3KQHA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
total genus 142
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqhA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqhA01
1MO3A 3MD0A 4DDTA 2YV5A 3A1SA 1XRJA 2ZSAA 1GAJA 5E7MA 5EUMA 3IHWA 4P4TA 4GZMA 2PJZA 1II9A 1VCOA 4CT5A 5LD2B 1GILA 4TTQA 2VP4A 4OI4A 2ORWA 1KK1A 3MWJA 1FQJA 3THOA 4JL6A 5EXPA 1P61B 1XCPA 3DZ8A 3AVOA 1KI8A 1KY3A 1Z07A 3OAAD 4A8JC 5BYJA 2ZE7A 1AKYA 2W6IA 4B44A 1Z28A 5FUXA 2OBLA 2O8BB 1MO4A 2C78A 4AKHA 2AHOA 3B5JA 2C95A 1W1WA 1BS1A 3U7HB 4DB4A 1CJVC 2IT1A 3ICQB 4LRWA 2IYRA 3ND8A 2B6HA 3AF3A 1FFHA 5G41A 3AGPA 2CNWD 1N25A 4U02A 5C1BA 4BFUA 2X77A 1ELOA 2RGDA 2VHCA 1RPZA 3F0TA 1ZNYA 1KIMA 1KMHB 3AKCA 5CIQA 1HE8B 2BCGY 1XPRA 2B7CA 2ERYA 2OAP1 2PBRA 1ZP6A 5KO2A 4JYCA 4CYMA 2GBLC 3TE6A 1HA3A 4PTLA 1K5DA 1ZM3A 2OCAA 3RS4A 1XD2B 4M1OA 4NYMQ 2JLRA 2QA5A 2WZQA 2FGKA 3CF0A 3L0PA 4BZXA 1JR3A 1E2DA 3FKQA 3I8SA 4D0NA 3DKVA 4QHTA 1J70A 2GBLA 3HDTA 2J7KA 2YOFA 3K0FA 3DO6A 3WP0A 4GPTA 3OEHA 5AUNB 2ZUBA 3VR4A 1TU3A 1YZQA 2G83A 5JZVA 3AB3A 1YQTA 1U0LA 3ZH9B 1CR4A 2QP4A 1VIYA 5KDDA 2GVZC 1E2GA 1E1RD 3EXAA 2YNMA 5BN3A 5KYKA 2JLUA 4KXFB 3KDSE 4ZDWA 1Q1BA 4BASA 1P62B 4HAZA 3SNHA 5TXGA 2FJUA 1G3UA 1C9KA 1ZC3A 2ZJAA 2JLSA 2VF8A 3FMFA 1OIVA 4OJKA 4IVPA 1T0JB 3M0EA 1NY6A 2F6RA 3L8YA 3ASZA 2QSZA 1NN3A 1DAHA 2ZU6A 4DBLC 3Q85A 2BV3A 4RD2A 3H0KA 4HAWA 3ASYA 4PQFA 3O8CA 1MO5A 4UKDA 3RSOA 3SR0A 4R9UC 2ORVA 4JT2A 5D3QA 5ANRB 3U5ZB 2V4ZA 3K53A 1UDXA 5K8TA 5AJZA 2ZI3A 4RFVA 3A4LA 3W8RA 2NMVA 3GLFA 4JT4A 2P6RA 4BEJA 5SZHB 4PZLA 5AJWA 3K0AA 4FW9A 5C2JB 2LKDA 3CF2A 1JXOA 3UG6A 5JEDA 2KJQA 1U0HC 2B7BA 4NONA 4U00A 5HCIA 2V7QD 1ZD1A 1NN1A 3K0CC 2D3WA 4JLAA 1DBSA 4D81A 4A0FA 1UADA 1Q3HA 2FH5B 3LNCA 3VQTA 5DHAA 1R10A 2GJSA 2XXAA 4Q4JB 3CM0A 1XCGB 1IXSB 4KHZA 2PCLA 4Q4AA 4KBGA 2PX0A 5DI3A 4DSOA 2BVNA 2Q0HA 3KL4A 1L4UA 4MGIR 4LJ6A 3EIQA 4QXAA 3RS7A 4UNRA 3K09A 3ZDQA 1T8UA 4XWAA 3DMNA 4UNPA 4KYIB 3CRMA 2N42A 3I1FA 3QENA 4Q02A 3K0EA 3NVAA 1J7KA 1KKLA 3PFIA 3MFYA 4ERNA 2QGZA 3GJ0A 2VF7A 1P6XA 1P73A 4F4JA 2IW3A 2XITA 1VDZA 4M4SA 4TLAA 5HCNA 2BBOA 3R8FA 4BUJA 4WZAE 4PFSA 2QTFA 5CJPA 3TLXA 4ZIRB 5JEEA 3OZXA 3IO3A 3PEYA 2DFLA 4RCZA 1F48A 4DCSA 3NEJA 2RGNA 1TEVA 3EC1A 4IJMA 2ZRCA 2H1LA 4HUQB 4RJLA 3KXLA 1DELA 2VH5R 1AZTA 3ADKA 3AP3A 821PA 2R6CA 1E2EA 4IXMA 4C9BA 2WWXA 2ZVPX 4PC3A 3B1XA 4EQ6A 1GSIA 4DLTA 1UBGA 4FN5A 2Q3MA 4X8OA 4HLUA 3CPJB 2HXSA 2WWHA 5IRCD 2G9NA 5CK5A 2OZEA 4Q7KA 4DCUA 5E7JA 3SQXA 3O8DA 1R5NA 2XX3A 5B2ZA 1J8YF 1NJFA 4HLCA 4TQ9A 3F8TA 4BPBA 1XD8A 1EFHA 2NO7A 2EYUA 3VTKA 3EG5A 4DDWA 3W90A 1RC8A 2DYKA 2MSCB 2UVQA 4WXPA 4JLDA 1GRRA 3P4YA 2RB4A 4PHFA 5KNBA 3MMPA 3KB1A 1KJZA 1ZIOA 5DIFA 2L0XA 2F1RA 5G3ZA 4ASUD 1KOFA 1NG1A 2O8DA 2ZRLA 2YC2C 1LY1A 2IXEA 4I1VA 3AVYA 1UM8A 1MKYA 1XTJA 1CJMA 1J90A 1NBMA 1NJGA 1VYVA 3MLEA 3N2IA 3U44A 2O8CB 4ZI3A 4AI6A 1RJ9B 1XJ0A 1Z0DA 3L82B 2G6BA 1S0UA 4UJ3A 4BFTA 2BC9A 1FMJA 3AUXA 3BD9A 1E2JA 1SQ5A 4KSCA 2NQ2C 2ONJA 4DC9A 3KQUA 1T3HA 1TMKA 1NL3A 4M9QA 1IBRA 4MDEA 2IS4A 1US8A 2GHIA 3FFBA 3T34A 1SXJD 4P0TA 3W8NA 4Q47A 2NIPA 3HPRA 4RCYA 4AYXA 5BWMA 4Q19A 3IGFA 3DOFA 3TR0A 3CR8A 221PA 3FGNA 3KJEA 5BQ5A 4DLYA 5JMTA 1VYTA 2VP5A 4BECA 4GOKA 4I1UA 1WB9A 5KNCA 4RKEA 1M7HA 2AK3A 4LV5B 3CO5A 4V0OA 3SU8A 3GMTA 1E9RA 1D2EA 1Q57A 4DSUA 4ON9A 4MA4A 3U61B 2VHUA 5FBLB 1Z22A 3AVUA 2HJGA 4OL0A 4A9AA 3LD9A 3NHBA 4TWZA 1GNPA 3HPQA 3HU1A 4WBSA 2P3SA 1G41A 3LV8A 4Q4HA 2W58A 1E2HA 4GSYA 3U7EB 3LQRA 2WWFA 3CX8A 2ODBA 1M7GA 1XD2A 1UBFA 2D2FA 1XD9A 1F3OA 1R8SA 1E0JA 4GOJA 2CNWA 4BFSA 1A7JA 4V03A 4BZQA 4WW0A 5GVSA 1K6MA 4PX9A 3KKMA 4CT4B 2K5UA 2IYUA 2GF0A 3OE7D 4HB3A 4RY2A 4RFSA 3SFZA 1RIFA 1DADA 2E1RA 2F1JA 3RS2A 4FMDB 4G1UC 2A9KA 5K8UA 2H5EA 1G6HA 4O0MA 2GEDA 2ZJBA 1U2RA 2IYLD 3CLVA 2BMDA 3AP1A 1OXUA 3ZGXA 5E4FA 2IEYA 4A2PA 1N2CE 4D26A 2BBSA 3D3QA 3ZD6A 1UDWA 4L9SA 2F7SA 2YINC 1YZGA 3KQHA 2FE4A 2ZPTX 3KJIA 5KPJA 4E07A 2QU8A 2XSZA 2UKDA 4BRWA 4GBMA 2IC5A 4C0JA 4HUQA 3IBYA 1S1CA 3QQ5A 3WNBA 4EPTA 1V5WA 4IDOA 4LCBA 1EWRA 3A36A 4NCNA 4QNRA 3AM1A 4O2LA 2OXCA 1Z47A 4Q1CA 1OB5A 1P5ZB 4TYWA 2GDJA 2BKEA 4EPWA 4F93B 4EPRA 2ODWA 3B60A 1XU4A 4GT1A 4MKHA 2HCJB 4FMCF 1N6PA 1PV4A 5G53C 4QHYA 1PJRA 3HR8A 2AN9A 3PEUA 5SZKB 3UATA 4CGZA 1ZVQA 2QT1A 3TMKA 4PO1A 4B76A 2F1IA 2IA5A 5KHOC 3KFXA 3U3OA 3AQ4A 1QG4A 4FMDF 3VHLB 5JRJA 5IT5A 1P2SA 4RZ3A 4ILEA 3GLGA 1QG2A 1SKYE 1S9DA 1X86B 1RRGA 2DR3A 4NTZA 4X8MA 4NCKA 1OYWA 4QRHA 4FIDA 3R9WA 2NG1A 2ZJZA 3KUDA 1JEDA 4JLJA 1OFHA 3QUSA 3T1TA 2ODEA 2O0JA 3TNFA 1KY2A 2VRWA 1RFLA 5FI1B 3H2YA 1BO6A 1E32A 2IUTA 2FN4A 2D2EA 2EFGA 4B3FX 4XVUA 4MUBA 3BBPA 2LCFA 3KFVA 3K0AB 1LS1A 3NIBA 3UMRA 2FMXA 1VG0B 3TAHA 3C41J 1CJKC 2MMCA 4EPXA 1DE0A 1HV8A 1Q21A 3QKRB 3TQFA 2ZAMA 1NLYA 4G01B 3TSWA 1YR8A 2NZJA 1GWNA 1R5BA 3Q5EA 3RNLA 1G8PA 2QEQA 4B75A 2ZUDA 3A37A 1XF9A 5SZIA 4RZXA 4KFUA 1LF5A 1TF5A 3DMDA 3ZVNA 2R6FA 2A30A 4WXRA 1P60A 3EIEA 1M8PA 1XEWY 2JJ2A 1X8JA 1M6NA 1WCV1 1M34E 2ZYWX 4K8OA 4TYPA 2FZ4A 2H92A 1XMJA 4IOJA 2O5VA 4FCTA 3RYTC 2AFHE 3TRFA 1XTQA 2J0UA 3T1OA 2IWRA 3SN6A 4G5GA 5CLLA 2OLJA 1E3MA 1OIXA 1JR3E 2AL7A 1CTQA 1OE0A 4JS0A 1XEXB 1LTQA 1LFDB 1R4AA 3K0SA 2O8EB 2FGJA 1E2IA 4BFVA 2VP6A 4PSVA 3LVRE 4Z54A 1C4OA 2IUUA 4XIGS 4PSAA 621PA 4AIIA 5JJKA 4V0MA 2PZGA 1KMQA 5EUQB 5FUYA 4L4UA 1UKYA 4MGKR 2OUKA 1MV5A 4UNSA 1N6LA 1KDTA 1NP6A 1FNMA 1H8ED 1DARA 1XEWX 3A4MA 3DKPA 2C04A 5A5GA 1W0JA 2V6IA 3QXCA 1NI3A 4IXNA 4Q7MB 1NBMD 2H17A 5F9FA 4CRWB 4JLVA 3REGA 5EZ6B 4RD4A 1ZUNB 3B13B 5JRZA 1II8A 2JIZD 2P65A 1B0UA 3VX3A 2F43B 1CR0A 1WRBA 2J1LA 5B57C 1JQJC 2CJWB 1OIWA 3K9GA 1KK2A 2JDIA 3OFND 4ZCIA 3K70D 5FL7A 4WIAA 4PQYA 4ZDKA 4HB4A 1IN5A 3EW9A 2XJ9A 1RYFA 3VNVA 1P7CA 1W5SA 4TMXA 1UEJA 1MABA 2AR7A 3HYTA 2CLSA 2O8EA 2Y8EA 4IRUB 2JJ1D 5FOXA 2JLYA 2RHDA 1JEEA 3GFTA 4MGYR 1UF9A 4FINA 4DEXA 2P2LA 1W46A 3NBYC 4QG7A 1OB2A 2EW1A 2XAUA 1E79D 4L5BA 1QHNA 1VMAA 2VHQA 4Q1DA 4QNMA 1FP6A 1KO5A 5KTYA 5IK2D 2C9OA 4C7OB 1N6HA 3VR3A 2WVJA 4PHGA 2GF9A 4DSNA 1UFQA 2W0SA 1NIPA 1NG9A 1XMVA 4HB2A 1ZMXA 2W6ID 4JSYA 3SDZA 4R2HA 2Q9AA 3HJNA 1VIAA 2CJWA 4F4IA 3FKSD 2ZI4A 2GJAA 4B71A 1D2MA 1ESMA 1G5PA 1VCIA 1AS2A 3VKWA 5KDOA 3RRNA 4TT3D 4YDHB 4LZZA 1Q20A 1E6CA 4ACAA 1Q1ZA 5FR1A 3OE7A 2B92A 4LK2A 1QZXA 4QJ3A 4TT3A 2CVFA 5CDFE 4A6XA 4LX0A 4LGMA 4CEJA 3KXKA 2VSFA 4C2TA 5D3MA 1H8HD 1LS6A 3VR2A 4BLRA 4IDPA 1XTSA 1N5JA 1I4DD 4PO8A 2PZFA 3AV0B 3QEOA 4IOLA 4OK3A 4Q18A 2FFAA 2JATA 1G21E 2DHRA 2ODNA 1NVVQ 2Q3HA 3HU2A 1AIPA 4Z8YA 1JR3D 4PC1A 4EPVA 2DWPA 2EYQA 2FFHA 2IXFA 2ZE8A 3GD7A 5FTKA 1TTTA 2ZM5A 4MGZR 1HH4A 1WXQA 4PR0A 3CIOA 3ADDA 1OH5A 3DDCA 1YZNA 4L8GA 1RVDA 3QKSA 1SVSA 1R0WA 1LW7A 2GTPA 2CHVA 4C0SA 3CRW1 1N6KA 1OH6A 1ZRHA 1J99A 3AKYA 4JMPA 1F60A 4G5QA 3SZRA 1JALA 2IYXA 4S2EA 3WRYC 3LVQE 1NVVR 2Z4SA 5AJXA 5FTNA 2HYIC 2OCBA 4KYUA 1GKIA 3QXHA 5FOTA 2IEZA 1KTVA 2NTYC 1AGRA 1MR3F 3AEZA 4OHWA 2NPIA 2PEYA 3Q72A 1CF4A 5J40A 3BERA 4OBEA 1W47A 1DAMA 2FFBA 2GNOA 3SBEA 2YWGA 3W3AA 4JVNA 3X2SA 5DN6D 1F2UA 4LOAA 3MJHA 2Q9BA 4GL2A 1VPLA 3NBXX 2YC4C 1Q1QA 1SZPA 3OIUA 1Z8FA 4LHXA 4IKEA 1VG8A 2WWIA 1FP7A 3UMSA 1QHGA 1YZUA 3BAFA 2ZRPA 2A5YB 4CW7A 1Z3IX 3F3YA 2H8KA 4ZIRA 1TU4A 4M53A 4R71A 1DO2A 1G9XA 4NYJQ 1L8QA 3SJCA 1N5KA 3QVUA 1AN0A 3S1AA 2OLKA 3RRZA 4XVQA 1G291 3CPEA 5FFMA 4JBYA 2JLXA 2XNSA 2WBLC 4HAVA 3SYKA 1D9ZA 2GCPA 2VP2A 3U3KA 1E94E 2FNAA 2CCGA 1II8B 4HI0E 5DYIA 2QMUA 1QHSA 3AF4A 4LJ8A 1GM5A 2ATVA 4GDFA 3FMPB 4EJSC 4LBZA 2I1VB 3D8BA 3SS8A 2VHTA 1CKEA 3JVUA 1J8MF 3M1IA 5DI3B 2XB4A 1JAHA 1YR6A 5TARA 2PL3A 2RAPA 3PEVA 3TIFA 4KITB 2XZPA 3QVVA 4V0NA 5DGXA 2WSSA 2ZYVX 3VR6A 2XZLA 3SOPA 3N70A 3OFNA 3R20A 721PA 4N0DA 4Q66C 4LBWA 4AG6A 3SHFA 5ELXA 2XZOA 3OIYA 4OYHA 4PHHA 2GCNA 4NCIA 5TV2A 3PUWA 2DFTA 4TMVA 3GLFB 3GLIB 1NN0A 1E9DA 1JXMA 1D8TA 2YJTD 5DE3A 1SXJA 1T5LA 2FPLA 3OIWA 1ONBA 3HU3A 5LB4A 2QQEA 1TAGA 1TEXA 3PQCA 3T06B 1OW3B 3UPUA 4TYYA 1GL7A 3U3RA 4WA7A 2OSBA 4DHEA 4JVMA 3KTAB 3OAAA 1CULC 3B7GA 3ONWA 2EWVA 3VAAA 3I5XA 2CHQA 5DHFA 1DPFA 5CM8B 2ZRKA 2HT6A 2J7PA 1MABB 4MDFA 4CIDA 1KI6A 4DDVA 2IS2A 3B9PA 4L16A 2ZETA 4RD6A 1SVLA 1DO0A 3LW7A 2XNDD 3ZJYA 1T6NA 4Q9JA 3K8YA 3UIEA 4OQLA 1Z6GA 1KAGA 4B73A 3CR7A 4DLSA 1OFTA 3NHAA 3RWMB 3A1VA 2GCOB 2J46A 1NRJB 3U4QB 2IS6A 1N5IA 2P5SA 1KNXA 3IIJA 3KXIA 5AJVB 3TW4A 5BN5A 3P26A 3I73A 1GNRA 1TUEA 1JQLB 4M9XA 5DISB 4ASUA 4HB0A 4URYR 4DJTA 1E2MA 2BM0A 3LX8A 1S8FA 2OM2A 4G5RA 4A4DA 2NO1A 5DSZA 2PX3A 2P67A 1TQ4A 2CL7X 3L8ZA 1YZLA 4Q03A 3K9LA 2QTHA 3FHOA 5LB2A 2O0KA 2CBZA 5HTKA 1JAIA 2VQSA 2F3RA 4M0LA 4PC6A 1K8RA 2WPDD 1KAOA 3KTAA 4JBWA 2ZVQX 3BE4A 2WJIA 2EQBA 3PJRA 3FDIA 1D6JA 3PXGA 5L3SB 2XTZA 4GMDA 3FMIA 1NN5A 1WDTA 2BM1A 2O8FB 4PAMA 1SXJE 2G0TA 2YWHA 3OESA 2C9CA 1FZQA 4LDJA 5AUPB 1E96A 4JLPA 4AWXA 2OEPA 3A1UA 3T35A 2GEVA 3QKSB 1KK0A 3AKDA 1E9CA 4Y0VA 5HR5A 4OK5A 2A5GA 4Q9HA 5LDDC 4RKFA 4CEHB 2FWRA 2WMNB 3AP2A 4TQAA 4LYAA 4JLMA 3RAPR 3W5IA 3GJ7A 2CHGA 2QBYA 3GPLA 1DAGA 4D82A 1OFIA 4NCJA 4Q9KA 5AR1A 5A4JA 3K9NA 4TMKA 2FOLA 3C14C 4TL6A 4A2WA 1AJEA 1CR1A 4TSFD 5BW8A 3WP1B 5EE1A 4TZ0A 4CF7A 2ZI6A 2QN6A 5K8IA 4ZPXA 3BH0A 3LLMA 4ZCLA 4QGFA 4M22A 2Z43A 3H1TA 2G0NA 4NP6A 3FFAA 3PEWA 1CRPA 4MKGA 4K81B 3GJ8A 3TR5A 4QBIA 4Q7JB 4B3CA 1E2LA 4N1AA 4NYIR 2KB0A 2QP9X 4IDQA 2KSQA 4A8JA 1U98A 3AVTA 3B9QA 2HCBA 4EJSB 4M1TA 3ZVRA 4LJYA 3MWLA 4MRVA 4WAUA 1JR6A 2IYYA 1GNQA 4A0HA 4H1UA 1P2UA 2P6NA 3GJXC 4GZLA 3WRXC 5FTLA 5J47A 1WBBA 4LHVA 4WZBE 3JZMA 1FTSA 3EC2A 4JLKA 3SJZA 1D2NA 4B6EA 2AKAB 3LRPA 3U3JA 2C77A 1OHHA 2ZS8A 2RMKA 1WA5A 3SEAA 4A2QA 3TVDA 3W3ZB 4BFWA 2IX3A 2XSZD 2CE2X 1T3LA 4V0KA 1SVMA 1CU1A 1W2GA 3ECCA 4Z1MA 2NO6A 2ZANA 1E98A 3CH4B 4KFSA 4XWKA 2WJGA 2ZYUX 2V1UA 4ZKEA 3UXMA 1QHHB 2FEMA 2P0EA 1ZD8A 4QOSA 4HAUA 2IF0A 1EFRD 2EVWX 3CNLA 4KFRA 2O52A 3RSLA 1A4RA 4MRPA 3V00A 3K0FB 2I4IA 1OXVA 2KBEA 2W2VA 1QDEA 3NBFA 1U0JA 2PEZA 3NEYA 4PANA 5FPKA 4EKDA 2CL0X 1F2TA 3QY0A 4I4LA 1EX7A 4IW3B 4M8NE 3QSYA 2B21A 3KB2A 1ZM4A 3ZIAD 4LC1A 1GL9B 3B85A 3BRWD 1TQDA 3QPWA 2JLQA 4D80A 2FV8A 5KOYA 2R62A 3GEIA 4N3NA 3EPLA 4HAYA 4GRAA 1Z2AA 2OBNA 4TTRA 4JVLA 2ZRNA 5JWHA 3SYLA 5CM9C 2FSIA 1RYHA 1UKZA 2WKRA 3M4YA 2VA8A 3R7WB 1H65A 5EXSA 1R0ZA 1EG7A 4LJAA 4IEIA 4BLTA 1X1RA 2WIAA 5KPDA 1PVOA 2I3BA 3IO5A 4HZUA 2ZR0A 5E7IA 2VIIA 3IHLA 4WVFA 3SHWA 2CDNA 4V02A 1JB1A 1XB2A 4U7DA 2X1VA 2NZ8A 1PLJA 1HQCA 1P2VA 3HP1A 2I1QA 2UZ3A 5FBVB 3BIFA 1A5TA 3QJYA 2QP3A 5AJYA 1G3IA 3THWA 1E9EA 4MRNA 4JJZA 4X8LA 3WNCA 5DI9A 2JEOA 4RZUA 3EA0A 5CLQA 1VCNA 3GLHE 5J4VA 4IHQA 1KYIA 5H68A 4IOKA 3BFXA 4LPSA 4OI1A 2DY1A 1II0A 3VKGA 2IHYA 5E3HA 1E9FA 3NH9A 2HJVA 1AM4D 1E9AA 4MYHA 1RRPA 1KI6B 4C0QC 4WOPA 3GJ5A 4UQOA 1S2MA 2YKGA 5IF9A 2W6JA 2AD1A 4IDNA 4IEEA 4JLOA 1R8QA 4KV9A 2ZXUA 4PXAA 3CRRA 4TYNA 1OSNA 1W48A 3W6NA 3OEEA 1HT2E 1ZBDA 3GCGA 3ZIAA 5JECA 1KI9A 4E03A 3BC1A 1FTNA 2DCUA 1E4YA 3OEED 4ESHA 5JLJA 1CBUA 2RH5A 4DLXA 1WQ1R 3KX2A 4NHOA 3PV0A 4C0HA 3EZ6A 1NLZA 1HQYE 2RGEA 2BHRA 4JKIA 3PIRA 3B2EA 4LV6A 1E2PA 2OESA 3D31A 4RZ2A 4ZO4A 3AGQA 2FA9A 4GNKA 1XNJA 2OXRA 2VPPA 3AUYA 4CDGA 2BBWA 4TLEA 3X1DA 4DUGA 3IUYA 2FSGA 1XDBA 4QJ5A 2ANBA 2KE5A 2A78A 4IVRA 3VU9A 4BLOA 4EDHA 1BKDR 1SVOA 3QE0A 1ANKA 2BBTA 4BE7B 3DPUA 4P4SB 4P4SA 5EE0A 2Z0MA 3NH6A 4NKRA 4TMZA 3TJZA 1EWQA 1Q12A 2OE2A 1TADA 3CNNA 1LF0A 3X1YA 4EUNA 4NH0A 4NDZA 3B8HA 2QG6A 4W7SA 2OT3B 2LWIA 5CIWA 4DLZA 5JWRA 1MT0A 4HLQB 4LBVA 3T15A 1WBDA 3UWOA 4PZZA 3E1SA 3Q7QA 1KSGA 4P33A 1QBKC 2FPKA 4Q4JA 2WTUA 1P75A 2J0SA 3Q5DA 1Z5ZA 3GLHB 1W4RA 1UAAA 2DFKB 2RKOA 1CJTC 1XMSA 4PO9A 3RABA 2F3TA 2WJHA 3NTUA 2ZE5A 3I4LA 1W0KA 3QEJA 5KSPA 1AKEA 4KAXA 4D4JA 1W7AA 2GCOA 1TX4B 2VP0A 2OFWA 2Z6VA 1MRSA 2REXB 2WIBA 3X1ZA 3QOFA 2J41A 3E5HA 1ZCAA 4LHZA 3PUZA 4FD2A 4PAQA 4HATA 1U99A 1TF7A 4MRSA 5L3QA 3I5YA 1TL7C 5F3WB 1WMSA 1CXZA 1ZU5A 3FHCB 2GJ9A 3ZZ0A 1KDOA 3UMFA 2QMHA 1Z0FA 1JI0A 1GG2A 1QHIA 2ZJ8A 1MRNA 3K9HA 1DS6A 3CB4A 3SBDA 1OKKD 1ZIPA 1ZNZA 3NKVA 1EFRA 2GKSA 2QAGC 2XJ4A 2YWFA 4QHSA 3WMEA 2GXSA 2Q21A 3KJGA 1G7RA 1IHUA 2OG2A 3EZ2A 1GKYA 2ZTSA 5JSZB 2EFCB 4EFMA 2A5JA 3E70C 1KJWA 1S4QA 2OHFA 4G5OA 4B48A 1N6NA 2Z4RA 2XTNA 3OHMA 3SC3A 2VO1A 3TSOA 1Q1EA 1M2OB 2VSXA 4HYYA 4DCNA 3CWZA 3RWOA 4OI2A 3ZD7A 2NO0A 1G7TA 4URXR 4BLPA 3FOZA 2FG5A 2WKPA 4DIEA 4TLCA 4PC7A 2W00A 4HZUB 2ZREA 3MRSA 2D74A 5F98A 3CRVA 1SULA 2TMKA 1GIAA 4BRUA 4Q4HB 2AX4A 5C46F 2QAJA 5D3MB 3DOEA 2ZAOA 2ZRFA 4XWOA 1OXXK 1Z0IA 1G4UR 2XOKD 3QF7A 4DLRA 4NMMA 3REFA 4PPGA 5H8WA 4YONB 4TLDA 4XSHA 1G20E 1A82A 3DL0A 1YKSA 1YU9A 3CZPA 2J9RA 2BWJA 3B78A 1G18A 3LBHA 2QQ0A 3T61A 2BEKA 1W4AA 1EGAA 3VMFA 2B8TA 3ETLA 1E1RA 1R2QA 2GJKA 2H18A 5AWFC 3T5DA 4PPFA 4DT1B 3GQBA 4QBFA 2RHMA 1D5CA 5FR2A 2VEDA 5GJCA 4TN1A 2JLWA 1E9SA 4NL4H 3B1YA 3WBKA 4P3YA 1UBCA 3NC1C 5DN6A 3TK1A 4BQSA 4US0R 4Q1FA 4MRRA 1O87A 2FDCA 3CH5A 5LBIA 4A6PA 5EE5B 4B33A 3THXA 3W9YA 2GETA 3QKTA 4YXWD 3ZLJA 1NMYA 2GILA 5JS8A 4ZKDA 4LJ5A 2W2TA 5EP1A 5FUWA 4EJSA 6Q21A 4RSGA 3B82A 3N5CA 4OK6A 4TL7A 1DEKA 2GZHA 1G7SA 4S35A 2IBMA 2J45A 2ZRIA 2C9YA 4ESVA 2CE7A 5L3VA 3ZQJA 2QPAA 3ZQ6A 3QXJA 1EX6A 2GZDA 2N1BA 1XTRA 3LFUA 1PUIA 3EPHA 4R98A 3LXXA 2A2ZA 1HT1E 2BJVA 2XNDA 1E2NA 4OKSA 1GUAA 3IEUA 2VBCA 5H70A 1GFIA 1E0SA 3WYAA 2BDTA 2Z5FA 5FBRB 4ZV4A 4LJ4A 1TNDA 1VCMA 4NU0A 1IJFA 3G82C 4P32A 4XD7A 1AZSC 3IQXA 1DG3A 1NBME 2IYVA 1Q0UA 1IOZA 3CONA 3DVLA 4DWJA 4C2UA 1A2BA 1IM2A 3MGCA 3MSXA 2A7QA 4OQNA 4DLWA 3PUXA 1U9IC 1G17A 2DFNA 4LWZA 2O8FA 3I72A 3TSZA 2W6JD 4JLBA 3DM5A 2F9LA 4FI3C 5F9HA 3B6EA 4GP6A 1A1VA 4QGGA 1Y63A 2VSOA 3ZYCA 4V0LA 3E2IA 2DWOA 2GAOA 5LPNA 1I4TD 1KHTA 3LWNA 4MITA 3O8BA 3IQWA 1OXSC 1W49A 1XCMA 3VX4A 4TZ6A 5H1YA 1VECA 2IF2A 3BWDD 3C8UA 4JKYA 2GWHA 3D6TB 2FZLA 1IXRC 1P72A 4D2IA 2QAGB 1CS4C 2GEUA 1X3SA 3VKHA 1M1YE 2FPMA 4ZDJA 4LPKA 1RE0A 4Y0AA 3U44B 5DH9A 2V7QA 1G19A 5TVKA 2D7CA 3RHFA 2D4HA 3MAAC 1GP2A 5FPTA 2CLDX 2OFXA 2GA8A 2QI9C 4R7ZA 2BJWA 5FL3A 4D4KA 2Q9CA 3LX5A 2V8OA 4M9SA 3MCAA 4DUGD 4M1KA 1GDDA 2P5TB 3C5CA 1XPOA 2OCPA 4CEIB 3EZ9A 3AVWA 1HEIA 3BB4A 1NMZA 2ZRDA 1TQ2A 2ZSFA 2IWHA 2IYTA 3RANA 4D6PA 2PJRA 5FI0B 4Q4LA 2OO7A 1PLKA 1XJQA 5DLQC 4XD7D 1C1YA 3LDAA 1XFAA 1XXHE 1YZKA 3GLHA 3JZAA 1IQPA 2EWWA 4LJ9A 3U6BA 5EE9A 2QTVB 2PLFA 2GJ8A 4F4CA 4QJ4A 1IN8A 2KBFA 3AVPA 4O2RA 4C30A 2QE7A 8OHMA 5B58C 2JJ8A 2R8RA 4DIDA 4IFEA 4YMVA 3GEEA 1F2UB 4BFXA 2ZSBA 1KDPA 1E9BA 2QE7D 3TVTA 4DEYA 2A5DA 2WAYA 3CKLA 4KFTA 2WJJA 3TUJC 3AKEA 1KMHA 3GLGB 1T5IA 4NE2A 5C18A 4ZCMA 1JJ7A 2EU8A 1SHKA 2SHKA 4AD8A 1IN4A 2EFDB 3UANA 2WPDA 1G7CA 5KSZA 5FH9A 2BOVA 4B6FA 3OEHD 3GEHA 2ZS9A 3EPJA 3QXXA 3I32A 2GK6A 3ZS9A 1P9RA 2JGNA 2ZSEA 3L0IB 4TL9A 2ATXA 4UXHA 4URVR 1U8ZA 2QGNA 2ZJYA 4MYCA 2EFEB 1LNZA 2LKCA 4M2LA 1E79A 4OHZA 3BJIC 2GXAA 2YOGA 1NVXQ 3UG7A 1XEXA 4OHXA 2ZRMA 4DLUA 2AWOA 1L7VC 2ZROA 3L43A 3W6OA 5IK2A 1P3JA 4HLDA 1SVWA 3V9PA 3J81k 1NIJA 2KWIA 3KQKA 2H16A 1ZUIA 3LW8A 2J0UB 5JJLA 3A8TA 1GZSA 1RRFA 2ZU0C 1KZ7B 4K46A 3LA6A 1EFUA 2IYWA 2ZS7A 1E2KA 1CP2A 1KSJA 2PMDA 3P27A 3IDQA 4FWIB 4HAXA 2PMKA 2XXAB 3TGPA 5HE8A 1YRBA 2ZUCA 5G40A 3T5GA 3THWB 1XXHB 1PLLA 2ANCA 3TUIC 2G3YA 4XTRA 2CCJA 1XEFA 2WM9B 2YYZA 2JIZA 1TPZA 4LYHA 4DKXA 3PUYA 4KO8A 3TBKA 3CF6R 4C0BA 4II7A 4KJZA 4B32A 4XJXA 2WMOB 2HYDA 1W2HA 3T1QA 5CK4A 4EIWA 3C16C 1FQKA 5FPSA 4EAQA 2IYQA 1OV4A 1Z6TA 1Z63A 4D25A 4BZPA 4US1R 2R65A 3QXSA 4KLNA 4C4PA 1MOZA 5JWOA 2W83A 1YRAA 1RRCA 4DSTA 2QT0A 5FOSA 2C99A 4TMWA 4XSGA 2RGCA 4M1MA 1DAEA 2QRNA 3SJBA 5TY0A 1W36D 1FPMA 4MKIA 2HDNB 2WWGA 4E5UA 1OHHD 4HEJA 3KKNA 3IIKA 4YC7A 4J0QA 3C7KA 1OT3A 4B3GA 5JHHB 1TF2A 3PR1A 3RRMA 1S3SA 1Q44A 1N0VC 1FW6A 1OF1A 1AGPA 1KGDA 1DTSA 4MYUA 3ZZUA 4CZ2A 1X8KA 1PUJA 2J3EA 3FTQA 3R9IA 3HYRA 4DT1A 1T91A 2RGAA 3QPVA 4IVQA 2QSYA 5E95A 4TQUS 2HUPA 421PA 1BOFA 2ONKA 2NO9A 2JCSA 3H4MA 1CIPA 4O25A 3ZVLA 4F38A 3JVVA 4LHWA 4F91B 2AK2A 2QM8A 4PZYA 4EFLA 4MUAA 1NVWQ 2YZ2A 5FPHA 4RVCA 2BKUA 1SVKA 4FCVA 5CJ2A 1ESNA 1KNQA 2QZ4A 1R0XA 1RW4A 1P4SA 4YXWA 3K70B 4GMXA 2F9MA 2ZI7A 2QL6A 1E0KA 4M1SA 3VNUA 1IY1A 3CW2A 3RLFA 3PG5A 2ZEJA 1UPTA 2C03A 3ZVMA 1GL6A 1AA9A 4E22A 3WMGA 2BMEA 3MUFA 4URWR 3U3MA 1HUQA 4HSEA 5CITA 1XP8A 3ZZTA 3KJHA 3SE0A 2ZQ5A 2IXGA 1Z6AA 2A3RA 1N6OA 2FF7A 1AQUA 3EIHA 4OI0A 1FMLA 1W0JD 4W5WA 1OH8A 3ZS8A 1CEEA 2ZITA 4EPYA 3KQLA 4YMTA 2ZR9A 1XJCA 2CVHA 3FE2A 2VL7A 2ZIAA 3A58B 1NY5A 5JI3E 1I2MA 4URUR 5FUVA 4H1VA 4LY6A 1Z83A 3VFDA 4B2PA 4PHTA 1O3YA 4MQBA 4A0RA 5LD2C 2ZR7A 2CL6X 3EPKA 1ZNXA 3UKDA 1NVUQ 4X8HA 1F5NA 1FX0B 1G3RA 1W5TA 1N6IA 1S96A 3AVQA 2Q3FA 1QHXA 2WSMA 3VR5A 2ZRHA 2JJ1A 4POAA 4LHYA 4IOMA 2RCNA 1DAFA 1SKQA 3CX6A 3LY5A 3M6AA 3MWKA 3W34A 4CVNA 2H57A 4DVGA 4HLUC 4WZ6A 4Q9LA 2WAXA 3BFKA 3BXZA 2W0MA 5TB5A 1FNNA 3LBIA 1MH1A 2OV2A 2QORA 4KBFA 4ACBA 1G5TA 3FYHA 4MH0R 1KK3A 2GESA 1IJEA 5FBQB 5J4KA 3R9XA 3N2EA 5AUOB 1KDRA 4P31A 5JS7A 3Q8XB 4JIMA 1KO8A 3FHTA 2C2HA 4YDSA 3NWJA 3C5HA 1UEIA 2IYZA 2WOOA 3NG1A 4LSGA 2MSEB 1WF3A 2WICA 1EK0A 2PLRA 1ZU4A 3SQWA 1ZUHA 3C4JA 1XX6A 1W4BA 4C0KA 2GVDC 3FKSA 1IAQA 4NPHA 4CEJB 2RGNC 2QPTA 4NBSA 4Q5IA 1A2KC 1E1QD 4PSKA 1ZCBA 4GOXA 4HDOB 4M1YA 1H8EA 1KI1A 1KI4A 1FL9A 2NOAA 1GVNB 3CBQA 2XGJA 1OFUX 4B35A 3QG5A 2Q6TA 4ARZA 2KI5A 3SI7A 4AYTA 1HYQA 5F2EA 3B1WA 4AC9A 5EP4A 1ODFA 1YHNA 1E4VA 5JSZA 4B3DA 1F2TB 1IONA 3CWQA 3NC0C 2VTKA 5CYPA 1BYIA 4UJ5A 4D0LB 4B2IA 1NLFA 2D7DA 1BMFD 3K0CA 3O8RA 2XOKA 2OILA 1ZJ6A 1L4YA 2ZRJA 4KCGA 2GK7A 1P9WA 2V54A 5M04A 4A0GA 2AD5A 4JSTA 3IPYA 1IY0A 1DAIA 1LB1B 4RD1A 3PUVA 1VKJA 5GVRA 3EX7C 3AVXA 3RRYA 4I1OA 4DDUA 3SJAA 1G8YA 1FX0A 5CYOA 3QG1A 4YMWA 4QL3A 3KUCA 5FOUA 1VTKA 1ZM7A 3DEFA 4HZIA 1BIFA 4XVRA 3K1JA 2DWQA 2Z83A 4CEHA 1RZ3A 4FMCB 4FXPA 3WYFA 4XH9B 4AG5A 5DNYB 2ZI5A 2IL1A 5TMPA 3IBGA 4R2IA 3BGWA 3MG9A 1KSHA 4JL8A 4YMUA 3G5UA 4PPNA 3P1JA 5FOWA 4NYJR 1M7BA 3EWSA 5BXQC 4DB2A 1Z0KA 2FX3A 4Q7LA 3TW8B 3OF5A 1E1QA 2J5XA 3VR1A 1ZM2A 2BIFA 2DPXA 2REOA 4LYJA 3Q9LA 1H8HA 2QMEA 2C5LA 1ETUA 5GJWC 5C4GB 3UK6A 3IIMA 4LYFA 1YJ5A 1Z2CA 3L0SA 4OQXA 2E87A 3THYA 1RKBA 2ASEA 2OFOA 1NKTA 3UWKA 1X1SA 3MWYW 1Z29A 3QBVA 3R7WA 2J0VA 1LVGA 3GJ6A 5JCPA 2NGRA 1VHTA 3S1AB 5TDHA 1Y3AA 2N46A 5G3YA 3A1TA 3G0HA 2HEIA 1JPJA 1R7RA 3W6PA 2PZEA 1G16A 2ERXA 4Z1MD 1F6BA 4G3XA 1SVIA 2F1HA 4AKGA 1OLOA 5HZKA 3HWSA 3V4FA 2RGBA 4QBGB 3U7FB 1KI7A 3KZ1E 5JHGB 1QHHA 2FSFA 3TH5A 1X6VA 4AKIA 3L2OB 5GJVC 3QNUA 3GJ3A 1T9HA 2YHSA 2XB2A 5P21A 3RC3A 5J4LA 3KKPA 3IKJA 3TAUA 2C96A 1SXJC 4TTPA 2C98A 2HV8A 1OJLA 3KKOA 3O47A 2F55A 5FTJA 2ECKA 3TQCA 3NBZC 4QKQA 4PAOA 2DB3A 1VG1A 2PH1A 2G1KA 2HF8A 2WWWA 4FMBB 3I3SR 5AK0A 3DHWC 4W9MC 2JJ2D 3R8CA 2J0QA 4YQFA 1AS0A 4PPQA 5B64A 4I1SA 5J4YA 2YWEA 2VYFA 3QKRA 4XTCS 2ORIA 1DAKA 1Q3TA 1Z6XA 3DZDA 3QF4A 4UNNA 4JBXA 1P2TA 5K8LA 3ADCA 4OHYA 4QM6A 1KO1A 3BOSA 1KJYA 2BEJA 4Z51A 2AWNA 4QFMA 4JL5A 4JVSB 2CK3D 3FB4A 4LC0A 1EESA 4KLZA 2RGGA 5KSYA 1GITA 4A15A 1XTKA 1DVRA 1KI2A 1GKUB 5HE9A 2J59A 2XTMA 2GRJA 4CEIA 1KSFX 1ZYUA 1GRNA 4AK9A 4P4UA 1ZNWA 2NPFA 2CLCX 1S1MA 4EFNA 3IEVA 4KU4A 3FMOB 3AF0A 3MJRA 1W36B 1AK2A 2HF9A 1EFTA 1U8YA 3U6KA 2ZRAA 1OYYA 3QI2A 2G1JA 3CRQA 4C0LA 4QC2A 1S3GA 2ZJ2A 2V3CC 4Q48A 2X2FA 3CX7A 3HR7A 2B8WA 4H9GA 3NXSA 1G1MA 2PT5A 3VU9B 1W4CA 2BCJQ 2MMGA 4OQMA 4Z8XA 3PITA 2QM7A 1AS3A 3B1ZA 2R6DA 3GLIA 3U60B 4DRZA 5L3SA 3GFPA 3WNDA 1NSTA 3BK7A 2QY9A 4BEBA 4OJQA 3Q3JB 4XOIA 4C7OA 5JJIA 2RGXA 3BH7A 3EAQA 3W5JA 2WKQA 1U9IA 2YVUA 4IFBA 3RVBA 2C8VA 1P9NA 2ZRBA 3CNOA 1XMIA 4AYWA 4UXIA 1IXZA 2WJVA 4YMSA 3U7GA 2AFIE 1TQ6A 2AXNA 2J87A 3AH8A 3WYGA 2QRZA 1RJ9A 1G64A 1UKEA 1Z0AA 2W2XA 5HKKA 4BLSA 1G3MA 4A92A 5EZ5A 121PA 3X1WA 5KUTA 2JASA 1ZC4A 2X2EA 2G88A 5HKKD 4ZDIA 5EQTA 1EFCA 3U4QA 4DCTA 5L3QB 2J7PD 5EXTA 4N0EA 5HZHA 1IN7A 3AF1A 3QIAA 2V55B 1GOTA 4I99A 3LH5A 1W36C 4RFSB 1OH7A 4G5SA 2VLIA 521PA 1QRAA 4D0GA 1T4GA 5EJEA 1WP9A 2FSHA 2JAQA 1HURA 1N6RA 1XXHA 3EA5A 3NDBB 3CUEF 3OIVA 5EP2A 4ABYA 4JLNA 2JLVA 2WSSD 3P32A 5SZJA 3BORA 4NCHA 3QF4B 2QAGA 3QPUA 1FUKA 1JBKA 3EARA 4ARZB 4EQ6B 3LBNA 5L8VA 4MKFA 3X1XA 1Z0JA 1MO6A 1D9XA 4B74A 2R44A 1TUIA 1JECA 1XZQA 3EZFA 5BYKA 2ZSDA 4JJKA 1CR2A 1XZPA 5JI2E 3I61A 3NDPA 1G8GA 2P6UA 4LBYA 1JPNA 2UZIR 1X8LA 3RC8A 1Z6YA 1UBEA 5EXXA 4ZI2A 2IHBA 3CPHA 4LI0A 2FFQA 5CB6A 3I62A 1J2JA 1BMFA 2X8AA 1E2FA 2MSDB 2H7VA 1SXJB 3KKQA 4PC2A 4BGDA 2GXUA 4NZYA 2QROA 3IILA 1BYUA 1NMXA 1VHLA 2CXXA 3T12A 2D06A 2A5FA 4F92B 1N0UA 3T1VA 2VP9A 2WJYA 1QHYA 3BFVA 4NYMR 3P4XA 5J4HA 4I81A 3AVVA 3A4NA 3U2QA 1R5OA 4BLQA 2QMOA 4A36A 3FVQA 1OKKA 4M1WA 4B47A 3L0OA 4Q1BA 4HUTA 1R0YA 3SFVA 3D7MA 2O8CA 2ZJOA 3BB3A 1FUUA 3K09C 3VHXA 1GRQA 3SYNA 3THYB 1OXTA 1U8AA 3CZQA 4E09A 1NNEA 4C3ZA 2WV9A 4Q00A 4OHVA 2ZE6A 3GJ4A 3BS4A 4A1FA 4C0AC 5GADl 2X19A 1K5GA 1ZAKA 2VHJA 4V0ME 3EASA 1HE1C 1E69A 1XBTA 1Q22A 4Q4AB 1T3SA 1B23P 2GAAA 1OPXA 1Z06A 1W44A 1KKMA 2R6AA 1VYUA 4GFDA 1CRQA 4B3BA 3LQQA 4GP7A 1NKSA 2V6JA 2YOHA 5KU1A 3V4RA 2WOJA 1CJUC 2JA1A 4QGHA 4U5XA 2GXQA 4B34A 5FPYA 3THXB 4DCVA 4Q1AA 2IS1A 3QKUA 1NF3A 4YLGA 2O8BA 2ZJ5A 1U94A 2WWYA 2O0HA 2BMJA 3I8XA 3RS5A 3PENA 1HTWA 4M21A 3H84A 1BH2A 3GLFE 3GLIE 1UKVY 4FWTA 4O3MA 3PVSA 2R9VA 5CDFA 4Q21A 2R6GA 5FOVA 1KI3A 1YE8A 4B3XA 4RD3A 2QBYB 2CCKA 3ADBA 5IHPA 4OQFA 1L2TA 2E9SA 2CEAA 1G5RA 1XTIA 1WE2A 2FEOA 3LXRA 1R6BX 3FPAA 2ZI9A 1EXMA 1XPUA 2OBMA 4TSFA 1S9HA 3ICEA 4PQRA 4UXJA 4IDHA 2V1XA 1SHZA 1YVDA 1YR7A 3WHLA 2CK3A 5JBQA 5KNDA 1NSFA 1N3BA 3WMFA 2QUZA 1US8B 4US2R 1E0AA 4ITRC 2XEXA 4BFZA 1QVAA 3WHKA 3WY9A 3P20A 3PCRB 4KSBA 1G3QA 3GLGE 1FOEB 4KI0A 4KODA 1JNYA 1QF9A 4KVGA 3QBTA 1ZW6A 2QPOA 2ZYTX 4A8JB 1G6OA 1ZD9A 4LUCA 1AQYA 2ZRGA 5KSOA 2AXPA 1V43A 2O8DB 1GTVA 4B43A 2IYSA 4NYIQ 4BWYA 2PCJA 4Q9IA 3EWAA 3GFOA 4W5JA 5DYGA 5CB8A 3DM9B 2QNRA 4GI7A 3F5FA 1N0WA 1I2DA 2JLZA 2REBA 3FWYA 2IK8A 4D4LA 3KQNA 1SKYB 4M9ZA 3Q7PA 1SGWA 3AF2A 4Q1EA 1Z08A 1DG1G 1G8FA 2OAQ1 2G77B 5FL7D 4A82A 4TL8A 5JFGA 4F7WA 5EP3A 2DBYA 1U81A 1N5LA 4QM7A 4TLBA 5FBWB 4AY2A 1G4AE 1W0KD 2GZAA 4AURA 4KVAA 5GJBA 2FU5C 2HLDD 3EZ7A 1YZTA 3ND9A 3LAWA 5B30A 5C4MA 1T0HB 2AKYA 2HLDA 4JYBA 3RS3A 5KDLA 5EE3A 1LV7A 3LO5A 5HPYB 4TMTA 2EFHB 5L3RA 2F43A 4RD0A 2D62A 1KO4A 2BMFA 2QENA 1M74A 1ZINA 4L15A 4DZZA 3RS0A 1JJVA 2WHXA 3B1VA 1IN6A 1DOAA 3TUZC 5J5CA 5JCZA 4MYTA 3IPXA 5BN4A 1ZM9A 4G0NA 4DXAA 1PZNA 2OCYC 4JZKA 4Q01A 1HY3A 1U90A 4TYQA 4FCWA 2IUSA 4LV8B 4HDQB 1COWD 3K70C 3LLUA 4L9WA 4B2LA 4URZR 1I4LD 5FTMA 1T8TA 5A0FA 3I92A 4HDCA 1COWA 3BH6A 2PT7A 1E2QA 3TKLA 4LJ7A 4DLVA 5AUQA 1XWIA 2HXYA 1KO7A 3BB1A 4QGAA 5IDVA 4BFYA 1UJ2A 3A6PC 1YR9A 5DO9A 5UKDA 3WBJA 2JDID 2V9PA 1CLUA 1IY2A 3RDPA 3GP8A 3H86A 1G8HA 2CMKA 4AKEA 1VG9B 4QBHA 2R2AA 4D4MA 1E99A 2HT1A 1KZGB 1QVRA 3A1WA 4UNQA 4W5HA 3WXMA 3C15C
chains in the Genus database with same CATH superfamily
4D7AA 1HC7A 3DZHA 4R9SA 2XECA 2C1ZA 5HRAA 3VC3A 3NANA 1ISIA 1TLLA 3A9WA 1A9QA 4I50F 1UANA 1ULSA 4FX2A 1ILWA 4MS3A 2IYAA 3IAM1 4P3KA 4V0RA 3S2IA 2WV7A 1II9A 5LD2B 2P9QA 4TTQA 4OI4A 2ORWA 6ADHA 5CGZA 2OOSA 1K4YA 3SIRA 5EXPA 1PWHA 1P61B 4G9GA 1XCPA 1A3CA 3AVOA 4OXRA 3OAAD 4WUVA 4X90A 3A9TA 1Q0TA 4CMJA 4C76A 1AKYA 4Q6WA 3KE8A 1Y48E 5AKXA 2G28A 1L5HA 1T2NA 3V9AA 1EIWA 2ZKLA 1Z28A 3DS8A 3P0JA 5KKNB 1MO4A 1U3DA 3IH5A 2AHOA 1XLVA 2C95A 2Q28A 4GIBA 4JP5A 4O4IF 2CLKB 1P2FA 4DB4A 3ICQB 2BEUB 2I6FA 2YHUA 3H5LA 5G41A 4E2XA 1XZFA 3SZUA 5BN3B 1EQUA 2VHYA 1Z7EA 2CNWD 2YV1A 3AUUA 1JFFA 1GYRA 4FFDA 1U63A 3DYVA 5JS6A 1WABA 2VHCA 4MVJD 4U7TB 1GA1A 1KMHB 1JE0A 3AKCA 1U5AA 1TIKA 3CNQS 3ODPA 1XPRA 2GD2A 3CKMA 4IYJA 2XUFA 1TZKA 1ODIA 4FILA 3FI9A 4K26A 1TM7E 1YTLA 2WKWA 4I66A 2PWYA 1FLNA 4NS1A 5EIXA 1HA3A 2OCAA 4DDMA 2O2EA 2AOTA 1YWGO 1JDNA 3G2QA 4KV7A 6PFKA 1GYQA 4N4AA 4X94A 3WIOA 5T6BA 2PD6A 2JLRA 4I2VA 3OP1A 5EJGA 3L0PA 4BZXA 2P2GA 4K6OA 1JR3A 4UMDA 5DOZA 3NBMA 2A5LA 4D0NA 3QWHA 3SLGA 4QHTA 5JISA 5LDGA 3EQ2A 4P0QB 4C05A 4WN3A 5C1PA 4UBLA 3MJCA 4FT4A 6AT1A 4RKYA 1V8DA 4GPTA 4QUDA 5TMDA 5IFKA 3W6PA 1FDRA 3VR4A 1H69A 1V35A 1YZQA 1QQBA 3K73O 1KPIA 4JN6B 4RA6A 5LQSA 3ZH9B 2VK8A 1UEXC 1N36B 1VIYA 3AR5A 5KDDA 4GLOA 3RKUA 4NOMA 3ZV6A 4MVJE 4N5DA 3WWCA 1WW3A 1ORVA 3GJRA 5EYPB 3WYDA 5KYKA 4IGIA 1Q1BA 4P22A 4CQMA 1NHWA 1GLVA 1QGYA 4H35A 1P62B 3AFMA 2KX7A 2X40A 4JBGA 1MQAA 1FSZA 5FDFA 3VJRA 2B98A 3QFCA 3QOXA 4NBWA 1YFLA 4QZVA 4J0IA 1T35A 1CQWA 2XCUA 4ND1A 4RA9A 1CDOA 3M0EA 1TW3A 1V41E 4FSHA 5LQMA 3N86A 1D2GA 1Q6ZA 3B70A 3LSYA 2W42A 1T10A 2BELA 3IFSA 3Q85A 3OZBA 4CM7A 3RJ9A 4RD2A 3H0KA 4PQFA 3ASYA 4XM0A 3SR0A 3F9CA 1QB8A 3HKDB 4IG4A 5A4DA 5K8TA 1UDXA 4Z3OA 3LK7A 2ZI3A 1GXSA 1KL7A 3A4LA 2WF9A 2BGUA 5DIZA 3D1VA 2DTXA 4RA9B 1CUJA 3PDUA 1XA3A 4B3JA 4FW9A 2FSVC 1W5EA 4ME6A 1JXOA 1KAMA 3KJNA 5JEDA 3W4IA 4QNNA 1U0HC 4I46A 1WO8A 4TV9A 4EX6A 2IZOA 4IKOA 3EH1A 4U00A 1FFEA 1CUWA 1TYEB 4GKKB 3K0CC 3HL0A 1TRKA 4Z99A 4UUAA 1ECLA 1KORA 3AJEA 1MPTA 5DGIA 2IZ1A 4O1MA 1JVNA 1Z2NX 2YVLA 2Z5GA 1IXSB 3B2NA 3CM0A 3E4DA 4FFOA 2ZDGA 3KJQA 4Q4AA 3TCKA 1BJTA 4DSOA 4EB3A 2BVNA 1JX6A 2CVQA 2YX1A 3LE8A 3KL4A 1L4UA 4KX3A 1IEXA 3QLUC 4QXAA 4KB5A 3AT1A 4OQ4A 3WK4A 1DQPA 3GDFA 3K09A 5CT6A 1J9ZA 1GCOA 3VZQA 4D8TA 3D64A 4UNPA 5KSWB 4EB6A 1GZUA 3O31A 4LDQA 5LJLA 4GD3Q 5KJ6A 2HW8A 1J7KA 1VB5A 3YASA 3PFIA 3MFYA 4A7PA 5DHPA 4ERNA 2QGZA 4I1YA 4QGBA 3TLGB 2Y9PB 3TW0A 5LU8A 1P73A 4F4JA 1GTL1 4U7GA 3M8KA 2ZYSA 2XITA 4RH1A 1VDZA 4TLAA 2YXNA 1GADO 4EG0A 4JZYA 4F4FA 5IKXA 4BUJA 3DBLB 3HRIA 4QQFA 3I5AA 4WZAE 2XKBA 3CX4A 2XZTA 4RIFA 1NSYA 3SG0A 1QP7A 4K05A 3PEYA 5JCOC 5KJEA 5B2EA 2ZT8A 1F48A 4RCZA 4DCSA 2H11A 3VO8A 2XCLA 5DEOA 3SICE 2FW6A 5C7YA 1TEVA 1E1MA 3EC1A 3EIXA 5GZ3A 1VI2A 4RJLA 5EMLA 2H1LA 4NMHA 2V9CA 3RAEC 4V24A 3ZEAA 1OTYA 1WU7A 1YU6A 3KLPX 4LNAA 3ADKA 4JXXA 3LOUA 3K9QO 5ETJA 3UJAA 3C43A 1X7DA 1XUOA 2HCTA 3U1TA 2IP1A 2A9RA 4PC3A 4DVJA 4EQ6A 1E1DA 1GSIA 4DLTA 1NXOA 1UZUA 4FN5A 4LFBB 4U0KA 2NSJA 4HLUA 1JIKA 3CPJB 3I6YA 8AT1A 2OOKA 2WWHA 4RDHA 3OSZA 4W6QA 2XQKA 5EWLB 5BR1A 3E2MA 4TSKA 1Y33E 5CK5A 2OZEA 1WXGA 2VSQA 1AH2A 4BBAA 1BCSB 3AG5A 3SQXA 1JT2A 1J8YF 2JGDB 1ZY2A 1XD8A 2GARA 4G4GA 3LY9A 3NBKA 4HCJA 3VTKA 4LDPA 4GO1A 1X0XA 4JC0A 2PUBA 2WHEA 1SURA 3OFKA 3NHZA 2DYKA 4KQXA 2FN8A 2V0NA 3FI0A 3RUAA 4FC7A 2JI7A 2BFCB 4PU0A 4QULA 5DIFA 1KJZA 2IW1A 2QVCA 2L0XA 4BEWA 1PD1A 4XCVA 4ASUD 2JGDA 2WTNA 3ZJVA 2O8DA 3LLCA 3OQIB 3BXEA 1KZ6A 3A3OA 3UJBA 1HETA 3OTHA 1Q77A 4N40A 4NPAA 2NVUB 2DETA 4GG1A 4D3YA 1XTJA 1CJMA 1NBMA 1NJGA 1VYVA 2O3JA 2YFHA 3O4HA 3A2MA 4HJRA 3VDRA 1PR3A 4F2PA 1Z0DA 3NHSA 4Y9RA 4E5VA 3EGVA 3W9SA 3QLVC 3S3TA 1ZEJA 3JAKB 1SQ5A 4B6SA 3D4OA 4ENWA 4RYDA 1LQUA 3P9NA 4FKBA 4FBLA 3SHVA 1T2DA 1NL3A 4DEVA 1ABEA 4E4RA 3FCEA 1H2AS 3C3PA 3HBAA 3L7JA 3W8NA 3V1NA 2NIPA 2O06A 1YK1A 3EQ7A 4G5FA 3IGFA 3WJAA 2J6CA 2CW5A 3ZH2A 3FSJX 4IXDA 2UZ1A 5G1NA 1LK7A 5H7XA 3SY8A 3IMCA 1JKMA 4BDTA 5JMTA 1B1CA 1N0HA 1VYTA 2HOQA 2VP5A 5KKAA 1QTQA 1OLSA 4W9NA 1CQPA 1YA8A 1ESDA 1YNOA 4B85A 1XZJA 1D2EA 3RKSA 2G1AA 2OB1A 3GT7A 3HACA 4HSGA 4MA4A 5FFNA 1PRYA 2COUA 3U4DA 3MGKA 3KT0A 5FBLB 1Z22A 2HJGA 1E1LA 4TV8A 4LNHA 2R8BA 4X3OA 3SC4A 4WK4B 3VBEA 1HGXA 1GNPA 5FWXA 5KYWB 3OKPA 3HU1A 1G41A 4Q4HA 1P29A 4C7BA 1E2HA 2F17A 3FZGA 3JQCA 4GSYA 4OYYA 2L2QA 4YNBA 4LXXA 4IZHA 1EFKA 3PUKA 4UDYX 4YJKA 1RFGE 3OJEA 1UBFA 2PFSA 2D6FA 1WCIA 1F3OA 3VHRA 3SGLA 1LFAA 3LOQA 1DDGA 3U17A 4UUPA 1UT6A 3IV9A 2AEEA 4WW0A 4BLVA 4CKWB 4PX9A 5BOVA 4AB1A 1EFVB 2HIAA 4H27A 3I5UA 1DADA 1P7YA 1PIWA 2E1RA 1G20A 4QDZA 3GUYA 4BMCA 1G2OA 3DVAA 2A9KA 4G1UC 4NC9A 3R6GA 5LOVB 3JQ6A 3EBLA 5K8UA 3HVRA 1U9ZA 1QYIA 1TA0A 1G6HA 2H5EA 5FBZA 1AHHA 4GL4A 3L8HA 3H6HA 4FFSA 3ZOKA 2Q0SA 2ZJBA 1N8SA 1VQ1A 1K98A 3FTCA 2XUZA 3CLVA 1CYDA 3VA7A 2CHUA 2BMDA 1R1DA 3PHHA 3S8YA 3ESDA 1JP7A 3NTOA 4YJ2B 3HYNA 3ZGXA 5E4FA 3L6CA 9MHTA 1SQSA 4KXUA 4LVCA 4IIBA 3D3QA 3MOGA 1UDWA 2BEWA 2ICAA 4PW0A 4JB0A 3PQ4A 1NQVA 2QS9A 4X85A 1GYPA 3KJIA 2VUTA 2YWXA 2M1XA 3Q0EA 4OGGA 3N8GA 4C07A 1L3BA 2BDEA 5KPJA 3PD1A 3NEAA 1HWYA 2BFBA 5ECYA 1ZR2A 4LJRA 3ED5A 1XQWA 3ME5A 4UHHA 1E1CA 4ZAFA 4C0JA 4J1SA 2NQ8A 3IBYA 4YECA 2AQ8A 3BAZA 1VC2A 3G8AA 1J24A 4KACA 4P36A 4QUIA 4WADA 3W2TA 3OJLA 1KKUA 4IDOA 4IM7A 3EDRA 1IPHA 3A36A 4O2LA 4CR8A 2YXLA 3H9EO 1GD1O 4Q16A 3VPAA 3WHIA 2BKEA 4KRYA 4X95A 3ZGVA 2QMQA 4KDCA 4UU0A 3U81A 4MR8B 3O4JA 4GT1A 1NNSA 5EZYF 5F35A 4MMXB 2A92A 2GSDA 3NLLA 2HCJB 5BSUA 3P9KA 4B6RA 4BB9A 4K9DA 4WL0A 2WYHA 4GRIA 2D1YA 1RWXA 4CUJA 4ZYUA 1PV4A 4F6LA 4GQBA 4X1KA 3HR8A 3UATA 4N48A 4I9GA 3AQIA 3TMKA 3W2EA 1CZNA 1DHTA 3BL5A 2BGGA 3CQ9A 4ZRNA 1P17A 2E4UA 3F6BX 3EIOA 1NVMB 3MWEA 3QUQA 5T8KA 3S55A 4J7CA 2XLBA 3F7TA 4IHAA 1RZRA 4FGSA 2IHNA 2F1IA 2IA5A 3KFXA 1MLDA 4FMDF 4GVLA 3VZDA 3WADA 1HO3A 4Z0NA 3AUFA 3DNFA 3ANYB 1IL0A 3LL4A 2FLVA 4O2BB 1YDHA 2NV2B 3PS9A 4NCKA 2WUGA 3PC3A 3ZHVA 4CETA 4FIDA 8LDHA 4I9UA 3R9WA 3H3JA 2XVMA 2QGFA 2VR1A 2WM2A 3QX8A 1JEDA 4R1MA 4WY8A 5D1HA 3BHIA 5KHLB 3T1TA 2QX6A 2HA7A 2RE8A 3TIGA 4D9CA 3DEYX 4MW9A 1BO6A 3WNQA 2D2EA 2EFGA 4GXNA 3IAAA 2IY8A 4JKOA 1H9BA 1ODJA 3NYWA 4RLQA 2A1UA 2LCFA 3DULA 1DTEA 3SJ7A 3KFVA 5IVDA 2UU9B 3F1KA 5BSVA 3NIBA 3Q6MA 4D9FA 3CU5A 3WL7A 3SKXA 3R6DA 1CJKC 4P3NA 4QEZA 1M76A 2O54A 3OCVA 2NLOA 2Y1KA 3E7PA 4Q3AA 3D6UA 4XGRA 2HQRA 3EDQA 4I4IA 1HSZA 1MFPA 2ZAMA 4ENSA 3L0CA 4KJXA 4OMFG 3A37A 5HBGA 3T5CA 1LF5A 1TF5A 2FPOA 2WE7A 3OJ0A 5T4HA 2A30A 5K8CA 4WXRA 3T6KA 4GZ6A 5BOSB 2AUTA 2HRZA 3IYLW 2NAPA 1PVDA 1M8PA 4K8OA 5FI5A 3EEOA 2ZYWX 1KOGA 4H4DA 4YIKA 1EQAA 3P0RA 3W1VA 4ZMBA 3L4SO 5IJ0A 1ZAYA 1XMJA 1U7OA 1XPJA 4V2UA 3G3EA 4FCTA 2ST1A 2QZ9A 3RYTC 1W75A 2Q3CA 2VDLB 3TRFA 3WBBA 1K86A 1NW3A 3T1OA 3DEIA 3U44A 3RBVA 4G5GA 1IN1A 1JFTA 3TLZA 3OLVA 1JR3E 4YB8A 2JH8A 3O8NA 1CTQA 3L84A 1ACJA 1AKRA 4YRIA 4OLAA 4JS0A 3PQFA 1JG3A 2AOVA 3OCXA 5CXUA 3DJFA 1K0FA 2O8EB 3RO7A 3LXUX 2C9MA 2IOFA 4FW8A 3S81A 3LVRE 4Z54A 3TQHA 4PLYA 4QLOA 1A9RA 2XNKA 3DEKA 4PSAA 2UUBB 1Y42X 4U39A 1PEAA 3DAHA 1SCKA 5T4EA 3C1TA 2PK3A 3KR9A 4G56A 1QH1B 2JGFA 1UBKS 4EG6A 1UWVA 4L4UA 4Z4EA 2WM8A 2OUKA 3OTWA 2W7TA 3WRXA 3ZQKA 4Y1GA 4NE7A 3VMMA 3TNLA 1JT9A 1NP6A 2QRVB 4DG9A 2E4AA 2XMRA 5K0GA 3EIFA 1DT5A 5CLJA 4BDSA 1REQA 3STYA 2FMFA 1R9MA 5EHNA 3T7DA 3OJWA 1JMVA 1NI3A 5CVEA 3WIUA 1ISJA 1NBMD 1YB2A 2C5GA 1QZZA 3LY7A 3ZK7A 4JLVA 4BFCA 4CRWB 5AESA 4JMLA 1JJBA 5JAZA 3EK2A 3BCHA 1ZUNB 2B99A 2WVGA 3L77A 2GN8A 4GR9A 3WK5A 3ZDFA 4FSDA 3DV0B 2JIZD 1B0UA 1AUOA 3IV7A 2F43B 1WRBA 3VX3A 2OXIA 3GNTA 4C29A 4DQXA 1RR6A 2QTBA 2SKEA 5AI9A 1KK2A 1TKBA 1V2GA 5CNJA 4ZCIA 3LUDA 4OH7A 5FL7A 3LJKA 3VC7A 4R8SA 1Q7RA 2JGAA 5IASA 1Y5NA 4MXDA 2PR2A 5C8YB 2YZGA 3JQAB 3KKEA 4WJZA 2YVAA 1P7CA 4TMXA 3VPSA 3QVGB 1UEJA 3UENA 1M2FA 2P9YA 4YMHA 2QX7A 1YVEI 4LRYA 2P2NA 3LDUA 2C2GA 2CXRA 1ZCZA 2CLIB 2J3DA 1K88A 2PMCA 3N6XA 1YDGA 4IRUB 2UUAB 2JLYA 3H5TA 1GEEA 1JEEA 2NVBA 5DASA 1SQFA 4DEXA 4X20B 1OB2A 5HUQA 2EW1A 5KC8A 1J1ZA 2XAUA 4QE3A 4MPRA 3AETA 4PWZA 5KAPA 5LYJF 1JQKA 2ZUWA 3I58A 3D4PA 5AD1A 1NYRA 2Q29A 1VMAA 1D6NA 4OAOA 2QVBA 2ZJFA 3MTQA 3QH4A 5FYDA 1BH6A 2C2MA 1DBPA 3N0VA 1QMGA 5A3VA 2IZ6A 4PHGA 3FZYA 1F2VA 2VN8A 2WWVD 3OT1B 4DSNA 1UFQA 1NG9A 1NOKA 1XMVA 4ZCQA 5FQNA 5TS2A 4R2HA 3LMKA 3Q7IA 3WICA 4HDSB 1VIAA 2CJWA 4W1PA 1CY6A 4FDTA 4LRQA 3FKSD 5DSXA 2GJAA 5FULA 4F4IA 5A62A 1CIJA 3VI4B 2JD2A 2XB6A 1VCIA 2QOEA 3T7RA 3MJVA 3RRNA 9GPBA 4TT3D 5KDOA 1N9GB 3OPQA 5EPOA 3NC4A 1YASA 2H1CA 2O1XA 3HZZA 2RJOA 2CVFA 2NUAA 2Y67A 4LX0A 5E8RA 1T8RA 2ZUSA 1XTPA 3IT2A 2DVMA 2I54A 4ETIA 4TRMA 5HYVA 1LS6A 1L7RA 3RAJA 4A27A 4BLRA 5C9ZA 1WV1A 2XDQA 4F9GA 5SYNA 1N5JA 2PSSA 1QYRA 1JIJA 4MJLA 4HVCA 1HYBA 3AV0B 3C2QA 3L1UA 4MQ5A 1C9MA 1GN8A 3CVWA 1BGVA 4ZCTA 1QIIA 4GQAA 3SSOA 5ITZB 3KALA 1HRKA 2HCRA 5E6UA 5AVQA 1NVVQ 1YBHA 1XL1A 2Q3HA 3MCWA 4GC9A 1SA0A 1ZXBA 3I39X 3L7KA 3CLRD 2PS3A 2FFHA 4RDIA 4B6JA 3ASVA 1RYDA 4KK4A 1TTTA 1EKXA 3FDFA 4PR0A 3WIBA 1YZNA 3HP4A 4L8GA 3PQ3A 2OYSA 2AG0A 3DG9A 3GB9A 3QKSA 1R0RE 4OIMA 3V8QA 3IP1A 2XF8A 4Z4QA 2VDNB 2W2LA 2YMPA 1FTWA 4XJTA 2G8LA 5CFNA 4L0DA 2PM8A 3UBMA 1SU6A 1J99A 2DPGA 4OG2A 1BVRA 1F60A 3SZRA 4S2EA 1FNSA 1OWNA 1ZOOA 2Z4SA 4LDNA 5FTNA 2HYIC 3FCXA 4JU9A 1GKIA 1H23A 1NFRA 3TIXB 5A02A 5JMWA 1KTVA 4J3FA 2NTYC 3RT9A 4OHWA 3QX9A 5TPZD 2NPIA 1PV1A 3GLVA 3ZIUA 3PXDA 5J40A 1AGXA 3BERA 3FOAA 2B9VA 3JWIA 4ZOLA 4ARUA 1I2ZA 2ZDHA 2YKGA 3ZGNA 2GNOA 4RHFA 1U7HA 2YWGA 3SBEA 2Z9BA 3TIVA 1VPLA 1Q1QA 1SZPA 2IGTA 3ZC3A 1Z8FA 5ER6A 3MUEA 2FEPA 2VJQA 1BWPA 1PX2A 1EUCA 2P9EA 2R48A 3FPFA 1GPNA 1YS6A 1GGEA 1Z8DA 3OURA 1YZUA 3ZE9A 1XRQA 1YMVA 4JIGA 3EDOA 4CW7A 2GCIA 1Z3IX 4IWNA 4ZIRA 2H8KA 4TKLA 2Q7OE 5DGHA 1WKBA 4M53A 1Q7BA 4R71A 1QORA 1G9XA 2FRDC 4NYJQ 3AMVA 1G0OA 1DXQA 2HLPA 4KTVE 3SJCA 3QEBZ 3QVUA 4ZOCA 2A84A 2J3JA 2OORC 5B3AA 3O1HB 2NZVG 5TQ2A 2BTQB 1H2HA 3A6KA 4YRKA 3M82A 5LQNA 1OUMA 2IHTA 2GERA 1I32A 2RHWA 1D9ZA 1GTJ1 2E6KA 4MZDA 4CMIA 3H99A 4RGVA 4KN9S 3QEKA 1GTZA 3TTSA 4P93A 4F46A 3LKVA 2VYCA 4LBZA 4ZVNA 5JJBA 3CHYA 4YPOA 3DA8A 3SS8A 1CKEA 3COSA 3TPCA 1U0BB 1J8MF 2Y0EA 3F4KA 3G88A 4MB0A 1XKQA 4L5IA 1DXOA 5LSAA 1JAHA 1W4ZA 3BK2A 3NTLA 2QVXX 1NRXA 3MNFA 1GTSA 4YT5A 3TIFA 2I33A 3DBHB 1XLTC 3B2QA 3KOUA 1BGWA 3PFHA 2AVDA 3VR6A 3WSTA 4X61A 4HHEA 3N70A 4UMVA 1E1NA 1L6IA 1ML3A 3ESYA 1PQYA 4GS5A 1VHQA 4CKBA 4E12A 4P83A 1KC3A 2X3FA 2Y1EA 3SHFA 1WY5A 3D4NA 2C92A 3VSCA 3ZDRA 4AG6A 2ZIZA 4C43A 1Z4QA 3JZFA 4GSLA 4NCIA 1U6JA 4BU1A 4J91A 2W6CX 2DFTA 4NMXB 4O6VA 4TMVA 5BUZA 1MC1A 2OCIA 2P8SA 4HNHA 4PPYA 5DE3A 4YRGA 4EKIA 5KNDH 4KHPB 3E1KA 1C50A 1NPTO 4D9HA 1JLRA 4RL4A 2VAMA 1RQ7A 3PQCA 4W8GA 1U3UA 3TZQA 1SHJA 1OW3B 3V1KA 2O2XA 3QPAA 2C5EA 1FJHA 1H2FA 2Y92A 3P0HA 4WA7A 3U3RA 1XROA 2B30A 3EZLA 4JVMA 5BSHA 1XSEA 1Z8HA 4QJIA 2EWVA 3VAAA 3EMBA 4E3ZA 1DPFA 1NM5A 2QQGA 3GAFA 5CM8B 2J7PA 1MQ9A 1V3QE 1N1MA 3H2GA 3MINA 3E3LA 2I9KA 3K9WA 5L51A 4NJMA 4IJKA 1AQIA 4N18A 1LLUA 2VK2A 4LSZA 4OUDA 1NUAA 5A2QA 2HA4A 2ZETA 1SVLA 4Y9TA 2BFWA 3LW7A 3RU2A 2I2DA 2Z3ZA 1T6NA 3R3JA 4KIGA 5F5XA 3TOVA 4E5MA 1AV7A 5AM0A 5B7PA 1Y81A 2G9QA 4XDZA 1Z0ZA 3FVTA 4AN1A 5CDHA 1FUYB 1UPUA 4YP9A 3CH7A 2ZTHA 3MINB 2P5SA 1KNXA 3KXIA 3TW4A 5BUCA 3FCYA 4B8WA 1ODTC 3GRCA 2QD1A 3S6JA 1I7LA 5LXTB 3LX8A 4G5RA 1DC5A 2WR8A 4CMBA 4G63A 1RQNA 5DSZA 5BWOA 5MGNA 4GOMD 3ITKA 1JV2B 5HFNA 1H0KA 1TQ4A 1EINA 2PRJA 3P0IA 3QYFA 5BXYA 2I99A 2CBZA 3ISVA 4Z9YA 2JEYA 2WUEA 4WCFB 3WC4A 3WGJA 4K2AA 1SRQA 2WPDD 5JO9A 1Y6FA 4B6PA 3U4MA 5EY5B 3BE4A 1FDSA 2WD7A 2O9JA 1D6JA 3TQOA 3PXGA 1M83A 2H2GA 4OU4A 5HKOA 1SJ9A 1SOUA 3Q88A 3H5AA 2EV9A 4ARCA 3FMIA 1CHDA 5ALYA 1WDTA 1QQAA 3KTOA 4Y1FA 1T8SA 2O8FB 2G0TA 3OESA 1YONA 3ANTA 1M3SA 3R5KA 3T1NA 4AWXA 1KU0A 2NU6B 3NBQA 3O95A 3ISTA 2XUPA 1NKVA 2A9JA 3K2QA 1J9EA 1JYEA 3OBBA 4H4CA 4Y0VA 4CLOA 4Q9HA 2OR3A 2B94A 4RKFA 1LDBA 3WO1A 3M6XA 3I2KA 3CLRC 4WD3A 4FR0A 4G8JA 4TQAA 4WH0A 5K0LA 2JGRA 4LYAA 1H6AA 3DOOA 1XVVA 3B6JA 4L6CA 3L1KA 3GJ7A 4OSPA 4BATA 3C6MA 2RH8A 2A9VA 4AM8A 4RQBA 2XQVA 4TMKA 4BQEA 2FOLA 1QV7A 4A2WA 2BH2A 1D07A 1CR1A 1O57A 2C58A 2PU5A 3J7TA 5JZMA 1J20A 1ISGA 2ZI6A 5EWJB 1QZ3A 4JEUA 3BWEA 2R8YA 3NIGB 4N8DA 4FKMA 4ZPXA 3PQEA 2B3TA 2XAAA 3LLMA 4WWHA 4ZCLA 5HWSA 2UZAA 3OOYA 3HEMA 3BXHA 5KYNA 4NP6A 3FFAA 3OQJA 1CRPA 1CC1S 3FR7A 4WLFA 2H9IA 3IQDB 1I1NA 4HP8A 3PXXA 4WLNA 1E2LA 4NYIR 3AEKB 4YX9A 2EJTA 2Q7XA 2Q5CA 2RG7A 2VRCA 4REQB 5JI2E 2D54A 3MZ0A 3AVTA 4JI4B 5F5LA 3QVXA 3SHOA 1F1BA 1R9NA 3GJQA 3KUUA 1IMJA 4WAUA 2ZSHA 2NXEA 5I7FA 4CMAA 3E9EA 4MZXA 2P6NA 4OQDA 3MGAA 3I2GA 1ZUD1 2O4CA 4PLFA 1U2PA 4LOHA 1FTSA 3EC2A 4XJVA 5K09A 5IULC 4B6EA 3STHA 5K6AA 1WCYA 3L7AA 2X9VA 2C77A 1OHHA 3U3JA 4EMBA 3SEAA 3W3ZB 3ND7A 4BFWA 2IX3A 2OL4A 1P19A 1F38A 5MFZA 2DSNA 4UHFA 5J59A 2GH1A 2RI0A 2I4LA 1WS6A 1ZG3A 2ID8A 1E98A 1QHFA 1S01A 2DHCA 1C41A 4MUFA 4O1IA 4DMHA 4R1SA 3V4LA 3KP1A 1QHHB 1ZCJA 4GYWA 1CUBA 3H19A 2XRMA 1ZD8A 3BQMB 1WPXA 2BI8A 3Q7TA 4QOSA 4AVYA 2IF0A 2C4MA 4WVLA 2R8PA 2EVWX 5K8VA 1VLQA 3GGDA 3N76A 1ULTA 4JC5A 2O52A 3RSLA 4CTKA 4F8JA 1QYDA 1EVJA 4UATA 1PR1A 4WFIA 3NQ41 1OXBB 4MI1A 1F0KA 1OX6A 1R6AA 2NU6A 2PEZA 3GR6A 3PEEA 1FW8A 4GX2A 4HAOA 5A5VA 3QP9A 4I4LA 4QYWA 4NOLA 3HO1A 3AJRA 1OZAA 1XCBA 2B21A 1VJGA 3RC9A 3ZIAD 4LC1A 4KQ9A 1F7UA 5IW8A 4XFJA 1PJSA 1ZBQA 5TF4A 4CL2A 4UDXX 4D80A 3KYBA 4DPMA 5JAUA 2FV8A 5KOYA 1K7CA 3NEPX 1NBWB 1R50A 5FXMA 2ZRNA 1J2RA 5A6SA 4ZVQA 5JZ9A 4DV1B 1PZHA 1LDYA 5JWHA 1ZVVA 4PZPA 1L5LA 2FSIA 1UKZA 3Q7RA 3ROXA 4TUYF 3IAS1 4XLLA 5AXBA 4LJAA 4BLTA 3JAKA 4IEIA 5GP1A 1OBFO 1X1RA 2CJPA 2WIAA 1P45A 2HFJA 2Q6LA 2I3BA 3T0FA 2ZR0A 3ZX5A 2F59A 4S1TA 2J5QA 4B3IA 4YAKA 1XB2A 2OHXA 3HA7A 5DKFA 1PGNA 1TC1A 4KREA 1PI3A 2GUWA 1PLJA 3G2KA 4J7XA 5DSTA 2PBZA 1P2VA 4IBOA 4MB6A 4M8IA 3RSGA 3F46A 1SCJA 2ZJ1A 3TB4A 4PLCA 4GF5A 1E6KA 2FKNA 4IUCS 4L2IA 3THWA 2AMYA 3PGVA 1O4WA 2P3LA 4B7AA 4NV1A 1NJ8A 1YZHA 1EIZA 1WUJS 1ZMOA 2FWJA 2PQ0A 2Q9UA 3IR6A 2JEOA 3UAOA 4RZUA 2JD1A 3EA0A 1VCNA 5CLQA 5J4VA 3ET4A 5JNRA 5IAKA 4HXGA 1DRWA 4BQQA 1R37A 2C3PA 4IOKA 3BFXA 5H68A 4LPSA 2HDOA 3AETB 3ICOA 4GPBA 4NJEB 1II0A 1MH9A 3ZPXA 3TW6A 1P5RA 4C0QC 1KI6B 3KSZO 3ZHCA 4LOKA 2C4WA 5I4BA 2I1WA 1S2MA 2I6GA 1CFZA 1IHXA 1L0BA 3NBUA 1U2TA 1G9SA 4IEEA 2HMWA 4JLOA 1R8QA 3GEPA 2CJXA 1R8JA 3MXOA 5EWLA 2LCQA 4CN9A 4DJAA 5DEIA 4TYNA 2ZUUA 3JWEA 2C20A 4RKRA 4D8WA 1HT2E 1ZBDA 3R0ZA 2ASVA 2JFQA 3OPYI 1KI9A 3K96A 5CDSA 4HNAB 2GTHA 4E03A 1JW9B 1JIIA 2GM3A 2O50A 3E22B 3OEED 2X9NA 4JR0A 5ADVA 1CBUA 1NUPA 2RH5A 4DLXA 2NP6A 1T3TA 2ZJ7A 5DGDA 3OE5A 1M1YB 4DCMA 4NU0A 1WOYA 2RGEA 2BHRA 5LQRA 1PAUA 2Q8QA 3B2EA 3ZV7A 3D31A 1G5QA 3WGUA 4EB0A 2FPWA 2OXRA 2RJNA 3AUYA 3IJRA 4DUGA 2HIGA 4MI9A 1A69A 1LSOA 1T1JA 3PHIA 1N0IA 3UAYA 2FSGA 2ANBA 1HFJA 4HQLA 1SEPA 3MIZA 2QG9A 3L02A 2LDXA 3ST7A 4EDHA 2GEFA 3L79A 2BBTA 3NJ4A 3DPUA 3A1EA 5A04A 2VHEA 5EE0A 3SQOA 2EQ5A 3E48A 2J33A 1K2VN 2Z0MA 1Q12A 3DTNA 1TADA 3COZA 1JZQA 4NH0A 3INTA 3NOOA 4W7SA 2OT3B 5CIWA 2VXBA 1Z5VA 1PYGA 4HLQB 4RJKA 4Y9DA 2QRVA 2CXOA 4BKPA 1I8TA 1WBDA 4WV3A 2QTLA 2NM0A 4KOEC 1KZ9A 4P33A 1QBKC 1T5DX 1U1IA 1CY8A 2BGMA 2FPKA 2SKDA 3KWFA 3N9IA 4M46A 5ENZA 3ZWXA 2WTUA 2I3AA 3VPXA 1O58A 3Q5DA 1ECFA 1X77A 2FF5A 2P2YA 1Z35A 4COKA 1XMSA 3GD5A 4F2DA 2HY7A 2H51A 2WJHA 3NTUA 4KQEA 5D00A 1L4BA 4HRXA 2G4CA 3LC2O 1W35A 1AKEA 5KSPA 1W7AA 3P97A 1PT6A 4LY3A 3IDFA 4BNFA 2CMFA 1NV8A 4F2WA 1CNFA 4Q7EA 3WLMA 1MRSA 4JOBA 4CG2A 4XX0B 2Q07A 3UKJA 3QOFA 2XQIA 2JFHA 2H85A 4G89A 3UUFA 4ZXFA 3CEJA 3GG9A 3H5VA 1TF7A 1IUOA 1TL7C 2FPGA 3H6KA 1ZU5A 3O9ZA 1CS0A 1CNMA 2OBBA 3ZCRA 2ZLBA 2QMHA 5HF9A 3M34A 4R51A 1JI0A 4PG5A 2J09A 2WABA 4RIEA 4EA9A 3HDVA 3KPYA 4PX3A 2OMKA 2FR8C 1I14A 3NKVA 3HV2A 1EFRA 4G81A 4X7BA 1C1DA 2DPLA 2YWFA 5BRJA 2Q21A 3HM9A 1TMGE 5ENDA 1T3ZA 1OX4A 5JSZB 2JS7A 2EBHX 2WP8J 3D8HA 3E70C 4ID9A 3ZWWA 2Z2YA 4MWZA 4G5OA 3ZGYA 2DBQA 4RQAA 1XE3A 5HF6A 4B48A 2P8JA 3BRQA 3P9PA 4ZAWA 3CEHA 2I62A 3KJFA 2PU7A 3AEKA 3E5NA 4BP3A 3WGIA 4K88A 1BA2A 4H3VA 4OXXA 2VSXA 4HYYA 1UBSB 5HK8A 1SXPA 2O3RA 2GM5A 1NQ5A 3PLRA 4DCNA 3K2BA 3AI7A 3N8DA 4OI2A 5AHXA 1J21A 3TD6A 1G7TA 4PG4A 4BKUA 4URXR 1MC5A 3FOZA 3M3HA 3FWZA 4KYVA 2XUAA 1R8YA 1DIRA 1XHLA 2ZREA 4OOEA 4BNIA 4EABA 2D74A 3JQ8B 3L7LA 4UAVA 4YR9A 3CRVA 1SULA 5KREA 1T0BA 2RARA 5GTDA 1CE8B 3M9XA 3SX2A 3PFGA 4G97A 2AOTB 2EW8A 5KVAA 1Z4KA 5C46F 1E7SA 1VM6A 4NH4A 2QZPA 1JG7A 3DOEA 3WA6A 1OBVA 1H6DA 2XOKD 4R2XA 5BW5A 3WRWA 4MEJA 4I3HA 3AIMA 4IG9A 2V7WA 3MMXA 4Z4CA 1Z39A 4EARA 2XUOA 3H97A 1PL0A 2PKQP 1YVPA 3DL0A 3PC4A 1I3OA 1NBAA 4BIMA 4BO8A 3II6X 4FHDA 2YYAA 4PHCA 1V1MB 4E2WA 16PKA 4YP5A 4HQFA 1FLVA 3LQ2A 5ALZA 4HN9A 1TJNA 2Q5QA 3H1BA 5CYFA 4DRYA 5TPZA 1F4LA 5AWFC 1HYEA 4QBFA 3TR6A 1GUZA 2RHMA 5GJCA 5FCDA 1E9SA 4NL4H 1UK8A 4Y6RA 3TOZA 3JQRA 4RSMA 4US0R 1UAYA 3PA8A 4Q1FA 2P4SA 1O87A 2GWRA 5KYTA 3SSNA 2FDCA 2I4MA 3CH5A 4Y8VA 2ZVJA 4A6PA 5ADHA 5DFAA 1BDBA 3QKTA 4QDKA 4KEAA 1KQPA 1NMYA 1I13A 4LJ5A 4LYGA 1ZD3A 6Q21A 1XAJA 1IWOA 3N5CA 2EP5A 1C30B 2G71A 1CDDA 1P44A 2GZHA 1G7SA 5GMOA 3VU1A 3EG9B 3IE1A 5IVIA 2ZRIA 4MMZB 4U7WA 5DCLA 5DP2A 3ESRA 5L3VA 3F5DA 5DK6A 1ULZA 3OA2A 5AW4A 3OQ1A 3ZQ6A 1NI4A 1E6MA 4RS4A 1CJBA 4DGSA 1NDHA 2DKNA 2PSDA 3NHLA 2N1BA 1GFWA 4HEHA 2HAEA 4D45A 3SKYA 3HFRA 2XKJE 2G72A 3CEPB 4QTZA 1DFGA 1PT7A 1RMQA 3E5MA 2AI1A 2WIDA 3EXHC 3HUTA 4E5DA 3O38A 2AYYA 2OHOA 4EEZA 3QA3E 1R9JA 2XMGA 2J5BA 1D8AA 3COPA 3JRNA 4RVOA 3WYAA 3ZNOA 2Z5FA 3NZEA 4ZV4A 4AN0A 2EJBA 4AIRA 3CMCO 1GAEO 1MORA 1OBCA 3F4LA 1IJFA 3G82C 2WYWA 2VF2A 4XD7A 2J6HA 4K3VA 3IQXA 1DG3A 5IWAB 1NBME 1M0WA 4DWJA 9LDTA 3O8OB 3MGCA 2FJ0A 1WY7A 3QELA 5E7QA 2QR3A 3NHMA 2GZRA 4G4SP 2E49A 1GARA 2IYFA 2O8FA 3P9CA 3TSZA 2OO3A 1GFSA 5EIWA 4ER5A 5IXSA 1A1VA 2VEOA 3P9QA 4QGGA 5B55A 1C3EA 1Y63A 1ZJWA 3ECSA 4CLOB 1C1DB 2P3OA 2Z4TA 3DT8A 3RYIB 4PLGA 4MROA 4QQRA 3X2FA 5LPNA