1KQPA

Nh3-dependent nad+ synthetase from bacillus subtilis at 1 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
b'SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
molecule tags Ligase
source organism Bacillus subtilis
publication title NH3-dependent NAD+ synthetase from Bacillus subtilis at 1 A resolution.
pubmed doi rcsb
total genus 102
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kqpA00
3LOQA 1U0BB 3UOWA 4R0NA 1VLHA 4MQ6A 1U3DA 3ND5A 4MW1A 4A91A 5LFAA 1EFPB 3KT6A 2DUMA 3PNBA 1FYDA 3COWA 1MAUA 2A1TR 1TYCA 3X1KA 1M8FA 1JEDA 3TQIA 3ZXSA 4WNYA 1O95D 1U7XA 4MAFA 1Q15A 1SURA 1J21A 2A88A 1N1DA 4MUKA 1I2DA 1N77A 3N9IA 4H3SA 5FO0A 1KQNA 2RD2A 4J75A 4OUDA 5IHXA 3ISJA 3VRHA 4HK4A 2QUKA 3D6UA 3A4IA 1ZH6A 1EFVA 4MW5A 1N2IA 5LLTA 4U8HA 3ZJVA 5J58A 1BS2A 2GOYA 1PFWA 2WQ6A 4I6JA 1UFVA 4EFKA 1B6TA 1PG2A 3CVYA 1EFPA 4NATA 3Q10A 1TYDE 3DLAA 1GLNA 3HGMA 4CDNA 1Q77A 1MB2A 4ZT3A 1ZJWA 2J4DA 4DDHA 4U63A 1MJHA 1EUYA 1TYBE 1X6VA 3RK0A 4DDMA 1IQ0A 1M8KA 4NAHA 3UC5A 5DB4A 3HFJA 3FH0A 1KR2A 1T6ZA 2QUHA 3CLUC 4K03A 3BL5A 4MUNA 4ZT6A 5FO1A 1H3EA 1U3CA 2A1UA 4ND7A 3H97A 5DEOA 2PXHA 1T9GS 2A7XA 2YWCA 4I6GA 1J1UA 2QJOA 1T6XA 4NAUA 2WQ7A 1FFYA 4Q93A 1NYLA 1JMVA 2HZ7A 2QUJA 4EGAA 1G8FA 2DETA 4KR7A 2YXNA 1MRZA 3HV0A 1M83A 1TQ8A 2V0CA 4XSVA 1XJQA 4NZPA 3ND7A 4YP6A 1NURA 3H9BA 1IQRA 1O97D 1J70A 2CFOA 2I1LA 2QTMA 4MW9A 4OJMX 4E1AA 2V0GA 1P7PA 3CLUD 1F7UA 4KKVA 4MUGA 1HYBA 3CLTD 4GU5A 1EXDA 3CLSD 4PBTA 1KP2A 3AKZA 5EKDA 4AQ7A 3KT3A 4JXXA 1I6LA 3MMXA 4MW4A 1Q11A 1OWPA 1VBKA 1R6TA 1MAWA 3HL4A 4ZCTA 1WKBA 2JA2A 1K92A 1KP3A 3CVXA 1WY5A 3COVA 3SDBA 1R6XA 1KAMA 4JXZA 4KR6A 4I6EA 2Z09A 4ARCA 4CT0A 1WOYA 1LW7A 3FOCA 4PBRA 2D54A 4QREA 2E21A 1WQ3A 3SZ3A 1K4MA 1XNGA 4ZCSA 5HUHA 1KAQA 3H99A 1GN8A 3G6KA 2R5WA 4G5FA 4ZT7A 3K9WA 1ZH0A 4EG3A 1IH8A 2E89A 4RPIA 2QTNA 1GTSA 1KH2A 1QTQA 1IQUA 3TZLA 4Q16A 1O6BA 3DV2A 1H1TA 2IJGX 2XRYA 4XFDA 2PZ8A 4EG8A 4ZCQA 4EG7A 4GRIA 3IH5A 2A84A 4MVCA 5DK4A 2DR2A 1NI5A 1Y42X 1V47A 1XNJA 2PG3A 2X1LA 3IOEA 4KPUB 5TS2A 4X0EA 3CVUA 3LE8A 5HUJA 3N8HA 2G36A 4DE5A 1QRUA 3FNRA 3FIUA 4ZT2A 1COZA 2D5BA 2A4MA 3KFLA 3K32A 2XRZA 1V8FA 3IODA 2J09A 3IMEA 2E18A 1EE1A 3RHSA 2VTBB 2WB2A 4MWBA 1EFVB 2WSIA 3KT0A 3NV7A 4MW7A 2DERA 3SEZA 2O5RA 3N05A 3H05A 4XFJA 1N2EA 1KQPA 3PNYA 1VBNA 4YBRA 3ZJTA 3IOBA 1N2OA 4MWEA 3C8ZA 3AIIA 2GKSA 4MWCA 3ZUGA 1OWNA 1K4KA 1CT9A 1OWMA 5H7XA 1R6UA 3AFHA 2EJCA 1YUMA 4UZEA 1LI7A 2CT8A 4YP7A 3P0JA 1N3LA 2QJFA 4AS1A 3IMGA 1I6MA 3FDXA 3CVVA 3L92A 4DDKA 2CSXA 4ZCRA 2IELA 2NSYA 2PIDA 1NUQA 4HJXA 1TFUA 1S4MA 5DASA 3ILVA 1H3NA 2CV1A 3KT8A 2J5BA 1JEEA 4MWDA 4BWVA 2DEUA 2AZXA 1JIKA 1WJGA 3COZA 5JBNA 1N2GA 3AL0C 3FI0A 4MLPA 4L2IA 5AHWA 1PFVA 4PY2A 3ZIUA 1IVSA 4YMIA 1N2BA 1WQ4A 3MXTA 3OP1A 3PNVA 5IJXA 1YIAA 4WSOA 4CQNA 4EG4A 2B7LA 2HMAA 2C5SA 1O0BA 2EL7A 3CLTC 3TS1A 2RE8A 1QU3A 4QRDA 2VTBA 1G8GA 1KH3A 3P0HA 2A86A 3DPIA 3ELBA 3QTBA 1IRXA 4P2BA 1QU2A 3MLBA 1JGTA 1O5TA 4S1OA 1G59A 1M8JA 1YI8A 3NBKA 2X0KA 1OBHA 2Z3VA 5KHAA 4YP5A 3IVGA 3CLRC 1PG0A 3TNJA 1DNPA 1ULHA 3CLSC 3H9CA 3G5AA 1QQTA 5K0SA 1J20A 1NUPA 2PFSA 3PXUA 4F4HA 3P52A 3HMQA 3A2KA 1J09A 2QTRA 3FG9A 3RK1A 2CV0A 1G8HA 4MUJA 1O96B 5TEWA 1JIIA 3IUBA 1IFXA 1MBZA 1WXGA 1WXEA 1YUNA 1QJCA 2J08A 4JYZA 4MW2A 1OWLA 2CUZA 4RUKA 1O94D 3I05A 5KCMA 3FY4A 1NUUA 3IVCA 3RJZA 3TZEA 4R2LA 1NP7A 1M1ZA 3NBAA 2A1UB 1XNHA 1JIJA 1MB9A 2X1MA 3IOCA 2H29A 3UK2A 3SYTA 3D6VA 3HZRA 2X3FA 3UY4A 1N75A 1M8PA 3X1JA 1ILEA 3G59A 4MVWA 1O96A 3AG5A 3S3TA 1TEZA 1IHOA 3VU8A 3CVWA 4MUEA 1F4LA 3M5WA 4NDAA 1M8GA 3IDFA 1O94C 4ARIA 1VL2A 4HJRA 4EG1A 1OBCA 1N2HA 4JZYA 3F3MA 1F7VA 1TYAE 2DLCX 3QTTA 1KORA 1WZ2A 4F3RA 2A1TS 2AG6A 3N2YA 4ZT4A 3RFFA 4CDMA 1ZUNA 3X1MA 2BTEA 2CYBA 3SEQA 2DXIA 4ND6A 3IUEA 3GUZA 3CA8A 5H16A 2QJTA 1OWOA 5BNZA 4UZFA 3CR8A 4PBSA 1RQGA 1LI5A 4HPWA 3PRHA 1F9AA 1X8XA 2JAXA 2Z08A 1JILA 1H3FA 1WXFA 4KR9A 4MULA 1KKUA 1I6KA 4MVYA 1N2JA 5HG0A 5FNZA 1OD6A 1K97A 4L2IB 4MUFA 1O0CA 1EUQA 3VGJA 2OV4A 1QRSA 1O95C 1EJ2A 1N78A 5K0TA 2O8VA 3GLVA 3GMIA 4MW0A 1NUSA 1QNFA 4G6ZA 4K0RA 4ZCPA 3LCJA 1WXIA 3IMCA 2H2AA 1NSYA 2D13A 3QE4A 3FETA 2HGZA 1O97C 1JHDA 1Q19A 1WXHA 4MUHA 4EG5A 4MUIA 3OTWA 1YIDA 1PFUA 4R2MA 2ZUFA 1T6YA 3ZJUA 1U7DA 3ZXIA 3JXEA 3Q12A 3AG6A 4TS1A 2BYTA 3INNA 5KWVA 4DLPA 4ZT5A 4G5YA 1GZUA 2VXOA 2QUIA 5LM3A 1NZJA 2CYCA 4MVXA 4QBTA 3SZGA 4EF6A 5F23A 4NX2A 2ZUEA 3IVXA 5TEVA 1VBMA 2JANA 4FZJA 2OQ2A 1D2RA 2YWBA 1T9GR 1NUTA 3A04A 4DJAA 3Q4GA 4EG6A 1JECA 3L93A 1GTRA 4OUDB 3DO8A 2AKEA 1PFYA 4MW6A 1A8HA 3ND6A 2PZAA 2CV2A 3UMVA 2GM3A 1JZQA 3CLRD 2CYAA 5J5AA 2YY5A 3FHJA 4U7JA 3COYA 1QRTA 3TQOA 2NZ2A 1JZSA 1KQOA 5J59A 2TS1A 3MUEA 1GAXA 5TGTA 1MOPA 2J07A 4J76A 4JFAA 4KPUA 4DNXA 1MC1A 3SP1A 3U1VA 3P0IA 3FWKA 3A05A 1KH1A 2DPLA 3MLAA 1GPMA 2IP1A 1YULA 3RBAA 2PZBA 3ZGZA 2E0IA 1J1ZA 3E27A 2ZP1A
chains in the Genus database with same CATH superfamily
3L7KA 4UBKA 3VYWA 3D1LA 3VNUA 1KR5A 1CERA 1GUZA 1VJ0A 3TTVA 1ID8A 1N9ZA 1E2NA 4HMQA 1BCSB 4I55F 5FUMA 3ND5A 3DKRA 5B4UA 1CY8A 5IKPA 5HF5A 3THSA 3KSAC 4HWRA 3UCEA 5I7HA 3N5KA 3H18A 2UU9B 3LKDA 5K09A 1ML3A 5DXJA 1CS0B 2FX2A 5TQ0B 6CHYA 4G81A 1PZEA 1N0IA 3DDHA 1ZD9A 4QFCA 1I2CA 4ED9A 1NM5A 3ZXSA 2VRCA 2J9RA 5CVUA 5DX0A 1IC6A 2OECA 1YHZA 2W22A 2UUCB 1F6DA 2FUG1 3OZXA 4M1YA 4P80A 3KOUA 2CCJA 3MCVA 3MGAA 2Q5JA 3E9QA 1N92A 2A9RA 2J5KA 2QDKA 3EPJA 2PFKA 2BFFB 3ZV7A 2PY6A 4V3CA 1USIA 1UH5A 4R8SA 2V9PA 3C45A 1MEOA 3MT7A 3T3MB 4CM9D 3IP9A 3ESZA 2Q6TA 4Q3LA 4RTOA 2V59A 5EHGA 3H4MA 5HCNA 4NK5A 1ZH6A 4P58A 2FPGA 1C8BA 2P6NA 4MW5A 2N1BA 1FLDA 3BXGA 3IURA 2EC5A 3O4VA 3NZEA 4INPA 3K72B 1DFGA 4LDAA 3T4XA 3VHRA 1DG3A 1KJZA 4MINA 3D3NA 3DEZA 2IX3A 1LWOA 1R12A 4KAFA 4ZQFA 5I9SA 3RLFA 3T7DA 1ENZA 1EFPA 5KKAA 4LZPA 1OA0A 5TV2A 3RSOA 3OIYA 2Q9CA 1GLNA 1ZC4A 3FYCA 3KYJB 1DAPA 2VUSA 5EFZA 3ZW8A 3OY2A 4RIEA 3FTFA 5TR9A 1U1GA 2XCIA 4MUAA 2Z2IA 2ZE6A 2HC9A 3ZQUA 3R0XA 2X2PA 4C7KA 2J30A 2YJ3A 5I47A 2ZYVX 5EERA 4ZC8A 2WILA 4FFBA 2W4QA 3NOVA 3QX9A 2LKDA 3BRQA 3VDNB 1NZDA 1FX0A 3FBWA 3FWHA 1T0HB 3KSMA 4M0FA 5TQVA 5HRAA 1Y33E 3KDPA 1A9PA 4A6EA 4PSDA 3WKEA 4Q15A 4JYAB 1OGYA 4FN4A 1XMQB 3MIIA 1KYYA 1IK4A 2NT4A 5CNIA 2EW2A 5JNRA 2WIGA 4JK3A 2GO7A 1U11A 2ZK7A 3EJWA 3AERA 5FQNA 3V2GA 2YIMA 2V8OA 1H94A 2FSGA 1NBWB 4XRRA 1KE1A 4HDOB 2C5BA 1P2UA 3N58A 5EUQB 3L43A 4BEJA 1P5HA 2FOLA 1ISGA 3HXLA 2I7CA 4IQ8A 3TOVA 4GPBA 3IQFA 1M83A 4PRKA 3AEXA 3W5VA 4EHIA 3TQQA 1OHHD 4JMPA 4LC0A 2TSYB 3L1JA 2AE1A 4QUEA 3PQ5A 4LJLA 5JNUA 1WABA 4P5EA 1N2CE 3D5QA 1Q12A 4CM6A 1JIUA 1I4OA 4CLOA 2BKVA 4H4DA 1CRZA 1BD3A 2G5TA 3IAS1 4LJ8A 4P2GA 5FUYA 1EJ0A 2FUKA 4EJSA 3NHZA 1X15A 1EBUA 2IZ6A 3PHJA 3RS2A 4IDHA 3V42A 1XHFA 1VB5A 3WOVA 2JLVA 4HNQA 3GRFA 5D7NA 4A8JB 1Z12A 5BSUA 2PJDA 4GGPA 1FTSA 5EZ6B 4A6DA 1DT5A 1T1RA 3HVHA 1FBTA 3WLIA 1AKYA 5H02A 3B9PA 3ET5A 4E11A 1RYHA 1VIVA 1Q11A 4JSYA 1DIRA 1H9CA 1UKEA 3BH7A 3GUUA 1E59A 1E77A 3LWDA 2HV8A 4OY3A 1XAGA 2YS7A 5A7GA 3BORA 4RO0A 4DQXA 1J23A 5CFLA 5IJAA 4M9SA 4BYGA 3IO5A 4PQYA 1GL3A 1V3VA 1NAIA 2B2CA 2JFHA 3X0DA 1O3YA 1E8NA 4CV3A 1ZUIA 3BQNB 3HJTA 3LK6A 1NWCA 1T0UA 1SZCA 2R66A 3BVPA 1QGAA 5FF9A 4J0HA 3H0EA 4OV6B 1EVKA 1XTQA 4JXZA 3B52X 3AUXA 3UK0A 1FTQA 3WK5A 4CT0A 4PBRA 1BE8A 2XTNA 1PTKA 3JQ8A 3N2EA 4HX9A 4V0MA 2PNJA 1YIOA 5AMXA 3TPCA 3MBOA 2EKZA 1CLUA 2YJ6A 3HYNA 1SEPA 4MWZA 4E5YA 1EP9A 4DBVO 3RFXA 3LX8A 5KSOA 3T3OA 3AMVA 3RVRA 4MV3A 2FZCA 1FEZA 5JSZB 4GECA 5AUPB 1N9GB 3RU9A 1M2VB 5ELMA 2BTQA 1CJBA 4M1EA 3II6X 3OMWA 4X63A 3UV3A 3ZQ4A 1KH2A 3DZFA 5JCPA 4WPGA 5JRDS 3HNOA 2GM9A 3MTJA 1ZX1A 3OHMA 4I1OA 4KVZA 2XRYA 4EUNA 1EHIA 4K05A 4OQDA 1L7RA 4YO7A 2BWJA 1T13A 4RPCA 1YJAA 2WAMA 3BGIA 3ONNA 1AKQA 1E9CA 1KJIA 1W1WA 1E9AA 3CINA 3GGOA 5HDQA 2DR2A 3TX6A 2H1OA 1TCVA 1UBMS 1FJGB 1XMIA 5BUCA 5FFMA 1GY8A 4MVJG 1A77A 2IW3A 2WG2A 2X8JA 1HLPA 4KQEA 3S99A 3WMXA 5HR5A 5JC8A 1UBJS 1QS0A 2CVOA 3H1GA 2WNIA 5JNLA 4EH1A 4KAAA 3FJ1A 2ZT8A 3R3YA 4CV2A 4DBLE 1BC5A 3DBOB 5KTRA 2CLCX 5FL3A 4MYCA 3BXZA 1R0ZA 1GTZA 1V1JA 2G82A 3D4OA 3DT9A 1UBOS 3F90A 4RK4A 4TLLB 3B3AA 1TJNA 3N0RA 1Q6ZA 4CHGA 2ORIA 1O57A 2O1WA 3B1JA 3U7EB 5G0SA 2Z5LA 2C77A 3MG9A 3NDRA 3NCHA 4ESOA 2MT9A 1A4IA 5B64A 3QUCA 2ON6A 1YCFA 3EZGA 1YB2A 4RGYA 1XL0A 4TV8B 3R7NA 1KQPA 3YASA 2XCSB 5F3DA 1GUAA 2C94A 2WB4A 4R0VA 2BFEB 1U9CA 4L6AA 4H1WA 1XZIA 3AQ4A 1KKLA 4JP8A 4Y9DA 1ZNWA 5FYQA 4F60A 1MO3A 2RAVA 2Q6OA 1NBAA 5MN6A 4GKJB 1SVWA 4DR1B 4ZANA 3TX2A 4XIJA 1WCV1 1XD2B 2EEPA 3Q0IA 3HLKA 1SHZA 3H5RA 4KIFA 2D8MA 2RGAA 2INGX 3A28A 3FA2A 3T8YA 4OHCA 1PAUA 2IEDA 3OCWA 4P3YA 4Y8VA 5DZSA 2CT8A 4AS1A 3CIFA 4X7MA 2H08A 4JJZA 1PGJA 2OV1A 5JC1A 2ZSDA 1P4GA 5ENVA 5AUQA 4DDKA 3NHKA 4GLJA 1FRVA 2EHDA 4E3ZA 2YY7A 3FPEA 1T0IA 2NSYA 4AXXA 5C2JB 1V6SA 1Z6PA 3TDNA 3U7RA 1DI0A 2OXCA 4RYLA 4Z53A 2J48A 2AOTA 5KJEA 1UM9B 3Q1LA 1TVKA 2XRFA 1RYYA 1XSEA 3EC1A 1V8ZA 4FI3C 5DWVA 8ADHA 3O1HB 1RRPA 3QHAA 1Y37A 4FGUA 4F9EA 2WF7A 4L8FA 4Y3UA 1G4UR 1BQ4A 1SUCA 1PS9A 1T3TA 1PJSA 4RM3A 2ZYGA 3M6LA 4MAAA 3V3KA 5LD2B 1IBLB 3TE6A 1C3XA 2ACEA 4IBOA 3PJGA 1J49A 3P2OA 1FW8A 1QIJA 5GJVC 1BIFA 3AFNA 3ASUA 4LRQA 3HY3A 2ECFA 3CNBA 1ZVMA 3GHYA 4I50F 3SXUA 4D1YA 3TS1A 2CJWB 3GAAA 2D7JA 3WBFA 4WKGA 1CVLA 4KEAA 4PYLA 3T34A 2VCHA 1F2TA 3R24A 1PG5A 4NOLA 2R6FA 2WSBA 2RGGA 5AH0A 2J59A 4C4SA 1VG8A 3I0MA 3JV7A 4B2YA 4Q1FA 2GZ3A 2EOAA 1P74A 3CBQA 4BTVA 2JFXA 4EPWA 3ANXA 4ER7A 3CBGA 4B3FX 4W5RA 3EASA 5LIRA 3KE8A 4XM1A 4EB3A 1QHFA 2B9EA 1HDXA 2I3DA 2R8OA 2V5AA 4FZRA 1BMFD 4IDNA 3BTSA 2NU6A 3TM5A 2DWCA 4YN3A 1EYZA 3CUYA 3IVGA 1QMPA 3KUUA 4BAZA 2VLBA 1HG1A 4ZU1X 2GD6A 4D8XA 3IQXA 4UD6A 4D4KA 2XIQA 1I1OA 2ZSIA 4MJ3A 4OGKA 5GV7A 1C1DA 4S05A 2D2IA 2HJHA 5L95A 1YZYA 2FSHA 4AJKA 3LRTA 5JVDF 4BXOB 5T3YA 2HCJB 1SKAA 2GH1A 2XY4A 4W4TA 5CDYA 3D3JA 3JVVA 1WXGA 3M3PA 3IV9A 1OAOA 3PHBE 4TTJA 2MOKA 3MWLA 1T34A 4YRJA 4YMHA 3O7MA 1N4DA 1BCRA 4RZHA 5B4TA 1A98A 1G8KA 3U60B 1IXYA 1JWAB 3A1SA 4EFNA 4O2LA 4Z4GA 3AOEA 2V65A 4INZA 4CMGA 4YJ3F 3TZEA 2ZRBA 3D4NA 4G5XA 3ZBUA 4RZUA 4BYMA 1Y9ZA 3LTNC 1NP7A 1S6YA 4TKLA 2FEMA 2EQ5A 3BL8A 1R9NA 2JGIA 3NLLA 2IHTA 1U0OC 3N53A 3SZUA 2GD0A 1IAVA 3FPAA 3L6UA 1N8KA 1FYXA 2AMFA 1G20A 3LQFA 5AW0A 2KWIA 3LCMA 1JLLA 2XWBF 5IC5A 4ZZ0A 1ZLXA 2YOHA 1N5RA 4A92A 1XTPA 1M8PA 5JYEA 5LBIA 5JPDA 3NW9A 1TIPA 3WLQA 4DT1A 2QQEA 4RF5A 3ROMA 1ZL0A 5HF6A 3ZWCA 1TEZA 5B3LA 3VZSA 4QJ4A 1TM1E 1U9ZA 2ONKA 4ASUA 1F4LA 4Y2YA 1KP9A 2CJPA 1QO9A 2IQ5A 2GN9A 4ZEMA 1N7GA 4KDRA 4IVRA 5AK0A 1EH5A 3CZ5A 4ZK6A 2GF9A 1VPTA 4QFDA 2OSVA 4JQSA 2EATA 3VHXA 4F6RA 3LWNA 1NI3A 1V6CA 2K2QB 1BMFA 3U7QB 1WZ2A 1TADA 2Y1WA 1MVNA 4B4VA 3CWCA 2OHFA 3PYLA 4ZI7B 5CFNA 4MV6A 4TM7A 5C80A 2MMGA 3HBFA 3HA3A 1QUFA 5JS8A 1Z7BA 3ZK9A 2XCLA 4K9OA 1CS4C 3DO5A 4DAOA 5JSFA 5LU9A 3U6KA 2V7QA 1P5JA 1MGOA 4NYIQ 2R8EA 2OP0A 4BGUA 1PTJA 4FEAA 5TPZD 3TGPA 1S3FA 1AK1A 2GCEA 2HA2A 3OEHA 4HWGA 1VQ1A 1FRZA 4DMUB 3BCSA 3U80A 3Q3HA 3DZIA 3PRHA 4PYRA 2PUBA 2JAXA 4L0MA 1Z34A 3MGCA 1V43A 4H77A 3AVOA 4L16A 4MR7A 3HYCA 5AW9A 2Z6UA 1VJTA 1KZ6A 4BQPA 1XDGA 3EXEA 3M4XA 1W9HA 2MIIA 5ERXA 4L2IB 5DF1A 2XDYA 5IDVA 3I42A 3MC1A 4JR2A 3ZU2A 3PCRB 4JAVC 3NBFA 5B3KA 2XUQA 3IUJA 5J5CA 4I2VA 3WIVA 3GLKA 3KTDA 2QW8A 3PC3A 1XZEA 1MKYA 3TSWA 4AQYB 1OZAA 1TZBA 3WOHA 2CHFA 2ZJ1A 4IV8A 4DABA 1SBCA 1X3LA 2J3MA 5EUBA 4B82A 4CQMB 3R9WA 1CG6A 3K70C 1T9DA 1FMLA 3WDLA 1J24A 1CUGA 3AILA 3L7MA 4P0PB 1PWHA 3KLPX 2HGZA 4N0EA 4QVIA 4MQEB 2R47A 2MSEB 3EWSA 4EARA 3GJTA 5SY6A 2IC5A 4RLSA 3ZHTA 3PC8C 1PV2A 2BMAA 1LRKA 4B0OA 3H5LA 3N6RA 3Q12A 4YROA 3DVSX 3LGXA 1GR0A 1OAOC 2R6ZA 3I4LA 4KXQA 4RKFA 4CR6A 1YTUA 1YFZA 5EXXA 3CH7A 4G0ZA 3OBBA 1QCZA 2TECE 4UHEA 4WCDA 5E9QA 5JEDA 5L7TA 5LDGA 3I9MA 3DEIA 2JJYA 3L0IB 1MIHA 4ID9A 4QT0A 1RHQA 1D6MA 5TEVA 1VBMA 3S68A 5AKHA 1GGJA 3QVGA 4JVLA 1RM3A 4Q19A 2NU8B 1E0AA 2YWBA 3EEFA 4P3XA 4EUKA 4XR4A 3QELA 3U81A 4ALLA 4CEJB 4OHWA 3RARA 3F46A 1CHNA 3LHFA 4LDZA 3C3EA 4HB3A 3SKXA 2CB9A 2GN4A 2UZAA 2ISCA 3BJIC 3JWPA 2H7YA 2PR2A 5D3MB 5GMOA 3WRXA 4D8WA 3DO8A 3GUYA 2ZUUA 4B3IA 2DY1A 1H2AS 1QF7A 4IZIA 4BMZA 2G04A 2P6PA 3U61B 2C8JA 1UFKA 4WESA 3EH2A 5BSMA 1KTVA 3BXFA 1OIWA 2GM3A 3NEAA 1GUBA 2D5LA 2LD4A 2WT9A 1ZCZA 5JYCA 1VFPA 5IAEA 2FY8A 5I7WA 3HI4A 4G1CA 2PRSA 3A3NA 4MNTA 3A6EA 4BNGA 4MA4A 1YZKA 5DGIA 1YKSA 4RH0A 4MIEA 2O2IA 2NZ2A 2CLOB 4DIEA 4YPFA 5AIBA 3OAAA 3R8FA 3L6BA 1MOPA 4I1IA 1Q1EA 4AJ2A 3GFSA 1UODA 1IN5A 1JAXA 1MC8A 2VQ3A 3ORHA 3CISA 3MCAA 3NRJA 5B3JC 3AVQA 1XRSB 4H3VA 4HRYA 4NQRA 4KVGA 4EMTA 1E62A 4NIMA 3L0CA 2CBZA 2AXNA 1SOVA 1C9JA 2X0FA 2O5EA 3ZDXB 5AHOA 1S2LA 5AK3A 5BP7A 2NSHA 1U7ZA 2CDBA 4WK4B 2JRLA 2OM2A 2AQHA 1P73A 2JFYA 3E2MA 1GT6A 2WSMA 3RRNA 4BPRA 2W2LA 3VTAA 1TA0A 3VH2A 4YQFA 3NP9A 5T4FA 2O8DA 4OEHA 5LFAA 3JYLA 2VA9A 1XL1A 1WTAA 1EFPB 3NUZA 2V4MA 5EMLA 1J0BA 2HHJA 3PHHA 4QYMA 4RPLA 1YSCA 3H3FA 2XXJA 3T94A 5KNBH 1QTIA 2F2TA 3DTVB 2P0EA 4AO6A 3N2GB 2PKRA 3LUFA 5HS6A 4UUAA 3ZVMA 2GARA 3A0RB 4KLAA 4N40A 3TQIA 3B6KA 2WM3A 2X58A 4X92A 1QAOA 1V8PA 1IG3A 2A0WA 2QVZX 1N6RA 1GU1A 3NRBA 3P2IA 1E79A 1W88A 4K28A 2GBLC 3I76A 1SURA 4M9ZA 2JIRA 2O05A 3JQCA 3I3OA 3WJ1A 2PCLA 3D81A 5G0UA 3RFCA 3GJSA 2RGNC 2DU8A 1MZVA 1WTCA 2Z4RA 2ETXA 3OZWA 4LI0A 2UXDB 2YFQA 3TQSA 2HWWA 4NHOA 5A1TA 3KVOA 3TFQA 1E2FA 3WKAA 1OZHA 1Z5UA 2H5LA 1YCGA 3MJFA 2IEIA 1ESEA 3PEEA 4IFTA 3F49S 1DCTA 2HMTA 4NQZA 5FPPA 3K31A 3FTDA 4HTAA 2LBPA 3E61A 1AH2A 2WQ6A 2ZSEA 2F1HA 1CUYA 3HYTA 2GM5A 3IE2A 4PO8A 4I6JA 2Y3IA 4HWTA 4Z9YA 4W9RA 4A0FA 3PICA 3W78A 1KOGA 3GJ0A 5FTNA 1W1IA 3L1IA 4E7PA 3C3DA 1DEKA 1ODLA 1T4CB 2QRGA 5KOYA 5KTOA 1R4MB 2RKBA 2DH5A 2WNHA 3ANSA 4FFMA 1GKKA 3VU3A 4P84A 2II6A 1R3DA 4GIBA 3EFHA 1D1PA 5JG7A 1P8AA 1V35A 4IINA 8LDHA 1KSGA 5DRYA 3LFHA 2FPMA 4X1OA 3UGTA 4RABA 1VSBA 2MSDB 4NFYA 3FW1A 2NO4A 5CXSA 3B3QA 4XFKA 1T3LA 2UZ1A 2JS7A 4BX0A 3DDWA 1XXLA 4JB8A 1V0JA 4N1AA 1VG1A 1KVSA 1GARA 5D85A 2FQQA 1H8HA 3PJEA 5IT4A 5K03A 1G66A 2XDWA 3H2IA 3R74A 3TEJA 5T4EA 4MP6A 3KAKA 4UHBA 1ODJA 2PXHA 3IEUA 3W9SA 5ITVA 1K6IA 1T6XA 1Z4QA 3K5HA 4BE4A 1SXJB 1QVAA 1OASA 2OCPA 1B2LA 4GOXA 2HBQA 3MJ4A 2C4UA 2VNHA 2RI1A 4ZDIA 3I5XA 4LN1A 3GXBA 3HR8A 5GZ6A 2IITA 3UEOA 1P1JA 3VO2A 1OBVA 3VTKA 2FZ5A 1HQYE 2WM2A 3H8VA 1POXA 3C1UA 3KQSA 3UXYA 3HCDA 1KY4A 1NVDA 2LE0A 1MENA 1XXHB 2O5VA 3PC8A 2OT3B 2PA0A 3PB3A 1B8NA 2G67A 5DYYA 3TB6A 1CLEA 1H8HD 1OGJA 3HCNA 3L7JA 4Z9FA 4YP6A 4NCHA 3JQ7B 1J7KA 4IV5A 4LKRA 1JRLA 2FW0A 2QR3A 3HR4A 3O2SB 5AKZA 3B6IA 2W6JD 4AZVA 4D3XA 2D5CA 1E2PA 2B92A 2VOJA 3CLUD 1SUSA 2Z1MA 1XCOA 5EG5A 1IEXA 3OUTA 3WIBA 1U80A 3ZWYA 4FWBA 1KI2A 5IULC 4AKGA 2EAUA 1J0DA 1R0RE 1BHQ1 1G6KA 2CNBA 2H3HA 3ICOA 5GM2A 4CLRB 4Z7NB 1QIMA 3G82C 1KL7A 3PLRA 5IK2A 5LQRA 4MW4A 2Q28A 1JP7A 1SRRA 2CMFA 1P1RA 1YZUA 2X8WA 3LHSA 5HIAA 2CZGA 3GGJA 1T6BY 2C96A 1L7VC 1AZLA 2JFWA 5T3UA 5CBPB 3CVXA 2C8VA 3WA6A 2QZSA 4NBVA 2C4VA 2VATA 5A6SA 1XZHA 5B5SA 2OHHA 2DTDA 4KR6A 1ZITA 5HP4A 1AB5A 4I6EA 2V4ZA 4QUAA 3OX1A 1D9ZA 1WEHA 4QREA 5J40A 4OHZA 1IONA 1TAQA 1A8SA 1N0HA 2BZGA 1Q83A 2QV7A 3GB9A 4MPRA 2XQJA 5AI0A 4KCGA 1JVSA 1LBEA 4W8GA 1T5LA 4YH1A 4EYGA 3IAM6 3V1LA 4US2R 5JY1A 1MFPA 3W9UA 4XVQA 4DQKA 8ABPA 3DGFC 2W8BB 4COKA 3WBJA 4RETA 3U44B 1XLUA 2ILTA 5LMCA 1IIRA 3T7SA 3EFEA 4YUWA 1Y7IA 2PMFA 4V24A 1WCYA 3NHRA 3WDSA 2PUAA 1RKQA 3BGOS 3NX4A 4L4XA 1Z2OX 4BMPB 5F2NA 3A9TA 1JKIA 4TMFA 1Y5IA 2HM7A 2I4RA 2O2DA 5KI6A 5MDHA 1Z35A 1ZW6A 2J67A 4TS9A 2I76A 5K0JA 2HJWA 3FLBA 1HMYA 2XTMA 5JMPA 4Y2HA 3H86A 1QP8A 2QNIA 1C2YA 3QGMA 4LSGA 1JB9A 3NGXA 1AKRA 3ZVRA 1JIVA 2I2WA 5DWDA 3AZPA 4ML3A 1I24A 2PZ8A 4OMFG 4PV7A 4I3HA 1XC7A 2WABA 2YOGA 3L02A 4C0HA 3MHTA 1UOQA 1T5IA 4Z99A 1YJ5A 3F78A 1U81A 2IKQA 3AFGA 4U2KA 3GCZA 1NI5A 3G0DA 4ZICA 3FYUA 3LDHA 3QELB 2PWAA 2GJAA 4GYJA 2DJIA 2R1TB 4XQEA 2ID8A 2ZIEA 4LMAA 5HUQA 6ABPA 1ZDMA 4R8RA 3AR5A 3R5JA 3RSFA 2FWMX 4F71A 5BV7A 5C1PA 4YX9A 2Q6VA 3KFLA 3K32A 3RSCA 4V02A 4EHBA 1J8FA 1NFQA 2A9KA 1EVYA 3H8WA 1MB0A 2VFAA 3NT2A 3L05A 1LS6A 1L3IA 4CIYA 2XYQA 3HXMA 3GPDG 5HKBA 2GLUA 1QWSA 3U5ZB 1Z37A 3NBMA 5JJIA 3V97A 4ZN6A 4MS3A 4F3YA 2JBHA 3N2KA 1UM8A 4RE5A 3TTSA 1ZGGA 4HLNA 2UVQA 3DL4A 4A10A 3NV7A 4JI4B 3R4CA 3OPVA 3P2YA 3OE1A 1QFYA 1DG1G 2A3NA 4JITA 1SMKA 2MR5A 1YVUA 3OLWA 3LCVB 4OYHA 4P32A 4DEYA 5G2OA 1H6BA 1T4GA 2PWZA 4DMKA 3KJZA 2ATIA 1P4JA 1EVJA 4XJTA 3OZ7A 4QBHA 1ZD8A 3TM4A 9LDBA 3IBSA 4QU8A 2D06A 5DNAA 4MP8A 2C9YA 2XB9A 5D51S 1QVRA 1TGVA 2N0SA 2QTTA 2GKSA 1AN9A 1Y5RA 1L6RA 1K4KA 2I78A 2R2GA 4H6VA 4PSUA 1OWMA 1LJLA 4UVGA 1R6UA 5D1HA 3B1XA 1N5KA 1RXIA 2H5IA 2GPJA 1Z28A 2NPFA 1QIFA 2QTWB 3D3KA 1XR3A 1DT3A 4UTXA 3E82A 4FCVA 4Q4HA 1QR2A 5HFJA 1HT3A 4POOA 4GNRA 5DGCA 5SV2A 1HQCA 1ZGHA 5A3SA 2GFQA 4HGQA 2HXYA 3LZ6A 4HUJA 5AT1A 1G3UA 1BH2A 1CJMA 2DULA 2FZGA 4V2IA 1D1SA 5CXUA 4QEDA 4XWAA 1I8TA 1NOIA 3JZDA 1V8DA 1PV1A 4HDMB 5FBWB 3RSZA 4LC9A 1G41A 5EPUA 6YASA 3ZU3A 5HWSA 5GY7A 2Y0BA 4G0UA 2I91A 5KHOC 2BE9A 1O08A 3BF8A 1ZOPA 3CEJA 2RDMA 4KXWA 4ER5A 1JSLA 3MK31 4RC9A 4ZOBA 3W2GA 4Q7QA 1WD5A 4AN4A 1AQ6A 4RYDA 1ST2A 1QCCA 2P11A 4UHFA 5AHWA 1TTTA 1PFVA 2YZKA 4PY2A 4P36A 4RD3A 4FCCA 1HWYA 1FLNA 4F72A 2WWRA 2XRMA 3D02A 3DFMA 3RANA 1WAMA 2FQ1A 4TV9F 5IM5A 1L5ZA 1YE8A 2Q5OA 1KEPA 1ZN7A 4KBGA 3ZWWA 1F06A 1K8ZB 3UHPA 1CSEE 3SG0A 3OCUA 2IYXA 3KOWA 4U2DA 4GSYA 1NXWA 5BY2A 4LJYA 1Z0UA 3WXBA 2JC3A 4P33A 3I5UA 1WUJS 3N3BC 2YUIA 1N1EA 2PBFA 2PSHA 2O52A 1WUYA 3O8BA 4LNUA 4U02A 4BO9A 1ZR4A 3JQ8B 2ANBA 5AD1A 3ICEA 5K5EA 4JT2A 1IUNA 3IMFA 3PTAA 4ZCMA 1M72A 4Z4FA 4JUCA 1DHTA 3G2NA 1YI8A 3OX2A 4OPMA 1Z26A 4EJ6A 1L5RA 3TW6A 4PSAA 3IDOA 1UJBA 4S12A 4L8WB 5IKOA 5TMPA 5LMNB 4ZIRA 2IH2A 3UZUA 5FV4A 2KE5A 3F3KA 3FSGA 2IODA 3DE6X 1FP2A 2NO0A 3D8BA 5ALHA 1HSZA 3ENKA 1GWNA 5GOZA 4ZDWA 3AF0A 3UJ8A 2X4IA 4F4HA 5KQMA 3FE2A 5BW6B 4J03A 4UOZA 1E5QA 1D1TA 4MUJA 1AX9A 1EX6A 1JQEA 2HO5A 4LJSA 2ORED 4MS3B 4NESA 4B6QA 2QMZA 2YZMA 5K7SA 3UGKA 2J3DA 1MIOA 4LOJA 3T5GA 2QTLA 1YL5A 1JHZA 1JR6A 3TLKA 3GOHA 2DFKB 2O0HA 3NC4A 5GQSA 2UV8A 1NDHA 3WV5A 3GJYA 3C3CA 1AS0A 4IO1A 1D04A 1F12A 1OOEA 2XMPA 3NJ4A 2H92A 4YRNA 3DMTA 4WVLA 5EJ2A 3SR0A 1JIJA 5K4HA 4PNHA 1W2WB 1TQ6A 2X1MA 1SM4A 1FX0B 1SHJA 4PGGA 5D3QA 3P9RA 2G83A 1N2CB 4B81A 2FVXA 4QXQA 2V8BA 3HZRA 3DVRX 3I23A 1L5VA 1ISIA 2Y4NA 5BW4A 1U0RA 1KEVA 3JQQA 4KTVE 2RAUA 1K5PA 4ALIA 3LC0A 1YB1A 3ZWOA 1N1GA 3T9DA 2J1LA 1QHIA 3INYA 4PQEA 1PFQA 4GOLD 1BYIA 2B36A 1FTWA 2RKWA 3UXMA 5HIKA 1VMKA 3GCXA 3ESAA 2OGTA 1G55A 4QPJC 3TR6A 5CFRA 3WK6A 5F7ZA 3QF4B 4O3FA 4BN5A 4CMEC 5AM3A 4CKEA 1HTWA 2VT7A 4LRYA 3HB9A 3ELUA 4F9FA 1O7JA 3CUUA 4FSHA 1TPYA 2RH4A 3O8LA 1ZONA 2W83A 4AJJA 2FDCA 2QKYA 4B09A 5CFPA 4EJSB 3CH6A 4TSRA 4M49A 4B7CA 5CM2Z 4DKXA 4JY7A 4RQAA 3MWKA 4ZT4A 1YJQA 2YTZA 1ZUWA 1IPFA 2VEDA 3GFPA 1KYIA 2BTEA 1NBME 4NEGA 3V8EA 5L6MB 4MS4B 5BT8A 3D54D 5HFNA 2PVSA 5DXFA 4FDUA 1T1GA 4O4JF 3N2NA 4EGCB 3NGLA 1LBHA 1RIIA 3K9BA 4GL4A 3QSYA 3DTVD 2J9XB 2O2XA 1OF1A 5BW8A 3TR5A 5DOZA 5AKYA 2BGMA 5AW4A 2IYQA 3WK8A 6NULA 2F3RA 1HT0A 5EKSA 2OFPA 3N87A 5CJ2A 4D92A 3JYPA 3HJFA 2WTBA 4OXYA 5IBPA 4U6NA 3KQVA 4H0NA 4JI3B 5IW8A 4CM8B 4KSCA 1H2FA 1DLIA 3O4RA 5BPHA 1QRSA 3FNBA 3V3TA 4GE0A 4IOLA 1NBMA 2D0DA 4W5TA 4GXQA 1WOMA 2VNSA 4DMFA 2C3YA 4DB2A 1SKYB 3WWCA 4LRXA 2A67A 3WFJA 1GV1A 2AG8A 4AF8A 1NTRA 4YDRA 1HLDA 4RW0A 3SKYA 4FYKA 2FW8A 4PSCA 5B6PA 2XCUA 5DN6D 4JB2A 5LUBA 3ZY3A 3EIXA 4TSKA 3B53X 4TXHA 2B8JA 3LOUA 2JI7A 5DTJA 4CQLB 1O9GA 5LXTB 2QTGA 1RWOA 1JJFA 3L01A 5IVDA 2Q5EA 4YRSA 4HFRA 1VIAA 2IUUA 1PJLA 4RZIA 1FXWF 2CNWA 4YV2A 4DFDA 2JJQA 1GZUA 3NP7A 1XCJA 2JGDA 3OZSA 1SXIA 5G0TA 4PZEA 5FNVA 2WJ4A 2G1JA 2EZ9A 2G0NA 3DOCA 3IVXA 1E3WB 4FP9A 2VWHA 2HCRA 1KDZA 1TKAA 3U1BA 2BKXA 2FR8A 4FFLA 1J56A 3PQEA 4J2TA 2GERA 3O74A 2PS3A 1Z29A 4UBNA 3OWOA 4NABA 3EDMA 2AL7A 3A6HA 1JECA 4JOSA 1KI6B 4Q1VA 4BO2A 3AEQB 3KD2A 3SIXA 4C7OA 4GC5A 2YWXA 4YRQA 2NW6A 3HDGA 2OV3A 5EP3A 4K81B 3OF3A 4QU0A 3ZQ6A 4O2BB 1PFGA 1Z8NA 4UVDA 2CYAA 1G3IA 1GUDA 4XXHA 4YRMA 2DHDA 1WU7A 1Q0LA 2QLFA 3VSAA 4EY5A 3ER8A 4G4SO 1MGPA 3U37A 1JFFB 3QUBA 2C4HA 3R3XA 1D2NA 1B93A 4TMWA 5AKXA 3QSGA 5C1BA 2V9CA 4Z51A 3ZWNA 1Q1AA 2HMWA 1MVLA 1RVDA 5HILA 1IULA 2RHGB 5J59A 4CG1A 4CL8A 3VU9A 4WKBA 2PKQP 5DU2A 5B1EA 4NYMR 4ZTBA 5AVUA 5TGTA 4TQGA 5IH7A 4QU9A 4ZYUA 1T8RA 1YGPA 3AY7A 1NNEA 2WDZA 4PRYA 2W42A 1AO3A 1EXNA 5LXTA 2OV2A 5J4HA 3BAFA 3UCFA 1H2ZA 1YOVB 4N0QA 5L51A 1NONA 5CVJA 4DXDA 3D8SA 2ZJ7A 2FVYA 2GETA 1KGSA 4G4GA 3ROGA 3KQWA 4BLWA 4P4GA 1IHPA 4DRZA 3QU2A 4F1JA 1K5GA 1QYIA 4QHSA 2BBSA 1QPBA 2X9QA 3HUFA 2CHGA 4BNWA 5ICMA 5ITZA 2X0EA 5EMHA 2QZ9A 2BCJQ 2WJWA 3NOXA 4YXWA 4NV1A 4OL0A 3WLOA 2JAWA 2VJMB 4EL5A 4KO2S 4TTPA 1A8UA 1WKVA 5FB3A 4UOEA 5ALRA 4MUXA 3BKXA 1XZPA 4EI8A 2EWWA 2H06A 2JFPA 3QRWA 4KH1A 4WZAE 1YCHA 4OATA 1YONA 2VR1A 3AHGA 4JEMA 2FEKA 4JGIA 1JSCA 2DBRA 4OKNA 5E4JA 4UFPA 4W5OA 1CDDA 2IOQA 2PUCA 2Q8PA 1ZNXA 3EXHB 4ON9A 4DILA 2O7QA 2P4QA 3ACDA 3R6TA 3S29A 3UWOA 3V1KA 3SI7A 4MVJH 1YQ9A 2CL5A 2GPAA 2HYIC 3GMDA 1TNDA 4E4RA 1DIGA 3QXHA 4R1TA 4EUHA 1JEOA 2PKXA 5DHRA 5HA5A 1DEHA 1SRQA 2N75A 1Y9AA 1OAAA 3AR8A 4R31A 4UNPA 5CH3A 3BJZA 1ACLA 1YUBA 3O8DA 5BWMA 1O6GA 4KR2A 4D0NA 3N9IA 4J0QA 2HTFA 2JDIA 4MYTA 4FOOA 2P9ZA 2B4AA 2NSJA 4ITRC 2A35A 4X24A 2X5JO 1OZGA 5FHQA 1DUIA 1Z68A 3VUEA 2RBGA 1SVIA 4OUDA 4HEHA 5D3MA 1U3VA 4RQUA 1G8SA 1RAHA 4HNAB 1NXTA 2GTIA 3LXMA 3MHPA 4CE6A 3LPAA 2J7PD 2MMCA 1UFVA 1VA5A 4KV7A 2BKLA 3KB8A 4EFKA 1N8NA 4GS5A 3QVOA 4Q66C 1X70A 3WGOA 2ZDHA 4B7UA 1LCIA 3QVVA 2BBOA 1UMCA 5LA6F 4J6EA 2YXEA 5KU7A 3A3OA 1SGWA 1Z62A 3HJNA 2ZJ5A 1CIPA 1SU4A 2R1UA 5E4YA 3GNLA 3THWA 1ZJWA 4IXMA 4L3VA 2JI4A 2ZVPX 3G2MA 5CH5A 4MQEA 1Q0QA 1ISFA 4NAHA 2NYRA 2VZ0A 4I7EA 1CQPA 4UTZA 3KUKA 4ALNA 4MP3A 2X9NA 2F9LA 4UZSA 3HB7A 4JT4A 4G85A 3PEVA 4KYUA 3TL6A 2IY9A 4CQJA 2FMTA 1XU7A 2D7CA 1B0AA 4WFKA 1TEVA 3PGVA 3QPAA 3CQ9A 2ZJ2A 2Q7DA 2C3UA 3IEVA 1DTEA 4PO1A 3ISVA 5CMLA 4M8SA 1NQUA 5BPFA 2VQFB 2UYQA 3KQHA 3E3AA 4I4CA 5BQ3A 1QOZA 1VECA 3OA0A 4Q93A 4KVFA 1JMVA 4TKUA 2YHSA 2FN9A 1RVV1 1U3TA 1N7JA 2OCIA 2BGJA 2HSDA 3HP4A 4IFEA 1MJGM 3SFVA 1ESMA 4TYMA 1N6KA 5HOQA 5BRNA 2PBLA 2XGOA 1MRZA 5KVQA 3VNRA 1TKRA 4DEVA 3NM4A 5JSKA 3OX3A 3PA6A 2R86A 3GA0A 4KBFA 5F73A 1TL7C 2VG8A 3R76A 4NYJQ 1E4OA 2AR0A 3RVOA 3KQOA 1JVNA 3RSQA 1EUDA 2EJTA 4DLSA 3N1UA 5H0IA 1ZRMA 3GAFA 3KV1A 3MILA 4XIGS 1L7NA 1MT3A 3M3DA 4YQEA 3TNYA 4CKWA 2JI8A 4INAA 1J6UA 4IWXA 3ANTA 1OFUA 1RMQA 3H16A 4IZHA 4KYTA 2F1RA 3B1ZA 3LL7A 4MV1A 3SK0A 1THMA 1SCBA 4AY5A 4G9EA 4P38A 3BT7A 5LLSA 2PBRA 3DHEA 3MS4A 3CX6A 1UT5A 1VYUA 2R00A 2XT0A 3U39A 7REQA 4CG3A 1WBDA 1RLUA 4RULA 1HQDA 2WHRA 4HRXA 3VMMA 3WKCA 1JHRA 2CUKA 3V9AA 3MOSA 3GJ7A 1VCIA 3AYXB 1Y4UA 4BFTA 5BV0A 2FETA 3PDCA 5HIIA 3ZZMA 3O75A 4ENPA 1IK6A 1E2DA 1W94A 4YCSA 2DT8A 3NBYC 1O87A 4NV3A 1C7RA 1RWXA 3CCFA 1EDBA 1IJFA 1P0CA 5KYTA 4IIYA 1PNTA 4Y2QA 4L0CA 3A6DA 2JCGA 4MB6A 3UB3A 5I8PA 3HTXA 2JEOA 3RTCA 5DM70 2XYGA 1LW7A 4IQ0A 2H2DA 4IHKA 5JAHA 4C2UA 3P71T 2Y6UA 5HKLA 1YQUA 3PNLA 2DAPA 4HQNA 4KX5A 4HCJA 3OIGA 4RJIA 4BKUA 4EA9A 1L9KA 5A5FA 3IQDB 2XVXA 4TL6A 5HUHA 1GSOA 4LNHA 3RI3A 5JTUA 4QEZA 4G0XA 3RTGA 5F1OA 1LLCA 3P5SA 5DBOA 4D43A 5BV8A 3ZWQA 3C3BA 4MZXA 2FN4A 3DLCA 2QRHA 5ER6A 1J8DA 2A57A 4HGNA 1HT2E 2CFSA 5EE5B 4FBMA 3GH1A 1WNTA 5JARA 3LRPA 3EPKA 3IQEA 2WD7B 3P9YA 2VDKB 2I2FA 2DSNA 5LQUA 2OM6A 2Q3LA 3FX2A 4LX8A 2NYAA 2V0NA 3HWX1 1VIMA 2CSUA 3KELA 4YC7A 3DCYA 2NX2A 1CR1A 5GJBA 1IZ0A 2P9HA 1K1EA 1B0UA 1P0FA 2H16A 1NSTA 1Y42X 2RGXA 1II9A 2ODPA 3DCJA 3OOYA 4OQFA 1C4WA 2DQZA 1P9RA 5TNXA 4IG9A 4ALJA 4A4DA 2CXTA 3GFVA 2UYYA 3PXGA 3G68A 4LJKA 1NLZA 1VJDA 2A4MA 4UKDA 1IZ8A 3ZE0B 3KD3A 1ISSA 2I03A 3N6XA 3OJWA 4KQJA 4EITA 1V7PC 1CQJA 2ZWOA 1ORRA 2R97A 5J47A 1OZ0A 2YY6A 3RWBA 3DJFA 4FOLA 4C88A 1C3JA 3ZDAA 3NIWA 4XE5A 4DYVA 2P3OA 1Q7GA 3Q88A 4X1KB 3OJCA 4ZKEA 1AZSC 1FFHA 2FPRA 3NVDA 4KFUA 4WEQA 2NXCA 2CD9A 3HBLA 4QOGA 1PVDA 4TWJA 1O6ZA 3JQ9C 1Y82A 4HNVA 3IOBA 3NBXX 1JTFA 3A3PA 3O1JC 2NQ2C 2FF7A 3PR1A 1BXGB 5ECYA 3AHIA 3LY8A 2ZE7A 2GD1O 3ABIA 3CPEA 1L1EA 1OWNA 4IXDA 1CKEA 4E1BA 1KPIA 3DBLA 3OFNA 5EY5B 1LPBB 2CNLA 4IRXA 5KJCA 5BQOA 2EERA 5EIAA 3AZQA 3HO8A 3B20A 5BQ5A 1PJ2A 3NTQA 4KLCA 4DBLC 4H7KA 3PC6A 3CE9A 3ZXXA 5JNVA 4NE7A 2F3PA 2HJVA 5JY6A 2CLKB 3EQ8A 3KUXA 3ND8A 1WW3A 3B13B 1GRRA 3SIPA 1BMDA 4GW3A 2ZUSA 4JVNA 1W44A 3WGUA 5EJIA 1NW9B 3GT7A 4CMBA 5KNBA 4LXTA 4JD5A 4ER0A 1YZQA 2PPLA 3EVAA 2Q5CA 2ZJ8A 3UN1A 1UZLA 2YYYA 2XB6A 2ZUWA 3DV0A 1SVUA 1VI2A 1YQXA 5ULLA 4RMHA 3MCTA 3VYUB 2OBLA 4ZRNA 1BO6A 1J4AA 2EFGA 2V1XA 3H5AA 1U8FO 4NE2A 4X1YA 3ZWXA 4AMVA 5EE1A 5G1OA 3CUVA 3C7KA 1PZMA 4FS8A 2WJ6A 3NJ8A 2X5NA 4QA9A 1GKLA 3C97A 4KO3S 4YMIA 1ZAYA 3G0CA 4EKIA 1HF3A 3KXPA 3N70A 3QEMB 3QMWA 5LB4A 3UPDA 3WLLA 2W6QA 1YIAA 1WSDA 1J5XA 5IJXA 1BDIA 2B7LA 2PGAA 4DQLA 2WJYA 4S04A 1PT8A 4YDHB 5KNLA 5LMUB 5JI3E 1A27A 2I1VB 3HVKA 4DV1B 1KPGA 3TOXA 2PGOA 4CW7A 1SHTX 1TD1A 1EX1A 3L8GA 4CEHB 4CTKA 2WF5A 3QX7A 4IH1A 2ZRLA 3PDHA 5EOVA 4H3HB 1NXPA 4OREX 1RCFA 1VKZA 2YBDA 3FFXA 2OHIA 4NTZA 5BNIA 5IABA 3TQFA 3U49A 3D6TB 5JH7B 4E1VA 2C5GA 2BFNA 3LU1A 1YR7A 2ZYUX 3CF4G 3KXDA 1V5FA 3R3WA 3R7BA 3T5BA 4OBBA 4N8EA 4QDXA 2W7TA 3P9SA 1B3BA 1QKKA 3QQ5A 5B1SA 5T64A 1SHKA 3ZE6A 3KOMA 5B6IA 5EJ7A 2POCA 3F97A 3RCBA 2F55A 5H1YA 4J07A 1R0KA 5PGMA 1OXBB 3H5VA 3TRIA 4FHDA 3AT1A 4KQ9A 3OLZA 1JWBB 2YXPX 3TI9A 3VX3A 3KOZA 1II0A 3NALA 5AW6A 1HEUA 3IUBA 4US0R 3TYXA 3IEMA 1SXJE 5EXTA 4H7PA 3W1EA 1U8YA 3OE7D 4MW2A 1WSAA 2G70A 3KX2A 4L0DA 5JAOA 3FGNA 4P4SA 4UPVA 2O3UA 2BEUB 2O0LA 3LECA 4YJ2B 5KCMA 3WV4A 4LXYA 5BR1A 1NVMB 4H3KB 3REFA 2A92A 3OQMA 3AJAA 3RJZA 3OZFA 4PVCA 2GASA 4JLNA 1KIFA 1RI4A 2GKGA 2ZR7A 3GT4A 4RIHA 1TO1E 4V0ME 5COAA 3Q1KA 2WTMA 1U0TA 2EG9A 4HLUC 3S6JA 5DNEA 1MO6A 5FBQB 2XKBA 3DOOA 4JI1B 2G9RA 5BR7A 1MB9A 2XUAA 3EBLA 3HYRA 3T15A 4CUKA 2J9YB 2C2WA 4MKFA 5HFAA 2Y9MB 1GA1A 4D3ZA 2WDPA 4BTEA 1JDZA 2Z0MA 2O19A 1XP5A 1CQIB 3EEQA 4FYVA 4QDUA 5EL0A 2QG4A 3AUSA 5H4HA 4I99A 1NVVQ 5LOVA 1O89A 3FROA 2QJWA 3V2UA 4C4XA 4CM4A 1I10A 1U2DC 5BORA 2BGLA 3PD7A 3W06A 2E2WA 2JZCA 5IF9A 2BPOA 5I7FA 5I4CA 5KPJA 2CXUA 5CIWA 3IDFA 4IDPA 1LUAA 4FM9A 1OA1A 4I4TF 3MWEA 1N2HA 4JZYA 3V7WA 4LGYA 1IPEA 2H0RA 2I3GA 3A1TA 3GDWA 3HWWA 4M46A 4RXUA 3ZHZA 4BB5A 2NTYC 3IKLA 3BICA 1SELA 2QHXA 2XNDD 3TLMA 4CM1A 1MH1A 2VCEA 1HDEA 2RHCA 2GVDC 1E6UA 4O2BF 5DHFA 5JO0A 1ETHA 1KVQA 1AU9A 1TJ4A 3Q9SA 1UF9A 1XTIA 1Y8CA 2A0UA 1XRPA 4F92B 4ZO8A 1LNZA 3AOGA 4MQMA 4OGWA 1DKMA 3OIWA 4MLDA 2QJTA 5H16A 3OSUA 3TW4A 5CFZA 1X74A 1CEXA 3IPAA 4L1KA 5L3ZA 3V7YA 1D8AA 1GTMA 1RQGA 1YQWA 2LVBA 3B60A 4HAIA 5FI3A 2J0UB 3K1YA 1HETA 5KZMB 2XGSA 1HC7A 1UFRA 3OZTA 3QYAA 2JIOA 1WXFA 1WUIS 3RSSA 4MULA 3KSBC 2GSWA 4P1ZA 3L7NA 1GRQA 2O2CA 5EE9A 2VF7A 1BX1A 3RAGA 1H0SA 3KSUA 1XNRB 1DC3A 1HUQA 1WBJB 3O3MB 5FADA 1O0CA 4CF6A 4LHSA 4XWYA 4M0CA 3AF1A 2WZQA 1EJ2A 1AHIA 1D07A 1PT9A 2RK3A 3RYHB 4PR0A 2WUVA 4JQCA 2O3JA 3CJQA 1GOTA 4JOQA 3JQFC 1JHYA 3SLGA 2H2AA 3CSUA 1IEVA 2WEKA 5H68A 3PRJA 4YASA 1I80A 1UPAA 1Y1QA 2PO5A 3ZD7A 4YGYA 1X2EA 2ZZKA 1U5CA 1ONSA 1RM0A 1H2HA 2I2XB 1EB8A 1JI3A 3DQZA 2JZNA 1JQAA 4UNIA 5HHTA 3RS7A 3DV0B 3HWRA 4O63O 2GZ2A 4JYCA 4U7GA 3JXEA 5BOSA 1Y5NA 5CD9A 4OIFA 1GLGA 1FTGA 3OTQA 3WL8A 1YA6A 3T5DA 2J87A 2VZ8A 3UT5A 4DLPA 2YQ5A 1YI0A 3TO5A 2GAJA 1WVGA 1E2HA 4QBTA 2ZUEA 3AERB 1U7TA 1L5NA 4XUDA 1E1YA 5HF9A 1ZL2A 3Q5GA 4LHXA 4JUAA 4F2GA 1F60A 2VLIA 4DJJA 1M34B 1VG0B 1V5GA 5ITZB 4GKKB 1PNOA 2XUDA 4DJAA 1A0OA 3U4IA 3EY4A 3T41A 1DKPA 2TRSB 4K6OA 4YEDA 2DWQA 5DYWA 2VEOA 4JC5A 3VPBA 3HCRA 2O06A 1W96A 1E58A 2Z8YA 4B9AA 2O8BA 1IOZA 5J5AA 3SSMA 2QI9F 3CLKA 3CU5A 4AZWA 1U6KA 4EW3A 3E18A 1A72A 1L1RA 2H00A 2PM8A 4AG5A 4LF6B 2X7HA 1IDN1 1TXGA 4DV4B 3COYA 1U8TA 3TQTA 3FBTA 3ZZ1A 2JD1A 3MUOA 3O5AA 2Z43A 4O2RA 4TL7A 3CT4A 2YW9A 5ITWA 2QIPA 3N0XA 2PKCA 3WGMA 2BFAA 2QRMA 2J07A 2XQVA 3IIIA 4X6LA 1P72A 3X2FA 1DV2A 4DNXA 4RM2A 3OJ0A 2W8ZA 1P4RA 1SG9A 4IHAA 4MVJF 2BI7A 4RF3A 4RLQA 4YGXB 5H70A 3UH0A 3VZRA 3RBAA 3WG9A 3FF4A 2WG0A 2NVUB 4AKTA 4QQ8A 5DLEA 4BEWA 2PZBA 3TZKA 5AP9A 4ZEVA 1R5JA 1WZIA 1HK7A 1Y98A 2VPTA 2V4UA 2HREA 3L06A 3HCWA 3ROZA 2EJUA 2F3UA 4R0NA 4RCVA 4BV8A 3MA0A 1JDVA 4MQ6A 1Y1PA 3WLFA 3HZHA 4MW1A 4A91A 4ACBA 4YUAA 5IT5A 1LGYA 1PS0A 5CCEA 2YIDA 3JVUA 2AYYA 3VHLB 3BULA 1C4KA 4UMDA 4X20B 4FR2A 1M8FA 3C2QA 3QE2A 5HKKA 3V80A 2NXJA 1ICEA 2GBGA 3I5AA 3FUWA 5EIHA 1VMAA 2QTFA 3GCWA 4PZ9A 4X8HA 1AQJA 1Q15A 2MYNA 4AP5A 2C2XA 2FHSA 2D0IA 4EJ0A 5EGNA 2O50A 4R83A 1K63A 2PLWA 1NPTO 1V96A 2HF7A 1SQSA 4OQXA 1N6IA 4YLGA 1PYGA 4BFYA 2ZBPA 1YQEA 1Z15A 3DZBA 4K8RB 1M6WA 1EAMA 1JPNA 4ENRA 3HNPA 2IU4A 3P9CA 1ZHFA 4R7GA 3S1AB 3TG2A 3LL4A 1UBTS 4NR0A 2X0DA 2UZ3A 2KM1A 2VHVA 3EX7C 3A26A 4U8HA 1L5FA 3NHUA 3T0IA 2DQYA 3A4NA 1T4DA 1A2OA 1DBIA 2KB0A 1HRDA 5FNVB 3TMKA 3STWA 1Z4MA 1QYXA 4PX3A 4OUKX 4WD3A 1X1TA 4OGFA 2VAVA 4JYMA 1L5YA 4EB6B 5ERYA 3QKUA 2P79A 3C6QA 1WSBA 5IMSA 3MAAC 5JRJA 1OROA 4LUCA 3EJ6A 3SXPA 2RBKA 4G1EB 4CDGA 3LW7A 4F4DA 1BVYF 3LBNA 1ESZA 2R84A 3I9V6 3KKNA 4BLRA 1X94A 3C6BA 5ADVA 4CL0A 4WI1A 7ABPA 2GHTA 4M2LA 4IO0A 2OAEA 1GPH1 3MYRA 4LMPA 5DB4A 4ARBA 3N59A 4ROTA 3P8ZA 4YK7A 2VYQA 3BZWA 4YI3A 1KR2A 5AXCA 3L49A 3GLFE 5KNCA 2GPSA 3F9IA 3OT4A 2FR8C 1MABB 3DE0X 4D8YA 4TTAA 1H3EA 1EUCB 2V6FA 3QBTA 4UCWA 3U9LA 4DLWA 4E7OA 5IFLA 2ZE5A 4Q9NA 2RGBA 1GPYA 1RYEA 3A3YA 1NQVA 5L7YA 1OILA 4OMDA 3I6ZA 4NPHA 3CB2A 3WE7A 4FFOA 4YMVA 2WQ7A 4N9QA 4NE9A 4XDYA 4EW6A 3B6ZA 4ZQHA 5EWJA 2C9OA 2RGDA 1AUVA 2XQIA 1FP6A 4YRAA 1VE1A 1OR8A 3B89A 3CX7A 1RJEA 1I9CA 2JFZA 5KQPA 4KR7A 2VI5A 4OJYA 1EUZA 2C98A 4QNMA 3IUQA 2LXNA 3G2HA 3RO7A 5AI6A 4K9SA 4Z2YA 3MCZA 4UNSA 1OJLA 2LZ0A 4KB5A 1Z83A 1D4AA 3P97A 3LGSA 4QDTA 2ENUA 1LLQA 3GEDA 4MI9A 2VJMA 2XQGA 3FUVA 3LBIA 3HWSA 3U3RA 4RAQA 2P30A 3D8UA 4IGEA 5JJKA 2I1LA 1F7UA 1QLWA 5HKKD 4LRTB 2C9ZA 1FVHA 3AF4A 3M5PA 3LT2A 3QVGB 3RRBA 2BH2A 2P41A 1VRVA 1V1MA 4NCXA 1YQQA 2V6GA 5E2IA 5ABPA 1EWVA 5IBCA 3RSLA 4Y9TA 1J2JA 4PBTA 1U04A 1QE5A 3GXOA 3TG8A 3EXG1 1T2EA 1UXKA 2I4OA 1S8FA 4WOCA 4K3UA 3ESBA 3T6KA 2D4HA 3TBHA 2GAIA 3AWIA 3TINA 4URWR 5DIZA 1CZHA 4RDXA 2XUJA 1OWPA 2GNOA 4ZARA 1E3DA 3H0KA 1G42A 1M66A 3L04A 3WMGA 4RA6A 2Y1KA 3VNQA 4C2TA 4MV8A 5TRTA 1QWOA 1VOTA 1E9EA 2FZLA 2WAAA 2RB4A 4O4HB 1Z4JA 1PZFA 3SC4A 3COVA 4A9AA 2WWTA 2IZ1A 3L4BA 4DC1A 2ZB4A 1NMQA 2KPOA 4IEEA 1H2YA 4X95A 5CJJA 4ALKA 3KLNA 4A27A 2BFWA 1P3Y1 2HJSA 3HCOA 2QRJA 1EIWA 4O25A 1A4RA 4ND1A 3O9VA 3QXXA 3ANLA 3NWPA 2AEFA 4L50A 4HZGA 4D46A 5J63A 2ZIWB 3BK7A 3L07A 5JCZA 3HP1A 4Q7MB 3W6UA 3EB9A 4R3UC 1G2PA 1QK3A 4EECA 5JSQA 1GKYA 3MW8A 4HI0E 3FRJA 4UOQA 1HFKA 3DDNA 2WIAA 1GNVA 1Y1LA 3S70A 5ALQA 1GTSA 4MQ5A 4DUZB 4B40A 4E5MA 4HLDA 2YNMA 3IAAA 5A5GA 3O2JA 4HMOA 1Z16A 5CVDA 5E1MA 3CZRA 1O6BA 4QX6A 3QU4A 4B73A 4XJVA 2DPXA 1S2GA 1A9XB 3HKDA 4Y0AA 4DCGA 3J7TA 2B82A 3SX2A 1WPRA 4IMJB 3Q2OA 5F7JA 2WHPB 3NNNA 1OXTA 2OFOA 4TZ0A 1C7JA 2J7KA 2PUWA 3K8ZA 3DMTC 4GRAA 1C1XA 1J06A 1QV9A 1QRRA 3D0RA 3GBPA 4UVIA 1YO6A 2PG3A 1SQ0A 1TM7E 4B3BA 4IVPA 4PQFA 4DOMA 4AT1A 2R7NA 3CVUA 3KO8A 2HU5A 4FUQA 3UATA 5HUJA 4XWWA 1LRLA 1JR3A 3AGPA 3K0SA 3L41A 4ZT2A 4DMRA 3RGWS 3JD0A 1G5TA 3N2ZB 3SFZA 5K0EA 1N6PA 5KSYA 2F8LA 2CUTA 4PGMA 4DCJA 2FXVA 1RAEA 2RGYA 3I30X 3QLUC 5ITSA 4UHHA 1SXJD 1X7YA 4EA7A 4G01B 1QVVA 4AUMA 2J4FA 2R1VA 3G0OA 4UBMA 4AYXA 3UJNA 2PSSA 3HZZA 1Z7EA 1KI1A 2ZATA 4J43A 4JP5A 3RBXA 1SOUA 3ZY2A 5BWCA 1YB7A 2JVIA 2VUIB 3DFFA 5F2KA 4I5DA 1APBA 5GONB 4CI9A 1Z3IX 4QYWA 1AS3A 1L4MA 4F6LA 2HQSA 1S3SA 3Q2KA 4TPKA 1E1KA 4TVOA 3I9NA 1GGEA 1VM6A 4FW8A 4XFJA 4ZOAA 4OSOA 1JFLA 4RCZA 1VBNA 1PL8A 1PE0A 2R6JA 3DAYA 4Y0NA 5FTMA 3T5TA 1MVOA 1XWWA 4MTCA 3BTUA 1A3CA 5BVHB 3V4OA 3L8ZA 2WJZB 2V6MA 3ZJTA 4GEGA 2AXEA 4BLSA 3K09C 1NNSA 2NSDA 3F6PA 1INLA 4KYIB 3DXXA 4MWCA 3U7QA 3RC9A 1OSNA 3E7FA 1A71A 4JQOA 1OIVA 2COEA 2FFAA 5HIJA 4J0JA 4CF7A 2AHOA 3SJ7A 5F5LA 4G0WA 5E3HA 2H07A 4YRGA 1G4AE 1EFRD 1D2HA 1MX1A 2X19A 2Y92A 3I0NA 3P0JA 2IYOA 1RHJA 4RFSB 3FM9A 2VSOA 4UUQA 4N6OA 4XPIB 3BSWA 1Y4DE 1JZTA 1GPJA 1HE3A 2H1SA 3FDXA 4QATA 1ZA2A 2HA7A 4MA5A 3ZXUB 2GAFA 5KNDD 4P83A 5JCJA 1TU3A 3FMOB 1QM5A 2C04A 1I3LA 3L7DA 1E32A 4IHJB 5D00A 4M0EA 5DASA 2VCYA 5ECWA 4UEQA 1X1QA 5F76A 1HNNA 2KYRA 4Z7OB 5DLPA 4B48A 1DWPA 4QASA 4F91B 2FK8A 4M38A 1SC1A 3H5IA 1Z2NX 4HP8A 1G7SA 3HJUA 4HN2A 2Z5GA 4K88A 3ERCA 1RR6A 1CUUA 2W9XA 4X94A 3VAAA 2GO1A 4K2AA 3ZDYB 2IIQA 4Q4AB 5JSHA 5F9MA 4UM5A 1WS6A 1B0PA 4ZYXA 1E1NA 4RTLA 2WKPA 4TMXA 3WKDA 3WY9A 3I0ZA 4D9BA 4Q5IA 1GDDA 1FPQA 1KU6A 4IDCA 1GNQA 1G7TA 2OQRA 1DEXA 1TUBB 2NQ8A 3WLPA 2ZU0C 3UQZA 1X7WA 1R64A 2R79A 2RI0A 1G3RA 2OLEA 3GG2A 1M7BA 1VP9A 2QTVA 3L5OA 4MA0A 4OAPA 2A86A 2RHHA 4P3OA 1NTOA 2Z4TA 1C3LA 4AIIA 3GRCA 4N8DA 2HLDA 1ID1A 4OOFA 5DCWA 2GXSA 4PPGA 2QB5A 5AM2A 1I36A 2ZAOA 4LGMA 3ZKWA 2OXFA 3FGZA 2EP5A 1QPGA 4AS2A 3K53A 7ADHA 5FUWA 1GCIA 1AXGA 2IEAA 3CLRC 5DNDA 1DNPA 1GQ2A 1EWTA 2QGFA 2JB9A 3UHAA 3A9SA 4GQAA 4KMRA 4X3CA 4ENVA 4MQFA 3MEQA 2JGEA 3KYDA 3EVFA 1TW3A 3IHTA 3X1XA 3LM8A 3RC7A 4ZC1A 5KOHB 1QRAA 4H7FA 3QENA 5AOCA 2AFHB 3AR4A 1DE0A 2PSFA 4DLLA 3IRVA 3EYAA 3DAPA 3I32A 3IXLA 5HJ2A 3KQUA 4HQRA 1TMYA 3T1NA 3PDWA 2Q6KA 3FY4A 4DV6B 1OLOA 3SJBA 1A2QA 1OKKA 4MQBA 3U44A 2JATA 1EFHA 2L0XA 3P7MA 4LW8A 1HYQA 2I55A 1GIAA 3B3JA 4L4ZA 4FE7A 3CF6R 3GZNA 4QAJA 3SHOA 3LXRA 3A4LA 3ESQA 1BVUA 2ZTSA 1OZFA 2REOA 1R3UA 3EXIA 1DAKA 1GYPA 3IAXA 4KZPA 2FPLA 4XR9A 2OGZA 1FSPA 2I5PO 3LCCA 5FL7A 3FB4A 4QBFA 3LXXA 3RAPR 2OG1A 3D6VA 3KZXA 5IFKA 1E2BA 3TDMA 3UBTA 3UK7A 4KQ1A 3D64A 3BJMA 1ORVA 5B4VA 4ZO7A 4DXAA 3Q85A 2VK8A 3ABRB 5JAUA 3FNGA 3STYA 2X7JA 3H2KA 5IRCD 1XZLA 2PTGA 2HDWA 2QTBA 4OHKA 3NWBA 2J3EA 2HK8A 5JANA 1WHTB 1RAIA 3HPRA 2G6TA 5AJUA 3RQSA 1B23P 3PI6A 2QRVB 2CK3A 2WHEA 4BBZA 4FOSA 4WJLA 5F7XA 1Q0ZA 1X1BA 1S8AA 3WO0A 4ZMBA 1NJ8A 1VL8A 4HJRA 3V4PB 1BWRA 5C53B 1LPNA 4BQNA 4UTRA 5JBQA 3QVLA 4RVDA 1UZUA 5L3VA 1LV7A 1UBKS 5CT8A 3JWGA 1HEYA 1PGNA 4IS3A 4OU5A 3ENQA 3SM9A 1QQ6A 3O93A 4FHCA 1N2ZA 2G1AA 2AG6A 2CZQA 2E82A 4B45A 2P9QA 1NXQA 2B4TO 3N2IA 2DXIA 3GUVA 4DJ5X 5PNTA 1BHSA 1U3GA 2JHGA 3O2QB 3P20A 2PQ2A 3SLKA 3G3EA 5DYTA 1M6VA 1U2RA 1ZNYA 2IYYA 3CW8X 3DD1A 4TS3A 1QHYA 4RFLA 3G8DA 2IZOA 5K3AA 2X4DA 3MMZA 421PA 4LDRA 1SVOA 1FUUA 1W36B 3AKEA 2E1RA 1VL6A 1XCMA 3KTAB 4XTRA 4AZSA 4F86A 1XVAA 5JXJA 3C85A 2OYRA 3H9QA 2PA3A 2PFGA 3CLVA 4ESEA 3OA2A 4BMXA 2H1RA 2YC4C 3A0UA 4RORA 3DOUA 4HX5A 3TIFA 1THTA 4JLJA 2VYVA 3BKWA 4FYPA 3ZWAA 3QIVA 1MEEA 4WMLA 3R75A 2WINI 1KZ4A 2ZG6A 4CZ2A 4H6WA 3GLIE 2MR6A 3VKGA 4TROA 5AO9A 4PLWA 2NAFA 2X76A 4LV6A 4O3MA 4DJFC 1TJ3A 4B3CA 1U8CB 4Z6KA 1UADA 4U6SA 5DTMA 2I9PA 3I2FA 4N3GA 4DM7A 2C2ZA 4GDMA 2IE8A 1KFJB 3AW8A 3GGGA 3ETLA 1XZKA 1U6JA 4GPTA 3FYTA 4LHZA 4MUHA 4EGQA 4EG5A 4KSBA 4MROA 4CN8A 2FWRA 1OX4B 1PWZA 3T4PA 4G8JA 1M1NA 3X44A 1T6YA 1N6LA 3RT1A 1T4BA 3NMUF 2WA1A 3SM3A 3TUZC 1N5DA 2G28A 4Y6GB 1BGVA 3LF1A 3O91A 5DM60 3HKEB 4RF2A 5G02A 4TS1A 5KNDA 3BE8A 3DBRA 3RAEC 1WHTA 2PLNA 4MKZA 1CEQA 4IMIB 4ND2A 3ISTA 2VXOA 2FG5A 3UJ6A 2EQBA 5EWMB 2CYCA 3P27A 1XT6A 4FBLA 4NLLA 4KFRA 3UCXA 1EFUA 3E7XA 3FWNA 5F23A 4G2TA 3PE3A 4LHYA 3X2EA 5AOAA 1RJDA 1H2RS 4BNFA 1T9GR 1NUTA 4CMKA 4OHVA 4XGNA 3A04A 5IMBA 4CIVA 4GI3A 4KRYA 1G98A 5TLSA 3I1JA 1DXOA 4NG4A 5F4ZA 3T3GA 4Q0MA 2BN4A 3L93A 3SBDA 2ZB8A 2O0KA 3HVJA 4KGDA 3ZI7A 4AO8A 4FW9A 3OH8A 2EV9A 4MGEA 4MJ7A 1KZYC 1WVIA 2P4SA 3GELA 1BKSB 5KJ1A 4FFNA 3C7CB 3JALB 1Z3CA 5AW7A 1EI9A 2ZYSA 3KS9A 3GJ8A 3RS8A 3EVBA 5CCXA 3HFGA 2EWMA 2JLQA 2D5AA 1K0UA 4NONA 1H0RA 5JPCA 4QM7A 2PX8A 6LDHA 2P6OA 1QX3A 2ZAYA 3NPMA 4D4MA 1J0EA 3GFBA 3MMSA 3LVQE 2R4QA 1U8EA 2V3CC 4KN9S 4YDSA 2FI1A 4Z7JA 3DHVA 5JAMA 1A7UA 1SAYA 3CRMA 2PXXA 4XVRA 2WM9B 3S1LA 4OQPA 3EDQA 4ENUA 2JGLA 1DC5A 1TQDA 2WKRA 4KPUA 2J5RA 4QPDA 3VH1A 2RIPA 1UBEA 1WD7A 2BLNA 3ZOKA 2F1IA 4YUZA 3EW7A 1Q1GA 3ZDEA 1JWLA 3W2EA 4D9HA 1XPRA 3K5WA 4AKEA 2O5CA 5ICFA 5B6JA 1JQ5A 2B25A 3ZH2A 1XVTA 3A4TA 3GJRA 1HNWB 2QMUA 4M0PA 2HK6A 1HGXA 1X7XB 3UOWA 4Q3KA 2RJ3A 2QE6A 4MPPA 4PAOA 2PDAA 4Y2GA 4CTMA 3ZLUA 4R51A 4S24A 1Z6ZA 2D62A 4ZA2A 4YJ3B 4CG2A 2XE8A 2XB4A 3HKEA 3GFOA 3HUTA 4E4TA 2BEVA 5ARBA 4UAGA 4UCFA 2C7PA 5I01A 5ALYA 1LY1A 3AF6A 4G1VA 1ZH4A 4Q1CA 2PZMA 2IEBA 2BGIA 3JATA 1JEDA 4L07A 1VI5A 3PQ8A 3MVEA 1QG6A 4ZI5A 5ADHA 2FE4A 4ZWNA 4GNKA 2FB9A 4HGRA 4FFPA 2ZI9A 1U7XA 4J1QA 4PPFA 4JT8A 3HB1A 1NHWA 1PLJA 2JFFA 2NQTA 2VSNA 4YMWA 3WJAA 4BRWA 3BE5A 2I71A 1N77A 1S2IA 3L2OB 4QL3A 1ZSYA 1MABA 1BJKA 1M34A 2YJTD 3EF0A 4OOEA 4B75A 4BIIA 5A9SA 2RD2A 4J75A 3WL7A 3RHFA 3EF3A 3O84A 1CF9A 4EDHA 1L5GB 2VF5X 4H1HA 3ZBQA 4CMIA 3T9FA 1P44A 1HZZC 3O4GA 1W4AA 4DSUA 3DMDA 3RHZA 4C3VA 1T0BA 3LQYA 3D7RA 1IJEA 1HDYA 1ZN2A 3QBJA 5SICE 1Z08A 2WQZA 2GF2A 2RIRA 3L6EA 5CH8A 4X71A 5EEHA 1TPZA 4BCBA 3PKJA 3OLCX 4WBNA 4MGKR 3CTPA 3DB1A 2E6KA 1OVMA 3FCCA 3HJCA 1MB2A 5F52A 4D4JA 1RRKA 3O0TA 2P8SA 2FUCA 1D0VA 2M2IA 4I81A 2RH5A 2IP4A 1BW9A 1JJBA 3LBHA 3P0FA 3PPYA 4R7ZA 4DGQA 4H0FA 3SZRA 2V97A 3DVQX 4R54A 5KNCH 1MC4A 1MJHA 1JF8A 2VJNA 2PT5A 3VKFA 2X8BA 5FBRB 2ZTUA 3RS3A 1NF3A 4ETMA 3A9VA 2PYDA 3GRPA 1XTSA 1V41E 1SUIA 1G3QA 3EZNA 3FH0A 3LFTA 3OECA 4LVOA 5KDDA 4UNQA 3TPFA 4CYMA 2IS2A 1AOXA 2QN1A 3KAPA 4PR3A 5JOQA 3NVAA 3AL2A 5KSWB 3TF5A 5DEOA 4CR7A 2MYPA 3TKYA 4YAUA 3AI3A 3UAWA 1FJHA 3WWYA 3B6EA 1BDMA 1NR7A 3QVJA 4NAUA 1OI7A 2ZRKA 3EOBI 4OQZA 3L7YA 5DBHX 4EK9A 4GPD1 2CE7A 1P5FA 1YBFA 3TJZA 4DCNA 3U5TA 1DUVG 2Z5VA 4YWJA 1Q1QA 3IGFA 3BMXA 1F3OA 4RKYA 3RIYA 4F5ZA 2RGRA 1JR3E 4HH3C 1C7IA 3ZJYA 4EEZA 1I6WA 9ATCA 5K6RA 4RGQA 3JTEA 2GESA 4Y2PA 1A2BA 1GXSB 4PLPA 5T57A 3S7TA 1DOZA 2XF2A 2ZBDA 4K87A 4RJTA 4PFJA 1KC1A 2IZ7A 1QH8B 4YDQA 5EKUA 5IC4A 1SO8A 2ZIZA 3MTDA 1T8SA 2XWSA 2V0GA 4RJKA 4KXYA 2NYUA 3DWGA 2GWRA 4LY9A 4M9XA 4G8BA 4JLOA 1HYBA 2XYRA 4XX0A 5CLLA 2B0CA 2QWXA 3SHQA 4J1NA 1P0PA 2B83A 3CLSD 4WCFC 4DLNA 1D4OA 2A8YA 4EB0A 4UM9B 1U2EA 1OQAA 5KTSA 4AQ7A 4R9RA 4R6XA 2ONCA 1H5NA 3IXMA 4YCMA 1KI3A 2OVFA 1RCUA 1CUDA 2F1KA 3ETNA 2VHWA 4OA8A 4DCVA 3EQ2A 1D4ZA 1E4EA 2PUVA 4KO4S 5DXAA 1OH8A 1Y9EA 2WWGA 4ZCTA 2Z8XA 1E2IA 2WD8A 4B8YA 5BN5A 4D0SA 3CPJB 4V39A 1F5SA 1NW8A 3DEYX 3LYUA 3JARA 3TRFA 1B6RA 1ZGCA 4HAXA 4ND8B 4D02A 4D96A 5IKMA 4G07A 5EJGA 2F3TA 3IBFA 1IU9A 4QXOA 2W6ZA 3VI3B 1XRQA 2JAHA 3B78A 1L7BA 1UBNA 4Y7DA 4DPMA 2YFYA 1R27A 3D8TA 1HRKA 3ABQB 2BSXA 3S81A 4PAQA 3UMFA 2BMEA 4MB2A 4JL6A 4FILA 4YI5A 2D1YA 1BCRB 1U1FA 2JGKA 4KQ2A 1T36B 3LQKA 4HDNB 4OFWA 2XCQA 1EAYA 3C14C 4V3BA 4Y1RA 3UXEA 5CB4A 5JZ9A 1EMDA 3IR6A 2LDXA 2GN2A 2LTAA 1EVZA 4EG3A 2FP4A 3RIXA 2J0UA 3C3JA 3QPDA 2IXBA 2X6QA 3QOXA 4ILKA 4OLFA 4Q82A 3GLGB 1T4MA 1Y9JA 4XWGA 1TFRA 3DLIA 4TVBA 2X0NA 2VZEA 1M6NA 4LA4A 4WFIA 4BRZA 3JYQA 2AE2A 1LBTA 1G63A 2VHUA 4QUDA 4ZXPA 3DL7A 3PNPA 5C8ZA 1YNSA 3KQTA 3OJEA 5BUZA 2XNHA 5C3UA 3CZ4A 3JWHA 1MX9A 1LBQA 3RH0A 3LPMA 4KACA 4UUBA 2B4YA 1ZEJA 1CEYA 4W5NA 2WKWA 4WXMA 5FLEX 1SA0A 1KEEA 2I7DA 4D81A 2VTDA 3D31A 4GH5A 5FFFA 5TS2A 2Y1GA 3DMRA 3SY8A 2Q5QA 2QEQA 2QTHA 3W4JA 1KYXA 1XPUA 3FDZB 4HXFB 1OLUA 3VR3A 1YS9A 3NTXA 1HDGO 3FIUA 1NJ1A 1RYNA 3DT8A 1CWUA 3N8NA 1JKFA 4QXRA 1K3TA 1K75A 3W2IA 4QXMA 1MCZA 2Z9BA 5AM4A 3AVVA 4ZCIA 3HSSA 2ADMA 3KIPA 4OBWA 3AVWA 1LBSA 3MTQA 2I6UA 2PUJA 4GMKA 4QDKA 1PT6A 3AO0B 3KB1A 4QIHA 4WLVA 4C7VA 2X5XA 4NF2A 2FPPB 3QMMA 3VO9A 2Q1UA 5C52B 3GJ6A 5A9TA 3W5UA 1PJCA 3IPCA 5LYJB 1QJ4A 5KYVA 3O3NB 3ZV4A 3KWLA 4OI1A 1P7ZA 1DAIA 1WQ1R 2WF8A 5HTKA 4BQRA 3DCIA 3K0HA 5C34B 4ZOLF 3COJA 1PYDA 3EPRA 1EUCA 3GIDA 3LLSA 4Y2XA 1PWXA 2NTVA 3GBSA 5KDLA 4CCAA 4C87A 2FW1A 2AI3A 3GP5A 4WGGA 2A78A 3P94A 2BUCA 2VUUA 1ENPA 1Z5NA 3VKWA 1JKJB 1JG6A 4KODA 1X80A 2Y9PB 2DWUA 4S0XA 3CONA 3ZUGA 4J4HA 4A03A 4BVHA 3KOOA 1QHHA 1ZVJA 2ZAIA 2VYFA 2NU8A 3D1VA 1X39A 3RC3A 3ZWMA 1G18A 2CNKA 2D4AA 3WB9A 3FCSB 1AIPA 4NK4A 3V1UA 4PYJA 5KVCA 1XQYA 2OGUA 5DYGA 3VOBA 3RGGA 2FN7A 1ISMA 1NNUA 4AU1A 1LZLA 3NXKA 3DS8A 5FYDA 1G8YA 1CUCA 4MDEA 4Y7CA 3X2SA 2CLEB 4LOAA 1JT2A 4D99A 3GJQA 3H2HA 4PTZA 3TZBA 3VGPA 4D97A 1PDWA 3F2IA 4FGSA 1BDHA 4MMYB 1JEEA 1HTTA 1DINA 3PE4A 3KM0A 1BDBA 3GN1A 2C92A 1JIKA 2QSUA 3AGQA 5JLJA 2AZXA 1WCWA 2PS9A 3T3PB 2PL9A 3QM1A 1QYRA 1W7AA 3T5PA 4YAFA 4L2IA 1L5MA 1TT5A 4LVCA 2IE0A 4X66B 1PQPA 1GPLA 1KYVA 3H9JA 4JBLA 1WQ4A 3K35A 3PENA 4GXNA 2QENA 3PNVA 3ZQJA 2I9KA 1JLRA 2C54A 2OWEA 4WSOA 4O4IA 2OV6A 3ZCXA 3N8GA 2EL7A 4KIWA 3UB2A 2JLAA 4ZJZA 3NIGB 3TIGA 1GA6A 3OEWA 4M0KA 4JLBA 3TFWA 4UM9D 4EVSA 1BMQA 4RJJA 4LGCA 4GWKA 4QSMA 3OM0A 1GG9A 4X20A 5CK5A 4QG3A 4TWZA 1KAOA 1Z75A 2Z2JA 1PBNA 4OX9B 2Z6AA 3GBVA 2UUOA 4IKOA 4EYSA 4WCFA 1UEIA 1U2PA 1TT5B 1IRXA 5E0KB 1QU2A 2ZYAA 3A3KA 3G9XA 2HRRA 4H15A 3E22A 4I1VA 4Q3CA 5F35A 3I8OA 1N57A 5I7RA 4B3SB 1KAHA 4ZMSA 1JIXA 4PAWA 4KW7A 5HGXA 2B2XA 2I22A 2OD7A 4ZOQI 1T8UA 1DC8A 3FBGA 2JFBA 4JBXA 4PPQA 4ZVOA 3G5AA 5ESWA 2IHUA 5GAJA 3AX6A 3SZMA 5JJBA 1NUPA 2W6IA 4JYBA 5IAKA 2QGZA 4X61A 4PHGA 3F7NA 1IXSB 2F90A 3T7JA 1VSUA 3FG9A 4QC2A 1IN1A 4MYSA 5TEWA 1JIIA 4KDCA 1ESDA