2FGJA

Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 63
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgjA00
2BBWA 2OBNA 2OBMA 2NO0A 2EFCB 4DLUA 3MWLA 4LHXA 1SVOA 3GFOA 2VP4A 2P0EA 4TMZA 3M6AA 2Z4RA 1OXSC 2QSZA 4LPKA 3ZDQA 3AB3A 2E87A 2W0SA 4QRHA 5KSYA 1RRCA 4NP6A 3O8DA 3QXSA 4M8NE 4V03A 3O8BA 4OYHA 1F2TB 2A2ZA 2F3RA 2R65A 3NC0C 4UJ3A 1E3MA 3H2YA 3VAAA 3IDQA 1ZM2A 3W6OA 4TN1A 4X8HA 1IBRA 2Q3FA 1DOAA 4DB2A 1P9RA 2VO1A 2YOGA 2QBYA 1OH6A 1ZUHA 4OHVA 5D3MB 1TQDA 4A6PA 4C0SA 3EPLA 4A2PA 3K70C 2ZITA 4OBEA 3O8CA 4BECA 2VBCA 4JIMA 4TQ9A 2CVFA 4I1OA 4BFTA 3BFVA 3CX6A 2VP0A 3CX7A 3B60A 1SXJC 3U3OA 5EZ5A 2HT1A 1LY1A 3TAHA 3KKNA 1G5PA 4PSVA 1ONBA 3Q9LA 3SS8A 1DELA 1NKSA 2AL7A 3TE6A 1CLUA 1UPTA 2ZSBA 3TAUA 2D3WA 2V3CC 3T15A 2PLRA 3KXKA 1PVOA 4V0LA 1VHLA 2GWHA 1TQ4A 4TTRA 3UXMA 2Z6VA 1YZKA 1AZTA 4LHVA 4DLZA 4EPYA 3EARA 3C14C 3M4YA 1OXTA 2WKRA 3HU1A 1U8ZA 621PA 2QSYA 3BIFA 4IEEA 1KDOA 5K8LA 3MGCA 3QNUA 2NO6A 2CJWA 3AF0A 1VG9B 1JEDA 4QC2A 3PUVA 4NYMR 2B7BA 4NCIA 4PQYA 1RVDA 2EW1A 3B13B 4YMVA 1GG2A 1QG2A 2FU5C 2J0UA 4A6XA 4U5XA 2IS4A 3DKPA 4LHWA 2VLIA 2O8EB 3AF1A 4L8GA 4ZDIA 2O5VA 4B71A 1DG3A 3TIFA 1D2EA 4EFNA 5J4HA 3WXMA 2IYLD 3DDCA 1NVWQ 2CL0X 2GEDA 2IYTA 5FPSA 5EXXA 3S1AA 3OESA 4NONA 4BWYA 1X6VA 2OV2A 3LQRA 1RPZA 1Q3TA 1MO3A 2ZRPA 3W90A 2CBZA 2ZRMA 4HZIA 1ZUIA 4RZ3A 4ZKDA 5JBQA 5K8IA 2RKOA 3WP0A 3OIUA 3AF3A 1NP6A 2G1KA 4US0R 1GL6A 1CR1A 4TMWA 3FFAA 2CHGA 4A15A 1R4AA 1UBFA 2R6AA 2XZPA 3ADBA 5GJVC 5FOXA 1E32A 3NBFA 2HUPA 5FTKA 1OHHA 4GDFA 4JBYA 4EAQA 1E0AA 4A92A 3V4FA 3PFIA 1PUJA 4RZ2A 5CDFE 2OCYC 2QBYB 2V55B 2RGBA 4I81A 4B2IA 3TUIC 4F7WA 2VA8A 4YXWA 4GBMA 1XCMA 3VX4A 5TVKA 2KI5A 4HAXA 4QXAA 4MRRA 1OXXK 2I4IA 1EGAA 2QAGA 1HYQA 4LC1A 4N0DA 1GL9B 2X8AA 3C15C 2BDTA 1GAJA 3HU3A 3AGQA 3NXSA 4AYXA 1N3BA 1UEJA 4TYQA 1OW3B 3I4LA 1FQKA 5FUXA 3SYLA 1GFIA 5FR2A 4KSCA 4TL9A 5E3HA 4DT1A 4LYJA 3V00A 4FN5A 1HUQA 1DAGA 1T8TA 3IEUA 3PUZA 421PA 4DIEA 5KUTA 4MKFA 1NN0A 2IYUA 1I4LD 1W5TA 2FH5B 2FE4A 3MCAA 4G0NA 4OHZA 3B1XA 2CJWB 4MITA 2ZUCA 4DVGA 1QVAA 1AQUA 1KAGA 1SKQA 2J0UB 2QENA 1UKEA 2GJAA 4MRVA 1Z6AA 2HJVA 1FMJA 4IRUB 2WSMA 1OHHD 3BERA 2FX3A 1TNDA 1JAIA 4F4JA 1NF3A 3KXLA 4S35A 3KJEA 4IFBA 5EP2A 3K70B 1BIFA 3ZQJA 4S2EA 1XD8A 5B30A 3DM9B 5DISB 1W36D 3ASYA 4YXWD 5J4LA 2V9PA 1US8A 3CH4B 4TYPA 4RCYA 3S1AB 3TK1A 3ZJYA 3HR8A 1OJLA 1KI4A 1P2VA 2GTPA 3TRFA 2ZRIA 4ERNA 5GVSA 1AGPA 4FCWA 4HYYA 1OYYA 3ZZUA 1EX7A 4DDUA 2GEVA 1FUKA 2CXXA 2A3RA 3KQUA 4YLGA 6Q21A 2WWXA 3REGA 4PC6A 1E2NA 1D2MA 4OI4A 1E4VA 1U0LA 1XEWY 4KO8A 2ODWA 1FX0A 2CLDX 3RSOA 5E4FA 4RSGA 1DS6A 2H1LA 3WYAA 2IYZA 3TNFA 1OIWA 1UEIA 1XEXA 4Q9LA 1OV4A 2GXAA 1W36B 2PJRA 5JCZA 2XX3A 3IQWA 1UAAA 2NPIA 4Y0VA 4IOJA 1N6PA 3I8XA 1EFHA 4NDZA 3AVWA 2MMCA 4EPTA 1X8JA 2AXNA 1NLZA 1CJKC 3AKCA 4JLMA 2GCPA 3FVQA 1Z0AA 4MGYR 1GILA 1IQPA 4TQUS 1KDRA 3EZ6A 1ZP6A 4WZAE 5FUWA 4CVNA 2ZYTX 2DWOA 3A4LA 4M9ZA 4FD2A 4QHSA 4URWR 4NPHA 4A1FA 2XXAB 4UNPA 1TF7A 1ZM7A 3QPUA 2VP6A 3ZD6A 5J40A 4DT1B 2J5XA 2F3TA 3OF5A 5JWRA 2YV5A 1JJ7A 3WMGA 3KXIA 5GJWC 2AKAB 4O25A 2VF8A 2W6JA 2BJVA 1Q57A 3SDZA 1P5ZB 4JT2A 4A2QA 4DDWA 3BD9A 5JWOA 2XAUA 4KBGA 4D4LA 4DCUA 3WMFA 1F6BA 3Q85A 4Y0AA 2D7DA 8OHMA 1ZM4A 1IM2A 1D9XA 2C5LA 4M2LA 1COWA 2QEQA 4XVRA 1Z22A 2OAQ1 3HWSA 2J0QA 1Z0KA 1AIPA 1NKTA 2ZRJA 1G9XA 2C95A 2Q3MA 4U00A 1KSHA 2GVDC 2ZYWX 3TSZA 2P5SA 1US8B 4JYBA 5CM8B 1U98A 4LY6A 2F1JA 4M1MA 4KFSA 4M4SA 4B34A 3BXZA 2WTUA 1DVRA 1M8PA 3D31A 4W9MC 2GESA 3LVRE 1AGRA 4PR0A 1NL3A 4XSHA 4B3FX 4C3ZA 3BH7A 2MSDB 5LB4A 3G0HA 2RHDA 2YWHA 3K0CA 1PLJA 3MRSA 4II7A 4DWJA 5JECA 1TTTA 1OLOA 5LPNA 3W9YA 3EG5A 3KJGA 5CK5A 3QEJA 2W6JD 1XEXB 1KI6A 1KHTA 1TU3A 4P4SA 1YVDA 2VP2A 3FFBA 1ELOA 1ZC4A 4UXJA 1I4DD 1X8KA 2JDIA 4RKEA 3X1XA 5G40A 1A1VA 1GL7A 1WE2A 5JFGA 3X2SA 1KKMA 5JMTA 2QRZA 1COWD 3K9GA 4R71A 1HH4A 4URZR 3FDIA 4DLVA 3CBQA 4EFLA 2OFOA 3AVPA 1IXZA 4D2IA 1YJ5A 2FEMA 2X2FA 4BUJA 4JLAA 4DHEA 3A1TA 3Q7PA 3W8NA 4LDJA 4TMKA 1SVSA 4UJ5A 2YOHA 2GXQA 4BLPA 3GLFA 5IF9A 5LD2C 4QNMA 3OEEA 4L15A 2J7KA 1C9KA 5HCIA 2FEOA 2JLXA 3I92A 5BWMA 3N70A 1FNMA 4L4UA 5AUNB 1G3QA 1F5NA 2C8VA 3AVTA 5JJIA 3SHWA 2GA8A 3CWQA 2R9VA 2Q6TA 4NCNA 1II8A 4BZXA 4C0HA 3DO6A 1R7RA 4MKHA 3DMDA 2KE5A 4L9SA 1SVMA 1UADA 4ZI3A 2HV8A 2ZI3A 2JDID 4PXAA 4HLUC 2XNDD 3JVVA 1B0UA 4YC7A 2IEYA 1E1RA 4KJZA 1Z06A 4R2HA 1WB9A 4L16A 4Z54A 2JLYA 3EZ2A 4D0LB 1XTJA 3SR0A 2IWHA 1MT0A 2OUKA 2ZRFA 5A4JA 5H70A 5CYPA 1A7JA 2W58A 3LD9A 1AKYA 4PC1A 4QJ5A 3TQFA 1SHKA 2VP9A 4Q48A 3T5GA 4MUAA 5FH9A 1LS6A 2IEZA 1YR9A 2Z43A 1KO1A 2YWFA 3PUXA 1KI6B 3NC1C 5JHHB 3AF2A 4P4SB 2VSXA 5BW8A 1WCV1 2J46A 5ELXA 2EQBA 1XP8A 2KSQA 4KLZA 2BEJA 1FPMA 2J3EA 2UZIR 1RW4A 2KBEA 1GKIA 4QGHA 4HAZA 4PPNA 3ASZA 1N6RA 3QPWA 2WWIA 2Q21A 4LHZA 4A2WA 2O52A 1KYIA 2QGZA 3U6BA 3AVXA 4JVNA 2DCUA 4RZUA 5JJLA 3I3SR 3CKLA 1SKYB 3QKUA 1E2GA 1NN1A 1NY6A 2DFTA 1E9AA 4K81B 5KSPA 5C4GB 2G77B 5HZKA 1R2QA 3R9XA 4L5BA 1AS0A 1QHNA 2OLKA 2QMHA 2OLJA 5FPHA 2RGNA 1E9RA 2IUUA 1E1RD 3GLFB 5DHFA 2IXEA 1ZIOA 5H1YA 3WMEA 3GEEA 1N2CE 1XRJA 2JEOA 3BB1A 3BRWD 1CP2A 1YHNA 2JIZD 4KHZA 4Q21A 1YE8A 4HDQB 4EIWA 3SBEA 1KOFA 2AWNA 4IDOA 1TQ6A 3A1VA 3B85A 4PQFA 3EAQA 2VHTA 1ZNXA 2PLFA 4HB0A 3ONWA 3ZVMA 2B6HA 3B7GA 3QI2A 1WMSA 1DBSA 3DKVA 4YDSA 3ZZ0A 1II8B 4DRZA 5KSOA 4BGDA 5EE3A 2BMJA 1D9ZA 4FMDF 3CLVA 4TL7A 4Q9KA 3H86A 3LVQE 3LRPA 2VHJA 4UNQA 3RWMB 3TR0A 1YZNA 1ZMXA 1QDEA 2DHRA 4HLDA 4D0NA 3M1IA 5TARA 2F43A 1G5TA 2G83A 2LWIA 2VYFA 2ZRKA 2G9NA 1G16A 2IBMA 2UKDA 3QXXA 1FUUA 3QG1A 1VDZA 1FNNA 3PCRB 3WP1B 1VTKA 2IUSA 1GNPA 4QJ3A 5KSZA 1XTIA 1AQYA 1ZCBA 3U61B 3ZVLA 3L8YA 4B44A 1SXJE 2QZ4A 5LDDC 4LJ5A 3A37A 1UBEA 2QPOA 2AXPA 2PT5A 3T1QA 3RNLA 3UWKA 1G7RA 3GFPA 3GJXC 1D5CA 2IYWA 3B8HA 2F9LA 3SZRA 3BBPA 2JLSA 4W5HA 1XMJA 5EE0A 4O2RA 3WY9A 4TMXA 1R0ZA 4D81A 4IKEA 1IXSB 5KHOC 2ZS7A 1TF2A 4OHYA 4Q18A 3KKPA 2ZANA 4A82A 1KK1A 4V0KA 1G6HA 2VSFA 1S9HA 1P7CA 3QVUA 4HDCA 4Q9JA 2ZPTX 4Z51A 1DPFA 2IS2A 4U02A 3OEHA 2CLCX 2UZ3A 3RS2A 2WWGA 2F7SA 2JGNA 3QJYA 2XZOA 5DSZA 2JAQA 2D4HA 3LA6A 1E0KA 1GP2A 3BH0A 1CJUC 1CR4A 1X1RA 4RKFA 3I73A 2WKQA 3ZYCA 4EDHA 1OH7A 1E79A 4IFEA 2ZVPX 4TT3A 1CS4C 2MMGA 3PUYA 4XD7A 5C2JB 3MD0A 3OE7A 3UIEA 2YC2C 5DE3A 3X1WA 3GJ7A 1XNJA 2WOJA 5D3QA 2O0JA 1NG9A 4ZKEA 2ZROA 4YDHB 4ASUA 4C9BA 1U9IC 4Q7MB 2CE2X 4JSTA 1WRBA 3W6PA 4M1OA 4XWKA 1E98A 3W8RA 3ND9A 4OQXA 3K0SA 4NYMQ 3SHFA 1OPXA 4AD8A 3KKMA 3IBYA 4URVR 2XITA 4CZ2A 2DYKA 2PBRA 3BB3A 2EFHB 4AK9A 5AR1A 2IX3A 2IYXA 2XJ9A 1KNXA 1V5WA 3L0IB 2WIAA 3EA5A 2V1UA 2BCJQ 3NEJA 4U7DA 1YRAA 3QVVA 2ODEA 3Q5DA 1LB1B 4DLYA 2F43B 4JL8A 1MO5A 4OL0A 3SOPA 2P2LA 3L8ZA 4NKRA 5BQ5A 1Q20A 4LX0A 2C99A 5IHPA 1A2BA 2WJJA 3PEVA 3ZS8A 1KI3A 2C77A 3B1YA 1TMKA 3QKSA 2AR7A 4LV8B 4P31A 4B47A 1M1YE 1AJEA 3H1TA 1HT1E 4XD7D 5AJZA 2EVWX 3OE7D 4TMVA 3WNCA 2KBFA 1TQ2A 3LAWA 2IS6A 1VYVA 4ASUD 1SHZA 1OT3A 4PSAA 1KSFX 2ZJAA 4LBVA 4B76A 3U7EB 4HUQB 2QU8A 3K9LA 4IVRA 4OQMA 5FPKA 4LYFA 4RD4A 4TZ0A 3UATA 2CCGA 1UDWA 2FFHA 1U2RA 3AVQA 1OB2A 1Z6YA 2FPKA 2VHQA 2W2TA 3EWAA 5KYKA 1RRPA 2WV9A 3LBHA 1CR0A 4A36A 1MV5A 3MSXA 1ESNA 2ZJ5A 4PAQA 1E2KA 3HP1A 4DBLC 4G5OA 4B75A 2XB2A 3BOSA 1Q1BA 4JLNA 3O8RA 3O47A 4WXRA 4DSNA 1UF9A 1YZLA 4IEIA 4AG6A 4EJSC 3IBGA 4MGZR 1OFHA 2H17A 5FOTA 1XCGB 2XEXA 2CE7A 1A5TA 2RMKA 3D3QA 2QN6A 2WZQA 4DLSA 1KK0A 4WA7A 3TLXA 4XTRA 3KZ1E 1YR6A 3SC3A 3AVUA 4M22A 1G1MA 2FG5A 3CR7A 3WNDA 1U99A 2REXB 5EQTA 3OAAD 4NMMA 1IN4A 1N6KA 3HR7A 3N2EA 2H5EA 3T1OA 3KDSE 2EFGA 1KK3A 1VECA 1ZM3A 4KV9A 2FFBA 1AA9A 4Q19A 4G01B 4B3GA 2ZJYA 3DZ8A 4PSKA 3THOA 1SVKA 4MDEA 1IY1A 1MR3F 2YHSA 5E95A 2F9MA 1EFTA 3SBDA 2ZI6A 2ZI5A 2ECKA 4LI0A 2ONKA 3KB1A 2CDNA 3ZVRA 4TLCA 2P6NA 2O0HA 1E2EA 2GVZC 2F1IA 2YWGA 2ERXA 3Q8XB 4NE2A 1IOZA 1XJ0A 1UM8A 2FPMA 2GF0A 4D4MA 4BPBA 1QHHA 4DLXA 4HEJA 1KJZA 2HYDA 3QKSB 4EQ6A 4QOSA 2WHXA 3LFUA 3QSYA 1IAQA 4G5GA 3BFKA 3RWOA 3B1WA 3BORA 3DZDA 2UVQA 5KPDA 1UKYA 1DO0A 1IHUA 4B6EA 1T3SA 3IILA 3MUFA 4IXMA 2GCOA 3KUCA 4MYUA 3CRQA 3Q72A 4G5QA 1RJ9A 3FB4A 1HQCA 3PG5A 2R8RA 2YYZA 1Z2AA 221PA 4W7SA 1XZQA 1XEFA 3P32A 1JPJA 4FINA 2R6GA 5GJCA 1KZ7B 2C2HA 2BKEA 1HA3A 2YJTD 2ZTSA 4YQFA 2QM7A 2BMDA 3QXCA 1LW7A 1G19A 1R5NA 3QXHA 4MQBA 2BVNA 2F6RA 5TY0A 1SXJA 2FN4A 4JVLA 4ABYA 1P9WA 1OH5A 2NZJA 4PZLA 3IO5A 4M1WA 1FTSA 2OT3B 4EKDA 5FBQB 4WZBE 2GK7A 1GRNA 4PZYA 2CK3A 1MKYA 1QHSA 2OHFA 5FPYA 1CJTC 3SQWA 2GZAA 5FTMA 1DAIA 4AY2A 3BFXA 1N6OA 1NMZA 4NH0A 2AFIE 3AVYA 1E2HA 2IF0A 3CPHA 1CXZA 1HY3A 3PENA 1JQLB 3UK6A 4BQSA 1SKYE 3AKEA 3WRXC 721PA 5JEDA 1N25A 3R8CA 5EP1A 3WYGA 3TJZA 2HF9A 4ZDKA 1R8SA 4UXHA 3MJRA 1NMYA 3LXRA 5F2EA 4PHFA 3T1VA 2AK3A 4B3DA 3CPJB 4NYIR 1H8HA 4JLKA 4DEXA 4LV6A 1QHYA 3GLFE 1E6CA 3RRYA 2HT6A 4KLNA 2D2FA 4RFVA 2GF9A 3U5ZB 2R2AA 5JCPA 1NBME 4LV5B 1ZVQA 4WAUA 2R6FA 2YC4C 1CIPA 4K8OA 4E09A 2JLWA 1E96A 1DG1G 2ZS9A 4NCHA 4A4DA 3K70D 1GM5A 1EWRA 1JR3A 3BJIC 3W3AA 1X86B 1H65A 1VIYA 3H0KA 1PJRA 1SXJD 1VYTA 2GNOA 2DY1A 4O3MA 2XXAA 1E2DA 5DYGA 2DWQA 1QHHB 1X3SA 2ZJBA 4KFRA 5EP3A 5C46F 4EQ6B 1A4RA 1CF4A 2LKCA 5F98A 5FOUA 4B43A 4QNRA 2CK3D 2EYQA 3AVOA 4MH0R 4Q5IA 5L3QA 1NLYA 4F38A 5GJBA 1MOZA 2WOOA 1G8FA 1GRRA 3K53A 4KBFA 1X1SA 3W6NA 2ZEJA 4L9WA 2E1RA 4CDGA 2GCOB 3HPQA 4Z8YA 2J1LA 1RJ9B 1OYWA 1YQTA 2G1JA 3NHBA 4C0KA 3RABA 4Q9IA 5ANRB 4BRUA 1LF0A 2VQSA 5F3WB 5FOSA 2IXFA 4CEJA 4BLRA 1W0JA 2EFEB 1LVGA 3RS7A 1N6NA 4M0LA 4G3XA 1JI0A 1AS2A 3GJ0A 5G53C 1GTVA 1H8HD 4ZPXA 2QT1A 1RFLA 1NJGA 3AP1A 4GP7A 4IVPA 1SXJB 1ZD9A 4N1AA 4D4JA 5H8WA 3AP3A 2VEDA 5GADl 2JLUA 2ZSDA 121PA 2D62A 2XOKA 1ZYUA 5EXSA 4DKXA 4MKIA 4GI7A 1UBGA 1W4BA 4DZZA 1P62B 2BBTA 1Q1EA 3KUDA 4TZ6A 2ATVA 2AWOA 1JR3D 821PA 3T35A 5SZKB 2IYVA 1ZM9A 1EESA 3CRW1 5DHAA 5FBWB 4PX9A 4OK6A 4AIIA 4HZUA 1U94A 3P4YA 3F0TA 1II0A 2QI9C 2ZE5A 3QUSA 1ZC3A 1L7VC 4EPWA 4Q02A 2NO7A 4IJMA 4B35A 3IHWA 3DEFA 1FQJA 5HR5A 4BFVA 4B32A 3MJHA 1J90A 3GEIA 3D8BA 2F1HA 4FCVA 1R8QA 2ZJOA 3Q5EA 2GILA 3PEUA 2ZR0A 3VU9A 2CHQA 2A5FA 2WKPA 4H9GA 1W0JD 1W47A 3BWDD 2ZR7A 2NIPA 3LX8A 2IT1A 2WJHA 1U90A 3TUJC 4Q1FA 5J5CA 4I1SA 4F91B 3NIBA 3SEAA 3PEWA 4HB2A 4GFDA 4PO9A 3VR1A 1YU9A 2OBLA 4QGFA 3HJNA 4OHXA 3RC8A 1TU4A 1F2UA 2ZI7A 2XOKD 2PEZA 3LY5A 4A8JC 5GVRA 2GKSA 3RC3A 2H57A 1K6MA 2HDNB 4GL2A 4LYAA 1UFQA 5L3QB 1XJCA 1FP7A 1T6NA 1QHXA 1S0UA 4RD0A 1G64A 1WQ1R 1XMVA 1DAHA 4UNNA 3LWNA 3GJ5A 3FHOA 5DIFA 1ZNZA 4QBFA 2GZHA 4ITRC 4X8MA 4D4KA 4LJ9A 2AN9A 1MO6A 2R44A 4JLJA 2D06A 1HTWA 3IGFA 4GOJA 2W2XA 4TTPA 5AJYA 3LXXA 2IYSA 2ZRDA 4CEJB 3IHLA 1KAOA 4NYJQ 2OM2A 2D2EA 2PX0A 1D2NA 1Q3HA 4FMDB 1SVIA 4Q01A 1DARA 1Z63A 1FL9A 3WNBA 4P4TA 4BLOA 1TX4B 3G82C 4US1R 2QTVB 4IOLA 4C0LA 1EK0A 2BOVA 1VCMA 2IYYA 2ATXA 3QXJA 3C41J 5CLLA 1CBUA 2ZSAA 1XCPA 1NVXQ 3QBTA 3LLUA 4D82A 4JYCA 4A9AA 1HURA 3QKRA 1N6LA 4TQAA 4B6FA 1IY0A 1DAKA 4ZIRA 1VCNA 4HZUB 1P2SA 3QF4B 4IOKA 4MUBA 2V6IA 3KQHA 4QM6A 3A4NA 4KAXA 4GNKA 4PPFA 4DUGA 1IN6A 2OXRA 1G3RA 2N46A 1XMSA 1XWIA 4KSBA 5BN5A 1DADA 4LJ6A 4BE7B 1P9NA 1Z0DA 5FTNA 1FMLA 4ZCIA 4I1VA 2QG6A 4D26A 2QP3A 3VU9B 2GEUA 3C16C 4PC3A 2HXSA 2RGXA 1JNYA 1Z29A 2XTNA 4HDOB 1KJYA 3MWKA 2BMFA 4C2UA 2BBSA 3QPVA 4TLBA 1Z47A 3R7WB 4DLRA 2XGJA 1NVVR 3IUYA 4HAUA 2ZJ8A 3I72A 3MMPA 3K09C 2CL6X 3C5CA 1M7HA 2NOAA 1YRBA 1F2UB 4Q4AA 5DO9A 1Z2CA 5FOVA 3H84A 3VR3A 2FMXA 2JLRA 3W5JA 1JJVA 2CVHA 2K5UA 1FFHA 4UKDA 4IHQA 5FR1A 3U44B 4V0MA 1WBBA 1NBMA 1P3JA 3SYKA 2A5JA 3A8TA 4P32A 4LJ4A 1NJFA 4DLWA 3DPUA 3CR8A 1KO8A 2C98A 3RRNA 2AKYA 3NBZC 3VQTA 4HAYA 4DUGD 3LX5A 1JPNA 3C8UA 1A82A 2YOFA 4OK5A 4RD1A 1E2FA 2WJIA 5UKDA 4Z8XA 3SYNA 1BOFA 2VPPA 4Q1EA 3RHFA 4ESVA 4R2IA 2B92A 4B74A 3ZH9B 4MDFA 3R8FA 1XX6A 4QHYA 4HAWA 2HCJB 2XTMA 2JLVA 4PHGA 4DSTA 4CEIA 4PHHA 3VKHA 3M0EA 1E9FA 4NBSA 3VFDA 1JQJC 1T9HA 2RGDA 4KYUA 4FCTA 4M21A 2A5DA 2FF7A 2GXUA 2ZREA 2ZU6A 3QKRB 2CLSA 1XDBA 4ZIRB 3V4RA 2BJWA 3FMOB 4CYMA 2A5YB 5LB2A 1BO6A 1K8RA 4JLBA 1W1WA 1ZU4A 2QPTA 3DVLA 3E5HA 1I2DA 4Q4JA 4TSFA 3OEED 3DMNA 2JASA 4DJTA 3KQKA 2HF8A 1G8PA 3CIOA 4AURA 1T4GA 1T5IA 3T34A 1XEWX 5G3YA 4OKSA 5FUYA 3N2IA 2FSFA 1NBMD 2FZLA 4LCBA 5KTYA 4LJYA 3T06B 3CM0A 4OK3A 3MWYW 2QORA 2QQEA 3IEVA 2A5GA 1S4QA 2GRJA 2XJ4A 3L2OB 1IN8A 2ZE6A 3LDAA 2ZE7A 1QRAA 4CT5A 3B9QA 2FJUA 1LFDB 3NDBB 4HLUA 1E2PA 3E1SA 3MWJA 2QP9X 3QQ5A 3VHLB 3GQBA 5DI3A 2QTFA 4Q4AB 5E7IA 4E22A 5JS8A 2O8CA 1KO4A 1W44A 2RGEA 1Z6TA 4URUR 4AYWA 1E69A 3NH9A 2ZRNA 5B2ZA 3PITA 2BC9A 3FKSA 4QKQA 2ZRLA 2LCFA 3EIQA 3OIVA 1MABA 4ZI2A 1IN5A 1KMQA 2Q3HA 3P26A 3JZAA 3RYTC 5IRCD 4AKIA 3JZMA 4QJ4A 5C4MA 4D0GA 4Q4HA 1W4AA 4FMCB 2BBOA 4QGAA 1TEXA 3E2IA 1VG1A 3B1VA 3RS0A 3SQXA 2MSEB 2ZRCA 1QHIA 1QG4A 5JEEA 3CZPA 5M04A 3F8TA 4M1YA 1NSFA 1OIXA 1U0JA 2OAP1 4R7ZA 1Z0JA 2KWIA 3TVTA 1EXMA 3G5UA 5EP4A 2PH1A 5JI2E 1QZXA 2P6UA 4DIDA 4WIAA 4B3XA 4QM7A 4CEIB 1AN0A 2REOA 3BB4A 3UKDA 2VH5R 1P2TA 4XIGS 4AKEA 4M9QA 1G20E 3EW9A 3PIRA 3KX2A 2DBYA 3WBKA 4LOAA 3VMFA 5FBRB 5BN3A 3P27A 4BLQA 1DE0A 1E2IA 3FMFA 2OCBA 1OXUA 2GETA 5J47A 3SFZA 5LD2B 2GK6A 5SZJA 3U3MA 1G4AE 2NO9A 2ZR9A 4Q66C 2NZ8A 4Q4JB 2ORWA 1SVWA 3UG6A 5CB6A 2FWRA 2DR3A 4ACBA 2WICA 4IDNA 1SULA 4ARZA 4HUQA 3P1JA 1VCOA 3FKSD 1EFUA 4LBYA 4RZXA 4XOIA 3K0FA 4GP6A 5L3VA 4GMXA 4LSGA 4TLEA 1VMAA 3EX7C 4EUNA 1KNQA 2OSBA 3GJ3A 3I61A 1JB1A 2JLZA 4E5UA 1RC8A 2EWWA 3VR4A 2ZRGA 4WOPA 1IY2A 3W34A 1RYFA 5H68A 4ACAA 4IXNA 2J0SA 1MRSA 1YZQA 4ZV4A 1XFAA 3QOFA 2QUZA 3U60B 1ZJ6A 2PJZA 4KVGA 1N0WA 5DI3B 1R0WA 5FI0B 1AS3A 2HJGA 4LBWA 2Q9CA 4A0GA 4RY2A 5EE5B 3R9WA 2O8CB 2N1BA 3UWOA 4GZLA 5KPJA 4BRWA 1W46A 2R62A 2QMEA 4NCJA 4NHOA 1JR3E 1EG7A 4AI6A 1PV4A 1MABB 2GDJA 3WHLA 1W2HA 3SJAA 3T5DA 2X1VA 2VSOA 4KVAA 3B82A 4RD2A 1GVNB 3L82B 2QY9A 4Q4HB 4DSUA 2VP5A 3W5IA 4ZDWA 2IXGA 4KODA 3A1UA 3TR5A 2OFXA 2V8OA 1N5KA 1KY2A 3HYRA 4YONB 2VHCA 3EWSA 4MRNA 2DWPA 2GAAA 2QRNA 3GEHA 4DSOA 2CMKA 5HKKA 3B1ZA 3OIYA 1PLKA 4C0QC 1XXHA 4LRWA 1GITA 2FOLA 3B78A 1AK2A 3RSLA 1RYHA 5FTLA 1AKEA 4FWTA 2VRWA 2ZUBA 4NCKA 2C96A 1G7TA 3FE2A 1X8LA 1DAFA 2GHIA 2QM8A 4HB3A 3EC1A 4DC9A 2QL6A 3OEHD 1BMFA 1W2GA 2FFAA 1JAHA 2NQ2C 3AGPA 3CX8A 1NY5A 5KNDA 1DTSA 1R0YA 3NEYA 4NU0A 4KXFB 4TYYA 2ORVA 3VKWA 1S1MA 1JALA 2GJ9A 4GSYA 2NG1A 4Q00A 4BFZA 3HU2A 4FIDA 5HE8A 4CT4B 1Q1ZA 4BLSA 1TAGA 5J4KA 2OXCA 1E79D 4IDHA 4TT3D 4JMPA 1G17A 2V7QA 1W4RA 1NIPA 2WMOB 3VTKA 1KMHA 2WBLC 2QTHA 2WAXA 1U9IA 2YVUA 3FPAA 5DGXA 5CIQA 4B2PA 1N5JA 4M9XA 5JRZA 1JBKA 1S3SA 4C30A 4XH9B 4ARZB 2OZEA 3AF4A 4AYTA 4NYIQ 2ZRHA 4X8LA 3TSWA 1CKEA 3K0FB 3GJ8A 4Z1MA 1V43A 1Z08A 4LUCA 4MYHA 3F3YA 5FL7A 1FW6A 2W83A 1P4SA 4YMUA 3D7MA 3BS4A 1XPRA 4HI0E 3NKVA 1XBTA 4Q1DA 4ON9A 3EZ7A 1E9DA 1Q0UA 4DCTA 1XD2A 1XTQA 5EJEA 1G3IA 5HKKD 1GDDA 4A0FA 4D80A 2W0MA 1HEIA 4N3NA 2C04A 5IT5A 1GNRA 2KJQA 1NN3A 3KB2A 1JXMA 1J99A 4ZCMA 3K1JA 3QIAA 3RS4A 3H4MA 5L8VA 3AUXA 3GLIB 5HE9A 4KI0A 4JS0A 5CYOA 1QHGA 2FV8A 4C0BA 1BMFD 4PC2A 3RRMA 5AWFC 1KSJA 3MG9A 3THYA 3CNNA 4B73A 3CWZA 2WM9B 2KB0A 1KK2A 2QROA 4W5WA 3DHWC 3VX3A 2RH5A 2QGNA 4IOMA 3RRZA 2ZSFA 1BYUA 1BH2A 4QGGA 4TTQA 4FMCF 4RFSA 4CEHA 4MGKR 1Z5ZA 4B3BA 4UQOA 3RLFA 1DEKA 2JJ2A 3ZD7A 1XXHB 3CRMA 4POAA 5G3ZA 5J4YA 4JVMA 4CW7A 4Z1MD 4OI0A 5FL7D 1EFCA 4PANA 1OF1A 3GJ4A 4IW3B 3P20A 1W4CA 4PAMA 5KDDA 3FOZA 4P33A 3IQXA 4Q7JB 3BAFA 4DCVA 2WJGA 1LNZA 2B7CA 3P4XA 4BFSA 1E99A 4QHTA 4LZZA 3UMSA 1Q21A 1WA5A 3SJZA 5HPYB 4EJSA 4JBXA 4ILEA 3AH8A 4FMBB 1G21E 1IJFA 2IYRA 2ASEA 1KMHB 3ETLA 3HPRA 3KKQA 2P3SA 4BFUA 3LNCA 1R0XA 4TMTA 3U3JA 3CO5A 2X19A 4WBSA 2ZRAA 4OI1A 1PZNA 2H16A 3TQCA 1PLLA 3WBJA 2WWFA 4IDPA 1P75A 1Z8FA 4JKYA 3X1YA 1T91A 2EFDB 2P5TB 2ZAMA 4A0HA 3ZVNA 3OIWA 4F92B 1J8YF 1XB2A 2REBA 3A1SA 1O87A 4Q4LA 5DLQC 3PJRA 4RCZA 1HT2E 5JI3E 2Q9BA 1XD2B 2JJ2D 4BFXA 2QMOA 3F5FA 5LBIA 2CCJA 4DB4A 5CJ2A 5F9FA 5FOWA 1ANKA 5FPTA 5JHGB 4Q47A 1W36C 1E9CA 4MYCA 5AUQA 3NHAA 4HLQB 2ANBA 2ZYUX 2Z0MA 1AM4D 3LLMA 2AD5A 2AHOA 5AJXA 2BM1A 3LBIA 2QAGC 1NSTA 2ORIA 1N0VC 2Z5FA 5KDLA 3U3KA 4HUTA 4Q03A 1QVRA 3LV8A 4TL8A 1H8EA 3THYB 5EE1A 3V9PA 2ODNA 1YZUA 1MH1A 5CJPA 2PCJA 1JECA 3AM1A 2ODBA 1M6NA 5JJKA 4FW9A 1G5RA 4N0EA 4Q7LA 3VHXA 3TGPA 4RFSB 1J70A 4CEHB 3BH6A 3GLHA 3QG5A 3WYFA 2YZ2A 3FYHA 2ZVQX 3FGNA 4MKGA 5DYIA 4QBHA 3T61A 1MRNA 4CRWB 1NNEA 4DLTA 2J0VA 4KYIB 1I4TD 1GIAA 1XZPA 3AUYA 2PZGA 4V0ME 4BEBA 1S96A 3IIKA 1JEEA 2PZFA 3EASA 3MAAC 4OI2A 2ZS8A 2J87A 3ZS9A 2A78A 4EPXA 3EC2A 1ZBDA 2H18A 3Q3JB 5DI9A 4DCNA 2IF2A 3I1FA 4PAOA 1T5LA 5TMPA 4UNSA 5AJWA 3PVSA 2B21A 4IVQA 3FWYA 2LKDA 3FKQA 2G6BA 3FHTA 1TL7C 2J9RA 2D74A 3TVDA 4EJSB 2RGGA 4E07A 1Z0FA 2CL7X 2DB3A 2ZI9A 3AKYA 4NL4H 1G7CA 2RB4A 3TH5A 1E2MA 5K8UA 1ZAKA 2JJ1A 4DEYA 2IC5A 5EXTA 3CW2A 1ESMA 1VIAA 1H8ED 3QEOA 4OQFA 1WBDA 1FTNA 3KFVA 3L0SA 3SI7A 5HZHA 1F60A 1NIJA 1M2OB 2RGCA 1GSIA 1Q44A 1KSGA 3REFA 2ZIAA 3FHCB 5FFMA 1TUEA 3B5JA 3SNHA 5JSZA 3CF0A 2D7CA 1TEVA 1II9A 3LQQA 2G3YA 4BFWA 1DO2A 1SVLA 1XD9A 2RAPA 1WF3A 3QKTA 1TPZA 1NVVQ 1XPUA 1OFIA 4FXPA 4M1TA 1GKUB 3QF7A 2EWVA 3U2QA 3ICEA 2ZSEA 1E0JA 4M53A 4KU4A 5EUQB 3GLGA 2WJYA 4BFYA 4BASA 5E7JA 2ONJA 4I99A 3PXGA 4YMTA 3K9NA 4H1VA 5E7MA 5CITA 2HYIC 5IK2A 1R6BX 2XSZA 2ZE8A 2ZU0C 1OIVA 3MFYA 3NWJA 2IL1A 4QFMA 3L0OA 1G4UR 3KKOA 3QF4A 1ZIPA 2WWWA 2C9OA 2IUTA 4YMWA 3J81k 2PL3A 3CH5A 4OQNA 1HQYE 1BYIA 4JLDA 2EYUA 4X8OA 3UPUA 3GLHB 1KI9A 2DFNA 1ZU5A 2H7VA 3ECCA 3I5XA 4J0QA 3U7HB 4D25A 1C4OA 2IK8A 2J7PA 2JATA 2JJ1D 3EZFA 4JJZA 3RAPR 2P65A 5TB5A 1IJEA 5CIWA 1U8YA 2N42A 3ND8A 1Y3AA 1IONA 2ZJZA 4GRAA 1N6HA 4TWZA 4B33A 3LH5A 1R5BA 2OO7A 3AVVA 3L0PA 4WZ6A 4B3CA 4LJAA 2G0NA 4LK2A 4O2LA 3R7WA 1Z6GA 4HB4A 1G7SA 4QL3A 2YWEA 5JZVA 2RHMA 1U81A 1OKKA 2ZQ5A 3NVAA 3NBYC 3A4MA 3D6TB 4JLOA 2RGAA 3JVUA 4QBGB 2WMNB 2QA5A 1T0JB 4E03A 3EPJA 4XVUA 4MGIR 1GNQA 3IPYA 2AD1A 1N5IA 5B57C 2QAGB 2NGRA 3PUWA 2B8WA 3CRRA 4MA4A 4AKHA 2BEKA 3CPEA 4YMSA 1U8AA 3CNLA 3U44A 4LYHA 5IK2D 2XSZD 5CB8A 4HLCA 5EZ6B 4G1UC 3GD7A 2F55A 3GFTA 1S3GA 1L4UA 4AKGA 2HLDA 2C9CA 4HATA 5DNYB 3CF6R 5F9HA 3TBKA 2BCGY 1E9EA 3K0CC 4UNRA 1E9SA 4CGZA 1Q12A 2CNWA 3VR5A 1P6XA 5JSZB 4NTZA 1ZRHA 4P4UA 4WXPA 4XWAA 2J7PD 1SGWA 1XTKA 1PUIA 2I1QA 1W48A 4LWZA 1L8QA 1NVUQ 1GZSA 521PA 2PT7A 1YZTA 1MO4A 2FSIA 3UMRA 4URXR 2WSSA 4B2LA 1L4YA 4NZYA 3BC1A 2FDCA 4DCSA 2XB4A 3C7KA 1E2JA 1ZD1A 2OG2A 3GLGB 4ESHA 1UJ2A 4WVFA 3RS3A 2GAOA 2ZETA 4AC9A 3A1WA 2CCKA 4PPQA 5KO2A 2IS1A 2Q0HA 1OKKD 2GCNA 1A2KC 1E2QA 4D6PA 4A8JA 5EE9A 2V1XA 3ADCA 2OILA 4LJ7A 4DDVA 1YR8A 3RS5A 1T3LA 2O8DA 3VR6A 4LPSA 2YKGA 3EPHA 3GLIE 3W3ZB 2R6DA 2P67A 2NPFA 2BHRA 1J8MF 4M1SA 3TUZC 1XMIA 1RIFA 2H92A 3EXAA 1WP9A 1VCIA 1W49A 1UKZA 1KGDA 3ZZTA 4JLPA 3AKDA 2GBLC 1N6IA 3CONA 5TXGA 3ZLJA 5JLJA 2HLDD 4JJKA 1ZNWA 1M74A 2PZEA 3EIHA 1S1CA 1CRQA 3CNOA 1FX0B 1S8FA 2J59A 2W6IA 5TDHA 2CNWD 3U3RA 2XZLA 1B23P 2YNMA 4PQRA 3PQCA 1VYUA 2SHKA 3NTUA 2A7QA 1Q22A 2GJKA 3B6EA 1XXHE 2NO1A 1CULC 1Z6XA 5SZIA 4BZPA 1M7BA 1EWQA 2W00A 4RVCA 2GXSA 1P73A 2R6CA 2WSSD 3R9IA 1GUAA 3RVBA 2XNDA 3U6KA 3K9HA 2XTZA 1U0HC 4LC0A 3A58B 4F4CA 4B48A 3U7GA 2PMDA 1NN5A 3CZQA 2NTYC 1CU1A 1KJWA 1VG8A 2A30A 3Q7QA 5FUVA 2GJ8A 4C0JA 5JWHA 4PZZA 2V4ZA 3NH6A 2IWRA 1OSNA 1NMXA 5BXQC 2PEYA 3FTQA 2IA5A 4A0RA 3OFNA 2AFHE 1BKDR 5HCNA 5EUMA 2BV3A 4HAVA 2O8BA 3C5HA 4QBIA 5BYKA 4O0MA 4TYNA 4PHTA 2Y8EA 3PEYA 2OEPA 1P72A 3I32A 5CDFA 3GP8A 1HE8B 1FP6A 1ZD8A 1ZW6A 4Q1AA 2FA9A 2DFKB 3KL4A 3QENA 3A36A 4FI3C 4F4IA 3CF2A 4BEJA 5P21A 2GBLA 4F93B 2B8TA 3K8YA 2F1RA 2VHUA 2BKUA 4PTLA 4ZO4A 3EA0A 4KCGA 5L3SA 1KDTA 1UDXA 2AX4A 2V6JA 3ZGXA 2C78A 4PO8A 2AK2A 2FGKA 3I8SA 1R5OA 3L43A 1R10A 2W6ID 2VF7A 3SFVA 3K09A 1Z28A 3PV0A 1WDTA 4QG7A 4Q7KA 4PFSA 5IDVA 3KFXA 1LTQA 4EFMA 3SN6A 3OZXA 4LJ8A 1VPLA 4MRSA 4A8JB 2MSCB 5KOYA 4R9UC 2O0KA 2FNAA 2PX3A 1RRFA 1S2MA 4JZKA 5C18A 1XPOA 3SU8A 1T3HA 3ICQB 1CEEA 1K5GA 1O3YA 4I1UA 4OHWA 4US2R 3I5YA 1L2TA 1XTRA 3BGWA 1DAMA 5JS7A 2VTKA 3CRVA 2O8DB 1CRPA 2E9SA 1E94E 3LW8A 1M7GA 2Q9AA 4CF7A 4W5JA 1QBKC 3DOFA 1HV8A 5KNBA 1N0UA 2RGNC 3GPLA 1KI7A 1E9BA 3BE4A 5FTJA 4EPVA 1E0SA 3OFND 4FWIB 2C9YA 2IHYA 5HTKA 2WAYA 2JIZA 4AWXA 3WRYC 4I4LA 1KIMA 3KQNA 1RE0A 3THXA 3IKJA 3U4QA 1OH8A 1P61B 1IN7A 1E1QA 2JLQA 4LHYA 3EIEA 4UXIA 1W5SA 1Q1QA 1NG1A 1RKBA 1HE1C 3GJ6A 3KQLA 2FZ4A 1OFUX 4GOXA 1XJQA 2X77A 4C7OA 1UBCA 3QBVA 2ZJ2A 4XJXA 4TYWA 2J45A 4NYJR 1F48A 1OXVA 2BM0A 3AEZA 3TW4A 1ZINA 1KDPA 2WVJA 1S9DA 1VHTA 3UMFA 2EU8A 4RD6A 3SJCA 4BLTA 5C1BA 4XWOA 3ZIAA 2I1VB 1Z3IX 1EFRA 5AK0A 2O8FA 1GRQA 4GZMA 1Z07A 3KTAA 2IW3A 4KFUA 4JSYA 2O8BB 5EXPA 2DFLA 1CJVC 2X2EA 1M34E 3QE0A 2CEAA 4TSFD 3AV0B 5A0FA 1KI2A 2WIBA 1CJMA 1ZCAA 1ZUNB 4XTCS 2I3BA 4P0TA 1KKLA 3K0AA 1FOEB 1XF9A 1GKYA 2CHVA 1RZ3A 3T12A 2OCPA 1ZNYA 2QE7A 1NRJB 1C1YA 2BWJA 1F3OA 1XTSA 4GPTA 5L3SB 2GZDA 2WPDA 1KTVA 3HYTA 1W0KA 1E1QD 3UANA 4ZCLA 4G5RA 3TKLA 1OFTA 3NG1A 3X1ZA 2FGJA 4JL5A 4TLAA 2L0XA 4DXAA 3A6PC 2A9KA 4GOKA 3B9PA 3NDPA 1GOTA 1YKSA 4MRPA 1NI3A 4JVSB 3C4JA 2G0TA 2QAJA 4V0OA 1P60A 1XU4A 4MYTA 1W7AA 2QNRA 4AG5A 4TL6A 4Q9HA 1BS1A 3IO3A 3IPXA 4WW0A 5L3RA 2ZXUA 1N5LA 4JLVA 3RDPA 3ZIAD 1G8HA 3E70C 5DN6A 1EFRD 5CLQA 1CTQA 4C0AC 3T1TA 1J7KA 3LW7A 4JT4A 4R98A 3RANA 2QQ0A 3VNUA 5AJVB 3THXB 4PO1A 3UG7A 2PMKA 3U4QB 2VL7A 5KU1A 4TLDA 2FFQA 1UKVY 3GLHE 4LBZA 2GJSA 3DOEA 3B2EA 4GT1A 5DH9A 1G8YA 2ZYVX 2RCNA 2BMEA 1D6JA 1J2JA 2QT0A 5A5GA 3TSOA 2ZM5A 2H8KA 1CR2A 5CK4A 3GLIA 2QE7D 2J41A 1LS1A 2VIIA 5BN4A 4C7OB 4KITB 4OQLA 1DAEA 2WPDD 4RJLA 1W0KD 3PR1A 4Q1BA 1IXRC 1GWNA 2C03A 1KI1A 4JBWA 2OE2A 2QMUA 4GMDA 4ZDJA 2JCSA 2QP4A 5FBVB 4KFTA 1K5DA 1LV7A 2YINC 3THWA 1YR7A 4OJKA 1TUIA 2OESA 2O8FB 1SZPA 3IIJA 2ZAOA 3R20A 3KTAB 5BYJA 2BIFA 3GMTA 1NLFA 5AUPB 2NMVA 2ANCA 3U7FB 4HSEA 3FMPB 2QPAA 3AP2A 1QF9A 2HEIA 4C2TA 3WHKA 2V54A 3LBNA 1JR6A 3K0AB 3N5CA 4OJQA 2IYQA 1E4YA 2OCAA 1WXQA 1P2UA 2Z4SA 5DN6D 1G6OA 5KDOA 1T0HB 1G3UA 1F2TA 5FI1B 3SJBA 3K0EA 3SE0A 2FSHA 4PC7A 4URYR 2W2VA 4XSGA 3ADDA 5J4VA 3EPKA 1Z0IA 1G3MA 1TADA 2ZI4A 2PCLA 4V02A 5D3MA 4BZQA 3QY0A 4M1KA 4XVQA 3KJHA 5TV2A 3ZQ6A 1KZGB 1AZSC 2G88A 4V0NA 1Y63A 2P6RA 4Q1CA 4K46A 4PPGA 1EX6A 2TMKA 1LF5A 3DL0A 3HDTA 1G291 2ERYA 1RRGA 2HXYA 3GLGE 1YZGA 1ODFA 3OHMA 4G5SA 2HCBA 5FBLB 1D8TA 2JJ8A 4JKIA 3VR2A 3AQ4A 1VG0B 5FL3A 3X1DA 3I62A 2WWHA 3MLEA 5CM9C 5KNCA 2WJVA 3IIMA 4CIDA 3DM5A 5K8TA 1G18A 1KO5A 5SZHB 4LGMA 1ETUA 4H1UA 1I2MA 3CB4A 1T8UA 5G41A 4C4PA 5B64A 5B58C 1OB5A 3VKGA 5AUOB 2FSGA 3BK7A 3OAAA 1SQ5A 1OE0A 1FZQA 3LO5A 1VKJA 4DDTA 1TF5A 2DPXA 2ZUDA 5JRJA 3TW8B 1JXOA 1KO7A 3KJIA 3CUEF 4RD3A 1KI8A 2IHBA 1G8GA 2FPLA 2JA1A 2XNSA 3GCGA 3NBXX 2O8EA 3VNVA 2Z83A 3FMIA 4JL6A 2OFWA 3EZ9A 4IDQA 4P3YA 4M9SA 1E2LA 1G41A 2ZRBA 3ADKA 2WWYA 1KY3A 3TMKA 3THWB 4EPRA 2V7QD 1Z83A
chains in the Genus database with same CATH superfamily
4YFVA 1CIVA 3CH7A 3RJMA 2XHZA 3LCCA 4OXYA 2EFCB 4KC0A 2H9YA 5DFAA 2X0DA 2VYQA 3GFOA 2P0EA 1R8JA 3KHUA 2D3TA 5F3DA 4IJQA 1OXSC 1P1IA 3OQPA 3VR2D 3I9V1 3AR6A 5LBTA 3CZRA 3IAS6 2AVNA 3JD2A 1O96B 1EDOA 3HL0A 3E1GA 1VDMA 5DM0A 3O8DA 3QXSA 4HNRA 1NSYA 2C4WA 3O1JC 4R8LA 1F2TB 2F3RA 2R65A 1A9QA 2VDJA 4ZD6A 3TSYA 3WLOA 4QAQA 3EISA 4W7HA 3W6OA 4G8DA 3UTDA 4CQLA 4DB2A 2WUWE 2NXCA 3RF6A 4W5RA 1KDZA 2C3MA 3PA8A 3ZU5A 5D3MB 4FNAA 2FQQA 2JZOA 2GEJA 3NHKA 2C1EA 2ZITA 4A2PA 3O8CA 3JD3A 2C3OA 1I3OA 2VBCA 3H9GA 5KI6A 4PLHA 3R0XA 3AESB 1EINA 4Q05A 1VI6A 1LY1A 3GA7A 4BO6A 3WQRA 1L9KA 3KKNA 1E5VA 1CUCA 2WTNA 3Q9LA 5JANA 1U7OA 3FB1A 2QX6A 4O2AA 3TE6A 4O4LB 1KWGA 1RYYA 1UPTA 2ZSBA 2VATA 1RBZA 1WZEA 1SUSA 2W7TA 3KALA 1P6QA 1PVOA 3I01M 3VYRB 2EKDA 4TTRA 1SK9A 4NMWA 1VL1A 4TVSA 1AZTA 5PNTA 4EOGA 4DLZA 2XIJA 2GARA 3DE2X 3LUDA 4NICA 2X3YA 3JWEA 4X61A 4OVKA 2WKRA 1U8ZA 621PA 3R7DA 2QSYA 4QA9A 5IEJA 4M8KA 3CUTA 1Y7HA 2WSBA 1EYZA 2FW1A 3PD0A 3I2HA 3WICA 4AQ7A 4QTYA 1JEDA 4QC2A 3UAXA 2BE7A 2RI0A 3UY4A 1K7XB 4CKBB 2JIBA 4R83A 5I45A 3MWFA 3FXAA 1YQQA 1QG2A 3PDCA 4RXMA 2P9BA 1S2OA 4ES6A 2EBWA 1GTJ1 1RKXA 1YZFA 3DUWA 2I0FA 5IT9A 4R1SA 4L8GA 2GYUA 2IE8A 4CM8A 3FCYA 3OZAA 3TIFA 4NZZA 5FWXB 2I9PA 3PUJA 2ECQA 4UUAA 3DDCA 3DUFB 1NVWQ 2BGJA 1NQWA 1OU4A 4OSEA 4V39A 1MIHA 2CL0X 2GEDA 1AD2A 2P9QA 2IYTA 2W70A 2OHIA 4ETIA 1U28C 1U9YA 1QP8A 3ENKA 4Y6SA 2QTLA 3OESA 4NONA 4BO3A 3E48A 4BWYA 4F8JA 3EXIB 3V1YA 3CH6A 4JNCA 1E4EA 1J4AA 1H6BA 1CQIA 2C1XA 3GFBA 3IA7A 3QLJA 3Q15C 4NPAA 1RPZA 4Z9BA 4IDEA 4PX2A 3KEOA 3SF8B 1XWWA 2BM9A 3A25A 4ZT5A 3ASVA 5K8IA 4S1TA 3AF3A 5EY5B 2WJPA 4US0R 2GZ2A 3UW1A 3FETA 5G0VA 2P79A 2QD2A 5CDGA 4DPMA 4ZCTA 2PFGA 2CHGA 1ZWKA 4EI7A 3DO5A 3T38A 2ODPA 4RKYA 3VNQA 1FTQA 2XZPA 2RH8A 5GJVC 5BSVA 3IQDB 1E32A 2J3KA 5IF3A 1DMSA 4FTWA 4HXEB 1OHHA 2CUZA 2EF0A 5FTKA 5KKAA 3VH1A 3D6JA 4XYEA 4A92A 3QUQA 1GN8A 5EUBA 1X0VA 5CDFE 3SIPA 1ZDMA 2RGBA 4B2IA 5A4MS 1QFYA 1XCMA 2E6KA 2KI5A 3CLSC 1KR2A 5F78A 4QXAA 3W9UA 5HTOA 4B6OA 4G24A 2BN4A 4YY3B 2PR7A 4DRXB 2VR1A 4LC1A 1GL9B 1CNMA 4C5AA 3EBOA 4C6TA 2GPSA 4ZO6A 3IEKA 2MT9A 1Q16A 2Q6OA 3TG8A 3IMEA 3AGQA 4B9EA 4YR7A 4AYXA 4RTOA 4R8KA 1JDUA 4MVJA 3C7CB 3F3SA 1UEJA 2J4FA 4TYQA 1OW3B 4UUPA 3F47A 5FUXA 3SHQA 5B58T 2GAIA 3NEAA 4KSCA 1M2HA 2W4IA 4M0MA 3SNKA 3RV4A 4ZAYA 1P39A 5ALNA 4CKCB 4FN5A 1FP4B 2FWNA 3IP8A 2YRWA 4ND2A 3S2GA 1JF8A 4XLTA 2IYUA 3U5TA 2FH5B 1UINA 2FE4A 4DCMA 2CJWB 2XT6A 5BSRA 1M6YA 4F1KA 3SHVA 4YRNA 1DDIA 5EHNA 3ITNA 3SZLA 2XUAA 4DVGA 1R88A 1QVAA 3ROPA 1TIPA 1KAGA 2DOKA 2QX7A 2QENA 2Z9CA 1W6RA 3H5AA 2GJAA 2Q3DA 3NT4A 4JLSA 4KK4A 1U2ZA 4K9MA 5D8DA 5G2OA 2PWYA 1TJ3A 4MLDA 5LP6C 4BIMA 1JXAA 2HJVA 1JE0A 4HEA1 5SV2A 1OHHD 3DOUA 2FX3A 3K6SB 1ZHOA 5I7OA 1RCTE 1Q0ZA 3HG7A 4HQFA 4XRGA 1BXKA 2O0LA 1BQ3A 1BIFA 4XFDA 5B7NA 3K70B 1XD8A 5D86A 1W1UA 2A4KA 4G1MB 2W5UA 5JY6A 1QTNA 3ASYA 4BATA 3DH0A 1PJAA 3V1TC 4BV2A 3CH4B 4TYPA 3SDSA 1W9HA 3AUUA 2ID8A 3IVXA 3PP8A 4OSPA 4RHFA 3S8YA 1VLHA 2WU1A 2P11A 2BP7A 1JKJA 1KI4A 2NVBA 2IH2A 2ZVDA 1AGPA 1GARA 4DIOA 4DWVA 4MVJD 4HDMA 1P4HA 1ID8A 2NVUA 2A3RA 3HZOA 3KQUA 1Z5OA 4YLGA 2G8LA 2WWXA 6Q21A 1DO8A 4PC6A 5FPPA 1U1EA 2XCUA 5AD1A 4UE6A 3PEFA 1E4VA 1U0LA 1XEWY 4KO8A 1IXYA 2ODWA 3H17A 3M9WA 2IXDA 2W4QA 3DBLA 4Y2VA 1BGWA 3AEUA 3WYAA 3TNFA 2B83A 2R79A 3LHFA 1OIWA 2O2SA 1UEIA 3L9XA 1Z5NA 1SHTX 1DFHA 1XEXA 3KS9A 4Q9LA 3KVRA 5NLLA 4V1CI 1U7HA 1OV4A 2NNWB 1BE6A 2WYUA 3T95A 5FQNA 5JCZA 2XX3A 3UOAB 4A5SA 3A32A 1ZMOA 5THKA 3WWYA 4ZHQA 2NPIA 4RIIA 1ZPDA 1BX1A 2X13A 2YYYA 3I8XA 4IOJA 1GVHA 2J32A 2RK4A 3KYIB 5D2CA 1X8JA 3FWPA 2AXNA 2GEBA 4EPTA 5FORA 1J1UA 3FVQA 3U7QA 3CCCA 1MLDA 5IABA 5A9SA 4FHZA 1GILA 1TO1E 3V2UA 2HX1A 1NGSA 2QD1A 4RTNA 1LU9A 1KDRA 4FS8A 4MOWA 3JQEA 5D7NA 1B00A 1ZP6A 3EZ6A 2D2XA 4MP6A 4ND6A 3B5EA 2ZYTX 3P2OA 3ADOA 3PC8C 1WXWA 4MWZA 1QUEA 2FI1A 2PKXA 1DHRA 1OCEA 4FUQA 4GKBA 4B09A 3NBMA 1AY0A 2NTJA 3AJDA 1WO8A 3C85A 1CF9A 3L7NA 5EEGA 3N6XA 3OF5A 2H1OA 2YV5A 4UHDA 1ZL0A 3GBSA 3KXIA 1IAVA 1FJXA 5GJWC 2AKAB 2P9GA 2W6JA 1YMQA 2BZ1A 3TYXA 5AW3A 4ZREA 1CDDA 4LOLA 5ALKA 5A04A 4WFJA 3SDZA 1A8SA 2QOEA 3JQ7A 2HQ1A 4JT2A 1QQAA 4XUDA 1SUPA 4D4LA 3E6AA 2G25A 1Y1RA 3I42A 4WK0B 3WGIA 3ZI0A 1QGUB 1ORDA 2H31A 1FU4A 1ZM4A 1IM2A 3BCUA 3OZGA 2GPAA 2AC7A 4H35A 2QYTA 3AHIA 1K3UB 4DDKA 3E8SA 4KLAA 4ZVOA 2Y1EA 2G1UA 1G9XA 3E7DA 2D5BA 3VOTA 2EHDA 1BXRB 2C95A 2GBFA 2XGMA 3N2NA 1KSHA 5DW3A 1F6WA 4WT7A 2YN4A 4JYBA 1M1YB 3JARA 3M6MD 4QARA 1U98A 4RY9A 2H6EA 3KEGA 5BUQA 1LC3A 2OV4A 2R1VA 4LXGA 2F1JA 4K8RB 5IAGA 5B2EA 1LBTA 3CZ5A 5J2UB 3H2KA 4W9MC 2IDJA 2GESA 1FLVA 2AYYA 3PFKA 2H9IA 4QUDA 3N2YA 1WCIA 1NL3A 4MR8B 4KPGA 2HHAA 1KRHA 3D1VA 2VSQA 1G5IA 5DTIA 2VCEA 2YWHA 3K0CA 1QAOA 4II7A 1DC5A 4MAAA 4D9NA 5JECA 5IM4F 3VHQA 1T6ZA 3CC8A 4Q93A 3GCWA 4RSMA 3OUTA 1R8XA 4P7JA 1RYEA 1O9GA 2B94A 1LLUA 2RHRA 3HNPA 1MGOA 4I1IA 4K1LA 2W6JD 1N32B 2B20A 1T2UA 2XIQA 4PNZA 1A76A 4J0FA 5CA0F 2OGWA 1V7CA 3V4LA 2Y4NA 4L0QA 1SCJA 3AM4A 3IESA 1NVBA 1NBOA 1FA9A 1SXGA 1Y8QA 4RV9A 5JISA 1EQ2A 1WNTA 1W5AA 2XKAA 3BJEA 2RHBA 1YB5A 4RKEA 5AW6A 1EWYA 1GGNA 3DWIA 1A1VA 2B5WA 1GL7A 3T3PB 3T9BA 4YRBA 1M6VB 2XQGA 1Z4KA 3RUPA 3TQQA 4CPDA 5JMTA 3FIJA 1XAIA 3TJRA 1PQ4A 4G0UA 1HH4A 2OB1A 3CW8X 4URZR 3MMZA 3FDIA 2C5SA 4Q9AA 4BU1A 5KTMA 4EFLA 2OFOA 3AVPA 3QRWA 4BGIA 1ISIA 2DC1A 2H5JA 4B3IA 1ZIYA 1S4MA 1U9CA 2FEMA 4D2IA 1CQWA 4MA0A 4DY4A 4M7PA 5LWHA 3F1KA 1GKKA 4OP2A 1NA5A 4CR6A 4ZZ3A 5ALDA 2H85A 4EH1A 3KRTA 2FPXA 2YOHA 3C7AA 4G0MA 2DRIA 2GXQA 2XMGA 3OO0A 1GQRA 4BLPA 3MT9A 5U1PA 3A6KA 4QNMA 5LD2C 4NABA 3HDQA 2CLKB 1GXSB 1RI2A 2OPBA 3SBXA 2NV2B 3W8FA 4AS1A 2J7KA 3N8HA 1M0SA 1C9KA 4YDQA 1YR2A 4XJVA 4D44A 1TC2A 2A1TR 2ZIXA 1LH0A 1DRKA 3FLAA 2QD4A 3ID6C 4LISA 3T0FA 2NZXA 3SIRA 4Y1FA 4K05A 4X93A 4X85A 5LOVB 2R0QC 5JJIA 4I1YA 4PSCA 3NHYA 4JODA 4HT3B 2LE0A 1XCOA 3EOBI 3RU9A 4W5NA 3DO6A 3U0VA 5DDIP 1Q19A 1KZ4A 4GG1A 4HGQA 1SVMA 5DNWA 4ZO9A 3ICCA 3KBBA 2QVZX 1YBHA 2XNDD 2XQFA 3JVVA 3TNLA 3OFVA 2FWJA 4LECA 3Q98A 1JLKA 2C42A 5BSWA 4M38A 1QVWA 1EVZA 1GADO 1GEEA 1ENYA 1X87A 3LDGA 3N7UA 4D0LB 4FYWA 4ZQEA 3V48A 4FHGA 4YJ3F 2CKDA 2I78A 4D4GA 5CYPA 5JCOA 1ZD3A 3PGJA 1A7JA 3HABA 1DJLA 1DP4A 1NFQA 2DHDA 3IAM1 5AKXA 3KR0A 4AG3A 4WMLA 5AM0A 1SHKA 2P9HA 5ICCA 4MV9A 3T5GA 4ZOQI 5FH9A 2AXEA 2OZPA 5DK4A 2CD9A 5LMCA 3IUMA 4HNSA 4WKPA 3MTJA 1YR9A 4N3BA 5DJ5A 4IZHA 4RZIA 3NHFA 1URPA 5JHHB 3AF2A 4P4SB 1WCV1 2P27A 2OBBA 3F2IA 4LXXA 5SICE 4W9NA 3NM4A 1IEXA 3VZDA 3W04A 2B30A 1QLJA 1RKQA 4PAGA 1ABBA 3ZK8A 1GKIA 3DXYA 4K7JA 4BKOA 2HCRA 2QKYA 3G2OA 3X1KA 2P2SA 5JYDA 3GUVA 1Z7GA 3RTDA 3U26A 1Y3HA 2DLNA 3LQ4A 4FYVA 1SU8A 4LHZA 3W2EA 2AFIB 3ZWKA 4A2WA 1Z13A 4DQUA 1A8QA 4TWRA 1SKYB 4ENSA 4UREA 2FMTA 5HCUA 2JB9A 1E2GA 4XAQA 3W3AH 2DFTA 2QR5A 3V4PB 2G77B 4N8SA 4L5BA 1AS0A 4Y6GB 3TLKA 4HMOA 2QMHA 5HOQA 4J2TA 2RGNA 1V3TA 1E9RA 4QICA 1X7GA 1V8FA 2GSDA 4MVYA 4NBUA 5KNBD 5DRTA 3VVMA 4FOLA 1FDIA 3Q10A 4MCAA 1ZIOA 5J5VA 2I1LA 4BCDA 2A1TS 3ZZMA 1POWA 4DV3B 1XRJA 3BB1A 3BRWD 3HJGA 1FFDA 1DOZA 2P7IA 3ZWVA 3RBZA 3EK2A 2JIZD 2Q3EA 4MMYB 3CSUA 1KY4A 4KHZA 4LYYA 4Q21A 4QYWA 1BFKA 2AWNA 1IK6A 4IDOA 4I50F 1XA3A 3HXTA 4IIEA 4X1YB 5IBPA 4BVLA 3ZCTA 1K27A 3IV7A 1ZNXA 2PL1A 4HB0A 3ONWA 4W5QA 2B6HA 4AJOA 3QI2A 3ZVMA 3SIWA 4YDSA 5AVSA 4RJJA 3ZE7A 1MAWA 5KSOA 1D9ZA 3DZJA 2I2BA 4OMCA 2JI9A 2VHJA 2EZ4A 4GRIA 1R66A 3DA8A 3MJDA 3N8DA 4L8FA 3H2GA 4B3JA 5CIYA 2F64A 5K0JA 4E0BA 4HLDA 3M1IA 3C3DA 1YJBA 1QFSA 1ZK3A 1NOJA 3IPAA 3NTVA 1XRNA 3S44A 3AF6A 2LWIA 3LXMA 2VYFA 1MAVA 2IBMA 2PXAA 4EMTA 3S8MA 1DNPA 2LV8A 1FUUA 2FZGA 5ITSA 5GPBA 2HFJA 2IHVA 1VTKA 1BROA 1GNPA 1YZ3A 2IUSA 3YASA 4QJ3A 3C3WA 4MUNA 1ZCBA 2IIBA 3N74A 3JYPA 1ST3A 3ZVLA 4E13A 2QZ4A 1LBQA 3ABRB 3U13A 2I4NA 1L8XA 3VKFA 1PDVA 2HF2A 3TRJA 2D5IA 2G8NA 2XRFA 4QG3A 3T1QA 3PQFA 1QNLA 1OAAA 1PL7A 3STTA 3AUJB 3JTEA 1K3FA 4CKEA 1BHSA 2G71A 4U1RA 2ZM6B 3WYBA 2HRCA 5CVTA 3BBPA 4UM8B 3MHTA 1JW9B 3CGWA 2DPYA 1R0ZA 4O2RA 1Y1PA 1NYLA 4DV2B 2ZS7A 1TF2A 1AKUA 2G06A 2G5CA 1N2IA 2ZANA 3FA2A 3GHHA 3HYLA 3K7EA 4JFRA 3TW6A 1FFGA 2V7EA 3N58A 1Q7GA 1C3OA 1MG5A 1S9HA 1P7CA 2FUKA 2NYAA 4LN1A 3ZXYA 2ZPTX 3ZHZA 1MEEA 4F5EA 3EVFA 1DPFA 4U02A 2W22A 3CY6A 1M2NA 1G4HA 2F7SA 2WWGA 1NX6A 4MPPA 5DSZA 4IIFA 3RIXA 4IWYA 2XZOA 2BISA 4KE9A 2O5EA 1DJQA 2FX2A 1JDTA 4J7UA 4BE9A 3RRFA 4Q16A 1X1RA 4RKFA 3UM9A 1K98A 2WUGA 1CQJB 3CSDA 4MJLA 3RTCA 1E79A 4TT3A 2HRZA 4KWHA 2ONYA 1IZ9A 1ODTC 2D1SA 4XD7A 2P90A 2POCA 2FKNA 1TAHA 2IOFK 3MD0A 4NQZA 2C5EA 4HX2A 3G23A 4LZNA 2AE1A 2EQAA 4ZKEA 4C9BA 4A7PA 3QEAZ 1T24A 4TSKA 4JSTA 4XIIA 2WWVD 3W6PA 1CS0A 2CN1A 3ZE2B 3UB2A 1MP0A 1G55A 2ZYHA 4XIYA 1Y33E 2IY9A 2C88A 2Y77A 3PHBE 1V8DA 4UAUA 2WU3A 3H6HA 3DBRB 3D8SA 1NBEA 4PCLA 1CNEA 2O2DA 4N3CA 1K2WA 1E1CA 1SXIA 1BFUA 1W96A 1BCSB 1OILA 2CBXA 3CBGA 4KO3S 3MPOA 1OTXA 5MGNA 2BHLA 3W05A 2IX3A 4I9GA 4DKJA 2IYXA 2C8LA 2VQDA 3EQ2A 4TUYA 4IJKA 4CTKA 4ML3A 1U2TA 3L0IB 2V4MA 1R37A 3OOSA 2V1UA 3BEOA 3PRHA 4YI3A 2FWBA 3EGXB 3QVVA 4DNOA 3JAWA 4AX8A 4F12A 5MN5A 4C7VA 1ZW1A 3ISVA 4KIGA 5CCDA 4GWKA 4FEEA 4NKRA 4OG2A 2G5PA 1Q20A 5DXFA 1G8SA 2XWQA 2C99A 3O26A 3VO2A 1D4OA 3LCUA 3L4EA 5EXDA 1AUXA 3KD2A 1DTEA 3PEVA 2C77A 5CLIA 5D84A 3ZS8A 1JU4A 3QKSA 3IT1A 2R60A 3EGDA 3PRJA 4B47A 1G9SA 5FHQA 5CNJA 4XD7D 3HKCB 5C8YA 5G1PA 4AF7A 3GLRA 3G1UA 2KBFA 1T5SA 3R5SA 2QG4A 3MLAA 3NBKA 1TQ2A 1YT5A 3IP1A 1VYVA 3UICA 3ZDQA 3FWHA 1VBNA 2DPHA 2HCFA 1KYVA 5A6SB 3VR6H 1OT3A 5DHPA 4PSAA 5KHLB 2GERA 4LBVA 1TKCA 5LXTF 1H2FA 1NQTA 3GAFA 3QMWA 4C4ZA 4PFQA 1H1DA 4RD4A 3EE6A 4UDXX 1HSOA 5C3MA 4BS9A 3T7CA 3UATA 2CCGA 3IT0A 3BT7A 1W88A 2ILVA 1UDWA 1UFRA 1WG8A 2XMZA 2P9YA 1U0TA 3GFQA 5IXSA 3B52X 2ZB7A 4P5PA 4B4OA 4IG9A 4FOSA 1JFFA 1RRPA 5JNVA 2IHNA 1IULA 5KQPA 5AW0A 3P9NA 2DH5A 4RSHA 4C04A 3ZLUA 2H0AA 1Y9JA 3O4GA 2PE5A 1KWKA 1EQAA 4J91A 3DYVA 4B75A 2XB2A 4R2MA 3VTFA 2WYIA 3KCQA 4IUBS 4JITA 4NATA 5C35A 1XZGA 4AULA 5A71A 1T9CA 3O8RA 3KT6A 2PU7A 3O47A 1SWWA 3OPYB 3BXOA 4HFJA 4WXRA 1UF9A 2C0QA 5EC8A 1YZLA 3IMGA 5DWVA 5IC4A 1PWYE 2FDRA 1ORRA 2P9CA 2H17A 3MLBA 1QF7A 2XEXA 4J0KA 4CDMA 2CE7A 3K20A 3OETA 3RC1A 2RE8A 4ZHSA 5KX5A 5KJ1A 3C8HA 2ODAA 2WZQA 4KQCA 4U39A 3WTBA 1WWKA 5CVUA 3N2GA 4WA7A 2GKGA 3U9LA 3AM5A 3TLXA 4XTRA 3FG9A 4WERA 1K08A 1YR6A 3B3GA 4YP0A 5E9AA 1E1YA 1XTTA 3LHKA 1UPBA 2FG5A 1B74A 2J31A 3S40A 1P1JA 4J1SA 3N2LA 3P2KA 4OBBA 1CJBA 2IKSA 3OAAD 5CT8A 4GXQA 2EDAA 2B3TA 4ZVUA 5B12A 3GV0A 3UK0A 1IHXA 3T1OA 2BW0A 3F4KA 4JROA 2WT4A 4KR2A 1KK3A 3HKBA 4UU1A 2PXHA 4EVIA 1SA0A 4MYDA 3FPCA 1Y6FA 5F73A 2WK1A 3G9TA 4TM7A 3QLEA 4GI1A 3THOA 2YHSA 2F9MA 1EFTA 1V2GA 2CJFA 2YWDA 1QX3A 2BFCB 4NULA 1SKAA 2Z2IA 5HS6A 3MIIA 4LI0A 1PL6A 3P9IA 3KB1A 2CDNA 2O6LA 1JB9A 4L3VA 3ZVRA 2P8JA 5BYAA 1MENA 2F1IA 2ERXA 4FXOA 3NM5A 1XJ0A 2GF0A 1OFUA 2JFOA 4DLXA 1IMJA 4FDAA 2HYDA 4RETA 9ATCA 4EYEA 2IDZA 2XUDA 2WHXA 3QSYA 1HDIA 3PD7A 2C2MA 2GLUA 3M6WA 3BORA 1EK6A 3RADC 3QMPA 1CP3A 1IHUA 2VJPA 3G8DA 3HCNA 1MOSA 4TKVB 4CN8A 2QTMA 3MUFA 3KUCA 4MYUA 2PR2A 3Q8KA 2L69A 3CRQA 3NIFB 3HJBA 1RJ9A 3IPCA 4BNXA 1MPXA 2R8RA 2D0DA 2YYZA 1YJXA 2OZLB 2QQFA 3K6KA 4J0GA 3I53A 3GT4A 3AHEA 3RTGA 4XYBA 3UF0A 3QLUA 2Q1YA 1XEFA 1TVMA 3LUCA 5E38A 2PANA 5AKGA 1ITZA 1HA3A 4B82A 1FZTA 5I7RA 2ZTSA 3TB4A 4EMUA 3H7AA 2WF8A 1G20A 2BMDA 4MQBA 1G19A 1R5NA 3QXHA 4JGIA 1S01A 1XYVA 1SXJA 2F6RA 3UJNA 4YRIA 5FEUA 2A0FA 2H59A 4L8YA 4M1WA 1FP2A 1CETA 1N57A 2EGGA 1E1NA 5EN4A 1EU1A 1XF1A 3HBNA 1J6UA 4OTZA 1SG0A 2GK7A 2BFAA 3EFEA 1N3YA 3LQ1A 3OCYA 1FRZA 2O2CA 1UKBA 2Z3VA 4CMHA 3BRQA 1XZBA 1DKNA 2NYRA 2A7XA 4FFMA 2UYOA 3CINA 2AN1A 3I34X 1QG6A 5FPYA 2GI4A 3LF2A 3NBAA 4NH0A 1E2HA 1I36A 1SO8A 3IUPA 4JQCA 3L05A 3WRXC 1NNUA 4KKVA 721PA 4U2BA 3GRPA 3UJ8A 1N25A 3R8CA 5G0WA 3TJZA 2HF9A 3ZGYA 1R8SA 4UXHA 3IKTA 3M1AA 3T1VA 1DBWA 1WXDA 4FR5A 2JHFA 1H8HA 3L79A 1BJKA 1Z8DA 2H00A 2R8OA 4IS2A 1OX5A 3GLFE 4D9KA 3RRYA 3WL7A 3W6UA 5A9TA 4KLNA 4P7GA 2D2FA 5GAJA 3I28A 1JHMA 2M6LA 2RI6A 1Y3IA 5KYUB 2R2AA 1NBME 1F12A 3OF3A 4WAUA 4E6EA 4U9UA 2YC4C 3HUTA 4IHJF 5ALEA 1NMSA 3UWSA 2L18A 3WRVA 2JLWA 4RGVA 4ZQBA 1EWRA 2Z1NA 4PZPA 5L53A 3W3AA 3T1NA 3UA3A 1SXJD 4RK5A 2XXAA 4GGPA 5KYUA 3N2ZB 2QUKA 4AWBA 5DYGA 1QHHB 5JSHA 4IRXA 1A8IA 1WKVA 5I6DA 1SKUA 4AO8A 2ST1A 2LKCA 1QVVA 5LUAA 2BFOA 2XUIA 3OPMA 1FB5A 1R6UA 2FHPA 2MYUA 3KQOA 5FOUA 1DBRA 4QNRA 4YRLA 1GZHB 2AFRA 1XVLA 2EYQA 3OIDA 5L3QA 2AR0A 4JUCA 4OMDA 1G8FA 1GRRA 3I9V6 4AIRA 2ZIZA 4ZP1A 1SHUX 1FVOA 3I6IA 3HPQA 3KLBA 3O0TA 3CVJA 3TQSA 4Z8YA 3RJ5A 4IO0A 3WRXA 3I1IA 3WLKX 3L6DA 3RABA 3UTCA 5ANRB 1GGEA 1RLMA 1LF0A 2VQSA 1YI1A 4OYYA 2EIXA 4FM9A 2IXFA 2PXCA 4IV0A 3WJAA 4Z9AA 4M0LA 5CBKA 3E4DA 4PQEA 2J5BA 1H8HD 2QT1A 2NQTA 2NUPB 2D1RA 2XUOA 2XE4A 4MARA 4N1AA 5EGNA 4L0MA 4XB6B 2W2KA 2VEDA 4J76A 2ZSDA 3GU3A 121PA 1TKAA 2V58A 3QFFA 2VPXA 5J2TF 8AT1A 1Y7LA 2AOUA 4WUVA 5EXSA 2PRKA 4MKIA 1EPUA 4DKXA 3BMCA 4DZZA 5AW4A 1P62B 2G9RA 3MQ4A 2DETA 1QZUA 4CG1A 4NBNA 3ZWNA 3PXDA 4TZ6A 3F6PA 2ATVA 2PX6A 2HQRA 4B0PA 3W9SA 3H2IA 2WIFA 5SZKB 5KMGA 2O8NA 4FFDA 1TEHA 2BRUA 2JZCA 4IIUA 4YJ3B 5DHAA 3WJ1A 1HFKA 5EJAA 1UXIA 4KQ6A 3K9FC 2F9FA 1GTRA 1U94A 3DCYA 3OJCA 5FA8A 4CQMD 2QI9C 2E4YA 2ZE5A 1E62A 1ZC3A 4QODA 1L7VC 3RRJA 1GUYA 1K4MA 1EJBA 2OAGA 1YB7A 2ID9A 2POQX 2WI8A 3SLGA 3VSBA 2J3JA 2NO7A 4UHJA 2NZUG 1OI2A 1ULTA 4PLTA 4YO7A 3LUFA 1QYWA 3I0MA 1FQJA 1PJ4A 3H97A 3K4HA 4LXHA 5FPQA 4B32A 4BFVA 5A02A 1ILEA 3OQOA 1JH9A 3GEIA 2F1HA 4WCFB 5TJ9A 1R8QA 2ZJOA 5D51S 4DR5B 5DCWA 2IUFA 4RHYA 3PEUA 2ZJFA 2ZR0A 3GRRA 2CHQA 3LQ2A 1YQWA 2WKPA 1PGNA 3FJ1A 4NY1A 1W47A 3BWDD 5LNK1 2IT1A 2GN9A 2WMDA 4Q1FA 4W4TA 4IQFA 4I1SA 1HL3A 2JFYA 3LPAA 5NULA 2WWTA 1MNAA 3PEWA 3EDQA 4HB2A 4KPUB 3SD7A 4C14A 1EUYA 4YRZA 3MCVA 2PV0A 4TWJA 1KEEB 4NXNB 3QWAA 3HKDA 4G65A 1F2UA 3TRKA 4EUSA 2BZSA 4A8JC 5GVRA 1IRXA 3INYA 4OUKX 4Z3DA 2J5QA 4PCVA 3NWOA 1HOXA 3DOOA 3QW2A 2D1YA 4HZGA 5J1SB 4ZALA 1FDOA 1HLPA 1WDWB 3F3MA 2XE8A 3K32A 3OM0A 4HGOA 1QHXA 4OB7A 5KCMA 5DBFA 3D8NA 3ICOA 5EIWA 2ATCA 3GDHA 3V4VB 4YLYA 5CBPA 1DTWA 3FHOA 4BX2A 5EIBC 3BX1A 4RLSA 3FYTA 3T3GA 3K0KA 1RZVA 3O8LA 1DWQA 2UZAA 4D4KA 5HXAA 4I50B 1XHEA 1KSGA 1HTWA 5B1SA 4TTPA 2JVJA 2ZRDA 3OY7A 4ARVA 1P4GA 2RHOA 4UBIA 1MDFA 1PT9A 5DP2A 3LBAA 4NYJQ 1N36B 2YXDA 4EKGA 4OXQA 1KZHA 2GM3A 2PWAA 3BXEA 1D5WA 3EQ6A 2PWBA 1SEPA 4GU5A 2OXIA 3VJKA 1NW5A 5I4IA 1JU3A 3FCUB 2YNMC 3NP9A 3WNBA 5H9WA 4YX9A 3LQKA 1HO3A 1WS6A 3UVEA 3ZCSA 2ZCUA 4ZMBA 1VXOA 4PBRA 1AHNA 1S2GA 3H1PA 1RWBA 2ATXA 4F3CA 1W93A 2ZSAA 3QHQA 2AMYA 1NVXQ 4TKZA 3ROZA 2NSJA 2R1TB 3VH4A 1LBSA 1WUJS 3LBYA 4XQ0A 1B1AA 4L08A 2VTEA 3EUFA 1PU2A 1ZQ1A 4YV1A 1N6LA 1MB0A 4UCXA 3RT1A 4FX5A 3V1KA 4S0ZA 1P2SA 3OKAA 1V1MB 4OXNA 4UTZA 4MUBA 1RYMA 1L5KA 4Z2AA 3GBPA 1Z4IA 1L7EA 1RHUA 2ECFA 6GPBA 3KQHA 1TA9A 4W5TA 1HX7A 5KOJA 3LKDA 1DHTA 4KAXA 4KB5A 4CWAA 3TIIA 2AA3A 2HA0A 3L7JA 5ALHA 4GXTA 4CLDA 4X65B 1SIOA 3LP5A 4QFDA 4LJ6A 1W25A 1ZBQA 2H9AA 3PGA1 5DTJA 4WZBA 1I4EB 4EYSA 4JJGA 3GIDA 1CJSA 4HEA6 4GLFA 5IZCC 5BMVF 2LD4A 2GEUA 1XK7A 4KE8A 2GHRA 2RGXA 4I4NA 5TT0A 3OC6A 4HADA 1Y6JA 4GLJA 3ZK9A 1KJYA 1Y1SA 4MQMA 1M1XB 3R7WB 5AHXA 2R8YA 3VZCA 1J8QA 4B45A 2YIDA 3QLVA 4DLRA 4EELA 3AK4A 2GM9A 4HAUA 4HFRA 3VJRA 3E15A 5IJXA 4B7CA 4JC0A 1PWXA 5K03A 1KVTA 1D6NA 2XNCA 5AW7A 4M86A 4EI2A 3GNSA 4WBXC 2QQGA 2PGNA 5KHAA 4P36A 4JBNA 1RI4A 1Z2CA 4E5SA 3ZE8A 3PQ8A 4FFWA 1NBAA 1DCTA 5JNSA 2PPVA 4IHQA 4PN7A 4BX9A 2HA6A 4QRDA 1UMDA 4V0MA 1WBBA 4JI2B 2P40A 4RV5A 5FFFA 4HQRA 3D2CA 4LY0A 4BLUA 3MT0A 4P32A 3WLMA 4ZI7A 3M82A 1FVFA 2I7TA 5CLFA 4LJ4A 5ALIA 4CNBA 3Q9SA 4IMIB 3GAZA 2EX0A 2C20A 2VS1A 3OPXA 4G37A 4N7JA 1JPNA 3QBJA 1A82A 2VPQA 1HWYA 2YOFA 3CUUA 4RD1A 3V34A 4HDRB 5IZCA 2WJIA 4EG3A 3TRHA 4OX9Y 4Z8XA 3SYNA 3KB6A 3QYFA 1NZDA 4H3VA 2B92A 3OJ0A 1YBFA 4QHYA 2RIRA 1UMKA 2OCGA 1AXGA 1KVQA 1ZVKA 2GOYA 4CEIA 4R54A 4M9RA 5BW5A 3IS3A 4KIWA 1E9FA 2YJ4A 1E3JA 1SQ6A 4QYXA 3VFDA 4ZAWA 3H2HA 1T9HA 2QZ9A 5EJ2A 3H3FA 1B8PA 1YQGA 3E05A 3QKRB 2XB6A 4D0SA 2CLSA 1Y5LA 2YZNA 2JGDB 2ZSHA 1MW9X 4UM5A 4ZIRB 4JYZA 2BJWA 2WHQA 2WU8A 1MGPA 2XBUA 3FMOB 4BMNA 5JY1A 1XA0A 1M9NA 2BR5A 1BO6A 1QV6A 2IE0A 4J07A 5K3FA 1W1WA 3ETHA 1ZU4A 2QPTA 3FNBA 3P97A 4Q4JA 3ZW8A 4O63O 1DUVG 3FSEA 3OEED 2JASA 1JHOA 3MEQA 4I6JA 1RXWA 3I9KA 2FPPA 4R41A 5G3YA 1M76A 1O0SA 1Y8CA 4XRRA 5LXTB 2FSFA 2VHYA 3WAGA 5TRTA 1UAGA 4CIYA 1U7PA 1UOPA 4ZVKA 2FEWB 5ETJA 3WKAA 4A23A 3T06B 4QUIA 1DIOB 3ZJUA 1RYNA 2VVTA 1Y48E 2QQEA 3QA3E 1WU8A 2A5GA 2GEKA 1R8YA 1YJAA 3LYLA 1L5QA 2ZAYA 2O8CB 3MJEA 3FMGA 3RFTA 3F8SA 1EG2A 1KYQA 1CB7A 1A97A 1Q1GA 2XJ4A 2ZE7A 3L2OB 1QRAA 3LDAA 4X6YA 4X7RA 3WGKA 4KREA 1U7TA 4O8ZA 4PR3A 1LFDB 4WK2B 4YR9A 3ZHSA 2OGZA 4KR9A 3VHLB 2DUWA 1CUVA 2WYHA 1WSWA 4AMBA 4MUFA 3FOAA 2QTFA 3BZWA 3DDOA 4G0QA 4JUAA 5E7IA 2EERA 5IARA 2O8CA 3DO8A 2OVFA 3COJA 4K1XA 4AYWA 1Z6TA 3EWNA 3LE8A 4URUR 5JATA 2FWPA 5HMLA 3C3BA 1UFKA 3K1YA 1MAHA 1XCJA 3QHAA 2GA9A 2B6NA 4X1OA 4Y3UA 2ZRLA 2LCFA 4KP7A 4ZI2A 3K16A 2MIIA 1IN5A 3Q2OA 2Q3HA 4H3KB 3RUFA 2VF4X 1P1RA 5CX4A 2IJGX 3N8NA 1XMQB 1YACA 5LZ4A 3KVYA 4FMCB 3UOGA 1MHTA 2HF7A 1QP0A 3F46A 2FDXA 1NTRA 2OV6A 3F5SA 1VG1A 2V59A 3U56A 2CHFA 3MELA 2X3FA 2MSEB 3B20A 4BP9A 1QG4A 4ZT2A 1AV7A 5B6IA 2OHXA 2SKEA 1NSFA 1OIXA 2OAP1 2R3SA 3VXKA 1WMEA 5K0LA 1Z0JA 4MDFA 3LKBA 4OQZA 4K0KB 4E3ZA 3T7IA 1MB2A 4BLVA 1VGQA 4O4IA 1E5LA 1RC1A 5IKMA 3CXRA 3EOAI 2OGTA 2P6UA 4XJTA 4H08A 4WIAA 1RJGA 1Z4NA 5FOQA 1XN1A 3IKLA 3V8PA 3BB4A 3P9XA 1K0UA 1O58A 5LR6A 5DF1A 5DLEA 3RUCA 2H4YA 4JXJA 2GBPA 4XIGS 4M9QA 4AKEA 1HNWB 4FJ2A 4ZEWA 3T4UA 4C6HA 4G0OA 4MWEA 2QTNA 2AN5A 3N0XA 1QF6A 2Y9MB 2J30A 3UMMA 2Q45A 3U3MA 2C9BA 1DINA 4ZZ2A 3PI7A 1MX3A 5CB6A 3UG6A 1SVWA 4CG0A 2OOSA 5HUJA 1XRMA 2GZSA 3A26A 1X1CA 4LQLA 4ARZA 2Y2VA 1FF9A 1VCOA 1WUYA 3PXBA 4LBYA 4XOIA 4TMYA 1T6XA 1NPYA 1HYGA 3P52A 4QDXA 4GUDA 5I9BA 3TBFA 1SPXA 4ARIA 1U9ZA 4TLEA 2XY4A 1T1JA 4MR7A 4OUDA 2D13A 1F8UA 2Q50A 2H52A 3BQ9A 1B26A 3IEXA 4BJ5A 1XLTA 1RC8A 4CE6A 1POXA 2ZRGA 4NOKA 4GPIB 4RS4A 4RTQA 3C4VA 4RNDB 4RVNA 2OFFA