4XEUA

Crystal structure of a transketolase from pseudomonas aeruginosa
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
663
structure length
632
Chain Sequence
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYMQHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYGYTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGISHEVASLAGTLRLNKLIAFYDDNGGWFTDDTPKRFEAYGWQVIRNVDGHDADEIKTAIDTARKSDQPTLICCKTVIGFADEIAATRAALGWEHAPFEIPAQIYAEWDAKETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKAAAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADTLWKGCKGVSADDAAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYVFTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALIFSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGRKVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSFGESAPAPALFEHFGFTLDNVLAVAEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transketolase
publication title Crystal structure of a transketolase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 246
structure length 632
sequence length 663
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 2014-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xeuA01
2BFFA 4FEGA 2WVGA 3F6BX 3FSJX 5EJ8A 2OZLA 3DUFB 3EXIB 3LQ1A 4MZXA 1X7YB 2R8PA 1X80B 2JIBA 1ZPDA 2JI7A 3AHCA 5EJ4A 5EXDA 3ZHVA 2E6KA 2BFDB 2BEWA 2BEVB 1PI3A 1OLSA 3E9YA 5HHTA 1YI1A 4FEEA 2BFEB 1DTWB 1X7WA 2IHUA 5HYVA 5DGDA 1GPUA 5EXEA 4D5GA 2G67A 4RJJA 2JGDB 3DV0A 1T9DA 3AHFA 2XTAA 5ESDA 1QS0B 2VBGA 2EZ9A 5I51A 2VK8A 1UMDB 2JLAA 2AG0A 2BFCB 2PDAA 5DEIA 1W85A 5K6TA 2C3OA 4RJKA 2OZLB 2C3YA 1OLXA 5C4IA 3LQ2A 1V5EA 4K9OA 1UM9B 1V1RA 4C7VA 3ZHUA 2BEWB 1POXA 1OLSB 4D5EA 4QPZA 1X7WB 1N0HA 3FZNA 3IAEA 3D7KA 1Q6ZA 3DV0B 2VJYA 5DGTA 1X7ZA 2C42A 2O1SA 2Q5JA 2NXWA 3HWX1 2X7JA 1YBHA 1TKAA 4JUDX 4K9MA 3JU3A 2FWNA 1V1MA 3UK1A 1OZGA 2WVAA 5EJ9A 1PVDA 1T9CA 5EJ5A 2IHVA 4Q9DA 2C3MA 3M7IA 1UMCA 3M34A 1OLXB 2V3WA 1R9JA 1QGDA 3EXHA 5EJAA 2R8OA 4XEUA 2JI8A 3DVAB 3L84A 3EY9A 4GPEA 1UPAA 2UZAA 2Q5OA 3AHDA 1PO7A 2VK1A 1WCIA 5IMSA 1X7ZB 3RIMA 2VBIA 2BEUA 1L8AA 1NI4B 2Q27A 5HJEA 2AG1A 1V1MB 4JUBA 3EXEA 2VK4A 2XT9A 2R5NA 1YHYA 2O1XA 4GM4A 1AY0A 1BFDA 4JU8A 1Y9DA 2BFCA 1UPCA 4GP9A 2BFFB 5HGXA 5AHKA 5EJ7A 4JUAA 1JSCA 3LPLA 4KGDA 3ZHTA 5ERYA 1T9BA 3HWWA 2BEUB 1U5BA 5FEMA 4WBXC 3AHEA 3FLMA 5I5EA 5K3SA 2VBFA 2QTCA 2IEAA 2PGOA 2UZ1A 5K6RA 3EXHC 1W88A 3EXFA 4ZP1A 1YI0A 3M6LA 5K2OA 3DUFA 3EYAA 2PANA 1V16A 3EXG1 1UMBA 1W85B 4KXVA 4MPRA 1T9AA 1X80A 1OVMA 1YNOA 4K9QA 1ITZA 3OOYA 1Z8NA 2BFDA 2Q29A 3OE1A 4GM1A 1UPBA 3F6EX 1V1RB 1RP7A 3AHIA 1DTWA 2YIDA 2J9FA 4MPPA 2JGDA 2JI9A 3AHGA 2BP7A 4MQ5A 2DJIA 1TRKA 2BFBA 4MPJA 1YD7A 1UMDA 3AHJA 2EZTA 2Q5QA 5EJMA 2XT6A 2UZ1B 1W88B 3EXFB 1V5FA 1OZFA 2JI6A 4JU9A 5EJ6A 1NGSA 2W93A 1V16B 1OLUA 1UMBB 2C31A 1UM9A 1POWA 3EXG2 2WVHA 2EZ8A 4JUCA 2PGNA 1UMCB 3EXHB 1KEKA 3AI7A 3IAFA 4KXYA 1V11A 1YHZA 1B0PA 3ZHSA 2G25A 2J9FB 2BP7B 4COKA 4K9NA 2FN3A 1WCIB 2BFBB 4QQ8A 5I4IA 4K9PA 2C3UA 4RJIA 1X7XA 4KXUA 1PYDA 3KOMA 2Q28A 1OLUB 3ZHRA 4GM0A 2QTAA 3EXEB 2YICA 3EA4A 3DVAA 1TKCA 3EXIA 2Q5LA 1V11B 3M49A 1X7YA 2G28A 4JD5A 5I5GA 2EZUA 2C3PA 4K9KA 4KXXA 3AHHA 2Y0PA 2BEVA 4GG1A 1OZHA 2EZ4A 2BFEA 1NI4A 3ZHQA 1QPBA 4JUFA 1X7XB 1TKBA 3LQ4A 5ERXA 2JLCA 1QS0A 4QELA 4KXWA 3MOSA 1U5BB 3UPTA 2IHTA 4K9LA 4C7XA 1MCZA 1IK6A 1V5GA 3HYLA
chains in the Genus database with same CATH superfamily
1KPGA 4TTQA 2BKUA 1Y7LA 3LZCA 3TB6A 3O3NB 1Z07A 1J8FA 1ISSA 4PX3A 1XMSA 3VBEA 1UDBA 2C2BA 4B4UA 2AXPA 2AWNA 2IYQA 1T6YA 3H9UA 4R1OA 1NZDA 2RKOA 4Q48A 3RSQA 4AIRA 4HEQA 4C89A 1XIVA 1E3WA 3VX4A 4OKNA 4BFWA 2YX1A 3AUFA 3EVEA 1UH5A 1OX4A 4AECA 1HG0A 5D5QA 3THWB 3PD1A 3AY3A 4MSUA 1ZC3A 4OUKX 2AJTA 4ECEA 3ND8A 3B9PA 4AKGA 1E66A 3ME5A 1CRWG 2JD2A 4ZKEA 3S7ZA 4C0HA 3EK2A 1SO8A 4X94A 3N75A 4ZOLF 4EUHA 1YKSA 4X92A 5UKDA 1QDUA 3SHFA 4QUHA 5ELMA 1SC1A 1L7BA 2HPAA 3TECE 4Z8YA 4JJAA 1UKBA 1U3GA 2GBFA 3FDJA 1XA4A 2ZS7A 3MT9A 1RXEA 3V4OA 2BSXA 1OR8A 4GBED 4NBTA 2OQIA 4NCNA 2BFEB 4CUZA 3FYHA 5EA2A 2G08A 2XMQA 3N8NA 5E2IA 5EERA 5BOSA 1OXBB 4WDQA 3S4YA 2Q3MA 4R16A 1TKRA 4B7CA 4DA6A 5C32A 4QA9A 1KOGA 1R27A 2BELA 3KZKA 2RC5A 4B6FA 4MRVA 2OG2A 1QS0B 2EAUA 3R1IA 1PQ4A 3LX5A 5J5AA 4Y1GA 3ZTTA 2EZ9A 4UNRA 1CF4A 2QRZA 1VRWA 3WB0A 1N6HA 3KUXA 1XXHA 5HBGA 1YR8A 5A71A 4CI9A 5JEEA 4LDNA 4DKJA 1F4VA 3HUEA 2PBZA 1YFLA 1C7FA 1B6RA 4YB8A 5DIFA 5EE5B 5U9CA 2X0IA 3GQBA 3TKYA 5L40A 1E3TA 1W85A 1THZA 2W90A 2WZCA 2WV7A 4FMPA 4YVFA 2O3UA 1SULA 1KEPA 4HKTA 5K6TA 1Y5NA 3IUEA 3TCKA 4ZN6A 1Y9ZA 1UFVA 1G20E 1KPIA 16PKA 2RFLA 2YN0A 3GLHE 1ZM7A 4QRDA 5KKAA 2CL7X 3W2FA 4DLBA 4RETA 2A5DA 5TC4A 1CQWA 2PZBA 2NPOA 2WW8A 4BGEA 2GJ8A 1YE3A 2ORYA 3OZBA 1VHDA 3G0OA 4L9SA 1KC1A 3WGVA 3TTTA 1Y7IA 2R6CA 4IIDA 2AFHB 2CVQA 3TNJA 1OPXA 1FS6A 1KYIA 2YZNA 5JLJA 3BE8A 4ZAZA 4Q4JA 4ZT7A 5EMKA 2Z9CA 2X3UA 3W8EA 5T4HA 1CY0A 2WLSA 5AM0A 3TR5A 1R8SA 3T9CA 2AF3C 2FOIA 3UJ9A 4AW9A 2D1QA 1KORA 1SXIA 3JWJA 4CL8A 4Z8XA 2PH1A 3HJUA 4G89A 4MUGA 4OMFG 2GPSA 3L0YA 1QZZA 1VPEA 4CV1A 1J8MF 1TEVA 2QGFA 1LQUA 3LY5A 2R96A 1R4MB 3QLVA 4NE7A 2BM8A 3LP6A 2YHAA 1J4AA 2X7XA 3G8BA 3KQYA 3WGNA 1UIMA 1HYEA 4QRIA 2HNAA 2O2YA 1QORA 3CO0S 3U48A 4AUEA 4YPOA 3KJEA 5ENVA 1BX3A 4BMXA 2V6MA 4Y67A 4ML3A 4NHOA 4AY2A 3CVOA 3ZZTA 4HZIA 1BWSA 1YJBA 1EE2A 1NBME 1X1RA 2WVJA 1U3CA 3DMNA 2GSDA 4GNRA 4DG9A 2C83A 2IZ5A 3R3XA 2PJRA 5SY4A 2PD3A 3ZD9A 2O8FB 1K9VF 1RXUA 4K9MA 1Z62A 1YIOA 2FGKA 1M2JA 1RWNA 3HI4A 4G5SA 4K1LA 2HJRA 1OZGA 3I1YA 1YR7A 4FP9A 4V0SA 5EJ9A 1RYBA 2OTCA 2FSUA 3D7SA 1DMRA 3IP1A 5F4BA 1XRJA 3ANNA 5D3QA 1X74A 2HSGA 2VAWA 1VIAA 3ERCA 4LQCA 4NAUA 4UNSA 4EHKA 4N65A 3GRAA 4ZZ3A 5KBYA 5LMCA 1YJCA 2I3ZA 3CRZA 3PJFA 1G2QA 2ZJ0A 3ICCA 1AQNA 4PO9A 4D9KA 2H3EA 4ZJZA 4OHUA 3KQVA 3TF5A 2J6BA 3PWZA 3E3MA 1YC5A 1KNXA 2YIVX 1JW9B 4DLPA 1J8VA 4HXGA 3NETA 3MELA 3R0JA 3LU1A 4UE6A 3EY9A 3MTGA 1RE1A 4NBLA 3JAMA 3PR2B 3JRNA 4LUCA 1RLOA 4I81A 3K72B 1JI0A 2PN1A 4L74A 3TCNA 5C8YB 1MEOA 3KAKA 3NX4A 4D25A 2Z30A 4QYMA 3IUPA 4YP0A 2Z2YA 5K0BA 3IVAA 1F0YA 3KTAB 1F4LA 4CNBA 1FUUA 3A37A 4OKIA 3VH2A 4Y2RA 1G63A 1XQVA 3OUTA 1J70A 2WWRA 1JRLA 4IIJA 1RJDA 3OPNA 1DFGA 4LOJA 3ZEAA 5H02A 2ZBFA 3G8CA 4EYOA 1H5NA 3LE8A 3LBFA 1MJ5A 1M2GA 4LV8B 4G0VA 2NZVG 1UKCA 4YJ2F 4KVZA 4NE2A 3ZI0A 1SY7A 2H18A 2IY8A 3LCCA 5JI2E 4EMBA 1A5SB 1K66A 5LQKA 2VQEB 4OMCA 2CKMA 5EKSA 1K4YA 2UUPA 5K8TA 4K46A 2IUUA 4ENPA 4O8ZA 2CMHA 5F9FA 3BZWA 4I1VA 2PGDA 1YQUA 2DHCA 2X40A 3IOYA 2I0FA 4HXYA 4H9GA 1O6GA 1PHRA 2FPPB 2FPUA 3KYCA 3IDFA 3KQQA 3QEMA 4E7OA 3B51X 4OGGA 1NF3A 3KS9A 5F78A 1WQ3A 2ZRFA 5K03A 2J7KA 1MFZA 2J5XA 3ZWMA 1FS4A 4I2NA 1A9ZA 1GTG1 1SZJG 1VA5A 2FZLA 3WIUA 3MJ4A 1N7GA 4XYLA 4FINA 1GNPA 1JE1A 1FUIA 1H85A 3HBAA 5T57A 4ZOEA 2L2QA 1XMJA 2XYHA 1DNPA 3HP1A 4MMYB 5ALPA 4LCEA 4K87A 1NRXA 1D6SA 3BDIA 3FRHA 1KWGA 3PVSA 3IURA 4IXNA 2OV8A 1D4ZA 4AJ4A 4RIIA 5B1SA 3TLZA 2F3RA 2CCKA 3SQNA 1RBYA 4KXLA 3DC2A 4RSRA 2IYWA 4LMBA 4ZEOA 3A6HA 2XKKA 1HTBA 1FQWA 1V96A 3E7WA 3OU7A 4PAWA 3EHDA 5H3LA 3T9EA 4EVRA 4QDKA 5E7QA 1VSVA 1EQAA 3E9MA 2IYUA 4CIDA 1QKJA 3RUFA 5BXQC 2FW8A 3UYLA 4QQFA 4KFRA 1R8YA 2I2FA 5ERYA 1B93A 1V7QA 2X9GA 5EC8A 4FR0A 3MLAA 1EFHA 1KS2A 3SZMA 2K5UA 2WSMA 3KWLA 5EJFA 1DBPA 1RJEA 1VLVA 1ZIDA 4KSCA 1FU4A 3G9QA 1Z6ZA 5A1JA 5SICE 1C1YA 2BF4A 2GA9A 4BWYA 3GN1A 1ZKDA 2CUKA 1NW6A 4UUPA 1HNNA 2I2XB 2V3VA 3OPYI 4XZ3A 2JZCA 4E4RA 4RW0A 4WCVA 4YLYA 4BVKA 1HNZB 4PPQA 5CW2A 4F2GA 3A6PC 3BWBA 1XWIA 2ZVPX 5KPJA 3LUAA 3PXBA 2P3SA 1QKKA 4W8OA 1G66A 2IEAA 4ZPJA 4E88A 4RTQA 3CIFA 3F98A 1Y81A 3H86A 4PLCA 1RPZA 3REQA 4FCWA 2Q3DA 3QLJA 1EIZA 2XHZA 4NF2A 3ZWVA 2HXSA 4TV8B 3BTSA 3RQSA 4CZ2A 4D9CA 1S8OA 4OQZA 1Y4AE 2OHFA 3BEOA 2J9GA 3FJYA 3HJAA 4ZZ0A 4UM5A 2AZXA 1EWQA 1Y48E 1HZZA 1NHWA 4ZHQA 3ANSA 3DWEX 1JU3A 2DBVO 5I7OA 3P9IA 3O90A 4KXVA 4UAUA 1V4NA 2HAEA 2R8EA 3EPJA 2EFGA 4YDHB 5DSTA 3VGPA 4H31A 3ZCSA 4RUKA 1CJMA 2YWBA 3DMDA 4R1SA 1E5VA 1SEPA 5HFJA 4R5MA 2IWHA 1NSFA 3DC7A 3PUJA 2WMNB 2F1RA 2IIQA 4WLUA 3N2KB 4BN5A 1OE0A 3KSRA 2O5CA 5DN6A 4ZVQA 4C0QC 5BN1A 3N58A 5FL3A 3K9CA 3P9SA 3IHWA 3FX2A 3NTRA 3MT8A 4KOEC 1C0EA 1E2PA 3BWXA 3MWYW 2J9FA 4W5WA 3UEOA 4H1WA 3EVNA 5CK4A 5JY1A 5JYBA 1HG1A 2GVZC 4ZCLA 1G59A 2QGZA 2FRDC 3RS0A 3DKPA 3D6NB 5JAOA 1NXOA 3V8EA 4YNBA 2A9OA 4KBGA 4FQ8A 3KOUA 2C7RA 2Q4OA 3BBLA 4Q18A 1JFFB 3SKXA 5C1DA 1YDFA 2X3YA 4FI3C 4XM1A 5BMVA 4KDFA 5DH9A 5ADUS 1T4MA 1ZP6A 3MQ2A 3DGEC 1LBSA 1ZAYA 4GLOA 3WBBA 4F7DA 3ESRA 5MHTA 4ZODA 4RE5A 2GNOA 2H7CA 1P81A 2XDYA 1KQGA 2DERA 5H80A 5GWXA 3CZRA 1NJSA 1SU8A 3B70A 3SOPA 1WWKA 2H1IA 2WIAA 1IM8A 4BFYA 4EFMA 4KQ6A 5JWHA 4KLAA 1AE1A 1Q0SA 1EX1A 2YWGA 5HKBA 2NTJA 2OK8A 4Z6KA 2QVBA 3PYXA 2PMCA 2GEKA 3OAAD 1GZVA 2Q1XA 4Y7DA 3SVLA 5DBHX 1I7DA 1MX3A 4DFDA 2XZOA 4N3NA 1KO1A 3HGTA 1E9EA 1FOEB 4BPBA 1O95D 2QT0A 3GN2A 5AVJA 4DABA 5AM2A 1P77A 3VJRA 1POWA 3DT9A 3DR5A 1XWFA 4W63A 2DHRA 1R9NA 5L95A 2ZUBA 2JCXA 2DPLA 2PQ0A 3MWLA 3PGJA 4TTRA 3ZC3A 3ODGA 4A8JA 2PS1A 2W2PA 1UAYA 4FIDA 2C1XA 1YRHA 1XLUA 2DFPA 3JTMA 4GZMA 5AJVB 3TLJA 3WWDA 2WHXA 2G9VA 4Z51A 1KMNA 1H2RS 3Q10A 4CMBA 1CZOA 4CKBA 3GO4A 2VHQA 4ZOBA 1FYFA 1SCUA 1DJLA 3S2FA 3CLSC 3DBHB 3VI4B 1KF0A 4HZGA 3THSA 1KRWA 2ZRIA 5M29A 3S2YA 1PGNA 4DOMA 1B43A 1NMXA 3WYAA 4QXPA 3HDYA 1GU1A 4K9NA 3DMPA 4RLFA 6LDHA 1BDHA 2BFBB 1U90A 3DYBA 3QVLA 4HXEB 4EITA 1IHXA 4H1UA 2PKWA 2XITA 3LRTA 3HRHA 4FDAA 3PQ7A 4WY2A 1GCUA 2CE7A 4B6RA 1P9NA 2AFIB 3L3BA 1P60A 5DCYA 5JO9A 5KQMA 1WXIA 4RVNA 4RXUA 2EQAA 2W42A 1LRLA 3CZQA 5IXJA 1JXOA 2BJWA 3K8ZA 3LDUA 4H08A 2G0NA 4UTZA 3TLMA 2DR3A 3ETNA 4GKVA 4ITRC 1EQ2A 2QRKA 3L43A 3NJ4A 2OHVA 5IYZB 3B60A 1DJMA 1MH1A 3BTOA 2C84A 3MCTA 3DV9A 1ZJ6A 4ZYZA 1M6EX 4MKFA 5AVUA 4EKGA 1SC6A 1COZA 4K6FA 2CZQA 5A4KA 3TLGA 1BZYA 1E1CA 4DMUB 4XR4A 2I6TA 3TZKA 1PRYA 1NXVA 1XPRA 5SYMA 5LXTF 5EP2A 3WY9A 5JANA 5G1NA 1NJ5A 3OHMA 3EUEA 4YDRA 4OHOA 4XWKA 3D6TB 2IP1A 2C2GA 1WVIA 4DZRA 4U2BA 5MGBA 3COVA 4BIMA 5CT6A 4DPKA 3A6KA 3ZHXA 2NVOA 1ZSVA 1P9RA 5JRZA 1KY3A 3R3JA 1D3AA 4RDIA 4JI7B 1BDJA 1JA0A 2Q5HA 5EMMA 4Z2YA 2W83A 3S7TA 1CUBA 4BCCA 2JDIA 4NABA 1X94A 3QG1A 3MLEA 4FOSA 2RKBA 3WLOA 5MDHA 1U8CB 4ISCA 2GK7A 2QUHA 2ZB4A 3TW6A 1WXHA 4UZFA 1XZLA 4REMA 2QJFA 5F1PA 4BNFA 3RU2A 4DV2B 4BP1A 1CUFA 1IWOA 1E4EA 3G02A 3MJFA 3O75A 3V8NA 4GOKA 3A05A 5TMEA 4X85A 2CV0A 4LFBB 3EDCA 2EC5A 4QDOA 1SIWA 2IU4A 2VLIA 4GEKA 4NTZA 4U7HA 4ALMA 1MO6A 3TZQA 2R9VA 5FT9A 2AEMA 2ZBPA 5M2QA 4KYTA 4KKVA 2PZAA 1X8XA 2FSPA 1II8A 4DMMA 2OMKA 2FI1A 5GV8A 5FHQA 5KTKA 2XGGA 4TYPA 3NVDA 5LP6C 1KDVA 4RY9A 3FR8A 4CKYA 1M0EA 2KB0A 2VHCA 3HDGA 1O97D 4NU0A 1PQWA 4HL6A 4QELA 4ZVVA 1CWUA 2H8GA 3FIJA 4PZCA 3I4CA 4TM7A 2PKEA 3OPYA 3E9CA 4POAA 2IF2A 3TD9A 1EVKA 4FHCA 3ZD6A 4QJ3A 1GSIA 4X8HA 1UXHA 2GN8A 2HBQA 5LDGA 1XD8A 3CRMA 3VJLA 1DHTA 5TDHA 4I2VA 5IPFA 3DZGA 3HCDA 3QBEA 2WKWA 3ROKA 3W6PA 5ALSA 3VU1A 4BL5A 1N4DA 1RW4A 4FEGA 2V58A 1RQLA 3KR1A 5B37A 5FNVA 4DDHA 4Q4CA 4DZZA 2PS0A 4MKRA 4G36A 5FIUA 5A0VA 5C2JB 3ZJTA 5EHQA 4BWVA 2C4WA 5FL7D 4EPRA 1T2EA 3TZCA 2XNDD 5KWJA 2PS9A 3N3BC 4D3ZA 1GO2A 1M6HA 2J0VA 2PUJA 5IM5A 3V1KA 4CR7A 2ZITA 5ES3A 3P0FA 1QYWA 2AYZA 4BEVA 1XCJA 4MWZA 3LWDA 3NAGA 1OAOA 4GP6A 3F5SA 1HBJA 2GAJA 2P5SA 5C5DA 1QH9A 5K3FB 4O4IF 5TRTA 4EABA 4I9HA 2BR3A 4YRDA 4LJ8A 1H22A 3TNFA 2BEVB 4DQ0A 3WBJA 1VZ2A 1WDMA 3IEPA 4I08A 3KUCA 3AVVA 1XKQA 5AI6A 3RKRA 5FF9A 2C5AA 2V98A 3C3CA 3F1LA 1TYDE 3JZDA 1JR3E 4ZHSA 1DTEA 4A03A 3EWNA 4G4IA 3BTVA 1SEVA 5IH7A 3GT4A 3PTLA 3OQNA 5B1IA 2ODBA 3AR9A 1SVNA 2BBOA 4BO5A 1JDNA 2FW0A 2YV1A 4D5GA 3N6RA 1NY6A 5C0OE 3OM0A 3X3HA 2V9CA 5L53A 3AHFA 2WHEA 4ZT5A 2G4CA 4INPA 2PX2A 1QIGA 5DF1A 1VYVA 3WJ2A 3EAQA 4L4ZA 5IABA 2JG3A 1YE5A 2R85A 1SR8A 5K6RA 2XYRA 3QPBA 1GN8A 4QLOA 4KC0A 3EZ9A 1RIFA 4NYMR 4MYSA 3MWKA 5IJ9A 3IILA 1KI6A 4IX1A 1Y8ZA 3ADBA 2J4DA 3OJLA 4DBLC 3G3EA 5CHYA 3SOZA 2ZAGA 4QGSA 1W0CA 5EZYA 1EZZA 1WXDA 4JMLA 3VZSA 3ZDQA 4BQNA 4QOSA 4A9AA 1KI9A 1W9HA 4FLFA 2IW3A 3WC4A 5ICEA 4MYHA 2D4AA 1K5GA 3E9QA 2HT6A 2Y99A 5TQVA 2C3YA 1EGVB 5AK5A 1MUUA 1XBTA 2JFOA 3ORSA 5EOVA 5IVDA 1FYVA 4XWOA 3J81k 2YNMD 2VKQA 2OSBA 5BW6B 4M0KA 1CLUA 1UK6A 4TXMA 4ZV7A 2IS6A 4OGWA 1QCDA 1V1RA 1PUXA 4X7RA 2ZRNA 2O2IA 3H5VA 3OE7A 3C14C 4QTTB 4DJEC 5GOZA 4CR6A 4D0LB 3KKZA 4TZ0A 3B8EA 4LXTA 1K6JA 2IY9A 4K8RB 4Q9IA 1M34E 3S2EA 4B6OA 3TLBA 1AQIA 4BLUA 2VH5R 1H4TA 4KK3A 1QDEA 1RYDA 2WMDA 4KN6A 4D5EA 1TTTA 5JJKA 3SEQA 1OYYA 1FQJA 5CFLA 4AYWA 5CVEA 4DJFC 1WHSB 3KEQA 3LNTA 4RWZA 3AVTA 4IX9A 4M7WA 3B36A 3ZK7A 4FC6A 1N0HA 1HEYA 1FC0A 1WY7A 1YO6A 2QV0A 2A0XA 2CLKB 2JHFA 3FM9A 3KFLA 2GPWA 4JYMA 4TSRA 4UUNA 1OU0A 3TM4A 5BW8A 1PFUA 1B26A 4EYQA 2WB4A 1R3UA 4I8DA 2H85A 4X84A 1JH9A 1E0KA 3LTEA 5T64A 4G0XA 4OM8A 1VL2A 4I36A 2B7BA 5JCZA 4BDTA 3PDIA 3BIWA 4R1NA 4RDXA 3ANLA 4BO2A 2QORA 1S96A 2P9HA 2GNAA 2G63A 4QWWA 5D1NA 5ED4A 1HL3A 2IYYA 4J29A 3ICQB 3E1GA 5JXHA 3PQ6A 3JAKA 2YFQA 3LUCA 3DG9A 4DPLA 4B87A 1W5SA 3NTUA 3JYHA 1D0SA 1CQXA 4FFVA 2Q9UA 2C2WA 3DV2A 3O47A 4X0EA 5ALOA 5E3JA 4TVSA 2X13A 5C1OA 2AW3A 2XUOA 3MTAA 4PPNA 4LTMA 4PPYA 1CVLA 1L5GB 1XPOA 3EVZA 3WGLA 4A0GA 3L0CA 4OSOA 1PEKE 2ADOA 3HJHA 1XAHA 1RWOA 1RQPA 2JH8A 5LZ7A 2I8AA 1DAOA 2NV2B 3A4VA 4C20A 3VH3A 5HE8A 3FCEA 2QN6A 4Z53A 1SHLA 3G0IA 5H3HA 5AKJA 1BROA 1MKYA 1OT5A 2BJVA 1EA7A 1KYVA 1JSZA 4P8RA 4P4SB 4Y2PA 2FZ5A 5K0SA 2ES4A 4Q1VA 4OK5A 4X45A 3ST7A 1RYFA 2VDLB 3SSNA 3OZRA 4YBRA 3TLEA 4YMTA 1OI4A 1F3LA 3BMNA 4J49A 4LOAA 4R8VA 1RLUA 4BNDB 4RD0A 4RTKA 2VG8A 4HHEA 1KI7A 1YRLA 4FNGA 1BDMA 3G2NA 1KVUA 3AEUA 2ASVA 4NESA 3OOSA 4NH4A 4G2TA 1V7CA 4P3YA 4POOA 4AJ1A 1GFSA 3L6UA 1Q17A 1G4HA 4MR7B 4N3GA 2XQVA 4OQXA 1VSTA 4MYUA 1CF2O 1QONA 5BR1A 3KR2A 5A6SB 1JE0A 3T9AA 1PSZA 2W2XA 5IMSA 2Q3CA 3G6WA 3CLUD 1AZTA 2OFWA 3NNDA 4OB6A 5K0LA 1ZCZA 2UZ3A 1IWPB 4HNAB 1G3QA 5T8KC 5YASA 4A7PA 4EI7A 1LK5A 1OA1A 1F06A 2EVWX 4L6IA 3CUTA 3HB4X 5E4FA 1YV9A 4F85A 4YJ3A 9ABPA 1APBA 1UJNA 5A03A 4I99A 2ZI7A 4ALLA 1PYOA 1E79A 5HJEA 1IEWA 1BOOA 3LY9A 3QLEA 5DYWA 1FYEA 2HJWA 3QKWA 4ZALA 1R5BA 3TSWA 1ANKA 3AO0B 1C3OA 2PNFA 2EKPA 1OILA 2AXQA 4D9IA 4MHTA 4LKOA 2D2FA 3SFTA 2VKTA 2Q5FA 3AJ9A 5CJ2A 4P0TA 4K3VA 2R5NA 4QYSA 5JTUA 4TMXA 4G8DA 1P1JA 1Y8RA 4I6JA 4EG5A 1M9NA 2BI8A 1N77A 3AX6A 3Q1KA 1GG8A 3P9ZA 3K9FC 3QVMA 4IRXA 3RVNA 4CM8B 1NZFA 3PRYA 4GOMD 1HT1E 2GBLC 5KDLA 5EJ4A 1NYTA 3L4BC 1KFKB 3IRVA 4FYIA 1Z5GA 2VXYA 2WT4A 4NENB 1A8UA 1Q84A 1CVRA 2I22A 4U7FA 2R1TB 1HM5A 1N2JA 1XX6A 1KYWA 1EFCA 1P17A 1QH8A 2GX6A 1C0PA 3A04A 1QQ5A 2ZU6A 4OJKA 1ZU4A 2HIMA 7GPBA 5BQ3A 4Y2TA 2ZRBA 1HORA 1X1BA 2GTPA 2QEQA 2YJNA 3GJ5A 2EQBA 3QBTA 3QTLA 1JSCA 1OAKA 3IOBA 4BJ1A 1D6JA 1QP7A 4N41A 1YFKA 3QOWA 1SUEA 3CIOA 1VL1A 1W96A 2H1VA 3ED1A 5CGQB 2QB5A 3V8MA 4E14A 4F6CA 3COYA 3IE2A 5G0UA 1L3BA 1UBJS 3A1SA 3G6KA 3SQDA 3UAZA 2GVDC 4YMIA 4WLFA 4IR7A 4L6CA 1L7VC 5HM8A 1JHYA 3I1FA 2QTLA 3TX6A 1P1IA 2FWBA 2F2TA 1HDXA 4K0RA 3X0DA 2XOKA 4UM9D 4C05A 3SIRA 4A8HA 3LW8A 2TMKA 1P61B 3DL2A 1JG2A 3B53X 3W6OA 2WNHA 1GTMA 3U44A 4DNXA 5K0FA 1WMEA 2VAPA 4NYIR 4ATNA 3FLMA 5LP1A 3U7HB 4ARCA 5K3SA 1TMKA 3ZG6A 4ZQBA 3T54A 2I29A 3KQNA 3W9YA 4E12A 4WT7A 3E4CA 3OHPA 5EVCA 1EHYA 1T36A 3EXHC 3G9ZA 5BWOA 5C8ZA 4ASUD 1CIPA 1XF1A 1QGUB 121PA 1CQPA 1T8RA 5AKGA 3T5PA 3MG9A 4GPAA 4E2YA 1P1BA 3V4RA 1L5LA 2E7ZA 2OPBA 3PJRA 2D8AA 4DAEA 3L41A 2XOEA 1UMBA 5J4YA 3PL1A 1EM8A 4M98A 2A5JA 4QM6A 2PTHA 2WI8A 1OVMA 2JGJA 2GA8A 4XUEA 1Y3HA 1NM5A 2FF5A 2D1SA 1EFRD 3B6ZA 2P4EA 4B6PA 1UFRA 2R6JA 4IGKA 2QN9A 3A1NA 2FKAA 4F2DA 1SG9A 2GN1A 4OM7A 5B7GA 3L01A 1WTAA 3ANYB 2CFIA 3OLCX 3VZDA 1V6CA 2HUPA 2V0CA 1PGOA 4E2XA 2JPDA 2DFNA 1DTWA 1H9AA 4RKYA 3JQRA 4HRAA 4M0MA 3KVRA 2HA5A 2YQ5A 3KB6A 3OAAA 3WLHA 3FYUA 1YB4A 1R12A 2GXSA 4IHJA 5CG1A 4M0FA 4DLTA 2A0FA 1GTL1 4C3VA 5JNVA 1T29A 1X0VA 5F1OA 3FBGA 2BP7A 4YRMA 2HQ1A 4QUGA 4Y2YA 1E3SA 2R62A 2XVYA 1SBZA 2CUNA 2Q2VA 4P4NA 4DG5A 5JJLA 2O0HA 5FBHA 2AUMA 2H1SA 3KX2A 2G36A 4JGBA 5JQGA 3FPGA 3HTXA 4CMIB 3E23A 4P4LA 1WX1A 1MTZA 1II9A 2PJDA 3HVUA 1RTTA 3JD3A 3O8LA 4PX5A 4DR6B 1FFXB 5EZ5A 5JS7A 1NKTA 1XKTA 4UU8A 1SXJA 1Z35A 4L7VA 5EP4A 4OTZA 4DAOA 1ZVQA 2Z2JA 1A4IA 1GFWA 4Z4CA 4JEMA 4AG6A 7YASA 2FWRA 1M7HA 1YQEA 4YGYA 4BGIA 1X19A 2BMFA 1E3LA 3G13A 3ZJ4A 4E07A 3DPUA 3EVAA 3DCJA 1XDBA 3AM4A 3CUSA 1OIWA 5HKOA 1RRFA 5KMGA 2HA7A 1NQOA 1WW3A 1Q1GA 2Q99A 4YO7A 3GL9A 3AF6A 1FYDA 2WJ6A 2NO5A 5LNK6 1YF3A 1C2YA 1NLZA 1SUPA 2OGSA 1KOLA 2QVYX 3SYMA 4OOEA 4WLNA 3D6MA 3D8HA 5K8VA 1YFJA 4RQAA 3RS4A 4L0DA 1YZYA 1WUYA 5JVDF 4CV0A 4DXDA 1IQPA 4YIKA 4Z7QB 5EI5A 4M1OA 2VA8A 2PU7A 2IJGX 4GXTA 5HQ3A 3HLYA 3SD7A 4CFYA 2B25A 1KE2A 2ZZKA 1YZFA 1B0PA 5AI0A 2JFNA 3F2IA 3L7MA 4N5HX 1I3CA 2O52A 2R66A 2D74A 3A2LA 2ZIEA 2CW5A 3DSRA 1A1SA 4TWZA 1PJLA 4FZ3A 2QY9A 2W4MA 3PJEA 1XTSA 4L8FA 4M1ZA 4WKNA 4I14A 3ICVA 6NULA 3N7UA 2VT2A 3O0DA 2FG5A 1MPXA 1KVSA 2QT1A 1A04A 3KQOA 4MRNA 1RWXA 1FE8A 1GQ2A 1AD2A 4IDPA 5CXSA 2VNAA 4JLWA 5ALGA 2BMEA 4OXRA 5BSEA 3X43A 1TUBA 3QUBA 1YCHA 2GBPA 9LDBA 5HBRA 4TT3D 3RK4A 1QHEA 3QHPA 4V0ME 3GGSA 2FPIA 2Q3LA 4LXHA 4BO6A 1HX7A 2PBFA 2W8ZA 2ZLBA 1G16A 3NR2A 1Q1QA 3PNMA 2N42A 1LV8A 2YUIA 2E37A 1GCAA 1N92A 3OQMA 1IHYA 4I1PA 4AI6A 1PTJA 1XCGB 1RZUA 3C16C 4XYMA 2PZJA 3SJCA 1U2EA 2GWHA 4GM0A 1Z2PX 1ZUIA 2C1ZA 2JC3A 3LUHA 4PQEA 2PNJA 4EJSA 4MYTA 2N0SA 2XH8A 3EZXA 4FTWA 3QHQA 2NMVA 1U0TA 4G1BA 3HP7A 4HXFB 5EIEA 1D04A 2VUTA 4LYYA 2QTBA 4H1VA 4IOKA 3EGDA 4XGQA 3U9LA 2A3NA 2EOAA 4BNXA 3H1AA 2W8BB 4EKNB 4RFLA 4PG8A 1PUJA 1OFTA 5DBOA 1T2AA 2COEA 1GRVA 1U7UA 2CBXA 5KC8A 4S3MA 2Q5IA 1Z7BA 2Z8YM 3IVXA 3EDOA 4AY6A 3W5SA 1ZXXA 1U31A 1GNSA 3RM3A 2BBWA 4YBZA 1B8NA 2N75A 2R65A 3A7DA 4RVGA 4NCKA 3W5VA 4C01A 5EZQA 2QM8A 3QX8A 2F64A 2Z1DA 1N8TA 1JQKA 3I32A 3JWHA 1X3LA 2VPQA 4GBGA 1KGSA 4YJ2B 5D6OA 5HF8A 3STVA 5AKKA 4WFIA 3PEVA 1MW9X 2LD4A 4J75A 1H4SA 3A9RA 1UKEA 4RZSA 4UEOA 4CV3A 5LMNB 4IPTA 1OZHA 4KWTA 4C88A 1QRUA 3O1HB 5DNUA 2Q7DA 5BN4B 1FNSA 3GELA 4KWEA 2EZ4A 4OIMA 1UC4B 2IHNA 3R3HA 4X8OA 2IS2A 2LCIA 1WUHS 4V0RA 4MV4A 1IK4A 5FL7A 5BN3B 1RABA 4OH1A 3RRZA 2OA0A 1C9NA 2XNDA 5JTTA 3W4JA 1R10A 2EDCA 4N5LA 2ZUSA 3EQ2A 3RFFA 3ZJ5A 3LKVA 1NYLA 4PXSA 4F2PA 1W34A 5JMTA 1AMUA 1OC2A 3KZVA 1GFIA 2FN4A 1PD0A 3QXSA 1EX7A 1T8YA 3Q9UA 3LKZA 4DDTA 3JARB 1SKQA 2NVBA 4KXWA 1UQUA 1H6DA 1PFVA 3JTEA 3PGLA 2B2CA 4C7KA 1KMQA 1NMSA 3UAWA 3LQRA 4U63A 3L40A 4C2TA 2C1EA 1HR0B 5FA5A 4H18A 2YBDA 4NDNE 2CLEB 4XB6B 3OLQA 2RGGA 5EINA 4ZV9A 8ADHA 5GTDA 3S8YA 4J3FA 1EWTA 3FVVA 3TD2A 3CN9A 3NKVA 3SHQA 4V38A 5KC9A 3I39X 4AN1A 1GPYA 1KZ6A 1NWHA 2VSFA 3FOWA 2CLDX 5FBQB 3RYHA 5GZ3A 5CT8A 4DL9A 3QBDA 5F12A 3CXRA 4PTYA 1RJFA 3CEJA 2V96A 3I9NA 3PKJA 4X7MA 5JAUA 3KSAC 4KV9A 1I2CA 2D1FA 3A1FA 1R8JA 2X2PA 1N6KA 5EXXA 1ORHA 2PLWA 1FTNA 1JVSA 1NG1A 3MINB 5HILA 5M34A 4Z1MD 4QDUA 1C4OA 5KIAA 3U1BA 3P4UA 4LE0A 3W90A 2Y1FA 3AIMA 4JJ7A 3QVGA 1ATZA 2A9QA 4NI5A 4UMFA 1UANA 1HLFA 1YCDA 2O19A 3U7EB 4H0CA 1XDUA 2I6XA 2V54A 4U02A 1A9YA 4KQGA 2REQB 1PEYA 2F48A 4LNUB 2GBIA 2IL1A 4PONA 5J5CA 3USCS 1PQYA 1NQ5A 4Y9DA 4NYMQ 4AT1A 2HSEA 3TQIA 1NJFA 2IPMA 4M36A 4N8DA 3FPJA 4LI0A 4XW2A 5JZSA 5CDHA 2OP1A 1TJYA 3N0VA 5JS8A 2J41A 3VC2A 4KSYA 4KWIA 3VTFA 4XCXA 2SICE 3O3OB 1SCNE 3IAM1 3KQPA 3RSHA 1SD1A 3E53A 5AKEA 5AVZA 1ZN8A 1QIIA 1A9OA 2V03A 2FFJA 1EUDB 2V7TA 4PZLA 4R83A 2VJMA 2PO7A 2EBFX 2YY7A 5EMLA 4DRXB 4R68A 4B4WA 2UUCB 1OBCA 4WHMA 4XJTA 1ZVVA 3RFXA 1YAHA 1Q7TA 2Q1SA 1TAGA 3UCXA 4JNKA 1UMDB 3GFTA 4OK6A 4UBIA 4OYHA 4NK4A 1SFRA 1TEZA 3R0XA 3LRPA 4J1QA 2RBKA 1RXIA 2X0KA 3Q85A 4HPXB 2C96A 3RHFA 2DY0A 2XMSA 4L16A 4LZWA 4RANA 1AHPA 2VDMB 3LKBA 1QO0D 4A2PA 1H5QA 2C58A 3RK1A 4B8ZA 4D56A 2ORWA 4GQIA 1NVDA 1NLYA 1OLXA 4F9EA 4CEIB 1IY9A 1ZXLA 5D85A 4IUBS 1AT1A 1G6KA 3IIKA 4K9OA 4MVJI 1JWAB 4DV0B 1I24A 4IYJA 3DBRA 5EWLB 1MP0A 1NW4A 1PJTA 1XI2A 1H0KA 4FKBA 1LU9A 1QO9A 2V4UA 4LDRA 4GZ5A 4OL9A 5AI4A 1MX5A 3W9BA 1DAIA 4H7KA 4JBLA 4DF3A 3BWMA 4QECA 4DNOA 1ZK0A 3FTDA 1ABFA 5E1OA 5HMMA 3HCBA 4YRSA 4JP1A 4DLZA 4CKEB 1JPJA 1UBCA 3TDMA 2QRVB 3JVEA 3TI7A 4G65A 4XCVA 1KY4A 1MQSA 1T3ZA 2DF8A 1TFRA 3LECA 1FP4A 1OROA 3V46A 4E5UA 5A5VA 3QMPA 4C30A 5KQRA 4MDHA 5IW8A 3ROPA 2M6LA 2EFHB 5EY5B 2FUNB 2PMKA 1YTLA 3D7KA 2XJ4A 4LFCB 4UM9B 3Q3EA 5FOWA 4CLHA 2AK2A 4OU4A 3ZWKA 1Z88A 3I76A 4FBGA 1BCSB 1SU4A 3F2VA 4FR2A 2FF7A 1JAZA 2JGMA 4KOAA 4X93A 5LU9A 1AGXA 4F38A 3PGMA 1IHDA 1C1XB 3A6DA 3UCFA 2GZMA 2RGNA 3MRTA 4J4HA 4WY5A 3FWKA 2P9FA 4A82A 2NQ2C 1E61A 1UODA 3N53A 5L9AA 1MV5A 3CNLA 1IPEA 2FUEA 4Q4AB 3H2JA 3WYFA 4S05A 1UM8A 2PQ2A 2Q07A 4G41A 4ER3A 1S3FA 3DUWA 1ZL2A 4GMDA 4U3JB 5JD6A 1XU9A 5HTOA 1KTVA 4EL0A 1WVGA 1P80A 3QGMA 3OU6A 4RDCA 2AS0A 4Z7NB 1WO8A 4NZNA 2E21A 2HW8A 1GGJA 1COWA 4LJ5A 1L7EA 1VSQA 2QJOA 1BWPA 1XTPA 1E8DA 1QFJA 2ZI6A 3M3PA 4MI6A 3KQWA 3NIGB 1QGDA 4X1YB 2VT3A 2Y6VA 1OHHD 4PZDA 1C50A 2AWOA 2WUEA 1FYWA 3NHZA 1U7HA 3V7UA 1C9JA 3QJYA 4MJLA 3RRYA 1YU9A 3TQFA 5BSKA 5KU1A 4RVFA 4WXRA 3C1TA 5I7SA 1J5XA 2VP9A 3HXPA 3HCWA 1GKKA 3HXOA 1ONOA 3A6EA 5I9SA 3KKQA 3T0GA 2YXBA 1FZQA 1UPAA 3EEQA 1LS1A 3SSOA 4TSFD 5F9HA 4EZBA 4BWFB 2C07A 3OZ7A 2O8BA 1JJBA 3VYVA 2YN2A 2Q8PA 1Q57A 4C06A 4QVIA 2B5VA 3W2HA 4BMZA 3OA2A 1Y1PA 1X77A 5HUJA 5C9ZA 4E7PA 2FA9A 1WCIA 4Q1CA 5CR9A 3O9VA 5DYGA 5L3SA 3GA0A 3TB4A 4N7JA 3OF3A 5EESA 3EZLA 5CDUA 1Y6FA 2XE7A 4P38A 4QNRA 2GF9A 3OSZA 2QRPA 4GPZA 2QX9A 3JQAB 3AH8A 3ZDZB 1N5OX 3VSAA 3G49A 3N6XA 1T5IA 3OQBA 1OWLA 3RVDA 1OXUA 4G3XA 3QU4A 2OECA 1NLUA 1XD2B 2I65A 4MUJA 3JD4A 3PLAE 4U2KA 1NW3A 1CUSA 2Q1UA 3IP6A 4IIVA 4OHFA 4XKJA 4BNIA 2HBYA 2F1KA 1J0AA 1L5YA 3HB7A 1RM4A 4L4YA 1NI4B 4B84A 5E4TA 5FWXB 5CJPA 1L9KA 2IYPA 1GPH1 3WGMA 5I7WA 1L4UA 1MNQA 2FP3A 2JGFA 2RBGA 4HH4A 4HVCA 3CVXA 2YFHA 3DB2A 4ECAA 4D0NA 4ZGWA 4CTNA 3HR7A 2QMZA 1GQQA 3LKDA 3VHLB 4PN7A 5HP4A 1IJFA 3SM3A 4KR9A 1MO5A 4KXNA 4UBLA 5HOEA 1QVVA 1XQ1A 3LT1A 1EJBA 3RRJA 5CFPA 1EFDN 3F4LA 4B09A 4D42A 5KWIA 3CKYA 1S2GA 2VP5A 1EJ2A 3C8ZA 5FULA 4XEHA 4U2DA 3SIXA 1GQFA 2IUTA 1MGPA 1D1SA 2FQYA 4RVCA 5AM3A 2FK8A 2W0MA 2XODA 3D2LA 2VSOA 1R18A 1W75A 4V2IA 1DC3A 1YRQA 4JXJA 4L0CA 4WZ6A 2AF4C 3RWOA 2JAXA 2OZEA 1KWKA 3UAYA 1XEWY 1LNQA 1A4UA 3BERA 1V0JA 2PSSA 2WP8J 4KG7A 4ND7A 2AEJA 3TEFA 4AJLA 1DJPA 4JP8A 4MRSA 3WKAA 2QKYA 4AIIA 2HRBA 2VJPA 3EPRA 5GY7A 1QC5A 3LVRE 5AW9A 3VXKA 3WZMA 1AS0A 3AYZB 3FLBA 1DAEA 4WCFC 5EUQB 5B57C 4FCVA 4J2OA 4Q15A 3EXAA 4Z7JA 1O94C 3ZNNA 4GGMX 1YTUA 3NALA 2WF8A 4NYIQ 3MCUA 3I8SA 4MA0A 3KD2A 2D62A 1F0KA 3M6MD 2C4NA 3RUIA 4DSTA 6AT1A 1DP4A 2JANA 2BCGY 3H2HA 4KZKA 1ISHA 2XIQA 3IEUA 1VB5A 1IQUA 2Y1EA 4NICA 4PVDA 5C5CA 1O4VA 2QYHA 5IANA 4R51A 3NC1C 4IH4A 2B6HA 4KLCA 1MHPA 4N4AA 1IUPA 4BDSA 5BN5A 1ISJA 3AOEC 3EGOA 1MX1A 2HJHA 2BM9A 4H6VA 4GYYA 1QNFA 4WBXC 5FEMA 1GGHA 3ZKAA 1ISRA 5MN4A 1X8JA 5I9BA 3AHEA 1ZRMA 3HYSA 1V48A 3TPCA 1QLHA 4IEEA 2VBFA 3G2PA 1YA8A 3U4QA 4Z4FA 3WB2A 4BFTA 4HMQA 2BTQB 1E92A 5CYOA 5DK4A 7MDHA 1TJ5A 4O2LA 5K4HA 3EXFA 3GWZA 5DNEA 1PDVA 3DEZA 2J3EA 4YCJA 1J9GA 1AK2A 5IASA 3W5AA 3I92A 1R0ZA 5IN5A 3FGPA 3UC5A 3BBPA 1M2VA 1PW7A 1RJ9A 2BLLA 2H2DA 3AERA 3BFPA 5DM4A 4GRDA 1PWHA 3LHKA 5GONA 2I87A 2M98A 1X80A 2AJCA 2WWVD 3T99A 3UC9A 2CL6X 1S89A 4H0FA 4DEVA 1LBHA 2VYND 3BGDA 1YNOA 3MMPA 3BHIA 1YQWA 3GPBA 3OD5A 3BSSA 4D99A 2Q4RA 4N7BA 6GPBA 2D6FA 3RARA 1I30A 2WTMA 3L1KA 1E4VA 1P6QA 1Z29A 2E4ZA 3DLHA 4EYSA 4RA6A 1V8FA 2HLNA 3B6JA 4K9SA 3C6YA 3GX1A 4WASA 3THYA 2MHCA 3QV1A 4HP8A 2E82A 1V26A 3E6AA 3H13A 4NPHA 1MN6A 4PGFA 4N6NA 4MW1A 1ZIPA 4CFSA 3CZ4A 4G8JA 4Y30A 1X13A 2C2KA 1X9HA 2W7TA 1RXSA 3AEQB 3U4GA 1CUXA 1ECLA 1TEHA 1JDBB 5J43A 1XA3A 2OCBA 4C04A 1B0ZA 1DUSA 2Z95A 1LLUA 3BH6A 3H97A 1WQ1R 1QYIA 4RABA 1WIWA 1JLLA 3GFOA 4KMSA 4ZCMA 4FYJA 5H4HA 3ZE7A 4P0QB 2TSYB 4RH0A 2ANBA 4RPJA 1H2HA 4NV0A 4I8XA 4C6TA 4X1IA 3T7SA 5LQNA 4DW8A 3EG9B 1MXFA 3AHJA 4LZOA 3VR2D 5F5LA 1XZPA 2W6ID 2PL5A 3ELDA 3EUFA 3AVYA 2EKDA 1NUPA 1UDAA 4LJ6A 3R9KA 4XGRA 1GCGA 1CEEA 1G64A 2D1TA 2NW6A 2P9EA 3BK7A 5BOVA 3RI3A 3S0JA 1ADYA 3VR6D 3FHLA 3IP9A 2ZUTA 1J0CA 2P9QA 4ARAA 1OH6A 4KQMA 1Z39A 4EWLA 4KPEC 1NVGA 5EJ6A 3ACDA 1G20B 3GLHB 4L15A 4LC1A 1IN7A 1GJRA 1RI2A 4JVSB 2H2AA 4OHYA 1RADA 1HYBA 3PTZA 1HC7A 1U5CA 4UHFA 1CDOA 1KH1A 1ZL0A 3TW8A 1UM9A 4EJMA 4OQNA 4WBNF 221PA 4PQGA 5KO2A 1H9BA 1OXSC 3EVGA 3VNQA 3WJ7A 5AJHA 1KIMA 1M8GA 1MT3A 4IBOA 3ASYA 1ILEA 1EAYA 1UMCB 4TXNA 3UJPA 5BORA 1MNAA 3IKTA 2VZ0A 3T3NA 3DHNA 3IMEA 2GQ0A 2FWPA 4IH9A 5TVGA 2WABA 2ZFUA 4M3NA 3S1AB 3IAFA 1DAHA 4C7BA 2BGWA 4ZJPA 4V3BA 3RVJA 2GB4A 4NP6A 5I9TA 3ZE9A 1PYGA 4DR1B 3Q15C 4LS3A 4R2XA 4GLJA 3NV9A 4FC7A 5LQRA 3TE7A 4W99A 4E5YA 3IQWA 1XMIA 1PK9A 3OIFA 4YYEA 2NUTB 3P20A 4OP3A 2WD7A 3MTQA 2W00A 5DWVA 4YWHA 2G25A 3A0UA 1B8OA 1JQJC 4D3YA 2AEEA 2P2GA 1TD9A 4UTOA 4BQRA 3VYTB 3DWFA 3ZNPA 2XRYA 3EWAA 5FAKA 3DYVA 3P45A 3FRJA 3GT3A 1Z4LA 4J6EA 5LMUB 4AO8A 3VO2A 1QIHA 4CQMB 1PFWA 3BIFA 4HGNA 4BGVA 1DRUA 3EMVA 2EKBA 1JZQA 3IYLW 4JI6B 5EE0A 4X5OA 1SZDA 4YQEA 2IXGA 1CUVA 1GWNA 4KLRA 1I3MA 2X8BA 5C4MA 2HRCA 1XQWA 2ZBGA 1UBHS 2FFBA 2ECPA 2GAFA 2REXB 1V3VA 3DTVA 1LVUA 4CWAA 1CRLA 1S3GA 3SQXA 1CNEA 3SVTA 3KDPA 4LY9A 4MOWA 3UM9A 3GLFE 3KZNA 3EJWA 1GRQA 4NK5A 3OBBA 4XDHA 1YA4A 2B4QA 1G60A 1P2VA 1Z47A 1YK0A 2INGX 3I9V1 4MB6A 5KYVA 4HD8A 1QOQB 1ZRNA 5CEEA 1XEXB 1Z5OA 2AH5A 2OBYA 2WTXA 2CXRA 3DMYA 3JALA 2VHVA 3Q2KA 4MW7A 4CMGA 2VWGA 3QFSA 4G5QA 1TT5A 4KWCA 1M2OB 2GARA 3QY9A 3EA4A 3NONA 2J8ZA 3ROFA 2XGJA 1TTPB 1NTOA 4MVJE 3K0AA 2H2GA 4KRXA 4MMZB 3IUQA 1QQ7A 2XWBF 4WZAA 4C14A 5HGXA 4S1OA 4QAJA 1EWRA 3DFIA 4B40A 4LBVA 4S1PA 3NJRA 5EEHA 3JD2A 4NPCA 1CNMA 3EXIA 1NVUQ 1PVVA 3BD7A 1WSDA 2CBGA 3IPRA 4J16C 5FUXA 5HK8A 3TYXA 5B2FA 1E1DA 1ZOIA 4N49A 4JEIA 2XA1A 3CSDA 1VL0A 3ILXA 2QM3A 3I0ZA 4Q1DA 1OCEA 1GPKA 1QLWA 1JHQA 1M67A 3TFWA 1ZUWA 2G76A 2MYNA 1GYRA 2C7VA 3L92A 3G9XA 2RI1A 3GT7A 1UMKA 1I2DA 2YHSA 1NULA 1V6SA 1VPVA 1SBHA 1U6JA 3IDAA 1BG6A 1JQEA 3BE4A 3OZDA 1UUFA 2FSGA 2W43A 2JGEA 5DVZA 1GGVA 1MMFB 2C54A 1J1UA 2QZJA 2B1JA 1A72A 4MEBA 2KM1A 4ENSA 4EEZA 2C94A 1JU4A 2OBNA 4HR7A 1TA4A 3LFHA 5A4IS 2WIDA 4Y7CA 3PITA 4NCJA 3V1TC 3CMCO 5FHRA 5BP7A 3C4QA 3U56A 4E09A 1V43A 2QJTA 2R87A 2Q4TA 4DIMA 2EX0A 5FX2A 5BVHB 5AJTA 3BAFA 4CN8A 1TIKA 4JCCA 4LZNA 2B2XA 3FF1A 1HDEA 2BCJQ 1YBMA 4WI1A 5DMXA 3AB8A 3A0RB 1AUQA 1HEUA 4S2EA 3EYWA 1G3RA 2YXPX 5FV7A 1BN6A 1K4KA 3HU1A 4M37A 3T3IA 4AZ0B 4BVLA 5B3JC 3OIGA 2MCFA 3SZLA 1PEDA 2FSVC 2JHPA 3HYLA 3QEKA 4KQWA 1I0LA 1WPGA 3K5HA 4EEXA 3U3JA 4I50B 1XZAA 2AZ4A 2M1ZA 1W0JA 1Z83A 1KFEB 4L5IA 3NBAA 3TOZA 3COPA 2WVGA 8ABPA 2ZM6B 2C5GA 4B83A 4C5BA 2G77B 2AUTA 2V4MA 2O2EA 3IP5A 2UVDA 3OEHD 4BAGA 3LWZA 5KOHB 1XDDA 2RCNA 1ZD2P 2MSEB 3SKYA 2F3UA 1LPOA 1KP3A 5DXAA 3LQ1A 4N54A 1ZBDA 3GRUA 4B4DA 5JAQA 4C6SA 1E3MA 5H9WA 1CDEA 4U6SA 1X15A 5DN9A 2R6FA 5C34B 1I6LA 4UVEA 2AJDA 4G84A 5E2AA 2QDXA 4WMLA 1V3QE 3QH4A 4B1FA 1OXMA 2JI7A 4FSXA 2J3QA 3GXOA 1DO8A 5FYDA 3RLFA 4DSAA 3A3YA 1GEEA 4RZUA 3RNOA 4JVMA 1G5IA 2A35A 4L27A 1SU7A 1XF9A 3ZDBA 1EVQA 3PZRA 1XVVA 2ZYSA 3DD1A 1SCQA 2WAAA 4XWAA 4ZWNA 2Z57A 4JXKA 5IF3A 1IM2A 4D4MA 2AVDA 3AGPA 2AN1A 4I0WB 3M4NA 3H75A 1QO0A 2DH6A 2FUCA 1INLA 3O2JA 4ZQGA 1QX4A 1Y7TA 3M6FA 2LVBA 2Q8NA 1GITA 1QUFA 1T5HX 3FGNA 3IAXA 4I1YA 1Z63A 1Q7GA 3FOCA 4FFWA 2G0TA 2HK6A 1NMYA 4PXAA 2ZK7A 1T9DA 4CTJA 3GHHA 2P69A 3FZQA 2ZUEA 5D00A 5KTTA 3TBFA 3GB9A 4YV7A 4BNWA 4F8YA 2VBGA 5JS6A 2Y93A 1VMDA 2OCIA 2XB2A 2QLMA 4MQEB 1FFBA 1X8KA 3DBLA 2JLQA 3WL7A 3WK8A 1O87A 1FFCA 2B8WA 3AK4A 1VLJA 4HQFA 3MZ0A 3VKHA 5DEIA 5B7PA 4JWKA 2RE8A 2CN1A 2XQKA 1QDLB 4K1XA 1DIAA 2GLXA 3KP1A 2H00A 3NPMA 5EG5A 3EPKA 2ZRJA 1DG9A 3FOBA 4J7UA 3RS2A 3EDQA 5CG2A 4B73A 4G01B 3BXXA 4G1FA 4F6RB 2Y9MB 5JE8A 1Q1AA 2OZLB 2J5KA 1R0YA 2GPJA 2DQZA 2PJUA 2JRCA 1YZ3A 1IU9A 1QIJA 2ECKA 3D0RA 3LQ2A 4MV1A 1DS6A 2FW7A 4CMEA 3KKLA 2JVJA 3BGOS 4MUKA 3UXHA 3L4EA 5C37A 1VPLA 2XJ9A 1PG0A 5FWYB 3BX1A 1JG7A 2XBMA 3ZDCA 3COWA 5DTQA 4U1RA 4KR6A 1N1GA 3BCSA 4JVLA 3HU2A 4YV1A 3WYDA 1KTIA 1DSSG 3PXUA 1U28A 1W581 3ZXIA 1BVRA 4E1BA 3D5TA 3A4NA 4LWZA 4XQ9A 3R76A 4B75A 4UVDA 1F8XA 1NXQA 3PD7A 4NEGA 5BQOA 4HX9A 1ZIYA 2WU4A 1QVAA 2ZRHA 2HH9A 4R05A 2O7NA 4U8GA 2YJZA 4UU7A 3W3AH 1BU5A 3BCRA 2QW1A 2QE6A 3KVNA 4O1MA 2I76A 1LF5A 3RBVA 3ZVMA 3A25A 2I34A 1RC1A 3C1OA 4HWGA 1S9HA 2HMWA 3IP8A 3R7SA 3O8RA 2RMKA 4QU0A 4ZFNA 1CVIA 4DUPA 1KK3A 3FMVA 4LHEA 4Q24A 1WD7A 1P39A 1NYRA 2Z1NA 2XZPA 3GNQA 2A1UB 3DV0B 1CG6A 3MW8A 4FEYA 2PBRA 2XMZA 1Q74A 4JVOA 2C7BA 1ZW1A 2OAEA 3VGJA 4JP2A 2IEYA 2HL6A 3RUHA 3ICPA 4NATA 4WUVA 5K4GA 2XMGA 4FNAA 1TJ3A 4PZPA 2ZYDA 3N87A 1G8MA 4N0MA 1OASA 1PR4A 3MOGA 4A0HA 1N5RA 3V9PA 3THRA 2O0JA 2Q6OA 2HM7A 4HTFB 3CLSD 3KWMA 3BIJA 4IQGA 5KHLB 1G6HA 3K0FB 1UJ4A 2EERA 3UK1A 1C4XA 4HPWA 3SIWA 3T9DA 4NS4A 2QUJA 3BKXA 2ZJ3A 2QY6A 4ZZIA 1JT2A 1YQQA 1P0MA 1KDPA 2PFSA 3HWRA 3QU7A 4GOLD 2XMBA 1BS1A 2QMQA 2EX1A 2GCOA 4MVCA 3Q6IA 2HQBA 5JVDB 3PUZA 4GC9A 4CQJA 3MSXA 2GZ2A 2DSTA 4AZWA 2JKYA 2A1TS 3CN7A 1DUIA 3HVIA 1JVBA 2JAUA 4GLFA 1B14A 1TZJA 1IPFA 3KUUA 4JVNA 2ZE6A 1U2TA 2MINA 3QU2A 3T12A 1FMTA 4ZCTA 4ESVA 1BGVA 4Q9HA 5EKDA 1T10A 4BKMA 3DFUA 1L5KA 2YYSA 1YE8A 2Z9DA 3GEHA 3PA8A 4DUGD 1AV6A 3JQ7B 2G1PA 3QYAA 2JJ8A 1YHNA 1GU7A 3RJMA 4S0XA 1ISIA 1SVUA 2WUFA 2R8RA 4KNVA 1FLVA 3FKSD 5LYYA 3I83A 4Q39A 3JWPA 4KQHA 4RQUA 4YAFA 4Z49A 1GKUB 3IPLA 2DBQA 4IJ6A 1Z8DA 2VPTA 1Y3IA 4R1PA 1QSGA 1A76A 1VSBA 2OHGA 2QD5A 5CVDA 2BHRA 3ZXYA 3WA7A 4WVLA 1A5ZA 3HCFA 2EFJA 3IUMA 3K9GA 4Q3CA 4JBNA 3VR3D 1PGQA 5I9MA 2FN7A 4MS3A 1ICIA 4TMYA 5FBZA 3VHRA 4Y2UA 5AW5A 2FP4A 5TS3A 2XCRB 3QEAZ 3MMXA 3PV0A 2OGTA 3CVUA 1AQUA 1HQDA 4B3XA 5LVAA 4IOMA 3IB6A 1AHHA 5H59A 4DLXA 1V1MB 3D3NA 3QSGA 1WZEA 1EA5A 4LF8B 2AN3A 4X1OA 1N75A 1Y7HA 1EUYA 1SB9A 4LXYA 3DDHA 5TARA 1RD4A 4OB8A 2QR3A 4N6OA 3GEPA 3HN7A 3JW8A 3SXJA 3I62A 3BMCA 3OM1A 4LDAA 4M6WA 5CW1A 3CS3A 4YCDA 2VXOA 4EY3A 2GT1A 1CBUA 4IDCA 3VTZA 2XNHA 4AJKA 3TGLA 3ZU4A 1ELOA 2VJOA 1GSHA 1E7SA 1NW7A 4RA9A 2OVBA 1KEEB 3PWKA 2GCEA 4MRMA 5DJ5A 5AXDA 3FVTA 3NHJA 5LQAA 1D2GA 3GMSA 4EHFA 1OFUX 5LOVF 1K8ZB 4CL0A 3I5XA 1HQKA 2I6GA 4W6ZA 4PYQA 4QPDA 1LV7A 1YZHA 3A27A 4FDLA 4DLNA 2YHIA 5CYGA 3AXTA 3QLVC 2HK8A 4IMJB 1HE5A 2NTNA 3RVMA 3LPLA 4LVOA 5A0FA 1T9GS 5H16A 3RAGA 4YC7A 4LDZA 1ZA1A 4P53A 4PRYA 2QQFA 3TQTA 4O1IA 3AZOA 1VE9A 1RYNA 1XZFA 3MSCA 5CLLA 5AW8A 3FAZA 3KKMA 5EL0A 2J0UA 4KGZA 3SFZA 4YAGA 5G53C 3ZWXA 1J0EA 3NBFA 1B8UA 1JDVA 1HUQA 3PGVA 5B55A 1E6LA 3JASB 5K8JB 1EP1B 2VYNA 4W7SA 1R6VA 4YCCA 3RLIA 2YXLA 4WA7A 3W7VA 4MVYA 2RONA 4HN4B 2E85A 3VHXB 4ALIA 4PYMA 2HX1A 4PC6A 3L1HA 2V59A 2JJYA 3A70A 3RIEA 4N0QA 5CB8A 1IUOA 1C4WA 1WSBA 2OV2A 1UK9A 1IM5A 2ATEA 2OZVA 4HAYA 4CM6A 2F4NA 4HNSA 2XXAA 1RR6A 1ZH8A 1ZM3A 1IJEA 2Q6TA 3CR7A 4O2AA 1TK9A 3OO0A 4WK0B 5A9SB 1TNDA 1OI3A 4S0ZA 1KAEA 1ZDMA 4ZP1A 2VJQA 3HVHA 3LUJA 3G79A 4C07A 4JMPA 1MG5A 4P3PA 1C7ZA 3AEKA 2W2OA 3EGIA 3KLMX 3H19A 2G70A 2WIFA 4GVLA 1VHWA 2OFPA 2QW8A 1ZLXA 1AUVA 2UDPA 3CONA 2RHDA 4CU5A 1LJUA 3O0TA 4RFVA 3F1KA 3ABOB 3AR7A 3DZCA 3QWHA 4KQEA 4YN3A 3AG5A 2PLFA 5HS6A 4PRLA 4R3NA 1R5JA 4IF4A 1ZJZA 4K9QA 4XQEA 4XLZA 1ITZA 1RRKA 1RYYA 1Z8NA 3GROA 4YRJA 2P65A 3EQ8A 2OHIA 4YS6A 1ZU5A 4E51A 2VEOA 3JQ8A 2W6IA 3K32A 2QPTA 5EE9A 5EGSA 4QKQA 5KOYA 2R11A 4F92B 3QKUA 1C9MA 1QIFA 3HDTA 3RVLA 3HDVA 1QZ3A 5KUTA 4M83A 1RP7A 2QAGB 5LN1A 1KFCB 5F9MA 3K1AB 2A5FA 2YYZA 1ADJA 2RAVA 1GEGA 4S35A 2JLWA 3KPUA 1BH2A 2H11A 4LWPA 2O6LA 4N8EA 3WNBA 4RADA 1G21A 3OETA 4OAOA 1W7AA 4F3NA 4L5YA 1GAJA 1VCNA 3F67A 3V00A 5AVWA 4CCWA 3F8TA 1NQUA 2DJIA 4P2GA 3G2OA 1ACMA 2OVFA 1L9XA 2VF8A 4OVKA 5K3AA 3RCBA 2GFQA 3ABQB 3LZDA 4BO0A 3RRXA 4ETWA 1W47A 1MAWA 1RCFA 4MPJA 2JCBA 4DWJA 1L3IA 3FGZA 3NM4A 4GR5A 4DCOA 4BJHB 2CHUA 2CNWA 2I3BA 2QJWA 1Y98A 4WRRA 1WCWA 3WGYA 2XT6A 4GQBA 2G9NA 7AT1A 4F96A 1XL0A 1K7CA 3ESZA 3IBTA 2OXRA 2NM0A 3WVNA 1IY2A 1PJ3A 3PHGA 1OWOA 3R5XA 2AXNA 4KYUA 2JFPA 4FR5A 1BXRB 2Z08A 1CHNA 1FCJA 1MVNA 3KQTA 4P7BA 4YK7A 3ZGXA 3WQSB 5ALEA 3FNFA 1K08A 4RACA 1V16B 3HHPA 4UDOA 4LRSB 3I0NA 3IO3A 3OSUA 4NG5A 1JTVA 2BI4A 4RZXA 1OD6A 4F72A 5HRAA 4KX3A 4PSCA 1GUYA 1MC5A 1T6ZA 2H1LA 3NBXX 4TPKA 3RFTA 2Y1CA 1PE0A 3T3DA 3UUEA 2PTGA 4D0SA 1Q92A 4MB2A 1TZMA 4JV5B 2CSUA 2FH5B 2MR5A 2ZVQX 1LY1A 3EXHB 5DTMA 3AI7A 721PA 2YXEA 2DB3A 1X1SA 5I8PA 1M34B 3JVIA 5IT5A 4KTTE 3DDSA 1BHJA 5A5EA 2KLBA 3R7DA 2VDKB 1V11A 3BVPA 1CY7A 1ATIA 4M9UA 1FFYA 4GO1A 3PI7A 1YMVA 3LPAA 3EUAA 1DOAA 5HCIA 3IR6A 1ZKMA 1MC4A 5F7JA 2ZJZA 5FXMA 1U99A 1G9SA 1CK4A 4JENA 3UJ7A 1JIQA 2OO5A 1O96A 1E1NA 3A14A 5CMLA 5ISMA 3WISA 3G7SA 2P7HA 3WGQA 1KP9A 2QVLA 3H04A 4KFSA 3DL7A 4BFVA 4QIHA 4RFSA 3SEZA 4FXPA 1RFGE 3W5JA 4EPTA 2JHCA 3MLBA 3PEFA 4LNAA 1E1KA 1GA1A 1HFEL 1T2DA 2YHBA 3LLCA 3OCYA 4OOFA 5HZHA 1ONNA 1TYZA 2I4MA 3E1KA 4ERNA 1L7OA 1SQ5A 1HT2E 2GLTA 4L3VA 4IY1A 4TMKA 1UR5A 5FTLA 4NJEB 2WBLC 1G9XA 4GKBA 1SUCA 1VDMA 1HZZC 1QFXA 4Y2GA 3UK6A 4EH1A 3LYUA 4LRQA 1R8QA 3O2SB 4UNQA 4LJKA 1TX4B 1QKIA 4V0OA 4WH0A 3UG7A 4EQ6B 1OLOA 3E3LA 2QTAA 1CZRA 4NBWA 1F2TB 1T8WA 1RQRA 4KI7A 5G0TA 1NQXA 3ZWQA 2HQSA 3AETB 1RCTE 1UAGA 4NIMA 3HO1A 1Z5VA 3LT0A 1L7RA 1OYOA 2IYXA 2Q3JA 3EEFA 3PL5A 2IWRA 2ZE7A 3SR3A 4IZOA 1XA0A 1MRSA 1GLGA 4BFZA 5ALZA 4CF3A 2VPWA 3K6SA 2GEVA 4MVJF 2VHYA 1ZBQA 3SG0A 1M6VB 3HBLA 5MF6A 3WTCA 1O57A 1BNCA 4M1TA 4AF7A 4PLVA 1Z74A 4PAOA 3THWA 1Q0PA 1ST3A 2GBGA 3WGUA 5B2EA 2AQ8A 3H0KA 1ZWKA 4WCDA 3HXMA 3CKKA 2DTDA 2P77A 3A28A 3MUEA 5COAA 1P7PA 4O4LA 3BMXA 4ZEXA 3THOA 5SYAA 1PEAA 1U9IA 4JJ4A 4FUQA 4BNNA 2GWRA 4LF7B 3IL2A 2J3IA 2YVLA 3UOWA 1QYCA 1A77A 3TOVA 3F6SA 3JWGA 3CJRA 3LXMA 1XTVA 4HAWA 5G3YA 4B33A 1IVSA 4BEJA 1WZ2A 1MB4A 4RM3A 3RWMB 2RG1A 4BBPA 3LNCA 4ESOA 2AYYA 2BFEA 2KHZA 3SX4A 3T8YA 4BV3A 1ADFA 1NF9A 4JUFA 2WSSD 3VNBA 3NVMB 1LD3A 2DE0X 2ZULA 4RTLA 2AQHA 4CVNA 4CIYA 5ILOA 4GU5A 1EVZA 1TKBA 1Q3HA 1ZI8A 3B1XA 4PGAA 1QAOA 1N5KA 4BX2A 3QYFA 4H35A 6REQA 1QS0A 3FLAA 2ONJA 4RSMA 2NLOA 4EBFA 3OC6A 3MA0A 4QFDA 4OHZA 3IA2A 2CLIB 2C0QA 2QYTA 4IDNA 3RJ9A 3WDSA 2O8CB 3X1KA 1XQ9A 1NKVA 1VIVA 3DQQA 3HCPA 3ROGA 4XVCA 2BGIA 3DE5X 4KVFA 3FB4A 3L7CA 1BHQ1 1U8XX 3OFKA 3OQIB 2DCUA 1WDLA 3DAPA 1F38A 5CUQA 4CEHA 5JSFA 2HFKA 3EC2A 1C5KA 5KAMA 4B5LA 4D97A 1AHIA 3WOHA 3X1YA 1T2FA 2HNKA 3DUFB 4PC2A 4TUYF 4QREA 4EJ0A 2FPWA 4FNOA 3K6RA 1R6TA 4L6AA 4P82A 5DNVA 2E5LB 2V7BA 4UHJA 5SZKB 5J2UA 1ODFA 3U7QB 1WMBA 4GSKA 4FHZA 2EW8A 2AFHA 4JYPA 3I8OA 4CT4B 4ZK2A 4MV0A 1O77A 3SM9A 3UWOA 4EB6B 3T1YB 4K28A 3RROA 4I4TB 3W2EA 3LSYA 4LKRA 5BMOA 2NUBA 1O6ZA 2WJVA 2Y4NA 4R8SA 4TS1A 3F7TA 3TIXB 1VDZA 2D0PB 4E2ZA 2XNKA 2DMRA 2FRDA 3EVBA 3HA7A 4Z0PA 2C9DA 2GM3A 3IH5A 1XZNA 3VV2A 5B2ZA 4A2CA 1SZCA 1A7UA 1NOKA 2JJ2D 3DLTA 1QCZA 1NJ6A 3I0MA 4L3WA 1YB2A 4AMGA 2R79A 2BFMA 1A9XB 4I1SA 1XRRA 3F73A 3ENVA 3K8QA 2MSLA 3FYSA 4EO7A 2IGBA 1JLHA 4GWKA 2YRFA 4Q93A 4TXLA 4BVFA 1YULA 4UAGA 2X76A 3CMMA 1Y0BA 2YWEA 2XNCA 1B3BA 1HTWA 5G0WA 5IC6A 1I4DD 5KWVA 1PNVA 3QVSA 2XXJA 4CFZA 5CFOA 4UDYX 2O8FA 3CXUA 1M5UA 1NXSA 3DEFA 4TMFA 2ZTVA 1VKNA 4MI9A 3TUJC 2ZG6A 2PT9A 3D4OA 3DHEA 4TWJA 1X2BA 4EDHA 3LFUA 4IKEA 4UTNA 3I9OA 1MOZA 1VE1A 3I30X 3K2IA 4WERA 2Q46A 1FB5A 2RK4A 3ZU5A 2PKYX 4ZAVA 1W52X 2PCLA 5CNKA 4KO2S 1TXGA 1RKXA 2IYFA 3E8XA 4IVQA 4E2WA 2ZB3A 3D2AA 3D4LA 3W3AA 3EEOA 4HGOA 3QLTA 5INTA 1YONA 2W11A 1RPAA 4M49A 2ROQA 1A27A 1ETHA 5CXXA 1B0UA 5EYPA 2G8LA 2GCIA 1QX3A 4PHFA 3I53A 5CCDA 3CCBA 5DBGA 3NHRA 1IY0A 2G72A 2IXEA 4E22A 5IG2A 5GIPE 1TQ6A 2BEWB 2ILVA 4KN9S 3PD0A 1CTQA 4MDEA 1U11A 3M5PA 4D98A 1BXZA 5DASA 2WMYA 1QK3A 3IIJA 2VK2A 4N47A 4NG4A 3RBXA 1WJGA 4FE4A 3LH5A 5JALA 3OFSA 4CGZA 3N0TA 4HFJA 3N2ZB 3PQ8A 4QPZA 5CAEB 3WGGA 3KTAA 1ZHHA 1BE1A 2VF5X 3OTIA 3RWBA 3FZNA 4IDHA 1BDIA 3MJDA 2YVQA 4X1KB 4IRMA 1R15A 1TCBA 3HZRA 2IYVA 5FI0B 2CXOA 4OIFA 1JEQB 2J6IA 2EWWA 2IS1A 1BD3A 2YDYA 4HUQB 5JMPA 2AOTB 2P2NA 4BNGA 3SYLA 1HETA 4AY5A 1C3XA 1WEKA 2O7QA 4F60A 2YJ5A 3P2IA 3UN1A 4AF6A 1YS7A 1YGPA 2D13A 1XC7A 1L5OA 2H2FA 1DZ3A 4K81B 4DUGA 2J3LA 3AF4A 2FPPA 3FGOA 3IO5A 4LIPD 5ALDA 4YPVA 4HT3B 2HLDD 3I5YA 4GXRA 4ETIA 1XV5A 4WBNB 1LQTA 3D3EA 3C1AA 2WVAA 3IALA 3NFRA 4PBRA 2WT9A 2R6DA 4LSMA 3QTBA 5CM8B 4MUBA 2GO7A 1BCRA 5FOTA 2H1OA 2WG2A 4Q9DA 4KDRA 4N12A 2GLUA 2XBLA 1QGZA 3G82C 4FFNA 3GJ4A 4MI1A 5CNJA 5EKXA 3HO8A 3B7GA 4OI1A 3GFBA 3WK5A 4FS3A 5KB3A 3GEGA 1KZHA 2DBZA 3ZIUA 2BISA 3GH3A 3F49S 3LP8A 3VR3A 5KOJB 4HRVA 3ILYA 1OAOC 3KZCA 5LQMA 2VSNA 2NQ8A 2XI4A 5GV7A 3ZXSA 3A4IA 3DEJA 3M3HA 3KHTA 3OKFA 3Q9LA 3ZEIA 2G1UA 2ZAOA 4M1MA 9LDTA 3GFPA 6ABPA 3SDSA 1AN9A 5LD2B 4DTIA 1J9ZA 3QWBA 3JQFC 4YRQA 1UEXC 3VNRA 1N0UA 1FX0B 3CH5A 5H5JA 4JI1B 5JS2A 2PIAA 3R3WA 1XWWA 3H65A 3VKFA 4IMRA 3TL6A 1GVHA 1KI8A 2AI3A 3K05A 1H0RA 1VI2A 2D2VA 3EZNA 3DZKA 4MS4B 4RS4A 1DRVA 1L0BA 3JVDA 3SZRA 3ZLBA 2A5YB 4KIWA 2O48X 4RGVA 4RVDA 3PRJA 2HU5A 2WTAA 3GUYA 3PP8A 3HV2A 3PFHA 3WP0A 2CDCA 1H3NA 3EGCA 2K2WA 4JA0A 3G0HA 4GYWA 1K88A 1JFVA 5ALNA 4FHEA 2WYWA 5ILQA 5AKHA 2VRCD 2WDPA 4MQFB 5B3LA 2RB4A 2FLVA 2VBIA 3OTOB 1VKHA 1EUQA 4Q3EA 4RSGA 1Z17A 3ADCA 1E9RA 1VM6A 4TVKA 4CLEA 1QHNA 5JNLA 3S5UA 3U09A 1XEFA 2F90A 1CLEA 5H8WA 1DBSA 1HLDA 1RE0A 1VCMA 2EL9A 4N39A 2UYHA 5TPWA 3OPMA 1V45E 1J00A 3H84A 1CY4A 2PYIA 2YINC 3LF1A 3TSCA 3TMKA 1XHLA 3UPDA 4BUJA 1JAIA 2L69A 5GJWC 1NN1A 3VJMA 1ZJ5A 3DS8A 4FLMA 1XLVA 3RODA 4G97A 1WUIS 3EG5A 4GICA 4QM7A 3ECAA 2XT9A 3U3RA 2BKVA 1IEVA 4L2IA 4L0QA 1I1NA 1E1YA 4UD2A 3OEWA 3FPHA 3E2PA 4TV8A 2UV8A 1E89A 2ECOA 3F6RA 1L8OA 1SBYA 4PSKA 4XWYA 3BMQB 1H8HD 3DONA 2CYBA 3IMCA 3OQVA 5IDWA 2DPYA 3M6XA 5CYPA 5AW2A 2MSKA 4C5AA 3KOOA 4J0JA 1H6AA 2ETXA 4I9FA 4EGQA 5L4SA 4H7PA 4LHXA 1BU8A 3H0CA 1I9CA 1OT3A 3LO5A 4GECA 4J1TA 3L0DA 4R69A 3L1VA 1EUCB 2WJIA 1XAJA 3JAWB 3NH6A 1NRJB 2JGIA 1QYDA 3C8HA 3H87A 4OCZA 5AHKA 4AULA 1N36B 3IX7A 1Q1BA 1W1UA 2EEZA 1FK8A 1S3IA 1UPFA 2XQGA 1HNWB 1ORWA 3AP3A 3MNFA 1TTHA 5EKUA 1IB6A 3N2KA 1R4NB 4D3SA 3KZXA 3L1IA 4BLTA 3VC7A 2NG1A 5HJ7A 4INOA 2FFRA 3H8SA 1QK5A 4OQMA 1P74A 4AAYA 3DDOA 1ECBA 4B3GA 3P97A 3H1PA 4JSRA 4MW4A 3HWWA 3GLKA 3G68A 1U3FA 4FBLA 4WN9A 2ZQZA 1W44A 5HRCA 3JYQA 3C48A 1KHHA 3AESA 3B2QA 4ZDIA 5IEJA 2JJQA 1DLIA 4L51A 5B1EA 5C3MA 1JFFA 4ZCIA 1KDYA 1O03A 2WJGA 4TYYA 1I51A 1U81A 4O4HA 4E5VA 2BGGA 3EIEA 2Z5GA 4BKOA 3QF4B 2PRYA 4I1OA 1B0AA 1Y1LA 4I9GA 1PR0A 2QTCA 3LY7A 4F6LA 2MYPA 1U6IA 2NZXA 4G4JA 5F5NA 3DKKA 4NBSA 4GDMA 5K0ZA 1MAUA 3T5AA 2WB2A 4LF4B 3W8RA 2R5WA 1Q15A 2BHTA 3Q3JB 2IS4A 4FYHA 3WTBA 1JXMA 1TMYA 1F8UA 3ABSB 5K2OA 1RXCA 2XWQA 5CH8A 5ALHA 1FTGA 1ZNXA 4QOGA 2RC6A 3ZU6A 4MUYA 2AGVA 1FYXA 4QT0A 2FCAA 3H5RA 1WMFA 2PANA 2VWQA 3EXG1 3DOOA 2ENUA 1FNNA 2FUKA 2RHRA 4JN6B 2JLSA 4IIEA 1PL6A 5LA6B 1HF3A 3PNVA 5BR4A 1J49A 5JH7F 1V3UA 3DDZX 1BXGA 2QD4A 2YZMA 2ZS8A 3H4MA 3OUUA 3OX4A 2EFYA 4Q9JA 1M76A 4QPJC 3ENZA 1O89A 4HB0A 1E4OA 3EW9A 2WC1A 3NXSA 3A9WA 5DYIA 2E18A 3HFRA 5L7YA 1D6MA 3SMQA 3TG2A 1DTSA 4PLGA 4REQB 4AYXA 4DSZA 2BVNA 3LUGA 3KOZA 1SVSA 2OBMA 2EU8A 1VKZA 3F6EX 4W7IA 1U0BB 1UBMS 1ZCAA 3DR3A 2GFHA 3EWSA 4XGKA 3U7GA 4J9UE 3HJBA 1EVIA 4TKVA 4HEHA 1NMQA 5CPFA 5IZCA 3ROTA 1F6WA 2VHUA 1CJBA 2HO5A 3OCJA 1QR2A 2QW0X 3DP9A 1SNYA 2AD5A 2COKA 5JYDA 1TC2A 2YTZA 1KAGA 5DI3B 3UXYA 2HN9A 1VJ0A 1ZN9A 3KKOA 2JI9A 1NKSA 3HEMA 4J4BA 4KJZA 4MVWA 4BGUA 5BNIA 3PYMA 2J3MA 5KX5B 4KU4A 5FQOA 3F47A 4B7ZA 1EFPB 1VLLA 3Q7EA 3TR0A 1DFHA 4GZ6A 5L7WA 3MQ4A 5G0VA 2BFBA 2WPDD 5TLSA 4GL4A 3X44A 3ZLVA 5T7BA 1YVEI 3KAQA 1FXWA 2W4IA 3EC7A 1RYEA 1IMOA 1MABB 3PUXA 1TA9A 4UMDA 5JI3E 1UKAA 2AFIA 3PVCA 5J2TF 2WSIA 3M4XA 3OKAA 3K9HA 4TV9F 4QUKA 2O2GA 4DS3A 3HBMA 4K3UA 4QPCA 3L8ZA 4MLPA 3W0LB 2AN4A 3C5EA 1FFAA 1V8DA 1NDHA 1N0VC 1VMEA 2ZWPA 2Y1KA 1P7WA 3LC0A 5FR2A 4E21A 1K63A 5IZCC 3UW1A 1UL1X 2I54A 1RMYA 2PO5A 4JSYA 3U0VA 2DKOA 1E2MA 4EY7A 4F71A 3DOCA 3LDFA 1OU4A 1D8AA 4YWJA 3NWJA 3RT7A 4U6NA 1HT3A 3KELA 1TU4A 3DE0X 3S1LA 3NB0A 4G5OA 1LA2A 2Q2QA 4I4IA 2WVHA 1L8LA 2EZ8A 3FMIA 5LYJF 4DC0A 5KINB 2NU6A 1X86B 4A27A 1N1EA 4F3RA 1RXWA 4HG2A 5H9VA 2IKSA 1OWPA 4NFSA 4EI2A 1LB1B 3O4VA 2VH1A 3KB1A 4EI8A 1NMZA 4LVUA 2XUAA 4AVYA 2F00A 1T15A 2VHZA 3JCZA 3AOGA 1A2QA 2QTRA 4HDMB 3AF0A 4HGQA 4NQRA 3WGOA 5K9ZA 4O4JF 1ULZA 1KRHA 3S70A 5KHOC 1NP6A 2EL7A 2Q62A 3TL2A 1CU1A 1N5MA 2RAUA 3B3GA 3GIWA 2JA2A 4MGYR 3ZHYA 3LX4A 4RPLA 3UJAA 2JKVA 4LDJA 1PP4A 3IOCA 5AM5A 3P7MA 3AJDA 1W5FA 2CJPA 1Y6GA 2GR9A 2O06A 5EGNA 1R0RE 5IT9A 3KJGA 3KNZA 2B82A 2H5EA 1CDZA 2F43A 4UTRA 3E0QA 1JLKA 1I6MA 1FFHA 3EQZA 4GYJA 4UFNA 2QYSA 3TRKA 1EVEA 1RYMA 4FZRA 4OLHA 3WLTA 1NY5A 2ZSBA 4E3ZA 5IHPA 1UZUA 2V65A 5TVKA 1O7JA 1BE8A 1SH7A 2H07A 3AJEA 3D8BA 3U81A 3IPXA 2OYSA 2WR8A 1L4HA 1DMSA 3E8SA 4Q3KA 2C3UA 2OQRA 2B36A 5ILGA 5F7XA 3VUFA 3BJEA 4GI5A 1Z4JA 5ABPA 2ZM5A 3GV0A 4BB5A 1KAOA 2WSLA 4Q21A 1Z0FA 3D3WA 3KOMA 4WOBA 1JH8A 1D2HA 5EIWA 3RVBA 3KO8A 2Q28A 4UDXX 4DIDA 3PNPA 4K26A 2VJKA 2HMVA 2XQJA 3I4FA 2AEFA 2FRVA 1OV4A 2J3HA 4LSZA 1X3SA 2D54A 4F4HA 3KVVA 3G17A 4X6XA 3V33A 4KNYA 1NM5C 2I99A 3G0CA 3O9ZA 4YAEA 3V48A 3EXEB 4XVUA 2GBLA 3NMUF 3DVAA 1NDUA 1UBNA 1TVEA 1QHFA 2FW6A 5CB4F 1IOVA 1Z0UA 1YB1A 3K0CA 2WSSA 3ZU2A 4YTEA 3A9VA 1MJGA 1MPTA 2H5LA 1R00A 4KRFA 2J33A 3W8DA 4RMHA 4EUEA 5B1YA 4LBYA 4HAVA 1KDZA 3MBIA 2IYLD 1FQOA 4GI1A 4DLRA 4EHHA 2WSYB 5F3RA 1R6AA 3TNDA 4DMHA 4X97A 4ZOCA 4DB2A 1XCOA 4BNUA 1E7RA 5AHOA 2QL7A 5HQJA 4GHWA 3ZW9A 5KNDH 3T5TA 1GNLA 1CY1A 4CIXA 4CBVA 2BEVA 5LZ5A 2PWAA 3QVXA 1P3Y1 1MG0A 1BYIA 1JB1A 1Z2EA 4N82A 4C7MA 1GUFA 2JRLA 2B1GA 3DM5A 4IJWA 1DT3A 1M6YA 1HRKA 3L7BA 1A88A 2G07A 3ESDA 3C6BA 3GJ6A 4YJDA 3SF8B 1I3LA 1N9KA 1Y3AA 1QPBA 4R0MA 1SD5A 5KVSA 2O7RA 1SXJC 1GDHA 2Q5EA 2WWXA 4AMBA 3WFJA 1ZD4A 4DLLA 1L5RA 4MUIA 1N9GA 2HA0A 1UEJA 5FPPA 4MV9A 4RZ2A 1U98A 2G88A 2YIMA 1XVLA 4HS4A 3MOSA 2YOHA 2BM0A 1O94D 2XVZA 3CEMA 4KODA 5LQSA 1W4ZA 1PT9A 4D45A 5ECDA 4A0QA 3D54D 2F9LA 4R9UC 1A4RA 4MVJP 2BEKA 3TDNA 2PAFA </