4XEUA

Crystal structure of a transketolase from pseudomonas aeruginosa
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
663
structure length
632
Chain Sequence
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYMQHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYGYTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGISHEVASLAGTLRLNKLIAFYDDNGGWFTDDTPKRFEAYGWQVIRNVDGHDADEIKTAIDTARKSDQPTLICCKTVIGFADEIAATRAALGWEHAPFEIPAQIYAEWDAKETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKAAAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADTLWKGCKGVSADDAAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYVFTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALIFSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSFGESAPAPALFEHFGFTLDNVLAVAEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Transketolase
publication title Crystal structure of a transketolase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 246
structure length 632
sequence length 663
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA01
2JI6A 1OZGA 4GG1A 2Q29A 3EXG2 1T9CA 4K9LA 1DTWA 2EZUA 2JGDA 3EXHB 4WBXC 1QS0A 3MOSA 1POXA 4FEEA 5K6TA 4C7VA 3M6LA 2BFFB 4GP9A 2EZTA 2O1XA 4Q9DA 2J9FA 1UMCB 4JUFA 3HYLA 4MPJA 2PGOA 4K9NA 3EYAA 2R8PA 3EY9A 1W88A 1IK6A 2VBIA 5EXDA 2IEAA 1MCZA 4KXUA 5EJ5A 1X7XA 4D5GA 2BFCA 2X7JA 4KXYA 5HHTA 1V5GA 2VJYA 2DJIA 4JUCA 4ZP1A 1ZPDA 1DTWB 1UM9B 1TKCA 4JUDX 3ZHVA 2BEWB 2JGDB 1KEKA 1V16B 1QS0B 1B0PA 4JU8A 3IAFA 5EJAA 1OVMA 2C3MA 3OOYA 1W85A 2JIBA 1V1RB 1V5EA 2G25A 2JLCA 2UZAA 4K9MA 2J9FB 3DUFA 1V1MA 3ZHRA 3EA4A 1PI3A 2EZ9A 3HWWA 5EJ6A 4K9QA 4GPEA 1PYDA 4MQ5A 3UPTA 2OZLB 1X7WB 1U5BA 1T9BA 1YI1A 1UPAA 2BFEA 2UZ1B 4COKA 4QQ8A 4GM0A 2O1SA 2BFDA 2PGNA 4K9KA 1UM9A 2VK1A 1PO7A 2BEWA 4QPZA 1OLSA 1QGDA 5EJ8A 1V16A 3M49A 5ERXA 1ITZA 4JU9A 2NXWA 1YBHA 2R8OA 1OZHA 1UMBB 4JUAA 1L8AA 1V1RA 1W85B 3AHDA 1YHZA 3E9YA 2W93A 2QTCA 2Q5OA 5FEMA 2VBFA 3AHCA 5I5EA 2C3UA 3EXG1 2PDAA 2IHVA 2JI8A 2EZ8A 3DUFB 1V1MB 4XEUA 2WVHA 2Q27A 1V11B 5EJ9A 2BP7A 2E6KA 1Q6ZA 2JI9A 2OZLA 1X7WA 5HGXA 3L84A 4MPPA 4QELA 1OZFA 2UZ1A 1U5BB 2C31A 2BFEB 2Q5LA 1OLUA 3DV0A 4KGDA 2BFBA 1N0HA 2BFDB 4KXVA 2JI7A 1OLSB 5I5GA 1X7YA 4MPRA 1QPBA 2PANA 3JU3A 1UMBA 3ZHUA 3AHIA 3AHFA 4FEGA 3EXHC 3AHGA 2BEVA 4JUBA 5IMSA 1POWA 1V11A 3LPLA 2IHUA 2FN3A 1UPBA 2BP7B 3DVAA 4MZXA 2WVAA 1R9JA 4JD5A 1JSCA 5K3SA 4GM4A 5EJMA 5ERYA 5HYVA 5K2OA 2FWNA 2VBGA 3F6BX 2C42A 2C3OA 1OLUB 1T9DA 3DV0B 2BFBB 4D5EA 4KXXA 5C4IA 3HWX1 1V5FA 3FLMA 1AY0A 2Y0PA 1X7YB 2QTAA 2G28A 1X80A 3EXIB 1NI4A 3EXEB 2WVGA 2VK8A 1WCIA 1TRKA 3FSJX 5AHKA 1YD7A 1UMDA 1TKAA 2BEVB 2XT9A 1Z8NA 3AHJA 3D7KA 2AG0A 3KOMA 2JLAA 3F6EX 3DVAB 4RJIA 2C3PA 1NGSA 5I4IA 4RJJA 2V3WA 2BEUB 1BFDA 3AI7A 5EXEA 3M7IA 3EXFB 1PVDA 4RJKA 3FZNA 1X7ZA 1OLXA 3IAEA 3LQ1A 5EJ4A 2YIDA 2XTAA 2C3YA 1YNOA 2G67A 3EXIA 1YI0A 1X80B 3EXEA 1NI4B 5EJ7A 1YHYA 2R5NA 5DGDA 3EXHA 1WCIB 3LQ4A 3LQ2A 2Q5QA 2IHTA 1UPCA 1Y9DA 1UMDB 2BFFA 2XT6A 5I51A 3RIMA 2YICA 1RP7A 5ESDA 3ZHQA 3ZHTA 2Q28A 4K9PA 5DEIA 5HJEA 3OE1A 1UMCA 4C7XA 1GPUA 2BEUA 3M34A 2AG1A 3AHHA 3EXFA 4K9OA 4GM1A 2Q5JA 1W88B 3AHEA 1X7ZB 5K6RA 3ZHSA 1OLXB 2EZ4A 2VK4A 1X7XB 3UK1A 1T9AA 2BFCB 4KXWA 5DGTA 1TKBA
chains in the Genus database with same CATH superfamily
5K3DA 1VCMA 3DAPA 1GHTA 4E5KA 5IX8A 3ZWPA 1EFRD 5FBVB 4UVGA 5EE3A 2V6GA 1H66A 4QKQA 4HDKB 4QTXA 4K9LA 1KPIA 3QUQA 1E9SA 2LKDA 2ZIXA 1NASA 1Z47A 3VNAA 4GDFA 2BMJA 2OVFA 3RROA 2I55A 3D2LA 4CMIB 1N2CB 4EY3A 1JNYA 5EHXA 3E9QA 4XZ3A 4H1UA 2R8BA 1FNCA 4LHVA 3OLYA 1IC6A 3HGQA 1G38A 1R4AA 1KGSA 1SCUB 3IT0A 1EIZA 4AP9A 5L7WA 1NMQA 2GBGA 2R1VB 4V03A 5EWLA 4ZAVA 3RTCA 1TIPA 4P98A 4Y1GA 1ZUHA 3UCXA 3VYUB 4ALKA 4R2XA 1DRWA 1XKQA 2WF7A 4GPBA 4HX9A 5DBEX 3SGLA 2V7WA 3WSWA 4RANA 4JT2A 3S2EA 1B8VA 2RH5A 1Z6AA 2DQZA 1NAIA 2H4WA 2P27A 3TD6A 4OA8A 2CB0A 3P32A 1U2GA 4OQNA 8MHTA 3LXXA 3AI2A 5FO0A 4RD2A 3GCDA 3CUUA 2YJ4A 2NUPB 2X5XA 1CKEA 5J2TA 3M6XA 3K9CA 2IKSA 2BV3A 2P2ZA 2ZBEA 1OX5A 2GETA 3EZNA 3QK7A 4P93A 2WOJA 3KKOA 5DRYA 5F2NA 1NUUA 4LA4A 5BVHB 5J59A 3QG5A 5LNK1 4DKJA 1UDAA 4K9NA 4INPA 3EJ6A 4I3GA 5CHEA 1LLQA 1LH0A 4M1SA 4ROTA 4PYNA 5K3FA 5IT4A 2IEAA 4HWPA 1BWRA 1DHTA 1MFPA 3H1TA 3IXMA 3S4YA 2ZXFA 3MCTA 4V2IA 1VCHA 3N3AC 3AUXA 3GH3A 1CVRA 1XZNA 5TF0A 3GT0A 4Q1FA 5TQ2A 4DKXA 3LLCA 3VPCA 3UWDA 2QY9A 1PCXA 2BGUA 3HK2A 3CZ5A 1YZQA 5BR7A 5IUNC 1OOEA 2UZ4A 4N7BA 1ZINA 3L8GA 3FA2A 2OP1A 1V5GA 4RJTA 1RYMA 2ENUA 3WWDA 3GLTA 2H00A 5HILA 2VJYA 3OCZA 4OIFA 2HJRA 3WK6A 3DEFA 1QQTA 5JIBA 4Q9JA 4ZCPA 3SSOA 5GINE 2PH3A 3ADBA 2CJPA 4HVTA 2VNKA 1A1SA 1EEXB 4BU0A 5KX5F 1M8FA 3MC1A 5D3MA 5KNDA 2WMDA 1LUAA 2NU8A 1K8RA 1L5OA 2C04A 3MAAC 4Y6GB 2DG2A 4CLEA 4D98A 4ZV4A 1LI4A 1H85A 2WUFA 4KLAA 4C21A 1XCJA 2BW0A 3OPYI 3QX7A 1E0JA 4FDMA 4XQCA 3CUYA 4GKKB 4YXWA 5FA5A 1NNI1 3S70A 1L5WA 2ID9A 4ZAXA 3U4QA 5EG5A 4HD8A 5GV7A 2XQKA 3PHJA 5K51A 3U3ZA 1MIOA 3WP0A 4FLFA 4MWBA 1R9NA 1TZKA 3HB5X 3PGKA 1XUOA 1PR3A 1VLQA 2H5LA 1JDBC 5B2EA 3KKNA 3SVLA 1ZDMA 4M53A 1GTMA 5H9WA 4S04A 1W5FA 4IHKA 4PNHA 1KO5A 4ZOLF 5JU6A 4GYJA 4UVHA 3TLXA 1KBQA 4CFSA 1DEKA 1V2HE 1NQUA 4AKHA 1JIUA 4WN9B 2PX8A 5T4BA 2JLCA 2PAAA 2OWEA 2QAGA 3PJGA 4R69A 3JAKB 2NO1A 1NP3A 4HYYA 3CO0S 5BSRA 1E5VA 1Y1TA 1JR6A 4S3MA 3VKFA 2YHBA 1M73E 2LTAA 4EATA 4UUPA 5A4KA 1EUYA 5EQJB 4AJ4A 3EY4A 4DQUA 3I61A 1F6DA 1XMOB 1I6WA 5ADWA 4EGCB 1XEXA 1KMNA 3DBIA 5E7IA 3C6YA 1NUPA 4Y2TA 4LFCB 1B4DA 4JROA 3L1HA 3LQQA 4YHBA 2Y0BA 2IUYA 2YVLA 1NR5A 5FRDA 1OH8A 2YRFA 4YMLA 1X7WB 4D9HA 1O03A 3MPOA 2B4YA 1UMKA 2UYCA 4O02B 1ZYUA 5GV8A 4IDBA 3W8NA 1T34A 4MTCA 4WXPA 5AVTA 1C3VA 3LSYA 4LKRA 1J2TA 3LUHA 1BSVA 2ISQA 1B2LA 3LNTA 5C81A 4B4VA 4MUEA 3R75A 1Z45A 4V24A 3ZQ4A 4AL4A 4KR2A 4A6DA 2XODA 1GNLA 4TTJA 3ROFA 3QEBZ 1T91A 4RZ2A 3C39A 1CUSA 5AKLA 3UJNA 2I1WA 2IPLA 2IVFA 5FLEX 2P8SA 4AMGA 1J9EA 5C8YF 5IKXA 1DC6A 2CVZA 2BEWA 2RKWA 4PLHA 5F5XA 3AVOA 1RHJA 1M2VA 4GXQA 1GTZA 4QTYA 1BRMA 3HACA 4R2KA 4S1WA 3TN7A 3U81A 1BEEA 1J2RA 4IDQA 3MHPA 5J4KA 3HY6A 2PVSA 3V2UA 1Y7HA 5CG2A 5C51B 1JR3E 2BWJA 4JU9A 2WC1A 2NO4A 2GFHA 3AF1A 3V7WA 5GZ3A 3Q2OA 2C2GA 2VDQB 2ZJ4A 3CX8A 4MIYA 4E5PA 3ZJTA 3GNQA 1MEOA 1GEGA 1K89A 1V1RA 1E4VA 1FK8A 2CNWA 2D1QA 3NDIA 5AVJA 2PS3A 1FRFS 1QFSA 3K73O 3X1DA 3RFXA 3G3EA 3MA0A 1B3RA 4AMYA 3L05A 5CFQA 2MMCA 1ZN2A 1WULS 4LDZA 4TKUB 2J0VA 4OI1A 3QXJA 4CW7A 5L95A 2DLNA 2XCQA 2WZCA 4WFQA 5A4AA 1A2OA 1CDZA 1AGYA 3R24A 4OOFA 4DC0A 2BHRA 3OX1A 2F1JA 5I8PA 4BO3A 1PD0A 1MQ9A 3IBSA 4MQ6A 4D1YA 1TUBA 2XCOA 3U56A 1QYCA 5CCDA 1KRHA 5KSWB 1QVVA 3KTFA 3PT5A 1D4FA 1VL6A 3M6VA 4WXMA 4HUQA 4LZWA 4P84A 5CT4A 2GH1A 3IIEA 2X9NA 4L1KA 4BMOB 1VCNA 3KL2A 1ZN9A 2AXNA 5MGBA 2VTKA 3QU2A 1C9NA 3CNEA 4L0QA 3V4VB 4H4CA 4O08A 1VIDA 2EOAA 1QCCA 1E1RA 1DQZA 1UBGA 2JJ2A 1QANA 4TXNA 1F38A 3P96A 3KR2A 5IYZF 3WQHA 1AQ6A 1BH2A 3GNLA 1T29A 3JWEA 3IRVA 3ESRA 4XM0A 5FL7A 1VCOA 1P1CA 3OCCA 4Q7LA 1S6YA 5HCIA 1ECCA 4G37A 3NBZC 1OI3A 2H2DA 1L3CA 2B20A 4IBOA 4MS3A 4C9BA 4EMSA 3NPAA 5HKAA 2QRVB 4C29A 4F2PA 3WMEA 3F46A 4N8SA 1B0ZA 4FFPA 3LCRA 5EFZA 3I6ZA 4B6GA 3X1WA 3JVUA 1PR2A 5K0NA 1NXPA 3HJCA 3MWKA 3W9YA 2WM8A 1U2EA 1WR8A 2CNLA 2FPMA 2VP6A 2HA3A 4LJ8A 5A4MS 5JAIA 5FLXA 1IOZA 4KSCA 4ACAA 4H6PA 1VYUA 1SXIA 1WQ1R 5F51A 1YS2X 2AW5A 3KFLA 3JU3A 1U31A 3U16A 2GPYA 1I33A 5D8DA 5CDFA 1RXYA 5C1DA 1P5FA 5AI0A 3OQJA 2F8TA 3NPMA 2P2LA 3VMFA 3WGZA 2ZIFA 4WESB 3UZUA 1CQZA 4OFXA 4ZAZA 4BMDA 5E8RA 2IDKA 3M5DA 4ESEA 3ZCPA 2HIHA 4P4TA 2C2KA 4MDHA 4JXXA 1Y3HA 4EY4A 4CEHA 2W6JA 5IMSA 2C8VA 2GN0A 3UXYA 3QVVA 3C97A 1M8KA 4RENA 1YAJA 1QJ4A 2QL9A 2HHHB 2A67A 2WPDA 2G0TA 1AO0A 3J7AC 1FXUA 3KM0A 4EHLA 2W58A 4KQJA 2ZRMA 4CCYB 3ADCA 1VJ0A 2IDMA 2X2EA 1RZRD 3JPYA 3QBDA 4IIJF 5DDIP 1ISGA 1KIAA 1NULA 3JR7A 1YDGA 5EL0A 3SOPA 4AKTA 4BJHB 4H3HB 2AGVA 1DOHA 5FWDA 3R74A 4OL9A 4HJXA 1HK7A 4ZCSA 1FQOA 4HP8A 4HTFB 1IHDA 5B5SA 1RQXA 3A3YA 3AP1A 2GHQA 3PGJA 1CE8A 5TPWB 1HDXA 2C4HA 1R1DA 1OFVA 2Q3JA 1Q20A 3HDYA 1TM2A 1KK1A 2DR3A 3PD1A 3PFCA 5ALTA 3IO5A 3VC1A 1O0BA 1VGQA 2VK2A 3D3WA 4NU5A 2QPAA 4R2MA 5IAOA 2H7CA 1IB6A 3C8UA 5D84A 3ZK7A 1NBIA 5ESRA 1SHKA 1U7TA 2VWQA 4PFKA 3AEUA 2Z04A 1NJ8A 5FPTA 1P2VA 2OCBA 3ESXA 3GO4A 5E6SB 1V25A 3EVTA 2REQA 3WGQA 5L3SA 2V1UA 2EX1A 3SCZA 1ECBA 4BTEA 1XI2A 4UASA 2J08A 2Q3DA 3QX3A 1YGYA 1VYHA 2FW1A 4J0GA 2DPGA 1CDEA 4EEXA 1QF7A 3ZV5A 3ZE1B 4DZZA 4UMDA 2R25B 2AOUA 2WBLC 4C2AA 4OBEA 3ZVLA 1OZAA 1T4MA 1GUZA 2E5LB 3KZCA 1DZIA 2AMYA 1CJUC 5H3LA 4AP6A 2PUTA 1HFEL 4GXTA 3L18A 3R3WA 3CRVA 2BTQB 4BFTA 4BNDA 1M8GA 1P91A 2AFHE 4WZAA 1WRBA 1L1RA 4BCBA 4Z0TA 4TSFA 1Y6JA 2RAUA 2FP4A 2WM9B 3CW9A 3LLVA 1W0JD 3PC2A 3UH0A 1X2EA 1A98A 1XROA 3KFVA 2ZU6A 5E1DA 5CDYA 2HDOA 1VKNA 3G2NA 1OILA 2HB6A 4MMYB 1VDZA 2XT9A 1K4YA 1S01A 3QTTA 2F9FA 3B6KA 2BSAA 8OHMA 3CLRD 2ZYTX 3KS9A 4FYKA 3ZGVA 3BQMB 3H42B 3TTWA 4FW8A 1E1MA 1NN1A 1UFRA 5ALHA 2GEBA 3DVAB 5CA1A 4GOND 3JARB 2E18A 1RBZA 1KE1A 3OZSA 3T99A 3ZNQA 1KKUA 1JYEA 3CX7A 3W5UA 3KQVA 1BD3A 3I01A 1GT91 3G2PA 1USVA 1JSZA 2IPAB 5DV9A 4CU5A 3DEJA 1W25A 1ZOIA 3MBKA 2WU1A 1N6IA 1EM8B 3W2HA 2D6FA 5EZ5A 2P35A 1V95A 4XWYA 5K0EA 4V0MA 2AB0A 2JBAB 1DEXA 5B1HA 1LK0A 4PV7A 1AX9A 2JHFA 4MVJD 1UFVA 5KO2A 4EHFA 1ZGAA 4WK0B 2EW8A 2GCGA 1JG2A 2HD4A 2HU7A 2II6A 2XMBA 3NG1A 5K05A 4OMFG 4WLNA 3TR6A 3G9QA 3TEMA 3QE4A 4BEBA 4DXAA 721PA 3DZJA 2NYAA 4UHHA 4HDMB 4X1OA 2CXTA 1NDQA 2WP0A 3FSGA 4RVSA 1Z17A 1ZM2A 3W8FA 3N86A 4ESHA 4D6XA 2R6ZA 2OYCA 1FMFA 3OP4A 1N9KA 2BJWA 4N01A 2DWCA 2JHGA 4ZKDA 3A6LA 3TSAA 1M67A 1CJBA 3A1NA 3ICWA 1M6WA 1SOWA 1VMAA 4LWPA 4M8LA 5EWMB 3UTCA 5J23A 4Z49A 1MGPA 2C59A 2XZOA 1YL5A 1NI4B 2P6UA 4HADA 1CWUA 3UT5B 3RSSA 5BORA 1Z68A 1T5TA 1Z6QA 3WDLA 1GL3A 2D5BA 4L6IA 1GPMA 3U9LA 4JT9A 3NIFB 3PE3A 2B36A 3O90A 4UHDA 2IWHA 3SR3A 1NQOA 3VDQA 5HX7A 3KOUA 3WQSB 1T13A 3FPCA 1SQGA 2EW1A 2BGKA 5ARDA 3DLPX 3DXFA 1ODKA 4IDEA 1FNSA 1G7TA 1SJ9A 2QR5A 4LUCA 3K72B 5E7JA 2B0JA 4BLTA 4DLNA 4JLWA 2CL7X 1Y8CA 4IMJB 2LBPA 4G81A 3PRJA 5HRAA 2XT6A 4HFJA 4NZ9A 4RD1A 2X6TA 3KZVA 3FIUA 4X7BA 1EFVB 1RKQA 3Q1LA 2HLDD 3R5XA 4L4YA 4UAVA 5U4XA 4N0QA 1XZHA 3WHIA 4R9RA 1PK9A 2OHJA 3EFOB 1Y0BA 2Q28A 1NPTO 4O4HF 2DFTA 2EC5A 1PL8A 2QE6A 5JJCA 1RI2A 3AI1A 3MJ4A 1WXXA 1TKRA 1A9XB 4B7UA 1EGAA 1W49A 3ZBUA 1E79D 1LWOA 2EWVA 4ER3A 1W36D 1R4MA 3QFRA 4XAQA 3V8VA 4MUBA 1BVRA 1Y8RB 4PN7A 3U0BA 4K3VA 2C57A 4EGAA 4JQCA 3L02A 3LGXA 3T5AA 2AX3A 3JALB 1JJAA 1BWQA 3O8LA 1I1OA 2F1KA 3BWBA 4TMZA 4N3BA 4R5HA 5E3HA 3DW3X 4NRDA 5AJHA 1J0CA 2X5NA 2J9YB 3ZQUA 1D8AA 2NACA 3IIKA 1J56A 1EHIA 4CE6A 4YRLA 1X7XB 2R8RA 3DE1X 5FB3A 3SLRA 1T0IA 4GT1A 4DLTA 5HWSA 1ZCAA 3Q8XB 3VHXA 3TTXA 4IXNA 1Q7TA 4QQFA 5KYNA 2H4HA 1KE2A 3VR5A 5CNJA 6LDHA 1KMMA 1J23A 3I45A 1GKYA 2CUTA 2IYSA 4ZICA 1T4GA 2ORED 3GJSA 3MD9A 1HMPA 3Q0TA 3TDNA 3TGLA 2HUPA 3MJHA 1E6KA 3EIHA 3H9GA 1ZBQA 3GMDA 3IAXA 4XJXA 2B3DA 3V1NA 3S8YA 5FWYB 5HFJA 4LEIA 1KAGA 4QBGB 3LUAA 4UUBA 2QNRA 3SQXA 3QNUA 1KAQA 2WKRA 4GQAA 4ENUA 3DTYA 1NBEA 1WP4A 1Z0UA 2NTYC 3FWKA 4FYMA 4HCJA 5F64A 1Y5IA 2BUBA 3WFZA 4A6PA 1O6FA 1R9MA 2FQ1A 4EM6A 1AQJA 4GUDA 4N40A 3V9AA 3I6MA 4CBVA 4F7WA 3KLBA 1EUZA 4JC8A 2JCSA 2B82A 2OLKA 1LK7A 1ZGCA 3LKVA 5K6TA 3N7UA 5ES3A 4ZDKA 1WDTA 1QYDA 4GRIA 4C7VA 4EB6A 1EA7A 2BH9A 2O7VA 2BFFB 3TZHA 1T36A 1A82A 1XZDA 3FPAA 1L2TA 3NLLA 4N7RA 3T9DA 3M89A 3R4VA 4R40A 4ND4A 1ADJA 1VJGA 3W3AD 5TIIA 2ZZMA 4JFRA 1O96B 2XXAB 1A76A 1OH7A 3CKMA 4IJMA 4G8JA 4OMUA 1OV6A 3K5IA 4D99A 1SUWA 3K32A 3B6MA 4OLFA 5EHGA 4CNQA 3HCAA 2MSWA 2GNPA 2RK3A 1F2VA 1V8BA 1ACMA 2CK3D 2JNWA 2SNIE 3HADA 4UE3S 5EJIA 5C80A 1NNEA 3IOMA 2IK8A 4YT2A 3WHPA 1M7GA 3BHMA 4WBSA 5ITWA 3HVRA 4EJMA 4U7TB 4I50F 5DM60 2XLCA 2I2WA 5JTTA 4DDVA 2WF8A 2HF2A 1YRQA 1DO8A 2LNDA 2PL3A 5ILQA 2OQRA 1T5IA 1Z83A 2OORA 3GJ0A 3MGKA 1YZGA 2CL6X 5AIBA 4DZTA 5IFLA 4ZAFA 1U3CA 4INOA 1QXSA 2ZYSA 3R2JA 1Z3IX 1RVDA 3L46A 3VRHA 4UUMA 2QR3A 3ZY6A 2XVYA 4ZJUA 2OXCA 1PVVA 2IBTA 4KXFB 4M38A 1DC7A 4FHZA 4JLMA 2CJWA 1FSPA 2CN1A 4S0XA 1JAYA 4FIDA 3UVEA 4D9IA 1CUHA 1PGQA 4X1KA 2W2PA 4GR9A 2RHJA 4IX1A 4M9RA 4TQGA 1N8TA 1Y33E 1V4VA 2OD9A 2DFPA 4HXYA 5JNUA 5JMOA 2WM3A 2ZIXB 3F5FA 1NBAA 1H0RA 3G5MA 3BFKA 4IS2A 3ZHVA 1DO2A 3RLIA 2BR3A 3T7CA 3PEWA 3S2FA 4DMGA 3T9AA 3WBFA 3AUFA 4FD3A 3KWMA 3X1JA 3OZVA 3STUA 2JLVA 4PAGA 1NBMD 5CBPB 4WUTA 5EWLB 1ZMTA 1QE0A 1FUEA 1CUJA 2BELA 2YOGA 2ODWA 3CX3A 2PXXA 1U0RA 4NMWA 2R48A 2ZB2A 5DCYA 2UDPA 3GW8A 1DV1A 1GLNA 2FY8A 3L43A 4MR8B 4ZVQA 1PV4A 1J0AA 3X1XA 4DNOA 3O91A 4NK4A 5JS6A 1F4VA 1L4UA 3PX7A 2G77B 4MWOA 4Q3AA 1FJGB 1NWCA 3D2AA 3O8OA 3ZD9A 4ZVUA 3RWMB 4IJVA 4KPYA 3BERA 4PY2A 3CUSA 4RFVA 1JEQA 1SG6A 1WUKS 2CDNA 1A2QA 1TCAA 1ODLA 3O9VA 1IJEA 1GEEA 4GL4A 3UF0A 3UQYS 5K8TA 5J1TB 3FUVA 4YV0A 2I2BA 4W5NA 3EPRA 3BGVA 1OXSC 1P9WA 5K3FB 3OE4A 4JI8B 1NKVA 1RDFA 2V55B 1PK8A 2OAQ1 2DZDA 4LXHA 1BX1A 2ENWA 3EQ2A 3VHLB 3OECA 1JEAA 3LY9A 5KCMA 2QD4A 2BFEA 2I3AA 3DP9A 4RTJA 1MJNA 4GM0A 2ZCJA 1VE6A 2IYFA 3OZWA 3UV7A 4CFYA 2O1SA 4KL8S 4KSBA 2SKDA 1EBUA 4MV8A 2JCGA 3L92A 3DGFC 1BH6A 3A6JA 4G2NA 3VM6A 1PJZA 4O0MA 1N6LA 4M8KA 1E92A 1U0TA 2BIFA 5D3MB 1AHHA 1B8NA 3QF4A 1NW5A 2VDMB 1OLSA 5EJ8A 1G3QA 4Q1DA 3V7YA 1MIHA 1YDWA 4EHIA 8ADHA 2YWJA 3R7DA 1UIRA 1U2QA 5K20A 4Q5IA 2O2YA 2HK9A 3LH5A 1L5NA 2IUUA 3C6QA 3WYGA 3AMVA 3OX2A 1C8LA 2OBLA 2P4SA 2VAWA 4R1LA 4A4DA 4B3FX 3U4QB 3TXAA 3GJ3A 4D82A 2R8OA 4R8KA 1MIOB 2N9UA 5C46F 3A9RA 1QQAA 4MA5A 4KXMA 1Y8QB 3E5HA 2EKQA 3E70C 5TT1A 3A1CA 2VF2A 2Z6VA 5JZSA 2GK4A 1W52X 3DCJA 3FZQA 3WO1A 1SA0A 3ZK8A 1U3TA 1WXIA 2ZITA 3G88A 1OC4A 2VBFA 2XTMA 4MRSA 4KPUB 2P0YA 1WKBA 3G7UA 1VLLA 4QG3A 4NY1A 1SURA 2QAGB 3GLHB 3BGSA 3KZMA 3VKGA 1QZ3A 2ZIUB 1WVGA 4HEHA 4RIEA 4PE5B 3U4MA 4E7OA 3HJUA 5HGXA 1ADYA 1LFAA 2IYYA 4L51A 9MHTA 4AMUA 2R00A 4NMMA 1J8QA 4RVFA 2D59A 2ZKIA 4CUKA 2XNDD 4Q1AA 2Y68A 4RK5A 3WLAA 2JFFA 4GGPA 4DREA 2RFLA 1EJ6A 1B6TA 2GZ3A 1QWOA 2EBUA 2PR7A 3GAZA 1TGYA 5LQSA 3KUKA 3TINA 5ED4A 2F3SA 3W9SA 2I3ZA 1U7UA 5BNIA 1DIRA 5LP1A 3WYFA 3G0BA 4XVUA 4QDXA 3OT1B 1R74A 1QIKA 2VDUE 2VQ6A 3SVZA 3VOBA 4Q01A 1NDUA 1ATIA 1OAOA 2QG6A 3VYRB 3AW8A 2AD5A 5AM3A 3K6JA 5T4EA 4D4HA 2Q5LA 3WGHA 2F43B 3WSTA 4DWWA 1J7JA 3ZIDA 4A0QA 2NZXA 1UT8A 2Z08A 4IW3B 2K7ZA 3PWTA 3HEMA 4MGEA 5JO0A 3R9WA 2R751 4RMHA 5LFAA 4A15A 4Z3DA 4Q02A 5A9SA 3IP8A 5FWXA 4AJHA 5LMCA 1EX1A 4HMQA 1T1SA 5M04A 1VL5A 4KR7A 2QJWA 3N07A 1YDMA 5A04A 4ZI7F 5EPEA 5I9NA 3K05A 4HHEA 4EKGA 2B1GA 2PKYX 4AZSA 1T9GS 3LW7A 2YCLA 8GPBA 1LPOA 2CZQA 4KG7A 2ATIA 4K6MA 5I3ZA 4I4TA 1IN7A 1O97D 4Q12A 2AW3A 3LO8A 4WLVA 4DMLA 1X19A 3DAHA 1XWFA 2D5LA 3M4ZA 4HZGA 3U7EB 4B7ZA 3K2QA 1M2HA 1SHLA 3IP7A 1EUCA 4H7PA 4MLZA 5CVJA 4RSHA 1G8SA 5ALQA 2HN9A 1O9GA 2C7VA 4IDNA 2HQSA 3AU8A 1DADA 3K1TA 3LBIA 4PTYA 1FS6A 5DHTA 3D0RA 4J29A 3PR1A 5EP3A 6ADHA 1QCYA 1G7SA 1UK9A 2P3OA 5ADVA 1MPTA 3MJFA 3OF2A 1ARZA 4OQMA 3U1VA 4DJFC 4EABA 4ZO7A 4PSCA 3NHWA 4CMJA 4Y1RA 4HEJA 2FFHA 2W6NA 3WK9A 4LV5B 5ALWA 1P1RA 4CKEA 4LTMA 5BV1A 2ZBQA 5DH9A 4DIKA 1P6UA 5BUCA 1DQNA 1DE0A 2IXAA 5LLSA 4QUHA 3SPXA 2XIQA 2FZ5A 2QUAA 2WSMA 2WUDA 4LC1A 2RMKA 4DUGA 2GLUA 1FFHA 4DLRA 3ZQ6A 5IC5A 1OI4A 1R15A 2HQRA 4H1HA 4JD5A 3LK6A 4RH1A 1QTNA 4YPOA 4BKRA 1QE3A 1X38A 4EGJA 2Z5FA 1YZUA 3LT0A 4LJ7A 3RT7A 5B6PA 4FE7A 3GGPA 2C5HA 3WG9A 1SGWA 4PPNA 4IQ8A 4F1JA 1SHZA 3C3CA 4TVKA 5ERYA 4CIYA 1N78A 2NNWB 2I7CA 4JK3A 3LAWA 5CFZA 4GX5A 4FLMA 2PVPA 2JANA 2AF3C 2V7GA 3PPIA 1O94A 4F5EA 1RWPA 3DXXA 4FMCF 4OJYA 3M3PA 4UNQA 3QU4A 1VHDA 5AUPB 3WLFA 4GO1A 1LV7A 3E2MA 1JAHA 3AM5A 1ZK3A 2P9JA 3BXXA 3TLKA 1HZJA 3GELA 3HCPA 1M5TA 3KEOA 4MS3B 4Q9IA 2DE0X 4G5RA 3LM8A 5JSYA 2PZMA 5DN9A 5J4HA 4JV5B 4CMHA 1UQUA 4L75A 2HA4A 1EFLA 2P1RA 4X3CA 3FZGA 1SEPA 4BEVA 1FFSA 2XPCA 3SQDA 4RELA 4OQFA 2Q49A 4URUR 2P6OA 4BXOB 2PXCA 2BISA 4ZREA 1YB4A 3FFWA 5D5HA 3A6EA 1CY6A 3W8DA 3ZBTA 1OSNA 4L02A 5IKOA 3U19A 1ZSVA 4CKCA 2ZTVA 4PLYA 1W1UA 3PDHA 4MYSA 3D9QX 4N6GA 1MLDA 3MBOA 1RYEA 2PPLA 3TZCA 3PQ3A 4NZYA 1T4DA 4BQQA 1VFPA 2FGJA 1H5QA 2GDJA 1FNBA 1WCIA 2FWBA 2FR1A 2FETA 3NUZA 3O2JA 1CUVA 3HS3A 3ZI0A 2CLLB 2QWXA 1UANA 3GJ8A 3NHRA 3SF8A 2OE2A 5B53A 3CZ9A 2OG1A 5A5FA 3ZU6A 1OBCA 3I4FA 3EG9A 1FLVA 3OBBA 3V8EA 1GRNA 3MOIA 4B76A 3ROEA 3DUWA 1BWSA 4GZ5A 4CEHB 4GLFA 4P9NA 3VAZA 5AVXA 4IH1A 3RS3A 2H18A 3L1IA 1O4VA 4DS3A 1AS3A 1PSWA 1K6MA 2XSZD 2X76A 4IOJA 4QRDA 1I7LA 5AXAA 2IRWA 4POOA 3FYCA 4OX9Y 1O6ZA 4OKNA 3O4IA 3UBTA 1D5WA 1DWQA 3WKBA 4A8PA 3D7MA 3DE2X 2VAXA 2YL2A 4F91B 3DKPA 4KMSA 2CJXA 3BIJA 2WV9A 1RMTA 1NW7A 4O33A 4MYRA 4EUNA 2VHWA 3MPUA 4J0CA 3ZXXA 5KKAA 4BFSA 4WOPA 3AF4A 1P19A 4UCWA 4MCHA 4X93A 3L01A 3ABRB 3Q41A 2B2XA 4PG4A 2FPIA 2DVMA 1H9AA 3FCXA 4MRPA 3BE8A 1DC4A 3RVBA 1J9ZA 1GSHA 5HJ7A 2HT6A 1QTQA 1D09A 2QW8A 2WW8A 2CLOB 1CE8B 3A9UA 4YDRA 3SXUB 3KHKA 2BMVA 1IM5A 1AUQA 2DPXA 2XTZA 4W63A 3CBQA 3THSA 1QX3A 1LDNA 5DBGA 5SYNA 4PZYA 3D3WB 1D0SA 3CWQA 4YYZA 3IAEA 4WKOA 3DEHA 2CYCA 2OBNA 2OB2A 4Y9TA 3GG9A 4EO9A 3AC0A 3B2EA 3CLUD 4UVIA 3ZIUA 2PD4A 2VTBA 4XOIA 2Y76A 3RLFA 3AEUB 1G291 3M2TA 1GIAA 2OFPA 4WUVA 2VDOB 1JEEA 1B8UA 5FTKA 3TTYA 2FXVA 4Q9NA 1U2RA 2X58A 3NOOA 1YCGA 1F2UA 4C4ZA 3A10A 5DHPA 1QHNA 3B6JA 4XD2A 4RF3A 1ZAYA 4FYVA 3E3NA 4ALLA 2W83A 3V4PB 4CKBB 2D5AA 4V3CA 1YJCA 1H9BA 3G9TA 1BYIA 4M9SA 4X0EA 5DYIA 3TMYA 5CVTA 2WUGA 5EJ7A 2QZPA 1BGWA 2WR8A 3QFCA 4MRVA 2IY9A 2FG5A 5G2OA 2GKOA 1EX6A 3X1KA 1CRPA 4BNDB 3EN0A 1JDTA 2NTNA 4E70A 1OAAA 4C4OA 4ARSA 2YINC 3AWDA 3LQ2A 3V5NA 3PPXA 3HV2A 1JPVA 1QMGA 3JQQA 4HRYA 1VA5A 1XCPA 4YY3B 1WHTA 5CPFA 1QV7A 3PRKE 4JDUA 3TD2A 4YMTA 3V4ZA 4Q4JA 4RTPA 4B7AA 4MW5A 2GN4A 2Q0HA 4A3SA 2C03A 2WSYB 4RY0A 1BA3A 3TECE 2VP2A 3USES 4DIBA 4JI2B 2JPDA 2EP5A 3FGPA 3K20A 3TPCA 3WIEA 2CLFB 1ILEA 2M2IA 3ADOA 1A3CA 5EMNA 2OR3A 3BYZA 3GIDA 3UJBA 1NX6A 3K0SA 1IBCA 4P86A 1EWVA 3QRWA 3IPLA 4P7GA 3SS7X 1X6VA 2I6SA 3RRJA 2HO4A 1LEHA 3A58B 1E69A 1WDMA 4DG8A 1CF4A 3LFUA 2JCYA 2Y99A 2Y0DA 3GY0A 4PGGA 3M4JA 3FHTA 3NASA 1QVRA 2JEZA 5P21A 1W0JA 2V5AA 1HE1C 1W9MA 1XRNA 3H16A 1Z5VA 2HCRA 3ZYCA 2RCNA 5F21A 1N8KA 1INLA 1VL1A 2PR2A 2ZUBA 3Q2KA 2AT1A 2IHKA 3AHEA 1XMSA 2B99A 2KLBA 1E61A 1W4ZA 2VSFA 4OAPA 5D3KA 3DEYX 3UAZA 3VR6H 4BDTA 1R37A 1WCV1 2EEZA 1W47A 1MB9A 1MX3A 1GKLA 1T3TA 2PZFA 1CT9A 4Y2HA 3W1WA 4RK1A 3G5TA 3WRYC 2VUUA 2VKTA 4PRLA 2BGJA 4ITVA 1BS1A 1J9GA 1KAOA 3PC3A 1WCYA 1VSQA 4OEHA 4PS0A 3TBFA 1P3Y1 4EYSA 5LQJA 3ADPA 3L8HA 3RF7A 4LK3A 5JYCA 1DSSG 1XPOA 3QW2A 3SJBA 3BEOA 2YVQA 2V3CC 4TXJA 3KJGA 3PENA 3VO9A 2FE4A 5CDUA 2V74B 2IIPA 3IIIA 4JC5A 3A8TA 5C5CA 2H9IA 2I6QA 4N3CA 4F3YA 2HNBA 5HZKA 3OOWA 1MOQA 3P9IA 4HDCA 4Z7NB 1C29B 3UJAA 4GE3A 1V3VA 2GEUA 3HYSA 1JALA 3CW8X 3F5QA 4MVJA 3EIXA 3GFRA 1I4EB 3QLTA 1CEXA 3G79A 1SBCA 2YASA 1R0KA 1CHDA 4UDXX 7REQA 2DT5A 4DUZB 3ZWYA 1EFUA 5C53B 2OGWA 3GDGA 1UOEA 5CH3A 3UK0A 3VR6D 1C3LA 2PSDA 3TQCA 4OBBA 3AFHA 4E5SA 4FSXA 4QNMA 1O57A 3B7GA 3L1KA 4R9VA 3FWHA 2C5GA 4JLKA 3KZNA 1EVJA 5CB6A 2Z98A 5JRJA 1X87A 2VAMA 4CV2A 1RE0A 1AMOA 2WWHA 3TGPA 4TSKA 1XV5A 4FPXA 3KO8A 1VLZA 3EDOA 3WRXC 2L82A 3VKWA 4HNHA 1FFYA 3DOUA 4PC2A 4OI0A 1TZJA 3FDZA 4JOQA 2CLIB 3DPSA 1JWAB 1TQ2A 4Q9LA 3U49A 1QYWA 1XMQB 4C7OB 2HJGA 3P9NA 1P29A 3C7DB 4X7PA 1SKBA 1TM4E 4C4YA 4JB3A 1F20A 1NNLA 3ZN2A 4PQFA 4WFJA 4BVEA 3GLGE 5HF8A 3VPSA 2IX3A 2O2DA 3V7NA 3KYDA 2HLDA 5A4JA 1ZCFA 1QORA 1BQ3A 1E3IA 2VTVA 2YS6A 3VH3A 3T0GA 4IJUA 2Q07A 1R27A 2IZOA 2R6CA 2Y9MB 3R5JA 4POAA 4U1RA 3VHXB 4EZBA 1E79A 3VDRA 3VUEA 1ZJ4A 5FI5A 1RRPA 5DKFA 4YRRA 1TAGA 4FGSA 4YNBA 3C3PA 2J6BA 2GFQA 4GR4A 4DSNA 3GUZA 2G1AA 4KR3A 3ZZMA 3PCRB 5IN5A 1QFXA 1ZKMA 4U7HA 1DC8A 3NBFA 4LJLA 5EN4A 3CMCO 4M1YA 2NSDA 1RLOA 3Q2IA 4Y0VA 3GFOA 1OWPA 2PLNA 3E8SA 1KIMA 2GF0A 4EK9A 1JRLA 1T2FA 1DKRA 3M0EA 4J2OA 2Q8QA 3KJZA 4NMHA 1FP4B 2R86A 3THXA 1HX7A 5JJIA 2AQKA 4JI4B 1ZRHA 1PV2A 4MYTA 4LECA 2UUBB 1T5DX 2A5YB 1M2FA 2O5RA 2BFNA 4BX8A 4EB6B 3Q3GE 4AZ0B 1V35A 4LRXA 3ZU5A 4QOFA 1GG2A 4PS1A 5A4IS 4LXTA 4RVOA 4O63O 5AIAA 3TQTA 5EIBD 1AG9A 1FZQA 3UMMA 4NBUA 1TF7A 5FJJA 4R0NA 1VZ3A 2OCKA 1I6MA 3A11A 3DGEC 1Y81A 4J16A 4TRJA 4E4TA 2G1UA 3MWEB 1Q1QA 4L5CA 5FWYA 2Q6TA 2FWPA 3DUFA 3UOWA 1EUDB 2FSVA 3R6LA 1YA6A 3A4MA 1YRYE 1Q44A 2VH2A 2FPSA 1ZBDA 2FWIA 2VP4A 3PJRA 2BZ1A 3CLTD 2PBZA 1H2RS 3PX3A 3T1NA 1PZXA 4HV4A 4XWAA 4OM8A 2TSYB 3MMSA 3MINA 3QPUA 2HSJA 4ZRDA 1SOMA 3O31A 2ZRGA 4LOJA 2A5FA 2ZT8A 1PQYA 4H08A 1RYDA 3W3AA 4BGDA 1NVWQ 1I0IA 4AF6A 1OTYA 2APJA 3GNSA 1QRRA 4IL5A 1I3KA 3E7XA 4IF4A 2QM0A 5FYDA 4K2HA 3UQZA 3V1MA 3V4LA 1F17A 3P2JA 5KQMA 3FGZA 4KH0A 1EP3B 5EQTA 3RVRA 2A2ZA 2MR5A 4PAQA 2Q5IA 3UMGA 2RHWA 2QN8A 3H8VA 2OBXA 4XM1A 4AULA 3MQ4A 1PEDA 3EYWA 3QY0A 3TM5A 3I5UA 5FOSA 5CJJA 1SY7A 2D2FA 4MINA 4XA8A 1GCGA 1OWLA 1GGVA 1AZWA 3BB3A 1NPYA 4X90A 1XZEA 4PC7A 1IK4A 3HSYA 4UBIA 4D57A 3WIOA 4A6XA 5LJIA 4KACA 5MFZA 1GQOA 2VZEA 5CLFA 4G5QA 3HYCA 4LOKA 4JSTA 3ROXA 2GAOA 3V7UA 4A8JB 1EE9A 4DGQA 3GZ4A 1XF1A 4S1TA 4BIIA 5KJ1A 3P26A 4FMPA 5BW4A 4K05A 5TY0A 1Q1NA 3WLJA 4L6CA 1CRZA 4URYR 4MLCA 5IH3A 3K30A 1A4UA 1UAAA 5F77A 4EJFA 2JLRA 1QTRA 2GEDA 1KF0A 1XZBA 4JYMA 3PTAA 3N87A 3ETLA 1KWGA 4KR6A 3U9SA 2I7DA 4AWXA 4EIWA 1AUOA 2RKBA 2FZ4A 3D8BA 2UU9B 4F3RA 2D5CA 1Q5PA 3E9YA 1JQEA 2VC2B 2FK8A 2Q6LA 2NXJA 3HBLA 4HGOA 5DPMA 7ABPA 3GLFE 4FYIA 4JI6B 1FFWA 3NKLA 2HHLA 4LV8B 4CI9A 2JLZA 3WLLA 5DNWA 3EXG1 3I2IA 3O8OB 3GUYA 4DJJA 2JGLA 1A88A 1RAIA 4LVUA 2IHVA 3O8RA 1VM6A 4JJ7A 2QTTA 1AXEA 3G7SA 3EVEA 4HRAA 4M9CA 2EFJA 1NBMA 1QRAA 2X23A 3JSXA 5GJCA 3CYFA 1IWPB 1NBWB 3ABQB 2ZVPX 2PTHA 3DFKA 5EESA 2CF6A 3S2UA 3GFBA 1RYYA 1X1BA 1RRVA 2GXSA 4ZN6A 4CIBA 5HVNA 4YLYA 4UARA 2EJTA 2XKAA 1X0VA 3GB9A 4ENVA 1S3IA 3QUCA 4JBNA 4G25A 4RZ3A 4BP1A 1OZFA 2XYPA 1E1DA 1KXJA 1NRXA 2GASA 2PAFA 1KS2A 2PKXA 2BFEB 3DL7A 3NDJA 1V43A 4ZJYA 5BUSA 1LPMA 1IY0A 1RRKA 4JVSB 1IVSA 1ZLXA 3IKMB 4GC9A 1WF6A 1TCVA 3NRJA 3BCRA 1K7EB 3WKDA 1EVQA 3DPIA 2WZDA 2R6FA 3DLHA 3AFMA 2C9CA 2P2NA 3CGWA 4HG2A 4JL6A 3PEUA 4O2BA 4PYIA 2Y9PB 2NADA 3GRYA 4M4SA 1WU7A 4H4DA 4Q1EA 2CSUA 2DPHA 5FTWA 5C37A 3ZR4B 3WLHA 3LBNA 2MSKA 1AGPA 1GP2A 1JYFA 1MH1A 1U2TA 2GT1A 2X5OA 3QF4B 1OLSB 4TV9A 5I5GA 3I09A 2AZTA 5BQXA 3FF1A 4I2VA 2MJLA 3KB8A 1E6MA 1AQLA 5BWMA 2PT7A 4PYJA 5KIAA 3PQ5A 4TRRA 1LKZA 5LYJA 3D7SA 2Z8ZA 4GFDA 4W9NA 1U9ZA 1UEXC 4B84A 4C7BA 1M1XB 3A04A 2HO5A 1EI9A 2CHGA 1WKVA 4DM3A 4IRUB 1KK0A 4F5WA 5JCJD 1B73A 4ALNA 4G4GA 1DELA 2OFWA 1CERA 4Q1CA 1SA0B 4GX2A 1NP7A 2IOYA 1TAHA 5JALA 1TEHA 3P2KA 3F5MA 2GXAA 2WF6A 4LY9A 1PYOA 5E6UB 2O8BA 5KHOC 5D3ZA 4BECA 4U63A 2YVKA 2VNIA 1POWA 5G0WA 2M6KA 5M5BA 4R8LA 4BN0A 2F3RA 3G1TA 1M8PA 5C8ZA 1E18A 1LXCA 2GA8A 3LBAA 3USZA 1SO8A 1TF2A 3BORA 3PFHA 3EEQA 3KK0A 1K75A 1KQPA 4OXXA 4B6SA 5HM8A 1QO0D 4AK9A 1PJ3A 1U7HA 5I9LA 1KPHA 3VO8A 1E9EA 4IX9A 4GM4A 4AN1A 2R4UA 2J0QA 4QWWA 2I65A 1BXKA 4LZPA 1RQPA 4MGYR 1R5OA 4FMDF 5A6SA 1W48A 2XWBF 1VBKA 3CUEF 3F6BX 1CCWA 3UCEA 4KWIA 3WAJA 1VPVA 2H5IA 3WWOA 4BO5A 3CG4A 1KH2A 1M6YA 1ZN8A 3ZE9A 4N76A 1JEOA 1P80A 3LWNA 2C3OA 4OTZA 4C88A 1O5OA 1JR3D 2HF8A 2WSSD 2QYHA 2P9EA 4RVHA 4B7XA 5JNVA 4EJ6A 3TKLA 3WFIA 2CLHB 5E1MA 5COQA 2DWQA 4JB0A 5AKEA 5A9SB 2NUAA 5DGXA 3VU9A 2AR7A 5BSVA 3K8YA 1B42A 1KC1A 1OY1A 2Q8PA 2V7EA 2QRQA 4PRKA 3DS8A 5L3RA 2BGNA 4MI9A 2XQVA 4G0QA 3UUGA 2P40A 2Y2UA 4TTAA 1W581 2VUHB 2XBLA 3HXQA 1OW3B 3IUEA 1KSGA 2VO1A 1IPFA 2CL5A 4I4TB 4X1IB 4HO1X 4NPAA 4KBGA 4WERA 4PLZA 4S35A 4RVCA 2OQ2A 1P2FA 5CW1A 5CLLA 4EHNA 1VIYA 3GEBA 4PAMA 3SFVA 2WABA 3O9ZA 1KDYA 1C4XA 1HL7A 1EUCB 2WTBA 3CRZA 3EXIB 3HKCA 5KQSA 1G60A 1SHJA 5HNKA 1KU6A 3AVUA 4OATA 4G0MA 2ZR8A 2ZYWX 5EJ2A 2CCJA 5EIFA 3ROTA 4IEFB 4YRIA 3ELUA 1KYQA 3DMHA 4TKMA 1COWD 1XTBA 1CNFA 4EG7A 3BSYA 3HPRA 3QVSA 1Y63A 3PGLA 1EDZA 1HT1E 3OLCX 3NC0C 1R8QA 2BTOA 3BMQA 1I2AA 3N3BC 4KYVA 4LJ4A 4Y1RB 3UAWA 5MHTA 5DM0A 1UFQA 3B2NA 3D64A 1PU2A 1XFAA 2Z9DA 5DGIA 1HDRA 1N1EA 1Z8NA 2AFHB 2J7PD 3QWIA 3EUEA 4MS4B 3OIGA 1NW8A 1OI7A 2G72A 3AV3A 2GTIA 4CFZA 4DABA 1OYYA 2GPJA 2JLAA 3REOA 4BTLA 1RXEA 4GHWA 4E03A 3L5OA 4M83A 3TSOA 2Z2JA 2AC4A 5B7QA 5AVSA 2GYYA 3AVVA 1NQ5A 1KEEA 3QKRA 3I2HA 3HV0A 1HT3A 4W82A 4DQXA 4F97A 4YMVA 3OQBA 4LOIA 1JJ7A 1VE5A 3BHIA 1OWMA 2H5JA 1N9ZA 4KDFA 1J06A 4NJEB 5EZQA 2RK6A 1U2DA 5LQKA 4G01B 4TXLA 4EO4A 5AUQA 1X3LA 1Y9EA 2EFDB 1AM4D 3TK1A 3AYXB 3R5HA 1NM5C 1OTXA 4UZEA 3ST7A 2G88A 4Q05A 1GGHA 3FTEA 1E0SA 1D4AA 4ZDJA 1EKXA 3Q85A 4YQEA 3V4FA 4YV1A 5C5EA 3HP1A 4QM7A 3WICA 4YAUA 2OBBA 4CQLA 1MR3F 3HI6A 1I9CA 1OX6A 4OHMA 4DMFA 2HYIC 1SNYA 5EJ4A 3GP3A 3ROQA 2YIDA 3C6XA 2JFXA 3CMMA 4TMXA 3K70C 2FZEA 3EEOA 1FL9A 3H2SA 3MGGA 5E4FA 3ZDZB 4Q1VA 4XCVA 5AP9A 3ZOKA 3SD7A 3K7EA 4EFNA 3GEDA 4NAUA 2N46A 2UZ3A 4S2UA 3VO1A 4E94A 1KWKA 3OMWA 2GEVA 4CKCB 1E9CA 2AMJA 3A3PA 5K0TA 3FMFA 2PGDA 4N1AA 5C1OA 4PNPA 3HY3A 4MP3A 1A5BB 3B20A 2EERA 5FNVF 2UYOA 1WCIB 5EAIA 1XQWA 2IZ5A 1YRBA 3DHNA 4CUJA 1HDCA 2ZTMA 5HQ3A 1N33B 1Q7GA 2I6FA 4HH3C 4QEDA 1NFFA 3T1VA 2WSBA 2WTNA 4RUKA 2F3TA 3LE8A 5F3DA 3TQOA 4E88A 5A3JA 3B82A 1KDVA 2AI1A 4R6WA 4YIHA 4MHTA 2VUIB 2PZKA 3IUSA 1UPCA 3MTIA 4IV5A 4M0MA 5FBQB 1VG0B 3B7PA 1ODTC 4GX0A 2R68A 3E53A 4JBLA 1PGOA 3WFJA 2E37A 4MUGA 4OHYA 1KL7A 1YQEA 4P81A 1JYSA 3E05A 1MEEA 1T6XA 3IV7A 1Z4IA 2YICA 3CT6A 4LMBA 5ESDA 3ZH2A 3TLAA 3ZHQA 1ZHOA 2BM9A 3OQ6A 1UFOA 2JGRA 3LLSA 4DLKA 4R68A 1DLIA 5EIHA 3CRQA 2JVIA 3HCWA 2ANCA 3UHOA 4DC9A 3BB4A 1HT2E 1OFIA 3AEQA 5G02A 1GGMA 3ZU2A 1KZGB 4FKBA 4J6EA 3MWYW 1PVOA 5LQNA 3NJ4A 1XDDA 2KYRA 4RPGA 2FPIB 4P7KA 1GFSA 4OK3A 3GBSA 3OD5A 2AXPA 1BDBA 3CCFA 4YJDA 3DOCA 4ZODA 5DX1A 1P75A 1Q12A 2GESA 4JGIA 5YASA 1XTRA 3B6IA 2H85A 1PT6A 4QDTA 2XI4A 4EPTA 4TUYB 4KQXA 4MVXA 1PR1A 3H83A 1HE2A 1LVHA 4YJHA 1WVMA 4OQYA 1II0A 3RBVA 3KB6A 4DSUA 1HOTA 5G1PA 5INTA 1QMPA 3TR5A 4RHTA 2H31A 1E9VA 1T8PA 4P33A 4UDNA 3QNMA 5GONA 2F8LA 3RS5A 3FUTA 4QPJC 1JF8A 4L16A 4FC7A 1GGFA 3ECCA 4TV8F 4QATA 1TEXA 4WEOA 4ENPA 2GEFA 3H9JA 1EK2A 4B35A 1JA9A 2IYLD 1AV6A 1F2UB 2UAGA 5HDQA 3ANLA 4YRAA 2QAIA 1RE1A 1VRWA 3AR9A 2D2IA 2VP3A 4W99A 3BWDD 1KP3A 3C14C 1SQ0A 3LBHA 2PGLA 5H81A 4RFLA 4MX8A 2B1QA 2GM3A 3HFGA 5ICFA 2V98A 3UT0A 2PRKA 4LRTB 1R5NA 4DDUA 4D3YA 4ZQEA 5BNTA 1JDSA 1Z5UA 2FTKE 3KJXA 2P9HA 1FJ2A 2JI4A 2R6HA 1E1KA 2I67A 3OT4A 1XP8A 3H8WA 4MGKR 4ARBA 4YRZA 2YVAA 1K5GA 1LFDB 2H1WA 3T5CA 1F5NA 1U5AA 1UXGA 1WHTB 2VSQA 3ELYA 3FAZA 4ZYWA 3CW2A 3Q7RA 3ER9A 2ZR0A 3EVDA 1J8FA 2W0MA 3D6JA 4Q4JB 3CCCA 3M6LA 1LCIA 3LVFO 2IH4A 4DHEA 4F4DA 2PUBA 5HRCA 4M6WA 3KXPA 3KEQA 2ZRDA 5THXA 4I66A 4YCCA 3HRKA 1FYVA 1IN4A 1I2MA 2C0CA 2ZWAA 3ACBA 3AP3A 3ZWQA 2GO1A 3ZLVA 1JU3A 2QSYA 2QENA 4PLCA 5F73A 1MHPA 3NOVA 4HNSA 1F7VA 2FRDA 4D25A 4UEWA 2C88A 4O4LF 1TYEB 4O2RA 1OBFO 1P9NA 2C54A 2VJQA 2XQFA 1NQWA 3SN6A 3ZS8A 4ZIRB 1DOAA 1YRLA 2VHCA 3SIRA 4EELA 2QN2A 2ZJ2A 3L1JA 3O7WA 4OU4A 5K1ZA 2A9PA 1ZUNA 3EYAA 1SVLA 3NT2A 1KDRA 4IG4A 3J80A 4EWLA 1UBSB 3PNQA 1I1QB 1FRVA 1HOXA 4F0JA 2D62A 5B30A 1L4KA 1XJWA 1SXJC 4QGAA 2PEYA 4K6CA 2AFVA 4NXNB 2F6RA 5ECYA 3AY6A 5J2UF 2W2NA 1PD1A 1PLKA 3ESBA 5LQAA 3R5FA 4IGFA 2FAXA 4DQLA 5L7TA 4LJ6A 2AXEA 3E1GA 2BEKA 4PC3A 3SQLA 1VPWA 2GUGA 5ANRB 5KX5A 2DXIA 5LQMA 1GSOA 3G7NA 3LUKA 1RRCA 2HMWA 1JE0A 2X1HA 2ZRQA 4TTTS 1VLHA 2NQ2C 4KIFA 1XXLA 2RI0A 2YXBA 4Z0NA 5H9VA 2WTEA 4GOMD 3UFXA 5CNKA 4YP1A 3RYFB 3Q8WA 4BAUA 1TZ2A 4MV5A 4C2UA 1QGYA 2FW9A 1UBEA 3DFUA 1QKJA 1S9DA 4C0AC 3M81A 1S2MA 2WIGA 4O25A 5IW8A 3M1AA 1XQVA 4MB6A 4RLFA 3SNKA 3FR7A 5G0VA 1AQNA 1L8QA 2DHRA 4B2PA 3T1TA 3VZBA 2WDZA 2XMGA 5AM5A 4Y7CA 2B4AA 3HVHA 3ZV7A 2XCRB 4NENA 2R84A 1TF5A 4J1NA 4V0QA 4RTQA 3IDQA 3DLIA 5A71A 1YRHA 1WLSA 4ZOLA 3OZGA 5A06A 1B0PA 2W37A 3Q6MA 3UHFA 4UTVA 2QMQA 1RQNA 2XUDA 1NYQA 4G26A 1E9BA 3NO4A 3G1UA 2WWTA 2VZ0A 1K2VN 4PU0A 5EZYF 4G4SP 4F4HA 1E1QD 2JIBA 1RAAA 2XCTB 4JBYA 4K6KA 2VPXA 3PQ8A 5DYGA 4BVKA 2G4CA 3IMKA 4L8YA 1FP6A 1Q2XA 1WNTA 1F9EA 2HSDA 1KEVA 1B74A 1YZLA 2QLJA 3H5RA 3IKTA 3A3OA 2IYPA 2ZBGA 4C3ZA 4E13A 2PK3A 1OASA 3QJYA 4AY3A 1I7DA 3ZHRA 1C4KA 1XL0A 1RI4A 5GJBA 3MHTA 3PLAE 3UJ3X 4Q47A 2Z43A 2H0AA 1PAUA 1QFJA 3A32A 1XJCA 3C4JA 3GJRA 4HH1A 4J6FA 5L3VA 2CYAA 3MRSA 1T8WA 2IEDA 5U4QA 1MZVA 2WE7A 9ATCA 3GHYA 4G67A 3EMKA 1NWHA 5LIRA 1Z12A 1X42A 5AK0A 3OEWA 3ZZUA 2G0NA 3UA4A 2G9QA 3PQ4A 2GXUA 2QLBA 1XEWY 2AIRA 4G56A 5T64A 4PSUA 5EZ6B 1T9BA 1U3DA 1YI1A 3HU3A 3AETB 3KTAB 4FFMA 4N82A 4RM3A 4TN5A 1UADA 4E6PA 1V4NA 2GEKA 5D3QA 2PUFA 1BJKA 4QRIA 2Z5GA 2D3TA 2J9XB 4H1VA 1HFKA 2Q2OA 3S2SA 5FBRB 4TTPA 4CF3A 4YAIA 1AIPA 2G9UA 1U90A 4GUAA 2PS1A 1KO7A 2CW5A 1RZVA 3D81A 5HBRA 1HZZC 2YUTA 3DDNA 3JZFA 4LW8A 2Q7DA 4JI1B 2WTUA 2AH5A 3I0ZA 3MWJA 2AFIA 1PNOA 3EISA 4R2IA 3ZHOA 1N6NA 4U2KA 2AJTA 1P5JA 2X1VA 1VPTA 1IN6A 3L3BA 3LCUA 4FSHA 2P6MA 5IDQA 1P1KA 1BGVA 1UPXA 1K68A 1UBLS 2R3SA 3BXOA 3EA0A 4JWTA 5LP6F 3VX4A 4E2ZA 1R6UA 2XMDA 3THXB 4Z7JA 3UC9A 2NXWA 3AR6A 1GVHA 5D85A 4N8DA 3I52A 4R1UA 4L78A 4DCCA 1JDBB 1RWMA 3I04M 1QHEA 5ITVA 3C6MA 1T0BA 2IHZA 2JLXA 5IEJA 3TLBA 4EJSB 2XE6A 2RGCA 3HR4A 4R16A 3TDMA 3HBAA 1AS2A 1IH8A 4GQBA 1S7GA 4ZO4A 2W93A 2RAVA 1H2ZA 3I2GA 4N8EA 3RC1A 2QROA 3W7VA 2XDAA 1L5GB 4EG8A 3PI7A 4HLNA 3FGNA 4MRMA 1RWQA 1V1JA 2OEPA 4FHCA 3WX0A 1CETA 1FTSA 1WMEA 2ASVA 2O3SA 4UD2A 4XXHA 3RUIA 2EYQA 1I0ZA 3BA1A 3NI2A 4LSWA 4RO0A 2QUHA 1WD5A 3BF8A 3DUFB 1OGYA 3WAKA 4G0UA 2NP7A 3GQBA 3STXA 1CP3A 3HUFA 1J20A 4X8HA 2WIBA 3X44A 4YR7A 3TPFA 3OKAA 4AMBA 1MHTA 3ET4A 2QRUA 1H8EA 3PT9A 5AK6A 4ZQIA 4V0RA 4LGYA 1GY8A 1B26A 2P5YA 4MKHA 4RNDB 5F2EA 3RHSA 4KVFA 1E7RA 4ZYUA 1LNZA 3MINB 4D44A 3KG2A 4MRAA 4OQ4A 4X7MA 4XB1A 5SICE 4GWLA 2FW8A 4D0SA 1F0YA 2ESRA 3H9QA 4EA9A 2OXEA 2YJ6A 4X95A 2I29A 2IZ1A 2IZ7A 3QU9A 4Z9AA 3KHSA 4RDCA 5ALEA 5F5NA 5HIIA 3OLQA 4X6XA 3WNZA 1CS0B 4PYLA 4CT4B 3NALA 3H7IA 2H92A 5EE1A 3NGMA 1V0JA 1RCUA 1Z4QA 2H11A 2H1SA 4PZLA 1OCEA 3RYIA 3CKLA 2ZPTX 4FMBB 4BEJA 4LMPA 4F6RA 3GR6A 1OT3A 2VHTA 2NZJA 3BAFA 5BQPA 1Q95A 3HGTA 4R6XA 3KEGA 4AN4A 2OK8A 1W30A 2C9MA 4RZUA 2JI7A 3OEYA 4X61A 3TL3A 2CCKA 4ZWNA 1AGRA 3UWMA 1QR2A 1Z9BA 4BO1A 5TQJA 2IV2X 1D04A 4N03A 3R0ZA 2ID7A 4YWHA 4AIIA 4KQCA 4BN4A 4MPRA 1NOIA 2W71A 4MMXB 1YR2A 4BZWA 3PDJA 4ALJA 1MABA 4OU5A 2VHQA 2IS4A 1PR9A 5BXQC 3L7NA 4YRQA 4RCZA 5JDIC 4BJ3A 3G8AA 3HNRA 3ES9A 4REQA 4UU8A 4NYIQ 3VR4H 7MDHA 4ZQHA 3OEED 1E0DA 1XVVA 2KHZA 2WD9A 2IUEA 2OENG 2OHXA 2XWJI 3B9QA 5D1NA 4CKWA 5AVVA 3ESCA 3V6MA 2ISSD 3A9CA 3AHFA 2V9ZA 3DO6A 1X1RA 2O2ZA 1U0LA 4RXTA 1JDJA 4P3NA 3H9EO 1FBNA 4AS2A 2DM6A 1I14A 3WNBA 3NOQA 1N7IA 1MENA 2BM0A 4PZAA 3HGMA 3R5TA 1PQWA 5CT9A 4DFDA 1PJAA 4RORA 5DCUA 2VF8A 4JJZA 4GOJA 3G9XA 3JQGA 4M22A 2CZGA 4G4SO 2ATVA 1EBFA 1FSZA 2MR6A 3HZRA 3JD2A 4IIJA 3DJYA 2PYDA 1S3SA 4HX5A 5HCNA 2YRXA 1IBRA 2OBYA 4LKOA 1D7AA 2OO5A 3FPHA 3DE0X 4FWIB 1YIAA 4QU9A 2PD3A 5FBWB 4GIBA 1OU4A 2JATA 1R9JA 2Q6OA 4C6RA 1U0BB 5PGMA 3HJNA 3RVNA 3WWZA 1Z5GA 5CIYA 1YF3A 4WZBA 2E4AA 3FROA 1G63A 4IVRA 1OPXA 1WL8A 4IIGA 2PHZA 2FPPA 2PFKA 4IY1A 3RDPA 5E9JA 5K2OA 2Q4TA 5KZMB 3QVJA 2ZAMA 1UINA 3AUUA 1ESEA 2N1MA 3JCZA 4I1VA 4OLHA 2QRMA 2VTEA 1K7SN 1XMJA 1TADA 2ACVA 3EPKA 4NYIR 4B82A 3CEAA 3IKLA 3ZHZA 5KPJA 3L8FA 1YJQA 1BE0A 1I80A 2OCIA 1QK4A 2CDCA 5DCWA 5THQA 2X0EA 1BYUA 2FDXA 2ZAYA 1SKUA 4B8WA 3ZWOA 1E2QA 1JH8A 2ZI6A 2I66A 5EXPA 1ZD5A 3NYWA 4E2WA 3P0IA 2IDJA 4I9GA 3FNRA 2X42A 2GCNA 5BR1A 1TRHA 4TV9B 1YJXA 1Y5NA 1XLTC 2HSZA 2ZB8A 2O7RA 2ZJYA 1EZ4A 1WCXA 2VUTA 3OJEA 4DXDA 1IHOA 1W34A 1GCUA 3WA6A 1P3DA 4J2TA 2PQMA 1N6RA 1KZYC 1K98A 4W9MC 2VF5X 2I4RA 2QD5A 4NU0A 5DWQA 1E6WA 3BMNB 5HE8A 3H04A 3W4KA 1R8XA 3UM9A 3BUSA 4GVPA 4AUMA 3BGIA 3G2IA 4Q1BA 1ULTA 4BB6A 4BO2A 3NTXA 2FWMX 4DV6B 1ZFNA 3BE6A 1Y1PA 3EE6A 3RJ5A 1NBOA 1D6JA 1FF9A 2W90A 3QVKA 4KN5A 3FMGA 4M0EA 2VOEA 1EWYA 3RVKA 2E1RA 3Q3EA 1NR7A 4XYEA 4EJ0A 2FMUA 4LRQA 1UR5A 3F7TA 3I2JA 1YZVA 2E82A 5A3SA 3RK4A 3W6UA 3BTSA 4DUPA 1W76A 1PFGA 3BAZA 2GAJA 2L69A 3BRWD 3IMEA 4K86A 5ALYA 2OC9A 3D6NB 3TFWA 3UUWA 3EWNA 4QLOA 4DQKA 1PIWA 2VJMA 1ML4A 4G8DA 4URFA 4ZRNA 2VJPA 1ZEJA 3E0XA 5DWVA 3KOMA 4DR7B 5IVIA 3HKEA 4UOZA 2DCUA 3H9UA 3IO3A 2DRIA 2FV8A 4O2LA 5AKHA 5JCJA 5TT0A 3SC2A 3PDCA 2M9MA 2PT5A 2W2TA 4QXOA 4I14A 5JWRA 3RHZA 2UXBB 1BCSA 2AR0A 2EL9A 4DTCA 2XXJA 4DW8A 2X6RA 3B38A 1Y3CE 2KJQA 3L4SO 4BUCA 1XZPA 4DDWA 1A7JA 1P0PA 1R3DA 3L6RA 5ALOA 1LC3A 1PVDA 2PRJA 4J9UE 3OQVA 4ZEMA 1ONPA 2CLEB 2OG2A 4NFYA 3BREA 3BSSA 4Z8XA 5DXJA 2O3JA 3TBKA 1N2IA 4P7FA 5J2TF 5FULA 2BDUA 2YJ3A 4I6JA 3WIDA 1T6NA 3BKWA 3H2ZA 2PJUA 3VU9B 5KTNA 1UJBA 3WLRA 3P71T 2R96A 4YGXB 1OTHA 4F2HA 5HW0A 3TRHA 2I1LA 4LAFA 1K86A 4E2XA 1FSFA 3Q0IA 4PQGA 4QSMA 1QRSA 5K0GA 1JBKA 4L72A 221PA 1EFCA 1JUDA 3CIFA 3EZLA 2XDQB 4IQGA 1Z4NA 1RJ9A 3T54A 4EG0A 1XHFA 5CFNA 4LI3X 4N0DA 1F4LA 4L27A 4QEZA 5LKRA 1LSOA 1YS1X 4NWIA 3RREA 2HEGA 3MUNA 4LY3A 1YI0A 2VZ8A 5TJHA 4OQEA 1I7NA 3A1TA 5BYKA 1LDYA 4JYPA 4J90A 2CBZA 1Q0HA 2FMHA 3JTMA 1H5UA 4HUTA 4AG5A 2O6LA 3PVZA 1RD4A 1Q1GA 4YRCA 4MSUA 1QZXA 1OYOA 3NB0A 2F3PA 3PLNA 4BMCA 3ZE7A 3T0FA 1RABA 1RLJA 4YCLA 2ZB7A 3ESYA 2ZUDA 4DIOA 3ZDEA 1ECFA 3HUEA 3M2PA 4MKXA 3Q7PA 4GYYA 2PTGA 1C81A 3PHHA 3QUSA 4QHSA 1QC5B 1QZZA 4ZC1A 3E3MA 1BGXT 1C2YA 1H6DA 2BMAA 4IIFA 3VTAA 3KXIA 4OQPA 2AK2A 1X15A 4P7JA 4P38A 3I28A 4ZV9A 4RTMA 4DR2B 3TX6A 5KCZA 1JBEA 1J6UA 1RQ2A 2CD7A 5EE5B 1NI5A 2DTXA 3QVGA 3QKUA 3B1WA 4AP5A 2CNBA 1ZD4A 1GXSA 1T2DA 5TR9A 1L5LA 4ITUA 4B83A 4B3IA 2F1IA 3PF9A 4ASUA 4KE8A 3QKRB 3LFTA 1VIAA 3BMCA 3L0ZA 2X1LA 3JQ9A 1EK0A 1RHUA 4I2NA 1IFXA 2BEUA 4TKVA 3RUCA 4PX9A 4B6OA 4Z4IA 3P2OA 2W6QA 1DOZA 1HDYA 4E3WA 5AESA 3OEHD 4FJ0A 3P5SA 2ZRLA 4IWXA 1GILA 2IEZA 3FWZA 3MF4A 3O4FA 4GM1A 5ALJA 1UQTA 2J7PA 1ZU5A 1KIFA 3LT2A 4W6QA 4V1CA 3EGCA 5L4LA 4CMCA 3DNPA 1VG9B 2JG3A 1CG6A 4C20A 4JBGA 2ONYA 2AKYA 5BPHA 4N7JA 4EKEA 3HFRA 4LXUA 3PXBA 4MMZB 3OJLA 4WW0A 4YA6A 1JH9A 1CR6A 3AFOA 2XF8A 1SVIA 1UK6A 2IYQA 3AM3A 3B48A 3BK1A 4PSVA 4RTOA 1S2LA 3RFUA 7MHTA 1VI6A 3U37A 3U4CA 1WQ4A 1BXGA 3M6WA 5HK8A 3JQ6A 2QTMA 3RT1A 3NBQA 2VNSA 2BGWA 2B4KA 3DJFA 1FNMA 1CD5A 3LY7A 1EP2B 3A9VA 4KX5A 2Q29A 2QMZA 2WJZB 4MH0R 3JQBA 1VIMA 2RGEA 1F4PA 2AUTA 3IAM1 4KC0A 4W5HA 3RJZA 4DL9A 1BX3A 2Z8YA 1S9HA 2JGFA 4YH1A 4BP9A 5LDHA 3HP7A 3P7MA 4M0FA 1RPZA 2OAP1 3BMOA 2JKVA 3RSCA 4BASA 5CFOA 1TECE 1QCZA 4DCGA 5C18A 5HQ3B 1QP0A 1Q7BA 2AWNA 3LLUA 4OH1A 3RU3A 4QYTA 1TA0A 2P9GA 3L0BA 2R1TB 3VMMA 3RGGA 4B79A 3T3OA 4BX9A 2FEOA 4FOLA 4QPPA 4COOA 3H4IA 4MKZA 1P2DA 1JQAA 4UM5A 4J7XA 1RC0A 2HHCA 2W6PA 3AVQA 3I4CA 5AOCA 1F7UA 3UENA 1RPTA 5FT9A 4I50A 5JO9A 1F48A 1AJEA 3TG2A 3LVBA 4DPLA 4MGZR 1T4CA 1Z6PA 4QOEA 4E1BA 1XTJA 5A9RA 4KH1A 2NQTA 5F1PA 3AEQB 2GYVA 3H5VA 3N0TA 1YR3A 2WA1A 4GZ3A 1JG1A 1KFBB 3QMVA 4RYDA 1MAHA 1UXHA 3GJYA 4BEWA 2O6HA 2IV3A 1XAIA 1E2IA 2FN7A 1RLMA 2JA1A 5KQPA 3OE5A 2CB9A 3RUPA 4PGMA 3T35A 2P78A 1GRRA 5EGSA 3JQ8A 5JZVA 4YLGA 1NVKA 1QRDA 1TMOA 2OAEA 1PRYA 3DMFA 4NBWA 5CEJA 4QFDA 3K31A 3LP6A 2AG6A 2HY7A 1PDWA 2BFCA 4NG5A 2GM9A 1RKVA 4UMVA 3QOXA 1CJTC 1Y1SA 5LB2A 3U5TA 2VI5A 2ODAA 4H9GA 1HURA 3FCSB 1ZWLA 3C7KA 1JAZA 3EEBA 3OZUA 1U3VA 4H7JA 1M0SA 4TPKA 5K03A 2ZS7A 1BTOA 3RO7A 4BRUA 4XM2A 3KEFA 4P5PA 5C8DA 4MUIA 4YUZA 5I6DA 3AEKB 1WPQA 3ANNA 3KQSA 4HWOA 4AKGA 3KBOA 2X9GA 1RLUA 3RVQA 3F2IA 3QLUA 2GBLA 4HTAA 4PR0A 4XDYA 5CDTA 2ZSIA 2MCFA 1LX7A 1ZC4A 3FNFA 4JUDX 2VPZA 5K6AA 1LRLA 1HE3A 3ETJA 3GVIA 4RA6B 1L7RA 2I9PA 3TSWA 1QG2A 1WETA 4IYJA 4RPKA 1KZ9A 1R0BA 2K6GA 4FDUA 4DY6A 2I33A 2OHOA 4M1EA 2ZIWB 4JU8A 1ZN7A 5H0IA 1EFDN 3IAFA 4J0HA 1D2AA 4LV6A 1RAFA 2I6XA 2PX0A 5JCOA 3F8WA 5HKKD 4FR2A 1RIIA 3IOYA 4M1KA 5EUQB 1OXTA 4D3FA 2G9VA 5EEGA 4TL8A 2H07A 4G09A 4C14A 4M6WB 4TTIA 4B1FA 5JLJA 3RSOA 3NCTA 1L6IA 1RQLA 3TOCA 3V1YA 1H2HA 1JR2A 1RJGA 1Z39A 2ZBUA 1QP8A 2V8OA 5I4KA 2DBYA 3IA2A 1SXJE 4MUXA 4A36A 4NBKA 3QX9A 3A1DA 2O1WA 4E30A 6CHYA 3D8HA 4JI5B 3TX2A 4AUEA 2WTXA 1WAMA 3M6MD 3LDUA 4OL0A 1FJHA 1JFTA 3A6KA 3AO0B 4P31A 2ZSBA 1HE5A 2RGRA 3WISA 2C4TA 4YUWA 2J32A 5ARCA 2QTZA 1RSZA 3ISTA 1F8FA 1EGQA 5K8LA 2OGUA 1MD9A 2XNSA 1EP9A 1G5HA 1K0UA 2WJIA 2YZ7A 4PC6A 1XTKA 3DFZA 5EUMA 4A10A 1DMSA 3GJ6A 1WEKA 5JI2E 2BKEA 4CEIA 5J1SB 1HY3A 5NLLA 5KYWA 5ES4B 5KJEA 2EDAA 2VDVE 4ZEXA 3DLBA 1DUIA 1L4MA 2IX9A 1R0RE 4BO6A 3CEMA 2QGZA 3AY3A 4UHFA 4L3OA 3CNHA 5KX5B 3WI7A 3CRMA 4FZVA 1BVHA 4B7CA 1JKJA 2VHUA 4WEQA 4DIUA 3U6BA 2GHIA 2BI8A 3UFXB 3LDGA 4ZZ1A 4ZZ2A 2NZUG 3R5KA 1QGZA 2JEYA 3NS7A 2PG3A 1E0AA 2V5VA 3QE9Y 4C2BA 4RIGA 2QYSA 3EZ7A 5ICMA 1Y8ZA 3OFSA 3QHPA 3H65A 2A5JA 3EGOA 3HO6A 4HN2A 4ND5A 4Z9XA 5BOSA 1XNRB 3E22A 4NKRA 4MA4A 4OQLA 4A16A 1GGNA 4TYYA 1ZGGA 1QGDA 4PO8A 1G8GA 3FCEA 2VHVA 3GFVA 4NENB 4CXMA 3O0TA 1JFLA 4BNLA 4B6QA 3D6VA 3AILA 5SZJA 1F5SA 1UDXA 1Z15A 4ZOLB 1NUAA 4FDAA 3F9RA 1RM3A 2R87A 1FNDA 3N2NA 4PYRA 3KUUA 5FAXA 4ZZ0A 1GQFA 1U7ZA 2WAYA 3KAQA 4LPKA 4Q6WA 4TRNA 3LPDA 4ZMRA 1TU0A 4EPXA 4KNVA 1AKEA 3ICPA 3SXJA 2FX2A 2FLWA 1JVBA 2AE1A 3PUHA 4JMPA 3COPA 4CLHA 3EBPA 5HRUA 4DR6B 2OCPA 3JQFA 4LC9A 2A7QA 3JQAA 2A57A 4DOMA 4Q34A 5HQJA 3KPVA 3HRIA 5SY6A 4B8YA 1NYRA 4MQFA 4RSMA 3HCRA 3QOWA 3R76A 2HA2A 2GERA 1D1QA 4DV7B 3E7PA 1RMQA 1C9MA 4LBYA 1KSFX 1PT5A 2XQGA 3OZEA 4MS1A 4MWEA 1AB6A 3CNBA 4KQ6A 4KQIA 3VH2A 3VZDA 4B75A 3BBLA 2BBOA 2VBCA 3IVMA 1SC3A 2BRUC 4IEEA 3I6QA 1X1QA 3GLFB 4HXFB 4F9EA 5CVVA 5EJ9A 4X3PA 1C7ZA 1SRRA 4PLTA 4IZOA 2GJ9A 2ZUSA 3BOSA 4Z7QB 1XHEA 3TCXB 2B25A 3D3EA 2VSOA 1G9TA 2NGRA 2ECPA 3AGQA 3EC7A 1WBDA 4YMIA 1M75A 2OZLA 2PGJA 1CK4A 1OXXK 1R6AA 3F8SA 4NK5A 4WK6A 2I8LA 2JJ1A 4Q39A 3VI4B 3RC7A 2WQ6A 2JFHA 4BBAA 3AJ8A 1Q6YA 4BX0A 1N5JA 1XLVA 2AWOA 5C8YB 5CA1F 5KC8A 4F71A 2A88A 4ZI7A 1OH6A 1WZIA 5REQB 4HLUA 3JATA 4M21A 1B8OA 1WTCA 3LIPA 2C7PA 3Q5DA 5KYYB 3QE2A 4KGDA 4JGBA 3O47A 2XHZA 2HTEA 1DMRA 4KO8A 3HB9A 4XFKA 4ND1A 1CUZA 4YLEA 3I3SR 3OIVA 1P9OA 1NQXA 3F78A 2GJ8A 1E9RA 1XRLA 2BN4A 5AO9A 5BN5B 2E2WA 1PJSA 1Z2CA 3AFIA 3I9JA 5IAKA 3NKVA 4P54A 4BJ6A 1L7EA 1XN1A 2DLCX 1OU0A 1TA4A 5AVWA 4HI0E 3Q8KA 3TD9A 1YDFA 3OURA 4ICIA 3KYJB 4AG3A 1NNSA 3RGWS 4DSOA 4AYTA 1MH9A 4II7A 2R6DA 1EG2A 2CHQA 2IYAA 3DBLB 3TTTA 4JFAA 1C5KA 2W00A 4MUKA 3KQQA 1X92A 9LDTA 1KZHA 2PMDA 1H94A 2VRCD 2Y1LA 3ITKA 1QV9A 1UP4A 1GPH1 4ZPXA 3V1TC 2CE7A 1O9HA 1NN5A 1LSUA 4BAGA 3VA7A 3C3AA 2EF0A 1GSAA 4MRMB 1L7NA 5GIOE 2MSNA 2BEVA 4LXIA 2D7CA 5JSZA 1D2EA 5F78A 2FE1A 1WXWA 2J6IA 5I9MA 1LVUA 3ZXSA 1WF3A 1EFKA 3K5PA 1YBAA 3CH5A 3F7OA 4BKMA 3KUXA 2O5EA 5IYZB 4OHXA 3G1WA 4DWVA 1YQXA 1KFCB 3GCWA 3IHTA 3MLEA 5BN4A 3F9IA 4EARA 1B76A 1ZAKA 4UM9D 3U4GA 1X77A 3G0OA 5E4TA 3UGJA 4US2R 4RQAA 4QUAA 3CV3A 2FG7C 3KU1A 3NHAA 2W11A 1SBNE 3NT4A 1QPZA 2JC3A 3FAKA 3ZDXB 2MTBA 4MK4A 3IR7A 1I2ZA 1IPEA 1XNJA 2IUFA 1A2KC 4JLBA 2QTWB 4UPVA 1S5PA 2P5UA 2PZBA 2TMKA 1XYVA 4F6RB 4ZYTA 4ZYLA 1KYVA 3EPJA 3E81A 1JJIA 2RHHA 4B3CA 1S4QA 1ZUWA 3AESA 3WP1B 3TQFA 1C4WA 5AYVA 1WSAA 1N77A 1RIFA 1I5OA 4MI6A 3CNQS 2ZE5A 4ND3A 3T3PB 1ZH4A 3Q3IA 3NOXA 1WS6A 4Y9SA 5EMLA 3PWKA 4UUOA 1MABB 4KFTA 2ZP1A 1IIRA 3BXPA 3GD7A 4ZD6A 4CM8B 1Z0IA 3H2GA 3JRNA 4N39A 1RFLA 1XU9A 4G23A 2GWHA 3PFIA 2X0IA 1U3UA 4K87A 4EBBA 5KOJA 3P4YA 1XU7A 1DI0A 4A1OA 3B3FA 1AQUA 2FK7A 1AV7A 3BXEA 3DM5A 3RSFA 3VJLA 4CMBA 2G5PA 1UP6A 2ORVA 1A77A 3DE5X 4DA8A 2AQIA 5HP4A 2A9KA 3HXPA 5HXAA 3PV0A 1AK2A 3USCS 3KR9A 2C9BA 4D3ZA 3NONA 4RDIA 1IEWA 1J2UA 4YDHB 2ODNA 4FXOA 4IIJB 3TEJA 3ZCVA 4JH0A 5K0FA 3CVXA 1LSJA 2C5FA 1KQFA 1O89A 3TRFA 5EMKA 3NJRA 3FTFA 1A0OA 3R41A 1FTYA 5HDBB 4RGBA 4WZBB 1BHSA 3LKDA 1N3YA 2BKVA 1IQRA 4J0JA 1Z37A 2Q1WA 2C00A 1XK7A 2V3WA 3RM3A 4RTNA 5ENDA 2YXEA 4KPGA 1E9AA 5HJ2A 2BH2A 5BRAA 4BFLA 3DHEA 5LZ8A 2JCVA 4XPIB 1PX0A 3AP2A 3SHTA 2P4UA 1LDMA 1YZNA 2FQQA 4K7JA 2CY0A 1KJYA 2YIJA 4BQFA 1R0ZA 1JL3A 2QRZA 3PFWO 2O2GA 2G1KA 2YFYA 3G5AA 2HX1A 3IJRA 4D45A 1Y80A 4MV0A 1E3MA 1Q0PA 1EM6A 2OOKA 3PDIB 1YFJA 4ZTZB 3DH0A 2EV9A 3DOOA 1Z2AA 4BNZA 5IUKC 1MB4A 2Q4OA 3WGNA 4P0QB 2CV1A 2PSHA 3JZAA 4LRYA 4I1IA 2QZSA 4PLFA 4D0GA 5B12A 4KO2S 2COUA 2P9YA 3QWFA 3C45A 3K0CC 1KJ8A 3M5CA 4KMOA 1B6RA 1IRIA 2QMHA 1DG1G 3DFFA 3EVNA 3OSZA 3FOFC 1MG5A 4AJ9A 4F96A 1RXSA 3K0EA 3V8BA 3FZYA 4E22A 4EI7A 5CFPA 2QA5A 5JAOA 1V3QE 4KAAA 4ZEWA 1L9XA 1QIFA 2B9EA 4GICA 4GVXA 5IAEA 4PZCA 3UPDA 4B0OA 1ZMBA 1G20A 4CQMD 3DWFA 5CDSA 3I9OA 4MVYA 5ILGA 3TI9A 1AMNA 3LG2A 1DIOB 2EKZA 2G5GX 2HUNA 3L7DA 1QKKA 2Z5VA 3PD0A 3S0JA 3H1PA 1VIVA 4UU1A 4DCUA 3K0BA 4CT5A 4YALA 4EA7A 1NJSA 1UK8A 4YACA 2J46A 1EWTA 2Y1CA 2UYGA 2ZQ5A 1SBHA 5JXHA 2VJMB 4RD0A 1CJVC 1ZQ9A 3PE4A 4P4SA 1K3FA 1PDVA 5SV2A 4L76A 4PIVA 5DLEA 4BJ5A 1NP6A 4OUDA 1WNFA 4QYMA 4YAJA 4BFUA 2I62A 3VGJA 16PKA 4YP9A 4JJAA 3SC2B 2XECA 3HN6A 2C2YA 3FTQA 3PXAA 2HZ7A 5LZ2A 3DTVA 2QQGA 1B41A 3MCZA 5JHHB 3OIDA 1DAOA 3H4TA 2RHDA 2ZWPA 2WI8A 5LBUA 1BCSB 1THGA 1ZVMA 3UOGA 4BNFA 2A5GA 1RJDA 5ECWA 3THRA 4CPDA 3PRHA 2QAGC 4I3FA 4ZZIA 3KQTA 3UJ9A 3IXLA 1YUNA 3OA0A 4Q4HA 1JA0A 1KHTA 3A37A 3GBPA 1SZJG 1V26A 3KHTA 1XN4A 2Z09A 3K2IA 5JHGB 2WE8A 1IVNA 2O05A 1C1XA 2Y1WA 5A1JA 4Y1EA 3FTCA 4BKUA 1T2EA 2H9YA 2Q4DA 3UK1A 1GCAA 3UMCA 3GLKA 3LUCA 4I5EA 3DZFA 1K7YA 1VE3A 3MMXA 1P1FA 1JJVA 2RGNA 1ENPA 2GAAA 2YQ4A 4MHOA 5DHSA 3QE3A 3ZWDA 2G04A 4BU1A 4PC1A 1HSZA 4F38A 3ZWMA 1AHIA 1KI9A 1NUTA 4KLRA 3ZCRA 4TMKA 4FGKA 4F8JA 4JJEA 2LCIA 4JXZA 2DY1A 3SHQA 1XALA 1L3BA 2AA3A 1WABA 3AFGA 3A26A 4PYMA 1HT0A 3ZKAA 1C8BA 2FW7A 2FFJA 5DLYA 3ULKA 2RDMA 3OCXA 5C3MA 5JPCA 4OO3A 5D5PA 2I7TA 2UYHA 3IQHX 1SEVA 4EGQA 3MFQA 1BX0A 1EVKA 2BFOA 3NAZA 2EIHA 2F4NA 3JZIA 4U2EA 1SK9A 1W8IA 4V02A 3IQXA 4FEEA 5JI3E 1PGJA 3C48A 5AXBA 1P39A 4DNXA 3GT7A 4EUHA 4Z54A 4JBWA 4WHMA 2QZZA 3OKPA 3MMPA 5AHWA 5KDDA 2O20A 4GWGA 2IOQA 4II3A 4O4HB 3PTLA 2OV4A 5BYBA 1V8PA 4FC6A 3ZWNA 4X60A 2P0AA 3C8HA 2XD9A 1DP4A 3QQ5A 4HY3A 5MDHA 1PLJA 2WLSA 3COWA 5BSTA 1JEJA 2AC2A 2ZS9A 4HMOA 4U9HS 5KB3A 3G0HA 2IY8A