4XEUA

Crystal structure of a transketolase from pseudomonas aeruginosa
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
663
structure length
632
Chain Sequence
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYMQHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYGYTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGISHEVASLAGTLRLNKLIAFYDDNGGWFTDDTPKRFEAYGWQVIRNVDGHDADEIKTAIDTARKSDQPTLICCKTVIGFADEIAATRAALGWEHAPFEIPAQIYAEWDAKETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKAAAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADTLWKGCKGVSADDAAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYVFTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALIFSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSFGESAPAPALFEHFGFTLDNVLAVAEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transketolase
publication title Crystal structure of a transketolase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 246
structure length 632
sequence length 663
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA01
2UZ1B 5I5EA 4K9KA 4QELA 2WVGA 5EXEA 1UMDB 5HJEA 4KXYA 5I5GA 4JU8A 5ERXA 1QS0A 2BEWB 1YBHA 2JI9A 3ZHSA 2OZLB 2VK4A 1PO7A 3DVAA 2Q27A 1OLXB 2JI7A 2BEUB 4MPRA 1W88B 2BFCB 1UPBA 2C3YA 5I51A 1ZPDA 1YI0A 5DEIA 3OE1A 1OLSB 1PYDA 1Q6ZA 2Q5LA 1WCIB 1OZHA 2VJYA 3ZHTA 2Q5OA 3EXEB 5ESDA 2YICA 1V11A 3IAEA 5DGTA 2XT9A 1V5FA 1OZFA 4ZP1A 3DV0B 1R9JA 3LQ4A 1V1RB 4GPEA 3ZHQA 5ERYA 2Q29A 3EXFA 2EZ4A 4JD5A 3DVAB 2BFFA 1AY0A 3AHJA 3M7IA 4C7VA 1N0HA 1UPCA 5EJ5A 5EXDA 3OOYA 2NXWA 1DTWB 1T9AA 2Q28A 3AHEA 2EZ9A 4COKA 1V16A 2X7JA 2XT6A 1POXA 1YD7A 2IEAA 2BEVA 1IK6A 5I4IA 4GP9A 3FSJX 2W93A 2QTAA 3M34A 3MOSA 1POWA 2JI8A 1OZGA 2BEUA 3HWX1 3JU3A 1W88A 1Z8NA 2C3PA 1T9CA 2BFCA 1NGSA 4JU9A 3EXIA 2FN3A 1X7ZB 2O1SA 4K9LA 2BFFB 5EJ8A 1WCIA 3EXG2 2AG0A 2VK8A 4RJJA 2JI6A 3EXEA 5EJ7A 2PDAA 3AHDA 4WBXC 5DGDA 2C31A 1UM9B 3EXHB 3DV0A 1V16B 3ZHRA 4D5GA 5EJ6A 3LPLA 1UMCB 1V1RA 2BEVB 1TRKA 1B0PA 3ZHUA 2Y0PA 3AHGA 1TKBA 4KXXA 2G28A 1QGDA 2J9FA 3EXIB 1PVDA 5IMSA 4JUBA 1DTWA 1YHYA 3RIMA 2R8OA 2G25A 4XEUA 2C3OA 5C4IA 4KXVA 4KXUA 2C3UA 2AG1A 3ZHVA 3EYAA 3IAFA 4JUFA 2PANA 2JLCA 2FWNA 3E9YA 1X7ZA 2VK1A 1NI4B 2IHUA 2DJIA 1ITZA 1X7YA 3D7KA 1UMBB 1BFDA 2J9FB 1U5BB 3AHCA 5K6TA 1UM9A 3EXHA 2XTAA 4K9PA 1UMCA 4KXWA 4MZXA 1QPBA 4K9MA 2E6KA 2Q5QA 2VBGA 2BFBB 2Q5JA 2C42A 3FLMA 4MPJA 5EJMA 1X80A 2EZTA 3EXHC 3F6EX 1X7WA 1X7YB 1OVMA 5HGXA 1OLUB 5EJ4A 4MQ5A 2IHTA 1X7XA 4JUDX 3DUFB 2V3WA 2WVHA 2VBFA 2G67A 4QPZA 1V1MB 1TKAA 1V5GA 1NI4A 3LQ1A 3HWWA 4RJIA 3AHFA 1UMBA 4GM0A 5K2OA 2PGNA 1W85B 2YIDA 4QQ8A 1X80B 1U5BA 1MCZA 3EXG1 1X7WB 3EA4A 2PGOA 5EJAA 1V5EA 1YNOA 2JLAA 4KGDA 5HHTA 5AHKA 4K9QA 2BFDB 2R5NA 3EY9A 2BP7B 4K9NA 2BFBA 3KOMA 1X7XB 4Q9DA 1PI3A 2R8PA 2JGDA 4MPPA 2JIBA 3M6LA 5FEMA 4GG1A 1KEKA 4GM1A 2C3MA 3F6BX 3FZNA 4FEGA 1Y9DA 2WVAA 1OLUA 4K9OA 2O1XA 1QS0B 2IHVA 3DUFA 3AI7A 2BFEA 1YHZA 3UK1A 2UZ1A 1V1MA 2UZAA 4FEEA 3LQ2A 1YI1A 3HYLA 1UPAA 2JGDB 1W85A 1TKCA 1T9DA 1T9BA 1UMDA 5HYVA 3M49A 3L84A 2BEWA 4D5EA 2VBIA 3UPTA 2EZ8A 2OZLA 5EJ9A 4JUAA 1RP7A 1V11B 1JSCA 4RJKA 1OLXA 4GM4A 5K6RA 2BFDA 1GPUA 3AHHA 2BP7A 3AHIA 5K3SA 4C7XA 3EXFB 2BFEB 4JUCA 2EZUA 1L8AA 2QTCA 1OLSA
chains in the Genus database with same CATH superfamily
1X14A 4D9JA 2IF2A 2CJWA 1E4OA 1B4DA 4XQGA 6ADHA 3UV3A 4XRRA 5AXAA 3W8DA 3KJGA 2L69A 1P1FA 3L7AA 4PRYA 1NURA 1UFVA 3CR8A 2JJ1D 2PFKA 2K4MA 5LL6P 3CSSA 3EFOA 4YJ2A 1UEXC 2B8JA 3EPLA 4L3OA 5TPWB 3RF6A 2DKFA 4RF5A 1FX0B 1QPGA 3V7NA 1JZSA 1QYCA 3F2VA 3HUFA 1SCNE 3IO3A 2FETA 1MQ9A 3UQZA 2CV2A 4OXYA 1VB5A 4CLXA 1Q57A 3IUEA 3EF1A 1E69A 3BXEA 1YMUA 3P2EA 3W5CA 1UQTA 1YBHA 4RM3A 1BG6A 1G8YA 3DDSA 1IYZA 1GQQA 3GP3A 2X22A 4WASA 3H0CA 2QJFA 2PNJA 4EGCB 2PZEA 1TW3A 3H2JA 3W3AA 1KEEA 2F1HA 4Y2XA 2P90A 2MDTA 2P91A 4Z7QB 1XMOB 3LM8A 2OM2A 5EJ2A 2C94A 4H27A 4YFYA 1EHYA 5EP3A 1X77A 5EUQB 2PLFA 3A4VA 3LSTA 4ZVTA 1L7DA 4XYMA 2LRHA 2VUIB 4MPRA 5LSAA 3PRJA 2VSXA 2JLXA 2FJ0A 4G8CA 3PHCA 4K8RB 5K4GA 1W88B 4K1XA 2YINC 4DMUB 2BFCB 3BIJA 4GUAA 3LC2O 4FBMA 2DJ5A 3EGXA 5HZGA 3H9CA 2C9YA 2HU2A 3F3MA 1MTOA 2CUZA 4FFBB 3LLMA 5I8PA 1CY4A 1VJTA 4DV1B 3UC9A 1XBTA 4EQ6B 4Y6PA 2BBOA 3B78A 3WK4A 3REFA 2GX6A 3PFHA 4JDUA 1QV9A 3WP1B 2J9YB 3JVIA 2UU9B 1Q14A 2CWDA 2Q2WA 3ZGLA 3ROTA 1OZHA 2HB6A 5F12A 2KLBA 2OB1A 2V8OA 4PG6A 2ZIUB 4LRQA 2QKYA 5AJVB 1E3LA 3ZBTA 1EWTA 5KNBA 3VU1A 5G0TA 4NHEA 3HI6A 4AT1A 1QB8A 3TIFA 4LWZA 4G86A 3P2OA 4HH0A 4KQWA 3VYWA 3JWEA 1AQLA 2WF8A 4RKRA 4XFDA 2UXDB 3TW4A 3UKJA 4L9WA 4F2HA 3PXUA 3VJRA 3HBJA 3CNEA 4GQIA 1E3QA 3I9MA 3EGWA 3P9NA 2PMEA 1FNSA 4YLEA 5AKKA 2AV6A 7MHTA 1JWLA 1I7NA 2BGJA 3MWDB 1IJEA 3OUZA 1U0SY 2B94A 4K46A 3ZZ0A 4RHYA 5LBTA 4BU1A 3WB0A 1XZFA 4GYYA 4QNNA 3SX2A 3D3WB 2BT4A 2OE2A 4DBLC 4D57A 4DVGA 3D6TB 1QFYA 3IAM1 4AY5A 4KN8A 4PO1A 4MGYR 4ALMA 4ZCQA 1TX4B 1UAGA 1RU3A 1EFLA 4Q39A 1JMKC 4QUGA 4EBBA 5DN6A 1SWWA 3I83A 2ZPTX 2P1DA 3BRSA 1M3SA 1PZFA 2F3QA 3DLCA 3QOWA 2VHUA 2Y6UA 3LF2A 4NENB 1IH8A 4F96A 1DAFA 2RGRA 3OZCA 4CR7A 1GZSA 4KTTE 1E32A 3K09C 3IR5A 4M1YA 5AI0A 4WTOA 2YZ2A 4IUDS 3HA2A 1B3RA 3TJMA 1YA6A 5ILOA 3PHBE 4WFIA 3HCDA 4MVXA 3E0XA 1DJPA 1N57A 3SFTA 1Q0UA 3N5CA 4LXIA 1ZGBA 5HFJA 2ZRIA 1RM4A 4P7FA 4RVGA 1Z0JA 2Z8YM 4LVCA 3H4TA 3DXZA 3I8SA 2JLBA 5C8XA 2XH8A 2C4KA 2DBYA 4AF8A 1CUFA 1EWYA 1XK7A 4H6VA 2WSMA 3FYUB 2PVPA 2G70A 3UFBA 2FWPA 4DR1B 2EATA 4IX9A 2A14A 3VDMA 2XDAA 1V43A 1CEXA 1B74A 1UJMA 2RKBA 1U9JA 1I7SB 4B3GA 4ZCTA 1YB7A 2L0XA 4JROA 4EJSC 5EE9A 3KQNA 2D0PB 4F92B 1C7RA 4MV9A 2IYPA 3TRIA 3UPUA 1E7YA 3T1OA 1QCZA 2XCIA 2IEIA 4H3SA 3ESDA 4YBRA 2ZXUA 2DKOA 3ZY6A 3ONWA 5EJ8A 1JMVA 1L8OA 4B76A 2HSDA 1DCKA 2V4ZA 1NVFA 3RYFA 2BUBA 1OH7A 1IN7A 2K2WA 4J0QA 4R83A 3R41A 1P2DA 3FOFC 3CX4A 5EYPA 1HG1A 2HADA 3UAWA 2EJVA 1YULA 3SGLA 3F5DA 2WJAA 4IZ6A 6REQB 2IYWA 3EXHB 3NVDA 4Y6OA 3EW7A 3FHOA 1JEJA 4BNDA 2VTEA 2OHJA 2DH5A 2QRGA 1RJFA 2TRSB 2VF5X 1RXVA 3FHJA 1GFZA 2D7JA 4GYJA 3CNHA 3MRTA 2XUFA 2HNBA 2HQOA 2PBZA 1DT3A 3O4GA 3B2QA 4EFKA 4DLKA 721PA 3PC4A 4F72A 3HVRA 5FPKA 3ZJYA 1U8AA 2ZT5A 1IUNA 4IJWA 4S1TA 4RY2A 4MLPA 2DG2A 4MULA 3TZ6A 1ORIA 4OVKA 1MRSA 1M75A 3HLYA 5HQ3A 3QYFA 2JH3A 4RUKA 1P4HA 1YZVA 1JHVA 4BVLA 4Z9XA 4MUFA 1DDOA 4DCSA 2J9FA 3EDRA 5EIOA 5KYKA 1NMYA 2JD1A 2LW7A 4GMKA 4NG4A 5L3QA 4TXMA 5NLLA 3C14C 3LKBA 4LXTA 4DNOA 1ZIXA 1UK7A 3BEDA 3L8EA 1NVEA 2RJNA 3MWYW 2IHBA 5F5NA 1DTWA 3GLVA 1Y33E 3DEYX 1BHO1 3GVPA 4UCFA 2WMNB 2QRVB 3OE7D 1KDZA 2G25A 1ZW6A 1Z06A 5B2FA 4GRDA 1V41E 1W73A 2IZ7A 3W8RA 3C8MA 2WWFA 5LWHA 4ABTA 3BBLA 4D46A 1N2OA 2C82A 2GZ2A 5JWRA 3AVUA 3D0QA 1UBMS 1Z7EA 1AO3A 4W5TA 4DLYA 1GG5A 2XD4A 4YECA 3RJZA 5BN3A 5IX8A 4CETA 3QLVA 5BN5B 6AT1A 4OLBA 3UHPA 4Q18A 4DMRA 1JR4A 4L5CA 4L75A 5EJEA 2NMVA 1KI1A 1R0WA 3DXXA 4LOLA 2IHNA 3OMLA 2YHUA 1ZXXA 3FCSB 5D3MB 3ACBA 1SQ6A 1J7JA 4C5BA 3GDWA 1OX4A 3BJEA 2OLKA 2ATXA 4XUEA 3EF0A 1P7WA 2RHJA 1Y42X 4LDAA 1FDUA 1UBTS 3HMQA 4BFCA 2CLMB 4DW8A 3NHPA 2GEDA 4Y0AA 3VNQA 5JO0A 3MF4A 1EFRA 4MV6A 5AVZA 3DE7X 4HB4A 1PTJC 4NESA 3E18A 3A0RB 1SU8A 2X41A 2JG3A 3UN1A 1R9GA 4F5WA 4JELA 1ATZA 3G5LA 4ZCMA 2TMDA 1PCXA 3ER8A 1UZUA 4HH3C 4LXHA 2PJRA 1XVUA 1BFDA 4RHCA 3V00A 3M6AA 1KJZA 2D1RA 4LCJA 2J7PA 3NU1A 2J5KA 1N4DA 4RKQA 3HWSA 3JQ9C 5KMGB 3KV1A 2J0UA 4QOEA 1G98A 3OFSA 1G0NA 1KSFX 4Q7KA 3RUAA 4IIGA 1JIQA 3CLTD 1XTZA 1NPTO 2CUTA 4IDDA 5DYWA 4W9NA 3QBTA 3TM4A 2Y68A 2P4EA 3UWOA 2V7WA 1NBIA 3G2NA 4LKOA 3THSA 1DDIA 3OFJA 3VC7A 5ICGA 4PC3A 4HVAA 1G63A 1GQ2A 3T5CA 5DTJA 5DU2A 1PZNA 3K53A 1QNFA 2SKDA 2WF5A 3B12A 3JVDA 5LBUA 2DR2A 4I99A 1QG6A 5LQCA 4MYDA 2Q7XA 2O8EA 2NVUA 3MFYA 1OB5A 3VH2A 1HFKA 4CJXA 3BTOA 2GD0A 2SBTA 5AJWA 3NV9A 4PU0A 3SE0A 4IXWA 3N0VA 3CE6A 5FI3A 1IRIA 2ZJ1A 3VFDA 3NWEA 1E7QA 5DM4A 1RWMA 2IOYA 2YW2A 1BD4A 4Z1MA 4E70A 5B3AA 2FB9A 4J1TA 2IOQA 3GY0A 4URUR 4E7OA 3MTDA 1ZGCA 3ENWA 4IWNA 4B47A 3MHTA 4KAFA 2Q3HA 3V80A 1VLVA 3IVMA 1LPBB 4YROA 1DC8A 3NHKA 2ZZNA 4YMSA 3VPAA 3ONEA 2RMKA 2UYYA 3VZQA 3ESXA 2OGTA 3UJPA 4AX8A 3D02A 4PSAA 5KTKA 2JA1A 1SVOA 1BXKA 2P40A 4L8YA 4RELA 1H6AA 1SD1A 2I4IA 1UWCA 2IEDA 3DL0A 3RUDA 4M7RA 1HYHA 1RRCA 2C5BA 3ISTA 4N65A 2AZTA 2AD5A 3QEMB 4URYR 4I4TB 1YOVB 2GJ9A 4J1QA 4R71A 2IY7A 4MINA 2BKXA 4JUDX 2P4SA 2B92A 3BD7A 2AXNA 2IYZA 2PQ6A 1WXFA 4EHAA 5F23A 1O6FA 4K6HA 2F1RA 5LZ9A 3OECA 3V42A 1XU9A 3DLTA 4WESB 1UBNA 2NU9B 4B3MB 4O59O 2AZMA 3OKPA 4CMHA 3VU0A 3GJ4A 2AR9A 2X0IA 5EQJB 2X6TA 4Q82A 1UJ5A 2H1VA 2ECOA 5AWFC 1P2VA 2IP2A 4BO9A 3CT4A 5TVGA 1X1AA 1E60A 4L6CA 3K9LA 1J0XO 4AI6A 1SBCA 4W9RA 3R7DA 4DA8A 5I4BA 4Q5IA 5CX4A 3S40A 5C8YB 4ZO8A 4RADA 2XNCA 1C41A 3QVSA 5TMEA 3SBDA 2NP7A 2PGNA 1YBFA 5TEWA 3ZDDA 1EQ2A 1NDUA 2NTYC 2YXLA 2AVDA 5AOVA 1IK4A 1EBUA 2PS1A 2QGFA 4FYHA 5LB4A 1DTSA 3ZHXA 2DM6A 4BQSA 5LMNB 2KWIA 5F35A 1M1XB 1T36A 3VPGA 3N7TA 3W2HA 3QWAA 3GOQA 3PFCA 1XMQB 4PSKA 4NXMB 1FTWA 4IHJB 5D5PA 1X15A 2R25B 2OWEA 1PR3A 5ICFA 2ZUCA 5FTKA 4B4OA 1CR4A 1A4IA 1EU1A 3NEJA 1P5ZB 4O4LF 4U1RA 4V3CA 2O1WA 1BJTA 1H22A 4UQLA 3BL8A 2B61A 4NPHA 5AVYA 2OGSA 1NW7A 1DV1A 4FW8A 4AJJA 2R5NA 1XVLA 3F78A 4K8OA 4BLPA 1J07A 1N2CA 2FLWA 3BIWA 4P31A 1R8XA 1GVNB 2FFAA 4EI8A 5T7BA 5AVRA 2QIPA 4O4JB 4CKZA 1W0JA 4F06A 5K4HA 2Z6VA 2R6AA 2I6TA 2JIBA 3J80A 3QVLA 3RHFA 1PT7A 4IOLA 4DCOA 3C7DB 2H1HA 5IUNC 3FPLA 3BGSA 4UMVA 4IWYA 3QPWA 4YC7A 1UBHS 4FQ8A 1ZL2A 3K15A 5DM2A 1TRHA 4PHGA 5DB4A 4C4ZA 2J3JA 2PYDA 2TECE 3Q3GE 3A2KA 3LE8A 4V0LA 4NFSA 1IBCA 3C3JA 1HE4A 4U7FA 1MAWA 2FSPA 2GTHA 2WG1A 3H0KA 3L1UA 5DI9A 5LOVA 3V1LA 2V6BA 1WDTA 4X93A 2P9EA 4RD2A 1H94A 3N07A 1H4VB 1S2NA 2Q3FA 4K26A 1ADYA 1U5AA 2V9ZA 5CX1B 4MJLA 4U7WA 1QS0B 4L15A 4WNCA 4QAJA 4I5IA 1G7TA 4RZUA 2IDMA 1S2LA 2Z30A 2B8TA 4ZDIA 2YFQA 2Q1XA 1T0PA 4N3GA 5FOTA 2J9XB 1XN4A 2OC4A 4FX2A 2R2AA 4O1MA 2JS7A 3UTCA 5FOWA 3HN7A 4Q4CA 2QD1A 2JBAA 1A8HA 3HA3A 4Y2VA 1UDBA 1MJGA 1RCFA 2JZOA 5CXXA 4NLLA 4YP1A 2XNJA 5A5GA 1QE5A 4KJZA 1WETA 3OCYA 2IS4A 2VC2B 2VZ9A 4KVFA 4MVJP 4MWCA 1JW9B 5LD2B 1G16A 2EG5A 4CG1A 2C2MA 2I4LA 2V74B 2P11A 3CX8A 1G1AA 2AJ8A 3INRA 3NVMB 4G9EA 5DNAA 4B6OA 4RJLA 4PE5B 5IDXA 4PLFA 3GJXC 4HQ6A 4DNFA 4RIEA 1QIJA 4FT2A 3DOFA 3DZCA 1QR2A 1LTKA 4IIUA 4FOTA 1PKXA 1N2JA 4ARZA 4CL2A 2IPOA 1U9YA 1WLYA 2OAP1 2ORIA 1IU9A 1NBOA 1UMDA 2GLXA 1E0AA 1Z13A 2WU1A 2ZYDA 1CFJA 5CGZA 3LIPA 4B7XA 3P0JA 2AH5A 2I2FA 3GN1A 3OZSA 3FJOA 3GX1A 1EFAA 1WB5A 2VP5A 1FW6A 4LECA 3T8YA 3FCOA 1I7LA 1YCGA 3LVBA 3MB8A 3I64A 3SXPA 4EW6A 4ZO9A 5C51B 3PICA 2HJVA 2C5AA 3KT0A 1EM8A 3T9CA 4G1VA 2OVBA 4QYMA 4AN1A 1UC8A 3PEYA 4GM4A 2CLFB 1B6TA 1NRXA 1G20A 2GKSA 2OO3A 2XNHA 3QW2A 4CKEA 5L45A 4OUKX 1W93A 1IDOA 4MR7B 4NL4H 3MZ0A 1L4YA 3PNYA 4RH1A 2E55A 3C3YA 5FP0A 1WHSB 3C43A 8GPBA 5IAAA 1RM3A 2OBYA 3FRJA 1G8GA 2GARA 4BKPA 5AIBA 3W5BA 4PZ0A 3NBUA 1T2VA 1ZR2A 4QREA 1ZI8A 4O8CA 2QMHA 1XVVA 2HFJA 4ND3A 3VQTA 1G21E 2NVOA 4OB7A 1L7MA 3ZWNA 2ZJ5A 3OLXA 1JEDA 2CHFA 2DPHA 2WD8A 4R5MA 2NU6B 4OX9B 2P3SA 1YC2A 5C1DA 1Z47A 3MJDA 2BE9A 4MPDA 3SDBA 4G5YA 1N5DA 3I4LA 1YZGA 1HF3A 2XITA 2VYVA 3R0VA 3K30A 1LW7A 4Z1OA 1D8TA 4U8HA 4FUQA 3LPCA 2QUHA 3NM4A 2B1IA 3FWNA 1E8DA 2GZAA 4TRMA 5EXEA 4EKIA 4W5NA 1C1XA 1WKCA 3H7AA 3PD1A 4OYYA 2XB4A 4JU8A 4EA6A 4QU5A 3N2NA 3HO6A 1UXIA 2Y4NA 1N78A 1P45A 4LJYA 4WJKB 4WN9B 2IYOA 1WX1A 1BGXT 2FWBA 2O8BB 1KZYC 3OPYI 1RQPA 4HXYA 2ZB7A 4HK4A 3DOJA 3O3MB 1TYDE 2DF8A 2YUIA 1ISGA 2GT1A 1KYVA 1R64A 4AZ3B 4DB2A 3ZCSA 1RWPA 2OG2A 4KXQA 2XJ4A 3ROZA 4O3MA 5AVSA 4F6RB 1VL6A 2Q2QA 1QUEA 2B9VA 1S4MA 3IBSA 4PFQA 3KP1A 4TTTS 4UHDA 1OU4A 1P77A 1PJ4A 4YRGA 5I51A 3AKDA 2G8NA 3G1WA 2QUKA 1BQ3A 1GA1A 1MPTA 2Z2KA 1JECA 5EWLB 1PF7E 2YY6A 4C3VA 1YTUA 3CCFA 1I4LD 3K4PA 3JD3A 4R1SA 1L3CA 4V0MA 4U7TB 3HYCA 4ZQIA 1OLSB 3SCZA 3VJMA 2YMLA 1RYEA 5FWYA 3T61A 4RL6A 2Q5LA 3TW8A 2RGCA 3AJ8A 1EIZA 1C7FA 1MZPA 1VIDA 1O96B 3T5TA 1CE8B 5LBIA 1TUIA 3NUZA 4C1NA 2E7ZA 1VYHA 2R751 4TWIA 3FA2A 3QHQA 1Y8RB 1NTOA 5KHAA 3WGKA 1GYQA 5JS1A 2B99A 2DX7A 1U2PA 1OFTA 4Y2YA 3AJDA 1U7TA 3GJ3A 4N5LA 4PC2A 1N0WA 1JQDA 1ZOSA 2FHSA 2DQSA 2H85A 3ZHYA 2HXYA 4B79A 3JD0A 2IV7A 5LNK1 1C14A 3M4YA 1J8FA 1GR1A 3IIMA 1ZSVA 4KMMA 1U7OA 2PGJA 4TL6A 1J25A 2PL5A 3I04M 1U8CB 3KOWA 4IG4A 4OYRA 1Z07A 2W2NA 1L5ZA 5EKXA 1AK2A 1CX9B 1N2EA 3LRTA 2HU8A 3OF2A 5LQNA 1WDKA 3T4UA 4Y9DA 5AI5A 4KSBA 2Q2OA 1H8HA 4ZOLA 2C1ZA 3RC1A 5KC9A 3IOMA 3TWOA 4YJGB 3SSOA 5BPFA 5KWJA 1KI3A 2A5FA 1HL7A 4ND6A 3GO4A 2ZZMA 5CT8A 5LYYA 2V4MA 1WQ1R 1OHHA 3I2JA 2OR3A 2QNIA 1HV8A 2PSJA 4TSKA 5SV2A 3ZLVA 1D2RA 1Y6GA 1I1NA 5J4VA 1NP6A 3TXXA 1C81A 1RHMA 1FX1A 1RWOA 3M7IA 1WJGA 1O87A 3RAPR 3W8FA 3T34A 2HJSA 2AFIA 2LKDA 2YRXA 3FHCB 4M0UA 3U3RA 4A2PA 4BCBA 4KI7A 4D1YA 1U28A 2DHEA 2AQKA 4R7ZA 1J2TA 1PEAA 2BKLA 2GEKA 3DOUA 1NN3A 1WB6A 3BA6A 4UFNA 1J97A 1TEHA 4L07A 2G09A 4IH1A 4WOBA 4O2AB 1H4QA 3FBGA 3GVXA 3D5TA 5ILGA 1QFXA 1EJ6A 1XF9A 4IIFA 2YHIB 4UHEA 2O3RA 5K01A 1MT3A 1Y7PA 1HOXA 4L95C 4OKSA 2Y1DA 2LKCA 1APBA 2H2WA 1T4CB 2A9OA 3AM4A 3FOWA 3KRTA 5I4IA 2WQ7A 1UWKA 4L8FA 4B2IA 1GADO 3AF3A 1JZQA 2C61A 4AIRA 4F3NA 4QYSA 2WWTA 3G1UA 1FS6A 1SBNE 3EASA 3GUYA 2HQBA 2V7QA 3E5MA 1XCBA 3P27A 4E5SA 1CY1A 4OHYA 5K5EA 2ZSUA 3DE1X 3MMZA 5EMNA 5GONA 4CMBA 4ML3A 1B6GA 1H93A 1KYXA 3BF7A 5BQPA 4RSRA 5FWDA 3U7GA 3CINA 2E0IA 2BHSA 2GF2A 4FEYA 1V4VA 2NLOA 5E38A 1YZLA 3LHKA 4PR3A 3LT2A 3AGPA 5C1OA 1D2HA 1KKMA 4K9LA 2YQZA 2V6MA 5DXFA 4B83A 2XF8A 3E7FA 4JB8A 1A3CA 5E6RB 2FJPA 3DWIA 4OQZA 2VWQA 1R8SA 1ZVMA 2G0NA 2IHJA 1CDDA 4BGIA 4RJJA 3VPBA 2W6QA 1H8ED 2WYVA 3IX7A 5GWXA 4F86A 1ZCAA 5IRCD 5EFZA 4D8YA 3IEIA 1PP4A 2VDOB 2QG9A 5BOSA 3E1SA 1L5MA 1UM9B 3QENA 4KMRA 4X20B 1TM7E 1FCJA 1JSXA 1ZVQA 2C2ZA 3K8QA 3WS7A 5HOQA 1MF7A 1PWXA 4HADA 5B7QA 1V4BA 3OESA 1PGOA 1DOZA 1UMCB 1KTVA 3IUJA 4XDGA 3PSAA 4M49A 1C7QA 2AYZA 4BX0A 2W6JA 4HX5A 2Y77A 3IQEA 1E64A 1DZIA 2WUEA 3G1TA 3DDUA 3KZXA 2JD2A 5EHNA 1J5XA 3JYHA 4D74A 2P79A 4K1LA 3SC4A 3EIEA 4EKGA 1XIVA 3IV7A 4FFNA 3S2GA 3M6FA 3ZY4A 3F90A 4UUQA 4DJTA 5JXGA 3E5RA 2ONKA 1TU0A 3K1JA 4G0NA 1GA6A 3EDCA 2ZI6A 3ZC3A 5JFTA 2NTEA 4MUEA 2ZM6B 1T2UA 2RH4A 5EPOA 4HWTA 3BEOA 3EXIB 4UBMA 1K06A 4X6LA 4IJUA 3AVXA 4N7MA 4GW3A 2BN4A 3MJ4A 1A4XA 1C5KA 4CLRA 4ID3A 1K4KA 3UVEA 4LZOA 1OF1A 4ZAZA 4EFLA 4EHIA 3R8FA 2EFDB 3Q0TA 2O2ZA 1B8PA 1P0CA 3GZTB 3P5SA 2NV2B 2C8KA 4O08A 3SKYA 2XKKA 1NW5A 3QKRA 2R6CA 1TLLA 4EX6A 1M34B 3L0DA 1RTTA 4ZQEA 1N5KA 1W0KD 3IBYA 4BE9A 2XWBF 1J1ZA 4ARIA 1COZA 4FT4A 3KDSE 5AOBA 3U48A 4RULA 2GXAA 1JHMA 4BVKA 1XCGB 5CA0B 3IA2A 5HXAA 1EKXA 2Z6QA 3DAGA 3PJEA 4UMDA 2WWWA 2HA7A 3QY0A 3ZHVA 5J47A 4JMLA 5C35A 3IMKA 1L5OA 2VJKA 1VXOA 2FWNA 3W6OA 3WQRA 1N5RA 3ENNA 1CT9A 1AHHA 3P2JA 4JR2A 4HH4A 2HIGA 3FFXA 1L1QA 4WBNF 5BWMA 3F71A 1U90A 2C5HA 2VYCA 1QYIA 1QU3A 3ABIA 4DA6A 3AR6A 3R0IA 4CUKA 4OCZA 3FD8A 4AJ4A 1E98A 4B1FA 5TIIA 1Q7BA 3RSFA 4F5EA 2IIVA 1VM6A 2X8WA 3ABRB 1QJCA 3Q9NA 1SZDA 1QKJA 3BK7A 2E85A 5C9ZA 5K0GA 5AUPB 3IMEA 1ECLA 3DV9A 1JHYA 4HMPA 4HQFA 1U9IA 2WKSA 3CLRD 3E1KA 4KQ6A 4MWOA 3X1KA 3STXA 1C0KA 1ODFA 1TEVA 1KFKB 1UC9A 4YJFB 4DIMA 1TD1A 4MUIA 3HKDB 2DFTA 2GCIA 4O4HF 4AJ2A 3ST7A 5DNVA 3RVLA 3WJ7A 1LVGA 1ACLA 3QNWA 4JI4B 3H99A 1Y9AA 3T7SA 2OECA 1OAAA 1XVIA 4FOOA 2ZRBA 4AJ1A 2WJ6A 4P58A 3ASZA 3QG1A 4HAUA 3UUFA 1ZG3A 1GGMA 4RMGA 2O2GA 2Z2JA 2WHXA 3IFSA 5CDGA 2AJLI 3Q3IA 4HS4A 1OXUA 3QW4B 4M6WB 2DVMA 4LQ4A 3UMSA 5JDIC 5AVTA 1EVLA 2AR7A 3CRVA 3GR6A 1V0JA 5JWHA 4URVR 4X1IB 3AEQB 2JJ1A 3O4HA 1WW8A 3FTPA 2ZYSA 3EGDA 4PLHA 2HH9A 1SZCA 2XGSA 1ADGA 2RGWA 3V9AA 3EQ9A 3IBCA 1A72A 4HDRB 3D5QA 3GZJA 3W1EA 3SMQA 4YP5A 5JFOA 1AE1A 1DEXA 3C5CA 1ISPA 1CY8A 3JQPA 3DSRA 1GGEA 1DJMA 4R4JA 1F6BA 5HJ5A 5K6AA 3RFCA 3NTUA 1ECFA 4JP8A 2EFGA 1RZRD 4NZYA 3JQEA 3TE6A 3WSVA 1G8HA 1VMAA 2ZJ8A 5AP9A 1E6UA 4FYIA 4AZ0A 3G0CA 4XR9A 4YAOA 1VJ5A 4YMWA 2OHXA 1VKOA 3D59A 1VI6A 1ZBDA 3LCJA 1H1LA 4FSDA 4PG7A 1T10A 1WW3A 4BWFB 3MGBA 3GC6A 5HMMA 1N2HA 2QX4A 1ZO8A 2OD7A 2XECA 2AG8A 1QYXA 1KR2A 2D4AA 2QGZA 3KEFA 5FL7D 1PYGA 4U6SA 4ZU3A 5GGXA 3CRRA 5EJ4A 3GLGA 1M1YE 4QGAA 4WK6A 2JNWA 1NN0A 3NOVA 5TT1A 1KBQA 3RKRA 1TZKA 1GLNA 2VHJA 4LYGA 3RFTA 3NJ8A 2HXSA 3KUXA 2XCTB 2NZ2A 2CVFA 1CCWA 4I1SA 4JBNA 4ZOAA 2HV9A 1BOFA 2ETVA 5DNUA 2EL7A 2ZR7A 3QX8A 3AB8A 2CNDA 4OI2A 4QARA 2XZDA 4B8WA 1BCSB 9ATCA 3QEAZ 1KH2A 4MYTA 3EFHA 2Y1EA 3LLUA 5C5DA 2ODQA 3EISA 3NBKA 3OWOA 4BJ3A 1U6IA 3QMVA 1NM5A 4JDPA 3D8BA 1A4RA 2V97A 1M8PA 4NMHA 1AH2A 4D3YA 1L5YA 2PX2A 1DC6A 3LQ1A 1JHUA 3NHSA 3JTEA 3P7MA 4KRGA 4Y6QA 4YI3A 4BRWA 4D9GA 2QPAA 1Y1LA 5EI5A 3GJ5A 1U2SA 2XHZA 1VIYA 4DL9A 5FOQA 2B8WA 2GHTA 3K32A 3QVWA 3TQHA 4FKBA 1SXGA 3LZCA 5ER6A 4QG7A 4AKEA 1Z0KA 3C5VA 1VTKA 2OORA 1PVVA 2AGVA 2EP8A 2HJ9A 3QMPA 2XNSA 4B32A 1BS1A 2H7CA 1MJFA 4FS3A 1JUDA 4E94A 3AJ9A 1RC0A 5KVAA 3THWA 1XDBA 1XKXA 2ZAYA 3KHUA 2F59A 4IQGA 2WICA 4NJEA 4PGAA 1H6CA 1PS8A 3DAOA 1EZ4A 5K0NA 4LNAA 4D79A 5J2TB 5AR1A 4X3PA 4KAXA 2A84A 3SQOA 5E3JA 4MQMA 2BFBA 3RVKA 4DM4A 4HGPA 1OV6A 3NBQA 2E48A 3AEKA 4BATA 4OL0A 3TEFA 3ZY3A 1SRRA 4JJZA 2BBTA 2AIRA 2IOFA 3A9RA 3L06A 5AKJA 5EE3A 3TAXA 3W5JA 4A0QA 5HSGA 4A0RA 4TVBA 3TNDA 4MXDA 4L51A 4RFLA 4CKBA 3MGGA 5DDIP 3VPSA 3ZJUA 3LJKA 1JWAB 4UD6A 4GE3A 2QV7A 4Z86A 4IY1A 2ZRHA 3QVVA 3HR7A 5FEMA 3TB4A 3AXTA 1EUDB 3HB9A 1M5UA 1LTQA 3IMCA 4G09A 4QUIA 5FNVA 5FWAA 2WYHA 4QC2A 3CVWA 1CRZA 3H1EA 4K6KA 5J4KA 4I46A 3WB1A 3R6DA 2FPGB 4Q9AA 4UHJA 5FLEX 5IXSA 4ZFNA 5K09A 5A4AA 1CZLA 2QLBA 3KDAA 3WHLA 1M0WA 5EQDA 1NVDA 4IH9A 4TZKA 5B58T 3UGQA 4ENTA 1KA9H 2NGRA 3OFKA 4BLSA 1WZ2A 3W5AA 2PRKA 3N0XA 1UFOA 5CLHA 1H4SA 1OXKB 4MX8A 4LE2A 4LGYA 4XI9A 3BDAA 3UY4A 1P1CA 4TVKA 4EYEA 1ZU4A 4GRIA 1GU1A 2CSUA 1DAIA 4QLAA 4PHCA 1KJJA 1A9OA 2XJ9A 3D54D 2BFEA 3R7BA 5KJCA 1K7SN 2V1XA 4HAZA 5DBGA 4JJ6A 3QYAA 1DMSA 3COPA 4ARCA 1X9GA 4LSMA 5DXJA 3ESBA 3EE6A 4FUTA 1SXJC 3C1AA 4ND7A 4G1FA 4BKMA 4DAEA 1II0A 4ZK6A 5HVNA 1JFSA 1QV7A 4C6TA 3R9XB 3PKJA 1Q1QA 4GGPA 3FCEA 2G76A 3C3EA 3L8YA 5EHXA 2C7OA 5CVDA 4ZMBA 3NC0C 1FSSA 4Q6BA 3TCKA 3G8DA 4IM7A 5F3DA 2QW8A 2VVTA 5JDCA 1ZBQA 1T2NA 4DNPA 3QIVA 2C58A 3M3PA 4W63A 3GLFB 4RD3A 1W4AA 2EFEB 4HWGA 3L84A 4TKVB 2BWJA 2P9BA 2BEWA 4ZD6A 3OIYA 4RZQA 4V24A 5L3RA 4FFVA 2YHAA 4TPKA 5LA6F 2AOWA 3RK4A 2W0SA 3LF1A 3WO1A 1JFTA 4HEHA 1JFFA 1FNBA 1NXPA 2OZLA 4PZDA 4G5SA 1Q0TA 3RIEA 2DY1A 4M4SA 2Y6VA 2GBLC 2VSNA 4QUJA 5AXCA 4LZPA 1QIMA 4GMFA 1SC3A 2PUEA 2LPMA 1MP0A 2FPKA 4MRMA 1JIVA 4OFWA 4R9SA 4V1CB 2HA4A 2AKEA 4NYMQ 3T15A 3L77A 1P2TA 3HDHA 4PAGA 1YU9A 2HIMA 2FUNB 5DHQA 4MJ7A 3KK0A 1Y8ZA 1O6GA 3IE2A 1KKUA 1N0VC 4DMGA 1GT6A 1EBBA 1P2SA 4FYKA 2P5TB 4UEWA 1JLRA 2HLNA 4BN4A 3RVQA 1PL0A 2WJWA 3OE7A 4ETNA 5E4YA 5FWNA 5BT9A 1Q92A 2MMGA 2OILA 1ZC3A 2PBRA 4MUJA 3H2ZA 1KRXA 1XJ0A 1E5QA 3ETJA 1JKMA 5SY4A 3PC8C 3PX3A 3I34X 2QRHA 2MT9A 5JCJA 1OILA 2EIXA 3O8BA 4K9KA 5AW0A 3SBEA 3DMHA 4F7DA 3H9BA 3TNFA 4JQZA 8ATCA 4UW9A 2ZBGA 3QFFA 3ZU6A 5LQMA 3IUBA 4JB2A 4DLLA 4EZEA 1JYSA 2TSYB 2AS0A 1D3AA 1F2TB 2G07A 2P3OA 2VPPA 2R1TA 2W2KB 2WYIA 4FSXA 6Q21A 3DOCA 4JSYA 1ZK1A 1Q21A 1ZJ4A 4ER7A 1Y1PA 4GVPA 2QMEA 2VPYA 3OOJA 2O20A 1S3GA 3B8EA 2HTEA 2FQ1A 2IPAB 2R6FA 3TLZA 4EHBA 2H00A 1GKIA 5E1BA 3ZHSA 2L2QA 2EX1A 4Q05A 2J9GA 3CVOA 1XR3A 2QRLA 4U63A 3TSOA 2EGGA 3L43A 3PC2A 5KNCD 1Q1AA 3MW8A 4D9IA 2KBFA 3TLMA 1WPXA 3ZZUA 4C7KA 1XX6A 1K66A 1CRWG 1PD0A 2ASEA 4KFUA 3VJKA 1RAIA 2JI7A 5A6VA 4NARA 4TWZA 4QDUA 1CS0B 2PLNA 1FQKA 2YZGA 3DHWC 4QVGA 4R7GA 2X23A 2X8JB 4AJOA 1EUZA 2VAWA 1OB2A 1VG0B 3M5CA 3UENA 3VYTB 1HA3A 3NM6B 5LCXA 1WA5A 2JPDA 2Y1CA 1OI7A 4LBYA 3KKKA 1O0BA 4KXNA 4XM2A 2RK4A 1OTYA 1BNCA 3BGIA 3VX4A 3LCVB 1U65A 2UYOA 4TQUS 4JJ8A 4RKYA 4O2RA 2GPTA 3RWBA 5JSFA 2QTZA 2Z4SA 3A8TA 4TQ9A 3E84A 1A77A 4K7JA 4R0MA 3AT1A 4MMXB 1H2YA 3OZWA 5FADA 3T7KA 5JMWA 2Q3BA 3DMTA 3AY3A 3LPNA 2OD2A 3F5MA 1KJ8A 4G4SP 3ISVA 3WVNA 3ZEAA 1G8MA 4EX7A 3AL3A 4UTPA 3UT5B 3O8CA 2GMWA 2HYIC 3NHAA 3SC2B 1KJ9A 1QKIA 2COKA 3FWKA 3SJ7A 1U7ZA 4J76A 3H1TA 1UBOS 4HH1A 4U7PB 4L5AA 4YCBA 5DM60 5T3UA 5MHTA 1XQ1A 4IUCS 1W8IA 2I71A 2LWIA 4INZA 2TYSB 4OF4A 2FUG1 1JE1A 4IRMA 4CQMB 2WTMA 4Q1CA 3LPMA 4QUBA 1GJRA 4N3BA 1X0XA 3H1BA 1RI5A 2WIGA 5A2GA 3ZD6A 1OE0A 1ADFA 4Z4QA 5F4ZA 2VT7A 2XUGA 5E95A 1G8KA 2WP8J 4Q7LA 1IAVA 4W7SA 4JD5A 4CR8A 2DTEA 1U1EA 3HCNA 3T41A 1C9NA 4UAJA 4ZT7A 2Y27A 3AHJA 3ZOZA 1HMYA 1KPGA 1B8OA 3DZDA 2ZRNA 3H5RA 4R2KA 4B87A 4EWLA 4U5XA 5IC5A 4MS3A 1RRPA 1ZNXA 1XHFA 1KQGA 4TMXA 2M98A 1PQWA 4H17A 3OOYA 4LSWA 1K7XB 2I1LA 4QU0A 5FUYA 4LDQA 3VVCA 4ESEA 2Q28A 2VDUE 2EYUA 1BH2A 5LDDC 3LY7A 4QX6A 3A32A 1J4AA 1GUYA 4ZVSA 1LJ8A 1W1IA 4FI3C 2JLQA 2PAFA 1PEKE 1XTBA 4FE3A 1JDBB 4Q47A 5EZSA 4AO6A 4PEVA 2OZEA 3L7MA 4NV3A 4R8KA 1FQJA 1TZMA 5H80A 1X8KA 2IEAA 1IEWA 1X1QA 5DPMA 1KY3A 4K2AA 3NAZA 4BCCA 1SVSA 1SHTX 4JHLA 3ZD8A 1ONPA 3L1IA 4RAQA 1M0EA 4HNSA 2F00A 4TXJA 3KLOA 4ZYZA 2GTPA 1JHPA 1DKOA 3IOEA 1PJCA 3JU3A 5F4BA 7REQB 2H1IA 4IF4A 1P5FA 2JFUA 1E3IA 1O89A 4J3JA 2DT5A 1N1MA 2P6PA 1Z35A 4JLWA 4NYJQ 3WK7A 5JD5A 4YY3B 4QHYA 3UV7A 1OY1A 2CE7A 1BA2A 2G5PA 1HR0B 4E5YA 3E9QA 2UKDA 1KXJA 1H69A 1RLOA 1TO6A 3L9XA 5AK4A 3ZY2A 2Z6UA 1DQYA 2C2HA 2EJWA 2GVNA 3U4CA 2Z57A 1P7CA 1WS6A 2ESRA 5CYFA 3ROKA 1MAHA 3DZGA 2H4WA 5LKAA 1WCIA 3D6AA 1JVBA 2ID7A 4CM1A 3QE4A 4OHWA 5AKXA 1XMSA 2V9CA 3KQYA 3QXHA 3IVGA 4BV3A 3KYCA 4MLDA 3GPIA 3DL4A 2V6FA 2QG4A 3C6XA 4NOJA 1Z88A 1DO0A 3E4CA 3VH4A 5CPBA 2DAPA 4B4VA 3OEWA 5TQ2A 1JSRA 5BV0A 2F48A 3NP9A 4A1FA 1NJ6A 1KZ1A 4CN9A 3ZDBA 4OI0A 1GL9B 1O8BA 3G02A 3P4XA 3RO7A 3K70B 3I76A 3GZNB 1XHLA 4JP5A 1GCIA 1ZMBA 2D59A 2JDID 4AJLA 1ZU5A 1D6NA 4WKCA 4ZI5A 5LZ2A 1QTQA 1V9SA 4WXEA 4E03A 1ZMTA 3PT9A 4CTJA 4MRRA 4PN7A 1ZVJA 1MAAA 1RDFA 4WZBE 1NG9A 4IO1A 2Z58A 4H0CA 3KETA 1E2QA 3H2YA 2BBWA 4WVFA 3F5FA 3U3KA 3W7BA 2R1VB 3WGQA 3C39A 3CJTA 4TVSA 2WT8A 3NQ41 3ZDYB 3JZAA 2FPIA 3SEZA 4NBKA 2PL3A 3KKMA 3LD9A 3T4EA 4B3DA 1VRVA 2A9VA 2J33A 3OJOA 3UXEA 2NQTA 2E89A 4IXTA 1BW9B 4RVUA 1ZAYA 1AKMA 2GN1A 1AQNA 1T6NA 2PX4A 4OGKA 1QHHA 2O5VA 5IJ0B 4LKRA 2YZNA 3F6RA 4WCFA 2YV4A 3FPHA 3BHJA 1ZEMA 2R8OA 5BXQC 2W2MA 5G41A 3B53X 4O29A 1E0KA 4CLOB 3I6QA 3LX5A 4MWTA 1QE3A 1YQXA 5MN4A 3IUNA 4R68A 4LRUA 2VHZA 4AXBA 3KKPA 1F2UA 4ALLA 4IDAA 4YUWA 3EZ7A 2EVWX 3K96A 3OY7A 4H2DA 5EHIA 4QTYA 5CVUA 2JAXA 3QBEA 1Y3HA 3FGPA 4JI8B 1NJSA 1JVSA 1RKQA 2PRIA 3DDZX 2JFPA 1EFPB 5L3SA 5KDOA 3KOUA 1K88A 2XTZA 4TLCA 4WEOA 4J3FA 3RIGA 4F97A 1AA9A 2R8XA 3PDWA 4M0MA 2K7ZA 4V03A 4CTKA 4XD2A 1I0LA 1ZSYA 4CDMA 4KJXA 3F46A 2O50A 3FSEA 4AXXA 1X3SA 1X7ZA 3IA7A 5CRIA 2UUAB 1I3MA 2HHCA 2XZTA 1PNRA 3IQDB 3PWZA 2ODAA 3ETHA 4BMYA 4P4GA 1IHPA 4DZRA 2VNIA 1LDBA 1UCFA 1D4ZA 3P97A 1G4UR 4FCCA 4F4FA 4TLDA 4UBJA 3D3JA 1G7RA 1W29A 5JPIA 4LK3A 4UPDA 4BE7B 1Y37A 1UMBB 5I7EA 1JKJA 1UIMA 1XP5A 2RJ3A 1W36B 1Z17A 3QLVC 5JNRA 3B5JA 4XD7D 1HT3A 4P4LA 1RWQA 3UXYA 4CM8A 2Q45A 4X5OA 1E1QD 3HADA 4TTIA 1MNAA 5CDFE 5JXJA 3GLIB 6PFKA 1XNGA 4FB5A 4DOMA 3GLSA 3PRKE 4XOUA 4L76A 3ICQB 2DQYA 2XTAA 1DXHA 3D6MA 3H8VA 4BAZA 3X1WA 2I1WA 4R1PA 4H3KB 2ZUSA 4UXHA 5BVGB 4LJ8A 1LQTA 5BYKA 3ANLA 3N0TA 5BV2P 4YUVA 3L6RA 1QPBA 4F4CA 2JKZA 1STOA 1ULAA 4WADA 4E30A 5P8WA 4EW1A 3CX7A 3AOGA 1BFUA 3RSHA 3L41A 4TTAA 3E2MA 2CHUA 5TGZA 1J1IA 4MLZA 2P5UA 3KEOA 1MQSA 2PT6A 2WU3A 3IDSA 3PC6A 4M0DA 3KAJA 4TRJA 5CVCA 4YQZA 3VNVA 4RTNA 4M1SA 3T9BA 3S8MA 1S9DA 4CEJB 3OUUA 2JCSA 3AG5A 4HDNA 4UZEA 3T5AA 3CLKA 2ISCA 4I1UA 3C5HA 4JZYA 5C5EA 2PKRA 1BRMA 3ITEA 5AI6A 4AJPA 4MUBA 1LBTA 2BEJA 4YALA 3A6LA 3HR4A 4YDHB 3KU4A 5KVVA 1SWVA 3EZGA 2R86A 4JLKA 3TPZA 4W9NC 4B7UA 4C88A 4HXEB 1AS2A 1ODCA 1X7WA 2CDBA 1YF3A 5LLTA 4KLAA 3V7WA 3ET5A 3MRXA 3QHAA 2PSDA 1P4JA 1MB4A 1XL0A 3I8OA 4JB3A 5FBVB 1OBHA 4LHXA 3R3HA 3AF6A 3F7TA 4DCTA 4E7PA 4F12A 1JJAA 2ZAGA 1OH5A 3BGVA 4X94A 2ETXA 2HL6A 2FRDA 2O3SA 4TTVA 3B6JA 3DKKA 2Z8XA 1FRQA 4LFBB 2WI8A 2J3HA 3ZBUA 5IYZB 5IM4A 1SOWA 2WJPA 3CNQS 3FVQA 3HNPA 2Y92A 4JEMA 1AF7A 4V2IA 4OP2A 3ZW8A 3CW2A 1J39A 5HRCA 2IX9A 5LWQA 1F3LA 2G1UA 4FP9A 4KV7A 4J1TC 1OIXA 1NUAA 1WZCA 1AV6A 5TF0A 5EIBD 4BP9A 1I2ZA 3DEKA 3HZRA 1SHUX 1HZZA 3AF1A 1Y4UA 2BV3A 2X1LA 5CNKA 4C4RA 5JPDA 4UVIA 2GNAA 4DPKA 3U80A 1ATIA 4MIYA 4XJTA 1N6KA 4NOLA 2V8BA 2I6SA 5BYJA 3DWFA 3F4KA 3GLHB 4R5HA 2Q3CA 4K6CA 3U3OA 4CCSA 2VDWA 5CB8A 1S2DA 4PNHA 5BUQA 4YAEA 5I9IA 4I6JA 1RLJA 1U7WA 4ZAXA 4JI0B 1QHYA 2ZITA 3ZXSA 3AHFA 4KR2A 2CUKA 3DMDA 4GPAA 4TWBA 1W85B 3IEVA 3L0SA 2H31A 4DDVA 4AMBA 4ZZIA 4MVJF 4ACBA 1UH5A 3HHPA 1W35A 3V8MA 2B78A 4YO8A 4N5DA 4GKAA 1V2HE 4F6CA 4IRUB 3HKEA 2P6NA 1LH0A 2WIJA 2ODBA 1C1DA 1PK7A 2W0MA 3DA8A 3ZJ5A 1Z2OX 2PUDA 4G56A 3CRQA 3L4BA 3T9AA 2AF4C 3PR2B 3OE5A 4ERXA 4J0KA 3AL0C 4H7FA 5DSTA 1K2VN 5IEJA 5SY9A 2NVWA 2DCMA 1JQJC 2E2WA 4IDHA 3PX2A 1W8DA 4RH0A 5IVKA 4DC1A 3UT6A 3ILXA 4GXQA 3EAGA 4LYDA 2H48A 2IT1A 2X3FA 3I2GA 3CVJA 3LWDA 4Q9DA 2B9EA 3D81A 5IZ4A 1P18A 1XZPA 2C7VA 1OT5A 3B9PA 3FIJA 2RGEA 4GMXA 4M37A 5TQ0B 5BMVA 2G4LA 2NZXA 3VO8A 3T1YB 3FBTA 1KMHA 4ZI7B 3LX6A 1XF1A 1JBQA 4CKWB 1YSCA 4JGGA 1R00A 1WUYA 2PNFA 4CG0A 4GNRA 4J2TA 4ZAFA 4DDTA 1PZGA 4NZZA 4XB1A 5CT9A 2GETA 3NCTA 3C3PA 1PR6A 4URXR 4UZFA 2ONYA 3HUDA 1DL5A 1RHUA 1N8KA 2H54A 3DMGA 1LPOA 1TIBA 4L3VA 3KJHA 4D80A 1GNSA 5BVHB 1YRHA 5F2OA 3SIXA 1AHPA 2ZU6A 1D4OA 4L16A 4I4IA 1WXDA 2WHQA 2XE8A 3B1XA 4GC5A 1KRWA 3AEYA 3F67A 1QF9A 4L4ZA 4UHCA 1N8TA 2Q6VA 4D6YA 2ISQA 2HCRA 2XYRA 1IFXA 2IFTA 4Q9HA 2ZSHA 4PGGA 1HDXA 3SIRA 5BXYA 5JAPA 4YCLA 4NYIQ 4ZEXA 3VKWA 1HXHA 3IAS6 2X6RA 2ORYA 5EPUA 3KSZO 4KIJA 4KWCA 4GAEA 2UUPA 3OJLA 2V55B 2NPOA 3I6IA 4MKHA 4GECA 4P0TA 4WEQA 3PV0A 4OGFA 3RBVA 6GPBA 5ARCA 3A1WA 3K9CA 2UZ1A 1VLLA 3TQTA 1AUXA 1CUEA 1JQEA 2CVQA 1H8EA 1AUVA 2W2OA 2UZAA 2YXEA 3G9ZA 3JSAA 3PF9A 2H1CA 4BZQA 1SD5A 1R6BX 2NSJA 2Q6LA 2WJYA 5DXAA 3SQLA 2AZXA 4TV9F 4DDKA 1XFDA 3NWOA 3BB1A 2GBPA 5BWNA 2YWFA 1LC3A 2MYUA 3HZOA 1YQEA 4RFSB 2NPFA 4AP9A 1QIKA 3ZWAA 5A4MS 1E6MA 1GVHA 1M8JA 4AP6A 3RRFA 5HYVA 1KZ9A 3EH2A 4GWKA 1WIWA 3D8RA 1BAPA 1XRQA 4X54A 5DASA 2CZQA 4UM9B 4ZOCA 2E18A 2FPRA 3W3ZB 2EZ8A 1A1VA 2B34A 1CUIA 3OZIA 4CHGA 1NVGA 1KK3A 3ROXA 1U2DA 2BZ0A 3I45A 4D9MA 4C7BA 5A1TA 5DNYB 1OI3A 4QDOA 3HV2A 1ODKA 1CW2B 1U0NA 2BKVA 5EN4A 1TJNA 4MP8A 5DTIA 1CV2A 1J6UA 3PTZA 2EAUA 1VE1A 3COSA 4WAUA 2R47A 3ED1A 3JSXA 4DLRA 3SQDA 1PJZA 3S8EA 1RXUA 1YUMA 1LLDA 3T94A 4ZVMA 3O6VA 4X44A 4YCSA 4UDOA 3LRPA 4JUCA 2XRZA 3ZQKA 4IO0A 2GJKA 2O0LA 4CMCA 4EHHA 5LZ8A 3WY9A 5CU7A 4MPTA 4GUDA 4AICA 3PUYA 4ERNA 2A9JA 3NXSA 3SM9A 2EOAA 3NOXA 1QZZA 3OPYA 5DIZA 2VT3A 4I9NA 4PZYA 4I50F 4P92A 1U1DA 1VPWA 3AVOA 4A8HA 4BLTA 1N32B 1OV4A 5TXGA 1ZUNA 3HL0A 4P08A 2A33A 2WD9A 3K31A 3L4KA 1ST2A 1YA8A 2GN0A 3H6KA 4B4DA 1K7YA 1U7UA 3FPAA 3OC6A 1U0FA 2IEZA 2EBFX 2PM8A 3O31A 5EXXA 3KQMA 5ERXA 2E37A 2Q2VA 2JHGA 4OGGA 5H02A 4EK9A 2G0AA 2Y71A 1Y4AE 1P8JA 2C5LA 2ECKA 3UAGA 4F3RA 4IH4A 1XVTA 2NVBA 2UZ0A 2QX7A 4MQFA 3GCGA 1MQ8B 1YCFA 4KSYA 1Q1BA 5CH5A 5TX7A 1FLVA 3TNJA 3K35A 5KKCA 3MM4A 2ZYUX 4BFXA 1BXRB 4RV4A 1P7YA 5CB4B 3A4LA 3OQIA 2BE7A 1SVNA 2O0MA 3HVJA 4LPSA 5AM4A 3KD3A 1QH1A 4YRQA 2YJGA 3QM1A 4QBIA 2VPIA 2X9GA 2YDYA 2HSGA 3GFTA 1DTEA 1ZCZA 2ZE6A 2D5BA 2C3YA 4PWZA 3HA5A 4K2HA 3V8VA 5KTYA 3V4FA 1T8TA 2WIFA 4QEZA 2XYPA 4DLZA 3TW0A 4E5VA 4Z4EA 2I7DA 1Z4KA 4OQNA 3AM1A 1YL7A 4MUAA 1CY7A 1I1OA 2Z2YA 3CRMA 2D2XA 3E35A 3TOVA 4YAIA 1Y8QA 1ZSNA 2VTBA 1EA5A 4ZCPA 2A88A 4RQBA 1EGHA 3PB3A 5A3VA 5A9SA 5BR1A 3EEQA 4FS8A 1VBNA 4F4IA 3DHEA 4E5MA 4RA9A 1HFWA 4G67A 1BQEA 3CN7A 5ESDA 2ORVA 4K28A 5H1YA 5LIRA 5AJYA 3OX1A 4S24A 4IWXA 1FYFA 2PXXA 3VR2D 4FCVA 3SSNA 1OZFA 2VCEA 1NU8A 1D2EA 4JAVC 1WCV1 4D0NA 3OURA 1V25A 1PEDA 1LRJA 2AOUA 3LV8A 3NEAA 5CYOA 4IOMA 1F38A 4YCAA 1EQUA 5DH9A 3VNRA 1SC4A 3HJHA 4E2FA 3LUPA 3TIVA 3IMFA 1GV1A 3P8ZA 3PQ6A 4NECA 4ZT4A 1J56A 3T7CA 4ZV9A 1M6EX 3ZHQA 4Z54A 5B6PA 2BCGY 3K7EA 4FYPA 1HDEA 2ZANA 4QA9A 5FRDA 3BFXA 5JHGB 5TC4A 4QBHA 3WX0A 3IGFA 1LDEA 5DWQA 5FJJA 1VA4A 1AY0A 1U0LA 5F7JA 1FP4A 2PUTA 4JQOA 5I9TA 4F84A 5JLJA 2WAYA 5FL7A 3ZHBA 1EFHA 3ICPA 1Z08A 2FWIA 3IERA 2VQSA 1QQ6A 1AQIA 2IS2A 4DJEC 1Q74A 1R8QA 1C9DB 1DIRA 1P1JA 2C5EA 2B82A 3KYDB 4U3JB 2ZKLA 1I3OA 2ZSEA 3U4DA 3WL6A 1N6LA 1M6VB 3T7EA 1SKYE 1XJQA 1DFIA 3DAHA 4I36A 1R1DA 1OWLA 5H7XA 1NVXQ 1EXMA 3OVMA 3R5FA 4PBSA 2V6IA 3VSEA 3FPFA 3MJFA 4TWAA 2AFHE 4OTZA 4UAVA 2JBWA 4WZAE 2AXEA 2WSIA 3A31A 3BKXA 3ADBA 4EEZA 4QE3A 3MSCA 1WCWA 4PLTA 3FSJX 4HQLA 5CD9A 1WMAA 1ZQ1A 2FCRA 4NTZA 1ZYUA 2W93A 1QCCA 1AKNA 4U39A 4YMUA 5KYGA 1JJ7A 2NP6A 1USUA 3PWKA 4KUGA 2HV8A 1T3TA 4PF1A 3BXGA 4M9RA 4YT8A 2BEUA 2FZ4A 4V0KA 1GGHA 2VF4X 4I1OA 4RZ2A 1M72A 3IJ5A 3NDRA 1U28C 1WR8A 2GSWA 3KYBA 4Q12A 1AF4A 4URFA 2UYHA 1KHTA 4JJAA 1Q0LA 5C31A 3OX2A 3R3YA 2EDAA 2BJWA 4BGDA 1V39A 2C9DA 2H63A 4I4CA 4RLFA 4A2CA 1SCQA 3KTOA 2QMYA 2FSFA 4AMZA 2Q62A 4KGVA 1CP2A 1PG5A 1T1GA 2PY6A 1SCBA 1RPAA 2P9JA 2NXJA 3EG5A 3KXLA 4JOBA 4MVJI 5HW0A 3U56A 1HKHA 1TQ8A 3QQ5A 4WN3A 1XXHE 3ESAA 5TQJA 2FR8A 1J70A 1SEPA 3K6JA 3UFXB 4LVNA 4EF6A 3KV3O 1NDQA 1KO4A 2I2XB 4O5OA 1QP8A 2QAIA 4R41A 4D44A 3IAUA 5TT0A 1KQPA 4KCGA 2DGDA 2X8AA 3B85A 3LA6A 5ITVA 5B36A 2P9ZA 5BY2A 3SQXA 2JCBA 1HLFA 1WKBA 1SU6A 1XQWA 1NUPA 1R88A 2DBVO 3VTAA 1OW3B 2D54A 3F6SA 3E2PA 3RJTA 4N0QA 5C5IA 8ABPA 1F0KA 3AINA 5IHPA 2CCGA 2F9LA 4EVIA 2APJA 4UE3S 3O2SB 4BU0A 1CU1A 1YS4A 3FMGA 3BJIC 5I4KA 2K2QB 4B85A 5CA1B 1UBUS 2FZKA 4HO1X 1D2AA 4OSPA 3SZUA 3TCNA 4S2EA 3QU4A 4URHA 3W6ZA 1RD4A 5AI8A 1RC8A 1J2YA 1FMTA 2XY4A 3TZKA 3E70C 5CAEB 3VPFA 1E2BA 4J0HA 2FFRA 4AZTA 2BMVA 2DPGA 2HC9A 2CBZA 1ACJA 2RGGA 3K0BA 3N39C 3R3SA 3CR7A 4G1MB 2XDWA 1KDPA 3Q7RA 3UGJA 4B0OA 1H05A 2B5WA 2XB6A 2FOIA 4PANA 4UARA 4RE5A 3WQQA 3TECE 3QLEA 3R5KA 4H9GA 1CNFA 3U4QB 2IXTA 2VTKA 1YIOA 2W2TA 5BWOA 5JSZA 2IW1A 5DX0A 3VKUA 3VH1A 2PZ8A 4RTOA 1VPDA 1O9HA 3KJEA 1X9HA 1DG3A 3TLBA 1CRPA 1CNEA 5DI3A 4JJIA 2FOXA 4GBJA 4HGYA 3WWYA 1AB6A 3A1VA 2MJLA 1GZ3A 1TAHA 4ZKDA 4QRDA 3K4HA 4QOJA 1BDJA 1N3IA 3LZDA 1RSZA 4AN4A 4DANA 3K4QA 5GOZA 3ZWDA 3FPSA 2EWVA 1UEJA 1WY7A 2INGX 4XA8A 1MC4A 1QONA 4RVFA 5U4XA 3EW9A 2DUJA 3K0HA 1L7OA 3P4YA 1ZOOA 4I66A 1T6XA 1XQXA 3F6YA 1NJFA 1YB6A 3PSHA 4LZAA 5J1TB 3WISA 2NUAB 3NRJA 1E5TA 2NO7A 4DJFC 4R3WA 3IB3A 2NOAA 2C77A 3ONDA 5HM8A 1RACA 3WGHA 2D6FA 4IGFA 3G9UA 5KNCH 3QPUA 1KBZA 1H4TA 1X1EA 1JHDA 2POCA 2YXPX 4RCZA 1YZYA 1HLDA 1RCUA 1LBEA 4BO5A 1DZ3A 1EX1A 1TA4A 1YB2A 1FTGA 2QAGB 1G9XA 4NAHA 3IOCA 2GK7A 1YB1A 3EARA 4TV8A 1ZI6A 3A9TA 1CC1S 1P5HA 4CDGA 4DRZA 2IPLA 2VYQA 2B8EA 5KYXA 1F12A 1OAOA 1WLSA 2II6A 2G04A 1G41A 1ONOA 3LVRE 1WXXA 4EKYA 1O54A 3IDAA 2R66A 3MTBA 1X6VA 3T95A 3FSRA 1VFPA 4BQEA 4LSZA 3R9IA 3H5VA 1RE1A 3QFTA 3BULA 2NV6A 3VR5D 1L7EA 2I78A 3X43A 3U9TA 2AOXA 4DC0A 4WKNA 2HK8A 2AX4A 2PH7A 2ZULA 2H3HA 4C21A 1U3CA 3Q1KA 4I7EA 5EA2A 1ZI9A 2ONJA 1JKXA 2P2DA 1GCUA 1GZ4A 1V37A 3ZDZB 4YMIA 1Y4ZA 2PMWB 3F49S 2Z2XA 3V8QA 5I7UA 3PNQA 3KTAA 3C24A 4LTNA 4KLNA 1ML4A 2PGLA 2CNBA 3M3HA 3UATA 3ZE9A 3ZCVA 3KQTA 1EVZA 4KOEC 2FX2A 4A23A 4BRZA 2X5XA 3AQ4A 3LOQA 2BTQB 3MS2A 5JCXA 1GPWB 5K0ZA 1K6MA 1E2LA 4JYAB 1NW3A 5EPEA 1CUSA 1HTBA 2J32A 2AX3A 3LQYA 5KVCA 1U9IC 5EMJA 3DPSA 1Z5ZA 5E6SB 4XVCA 3ZCXA 3PPYA 2IHZA 4U2KA 5EJGA 4JYZA 3SHVA 3ND8A 5AK6A 1YJCA 4B3HA 4FPXA 1F8GA 1G7SA 1T91A 1AG9A 3E48A 3I4CA 4F91B 1XXLA 1R8YA 1WAMA 1QLWA 1NKSA 3GRFA 1B15A 4JJ4A 1NSTA 4MR9A 1PL6A 2XEXA 1AKTA 3BD9A 4GXRA 4H35A 1JEYA 5KNCA 5FFFA 3QUBA 4PTYA 6YASA 2ZBPA 2NUTB 1DAEA 4UTOA 2R8ZA 4YAJA 5L7TA 5DLPA 1ZH4A 2WZQA 4WA8A 3UJ9A 4DIDA 1PS9A 1N2IA 2ZSKA 3GNSA 1SC6A 3HQ4O 3QUTA 2YJ4A 4RV5A 3H2KA 3AZOA 4JEHA 4QBFA 3V4PB 5CITA 5B30A 1BEEA 3OA0A 4X84A 3TIIA 1T26A 2JAWA 5TB5A 5FFNA 3I42A 2FP4B 2VAXA 2OC9A 2LTAA 4KQFA 1L9XA 3SJBA 3L8ZA 1KVUA 4QYWA 2YFHA 4XQCA 1ZK2A 4YFVA 4W9MC 1GN8A 5IT5A 3ZG6A 3VA7A 1T0IA 3QPCA 3T4PA 4GT1A 2PZBA 3S6JA 2LBPA 3R74A 3GXOA 4HFRA 4M38A 3TZEA 4A8JB 4EHDA 4EUEA 1F2DA 3U7IA 4YUXA 1GQFA 4RF3A 5IAKA 4CMGA 5B37A 1ZH6A 1J5PA 4Z99A 2IXAA 1DIHA 4CMJA 4D98A 2FZEA 4HDSA 5K20A 2QJOA 2H1WA 2B2NA 1PW5A 2JK1A 2DBZA 4MVJD 4RABA 3TEMA 3WIEA 4FBGA 2BHTA 2OBBA 2ZR0A 3H4IA 5FKJA 2PA0A 2A1UA 1JG1A 2I5PO 4MUMA 4Z8XA 4FTWA 4A8TA 3DFIA 3QF7A 2VKQA 2H0QA 1MO4A 3BK2A 4PZUA 2ZU0C 1LSOA 5FAXA 1YV9A 3U13A 2IJGX 3AF5A 1BMQA 1DIBA 2P7IA 3B6MA 4XB6B 3ZWBA 4EY7A 1FTSA 5IT0A 2QD3A 1YVRA 1SCUB 3SVLA 3DKIA 1Y6FA 3DONA 4C05A 4KPUA 3H5AA 1MB9A 1ZH2A 1ODSA 3B89A 5ALKA 4EO9A 5HPYB 2H9IA 2DPMA 1NM5C 4EG5A 2VK2A 1LDGA 3QKUA 3EY9A 5K05A 3WBKA 1M6HA 1NBHA 1RR6A 5AKLA 2C97A 4Y98A 5D5QA 1JLHA 2WA2A 3CA8A 3ML1A 1A2KC 3KKOA 5ARDA 3RJMA 2GK4A 1WP9A 2Z9DA 1HE8B 1TYAE 2Q0QA 1PI3A 2PVSA 3ELUA 2PZAA 3GG2A 5KX5A 2MU1A 4NZNA 4ZO7A 1WQ3A 1RKVA 2C29D 1I2BA 1TKRA 2JGDA 2REOA 2ZWIA 3SG0A 1CUYA 2ATVA 3PCRB 2QVBA 1ESDA 4IJMA 1M1NB 3K9WA 2OORC 3IPRA 1JXAA 4MQEA 5FOXA 2I22A 3CRZA 4Q9LA 1U3VA 5CH3A 5J40A 4CVNA 1Q22A 4I8IA 1CQIB 1IG3A 3P9QA 1VGVA 1D1PA 3AETA 3P0EA 4JT9A 1M6YA 1N6RA 4U6QA 4UHBA 3SJCA 1RPTA 1ZMRA 1X7GA 3I12A 1BD3A 1TYCA 4KGXA 3NVKI 1CHNA 4UEKA 3I6YA 5IAJA 1LQ2A 5J2UB 2RI0A 3QXXA 4ED9A 4ZI2A 4FEGA 1KH3A 2WTBA 4RTPA 2JIMA 1JNYA 2O3TA 4QUKA 3UK7A 4AYTA 3GUZA 2W58A 4K9OA 5JSHA 1MMFB 1HC7A 2VDLB 2I1QA 4BFUA 3SY8A 1WVMA 4LFAB 2WM8A 2H9YA 2XAUA 1P62B 3QV1A 4IIEA 4TUYB 4N5NA 5CFOA 3CTPA 2RD2A 1VL5A 3TGWA 1JDSA 1OFVA 4ROSA 3GVCA 4PONA 3N75A 1OQAA 3EDMA 2B4KA 1ZMOA 1BN6A 3WAJA 1VGRA 1WUJS 3H7IA 1LPMA 1M2FA 4HDMA 2EC5A 1EUCB 4LEIA 4RFVA 2X9VA 2E21A 4RTRA 2GHIA 1B0AA 1K2WA 3CX6A 4LJ7A 4DQUA 3AY0A 2CLDX 1YI1A 3HYLA 1MX1A 3FNFA 4X3CA 2GCEA 1DRWA 5ICEA 4I55F 2R4QA 3TLAA 2ZJ0A 4X00A 3KJQA 3TMKA 3K6SB 2GO7A 5AW2A 1ZHOA 3WDKA 4NPAA 2XBUA 1CJCA 3ANYB 3MWEA 3IKJA 2JDIA 2IUYA 2LIVA 1J33A 1JHZA 3JZMA 1MNQA 2BCEA 3PF8A 1KDOA 3PS9A 4INAA 4MWGA 2YVUA 3VMMA 3D6UA 3EIOA 5DHSA 3UPTA 1E3EA 2Z04A 4V0SA 1ZY2A 4BE4A 1A8PA 1V11B 3BE6A 4FZJA 3DE0X 5D51S 4BX9A 3QMWA 4I9HA 1H5NA 4V0QA 4XWAA 1OLXA 5BNFA 1DE0A 4RDXA 9LDTA 1R16A 1CZNA 1MXHA 4LJ4A 3V48A 3TUJC 1SCKA 2C8JA 2GHRA 3LVQE 5K6RA 2JCVA 2O0KA 1NRJB 4JBIA 4V2UA 3C87A 3Q4GA 1M2HA 2GQ0A 2O2SA 3R40A 5CGQB 5DTRA 4ZYXA 2XGGA 2IOHA 4N54A 4HYTA 1ENOA 4FN5A 5JDCC 1FS5A 3GJ0A 4PCVA 1I51A 1QSGA 2NPIA 2RKOA 3EXFB 5LUBA 4I3HA 3OPNA 3L8GA 3LMKA 3AESA 2EZUA 5M29A 2VCYA 3DAPA 2WJGA 5CCEA 3NDJA 2CMFA 1A8QA 1M2NA 1L3BA 2J30A 4FBLA 4KQCA 4DEXA 1EAYA 2OT3B 3ZJTA 4GX5A 4HPJB 4DYVA 1GSIA 2YWDA 4YB8A 3T3OA 1EVJA 1FJHA 5M34A 4M1OA 1OZ0A 4QELA 2OBLA 4X91A 1EFVB 3MEQA 3PI7A 2RE8A 2IC5A 3HWRA 4JC8A 2W6MA 2B2XA 5ALWA 3EWIA 4ZZ3A 2P9CA 1OXBB 1NYTA 3B51X 4QU8A 1HT1E 4J8PA 2VRWA 1EDBA 2Z95A 1OBOA 3ZNOA 1FK8A 2AWOA 1R6AA 3HNRA 4ABYA 3KOYA 5IS2A 5DM0A 1BHJA 4KXYA 1ORTA 4OPMA 3ZHOA 2CYCA 3KVYA 3FOAA 4UAUA 3VKGA 1XJWA 3Q41A 1P17A 3QMMA 4M0LA 3OTQA 4AJEA 1QFJA 3A0UA 1TVKA 4UXJA 3VH3A 1E3SA 2WJVA 2PS0A 3PR1A 1HYEA 4OI1A 5A62A 4CI0B 1US8A 3GBSA 4DILA 1SUAA 3INTA 1AU9A 2M6SA 1ESEA 2BY4A 3LBAA 3MIZA 2X2PA 3PHHA 2C96A 1BKDR 3Q0IA 4O6VA 2AWNA 3PEWA 2BMDA 2H1LA 2WWRA 4XD7A 1U0JA 3VC1A 2C07A 2OESA 1E1QA 2OHFA 3SS7X 4MYRA 3ZGNA 4HVLA 1Z2CA 2DPYA 2QQGA 3LPDA 4Y6SA 4ZVNA 4ZJZA 1KAOA 1SD2A 3ICEA 1VE5A 5CYPA 5BN1A 4JQCA 3GIWA 1FRFS 1P7ZA 1UPFA 4C1BA 5LP6A 2XGJA 5H70A 2WPNA 2C95A 4GR5A 1HY3A 2M1ZA 3UT0A 4W82A 1YR3A 1BH6A 2BI4A 4HNRA 4R31A 1EZZA 2VT6A 3QF4A 2CJWB 3QTLA 4YCCA 4FE7A 1A9XA 4KBYA 4FMCF 2VJYA 3ZJ4A 4CQLB 1OFHA 1B16A 1UUFA 2Z9CA 4B7CA 1JRLA 3OSZA 1EVKA 3N7UA 8AT1A 3KSBC 2PL1A 1IVNA 2IYTA 5BR4A 2XR1A 2YICA 3NTVA 1SVWA 4EF4A 3EFOB 4G3XA 2Y1GA 3G3EA 5DGTA 1A98A 1R5NA 1DC4A 4G1CA 4DLWA 2MSNA 4KXFB 5EMLA 5AFSA 3RH0A 5IJZA 5G4KA 2HIHA 4KODA 1A50B 3VHXB 3I2FA 4P84A 4WV3A 3R0JA 1GRCA 4EH1A 3N2IA 5C53B 2XZOA 4YJ2F 1UK8A 1NW4A 5JANA 4U9UA 4WA7A 1A7AA 2R84A 3BX1A 3R3XA 3ZV6A 1XKLA 3DCNA 3GA0A 1ZA1A 2CVPA 3TTWA 4F21A 2OCPA 3SK0A 3A37A 4P2GA 4BNWA 1HT2E 4PM4A 4S2UA 4MUKA 4AG6A 5LU9A 1SIUA 1KEEB 1V8PA 3IAM6 3R3VA 3WYDA 4RNCA 1DKPA 4MSUA 4ZARA 3N7AA 5EEHA 1X1DA 1R4NB 1T9HA 5LZ7A 5CVJA 4CFZA 1MU0A 3K8OE 3ROQA 4C14A 3ZWXA 1D2CA 1P0FA 3LYAA 2W98A 1VYUA 3HXOA 1GPH1 4REMA 5HK8A 1FFDA 1MLDA 1VSBA 2A57A 3DCIA 3EGXB 4LS3A 4NMMA 1PR2A 2C8VA 1YC5A 4Z3OA 2BFNA 5J5CA 4DCJA 3BPSA 1Y9ZA 1L4MA 3B52X 2X14A 5ENDA 5CT4A 4XJXA 2QR5A 4A73A 3B1ZA 3Q3HA 2ZZKA 3C74A 4CDRA 5K3OA 1Q50A 2X7JA 1Y1RA 3QK7A 3HK2A 1SC1A 4HL6A 4KACA 2O6HA 3RSCA 2XWQA 4J91A 3BYZA 2ZUBA 2YIJA 3VR4H 4PYMA 3D9QX 4LYJA 2ZFUA 4EA7A 3CF0A 2ZBEA 1Q0ZA 3VO9A 3MUEA 4PS1A 5BYAA 1EDDA 2D8MA 5A3RA 1P60A 3DT6A 1POWA 4G9BA 2ZE5A 2FPUA 5CK5A 1J23A 5IVHA 2QLNA 2J08A 3S29A 1KEUA 4IILA 3I9NA 3S99A 5KIAA 2PPVA 2FEPA 2VNAA 1N7HA 3DP7A 5T57A 3V2HA 4Z4CA 3JWJA 3KTDA 3MELA 3Q7QA 1KJIA 2CNNA 5EVJA 3DJYA 1P80A 3RW9A 4X1YA 1BKSB 2FLVA 3KKLA 4I0WB 4A03A 1Q7GA 5ULLA 1N1DA 2BTOA 4FI3F 3PQ8A 4LNHA 1ZD4A 1LC0A 1RRMA 2VSYA 4WE3A 3CB4A 4P54A 4W8HA 4ND2A 5HCNA 3ZVMA 2ODWA 4OD0A 3PQ4A 1OLOA 2AG0A 3G6KA 3NW9A 4XVRA 5D5HA 2J4FA 3NTOA 2QDXA 4AG3A 1JI0A 5EZ5A 3CGWA 2NYRA 3LG2A 4FWTA 4WBXC 1RRFA 1JPJA 5A5DA 2Z6AA 1QGUA 1K86A 3GRUA 4LXUA 4G63A 2IY9A 2JATA 3C7AA 1CEQA 1U8TA 1GG8A 4ID9A 5BR8B 3H9JA 2DR0A 4YNBA 3N6VA 5L3VA 1XRPA 2JARA 1X86B 4BFSA 1PFYA 4EUFA 1MC8A 3DZBA 4PYLA 5EJ6A 3IQIX 3RS9A 4ER6A 1T1RA 4OAOA 5DTEA 1RYYA 4Y0VA 1JP7A 1JBKA 2GN4A 2DHRA 2HMWA 5JZVA 1EP3B 4RYDA 5A5FA 4IIVA 4U2EA 5BSGA 4L74A 3VR4A 3VYUB 2IZOA 3QKSA 4F04A 2HDOA 4NV0A 3H13A 4GLOA 5C1PA 4G81A 1O4WA 1DKQA 3BMOB 2F1IA 1H5UA 2ZXEA 2P9QA 3LFTA 3L8DA 1F60A 4B45A 4Z4GA 3NDPA 1B8VA 4RMNA 4IMIB 4H7HA 4CYMA 5KBYA 5D2CA 1N2GA 4BHTA 4LMRA 4LZLA 3JY6A 4HOYA 4LYFA 5DOZA 4YUZA 1RI2A 1Z4NA 4D6XA 4YMTA 1M2OA 3Q0EA 1NTRA 4BXOA 1DUIA 2YFYA 1XD2A 4WGGA 2XQGA 4BIIA 3Q15C 4OK6A 3VOTA 1FYVA 2UUOA 2HF8A 1YHNA 2RB4A 2VJLA 3PPXA 4XEUA 3VO2A 2VPTA 3BXPA 5I47A 2J6CA 5JC8A 2D7CA 3LNTA 1Z0FA 1I30A 3EUWA 3QZUA 4J4HA 5H59A 1E94E 3ZGVA 4LRTB 5FF9A 3IIEA 1KMIY 1E5LA 5E0KB 5DBIA 4BVJA 3H2SA 3P0IA 1MJHA 3FB1A 1J8VA 3L1JA 3E8SA 2AD1A 2C98A 4XQ0A 4DQXA 1E0SA 2WUDA 3AZQA 4G1BA 3AR4A 5INTA 2QVXX 3KAPA 2SCUA 3NIGB 3FNBA 4BNDB 2VFAA 4N0DA 4XJSA 1QHSA 3KEQA 4I1IA 3P9YA 1VG1A 4XH9B 3SZRA 4N6NA 1M2EA 3MXTA 4L0CA 3UOAB 1CP3A 1MV5A 1OR8A 2MSEB 3GNTA 3H8WA 4EGSA 1WB9A 3RRNA 1FP1D 2H7VA 3PI6A 1SXQA 2O7RA 3JZFA 1SB8A 3M9LA 4N0PA 4WDRA 1T9GR 2OKGA 1W36D 3HEAA 3UGKA 3ZDCA 1EE2A 2RI1A 1R27A 2AJCA 2DJIA 2PH5A 4LJ6A 4HRYA 3RSZA 3U5TA 3FMPB 4G1UC 4Q4JA 4TMFA 4DDUA 3F2IA 4KQXA 2GERA 4NCXA 2J9FB 2GEBA 2EEZA 2GAJA 4E4TA 2OV6A 5K8IA 4PYQA 3SX4A 5LQKA 3KJFA 2XPCA 4RY9A 4DCVA 2R4TA 4ITRC 4A26A 3P9XA 4PG8A 4FXPA 1IM8A 5EWJB 2KHZA 3L0OA 3WAGA 3WKBA 1U8UA 2O23A 2X2FA 4FVTA 4PHHA 3OQMA 3C41J 2X3YA 1JEEA 3BTSA 4REQA 4J4TA 4L6AA 2QRMA 3EBLA 4IIJB 5CUQA 5IG2A 5BO5A 3K71B 3HPQA 5EZYA 4M9QA 2IS1A 1YRYE 1GAXA 4NHOA 1RRGA 5EP4A 3UF0A 4AX4A 2BAGA 1TJ5A 5C7YA 1JH9A 4CCWA 4HS9A 4EUKA 2MR6A 1DC3A 5BN3B 5IC4A 4S35A 3RC2A 5FT9A 2IUEA 3LAWA 1KE2A 1YS7A 3KQKA 2GK3A 3DDCA 1EX9A 3EPRA 3G9TA 2ZB2A 3NT5A 2IVZA 1KAEA 3ZCRA 5DHRA 4M60A 3G88A 4RK1A 3GA5A 2WY2D 2P6RA 3X1ZA 3DC7A 2GYUA 1QGED 1T8YA 2PKCA 3BDIA 3M33A 3V97A 5M04A 2ARKA 4UBLA 4CLEA 3QITA 3V6MA 5B3JA 4EUSA 4REOA 1C3OA 3DPIA 4PFJA 5AVKA 2ZUFA 3OP1A 1D6MA 2M32A 3I3SR 4AUNA 1MFPA 1BXZA 1VJGA 3AVPA 2X86A 1G5QA 3NAMA 2OQVA 1DO8A 5IAEA 3ZNPA 1NRIA 4YMHA 3OY2A 3QIAA 2PZKA 4NJOA 4Z7OB 3G8CA 5HG0A 1FOEB 2J4DA 3QU2A 4E2WA 4F1KA 5I7RA 1DELA 2H07A 5GVRA 1KVSA 1V7PC 1U3FA 1XZKA 1G5HA 2HSZA 2WAXA 3BMCB 4MQ5A 4B6FA 4HQ0A 3L6BA 4X95A 3LH5A 1A71A 3ZGOA 1RYDA 3OZAA 4F7WA 2RHGB 1Y6ZA 3KSUA 3OJ0A 3SN6A 3HB7A 2QL6A 3HI4A 4DYHA 3R3WA 1OYWA 2QUBA 4FNMA 3C3BA 5IKMA 3UAVA 2PO5A 4RHUA 3LUCA 5DYGA 3D6HA 3L6CA 4IGKA 1I1HA 2ZPAA 1R6DA 1PT9A 2NO1A 3IKLA 3M4ZA 4E09A 1VKZA 5KPJA 3F8SA 3DE4X 2O8EB 2NVUB 1AOXA 2VKTA 5I7SA 3LTEA 3BFKA 3AR2A 3EY4A 4GKBA 3KVVA 2IY8A 4KYIB 5JCOC 5ALDA 4AUMA 3HWWA 3QPAA 4F3KA 4HQRA 4WQMA 3VR2A 3A6KA 2FRDC 3DO5A 3TUIC 3AVYA 3TFWA 3FZGA 4CN8A 5TMPA 1GSOA 2ERXA 2JBHA 2QL5A 3DYIA 4QXRA 3S68A 4E08A 2Z2IA 4HEA1 4UQPA 3AYZB 4EG0A 3AUXA 3KQLA 1Z4PX 3RRZA 2AN4A 4FC6A 1GUZA 2FPPA 2Q21A 2POQX 3A9WA 3NIDB 4W5HA 5AOAA 1FA9A 1ZISA 2QTBA 1J20A 1JF8A 5ALRA 1HZZC 3RF7A 1W9MA 2QZPA 3OKCA 2NADA 3L6UA 4HYYA 3QBJA 4NBNA 4OU5A 3ZN2A 3D3QA 4W1PA 5JH7A 2I66A 2XGMA 2PBFA 4RDCA 3EHEA 4C89A 4R3UC 3ABQB 2W6PA 5AHKA 3QP9A 4K9QA 4H31A 4JITA 5FUQA 3UMFA 3OT1A 6LDHA 2FCAA 3PZBA 3N6RA 4C87A 3PQEA 1N5LA 1XRLA 2Z3WA 1TI7A 3V3KA 4KMOA 1C9EA 1VCNA 3FYSA 4H6WA 1LLCA 1VE7A 3OIUA 2FZ5A 4HWSA 2IZ0A 4TWJA 2A1TR 4C43A 3JQGB 5JQGB 1UFRA 4UCWA 2IKQA 2OB2A 2VJMA 2Z5VA 3Q7TA 4CEHA 3B3GA 4IUBS 5DO9A 4JLSA 1V3TA 2CDNA 2QDKA 2VF7A 4WXPA 2YNMC 1P9LA 3UAXA 3REQB 1KEKA 4YR7A 4PO8A 4IAOA 2D0IA 3D0KA 3IUMA 3DHNA 3L4BC 5TR9A 3V4LA 3WYBA 2R62A 3CXRA 4DJ5X 5EWMA 2ZUUA 1ZICA 3NHYA 3L46A 2J09A 5ICSA 1EQAA 3H8JA 4N5MA 2Y0DA 5B1HA 3AJEA 3HH8A 1K1EA 4BLOA 3ASVA 4WY5A 2E49A 4RV9A 1PZEA 2HJHA 4HD8A 4QRHA 5JUWA 2D7DA 1PX2A 1M1YB 3ZZ1A 3W8NA 4F93B 1T36B 1WSWA 1YKFA 2I4NA 3A11A 4G37A 4W7HA 1KQNA 3EGOA 1P8AA 4Y18A 3U7EB 5LP1A 3AI7A 4EPTA 1S4QA 1B7GO 2JLZA 4JYMA 3WYGA 4OEHA 5IF3A 1GFSA 4JJ7A 2XMZA 4ND1A 4KPFC 4N3NA 1QIFA 4LOJA 4Y6LA 5HE9A 3AV3A 2QL7A 4MI9A 5E0OA 4UNSA 4QECA 3WFZA 1N2CB 4Z0HO 5BNTA 4QOSA 4ZYYA 2DR3A 3QLTA 2H65A 3BRWD 3WLTA 4JP3A 2AL7A 2NTJA 1TAQA 1RRVA 3EULA 3V46A 3IVRA 3KAQA 3RC9A 1HQDA 2HWUA 4EJSA 1XQ9A 1LDNA 4C0BA 3B7WA 4ZAYA 2MTBA 3WMGA 1YZTA 1IZZA 2IDZA 3B7GA 4AMGA 821PA 3ZCPA 3C1TA 1NQTA 3PYLA 2ZT7A 1J0DA 1M34E 3JQ7A 2BGWA 1LW6E 1VZ2A 2XMCA 2D0OB 4P35A 3I53A 1AB5A 1H2AS 1JIKA 1P6UA 1SXJD 3L7BA 4WNAB 3B6KA 2E4XA 1RYNA 3L0YA 2O2XA 4AVYA 1FFYA 1PDOA 2G08A 3IP3A 3V4OA 5LOVB 1HL3A 4P3XA 4WZAA 2G71A 1XTQA 3GQBA 1CPYA 2EDCA 1NQAO 1IBSA 1N2XA 1JHOA 2CLEB 3LK6A 5DN9A 1L8LA 2IYXA 3U7QB 5HIJA 3WFJA 2BP7A 2KS6A 4O1HA 3HJFA 1ZIDA 3V8BA 2P1RA 2WABA </