2FGJA

Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgjA00
4OHVA 1CR2A 2QGNA 4Q7JB 4AY2A 1JJ7A 4MA4A 4CRWB 1G7SA 2G88A 2GF9A 2OFOA 3O47A 3SJZA 1S3SA 3FHTA 1VG8A 1VHTA 1O3YA 5AK0A 5GVRA 4Q47A 4F38A 3B1ZA 2PT7A 1UM8A 3PENA 4EQ6B 2G77B 2D7CA 3CRMA 4PO1A 2VBCA 1KI6A 5L8VA 2BMFA 3OAAD 5JI2E 2OILA 2ORVA 2ZJ8A 1OYWA 4CF7A 1E9RA 1CTQA 1EX7A 4TYNA 4HLUC 2WKPA 4JSTA 3AVXA 2ODNA 3A6PC 2QN6A 2PLFA 2ZSBA 5JS8A 2KBFA 2ZR0A 1BMFD 1JQLB 4HZUA 1KSFX 1KI7A 4D80A 2FPLA 3EZFA 3CF0A 1JB1A 4OHXA 2C98A 4MRSA 4LGMA 1ZNXA 4DDVA 5KO2A 3SQWA 2ANBA 3TSZA 4A0FA 1NG9A 1NY5A 2BJWA 2FEOA 2JLYA 2PZGA 2OSBA 3LBNA 1JJVA 1OE0A 2EFEB 4Q7KA 4X8OA 3GJ8A 3NXSA 3KZ1E 2BV3A 4Q19A 4ZCIA 5LBIA 3SJCA 1T0HB 1J70A 2ATVA 1XPUA 5EE0A 2XZOA 4CVNA 1YKSA 4E03A 4A0GA 1A5TA 4DB2A 2HYIC 4NL4H 5HCNA 1P75A 2O8EA 1U0LA 3LLMA 4Q9LA 4CEHB 1G291 1I4LD 1G8HA 3GFTA 5EXXA 2Q3FA 2A5JA 3MWJA 4G3XA 1UJ2A 3CX6A 3IBYA 4HUTA 4IDPA 2IS2A 4PQRA 1Z2AA 1Q3TA 3EAQA 4JBWA 5JLJA 4DVGA 4URUR 3KFXA 2AKAB 2O52A 3J81k 1FQKA 4LY6A 4EPWA 3L2OB 5JI3E 3O8DA 4QFMA 1ELOA 2HJGA 2N42A 3CKLA 2D74A 1E4YA 5BN4A 4NH0A 1NIJA 2JLVA 2ECKA 3R7WB 3TW8B 3TMKA 2VA8A 3NC1C 1VTKA 5FI1B 3RRNA 2ZS7A 2QROA 2G0NA 4XTRA 1E3MA 3AEZA 2ZVPX 2P2LA 3PVSA 1E2KA 2IUSA 2ZE7A 3IHWA 1KO4A 2YYZA 1FOEB 1SVWA 5H8WA 4IDNA 4X8LA 4LJAA 3PEYA 2AHOA 2O8DA 2OE2A 5FOWA 1COWA 1U8AA 1GKYA 4B48A 1YU9A 1T3HA 1XEXB 3MSXA 1HE1C 4NONA 2CVFA 2BWJA 3LNCA 4GOJA 4JJZA 4DIEA 4O2LA 1NN5A 2PCJA 4MKGA 1GILA 2JLZA 4DEYA 4ZO4A 4IOKA 2QMOA 3I73A 2B6HA 1NMYA 2GEDA 2BCGY 4JYBA 5J4VA 1G5RA 4AYXA 1R6BX 4LPKA 3K0AB 4MGYR 3MGCA 3CBQA 4MKIA 2Q6TA 4A2WA 4KCGA 4POAA 2AD5A 3P27A 3QPWA 4YQFA 1N6IA 2ZROA 3GJ5A 1YJ5A 3T5GA 5BW8A 5K8TA 2DWQA 1EWQA 1E2DA 3K9GA 5G3YA 5K8LA 4RFSA 4A1FA 2GK7A 3VR5A 1T6NA 3WHLA 3L82B 1OIXA 4X8MA 1XCPA 2ZXUA 2J0SA 4LRWA 4H1UA 4HLCA 1GKUB 4GMXA 5DSZA 4XSHA 4D82A 2WTUA 2BCJQ 5GADl 2R6GA 4EIWA 3SU8A 1EXMA 1Z0JA 3T34A 5FPHA 2EWWA 1PV4A 1AZSC 1FNMA 1EFHA 1JEDA 2ZTSA 2DFLA 1E79D 2MSDB 4G5RA 4IFBA 3SFVA 4C0JA 2ZETA 3P26A 3ZZTA 4EFLA 3M0EA 1ZYUA 2KE5A 3BJIC 3CONA 1SXJD 4DLZA 1N6RA 2PLRA 1WB9A 4JBYA 2QNRA 2W00A 2OUKA 4I81A 2FF7A 3Q9LA 1AKYA 2OFWA 4E5UA 3I61A 5JEDA 4JJKA 3K70C 3SHFA 3GPLA 2ZRKA 1HV8A 2WPDA 2R6FA 1L4YA 1XMVA 1R0XA 3I92A 5F9HA 4I99A 2YVUA 3OESA 1W1WA 1EFCA 1NBMA 1OLOA 3CX8A 2GK6A 1DOAA 2FH5B 2AL7A 3KFVA 5EE1A 4IVQA 3HJNA 3LA6A 2ODEA 3QF4A 3C5CA 4JIMA 3GLHB 4WIAA 2IXGA 1LF5A 3OIVA 1FTSA 3QVUA 5HTKA 2V4ZA 4RKEA 3QKSA 4V0NA 2QAGA 1GFIA 1XXHE 1DBSA 3TUIC 5KHOC 4YDHB 4Q9IA 4HUQB 1OSNA 2ERYA 2ZJOA 4LJ6A 2YZ2A 2CE2X 4NYMQ 3K0CA 4TL6A 1OH8A 1P73A 1BOFA 2WWWA 3Q5DA 5JHHB 3BIFA 4AG5A 3A4LA 3KJGA 3IHLA 4PPFA 1Z0KA 4A36A 3CRQA 3LH5A 3P20A 4Z54A 1XTJA 1KO1A 1ZAKA 2R62A 4QGGA 3K70B 2PEYA 2GKSA 2OT3B 1H8HA 1NLYA 3A1WA 2V1UA 1L8QA 1EFUA 2ZREA 2Z0MA 1W0JA 3TNFA 4GOKA 1P60A 3A58B 1D5CA 2CNWA 1IXZA 3MD0A 3BS4A 1G7TA 1X3SA 3WMFA 1SVLA 2DFTA 5B2ZA 3QNUA 5CDFA 4BLPA 4WZBE 1IAQA 1ZRHA 4IFEA 1XPRA 1UF9A 2GWHA 4NMMA 1W36C 4ZI3A 3T15A 4OK5A 1KI4A 1KAOA 1IY2A 1GRQA 2ZE6A 4RD0A 2XZLA 3THOA 2SHKA 2GAAA 2V8OA 4OQFA 3QKTA 2FA9A 4O25A 3DEFA 4IJMA 3VNVA 5KPJA 4HZIA 3FKQA 1P2VA 1QVAA 721PA 5JJLA 1OYYA 2J7PD 3VR2A 2WSMA 3UMRA 1N6LA 4PTLA 2O0KA 5CK4A 4FMDB 2QMEA 4Z8XA 2GJ9A 1DAEA 2QQ0A 3FYHA 2OFXA 1E9FA 2Z5FA 3IKJA 4B47A 4NYMR 5J4YA 3LWNA 3FPAA 3MMPA 1KZGB 3EX7C 3WY9A 1A4RA 3W6PA 3A1UA 2BBWA 2QGZA 1BO6A 5LD2C 1FUUA 2QSYA 4W5WA 1VIYA 4CDGA 3RS3A 4TL9A 6Q21A 2G6BA 2J0UA 4TT3D 3QG1A 1QHGA 2IYUA 4PAMA 2JGNA 4HSEA 1WDTA 4JKYA 4DJTA 1KDPA 5IK2A 5LB4A 4A8JC 2YWGA 4BLTA 1E2QA 3WRYC 2FE4A 2XEXA 1ANKA 2ZRFA 3Q7QA 1QHSA 1OV4A 1XJQA 3FMPB 4MRVA 4HAZA 4RZUA 1SHZA 5DYIA 3R20A 5B30A 4RFSB 1KKMA 1Z06A 2WWIA 3CM0A 2V7QA 1W44A 4FMDF 3CH4B 3W6OA 3R9WA 1LF0A 4V03A 2OEPA 5AUPB 2R9VA 3BH0A 1KK3A 1IONA 4QOSA 1I2DA 1YRAA 3X1YA 4V02A 1E99A 2CBZA 2ZRAA 1NN1A 4KBFA 3QY0A 3B9PA 2X2FA 1XMIA 1D2MA 4TMWA 4HDOB 3FKSD 4XH9B 5CJ2A 4OI1A 3RLFA 4NZYA 5KNDA 1MKYA 4HAVA 4M1KA 1SULA 5DIFA 4B2LA 2RMKA 3AH8A 2CJWB 5H68A 5LD2B 2W2TA 1EWRA 1MT0A 4C0KA 3MFYA 1P2UA 5CIWA 1U8YA 1AKEA 2X8AA 1NVWQ 4BECA 4RZ3A 4FCWA 1W7AA 2A78A 1XBTA 2EFHB 1MOZA 4RFVA 1WP9A 3W3AA 1XX6A 2ZI4A 4L8GA 4B6EA 3IILA 5AJVB 2F7SA 2DHRA 2Z6VA 3RWMB 4BFYA 3U4QA 3NBFA 4DEXA 5B57C 4PSAA 5DYGA 121PA 2V6JA 3QXCA 3QF4B 1XMJA 1UEJA 5HZKA 4LX0A 3AUYA 1VDZA 3AF3A 4D0GA 4DT1A 3W34A 4DCVA 2ZRDA 2O8FA 4KFRA 2WJIA 3K9LA 3ASYA 3ONWA 2QAGB 1VCOA 2C9YA 4JVSB 2A5GA 3DL0A 4KODA 1S0UA 2I3BA 3E2IA 5K8UA 1OF1A 3AP2A 1HT1E 1KIMA 3SYLA 1CS4C 1E2PA 2GBLC 1R5OA 1XEWX 4JSYA 1JAIA 1E0SA 5E3HA 3AVQA 4DUGD 4TYWA 5BWMA 1XD8A 1W47A 1YVDA 2JLRA 3AF2A 4PZLA 2ZUBA 3OFNA 3V00A 1E2LA 3IQXA 4NCJA 1XFAA 1P61B 2BMJA 1KNXA 3ZIAA 1Z63A 3MJRA 2IHBA 4JMPA 521PA 3CR8A 4MYTA 2QBYB 4DDTA 1ZU4A 4PAQA 4Y0VA 4IHQA 4PC7A 1M2OB 2CL6X 4K8OA 2JJ2A 4RD3A 3LX8A 1W2GA 2ZRNA 3MG9A 4FXPA 2IL1A 3EA5A 3DZDA 2IWRA 2QSZA 2RB4A 3OAAA 2GDJA 3LRPA 2P0EA 4AKIA 3DM9B 3KJHA 1WA5A 1XXHA 2OZEA 3AGQA 4DWJA 4TQAA 4ZDJA 1IOZA 1VYUA 1DS6A 4OL0A 1MV5A 1ZCBA 2W83A 3QXXA 4R7ZA 1S1CA 2BDTA 5LPNA 3ADCA 3ZVMA 2VHJA 3NG1A 5J4HA 1V43A 3LXRA 3W90A 3ZQJA 3ADBA 2JLWA 1OXTA 3BAFA 2EYUA 4MUAA 2KB0A 2ZAOA 5EE5B 4EJSC 1OW3B 1H8HD 4DLUA 3ECCA 4P31A 4GFDA 4CW7A 3ZH9B 2D2FA 2YV5A 2GXAA 1AS3A 3HYTA 1NG1A 3TR5A 821PA 3PUYA 3W5JA 5SZJA 4ZI2A 4TLEA 2OCYC 1P62B 2BBOA 2CLSA 2I1QA 5FBWB 1W2HA 3GLGA 4BZQA 4LI0A 4F92B 2FDCA 2QRZA 4QXAA 1U8ZA 2HCBA 2ZAMA 3ASZA 5CB8A 3GMTA 1Z28A 2ZSAA 2ZQ5A 4QBGB 4K81B 4Q4HB 3BWDD 3LX5A 1A82A 2A3RA 3QI2A 3G82C 3CPEA 1P72A 1E2IA 1G8FA 1EGAA 3EARA 1M7BA 4W5JA 5JRZA 4O2RA 1N6OA 1FFHA 5BN3A 3W3ZB 2B21A 2Z4RA 3PR1A 3I8XA 3U3JA 4BE7B 5DN6D 1W4CA 1VCMA 2XNDD 2QP9X 2B8TA 1H65A 2GESA 4JT2A 5FUWA 2ZRLA 1KZ7B 4BZPA 2XTNA 2C99A 4EJSB 2XXAB 5CK5A 2ANCA 1U9IC 2FWRA 2REXB 2QP4A 4P4TA 3B6EA 1B0UA 4MYHA 4PO9A 2CXXA 3W8RA 1MR3F 1W0KD 2CCKA 1E2FA 2CCGA 1JAHA 3L43A 4KHZA 3FHCB 1F48A 4U5XA 2ZUDA 4ZKDA 1XB2A 4J0QA 2QQEA 1D9ZA 2VF7A 1Z2CA 4DCTA 1HURA 2IWHA 5CITA 2IEZA 1XCGB 2OLKA 2XJ9A 4DLWA 2GZHA 3SE0A 4YXWD 2J45A 2NOAA 221PA 1C1YA 1E32A 1ZJ6A 2H92A 3HP1A 4MGKR 4TQ9A 3BB3A 3U7HB 4C0BA 3U4QB 2GCOB 2XJ4A 4A6XA 4NDZA 1XMSA 1NMZA 3GD7A 2JLXA 2OAP1 3N2EA 4MRPA 4RY2A 5TY0A 1LS6A 2HDNB 4HLUA 4HATA 4YMVA 3SBDA 5IT5A 2NO1A 1QHIA 1Z0AA 3PUVA 1E96A 2JLUA 2JA1A 1LB1B 4M1WA 2YC2C 2QZ4A 4IOMA 1G17A 2XAUA 1ZW6A 1KYIA 3HR7A 4A2PA 2HT6A 3I8SA 3T61A 2AX4A 4PHFA 4UNNA 3RS5A 1PVOA 1G8YA 2Y8EA 2ORWA 5FTMA 1E9DA 1S9HA 1BH2A 3EPHA 2ZR7A 3OEHA 3EIEA 3KUDA 2VYFA 1AGPA 2PMKA 3VR6A 1SGWA 4NYIQ 1KI1A 4ZCLA 2UZ3A 3GEEA 2DYKA 2AN9A 3GLIA 5L3SB 5C4GB 2EW1A 4KSCA 5FBVB 3IEVA 4XJXA 3T35A 4Q1EA 1Z07A 3AVOA 2CL7X 1E79A 4IXNA 2O8BB 1OHHD 5K8IA 3WBJA 1OB2A 3X1ZA 1RRPA 2G1KA 3FMOB 2PX0A 1PUJA 1XU4A 2EQBA 4RCZA 1LV7A 1SXJA 4H1VA 1ZD9A 2ZI3A 1SKQA 2YKGA 2PL3A 2MSCB 4ZV4A 2XSZD 3VKGA 3F3YA 1K8RA 3FE2A 5IRCD 4CEIA 1NBME 1Q1ZA 2FEMA 2RH5A 1Y63A 3ZGXA 4KJZA 4KI0A 1U98A 1XXHB 2OXCA 1NN3A 1Q57A 2XTMA 3RWOA 2FPKA 2FFBA 1GTVA 3NHBA 5TARA 1G20E 3OFND 4OQLA 3CO5A 1GIAA 1SZPA 3B8HA 1FW6A 5J5CA 1II9A 3UANA 1N0UA 2HF8A 1G3RA 3D6TB 3GJ4A 4JL5A 4BFSA 5F98A 4CZ2A 3QKRB 1R10A 3C7KA 2Q3HA 4B44A 4D81A 2VSXA 1GNRA 2XITA 1F6BA 4FMCB 2AWNA 4LJYA 2JJ2D 1GZSA 4YMWA 5J47A 4C7OA 5HKKD 4CT5A 4LDJA 4JLAA 3CX7A 2YWEA 4NYIR 5EP3A 4A9AA 2G3YA 3ZVRA 3I32A 4HAUA 1W5TA 3OEED 3BC1A 1II8A 1NI3A 5G40A 5FTJA 1U0JA 2O8CA 3WYAA 4YLGA 3BE4A 3L0OA 1TEVA 3AQ4A 3CPJB 3M1IA 2CHGA 4KU4A 1NP6A 1ONBA 5C1BA 3RHFA 1CR4A 2QL6A 4N3NA 5CDFE 4P32A 1TNDA 3THXA 4B3FX 4URXR 1HYQA 4I1SA 3VX4A 2QPAA 1P2SA 2RGEA 2D7DA 1CULC 1E2NA 1FP7A 3W5IA 3MCAA 5KOYA 1A2KC 4TYYA 2W6JD 4L5BA 1OJLA 3NKVA 4ZDWA 4C4PA 2XNSA 4OJQA 4G5QA 3TKLA 4FMCF 1GNQA 3IPYA 2J1LA 2NQ2C 4UJ3A 4B2PA 4Q7LA 1WF3A 1XTKA 3MJHA 2OV2A 2AD1A 2VP5A 5JWOA 2F1JA 3UMFA 3TSOA 2FGKA 2HLDD 4DCSA 2ZYTX 4R2IA 4WZ6A 3AM1A 4EPYA 5P21A 2FZ4A 2BOVA 2J7PA 4XWKA 3KB2A 2PJRA 4ESHA 3QG5A 2HJVA 3G5UA 1E9EA 1KMHA 1Z0FA 1NVXQ 5G53C 4P0TA 1T5IA 4Z1MD 3DM5A 1IN4A 4KO8A 4IDOA 1E2JA 4NYJQ 4ZPXA 4YDSA 1VYTA 3DOEA 3VTKA 1E2HA 5AJZA 4BEJA 1TL7C 4UQOA 4AYWA 5DO9A 5JJKA 1UBFA 2ASEA 2J59A 5EQTA 2J87A 3EXAA 1AZTA 4Q48A 2ZSFA 3TR0A 3QQ5A 1QRAA 1IHUA 3BK7A 1ZD1A 3UWOA 3VU9A 3BB4A 1N5IA 2ZS8A 4BLOA 3QUSA 4G5SA 4PZZA 4TT3A 5G41A 2X1VA 1NRJB 4QHSA 5C2JB 1G16A 5A0FA 1EESA 1EK0A 4B3XA 4XTCS 2B8WA 5AWFC 2J7KA 3KJIA 4FW9A 3ZLJA 4LYJA 3ICQB 1S1MA 2REBA 2A5DA 3OE7D 5FL7D 1QG4A 4U00A 1YRBA 5A4JA 3LW8A 1GNPA 4QL3A 1F2TB 4LBYA 1EX6A 1FX0B 1G6HA 1JXOA 2ODBA 1CJTC 2TMKA 3UKDA 1VCNA 4PPQA 1SVMA 3EWSA 3MUFA 4FWTA 5AR1A 4URVR 1YR6A 4XD7D 3NTUA 3K09A 1TADA 4UNRA 2DWPA 2P6UA 1Z83A 4JLMA 4JKIA 2UVQA 1AS2A 4FWIB 4TWZA 3FKSA 3SOPA 1KHTA 3EC1A 4NYJR 4OK6A 1JPJA 2CMKA 2ERXA 4HB4A 3WHKA 2OO7A 4QGHA 1HA3A 2ZEJA 5GJWC 2ZRPA 4KAXA 4MRRA 1YZLA 1AS0A 3W6NA 5FOUA 2IYLD 1K5DA 4DDWA 4O0MA 1N5KA 1G9XA 2GEVA 4GDFA 4IOLA 4ERNA 1DAGA 2IEYA 4PC3A 4M2LA 1XD9A 2ZIAA 2BKEA 4TQUS 1RJ9B 1RYFA 3GCGA 4TZ0A 3KKPA 4A92A 2OCPA 4TTPA 3TSWA 4B74A 2RGCA 1ZINA 2FSHA 1NIPA 2GILA 1OIVA 2G0TA 4PAOA 4BGDA 2F43B 3HPRA 3OEHD 1NLZA 4ZDIA 2FFAA 2CDNA 1KJZA 2ZR9A 2DFNA 4DSUA 2Q9CA 2E1RA 2WJGA 1E0AA 3BXZA 3MRSA 4DCUA 4JLNA 2XB4A 3SQXA 1UEIA 2W0SA 1M1YE 4GZMA 1U99A 4PPGA 4C7OB 1ZUNB 2WMNB 3EPJA 1T5LA 4CGZA 3AP3A 5FOXA 1X1RA 1G7CA 1KDOA 2R6AA 2Q9BA 2V1XA 4IEIA 4YMTA 4L16A 3ND8A 5SZKB 1KI6B 5BN5A 2AK2A 3WP1B 5AUOB 2X2EA 5DH9A 1DELA 3X1XA 4DUGA 4XWOA 1XRJA 5KYKA 1OH6A 1DPFA 5DI3A 4N1AA 4TMTA 4WZAE 3LBIA 5M04A 3ND9A 5HZHA 2YWHA 2F9LA 3THWA 4D25A 1G3IA 1J99A 1XWIA 4MKFA 4HZUB 2YWFA 1D8TA 2RGGA 5KPDA 4B75A 2ZU6A 3RNLA 3QSYA 4ZCMA 4LOAA 3AF0A 5JSZA 5KDLA 3U3OA 4Z51A 2OCBA 4JVMA 4A4DA 2KJQA 2ATXA 4WVFA 2XGJA 5ELXA 1KSHA 1U90A 1LY1A 2VQSA 3VMFA 2F1IA 4RD1A 3FVQA 4Q21A 1FMLA 2ZJ5A 1UPTA 2GRJA 2GJAA 4A8JA 4Q9KA 2VP2A 4US1R 4LHVA 3OZXA 1UDXA 2LKDA 1VG0B 2CE7A 2W58A 4MH0R 1X86B 1MH1A 1X8KA 3SR0A 3K9HA 1AGRA 2IYWA 2W6ID 3B5JA 4II7A 2P6RA 2NO6A 2FPMA 1KSJA 5JMTA 1E9CA 2X77A 4Q5IA 1A1VA 4BFVA 4RD6A 1XP8A 4ZDKA 2O8EB 3CNNA 1YR7A 4FD2A 5TV2A 1WCV1 2HF9A 3VR3A 4UKDA 1TUEA 2YOHA 5KSPA 4XIGS 2AFIE 1UKEA 4JLOA 3C41J 4JVNA 4TLAA 2H8KA 1P6XA 2OG2A 3AP1A 2XX3A 1IY0A 3R8CA 3VR1A 3GLGE 4GP6A 4RD4A 2AXPA 2W2XA 1NLFA 4LUCA 4DSOA 2QP3A 1T0JB 2PT5A 3E70C 3GJ0A 3RYTC 4I1VA 1D6JA 2NZJA 3Q72A 3A1TA 4LJ4A 3SHWA 3TVDA 2UZIR 1ESMA 4BLSA 4BEBA 1KK1A 1E69A 5L3VA 1S2MA 3B1XA 3CPHA 3MLEA 2NPFA 2HUPA 1OFTA 4Q4AA 3X1DA 1BS1A 3KKOA 3CF6R 2VRWA 4DLTA 3AGPA 4I1UA 4BRWA 2H17A 1KGDA 2ZM5A 4BFXA 3TH5A 2O8DB 4PANA 4ASUD 1GSIA 1KY2A 2RCNA 4GRAA 1G7RA 3TQFA 3B13B 2NG1A 5DN6A 5HCIA 2XNDA 1Q21A 4QM6A 1GP2A 3I1FA 1JR3D 4NPHA 1Z08A 1XZQA 1C4OA 3QVVA 4OI0A 5FH9A 2F55A 2JJ8A 5FFMA 2V6IA 3B2EA 3C16C 3M4YA 4C30A 1Z6XA 2A9KA 2J41A 4KLNA 4E22A 3KTAA 3A36A 1G5TA 3DHWC 3PCRB 3K9NA 2NO0A 3K70D 3SS8A 2RGNC 3AKCA 4BFTA 1W0KA 4IW3B 3CF2A 1ZM4A 1E2EA 1TF5A 1EFRD 2ZYWX 1ZNZA 4JS0A 5CIQA 3GP8A 3U5ZB 2A7QA 3AVPA 4AWXA 4YC7A 5EE3A 3A8TA 3KXLA 4D0LB 3T5DA 5FBRB 3H4MA 3THYA 1US8A 4GPTA 3KL4A 1TU3A 3BB1A 5EXPA 5C4MA 5CM8B 1W5SA 1X6VA 4M1SA 3QXJA 1CXZA 3LD9A 4YXWA 3VX3A 3KQHA 1P7CA 2C78A 4HB2A 1KMQA 4KFSA 1BYIA 1VMAA 3CNOA 4RCYA 3T12A 5E7JA 3GJXC 3CZPA 2QAGC 3FB4A 4B3CA 2ONJA 2ZVQX 5C46F 4QNRA 1W4AA 2IC5A 4QJ5A 3G0HA 5GJCA 2R6CA 2WJVA 5J4LA 2EFCB 4BZXA 1XTRA 4I1OA 4LHWA 2YOFA 2VP9A 4LK2A 3B1WA 3K0CC 4C0QC 1PLJA 3U3RA 1TEXA 2QM8A 5SZIA 1G3MA 1GM5A 3C15C 3FGNA 3JVUA 2ZYVX 3QBTA 3GEIA 1DG3A 5E95A 2FN4A 4M0LA 3RS7A 3C14C 2GCNA 3K0FA 5EZ5A 2R8RA 3Q85A 4MDEA 1CU1A 2NPIA 2R6DA 3GLFE 3GLIE 2QE7D 3E1SA 4TTQA 4AK9A 1VYVA 3WNDA 2OBLA 1LFDB 4A82A 2Z83A 1IN8A 1R7RA 1TF2A 2JLQA 4ARZA 1P5ZB 5TB5A 2Z43A 1W36D 1RPZA 3SJAA 4UNQA 3ZZUA 3PFIA 3EZ6A 2ZITA 2QI9C 3PUXA 3BRWD 2X19A 5KTYA 1IQPA 1SXJE 4LV5B 2HXSA 5D3MA 2WWHA 2IXFA 1G19A 4QBHA 1OHHA 2J0QA 1YR8A 2A5YB 1HH4A 2WKRA 2QENA 3JVVA 3Q5EA 3QKSB 4TL7A 3ZJYA 1NJGA 2AXNA 3RC8A 1YZNA 1R5BA 4LV6A 2ZE8A 4TL8A 1VG1A 5TVKA 4H9GA 2HEIA 1PJRA 2XSZA 2WV9A 4EAQA 4BRUA 3O8CA 1KKLA 5FOSA 5BYKA 3KKQA 3QIAA 3PEUA 4M4SA 4B32A 4FCTA 4PPNA 1H8EA 4MDFA 3TGPA 1KJWA 2ZI5A 1XD2A 1Z6AA 2C96A 3RAPR 1G4UR 3GFPA 1RC8A 1YZKA 1IXSB 3DOFA 1I4DD 1RKBA 4MITA 3QE0A 1KOFA 4QHYA 4OQXA 3D3QA 1Q1QA 4R98A 4DBLC 3A1VA 3TAHA 3FWYA 3B82A 5DGXA 4AG6A 1Z6YA 1HT2E 5HKKA 3QEJA 4F7WA 3S1AA 4HYYA 1HE8B 3MAAC 4TMKA 4V0LA 2C9OA 2C9CA 4ZIRA 2PZFA 2RGAA 3CW2A 3LVQE 3B7GA 3OEEA 1S3GA 4QJ3A 2BEJA 5TDHA 3VKWA 2C04A 4TLBA 4NU0A 2RHMA 1YR9A 3IUYA 1ZUHA 4Q9JA 5KUTA 4B33A 3RRYA 1OXSC 3EW9A 2J5XA 1ODFA 4MUBA 5FPTA 4C2UA 5JBQA 2ZI6A 1DARA 1IN6A 3IBGA 1J2JA 1F3OA 4LYAA 3FMFA 4PQFA 3BFKA 4C0AC 1F2UA 2VP0A 2WJHA 1GKIA 4JVLA 4D2IA 1ZC3A 5CYPA 1WXQA 1J90A 2FV8A 2PJZA 3BBPA 1WBDA 5EP2A 4IVRA 3W9YA 4WOPA 1CEEA 2QPOA 2W6JA 4HB0A 2ZANA 3HU3A 2GZAA 4D26A 4Q4JA 3X2SA 3SYKA 1RFLA 1T9HA 1ETUA 3GEHA 3KKMA 2NMVA 3NDPA 3B9QA 4P4SA 1JALA 2A5FA 1Q1BA 2WSSA 2YINC 1NVVQ 3LBHA 2HLDA 2J0UB 3AKEA 3RC3A 5KSZA 5FTNA 2C95A 5DE3A 4B43A 4PHTA 3EG5A 4R71A 5CYOA 1HY3A 4EFNA 4F93B 1HQCA 1G5PA 1RYHA 3SEAA 1FMJA 1US8B 5FPKA 1JR3E 4IOJA 4DSTA 1E0JA 1EFTA 1MRNA 4Z1MA 3I62A 3HWSA 3B78A 5KSYA 1VECA 2D4HA 3T1VA 3TLXA 2G83A 1NSFA 1CBUA 2AR7A 2FOLA 3L8YA 1RZ3A 2WJYA 3KX2A 4QG7A 4WA7A 2WJJA 2WWXA 3AV0B 3GJ6A 1FPMA 1OPXA 4YMUA 1TQ2A 1ZVQA 2WBLC 3U3MA 1FL9A 3X1WA 3SI7A 4B71A 2PEZA 2OAQ1 1GRNA 2K5UA 1EG7A 1MO5A 3VQTA 2REOA 1MO3A 3IIMA 4F91B 5HR5A 2YJTD 1D2NA 3PUWA 2Z4SA 3AVYA 1NY6A 2EU8A 4M9ZA 1P9RA 3OE7A 3CH5A 5FL7A 4RSGA 3OIUA 5E7MA 1OKKA 5GJVC 3TBKA 1SKYE 1TX4B 5JZVA 4BASA 2IK8A 2QMUA 4A0RA 2QUZA 1NVVR 3K0FB 5G3ZA 4D4JA 2PBRA 5EP1A 5IDVA 1KO7A 2QORA 4JLBA 4EKDA 2QAJA 3B60A 1M74A 4IDQA 4N0EA 5FOVA 4XD7A 2GJ8A 4KFTA 3PITA 4KVGA 4Q66C 4TSFD 4CEHA 5D3MB 3VR4A 2P65A 4DT1B 4B35A 2O8FB 1K6MA 4FMBB 2D2EA 2F9MA 2NIPA 1QDEA 3IQWA 4Q1AA 3SDZA 1JECA 3QPUA 2QRNA 2O0HA 1R0ZA 2B7BA 2MSEB 1N25A 1R0YA 5TXGA 2GJSA 5FR2A 4AKGA 1Q22A 1E98A 2GJKA 1LW7A 3AKDA 1KTVA 4B76A 4PSVA 1Q20A 3AF1A 3R7WA 1XD2B 4BUJA 4XVUA 3CRW1 1E1RA 3CR7A 4B6FA 2VH5R 2WMOB 1DO0A 1ZNWA 3B1VA 2C8VA 4WXRA 2JCSA 4NBSA 4TTRA 3TQCA 3GLFA 4BFZA 1RE0A 1Q1EA 3I4LA 1UKYA 3CZQA 1A2BA 4IVPA 3AVTA 1TQ6A 1JEEA 3C4JA 1TMKA 4LYHA 4ZKEA 3U60B 3QJYA 2VO1A 3T1TA 2ZU0C 1XEXA 3P32A 3U7EB 3GFOA 5J40A 4D4MA 4WW0A 2WOJA 4Q03A 1CLUA 3FFBA 3S1AB 1N0VC 4PSKA 2PH1A 4ZIRB 3BH6A 1G18A 1SHKA 2RHDA 4Q1BA 1UADA 1NMXA 3MWKA 3AVVA 3SN6A 1D9XA 2R2AA 1KO8A 3T1QA 2JASA 1F5NA 3VHLB 3IDQA 1H8ED 3FOZA 1Z3IX 1QHXA 2GXSA 4OHZA 3K0AA 4M1OA 3K0SA 2IHYA 4JBXA 2Q9AA 4F4JA 1CJVC 5FTKA 1Z29A 1GVNB 1ZU5A 4KYUA 2G1JA 3TW4A 3ZQ6A 3WXMA 3EZ9A 2IS1A 4JLVA 2AFHE 1YZGA 3UATA 3L0PA 2WM9B 4QC2A 2VIIA 5CJPA 2DB3A 3SC3A 3HDTA 2XOKD 2P67A 2OESA 2VLIA 5AJYA 4MYCA 2YNMA 4EPTA 1CRQA 4DHEA 2W0MA 4MRNA 3DDCA 4QNMA 4HI0E 1ZP6A 4DLVA 1M6NA 3AB3A 5UKDA 3GLGB 5KDDA 1RVDA 4PHGA 2WHXA 1U94A 2W6IA 1DAFA 1GITA 4GOXA 4L9SA 3KQUA 2DWOA 3DVLA 2ZRHA 1CF4A 3WYGA 4GT1A 2GVDC 1XJCA 3FTQA 4ILEA 4V0OA 3CRVA 4OQNA 1RRFA 5H70A 3V4FA 1R5NA 4CEJA 3DPUA 4JYCA 4WAUA 2QY9A 2FGJA 2OBNA 4IDHA 2O0JA 4OI4A 1KY3A 1QHHA 4D4LA 4UNSA 2ZSEA 3NH9A 5EJEA 3KQNA 1U81A 1YZTA 1WBBA 3SZRA 1Y3AA 4DLXA 1HUQA 2JIZD 3OIWA 5LDDC 4BLQA 1Z8FA 2FSIA 5EUQB 5BXQC 2ZJ2A 1GOTA 3RS2A 4LC0A 2Q21A 4CYMA 1N6PA 4Q02A 2WIAA 1KJYA 3D8BA 4B2IA 1ZD8A 2DCUA 4ON9A 5F9FA 4P33A 5ANRB 4NKRA 2WSSD 4PC2A 4NCHA 2VHQA 1TU4A 1VPLA 1G41A 5AUQA 4AYTA 3UG6A 1OH5A 1B23P 3GLHA 3QBVA 2QT1A 4AURA 2Q0HA 1XDBA 2D3WA 1GUAA 3IIKA 4ASUA 4KV9A 1KI9A 2HV8A 3TJZA 2GNOA 1UKZA 2DFKB 2ZJZA 1DVRA 3HR8A 3NBXX 4HUQA 4RJLA 3ZDQA 1JR3A 1FP6A 2ZRMA 4PFSA 1IBRA 3EIQA 4TYQA 4UNPA 2CLDX 2B92A 3REFA 3H0KA 4A2QA 4D4KA 3WBKA 3RRMA 1XJ0A 1CR1A 3U6BA 2J0VA 5B58C 3EASA 3DMDA 5JECA 2F1RA 5EUMA 1SXJC 2QM7A 5KNCA 3RSOA 3GQBA 4D0NA 5JJIA 4IKEA 2WICA 2EVWX 2LKCA 1XEWY 2XB2A 2BKUA 5DLQC 1SVKA 2F1HA 1Z22A 4ACBA 1EFRA 2J9RA 2IUUA 2JEOA 2CK3D 4V0ME 5GVSA 1AN0A 4FI3C 5D3QA 3ZS8A 3UPUA 421PA 1OKKD 4FN5A 1UBEA 2C03A 3A1SA 2ODWA 2QTFA 3FDIA 4LHXA 2WZQA 1BIFA 3RVBA 3UWKA 1GRRA 3R9XA 4M22A 4C0HA 4MYUA 3U2QA 1W4RA 4HDQB 2OBMA 2QTHA 5FL3A 5FOTA 1AJEA 1LNZA 2FSGA 2IW3A 3IIJA 1KNQA 1ESNA 4AIIA 2QMHA 2RAPA 3B85A 4W5HA 1QVRA 1XEFA 2DY1A 4TMXA 3NHAA 1KI8A 3GLFB 3GLIB 2E9SA 2H18A 1OXVA 3U44A 2CLCX 4DC9A 3WRXC 2GEUA 1GDDA 2RGBA 4GP7A 3PXGA 2PX3A 3CIOA 1SXJB 1N2CE 1CJKC 1UDWA 4DRZA 4NCNA 1F60A 2OXRA 4O3MA 1HQYE 4IRUB 1J8MF 3F0TA 5EE9A 1LVGA 1DAKA 3I5XA 4CEIB 5JCZA 2OCAA 4KSBA 3RS0A 1UKVY 3ZS9A 4DZZA 2PCLA 1IY1A 2QE7A 4GZLA 1G4AE 1R8QA 2IYTA 2V9PA 4G5OA 1E1RD 3PV0A 4JL8A 4URWR 4ESVA 1XTQA 3SJBA 4TN1A 4LBVA 2P5TB 4HB3A 3U61B 1DAHA 2CHVA 4XSGA 2IYXA 2O5VA 1AIPA 2F3TA 2XZPA 3ZD6A 1KDTA 2ZI7A 5FTLA 1HTWA 1S8FA 1UBGA 1R2QA 5H1YA 5CLLA 1G6OA 3DKVA 1OXUA 4KVAA 5DHFA 1O87A 1IN7A 4AKEA 2GA8A 4OYHA 4ITRC 1XNJA 1FZQA 3ZVLA 4C3ZA 3N2IA 5JWRA 1E2GA 4Q01A 2WAXA 3BH7A 4NP6A 3OF5A 4M1YA 2GVZC 4KBGA 1NF3A 1II8B 2R65A 4UXHA 3VKHA 2QPTA 4C9BA 2O8CB 2VPPA 4OK3A 2RGDA 2H1LA 5FPYA 4G01B 2IYZA 3HU2A 3TRFA 4X8HA 2CEAA 3R8FA 3I72A 2P5SA 1SVOA 1N6NA 1WMSA 3BD9A 4DLSA 1G64A 2JLSA 4N0DA 3THXB 2BJVA 4CEJB 3AUXA 3TVTA 1TTTA 2CJWA 1GAJA 2WWYA 1QHHB 3U7GA 2GCPA 3D31A 3HYRA 4MGIR 4R9UC 3WP0A 2CHQA 4BWYA 1NKTA 2ZRGA 2AKYA 2RGNA 2BMEA 5IF9A 5BQ5A 3U7FB 4P4UA 1Z6GA 4E07A 5GJBA 3EIHA 4Q1CA 1AM4D 1WQ1R 1NVUQ 2V3CC 1ZM7A 4HAXA 4YONB 3T06B 1E4VA 1VKJA 1M8PA 5L3QA 4Q4LA 3C8UA 4AD8A 1JR6A 3DZ8A 4OI2A 3UG7A 5B64A 3F5FA 3P4YA 1PUIA 5AJWA 3EC2A 4L4UA 5FPSA 1RRGA 4GSYA 2J46A 3L0IB 5JCPA 4Q00A 3GJ3A 2MMCA 2NZ8A 3LVRE 4GBMA 4LBZA 3WNCA 3BERA 2FNAA 1KMHB 5CM9C 4LC1A 1RW4A 4QRHA 1QG2A 1P3JA 1T3SA 1X8LA 1ZM2A 2I4IA 3BORA 3K09C 4I4LA 4KXFB 3ZD7A 1D2EA 2IF2A 4JLDA 4WXPA 2LWIA 2H16A 4C0LA 1DADA 3KQLA 1OIWA 1NKSA 3Q7PA 4BPBA 4JT4A 2IF0A 3H1TA 3ZYCA 2FMXA 1P2TA 2RGXA 4OKSA 1TPZA 4AI6A 1ZIOA 1W49A 2IXEA 1X1SA 1VCIA 3VU9B 4DCNA 3OHMA 4HEJA 5KNBA 3VNUA 1NL3A 2N1BA 4F4IA 3UMSA 2HT1A 3UXMA 1NJFA 2QBYA 3BOSA 3QENA 1C9KA 2BBTA 3LLUA 1TQ4A 4AC9A 3BFXA 2RKOA 1BKDR 1PLLA 3IO5A 1S9DA 4C0SA 4PC6A 1KSGA 4DXAA 2VHTA 4G1UC 1QBKC 2EFDB 5IHPA 1P9NA 2KI5A 2FSFA 4M1MA 5F2EA 5LB2A 2BBSA 5F3WB 2JAQA 4IXMA 4G0NA 1JPNA 4QGFA 2G9NA 4R2HA 2ZS9A 1Q0UA 1L2TA 3DKPA 4LHYA 4LV8B 4KITB 1R0WA 3EPLA 2WOOA 1G21E 1SKYB 3NWJA 5EXSA 5L3RA 3M6AA 4HDCA 5FI0B 4RKFA 2DPXA 1K5GA 2HYDA 2IS6A 1U0HC 4G5GA 3U6KA 1ZIPA 4B3BA 5JFGA 4B3GA 4TZ6A 2GBLA 3KXIA 4HAWA 5KDOA 3U44B 1XTIA 2JDIA 2ZYUX 1ZM3A 4LJ8A 1N0WA 2MMGA 2ZI9A 1FUKA 4Q1DA 4MKHA 2ZUCA 2QU8A 1Q3HA 4UJ5A 3VFDA 4M53A 1GG2A 2V55B 2WVJA 4QJ4A 3SFZA 3RDPA 3D7MA 5JS7A 4Q1FA 2GETA 3PUZA 4F4CA 2VP4A 3WNBA 1E2MA 2J3EA 2YC4C 4V0MA 5FBLB 4B34A 4OJKA 4D6PA 3H86A 3ADDA 1L7VC 3ZZ0A 2ZRCA 2D62A 4GL2A 3A37A 3PG5A 5E7IA 1T8TA 1S96A 1CRPA 2IYVA 4CT4B 1RIFA 4M8NE 4US0R 1W36B 1CKEA 1JQJC 3AF4A 4NHOA 1XCMA 3QXSA 621PA 2ZSDA 4Q4HA 1J7KA 2IYSA 5DI9A 1SVIA 4TSFA 2GHIA 2JATA 2DR3A 1AA9A 2KWIA 1R8SA 1IN5A 1COWD 2IUTA 3I5YA 2VTKA 5DNYB 4DB4A 3K8YA 2BM0A 4BQSA 3KQKA 3IGFA 2NO9A 1UAAA 2NTYC 4AKHA 1R4AA 3H84A 3LFUA 2OM2A 1E1QA 1MABA 4W7SA 1CIPA 3K53A 1M7GA 3LO5A 1Z47A 3O8BA 4A15A 4EJSA 1V5WA 3R9IA 4M9QA 2XXAA 1E9AA 4QHTA 3QKUA 3FMIA 3LQRA 3RS4A 5AJXA 3EZ7A 5DI3B 2WKQA 1OB5A 4NCKA 1G1MA 4DSNA 1AQUA 3THWB 3PQCA 1W48A 3TAUA 3LW7A 5JWHA 3LXXA 1VG9B 3QF7A 1Q44A 3L0SA 4US2R 3O8RA 2HCJB 5JSZB 3BFVA 1W46A 1UBCA 4V0KA 1G8PA 4FINA 4PC1A 2FJUA 1T91A 1GL9B 2NO7A 1MRSA 3L8ZA 1MO6A 4XVRA 4DIDA 1W4BA 2JJ1A 4FCVA 3F8TA 4A8JB 1NNEA 1M34E 3W8NA 5CLQA 2C77A 4QBFA 1FNNA 4WBSA 5L3QB 2GCOA 4DLRA 4U7DA 1I4TD 3WMGA 2YOGA 2VHCA 4JLPA 4CIDA 1JXMA 4B3DA 3MWYW 4C2TA 2ZJBA 4XOIA 5EXTA 3NBYC 4RVCA 1YHNA 1YE8A 3VAAA 4RZ2A 4M9SA 3Q8XB 3CWQA 2GAOA 1IJFA 1Z0IA 1U9IA 1DEKA 1VHLA 3U3KA 3UK6A 5TMPA 2D06A 1TUIA 1TQDA 3KUCA 4P3YA 2H5EA 2XOKA 3CLVA 4LSGA 2AWOA 1GWNA 4JZKA 1VIAA 2WPDD 3LV8A 3NVAA 4Q7MB 3DMNA 1RRCA 4PQYA 1E9BA 4OHWA 1U2RA 3B1YA 3RABA 2WAYA 1N6HA 1MO4A 1NBMD 1E0KA 3NEYA 1G3QA 3QPVA 2VF8A 2IBMA 3A4MA 5DISB 1YZUA 4Q4AB 4TLDA 5L3SA 2F6RA 2QT0A 1E9SA 4Q18A 1Z5ZA 3QOFA 4A0HA 2ZRJA 3CNLA 4LBWA 3PEWA 2O8BA 2BVNA 3TE6A 1XZPA 1YZQA 4TLCA 1XF9A 2WWGA 3AKYA 3K1JA 1ZCAA 1GL7A 3IEUA 2VHUA 3HPQA 2ZJAA 3LAWA 4ACAA 1BYUA 3N5CA 1X8JA 4W9MC 2JIZA 1QZXA 1QF9A 1NN0A 4EPXA 1Z6TA 4S2EA 4QKQA 1I2MA 3NDBB 3AVUA 2FFHA 3AVWA 2VEDA 1CR0A 4UXJA 3K0EA 4HAYA 1T3LA 2CL0X 2Q3MA 1IM2A 2BMDA 1E94E 3TUZC 3V4RA 2E87A 5A5GA 1PZNA 3GLHE 3WMEA 1DG1G 3WYFA 1BMFA 3KTAB 3T1OA 3JZAA 3LY5A 1SVSA 4JLKA 3NC0C 5C18A 4M21A 1DAIA 4MQBA 1II0A 1KO5A 5EP4A 3KB1A 1M7HA 2QTVB 1W0JD 2IYYA 3NH6A 3QKRA 5CB6A 1DO2A 2BM1A 3KJEA 1AQYA 2CNWD 3TIFA 3A4NA 2DBYA 4RD2A 3THYB 4PO8A 1ZMXA 1FTNA 4IEEA 1T8UA 3IPXA 4Z8YA 1N6KA 2QA5A 4L9WA 2IS4A 4LJ7A 2ZE5A 4QBIA 4XWAA 4YMSA 3N70A 1OT3A 3VHXA 4EPVA 4LJ9A 2EYQA 3QXHA 2GF0A 4EQ6A 3KXKA 1P4SA 2FU5C 4Y0AA 2AK3A 3TUJC 4BFWA 2HXYA 4NE2A 3RSLA 4DDUA 1Z0DA 5JEEA 5JRJA 3CB4A 3FFAA 4M9XA 4PHHA 1QHYA 2XTZA 2ZPTX 2CCJA 4NCIA 5FUYA 2JDID 1ZM9A 4OHYA 1TAGA 4KYIB 4EPRA 2CK3A 3EZ2A 2GXUA 4HLDA 1ZBDA 2GXQA 2KSQA 4URZR 1G8GA 3DO6A 4OBEA 1HEIA 1MABB 2I1VB 1KK2A 3BGWA 3PJRA 2VSOA 5FUXA 3ZVNA 1WE2A 4QM7A 1OFIA 5AUNB 1ZNYA 3EWAA 4BFUA 1CJUC 1XTSA 4E09A 3EA0A 4DLYA 3LDAA 3PEVA 3NEJA 3CUEF 1G3UA 1OFUX 1P9WA 1ZC4A 2FG5A 2N46A 3ADKA 4GNKA 1AK2A 4JL6A 3SNHA 2UKDA 5KSOA 4ARZB 1N5LA 5DHAA 1DAMA 5KU1A 3OIYA 4Q9HA 2OHFA 2P6NA 5IK2D 2C2HA 2H57A 4B73A 1Q12A 1YQTA 1T4GA 1QHNA 1A7JA 4LJ5A 2GTPA 3CWZA 4L15A 1NSTA 4LHZA 2NGRA 1CP2A 3EPKA 4GMDA 3IO3A 2F3RA 4PZYA 3LQQA 2L0XA 3V9PA 2V7QD 8OHMA 2EFGA 4PR0A 1KAGA 5EZ6B 2KBEA 3UIEA 1L4UA 3CRRA 4URYR 2CVHA 4EFMA 3NBZC 1E1QD 2IT1A 4KFUA 4MGZR 1DTSA 4UXIA 2BC9A 2R44A 2PZEA 1UFQA 1JNYA 4TMZA 2FZLA 2GZDA 3HU1A 4EDHA 3SYNA 2ZRIA 1KI3A 2H7VA 3GJ7A 4FIDA 3ETLA 3I3SR 1KDRA 3E5HA 1N5JA 3ICEA 5SZHB 5JHGB 3MWLA 1S4QA 5E4FA 2A2ZA 4K46A 4BLRA 1KI2A 5HPYB 1XPOA 2WIBA 4LWZA 5FR1A 2B7CA 1GL6A 4RZXA 3PIRA 1IJEA 2LCFA 1LTQA 1J8YF 2BIFA 1FQJA 2ORIA 4A6PA 2VL7A 4PXAA 1PLKA 1F2TA 2IA5A 4OQMA 1OXXK 1FX0A 5BYJA 1KK0A 1IXRC 2JJ1D 3P1JA 1DE0A 5J4KA 2OLJA 3KDSE 2A30A 5FUVA 2P3SA 1SQ5A 1ZUIA 4NTZA 4S35A 2C5LA 4LYFA 4M1TA 4JLJA 2FFQA 2V54A 4TMVA 3TK1A 5HE9A 2W2VA 3Q3JB 4EUNA 4LCBA 3JZMA 4U02A 4ABYA 1WRBA 3H2YA 3KKNA 2FX3A 2QEQA 2WWFA 1LS1A 4GI7A 4LZZA 3C5HA 2ZRBA 1OH7A 3NIBA 1F2UB 2PMDA 2IYRA 3RRZA 1OFHA 2BHRA 2EWVA 2YHSA 4KLZA 2VP6A 1CJMA 2ONKA 4PX9A 1RJ9A 2VSFA 2QG6A 3RANA 1JBKA 2ZJYA 4Q4JB 4QGAA 3FHOA 2IX3A 2IYQA 1N3BA 1TF7A 4HLQB 1JI0A 5FBQB 1E6CA 5HE8A 4P4SB 4TYPA 2F43A 3REGA 2BEKA 3P4XA 3SBEA 3ZIAD 4DKXA 3QEOA 4LPSA 4XVQA
chains in the Genus database with same CATH superfamily
4ND4A 2ZWVA 5I51A 3K72B 2JBHA 1T36B 4UVDA 1E7SA 1KDYA 4J3FA 4FE3A 2PNFA 3LQKA 1RLTA 1VG8A 3OZBA 1VHTA 4CL0A 5HNKA 4WX2B 1FJ2A 1MC8A 4RHUA 4DLLA 1XHFA 1CRZA 1HKHA 2WTNA 4R81A 2FWPA 5EXEA 5GVRA 3V32A 4AJ4A 3O1JC 2R8XA 4OP3A 3V4OA 3AT1A 2D7CA 3CLRC 3RVDA 2VBCA 4FCCA 3UJNA 2OA0A 1E3TA 2OILA 2ORVA 1OYWA 1CTQA 3SIPA 3OTWA 1SOUA 3G5AA 1ZITA 4JP2A 5HF5A 3C98A 2WKPA 3IUQA 1W35A 2UUPA 3FWZA 2B1JA 4YCDA 1UZLA 2ZSBA 4I55B 2X9LA 5JNUA 4BP1A 2BTQB 1RHQA 5F51A 4DW8A 2ZR0A 2OV6A 2QV0A 4WN9B 1JTEA 2VAVA 1KI7A 1V0JA 3TB4A 4GL4A 4YRBA 1UK7A 1PGNA 2ISCA 3R5HA 3EG9B 4H3SA 4KX3A 1Q7CA 4D99A 2C98A 2TECE 2XB8A 3P2MA 2AG1A 5I7OA 1S2GA 1WDLA 1XVVA 3I01A 2VHZA 2ANBA 5DZSA 3UJHA 1XZFA 2MSWA 3TSZA 4A0FA 1NG9A 2ESRA 3ICCA 4EY3A 2UVPB 3V4ZA 3M6WA 1NVKA 4L28A 1X87A 2IE8A 3VTAA 2Q5FA 1UJ5A 5LA6F 1JJFA 4C03A 1FUEA 1O5IA 5H80A 4TKUA 1MIOA 3UF0A 3NXSA 1MAVA 1O7JA 2DBVO 3KZ1E 2N75A 5DF1A 5B6PA 5FWNA 1UQUA 4ZCIA 1VXRA 1GGJA 3IJPA 1BXGA 2FK8A 1VKRA 5FBKA 4ZICA 1WUIS 1F0YA 4OQPA 1XAJA 5FHQA 1G38A 3NTLA 2XZOA 5EC8A 2VTBA 4DB2A 2HYIC 5MHTA 4NL4H 3T5PA 3ZE1B 1KVUA 5EWMB 5I5EA 1KFJB 5AQ1A 3GCWA 1CRWG 2YBEA 1UJ2A 1KXZA 3CX6A 4P54A 4QEKA 1TECE 2D4AA 2P62A 3MERA 4X1YA 3D3NA 4KDRA 4DNPA 1CDZA 5B1IA 2Y1GA 1I0IA 4CTNA 3OZVA 5JFOA 3RKSA 5KNCH 2YIDA 2AKAB 1FVXA 1YGYA 1ABEA 2JBAA 4I3FA 3N87A 1FQKA 4LY6A 4NV0A 1KQGA 2AZDA 4DSZA 1K89A 1IQUA 3LKZA 1ULBA 4QREA 1SBYA 4KQGA 1SCJA 4BQPA 4R84A 1V5FA 4NH0A 1LLDA 3E4DA 1DXYA 5E1DA 3VAYA 3TW8B 1KEPA 4F9GA 5KSWB 2FMHA 2WTAA 2QROA 2G0NA 5FXMA 3QEKA 1P7YA 3AEZA 2ZVPX 1FMFA 4QO7A 2P2LA 3IOYA 3PVSA 5F77A 5AVQA 1I5RA 2XBLA 1C14A 1KO4A 2OV8A 1SVWA 3MOIA 3OURA 3GJRA 1M8KA 4IDNA 1EP2B 4N5MA 4Y9UA 3W78A 3PJDA 4ZJYA 2IQ5A 1OZAA 3EPPA 2X8LA 5FOWA 2O8DA 1COWA 1U8AA 1IH8A 1OJ7A 4OD0A 4YLEA 1XEXB 3MSXA 1VBKA 4RHFA 1M5UA 2BWJA 2L82A 3LNCA 5CTAA 4DQDA 1X14A 4GOJA 5A62A 1KKUA 4K9LA 4WUTA 4BN4A 4GHWA 5BY2A 4E30A 2ZIEA 3DDNA 4KPYA 1S2NA 4MKGA 3ROXA 2WF8A 3ZE6A 2ID7A 4DEYA 4KIUA 3H4IA 2G76A 5K4GA 4ZO4A 3WDLA 1HMYA 4UQPA 3N0VA 1O03A 3LHDA 4YPVA 4JYBA 4B8ZA 4AS1A 5J4VA 3P5BA 1G5RA 4DANA 4KACA 5AM0A 1SB8A 1JN0A 3C5EA 3K0AB 3GA7A 3PNBA 3MGCA 4MGYR 3DBHA 4MWOA 3GI1A 4MKIA 5IHXA 2Q6TA 2QYHA 3FTCA 1UQRA 4KCGA 3P4UA 4ZO9A 1XDSA 3EZLA 5B7QA 3OHPA 4YQFA 4XB6B 5BW8A 2NZVG 1Y6JA 2C4UA 3HCCA 3W4JA 2JI4A 3IDZA 1DTWA 1V8OA 4TMYA 3X2FA 3PRYA 4G4IA 4G0WA 2JRCA 2WTXA 4IYJA 1BU5A 3PDIB 2VHEA 4X95A 4R9SA 5HDQA 3DB1A 2EP5A 5E0OA 3L82B 4JP8A 2I7DA 2J0SA 4LRWA 4AY4A 4Q05A 1ZL0A 3COWA 5DP2A 4JLWA 4CQNA 4HLCA 5A0VA 1MJGA 1WW8A 2VA9A 2WTUA 4DV4B 5F78A 5GADl 3GXOA 4EIWA 1KRXA 3SU8A 2H1WA 2CHUA 3WIBA 3T34A 3ZI7A 1A9RA 4QDJA 2EWWA 1EPUA 1AZSC 2XKKA 4FFRA 3A6ZA 4MQEA 4LRXA 4YCAA 1JEDA 2ZTSA 2MSDB 1VJCA 2PH3A 3D59A 3MWGA 4G5RA 4ZOEA 3HKCA 4RIGA 1NI4B 1PAUA 3PPIA 4IFBA 2GTHA 4K40A 4J1TA 3SFVA 4O0LA 4XSVA 3FPFA 2QJOA 4EFLA 1I6KA 2Z2ZA 1XRMA 2KE5A 4QPZA 1R3UA 3CONA 3A6JA 2QPLA 5TMDA 1N6RA 3BHNA 4G0QA 4I81A 3E1KA 4QA9A 5JEDA 4O2BB 1Z6QA 3I04M 3EZXA 4JJKA 3EMDA 4F4UA 5B6IA 2GB4A 3VOBA 1QCDA 3C3CA 1C0PA 3WGTA 2WPDA 3B12A 4PQGA 1AQIA 1PFQA 1G42A 1D2GA 1XMVA 3D3EA 4NJMA 3RW9A 3IUSA 3KALA 3ROPA 4AECA 1U8TA 4IQFA 2NU9A 2ZSKA 1OLOA 4XDHA 3SBXA 5B3KA 5K99A 5JHGB 2DXIA 1CVLA 1DNPA 4ZOLB 2LCIA 2QGFA 2LIPA 2HF7A 3EEYA 3K30A 5ER9A 3O3OB 5JQGA 1IK4A 2ODEA 3QF4A 4JIMA 2DKOA 3GLHB 2YY6A 1JPUA 5K3FA 2VHYA 1XT6A 2PWYA 3DAHA 5HTKA 3V1LA 4A5SA 1IY8A 3GUHA 1ZOPA 3OG9A 3DLIA 1H66A 3QKSA 4AN0A 3GDWA 5B7NA 5IAEA 5C8YF 2D3TA 1DPGA 4GF5A 4FB4A 2VDWB 4D9MA 1VPTA 3VXKA 3OWOA 2VTVA 1GCUA 3YASA 1IRIA 4REOA 5KHOC 3L7IA 3D7RA 4DWWA 3N8KA 2IH5A 3B1FA 3PTLA 4TV8B 2YZ2A 1M2VA 1SXPA 4N54A 4BNKA 3GNLA 3M34A 3ZIDA 4E5KA 5AI8A 1WOYA 4TL6A 2GCEA 5LN1A 2P11A 3Q5DA 4BVJA 5JHHB 1DKUA 2H7CA 4AG5A 3TQIA 3TM4A 2ZAIA 3NBKA 1XUOA 1Z0KA 2XDYA 3P20A 4Z54A 2DPLA 1JS1X 4ZO8A 5A5VA 1DFGA 1JHPA 2Q6KA 2R62A 3M3PA 4FYPA 4QGGA 4BWFB 3A1WA 2OT3B 1NLYA 2DKFA 2GEBA 1VB5A 2KPOA 1WJGA 1GUBA 4GOKA 1P60A 1IXZA 4CV2A 4L5JA 1T4DA 1X3SA 3WMFA 5LKAA 5LYJF 1DJQA 2C2WA 4V3CA 3JQBC 3RT1A 4RXMA 4P7GA 5ALLA 3G9XA 1I2CA 4JU9A 1SZCA 3RIGA 4I1YA 3IT0A 4IFEA 4OJMX 4D5GA 2PGAA 1X7XB 4ZI3A 4EY4A 3UK7A 5LQSA 4BLUA 1KI4A 1KAOA 1IY2A 3SDSA 1RQ7A 1D1SA 2ZBPA 1WDMA 2I66A 4TTAA 4YHBA 1NQTA 5PGMA 5I45A 5IVPA 3SZ3A 3E2PA 1EXWA 4BNVA 2V8OA 4OA8A 4OQFA 4EG8A 4X64B 4O25A 3DEFA 3I5AA 3ZGVA 4HVTA 2EAUA 4D8YA 2XF2A 1M6HA 1P2VA 1QVAA 1X2BA 4TRRA 3U48A 2DCMA 4G84A 3UMVA 1IOWA 2X9QA 3CN7A 3O0DA 3ZBQA 3F7TA 3ON5A 4KE8A 3MB5A 3K2QA 3SDBA 4CTJA 4B2YA 2HCTA 3OHSX 4UEQA 3T8YA 1U28C 4MW6A 1XCJA 3S8MA 2QAIA 2X8WA 5ALPA 1NNI1 4YMGA 5BVHA 1DCKA 4IGIA 3VC7A 4PZAA 5CCBA 1TVKA 1BDJA 2ZTHA 2VZLA 3SIWA 4I6GA 2WHRA 3G2QA 3I9OA 3IEKA 1O8CA 4FKBA 1AXGA 1UOEA 3BSWA 1UXGA 1QIDA 5CBKA 3EX7C 1A4RA 5J2UF 3A1UA 3WGJA 4CNBA 3KYCB 2QQ5A 1YBFA 4WFJA 2X0EA 1NW4A 2QL7A 3SPXA 3KLMX 1D4AA 3HCBA 1Y5IA 1E7YA 1KJ9A 3KSBC 4OM7A 5BMOA 4W5WA 3FCUB 3RS3A 2O3UA 4KE6A 3HRIA 2VNJA 4PZDA 4TT3D 3QG1A 2PIAA 5AOCA 5EJ4A 3GU3A 2IYUA 4IGFA 4KK4A 3H17A 4LOKA 4BVBA 1QOZA 3PNOA 3F2IA 5HOQA 3NPMA 5BSTA 3ZCRA 4PG4A 2HZ7A 1YJBA 4CLXA 3AI3A 3WRYC 4EJMA 2PY6A 1ANKA 3A6FA 3B1JA 1E7WA 4OFXA 3Q7QA 2BUAA 4INAA 1SG6A 3RYCB 4WCVA 1SHZA 5DYIA 1R9MA 3N6VA 3Q41A 5B30A 5K09A 5JD3A 1KKMA 1Z06A 1CNMA 3AY3A 1W44A 2IZ6A 3HB9A 3W6OA 2D2XA 1LF0A 4OAPA 3GAFA 2VEOA 4W8OA 3DLBA 4TWBA 1EX1A 1Y4AE 5KTTA 3HV0A 4F96A 2BFCA 4DRXB 4E33A 3X1YA 4OGWA 5KTOA 1E99A 2ZRAA 4O5OA 4DR5B 1HYHA 3T9BA 1H2ZA 4KBFA 2ONZA 1KYVA 3RFVA 1N7IA 3VV3A 3E3LA 4NC9A 4HDOB 4XH9B 2VJKA 1Y80A 3NGLA 4RJTA 5TLSA 1PG5A 1YMUA 1IG3A 3PYMA 4M1KA 1BDIA 3L8CA 4ENTA 4B2LA 2II6A 3SHQA 4L8FA 2D0PB 3TQSA 1DJMA 5EVJA 1SOVA 5ERYA 1B2LA 1Q74A 2W2TA 1YO6A 3CTMA 3Q4GA 5KNDH 1UXJA 2AYZA 4KDFA 5H3LA 1UEXC 1V2HE 3ZJUA 2IYFA 4IG9A 3JQQA 4R9NA 1AK9A 3ZTYA 2G0AA 1JEOA 4XUGB 4S04A 1W7AA 1I2BA 4L78A 2O2EA 3RS8A 3PVCA 1WP9A 4AJ2A 1XTPA 1A5SB 1JFFB 3DZIA 1NDHA 3CE6A 3C43A 4Z4EA 4EI9A 1CY1A 3TEMA 1N9GA 3T7IA 1PSZA 3TKAA 1ZK4A 2GLTA 2O2HA 4M76B 4RTRA 5EYPA 5DYGA 3QXCA 5CJJA 4B9AA 3FOAA 1RS0A 3FPHA 1Z5OA 2R5FA 4LX0A 2IYOA 2JG3A 1VDZA 4DV0B 1EXNA 1SUFA 1Z38A 3DNFA 1V1RA 2LDXA 1MAHA 2WUDA 2O8FA 1LPPA 4BBJA 4ZYLA 5EMKA 3BIXA 1N8TA 5U1PA 1WXHA 4JVSB 4EGFA 4HH4A 4AZ0B 3CTPA 2WABA 1I3MA 3E2IA 4FYKA 5EJ5A 3IAFA 1GPWB 2Z8ZA 3DT8A 3GGCA 3DHNA 1TVMA 2ZGVA 2HWYA 4ICIA 4N82A 2OO5A 1HT1E 2XVMA 4L8WB 4LMRA 3KV3O 3RSCA 3EIUA 1R5OA 3TM5A 3VDXA 4TYWA 3VZQA 4IWYA 3WMWA 4DUGD 4F86A 5JDCA 1K68A 3K05A 1HF3A 5BWMA 4GR9A 1W47A 1YVDA 2JLRA 2WHPB 4PZLA 3F47A 2X8JB 3T1NA 1C1HA 2ZUBA 4ZEMA 4CGYA 1E3QA 1JJBA 4MPPA 3GJZA 3WLPA 1KNXA 5NULA 1LK7A 2PIDA 2XWSA 2IHBA 3DD1A 4B83A 2QBYB 4DIFA 4DDTA 2JB9A 1R9NA 4PAQA 4TTIA 3X2EA 3FOFC 4XCVA 1AUQA 1I1NA 1UWCA 4PC7A 3MYRA 4LXYA 5C53B 3DZGA 3H5TA 3KR2A 5DNAA 4K8OA 3SKYA 1CY4A 2OWEA 2JJ2A 4RD3A 1RWWA 1KJ8A 3PX2A 3WB0A 5JFTA 1K6EA 1OWLA 1XVLA 2D00A 4P86A 3D9QX 3NHUA 5IC4A 1L5HB 3CUVA 3HEBA 3MG9A 5FBZA 5KQMA 4ZYUA 1QH9A 3TLKA 1D2CA 1N1MA 3R3VA 3OAAA 4JK3A 2GDJA 1L8AA 3O8QB 2I1LA 2WVGA 3DEYX 3IVRA 4LJSA 2F8SA 3C4QA 4OH7A 4AKIA 1OXKB 3KOZA 4RMGA 5JY1A 2JAXA 3DM9B 3ESQA 5GOTA 5BRAA 4LFAB 5B6JA 3N6RA 4TQAA 3DNPA 2HU8A 3JV7A 4JD5A 4NLLA 2QTLA 3FYSA 3L7JA 4GEGA 3PK0A 4PYQA 4OL0A 1MV5A 3QXXA 4MAMA 4R7ZA 1KPHA 4DA8A 3ADCA 4B6RA 2JLWA 4LF6B 3R4VA 3ACBA 3IKLA 3BWCA 1C2YA 1MJGM 4MHTA 5EE5B 1Y37A 4ZT4A 4DQUA 1OW3B 5EHXA 4EABA 3AMVA 3ZCQA 4ZCQA 4YJHA 1GN9A 5I8PA 4DMLA 4QYWA 4ETMA 4CW7A 2HA7A 1E7RA 1SUSA 3EQ8A 4E4YA 4YCCA 1JRLA 3UGKA 5DRYA 3DWFA 3QGMA 5EZSA 5J2TB 2GXAA 3CUKA 1RPNA 1D6MA 2BP7B 3QU5A 1GPJA 5E6UA 1AS3A 1P17A 1NG1A 1XCBA 2FG7C 3E5NA 1HZZA 2PKYX 4IIJA 3PUYA 1L5FA 4PX2A 4U63A 3TOVA 821PA 1YBVA 5H83A 5GPBA 2AFIA 3EXEB 3VA7A 5SZJA 4DLBA 3EXFB 2OCYC 5AM5A 1HGXA 4KVZA 2GAJA 1LX7A 2GMWA 1WAMA 2CLSA 4IIGA 3R0QA 5FBWB 1W2HA 4OF4A 2HA2A 2HMWA 5HVNA 2WD8A 4IFTA 3GYBA 1H85A 2EZUA 4FEYA 3ZBUA 3EDRA 2CUZA 5CB8A 1IATA 1Z15A 2C3MA 1Z28A 2Q5LA 2QUKA 4JQZA 4MI1A 4MWTA 4CR6A 3BWDD 5CCXA 2A3RA 3NU1A 3E35A 4BATA 4FDLA 5HF8A 5HW0A 1UUFA 3NYQA 3CFYA 2QXUA 4HL6A 2OUIA 2V5UA 1N6OA 4IKPA 4XJVA 1ZL2A 2EFJA 5DHUA 5AKYA 5K0TA 3NAGA 5FYDA 1LD3A 3BGOS 1J20A 3DDWA 2HSDA 3U26A 4BE7B 5DN6D 4N41A 2W2PA 4BIMA 1RWXA 3L49A 1DINA 1XWFA 1H65A 1XC7A 2B8TA 2BFAA 4CKCA 4DSAA 3MGAA 4ZGBA 2JGDB 2XTNA 2NO4A 2C99A 4EJSB 2D59A 1OLSA 2FW8A 2X0RA 3DCIA 4XA8A 1U9IC 2FWRA 1PT9A 4B4UA 5HS6A 3BWEA 1NYLA 4FFDA 2WKWA 2JCGA 1L9KA 2E4ZA 3Q3EA 1HYBA 1D4FA 3W5SA 2AG8A 2A84A 2CXXA 3IDSA 3OZCA 1JHAA 2WTBA 2EW2A 3N07A 2CCGA 1SU7A 4PVDA 1JAHA 5B53A 3VUFA 4D8VA 5K8JB 2GYWA 1J2TA 1LZLA 1W581 1BX1A 1RJGA 4ZKDA 1EM8A 1W59A 4GW3A 4C4YA 4H17A 5DP1A 3OUUA 1AQLA 2ZB2A 1Z2CA 3JQAD 3ZK8A 1MX5A 2YMPA 4LF5B 4KK3A 1ULAA 3G1WA 4G81A 2QJFA 3N2ZB 5FI5A 1XCGB 1TJ5A 2XJ9A 1JHDA 2GZHA 3AIKA 3T0GA 1T6ZA 4YXWD 5EA2A 2J45A 3L4EA 2NOAA 1C1YA 3U7HB 4ZEXA 5DYNA 1RJWA 1K1EA 3DE0X 3QP9A 2GCOB 2JIMA 4DZRA 2V7VA 1BJRE 1DX9A 4IRMA 3ED1A 4W9RA 1NMZA 1IYZA 3KBOA 4QVGA 5HKOA 1N2GA 2MSNA 1M66A 4Q93A 2OAP1 5H02A 3U4HA 4AJHA 3N8IA 1P39A 5EKSA 1P1IA 3GFRA 4YCNA 4FDAA 4G37A 2QHXA 2JHPA 4RY2A 2DLNA 5TY0A 4W5RA 2PQ0A 3IP8A 5EJ2A 4HLUA 3BULA 1R9JA 1LA2A 2R7NA 3G0DA 4X00A 5JUWA 2I03A 2Q5OA 4GE0A 1H9CA 2WUGA 1S6YA 2F90A 4N6OA 4EG4A 5A7GA 1E96A 3MWDA 2JLUA 1OGJA 2Z9DA 2YC2C 2ZWIA 3PGXA 2JCYA 3STTA 1NTRA 3PHGA 2QZPA 4KEAA 1G17A 1KYIA 2FSVC 3K9CA 4F3RA 4NF2A 4A2PA 1QNLA 2RB5A 1FS4A 4GKBA 1PNRA 4NBNA 1NAHA 1LDEA 3E7WA 4RPIA 3VH2A 3RS5A 5KYYB 2D5IA 4P83A 1E9DA 1BH2A 3F74A 2ZR7A 4WUVA 1B0AA 1UC5B 2W8BA 4KGXA 1Y6RA 4AJ1A 5B1HA 1SGWA 1GPDG 3ZWYA 1KI1A 4ZCLA 3GEEA 3Q7TA 2DYKA 3J7TA 3K1TA 3QA3E 4NBVA 4X41A 4X20B 3PGMA 5L3SB 5C4GB 2RDMA 3ZWOA 2UU9B 3SKVA 1PNOA 3T35A 5AICA 4BMPB 3HWRA 5JPCA 2CL7X 1E79A 1PJ2A 3PE6A 2O8BB 1KARA 3HU5A 1ECFA 1XQ1A 5EPEA 1LGYA 3WBJA 4MUXA 3TG2A 1RRPA 3ZHVA 2YJ4A 3RVRA 3W2IA 3EK2A 2QUHA 1OGYA 1SXJA 4NV3A 3DYVA 2Q6VA 2W2KB 3FJ1A 3TD9A 1TFRA 4BNDA 2YKGA 4L02A 4UM5A 3RYHA 4GX5A 4MIKA 4GWLA 3FUCA 1RLJA 5HUHA 5D3KA 5LLTA 4CEIA 2O5CA 2XHEA 3V9AA 3ZGXA 1C2TA 1XXHB 4EATA 2CYCA 4HVAA 3WSWA 1N2JA 1YH3A 1MC1A 5F3RA 2R6R1 3RWOA 3ZDYB 1IDN1 2FFBA 2PU5A 2O07A 1GTVA 2Q99A 4GXRA 4X1KB 5CPBA 5TARA 1UKCA 4LCJA 4DEVA 1CD5A 2WZDA 3CO5A 4I8XA 3RTBA 4ESOA 1SZPA 4K7JA 4AO6A 4ZOAA 2B61A 2FCRA 4AJJA 1SFRA 3OICA 1A88A 3UJDA 5F98A 4CZ2A 1NJ2A 5C7YA 2HRQA 5K6RA 3DT6A 4B44A 1GG8A 4F12A 2VSXA 4K1LA 1YS9A 2NXNA 1ONOA 5DB4A 1RJDA 2EBWA 3PPVA 3P9RA 2VYVD 3M3DA 4LJYA 3UQZA 4B6GA 3UAGA 1GZSA 5J47A 3FB1A 2AOWA 3LKBA 1VLJA 3ZTWA 4C7OA 1H9BA 3JD0A 4HQNA 4CT5A 2P6MA 5ERGB 4G9EA 2H4WA 1J25A 4YAKA 4YRRA 2QLMA 3CGWA 2XI4A 3ISVA 4DM7A 1NMSA 2XTAA 5KYXB 3OZIA 2V6BA 5EEGA 3SHTA 1II8A 2DUUA 3LUJA 4M7OA 4WZBB 1GL3A 5HMLA 3USZA 3STWA 3Q7RA 4YEDA 5GTDA 1EUDB 1FMTA 2FZVA 1EKXA 1W96A 3DFMA 2CHGA 3M1IA 3QELA 4KU4A 4YRQA 1L1FA 1U7PA 3ENKA 4J0IA 5ALUA 3HUEA 1ND5A 2BCEA 3HWX1 3QMVA 4RTSA 2O2YA 4N3NA 3JQ7A 1SCUB 1KY5A 1P1KA 2QT9A 2H4HA 1DRJA 4ND5A 3S0JA 1T6BY 2BGNA 4WA8A 5K9ZA 3M6VA 3VX4A 2QPAA 1P2SA 3DXFA 3GRFA 4D8XA 2COKA 3WGGA 3E2MA 1YJCA 1NLMA 1E2NA 2R1ZA 1FP7A 1Q6ZA 1ZBQA 4YAIA 2GARA 3IPAA 1ODKA 1H0RA 2W6JD 4FHZA 1GA4A 3I3OA 1P0QA 1NW3A 4CV1A 3N59A 4WOBA 1USKA 2J6HA 4G5QA 1GRVA 4MV7A 1R6AA 3EVGA 3KU1A 4UJ3A 1M6WA 4Q7LA 2QLNA 2A1UA 4P84A 4B2PA 3W5BA 1XTKA 3HGQA 4M87A 1P91A 2AD1A 2VP5A 3K0BA 4F8EA 4ZU3A 4E31A 2FGKA 2X0KA 4KXYA 4NCBA 4O08A 4XB1A 4BL5A 1D1PA 3ZDFA 1HTTA 2BOVA 2J7PA 4NQRA 4XWKA 1XLTC 4KLAA 1WCWA 2HJVA 3E9EA 4PZUA 3VPCA 1U0EA 3I28A 3NOOA 2G8NA 4F1WA 4KPUB 3A7EA 5G53C 3EF3A 5C8ZA 1IBKB 2H5JA 2IEBA 1V1MB 4G0YA 1IHXA 1A2OA 3W05A 4YDSA 3DCJA 4KW7A 3VTKA 3FAZA 4ALLA 5CG2A 5U9CA 2CNDA 4UQOA 4AYWA 5DO9A 2WPNA 2ASEA 3NX4A 3UY4A 1C1DA 3IHKA 4MP8A 2FMKA 3GJQA 3TR0A 4DG9A 1A8SA 3QQ5A 5D86A 1M2EA 2YIMA 4ZMBA 3UWOA 3VU9A 1HLGA 1JSXA 1XI2A 2ZS8A 2QSJA 4ND1A 4A7PA 4C5BA 4F4DA 2QTWB 4QQKA 2IEAA 2PX5A 1YI1A 2FP3A 4RX1A 5EIAA 3PSAA 3GGOA 5HIIA 3UOAB 1NRJB 3DZFA 2DR0A 2ZUFA 1ZOOA 5A0FA 1NJSA 1G2OA 1QV6A 4B3XA 2B8WA 1EESA 3PQ2A 3QFHA 5AWFC 4TRNA 1JH9A 3F9IA 4FW9A 5GAJA 1DAPA 4M8IA 4LYJA 2A5DA 4OMDA 4NFHA 4WCFC 4MIYA 2X4DA 2HU7A 4G1BA 5J58A 1XQYA 1YRBA 3OU2A 1LLFA 1U2SA 4OTZA 5A4JA 1GNPA 2LXNA 3IB6A 3N2KB 3TPCA 4JH0A 2PKQO 4L9RA 1IBLB 2O2IA 1G6HA 2QX7A 2ODBA 1RTKA 4MQMA 1LBTA 4NI5A 4CTKA 4OQEA 1VJGA 2ZYRA 3UKDA 4ZRNA 3K71B 3EWSA 3MUFA 4KR2A 4MVJD 3WWEA 3MLAA 4FWTA 4PW0A 1FVHA 2RGRA 4MW7A 4XD7D 5KMGB 3TXXA 2OXTA 3WWYA 1CUFA 2DWPA 3EVNA 2FE1A 3SEFA 4RH0A 3GR6A 1Z83A 4JLMA 5FPQA 4FWIB 1MX1A 2AXEA 1GZVA 1F12A 3R7BA 4BMSA 1ZPDA 3A4YA 5CURA 2OO7A 2WFMA 2DH6A 3N53A 3RFXA 3ZG6A 2R1TA 3K92A 4AP6A 1FE8A 4KAXA 1FTYA 5DTIA 1AS0A 3DG9A 3UT5B 2PGNA 3W6NA 2QW0X 1K5DA 4DDWA 2JIBA 4O0MA 1CB0A 1KORA 4GDFA 1N3YA 2IEYA 4B17A 1K2WA 1JLSA 2R6JA 5DNCA 4Q9NA 2NZ2A 3OZAA 4W5NA 4RCVA 2PMFA 4PC3A 1DC8A 1LRKA 2YHIB 2CHFA 3X3HA 3GCGA 4M6WA 1HYGA 4YRCA 2OD2A 1QH1B 3WLSA 3UUGA 1BVYF 1HTBA 1ZINA 1IC6A 5HDBB 5I7UA 1NHWA 1PQ4A 2G0TA 3CT4A 3PGVA 4IICA 2ZR9A 2CDNA 1I94B 3FLMA 1YL5A 1V8ZA 1H05A 2Q9CA 3BRWA 1C7ZA 2WJGA 4DV1B 2YIJA 3VDNB 4R51A 3ZR4B 4CM8B 3L06A 1MIHA 2NU7B 2PGDA 4WSOA 2JHCA 2Z8XA 1JA0A 1VOTA 3PTZA 4JBNA 2AEJA 1JKJB 3AEQB 2BMVA 2XB4A 3PYLA 1UEIA 3T38A 4J9VA 1AKVA 3IHTA 1NQAO 2R84A 4LF7B 3WAJA 1U9YA 3IAS1 1X7GA 1G7CA 1KDOA 1ESDA 5EJGA 2Q9BA 2V1XA 4IEIA 4YMTA 5SZKB 1TYAE 2NP6A 2BM8A 4KMSA 4D44A 3R6GA 3KDPA 3X1XA 1A9SA 2PV7A 1O77A 2YJ3A 1CDOA 4M86A 1ZNQO 2BFBA 2H63A 3LPCA 4NOKA 1OH6A 1OZHA 5DI3A 5K0LA 4EB6B 3LBIA 4QOEA 3LTNC 4Z0TA 1MVLA 2P1RA 1CYDA 2V0NA 3FBWA 3ND9A 3EIOA 3Q2IA 3SICE 4BS9A 5HZHA 3WSTA 4F4FA 1FRZA 3Q9NA 4MKFA 4EUHA 2FEWB 3LT1A 3SOZA 3FUXA 2JGRA 4B75A 5C1PA 1L6IA 2ZU6A 3ZWWA 1YRHA 5FOQA 5JO0A 4LOAA 3AF0A 5JSZA 3HYCA 4MO2A 3TNYA 5JAUA 2QZJA 2A1IA 1M0WA 3ESXA 2V96A 1NVAA 2KJQA 3LC1O 1A71A 1ZKDA 3T4UA 2XGJA 2MYTA 3GUYA 2P27A 2VQSA 2F1IA 4JBLA 2MYPA 5ICCA 4Q9DA 1NQUA 5IXJA 1FMLA 3GT7A 2AFHA 1SG0A 4LSZA 3IXMA 5GOZA 2FG6C 2BFMA 1ZWKA 2PA3A 2M2IA 5I9SA 3JU3A 1VG0B 2NADA 4HDKA 7MDHA 3CVVA 1XNGA 2G9ZA 3FPSA 5LXTA 4XPIB 3C3MA 3TO5A 4JWTA 1IL0A 1H4SA 1FNDA 2W6ID 1LDGA 2V03A 2C3PA 3MXTA 4NG5A 3DV9A 5JADA 4KTVE 1Z4MA 1TKRA 5U4QA 3I9JA 1WMDA 8LDHA 2O8EB 1Q19A 1YR7A 3L40A 2Q5EA 4RV4A 3F3SA 1QRUA 2D0DA 3L6CA 4IINA 3GOHA 5EEHA 4LXTA 4UKDA 5A9SA 2YOHA 3D8TA 3RK1A 1ZOLA 2EEZA 1SB9A 5FP0A 4JLOA 3C41J 2FWBA 4CQMB 6PFKA 3C87A 1DRVA 1NV9A 2XX3A 4IX9A 4RF4A 5IARA 3V55A 5HIKA 2Q41A 1KTIA 2W2XA 4CKWA 2VSQA 4LOLA 3QU9A 4G36A 5TRTA 4NU5A 4DSOA 2I4NA 1UDBA 3FTFA 1D0IA 1TIPA 5C32A 4I1VA 2NZJA 3A1TA 3IAEA 2UZIR 1ESMA 1G8SA 3SF0A 4BEBA 1KK1A 1E69A 3B1XA 5JG7A 4DUZB 2OGTA 4D1YA 1BRTA 3KR1A 1E2UA 3X1DA 1XQ6A 3QTLA 4KXQA 1BS1A 1YL6A 3EZNA 3LGSA 4R8LA 2VRWA 3FWPA 1EE2A 3O4FA 2IOFA 4KDCA 4PRLA 1SJ9A 3SC2A 1R5JA 1HX7A 2YVAA 1GCGA 1JDJA 2ACWA 3CQ9A 3F2VA 1K3TA 1MLDA 2ZYSA 3Q7IA 4PANA 3HJTA 5DWVA 3JQDA 3KK0A 5BV7A 2C7RA 3RNOA 1CUWA 1D07A 1A8PA 1Q21A 2XNDA 4MQ5A 4ZTUB 1UP6A 1N0IA 2HNBA 4E14A 1JR3D 5EJEA 1JIVA 1V7ZA 4FR0A 2WHQA 4N5LA 4YJ3B 3H04A 3OZTA 1KZHA 4YMLA 4J1TC 4C30A 4B1FA 4XLLA 4BGVA 2AC4A 5B12A 2PZKA 2J41A 4L9AA 3IOCA 2P75A 3KTAA 3QX7A 3BILA 1MHTA 5B5SA 2OV3A 4RIFA 2P2GA 2RGNC 3NC4A 1Y5NA 4UE2A 3ND6A 2D54A 4XR4A 3CY6A 1AB5A 1WV0A 1ZM4A 1TF5A 2ZYWX 1EFRD 2H2HA 2QUBA 4PG7A 4E6PA 2GAIA 4H4DA 2QRKA 2YUTA 3U5ZB 1SC9A 4YC7A 1P5FA 1EB8A 3KXPA 4RDIA 3THYA 3LTEA 4MR9B 5AW2A 4FSDA 3KCQA 4BYGA 3KL4A 3WDSA 2CLIB 2EJUA 3H1GA 3N7TA 3K5PA 4PYIA 3U09A 5CM8B 3IURA 1IBSA 4GRDA 5EZYF 1O96B 3DLPX 3AIIA 4EKNB 1XQWA 1CXZA 1H5QA 3SVTA 1KYXA 3BKXA 2GTIA 3KM0A 4ZVOA 3KQHA 5LQMA 4HB2A 3QVKA 1E1CB 1ZK0A 2HSJA 1KMQA 4GXQA 2HZBA 3B5EA 1VMAA 4KFSA 4MCHA 4RCYA 4H6VA 3C3PA 1IXKA 1ZIXA 2P9JA 4UUOA 3T12A 3DBLA 2VJNA 1PGOA 3CZPA 3O38A 4NK4A 5T57A 3FB4A 4KDEA 5CM2Z 1Q95A 1VSTA 5KC8A 1FJGB 4YR7A 2HAEA 1DDIA 1PK9A 1C7FA 4J4HA 4F60A 5JMOA 3LSYA 1GYPA 1GR1A 2Z4TA 4RKYA 3JZDA 2HWKA 3IR5A 4JC0A 1XV5A 1XXLA 4I1OA 4O8CA 1BCSB 1XRRA 3VUEA 3B1WA 1C8KA 4QATA 2RH8A 3TLAA 3U3RA 1Y9ZA 3NBUA 3TZHA 4HDMB 2CMHA 1G3MA 1PIWA 1C30A 3FGNA 1EK6A 4EKIA 2Y2UA 3QBTA 4KPEC 1DG3A 1JHMA 3MXOA 1RHJA 2BFNA 2FN4A 2R7MA 2Y6VA 3K1YA 3PDWA 1DXQA 1SD1A 2WIJA 3JD1A 1W4ZA 3C14C 1V11A 2PGOA 4FDUA 5DXAA 5ED4A 4MDEA 2R8RA 3HBNA 3WGVA 1X38A 2H1HA 1L7XA 2QE7D 3GZ4A 3C24A 3NJRA 4TTQA 4RETA 4A82A 2VWHA 4QD3A 4AK9A 4E1AA 5L7TA 3K1AA 3RT7A 3LPAA 3VPDA 1TF2A 1X7ZA 1IHPA 3R5XA 1DZ3A 2Z43A 2VDJA 1W36D 3IVGA 3NUQA 3A0UA 4JC5A 2ZJ4A 4HDSA 4UDOA 3WB1A 1TAUA 4V0QA 4U8GA 4E1BA 4GGMX 4ROTA 3EVZA 5CA1B 4MXDA 1CQJB 1G19A 2VJLA 2Q7OE 1OHHA 1HZJA 4GBED 4H77A 4IHAA 1T26A 4AW9A 5JC1A 1C9JA 2BI8A 2WKRA 3G79A 3Q5EA 4JXKA 3G88A 4UU8A 4EP1A 1RMTA 1XELA 1JAYA 3FHLA 3FPGA 3ECSA 4P3OA 3EHEA 4HWTA 1G0NA 4G1FA 3GK3A 2OHXA 2HEIA 2PV0A 4PS0A 4X44A 4V2IA 5I7FA 1HLDA 1GKLA 3JAKA 1KKLA 5BYKA 1DT3A 4M4SA 1UR5A 2JAHA 1I9GA 3F6SA 4AUMA 3KXDA 1KJWA 1ZI6A 2ZI5A 2JVKA 1SUDA 1WMEA 1XD2A 3GP3A 3RAPR 2IYPA 4DKJA 1RC8A 1WHSB 2R87A 3D6UA 2HMSA 3EY9A 1WABA 4HQFA 3DOFA 4ZZIA 5BVGB 2H54A 4JX8A 1D1QA 1CQIA 1VIMA 3UOWA 4HNTA 4KI7A 4QHYA 4YJKA 2YZ7A 4EG1A 1JHYA 2BFEB 3D3QA 1Q1QA 1PGPA 3I9NA 4O1MA 1NXXA 1RABA 4R98A 1K8XB 1KC3A 3HB0A 3U16A 3AW8A 2FUG6 3FWYA 1YOVA 2IP4A 5BURA 5FWXB 1UPUA 2QTBA 4AG6A 4Z7JA 1CUJA 1HWYA 1Z35A 1F8YA 1HT2E 5HKKA 3QEJA 5IYZA 1YIAA 3EEOA 5A3SA 1GYRA 2OZKA 4K87A 2WFLA 3MAAC 4NEQA 4QE3A 4TMKA 4YK7A 3U7QB 4JI7B 4DAOA 4HN9A 4L4RA 2RGAA 3LVQE 1R6DA 3O8OA 3PT9A 5TDHA 1OVGA 4KWEA 2C04A 5EJIA 4NU0A 5IJWA 4BNZA 2FKNA 1JQDA 2L2QA 3SXUB 3MA0A 1OXSC 5CDTA 3D3KA 5DGHA 3EW9A 3OOHA 1ODFA 4MUBA 4C2UA 5BUCA 4LYAA 1QIEA 2DPYA 3EVBA 3G2PA 3IBGA 4LGCA 4ZC8A 3V2GA 4CQJA 1FLNA 1U8FO 2EBFX 2VP0A 3FRJA 4TZKA 4ZI7A 1GEEA 4B3JA 3BT7A 3HZRA 4IQ4A 4CQLA 1H3FA 5IJ9B 2IELA 5AKZA 1EWYA 4CLRB 1CEEA 1MG0A 1WHTB 3WB2A 5AVYA 4HB0A 2GZAA 3D8HA 3KPJA 3OC6A 4D26A 4LYEA 3RG8A 3PCXA 3X2SA 1T9HA 4NCXA 1AU9A 4QPJC 4Y6LA 4BGEA 5IASA 5H82A 4MIEA 4Q82A 1BRMA 4QDKA 1JALA 4C4AA 3LBHA 1QQ7A 2J0UB 1J9ZA 4CG0A 5KU7A 2XNCA