 3FHTA 1LK7A 4F5WA 1OMOA 3HVUA 1RABA 4IEIA 4RANA 3SE0A 1SHLA 2QR3A 3PYXA 3TDMA 1QU3A 1AA6A 3D1LA 1IJEA 1PX0A 2R00A 2YZ2A 4PLGA 3B1WA 1PR6A 1RXSA 3IP6A 3UMYA 4ZYYA 3EXEB 2QDKA 3QMWA 4FXOA 5B2EA 2Z56A 1QTIA 3O8OA 1OB2A 2A9FA 4W8GA 3VR2A 4RJLA 1NOKA 1RZRD 4CKYA 2X9LA 3EWIA 4LE2A 4PYKA 1QJ4A 3BCSA 4I50F 5IWCA 2IEAA 4FYYA 5AKYA 3GPDG 5KMGA 3CPHA 2PMBA 3N59A 1TADA 1Z07A 2X1MA 4HVAA 4N65A 3MTQA 3VAZA 3KOUA 3TIIA 3PNQA 3PKJA 3UWKA 5KNBA 3FLMA 5ALGA 2FPGA 2QG9A 2IHTA 3QE2A 2GN8A 2QRPA 1KKMA 2EJCA 5K0JA 3ABQB 4QXPA 4HC4A 1S8NA 3SVLA 5EIXA 4ZQFA 4IS3A 3WSWA 2R8OA 1FVHA 2W2LD 1ECFA 3D6UA 3H9UA 2Q9BA 2BFCA 4Q4JB 4AJ2A 4RZXA 3A32A 2WJPA 3FRJA 5MFPA 4KK4A 1KYVA 2V98A 4PAMA 5TEWA 5JZVA 4Q7LA 2Z04A 3AL0C 1C1HA 1R4NA 3V00A 2ONCA 1BEUB 4KLZA 1XQWA 4X63A 2Z9CA 4Z7OB 1E9FA 3NEJA 3BICA 4JBGA 1G7TA 5DO9A 4INPA 4CM7A 1QDEA 1KDVA 4P2BA 5TEVA 1RW4A 1FXWF 3KZMA 1NI3A 4JUBA 5DNVA 1VLZA 4N9WA 3L0IB 1UZMA 1Z7YA 3CT4A 2FPMA 3CW8X 3KUXA 3BEDA 4JXJA 4QLAA 3AUYA 2JGJA 3L7JA 2LCIA 4B3CA 4D3SA 5REQA 4X6YA 3C45A 2QRVA 1NW4A 4ZPJA 2ZIGA 4Q4CA 1NU6A 5BVHB 5CFRA 4YAUA 3QEAZ 1WCV1 2FRXA 3NRCA 1AM4D 1QVZA 1ZUNB 3IPAA 3DUFB 1X7WB 1V5EA 4Z86A 3L8CA 2GPAA 4TWIA 1BX3A 5TLSA 1G6Q1 2WHPB 3NKLA 3WMWA 5FEMA 4BAUA 3WLQA 1PR0A 4OUDA 3WLFA 2OHVA 2ZRGA 3IDZA 2H31A 1FFDA 2VKQA 4QOSA 1ZONA 1CY0A 3GELA 4KR0A 4PAOA 3QEMB 3KYCB 1IZ9A 1THTA 2NZUG 2DR3A 1YUMA 2I1WA 1SPXA 1TM7E 1UAGA 3LHKA 2XUOA 3M5DA 2VHCA 1E9EA 1GSAA 5AXCA 4MWZA 1U8YA 3R5XA 1I2CA 1XB2A 3H9EO 4JT4A 3J81A 2FPIB 2H4XA 2VDLB 4WCFA 1VHLA 2OXFA 1ZKMA 2RGDA 3UT0A 4R7ZA 1P0QA 2ZYSA 3QQPA 4CETA 3AVQA 1JRLA 2VR1A 2XYVA 4V0SA 5ETJA 1BMFD 4EB8A 2CNOA 2QQEA 3GCGA 3ZZNA 1Z62A 3QVGB 1M1XB 4GUDA 2W6OA 3E9YA 3PKZA 3PHBE 2H9AA 3LZ6A 4RZSA 3JATB 1K08A 1URPA 4TXNA 1OFGA 5LXTF 4IO0A 1L7QA 3FX2A 5AM5A 2V0GA 2RK6A 1P2TA 3M1AA 3WKBA 2ECQA 2J9GA 5F73A 4MP8A 3LA6A 3IVRA 4UM8B 1LPSA 3R9IA 2C3YA 2NZYA 3DBOB 3LUGA 4M83A 1IZ8A 4MH0R 3UJ9A 1XDDA 2P9GA 3NNNA 1MH1A 4ETIA 3HJGA 4G07A 4W7SA 2QGFA 4WUTA 1NX6A 2DUUA 3CNOA 3UJPA 4P4NA 1FW8A 3T5TA 1D1SA 4ZVNA 3OZAA 1SUFA 1KBOA 3V4ZA 4GXQA 2XUKA 3ED1A 2WYIA 3W7VA 2GN0A 3RWMB 4F5YA 1G2QA 2H7YA 2ZBVA 3LX8A 4FYVA 2D59A 2H4WA 2R7MA 2VNKA 4RY9A 5FT9A 3C3PA 3VR6A 1ADFA 5BN3A 1SD2A 3DGEC 3VKVA 1UMCB 2WIFA 2YHSA 3IUSA 3W5VA 4A7PA 3CINA 1DJOA 4IV5A 2IXAA 4ZRNA 3MM4A 3OH8A 1Y8QA 2A4KA 3GP5A 5JSYA 4DV3B 2ZBEA 3WL8A 1PCXA 2G40A 1QKIA 3U4CA 1TUEA 4UE3S 4DY6A 1UOPA 2HD4A 3DEAA 2XQJA 4RVOA 4Y9UA 5IJZA 3KKPA 3EXFA 3OZSA 1AKYA 4LCJA 4LK3A 3KXLA 4E2WA 4EZEA 1BDIA 2GASA 3QV1A 4ALJA 4QECA 2DR2A 2P6RA 5FBVB 2H65A 3F96A 5L6LB 1SBTA 5H4HA 1RXYA 4KXXA 5YASA 2CNNA 4HRYA 1T8PA 1USUA 3BMQA 5EUQB 1OUMA 4PS0A 1A71A 3RSLA 5JATA 3X1ZA 5FYQA 1XYYA 3ROGA 2YIVX 3O2JA 2CJWB 3F90A 1IHXA 1WUIS 3QVOA 3DUWA 1MO6A 1P9NA 1QZZA 1V6CA 4X94A 1ZH8A 3ESXA 3RSFA 3SIWA 3LUCA 1XWFA 3E35A 2B8WA 4W63A 5CDFE 1C81A 3GA5A 3EXHA 1BXGA 1ECBA 3IBCA 3IH5A 3QKSA 5LQDA 4F45A 1UANA 2I7VA 1YDMA 2XQIA 1V2GA 4PZZA 4GOJA 5EZQA 2RHLA 4HJXA 3LPDA 4PFKA 4CIVA 2ZCJA 2GNOA 1LNSA 3TQQA 2XMDA 3QE0A 2C5HA 1JDZA 3ZHVA 3A9CA 3EMKA 4OYLA 4PLHA 1AKNA 3EASA 4L8FA 1ZK2A 1E2IA 4QELA 5T4EA 1GR0A 3ZGNA 3OY7A 2XOXA 3SYMA 3IAS6 1R6XA 1DCFA 4QEKA 1KFJB 3ZVRA 5LP6C 1R6VA 2AG6A 4LVNA 2C0QA 3ROEA 5ICCA 2I8LA 2CLKB 1CUVA 4JJAA 4OBEA 1ECCA 3ZTWA 1A3CA 3GLFB 1U2PA 2J0UB 3TD2A 4ESHA 4BB5A 2B69A 2DG2A 2AZTA 3FLBA 2VL7A 1U5AA 3FUWA 1KHTA 2Y9PB 3SZRA 5JJLA 1ADGA 4EEXA 2QTNA 2ANCA 1QB8A 1YIAA 1ZWLA 2XCIA 1Z26A 4OI0A 2XOKA 4E1BA 4WADA 1T9CA 3QFCA 2I3AA 3AINA 4A2WA 5JJBA 2HQSA 4TLBA 1F1BA 2PL9A 1PHRA 1Q57A 1T1JA 3DVQX 4LYGA 1H4SA 3D8HA 4I1OA 4YJHB 4MARA 5LOVB 3ROTA 3RIEA 1AKVA 1RHRA 3FOFC 3VSEA 4YONB 3TDNA 4YRPA 1VYVA 1Q0SA 4GM1A 4GLBA 1GZ7A 2ENWA 3IURA 1P75A 4LXTA 4G5OA 4DKJA 4MZDA 1SKMA 3G2OA 1LF5A 4WSOA 3FF1A 5AHKA 5LZ5A 1I24A 4RM2A 5AW6A 3R76A 5HUQA 3EIWA 3IP5A 2GA8A 3QEKA 1IN8A 5TS3A 1WOYA 1P9WA 4D41A 1OAKA 4GYYA 2X2EA 1Z68A 2DQYA 2IV3A 1I32A 3ZV7A 3BH6A 4FX5A 4OP3A 1C8KA 4A6XA 2RAPA 4RVCA 4LF8B 4O8CA 1KO8A 4Q3DA 4ITRC 2ZBQA 3HA7A 4ZGBA 4TRJA 2B9EA 1NV8A 2DT8A 2X0RA 1BJKA 3HZRA 4MS4B 3G2IA 5A5DA 5C1DA 1AIPA 4RD3A 3RRZA 3OCVA 1CP2A 1I2DA 3IUNA 4QUBA 1LEHA 2UUPA 3HJTA 5CAEA 4DEYA 3DP9A 4BNUA 2Y9MB 5BXYA 1IWBB 1Z5ZA 2V6MA 1PDOA 4G0MA 4D9HA 2JLWA 2O0HA 2O8FB 1U81A 2ZRBA 2WIKA 2F3TA 1VI2A 1XROA 3EAGA 3RNOA 3OZ7A 1FUYB 1SB9A 1WF6A 3VPAA 1PL7A 1WHTB 2PLWA 2W22A 3UB3A 1GPLA 1VJDA 2BMFA 3P2KA 4EF6A 6YASA 2BCJQ 4A2PA 2UYHA 4RMNA 1T24A 5AJTA 1X13A 4EMSA 3V1LA 1MUUA 3KXDA 3LTNC 1T9HA 2F64A 3D2AA 2QMQA 3BGWA 3HEMA 2LVBA 4Q9DA 3IAHA 3ISTA 3CA8A 1CJVC 4NQZA 3WYFA 2RB4A 4N0MA 4CM8A 3I6YA 5IN5A 4IIFA 2HWWA 4GVXA 4TROA 3WZ2A 4WJZA 4M3NA 1C4WA 1P3JA 1NXSA 4ARUA 4N5LA 4ND1A 1WDLA 1O57A 2VYNA 1TFUA 3BFJA 1Z0SA 1ODJA 3K0EA 1OX6A 2ZSHA 4YVFA 3Q7PA 2JIBA 2VIIA 5BPHA 2SBTA 2BHRA 2HRZA 1L2TA 5JVDF 5DBFA 4BUJA 5D3QA 1CSEE 3OOHA 3KYJB 4I46A 3SQWA 4CF7A 1C29B 1OBVA 2WPDA 5L3SA 1Z4KA 2NZVG 4HPJB 4CU5A 1QCZA 1N3IA 1POXA 2W00A 1RI3A 3VNVA 5TMDA 3IPXA 4OJTA 1XJQA 3JY6A 2Q3MA 4BMPB 4CM1A 3A25A 4QHSA 4ZVRA 1XQ9A 1A4RA 5KQGA 3L7CA 2P41A 1MJNA 1UFQA 2W2QA 4GX0A 4KLAA 2FDCA 1XFAA 1NQ5A 4G5SA 1YZNA 3SXUA 4AJJA 2FYTA 4K0RA 4IIJA 1DBSA 3KLPX 3RASA 4M6WA 3C0KA 3MGBA 4RETA 5B4VA 3PX7A 1NW5A 1M54A 1Z7BA 3AI1A 3JRXA 5EJ7A 2EU8A 4JXKA 3FOAA 2D5AA 2YBDA 1KMNA 2KB0A 2C9ZA 1MR3F 3ZOZA 1G8YA 1MHPA 1P4AA 3ETDA 2V8BA 2FK7A 3I04A 4JJIA 4UJ5A 5F33A 5LP6A 3D6NB 1AZSC 1Z37A 3VH2A 4UDYX 4Z3OA 2E5FA 1E2EA 3ZLUA 2QBYB 3I5XA 3I83A 4HNAA 3P9CA 4OI4A 2C4UA 1F48A 2WTEA 1JB1A 3D8UA 1OYVA 3ZK9A 3NWJA 3F8WA 4LW8A 4CYMA 3NJ4A 4FLMA 5EJ4A 1U8UA 3HKEA 1NKSA 4JU8A 3I9V1 4O33A 1UJMA 1Y3FE 1J0CA 3S5UA 2P91A 4H7KA 1EGQA 4GZMA 3SNHA 3FR7A 3BMNB 4RVSA 2BF7A 4G86A 3RKRA 4BN4A 4J1QA 4UDOA 1UPXA 4DB2A 1H0RA 4INOA 3GBSA 5I9TA 1P5ZB 3QXXA 3WLKX 4IHJA 3Q2IA 1X0XA 3EGXB 3C8ZA 4QVGA 1NBMA 1T10A 2ZSKA 2P6OA 4MAFA 3E5HA 4MQBA 3Q8KA 2UZ4A 2GXUA 4IVQA 1E9BA 2VHVA 2ZATA 2G8LA 1DCTA 2EOAA 3KD2A 2F8TA 5F2KA 2PH5A 4IQGA 1M2EA 1RQLA 2VT2A 4BJHB 4OA8A 4FS3A 2FWPA 5C1BA 2ZBUA 3D6MA 2V4UA 1LSOA 1ZCFA 2FPLA 3L1JA 4UQOA 3GJSA 1DQYA 4WBNF 2FSIA 3QOFA 4GNKA 3FYUA 4M54A 4A0RA 3F47A 3G3EA 1C4OA 5H5JA 3W2IA 1FDIA 1YAJA 1ZN9A 1N3BA 4YDSA 3TSOA 1USKA 2EP5A 2FE4A 2A59A 2BHTA 2O6LA 3ZOKA 4U39A 1SKYE 4CIXA 3D3WB 1BOFA 1U7DA 1J2JA 3E3OA 4PSCA 2FZ5A 3I12A 2FGKA 2OK8A 1NBIA 1WO8A 4L8LA 1Q1AA 2G5GX 4NCIA 1RHMA 4M76B 2GXAA 3OZFA 4DUGA 1KYIA 4OK3A 1M2JA 4WOJA 3WFJA 3MGKA 3QKUA 1SO8A 3L1HA 1ZOOA 4NYMR 2ZTSA 4CF6A 3UPDA 2W83A 2GBLC 4D5GA 4YT4A 3GEGA 4YPOA 1E58A 3NC1C 1DJLA 1Z4PX 5BUCA 3LQRA 1WJGA 5KYGA 3V8BA 3K0AB 4MHTA 4RPLA 4ZTZB 2GCNA 4E88A 1Q22A 4RY8A 2QZSA 5CM9C 4CLOA 3WB9A 2M6RA 1CW2B 3LK7A 1FQJA 4JJZA 1P0MA 2FP4B 2NAPA 3DL7A 5DYYA 1ZR4A 1N5DA 2MYPA 4F4HA 3HYTA 1XZ8A 4DCJA 5DASA 5E7MA 4DYVA 1Y98A 5B2ZA 2I6XA 2P6UA 5ADUS 1USGA 1NJ5A 1G19A 4YHBA 5DTQA 3IAAA 5FUBA 2PSSA 2HY7A 3NFRA 5J3JA 3N70A 2WUVA 3PHGA 3NWOA 3TLMA 2EQBA 3ZXXA 1XTVA 4GLJA 3PBKA 1M5UA 1OKKA 1VKOA 4NNOA 4R2HA 3ZBPA 1Y0BA 2QP3A 4DMUB 3GLGB 4Z4IA 2BGGA 2X4DA 5BWLA 4R83A 1XMQB 1VG1A 1XTZA 2IQIA 3RLIA 1E6KA 1CDEA 3S5JA 1DFHA 3ZLJA 2FEPA 2IOQA 4FB5A 5JXHA 1L4FA 1GTSA 4S0ZA 1Z36A 3Q0IA 4XUGB 3OC6A 3SM9A 2D7CA 3AZOA 3QW2A 4URHA 3T4XA 4DCGA 1ZLYA 2X40A 2PL1A 1NASA 3M6VA 5L3ZA 1D6JA 1HETA 2XWQA 2FR8C 3NEAA 5CB6A 3K2BA 3RYCB 3BMXA 4QSMA 1D0SA 4U3JA 2XADA 4WI1A 3AW8A 1XAJA 2VZ8A 4S1VA 3FOWA 1FY2A 1R64A 1V8FA 2QN8A 3NVKI 1WVMA 4ER0A 1N8SA 3DMRA 3DVAB 5DU2A 3EXEA 4P7JA 4JKYA 3VHQA 3TAXA 2ZRLA 4R2MA 2Q1XA 5JE8A 2A9QA 1Q3HA 2Z8YA 1XDWA 3HUUA 1PZHA 1GN8A 1O5OA 2P5TB 1AGPA 1QZXA 3D0OA 5HTKA 4EG5A 2Z6VA 3R3YA 4A2QA 2HA7A 1SC1A 1OYOA 3F7NA 1E1NA 2GCOB 4DDTA 2IYAA 5C9ZA 3SHVA 2WSMA 3FPKA 1J33A 3L3BA 3VR5D 1NFFA 5PNTA 4FDMA 4KBYA 1MW9X 3CKLA 3DL4A 3OKFA 4JJ8A 1KI4A 5FOVA 3PRYA 5L45A 3D6JA 4RHCA 2XA9A 2DOKA 5JO9A 3L9WA 4HBGA 4P0PB 3ETCA 3QYPA 2WT9A 5AQEA 1JXMA 2PUVA 3CZMA 1O08A 2JGDB 2R5NA 4UAUA 4K6MA 4Q4JA 1BJTA 3B1FA 3HNPA 3LHSA 4NZOA 1S89A 4NICA 5IT5A 2G5PA 3ENZA 2PRKA 1HLFA 5K51A 3O3OB 3CSDA 1K86A 1Y3IA 5J1TB 4EW3A 2VTEA 4XWTA 3FWKA 2M32A 2WUEA 5C7OO 5IULC 2ISSD 1PK8A 2FQWA 2XCOA 5GIOE 4JEHA 5CHYA 4DS3A 3DMTA 4R1TA 4ZMRA 5K4HA 4C2AA 3MGCA 2J9YB 3H5OA 3GMIA 2NTVA 2V7XA 3PUJA 4GI3A 4BEJA 3TZHA 2ZIEA 5F9HA 1TIBA 2FZVA 2HV8A 3PRKE 3SDSA 4ZZIA 5DSTA 1Y4SA 3RW9A 3QXGA 5FWXB 5I8PA 1N7JA 1JWAB 2PS3A 2YVLA 3LA8A 2HSDA 2VPXA 3LT0A 1KY5A 1U8CB 4MYDA 3PIIA 2FJPA 3RIMA 4G0OA 4MO9A 4RKWA 5CGQB 5FPHA 1ZUNA 1W581 5FWAA 2GQ0A 3DUFA 1X7WA 1LC3A 4J3FA 2JIZA 3GUYA 3L9XA 1HOXA 3CRRA 1K8YB 3NJRA 4XOUA 3V4LA 4C0AC 4EQZA 5G53C 2Z57A 2WHPA 4UTPA 4BO1A 1JDBB 4E4YA 4XYMA 1T8TA 1S01A 2QT0A 4V0NA 2GBLA 1TKAA 1KVQA 3ONDA 4WBXC 4LQCA 1J49A 3SLKA 4OLHA 1BFDA 2X4LA 4O5AA 1G1MA 3KYCA 1K27A 3QEMA 3ROKA 3SEFA 3VKGA 4JSRA 4A73A 1A76A 2O2IA 1DSSG 2FSVC 2XCQA 2DXIA 2R7AA 4FDTA 3DFIA 3IKVA 3O1JC 3CPEA 4H3KB 2FPIA 1W4CA 2WMDA 1U7OA 4G0QA 5AH0A 1EWYA 4BV3A 4EMUA 4W5OA 4UDNA 3F4BA 3ZCQA 4H1VA 1CEQA 5CFZA 2O2SA 4F84A 4AUEA 1TVMA 2ZZKA 3UOGA 1YAHA 4RTKA 3U3DA 3DW1X 4GPTA 3S8MA 2VJMB 2XYPA 3QVGA 4G2TA 2VSNA 3RC2A 1NSFA 3K1YA 1FYFA 1GZ4A 1YQWA 2XRFA 4OF4A 5EZYB 2A57A 3JATA 4EECA 1P0FA 2IU6A 2R48A 4DLBA 4WNAB 4DSNA 2JJ1D 5DI3B 4EDFA 4O2LA 2Q29A 2M6LA 4DJJA 1M6NA 1M1ZA 2IUFA 3FE2A 1I5RA 1QYDA 2YMQA 1C30B 1OZAA 2PGAA 2JLQA 3IDFA 2QW1A 1HSOA 2QW0X 4KRFA 1YK1A 4JVLA 5F7OA 4X7PA 1KNQA 1Z0IA 3PFIA 2FR8A 4J91A 5GY7A 1N5JA 3ZWOA 4YYEA 2RH9B 3NGLA 3F6EX 2Q45A 4BVFA 1F2TB 2HFKA 4GICA 3HVJA 1PT5A 3HK2A 4ZYLA 4MDYA 4OJNA 1TPYA 4KX3A 1UMDB 4DG9A 1COWA 4PO3X 1XD8A 2R62A 2VYFA 1Q7EA 1UMCA 2AK3A 2I4NA 3GHYA 5ALYA 3UHAA 1PG2A 4YQFA 5IT4A 2TMGA 1ODKA 1BCSB 2FNAA 4J7CA 4HN4B 1QU2A 5EIHA 3LRXA 4JBXA 4QBGB 3QFTA 5MGBA 5FJJA 3PTZA 4IFTA 4MI6A 2B35A 4CTJA 1EJ6A 4LIPD 3U3XA 1PBTA 3BBLA 3A05A 5JNRA 1KK3A 1IK4A 4OLFA 4CR8A 2WT4A 4DPMA 3NXKA 3OQIB 4W1PA 2VF8A 4P92A 3GUHA 3EY9A 3AVXA 2C5GA 4OMUA 3W3AD 4OA5A 3I6BA 4OXRA 4TWZA 1E3WB 1BU5A 3CGWA 3ROFA 3U9SA 2IEBA 2M1XA 4BUCA 1EFAA 4N47A 3UMFA 3TPCA 5CT4A 2PGIA 4NOKA 5AJUA 2J41A 3V9PA 1J25A 4GOND 4R54A 1LLUA 1T8UA 2CJWA 5E2AA 4HF7A 1E8DA 4NECA 3AOGA 2ODAA 3RM3A 1R6BX 5C1OA 3EQZA 2OAP1 4KXMA 3NTUA 4Z8XA 4E31A 1DFIA 3D6TB 3DVRX 1QONA 2ZJ3A 3E7WA 3HUEA 3WNDA 2QTHA 4GZ5A 5AKKA 5E9JA 3TD6A 2GBCA 4L7QA 1XUOA 2JARA 3QVXA 5HQTA 4HNSA 3GJQA 3URKA 3OBBA 4OFWA 3ZPXA 4A2CA 3WL6A 4MYHA 2F1JA 1I30A 4O63O 4BRWA 5JPCA 3HE3A 1HI9A 4L5BA 1KSFX 1N4AA 1GRRA 3DB2A 2WVHA 2C20A 2OBFA 2YY7A 3GLHE 4UFOA 4C88A 3GZTB 1APBA 5MN4A 1CT9A 2Q41A 2BGUA 3WRWA 5BOSB 2JI6A 5JS8A 4LX8A 5FOQA 1H2RS 4MIEA 1ZJZA 5HZMA 3ON5A 2GESA 5HMMA 2IDMA 2EW2A 4RV4A 5CM8B 1NSYA 3PJDA 3UV7A 5HRAA 5G0VA 3GRRA 1W1WA 1OXMA 2WF6A 3T9CA 1TD1A 1PJBA 2PR2A 5EWMB 2WVAA 5F9FA 1TL7C 3FAKA 4QHTA 2FUG6 4OATA 1I10A 2C5SA 3N9IA 3FI0A 4Q66C 4RVNA 4XVRA 2DUMA 1DIRA 4BECA 2FSVA 4ABTA 4EAQA 4H27A 2MYTA 1XZBA 4F2HA 2J0UA 4B3DA 3EY4A 3GLFA 1SZDA 4YRSA 2O7SA 3G0OA 4BV9A 4GGOA 1G8HA 3AU9A 3MAGA 1GUDA 2GHQA 3GV0A 4MV4A 4QBIA 3DZHA 3TX6A 1S4QA 2Q27A 1KDPA 4EF5A 1V6SA 1VIDA 3CKMA 2XQVA 4GE3A 2I1VB 3AFGA 3LKBA 4MUGA 2VT7A 4REOA 3VJMA 2GD1O 1BIFA 1GKYA 2JFFA 3G0IA 4RELA 2XA2A 2PQMA 4RWEA 3OP4A 3GVPA 1B8VA 4DXAA 4MKIA 4ITUA 4YJHA 2ZR9A 1HE1C 5JCZA 5LOVA 1D6MA 5LR6A 4PYOA 1HUQA 5ULLA 1BVHA 1GLGA 1DEAA 1K9SA 1PR5A 2DULA 1QCYA 4GT1A 4K46A 1M75A 2YXEA 2BEUB 3QWAA 4EITA 1KEZA 3DF9A 1CYDA 1VECA 2EF1A 3S0JA 1Z3IX 3QH4A 4H60A 4PCUA 3UXYA 1NYTA 3WLEA 5CFOA 5KWSA 3EDOA 1QJCA 2YRWA 5DPMA 3WYCA 2P65A 4A92A 3JQDA 3M7IA 3TLAA 5BNIA 2CUZA 2NUBA 2XGSA 2O59A 1W5SA 4MITA 4MS4A 2BBWA 4AULA 1WE2A 2FHPA 3L7YA 4PX5A 1N2BA 1PIWA 1BRMA 3BG5A 3R5JA 4GWGA 4LYYA 1OBFO 4A16A 4BKUA 4CL0A 2HF2A 1DADA 1WD5A 2H4ZA 4CLRB 1R8SA 2W90A 4Y0VA 3P7MA 1HPLA 2CE7A 5LP1A 4TLMB 2W2VA 4KR2A 1J8FA 5JCPA 4GRAA 1J24A 1KMHB 2IHZA 4IIEA 4Q5IA 4DFDA 3RTDA 3Q1KA 3FTNA 1EX7A 2O8FA 3IVAA 4YLYA 4BRSA 3EUFA 1BYUA 3AJDA 4JP2A 4KDRA 4GEKA 4ZI7F 2GJ8A 2XTZA 2O2CA 1QAMA 1WHTA 1N6IA 4BRZA 4JXXA 4D9MA 3NC0C 1DV2A 1PU2A 2PSJA 4FSDA 4XM0A 4Y9RA 4TXLA 4ENTA 4N0PA 4JR2A 2O5EA 1EIWA 1JU9A 3E9ZA 2AI2A 2XGGA 1SIWA 1HFKA 3GMDA 1QK4A 2E4ZA 1BHO1 3CWQA 4Q3NA 1DE0A 1XD2B 3MMSA 3TO5A 4M8NE 4M1ZA 3PDWA 4LXUA 2COUA 2VUIB 4TS1A 5HE9A 2P4QA 3CUSA 3N3BC 5HVNA 1LVUA 2ZROA 3P9YA 3T7KA 4LK2A 1KJIA 1QF6A 4OQQA 2MOKA 3MRTA 3DDCA 4KQXA 4CV3A 3ADOA 2C3PA 4MW2A 1TW2A 1YI8A 1I7PA 3D0KA 2ZBFA 1YQ9A 5CG1A 2DB3A