2FGJA

Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
b'DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 63
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgjA00
1Q22A 2NZJA 5HZKA 1KY3A 3BC1A 4TLBA 3T1VA 1ZIPA 2ZR7A 4DIEA 3DM5A 2J7PA 1TU4A 1US8B 3W6NA 3OESA 4XSHA 1SGWA 1Z0IA 3HPQA 3OIUA 2DCUA 1ZNWA 4HB0A 4KODA 4LJ6A 4LY6A 2XITA 4ZKDA 3OFNA 2QGZA 2MSCB 2D06A 1E69A 3FKQA 4IDOA 2GJ9A 1DE0A 3BIFA 1ZBDA 4Q4AB 3T06B 1NN5A 3B85A 5J40A 3RS4A 1Z5ZA 2YC2C 1P60A 3QKSB 4GZMA 2D62A 3EIQA 1YZKA 3RLFA 2WKPA 3B60A 3W5IA 4C4PA 1M7BA 4NYMQ 8OHMA 3MFYA 4ACBA 1QDEA 1UDXA 4M1KA 4US2R 1I4DD 1GWNA 2QNRA 4NH0A 3R7WA 3AGQA 5B57C 5FOVA 2NIPA 2CE2X 1VG9B 2FG5A 3H2YA 1Z0JA 4GMDA 4LJ5A 4RFSA 1G21E 1NIPA 2RGCA 2JLWA 1NKSA 2VF8A 3AF2A 1G8GA 4OK6A 4LDJA 4B75A 2OILA 1J8YF 2WAXA 2PZGA 4ITRC 1HE1C 1KI7A 1E1RA 1XJCA 3ASZA 2NMVA 2FEOA 2WJGA 2J3EA 5DI9A 3X1DA 1OLOA 1PLJA 3TKLA 3TE6A 4FW9A 1E4VA 4L4UA 3RS0A 4RVCA 2ZUCA 4JBYA 3H86A 5KSYA 1W5TA 4HLDA 1RJ9A 4QGGA 5BN3A 2Q3FA 3X1WA 5EUQB 2QTHA 5K8UA 2FDCA 2B6HA 3MSXA 1RRPA 2ZSDA 2R9VA 3FB4A 3W90A 1EFTA 1VYTA 3NG1A 3UANA 3HU2A 4V02A 1IQPA 4IFEA 3KZ1E 1N5LA 5G3YA 4DCVA 5FPSA 4HDQB 4Y0VA 3K9HA 2J5XA 3GLHE 2A7QA 3T12A 2IWHA 3EPHA 4Q7JB 1ONBA 1SVMA 1IN5A 3NBZC 2XNDA 3FMOB 2BV3A 3H0KA 4QFMA 1AS2A 2GBLA 4AG6A 1KNXA 2DHRA 3K9LA 1FTSA 4G5RA 3MJHA 1LNZA 4S35A 1UBEA 4ACAA 1FNNA 4F38A 1XZPA 1G8HA 3G0HA 4AKHA 2ODNA 2WPDA 2Q3MA 3GCGA 3O8CA 1H8HA 4LV5B 1IN8A 1E32A 3IHWA 3KXLA 5G40A 3ICQB 1R6BX 1DVRA 2QPAA 2HYIC 4UXHA 2IYYA 3B1YA 3NH6A 5FTKA 1E3MA 2CEAA 1B0UA 1CRPA 3EZ2A 1S1CA 3TW8B 2NO6A 4HLUC 2JGNA 4YMTA 4HAZA 1XPUA 1G6HA 1IN6A 3Q7QA 4F4IA 1VIYA 1AN0A 4GMXA 1GFIA 1YRBA 3WRYC 2JLQA 3IIKA 5LDDC 3B13B 5L3VA 2IHBA 5JSZB 2JLUA 1FUUA 4TQUS 5JEDA 3DZ8A 2G0NA 3GEIA 2CCGA 4YMSA 4D0LB 2DPXA 1ZC3A 3AVQA 4C0LA 2HLDA 5LBIA 5CYPA 2UZIR 2ORWA 1AKYA 1VCIA 4P3YA 1EWQA 3TSWA 2QP9X 2ZE7A 2PH1A 3Q5EA 4BFVA 4F93B 3QF7A 3DEFA 2JJ1A 3R20A 4Q9JA 1LFDB 1YKSA 1FOEB 2MMCA 4Z8XA 2BJWA 4Z1MD 2ZAOA 4NTZA 1O3YA 3BORA 4V0LA 1HH4A 3S1AB 4WXRA 4LHZA 1SVWA 2B8WA 2ZRJA 4BFYA 4D2IA 4A8JC 3C4JA 3CRRA 1K6MA 4PPFA 5E95A 3TUJC 1XCMA 1X8LA 3UIEA 2ZRHA 3EAQA 4Q7LA 4EFNA 1G3IA 5FOTA 5P21A 2IWRA 1VECA 5J4KA 2ZM5A 4BUJA 4TSFA 3FHTA 3BB4A 3QQ5A 2QU8A 2W83A 2ZI5A 1JI0A 2HCJB 2GK6A 4B34A 3UMRA 1Z6YA 3EWAA 4AK9A 4AYTA 5TY0A 4BZXA 1JAIA 1N6NA 4Q9LA 1FZQA 3SJCA 5FOXA 4I1UA 4HDCA 1ZM7A 3AVOA 1MKYA 2JAQA 4TLAA 1WBDA 1K5DA 2QPOA 3U3MA 3KQNA 2FJUA 4NHOA 3I8XA 5K8IA 4LBYA 2VP2A 4M4SA 1E1QA 2BKUA 3AF1A 3OEHD 1JR6A 5EQTA 2IXGA 1N5JA 3GP8A 1XB2A 3AVXA 4BGDA 4MRSA 1Z83A 2KWIA 1IY0A 2MMGA 2WOOA 4JL6A 1GOTA 3NBFA 1Z6AA 3MWLA 5CYOA 4IEEA 3B8HA 5FUVA 4XWOA 3ICEA 2FSGA 4JMPA 2GZHA 4NCJA 4PR0A 1LVGA 4PAOA 4PPQA 5AJXA 4QL3A 2G88A 4HUTA 1E9BA 1TU3A 1E2HA 4QBIA 1R7RA 4B71A 4Q4LA 1KO7A 3Q3JB 1TADA 1E2GA 4O0MA 4I4LA 5FL7A 4NONA 1XD2B 1KDOA 4OJQA 3GLIE 4YC7A 1SHKA 2NO0A 4X8LA 3DPUA 3QJYA 2WJJA 1M2OB 1EWRA 1P9WA 1W4AA 3KQLA 1HT1E 1J90A 1GP2A 1ZUNB 2QPTA 4P4SB 3UATA 1KI6B 5DI3B 3FWYA 4G5QA 1KTVA 2P65A 2ZRDA 2QQ0A 2HF8A 5IDVA 1KSFX 3BD9A 1LS1A 3SHWA 1KK2A 3W8NA 2J7PD 3AVWA 1NJGA 2GA8A 3KKOA 3A4NA 3I3SR 1UADA 2CHGA 1TF5A 1DAHA 1J99A 1NIJA 2IA5A 3C7KA 4PSKA 4ZCLA 2QRZA 1JPNA 1T8UA 3OFND 4BFZA 2ZI7A 4ASUA 1EESA 4C7OB 4PPNA 2AFHE 4PHTA 4Y0AA 2RCNA 5BQ5A 1Z63A 1XP8A 1G7RA 2JLXA 3THWA 2GEUA 1E79A 2O8EB 2P6RA 1VYVA 1TQ4A 2IK8A 2WVJA 4DSNA 4BEJA 1ZINA 3BOSA 1IJEA 2VTKA 2JEOA 3NC1C 3DL0A 3E2IA 1KMQA 4DT1B 2XZPA 4TZ6A 1YR6A 2EWWA 3KKQA 1SXJB 2QEQA 4Q1DA 2J0UA 3K0SA 5FTNA 4JYCA 3TAHA 1UEIA 1ZM3A 3P32A 4P31A 2QGNA 3B1ZA 4LHVA 1V5WA 1YR7A 3U3RA 2XOKA 4NKRA 6Q21A 4TLCA 1E1RD 1KI8A 3X1ZA 1F60A 2ZRNA 1ZCAA 1T3LA 2ZUDA 3BWDD 4W7SA 4CRWB 5K8TA 1E2LA 4RD3A 4BECA 2GJAA 4RD4A 3ZLJA 3I62A 3QEOA 3DKPA 3SYKA 1XTKA 3BFVA 4C3ZA 3THXB 4BASA 1XD8A 4V0NA 1N25A 1SVOA 1E2DA 3I1FA 1E9EA 2J41A 4M8NE 1WQ1R 5KTYA 1Y63A 1CS4C 4OQLA 2QA5A 2VPPA 4ESVA 3NHBA 4M1OA 2VSXA 4IRUB 3UKDA 1RIFA 1KZGB 3AM1A 4EPVA 3AVTA 4IOJA 2OEPA 1SZPA 2AFIE 4BZPA 1KKLA 5DLQC 5FOWA 3SHFA 4Q4JA 4DLTA 3E1SA 4YMUA 2O8DB 2GNOA 1XRJA 1O87A 2OESA 3HU1A 2BMJA 2QSYA 4TMWA 4XH9B 2XNDD 5TXGA 5E3HA 2ANBA 4RKFA 2ZYUX 3IUYA 4E07A 3TR0A 2PJRA 1GZSA 4JLPA 3AUXA 3PVSA 1UJ2A 1ZYUA 2W0SA 4FD2A 4KV9A 3VU9A 5AUPB 4A15A 1Z6GA 2EVWX 5CM9C 3BFKA 5FUYA 2GCNA 3P1JA 2ZJOA 2W6IA 2A5JA 2WPDD 3NHAA 1VDZA 1YZTA 3A4LA 1H8HD 4R98A 1MR3F 1KYIA 5LD2C 4DCTA 1OYYA 4KVAA 3C5HA 5H8WA 4Q9KA 3KKMA 1KSGA 3AF0A 3QPWA 5KSZA 1Z6XA 1D8TA 3NDPA 5B58C 1F2TB 3B1VA 4TQ9A 2ZROA 1G16A 1EFCA 1QHHA 1HT2E 4BFTA 4ZV4A 4Q1AA 3IO3A 1S9HA 2R44A 3CUEF 3FMPB 1LF5A 1JAHA 1N5IA 2ZQ5A 1JPJA 1ZW6A 1NBMA 4NCHA 1I2DA 4HLCA 1KO5A 4QNRA 3GLIB 2CMKA 3K09A 1II0A 3T35A 4HI0E 2HLDD 4C2TA 5FTJA 3PEUA 4CGZA 3O8BA 3QKTA 2ZJAA 4LV6A 4IDQA 2JJ8A 3JZAA 5EP3A 3EZ7A 3QNUA 3QVVA 1Z0AA 3WMGA 1TQ6A 5EJEA 5AJYA 4GOJA 2VP0A 4DCSA 4DLYA 2JJ1D 1U94A 3VHLB 1U0JA 4MRPA 4B73A 1GNRA 1TMKA 5AWFC 1OXTA 3SYLA 2GF0A 4PSVA 4IXMA 1VIAA 2IC5A 1A4RA 3WMFA 2RGGA 2BBWA 4RD1A 1PJRA 2A5FA 4TYWA 5EE5B 4BRWA 3PFIA 3EPJA 3TSOA 3I73A 1P6XA 2GEDA 3PG5A 4FWIB 3Q72A 4WOPA 1G6OA 2HUPA 4GI7A 4PZZA 3PUXA 4AKEA 5C18A 3K0AB 4TSFD 5CIWA 1PUJA 5JRJA 2XB2A 3QKRA 1FW6A 2P5TB 4TMVA 4DUGA 3DVLA 2AHOA 5CK4A 2Y8EA 3CKLA 1L4YA 1F3OA 3EG5A 4V03A 3UK6A 4L9SA 1CRQA 1FQJA 5CDFE 5BW8A 2X8AA 5AUQA 4YXWA 2AWOA 2BBTA 3EC2A 2GDJA 2QMHA 3T1QA 4GNKA 4PHFA 5F9HA 2V1XA 1D9XA 5JCPA 4DDUA 1P7CA 1E1QD 2QZ4A 3R9IA 1T9HA 1AJEA 3V9PA 2VP4A 4RD0A 1GL9B 1OV4A 2ZE6A 1XTQA 3FGNA 2XTZA 2JA1A 5JS8A 3A6PC 5BWMA 3E70C 3M4YA 1M1YE 1CKEA 2DYKA 3KFVA 4BLRA 4QGHA 5UKDA 2JATA 1E2FA 1PLKA 4URWR 4CT4B 2ZR9A 2ZETA 1OH8A 5KHOC 4AKIA 2GK7A 1RKBA 1CXZA 3WP1B 1CJUC 3ND9A 1D2EA 4XTCS 1NNEA 1G17A 2AK2A 4PSAA 2ZRPA 5FL7D 4DXAA 2FFQA 3TUIC 5EXPA 2Q9BA 2ZRCA 2NGRA 4E5UA 5DHFA 1G9XA 2HXYA 3WP0A 2IX3A 4MKFA 2B7CA 1MO3A 1R8QA 5CK5A 3CNLA 1OFIA 1FP6A 4JT2A 3O8DA 1OFTA 2O8CA 4JJKA 1QHXA 5TDHA 1JR3E 4ESHA 1UBFA 2PBRA 2IT1A 1P61B 2IF2A 2OBNA 4JZKA 2PZFA 1KDTA 4Q21A 1T8TA 1KHTA 1W0KA 1KK0A 2REOA 2ZJ8A 4TTRA 3PEWA 1SXJC 5D3MA 2HXSA 4NDZA 4PAQA 3A1SA 1NG9A 5C2JB 4ASUD 1P9RA 2RB4A 4LJ8A 3AVUA 4CEIB 1UKVY 2LWIA 4I81A 1AM4D 2DR3A 4UQOA 1XF9A 5JS7A 4JSTA 1NKTA 1ZD1A 4HDOB 5L3QA 3CNNA 4Q1FA 1II9A 4JLJA 4NYMR 2NO1A 4R9UC 2QG6A 1VPLA 2G6BA 2IHYA 3Q5DA 1QVAA 1TAGA 1ZUIA 1NRJB 2WWGA 5EP1A 1ZM4A 2Q21A 4Q1EA 2HCBA 2OE2A 1SQ5A 1FTNA 4ARZA 4B6FA 1E2PA 4GP6A 3T61A 1AS0A 2I3BA 3HU3A 3EX7C 1M6NA 1S96A 1W2GA 1WCV1 2CNWA 3RRNA 4A0RA 4MDFA 2XOKD 1GILA 1NY6A 3UXMA 5BN4A 2GXQA 4QJ3A 1MRSA 2CE7A 2GZAA 2WSMA 2ZSBA 4NP6A 5JFGA 1OPXA 4QJ5A 3LW7A 2YOFA 1J2JA 4A0GA 1TF2A 2PX3A 1R8SA 1E9RA 4IW3B 5DGXA 3OIYA 3A37A 4JL5A 1QHSA 1G4UR 4LBZA 1N0WA 3SFVA 2FWRA 5BN5A 2AKAB 4LYJA 2AWNA 3KQKA 2P2LA 4OI4A 5HCIA 5JEEA 2IS1A 1VTKA 1XTIA 2HJVA 1T0JB 4Q01A 4MYUA 2HEIA 4ZDKA 3SJBA 1OH6A 2GF9A 5FPTA 2IYZA 1ZUHA 5C4GB 4ZCIA 2W00A 2HT6A 4H1VA 4M2LA 2YWHA 3KB1A 4PQFA 3LQRA 2IW3A 4EQ6A 3L43A 4M9XA 3FKSA 1E9AA 3RANA 1ETUA 1IN4A 1FL9A 1KNQA 2KB0A 2FZLA 2WJHA 3QPUA 4KITB 1SKQA 3IIMA 2VHTA 4Q00A 2CLCX 4BLTA 4RD2A 2O0HA 4PO1A 2V54A 5CB6A 2W6ID 2ZE5A 2YV5A 4D26A 4QM7A 3EIEA 1VCOA 4ZI2A 1MO6A 5G3ZA 3R9WA 2ZEJA 3KL4A 4DLUA 3U7FB 2WZQA 2DBYA 3PUWA 3AV0B 4B3BA 3P26A 1KJYA 4CEJB 4OQFA 2YWGA 4LX0A 4MRNA 2IUSA 5FOUA 3K1JA 1Z06A 3I32A 4NZYA 2C8VA 1RFLA 1HY3A 4NL4H 4RCZA 3IBGA 5KYKA 3U44B 4IEIA 3W9YA 4DSTA 2P6UA 1JXMA 1AK2A 2LKCA 1U8ZA 4JVNA 2F1IA 2SHKA 1TEVA 1NBMD 1E2EA 4KO8A 4QHYA 5FI1B 1JEDA 2ZPTX 4DDTA 1PUIA 4CEHB 1X1SA 4HUQA 4TN1A 2ZS8A 4P4UA 5KDOA 3B5JA 1Z28A 2QBYB 4R2HA 3KQHA 2GCPA 4B2IA 2QSZA 1W44A 3AKEA 4B76A 3NBXX 2QTVB 4A36A 2CCKA 3GLFA 2F43A 2FA9A 4RSGA 1W4CA 5FOSA 2GCOB 4AD8A 2FSFA 4Q03A 5DIFA 4I1VA 2F55A 4JLNA 4WZAE 5CM8B 4TTQA 2B92A 3FTQA 1WP9A 1N3BA 1W36D 1ZRHA 1ZD8A 1DBSA 3N2EA 4GZLA 4RD6A 4ON9A 3SBEA 1XNJA 4D4MA 4HATA 1JNYA 4JLMA 5JECA 2RHMA 4V0OA 4X8HA 3LA6A 4DLWA 2IEYA 5FL3A 4DUGD 1E94E 2H57A 2OXRA 3CR7A 1XJ0A 5JLJA 3WHKA 4TMXA 1OF1A 4KVGA 2H17A 1XCPA 5LPNA 4UNQA 4LOAA 5CITA 3TQFA 4TLEA 4YXWD 3A1VA 2ZYVX 4LI0A 1F2UB 2YJTD 2ZJBA 3T15A 2FGKA 3K09C 1LTQA 2QT0A 1TUIA 1XEWY 2WWFA 3QVUA 3U4QB 4RKEA 2ZS9A 5KNBA 2VIIA 1QF9A 1DTSA 2FPLA 4A6PA 5JWOA 3SQXA 2VH5R 5FBRB 2FEMA 3RNLA 2OLKA 3I92A 3I8SA 4LJ7A 3REFA 4M1YA 3FFAA 3RDPA 2JLVA 4XTRA 1Q57A 1E9CA 3N2IA 4BWYA 2FSIA 3LXRA 1SVLA 4FIDA 2F3TA 3RWOA 4Q4HB 2IS6A 3AGPA 4AG5A 4Q66C 3WHLA 2B7BA 3VR5A 2VHUA 1D6JA 2P5SA 4BRUA 4JL8A 5CIQA 1KZ7B 4EJSB 1SKYB 3C5CA 1N0VC 2EU8A 2Q6TA 1NI3A 4IOLA 1VG0B 3VTKA 1WRBA 1A2BA 2WMOB 3CF2A 4GT1A 2KBEA 3EARA 121PA 1T6NA 5JWRA 2H1LA 2C04A 3PQCA 1WB9A 5EUMA 1GIAA 1LB1B 2V8OA 2OUKA 2F9MA 5EE0A 1ANKA 1KO1A 3LFUA 3JVVA 2X1VA 3NIBA 4JYBA 1AS3A 3CIOA 1OHHA 5JHGB 5KSOA 4J0QA 4L15A 3ADKA 1HUQA 3QSYA 4QM6A 4EIWA 1W0KD 3WNDA 2BEKA 4MQBA 4DLVA 5ANRB 1SVKA 2IYWA 2EFGA 4MA4A 1S8FA 1GSIA 4BLQA 1WMSA 3K0FA 4ZDWA 2G1JA 3G5UA 5HR5A 4BEBA 4E03A 4BLPA 4M1WA 3QENA 3H1TA 2GVDC 4C0SA 1AZTA 5A4JA 4C2UA 1WXQA 2YKGA 1BIFA 3VNVA 2FU5C 4L16A 1GAJA 4U00A 5EE1A 5H70A 3R7WB 3VNUA 4H9GA 1U0LA 3U5ZB 1OFHA 4K8OA 2WTUA 2XJ9A 2GTPA 1IXZA 2WWHA 4LV8B 3KTAA 4RFSB 1BS1A 1MABA 3OEEA 4CZ2A 2IYTA 5FUWA 2F3RA 4PFSA 4JSYA 1SXJE 2BBSA 3A36A 3SOPA 2D7DA 1V43A 1Q3TA 5LD2B 1UAAA 4AYWA 2R6DA 1QHGA 2WICA 1XMVA 1NSFA 1UPTA 4B2PA 2QL6A 5CLQA 5GADl 3ZDQA 3SJZA 2HYDA 4PC1A 3VMFA 4TQAA 4MGKR 3RC3A 4IXNA 2CNWD 3GQBA 2CCJA 1A2KC 4QRHA 4BLSA 5FTLA 4URZR 3TQCA 4IOKA 2JDIA 2WWYA 4TT3A 1RJ9B 3EPLA 4F92B 1U0HC 2AR7A 1W4RA 5GVSA 3IHLA 1RVDA 4XWKA 2OG2A 3BH6A 3T34A 2HT1A 2F1JA 4AKGA 3CWZA 1GUAA 1U98A 5LB2A 3FMFA 4NYJQ 2O0JA 3GLHA 4A82A 2A9KA 3WYFA 3QUSA 2EFDB 3BK7A 1Q12A 1GKYA 4TTPA 1I4LD 2EWVA 3AP2A 3LAWA 1K5GA 1Z0DA 2XSZA 3KKNA 1GNQA 1C9KA 4M22A 4ZPXA 2KE5A 2ZSAA 3U6BA 3NKVA 5KPJA 2G3YA 3CNOA 3LY5A 4U02A 4I1OA 4WZBE 4L8GA 4TYPA 3EC1A 4WA7A 1VCNA 2C9OA 3TSZA 1EX7A 3FKSD 2GXUA 5L8VA 1R4AA 1Q0UA 1KDRA 5FR1A 4AURA 1Q1ZA 1E2QA 1N6LA 2ZIAA 1KO4A 2B21A 1ZNZA 5E7IA 4DKXA 4PHGA 2DWQA 3Q85A 5G41A 1BYIA 4QKQA 4LYAA 3SNHA 2PMDA 3I4LA 2JLZA 4B3DA 1M7GA 3R9XA 4KCGA 3NC0C 1G8YA 4Q18A 3AVPA 4ZIRB 1SHZA 1EFRA 5TMPA 5KU1A 5M04A 3U60B 2VA8A 3QXHA 4GRAA 3AKDA 3QG5A 3VHXA 2EFCB 1FMLA 2ZR0A 1YU9A 3B1XA 2CL7X 1QHNA 2ONJA 2C77A 3ND8A 2UZ3A 1ESNA 3NDBB 5CJPA 1L4UA 3GJ3A 4TLDA 1U99A 5AUNB 2V1UA 1G4AE 2QQEA 4O2RA 1HYQA 4RJLA 4Z54A 3LDAA 1S4QA 1DOAA 2EW1A 4L9WA 1XPOA 1MOZA 2CXXA 3IIJA 4IVQA 3SZRA 4EPWA 1IM2A 2UKDA 3CBQA 4A6XA 4JLAA 1XXHE 3FVQA 2QP3A 2L0XA 1E98A 3CX6A 2I4IA 1X8JA 1C1YA 2P3SA 1AQUA 3GEEA 3NH9A 2EYQA 1S3SA 3PENA 4OHYA 4KXFB 1G7TA 2VHCA 1U9IA 2ZRBA 5FPHA 1ZMXA 2FZ4A 4NU0A 2QE7A 2HV8A 3PUVA 4G5GA 5GJCA 1Q21A 3CF0A 4URUR 4W5HA 3LLUA 4UNSA 2BJVA 1R2QA 1NMXA 1U81A 2ODBA 2YOHA 2C99A 4LJ9A 3V00A 1IXSB 1X1RA 2WSSA 1GVNB 4OQXA 3ADDA 4UKDA 3GMTA 2P6NA 1PZNA 1TPZA 5EXTA 2PCLA 3HDTA 5E4FA 1X8KA 221PA 1EFUA 1YJ5A 1YVDA 4WZ6A 4BQSA 2WJIA 3QF4A 3BS4A 1PVOA 1ZIOA 4TL7A 3V4FA 1IN7A 3H4MA 4LC0A 4LJYA 2ERXA 3UMSA 4G1UC 4A2PA 3KQUA 5AK0A 2GAOA 421PA 3RSLA 3CZPA 3HWSA 1IY1A 1G3RA 1OFUX 4EJSC 2C98A 3P4YA 1KJWA 2RGNC 4V0ME 2BM1A 2F6RA 3MMPA 4D4KA 1EG7A 1QG4A 4U5XA 3PJRA 1E0KA 4BPBA 2ZSFA 2Z83A 2R2AA 2ZU6A 1KI4A 2F7SA 3FHCB 3GEHA 2BC9A 4JT4A 4O2LA 4C0JA 1N0UA 3F3YA 1VG1A 2PCJA 5HZHA 3VR2A 3VKHA 2FFHA 4QGFA 3IBYA 2TMKA 3U3OA 2OBLA 3CPEA 2IYQA 4UNPA 1XEWX 3REGA 4DCNA 1PV4A 2DFTA 3AP3A 1GRQA 1PLLA 3R8CA 4EPXA 3FE2A 4K81B 4AI6A 2JCSA 5EZ6B 4NPHA 5J47A 3ZD7A 2RGAA 1E0JA 1ZCBA 2ZRIA 1UEJA 3B9PA 2QAGA 1BH2A 2X2EA 3AUYA 4G3XA 2WV9A 1OHHD 4JS0A 2BEJA 2IS2A 2ZSEA 4P32A 2KJQA 3HYRA 1KI2A 2Q9CA 4G5SA 1JJ7A 4PTLA 3NXSA 3K0CA 1NVWQ 3F0TA 3A1TA 5C4MA 5DN6A 4IVRA 3RAPR 3L8ZA 4DEYA 1WA5A 1S1MA 3M0EA 3NEJA 1OIVA 1R0WA 3DHWC 3THWB 1U8AA 2GKSA 5KNDA 2A5YB 2ODEA 3CM0A 5C46F 2JJ2A 2Z43A 1KSJA 3H84A 4QHTA 1P62B 3EWSA 4D0NA 1B23P 4PANA 2CJWA 2NTYC 2AN9A 1FUKA 4I1SA 4HLQB 3FHOA 3OEED 3QE0A 4UNNA 2J0UB 1E2JA 3VFDA 3GLGA 4ZCMA 1FX0A 3KX2A 1GL6A 5GJVC 1KAOA 3ZVRA 2NOAA 3FMIA 821PA 1KI1A 1YZNA 4A2WA 1G41A 1QG2A 3BRWD 4TL6A 4DLZA 1Y3AA 2DB3A 3NEYA 4G01B 4OI2A 3K0EA 4A9AA 5K8LA 4UXIA 3JZMA 3ZVNA 3OZXA 1KMHA 4BZQA 3GJ5A 3LO5A 1P5ZB 2AXNA 1XXHB 3BH0A 2KSQA 3CZQA 1NG1A 2JDID 1OE0A 1NN1A 2GBLC 1CF4A 4TT3D 4DEXA 1II8A 3JVUA 3W34A 1XJQA 4ABYA 3OHMA 4HZUA 1TQDA 4KSCA 3THYA 5KUTA 1CJTC 2WBLC 1VKJA 1MO5A 4TYQA 4QBGB 4FN5A 1ZM2A 3ZVLA 2WKRA 3ZZTA 4RCYA 1AQYA 4BFWA 1XEXA 5CB8A 1F6BA 2QM7A 2W2VA 5HTKA 5DE3A 4Q4JB 1W46A 3SS8A 1XX6A 3RHFA 4ZKEA 5KNCA 2W2XA 3FFBA 1D2NA 2XSZD 3NVAA 2V3CC 1NP6A 2PMKA 2IYRA 3AKCA 4UJ5A 3GJ6A 3U61B 5A0FA 1NY5A 1J8MF 1GTVA 1VYUA 2O8FA 2QM8A 2IYVA 2ZTSA 2VHJA 1VHTA 3B7GA 2VSFA 1RYHA 4KBFA 2CL0X 4FINA 2ZUBA 4FI3C 3BJIC 2ORIA 3AVVA 5FI0B 1AGPA 4KBGA 1CBUA 2NO7A 2QRNA 5FBLB 4HYYA 4D6PA 2QORA 2X19A 1LF0A 3AF3A 3KFXA 4FMDB 2OCPA 1EFRD 1EFHA 3KXKA 3CX7A 3DKVA 2WAYA 1QHHB 4BE7B 2ERYA 1NMYA 1LY1A 2V9PA 5EE3A 3CB4A 1M8PA 2OSBA 3KJHA 3L0OA 1FP7A 4JLOA 1DG1G 1IXRC 1FFHA 3KJEA 3K9GA 2UVQA 2BMEA 4YQFA 3ADBA 2ZRLA 2WIBA 3F8TA 2BCJQ 4LYHA 5A5GA 4R2IA 2J0QA 1R10A 3AF4A 2OAQ1 2WHXA 1RRFA 3A1WA 1NVVQ 1W47A 1T5LA 3HP1A 2XZLA 2C9CA 2J45A 3GJ4A 2P0EA 4HLUA 4OI0A 3RWMB 5DO9A 3RS3A 1E4YA 1GRRA 3SDZA 1E0AA 4P33A 1G3MA 1KI3A 2GJKA 3EA0A 5TV2A 1NMZA 1TX4B 5EE9A 3EXAA 5SZKB 5DYIA 2QROA 1ZC4A 3CRW1 3AH8A 2ANCA 1HA3A 3ETLA 3PXGA 3ADCA 1W36B 3MCAA 1KKMA 2VLIA 2CVFA 3PCRB 4GDFA 2B8TA 4KFUA 3IEVA 1RRCA 2XAUA 3P4XA 2QE7D 3QKRB 5BYKA 5JHHB 1UBCA 5SZHB 2Q3HA 3O47A 4PQRA 1ODFA 2J0SA 3GFTA 2GETA 5FBVB 4O3MA 3LLMA 1Z22A 1VG8A 2BM0A 3TH5A 2ZRGA 3C41J 4ILEA 1P2UA 4N0DA 5G53C 2IS4A 1M7HA 3V4RA 4A8JA 2BVNA 1E2MA 2WSSD 1HE8B 4JLVA 2VBCA 3TRFA 2ZJZA 3IKJA 1CJVC 1WBBA 4CDGA 4JLDA 5FFMA 5L3SA 3W6OA 2W2TA 3CRVA 1H8EA 2YINC 2J1LA 2NQ2C 4QC2A 5EP2A 2BDTA 1N6IA 1TF7A 1P2VA 2A3RA 5J4VA 4WIAA 4P0TA 2HF9A 2VP9A 1R0XA 4LBWA 2BWJA 2ZRMA 3WY9A 1Z07A 2R6GA 2HJGA 3EZ9A 1FNMA 2XXAA 1C4OA 2FX3A 3QXJA 1R5OA 2YOGA 1IONA 2RAPA 2R6AA 1DAGA 4QBHA 1JEEA 4URXR 2XJ4A 3LVQE 1TNDA 4A1FA 4Q9HA 4G0NA 4FCWA 1Q3HA 4DVGA 4B43A 4RZUA 4MYHA 2Z0MA 1XMIA 5E7MA 5FBQB 3AP1A 2ZRAA 3W3AA 4B3CA 1L7VC 4D0GA 4Q47A 2VEDA 4US0R 1D9ZA 3VR3A 3SQWA 3TUZC 3IEUA 1SKYE 2ZJYA 1BKDR 1NVXQ 1R0YA 2ZJ5A 5HKKA 4IFBA 4B3FX 2BIFA 2FSHA 1I2MA 4MUAA 3KJIA 3LQQA 4D82A 1IOZA 3NBYC 1HV8A 2K5UA 3IQWA 4OK3A 2O8CB 1JR3A 3K70D 4TZ0A 1DAIA 1ZD9A 4QHSA 4RFVA 4DWJA 1US8A 4M9ZA 3T1OA 2O8BB 1YR8A 5H68A 3SEAA 3IQXA 3UG7A 3EZ6A 4II7A 4NE2A 1W49A 4CIDA 2C03A 1CR4A 3P20A 2C95A 1UM8A 4R7ZA 5D3MB 4Q4AA 4B48A 2AXPA 2RMKA 4FMDF 3QKSA 4FMCB 5DN6D 1KO8A 2Z4RA 4WBSA 5HE9A 2ZAMA 4OQNA 3VKGA 4C0BA 4F7WA 1ZU5A 4A0FA 4DRZA 1KGDA 2CHVA 3IGFA 4DSOA 1YR9A 1OKKA 1QRAA 2JJ2D 3DOFA 1FQKA 4LGMA 5L3QB 2GXAA 1YE8A 4PC6A 1T4GA 2BBOA 5SZJA 2WJVA 3QBVA 1EX6A 3MWYW 3ZD6A 2EFHB 3MLEA 3RRZA 4XOIA 5IT5A 5B30A 1W0JA 1Z47A 2CK3A 4C0KA 4KAXA 2BMDA 1E2KA 1YZUA 3IPXA 1IHUA 2VSOA 2AL7A 4TYNA 1OH7A 3MGCA 4JBWA 4PQYA 1J70A 1KY2A 3W6PA 1TL7C 3HR7A 1OXXK 4XSGA 3BH7A 2IYLD 4WW0A 3VAAA 4JBXA 4AWXA 1P72A 2JASA 2FE4A 3SN6A 4LRWA 1IJFA 1G8FA 2XTNA 3CWQA 2D3WA 1GG2A 4OHZA 4Q4HA 2H5EA 4MGIR 3C15C 5DYGA 521PA 2G9NA 4EPYA 4IOMA 2QT1A 3TIFA 1JBKA 2CLDX 3KKPA 3K0CC 1E9FA 1Q20A 621PA 1YZLA 3GJ0A 1MRNA 1GL7A 4N0EA 3LRPA 2V4ZA 2WWWA 4QJ4A 4CYMA 3X1YA 3LXXA 1XMSA 4HB2A 3PITA 1QZXA 1RW4A 2WM9B 4NYJR 1MO4A 2E1RA 3OAAA 1BMFA 1MT0A 3UPUA 4EQ6B 4R71A 2FH5B 1G3QA 5FPYA 3UWKA 3LBIA 2OM2A 1XTRA 1LV7A 4NMMA 1CJMA 3IILA 2Z4SA 3PUYA 4ZO4A 1R5NA 3OIWA 4PAMA 4UXJA 1AGRA 4DLRA 2D2FA 2FPKA 3TLXA 3BB1A 1Z6TA 2PT7A 3DOEA 3MJRA 3QXSA 1DO2A 2CL6X 2VP5A 4N3NA 4URVR 5J4LA 4K46A 3B78A 2WJYA 5KOYA 5L3RA 2Q9AA 2IEZA 2BOVA 4CF7A 4QXAA 3LH5A 3GFOA 5JSZA 5FH9A 3AKYA 2GJ8A 2IF0A 3ZS8A 2YHSA 1NN0A 3MRSA 1T3HA 4Q7KA 2PT5A 3I72A 4Q7MB 2ZI9A 4Q19A 4A0HA 2PL3A 1P2TA 1BO6A 3HR8A 2KBFA 4Q1BA 3W8RA 2ASEA 5TARA 1NSTA 3W3ZB 3X2SA 4OJKA 4LHXA 4EPTA 1DS6A 2R62A 3RVBA 4HUQB 2W58A 1W36C 2ZYTX 4HB4A 2PX0A 2V7QA 3CH5A 5JZVA 3LNCA 1Q1BA 4NYIQ 2XZOA 1AIPA 4HAXA 1N6PA 3Q9LA 2J59A 2ECKA 5B2ZA 3GLFB 2F43B 3S1AA 3M1IA 1W2HA 3E5HA 2H8KA 2X2FA 3U7EB 2QMOA 3UMFA 2FMXA 4DSUA 3WYGA 4ERNA 3PIRA 1DAMA 1KI9A 3SI7A 3ZZ0A 3ZJYA 3VR4A 2NZ8A 3ZH9B 1CIPA 3ZQ6A 4LUCA 2QP4A 4E09A 1G18A 1M74A 2IUUA 1R0ZA 1NN3A 3KJGA 4Q48A 2X77A 1G3UA 3LW8A 4FMCF 2KI5A 4B32A 2LKDA 4Q9IA 1E0SA 4OL0A 3CRQA 4O25A 3HPRA 1JQLB 2MSEB 2JIZA 4LK2A 2G1KA 4LC1A 4XJXA 2Q0HA 1X6VA 2ATXA 2CHQA 2NO9A 4LJAA 3L8YA 1HTWA 2C9YA 2BCGY 1KIMA 1DAEA 4LSGA 2N46A 2J46A 4UJ3A 4BFXA 5CLLA 5F2EA 1CEEA 1UBGA 1P9NA 1P75A 3F5FA 2VQSA 4KYIB 3C8UA 4OHVA 4DDVA 4JVLA 2WWXA 4M1MA 5AJZA 1ZNXA 1NLYA 1BYUA 1H8ED 1WDTA 4CVNA 1ELOA 1XBTA 5FR2A 2IUTA 1JQJC 1D2MA 3QI2A 5GVRA 2BHRA 1JXOA 2E87A 2FOLA 3PR1A 4ZIRA 2IL1A 4C0QC 2DFKB 2O52A 3ZVMA 4MRVA 3U7GA 4MKIA 3L0SA 2YWEA 2R6FA 5AJWA 3RSOA 1XCGB 4DC9A 2PEYA 4IDPA 1ESMA 5BXQC 4EAQA 1E99A 2CVHA 3QXXA 2AKYA 2C5LA 1SVIA 5JJKA 1XD2A 3NTUA 1VMAA 4A92A 3UWOA 2D7CA 2ORVA 2D74A 1KK1A 2F9LA 2OFWA 1COWA 3PV0A 5BYJA 4EFMA 2GZDA 2OAP1 3QXCA 4P4SA 1KI6A 4KI0A 5DI3A 5JI2E 2NPIA 4KFSA 5HKKD 1OJLA 4LCBA 4YMWA 1S3GA 2QMUA 5J4HA 5EZ5A 2R65A 5KPDA 4DB4A 1JR3D 3TMKA 3KUCA 1XEFA 2ODWA 2ZI3A 2OLJA 4PX9A 5AJVB 1MV5A 1Q44A 2CBZA 4OI1A 4HSEA 4W5WA 1CP2A 3IPYA 4FWTA 2IYXA 2ZI4A 4B3GA 1A7JA 2FPMA 1G5PA 3LBNA 5FUXA 3IO5A 4OBEA 2W6JA 3CPHA 5J4YA 3K0FB 1G5RA 1UF9A 3EIHA 3P27A 2JLYA 4C7OA 4U7DA 3SBDA 4GPTA 1F48A 3QPVA 3TVDA 4GL2A 2FFBA 1G20E 1UKYA 1OT3A 3WBKA 5DHAA 3T5DA 3TGPA 3GFPA 2O8EA 2PZEA 1N6OA 5JWHA 3MG9A 4H1UA 1OXVA 1G8PA 1NL3A 3B9QA 2OBMA 1HQCA 1ZJ6A 1OKKD 3KTAB 2FV8A 2ZVQX 1MABB 3NWJA 2ZXUA 3TK1A 4DT1A 3PEVA 4LZZA 1SXJA 1E9DA 2P67A 4MKHA 1VCMA 4JIMA 2A5DA 2GRJA 3BBPA 1CULC 4HAWA 1RPZA 1CTQA 1W0JD 3SU8A 4DBLC 1RZ3A 4Q5IA 2GESA 2CK3D 2ONKA 5F9FA 3FPAA 1KOFA 4B74A 2RHDA 2V6JA 3O8RA 4KLNA 3B82A 3U2QA 4DIDA 1X3SA 3OE7A 3RRMA 4MGZR 4FXPA 3ZGXA 3DMDA 4QNMA 4B44A 4LPSA 4JLKA 2NPFA 3I61A 2XX3A 2ATVA 3SFZA 1YZGA 2A30A 4TWZA 4MITA 4TMKA 2OCYC 4KYUA 2F1RA 3THXA 1GRNA 5AR1A 5LB4A 3A8TA 2G0TA 1L8QA 3B1WA 4OHWA 4DLSA 5HPYB 1IY2A 4MYCA 1G5TA 3L82B 1N2CE 2BKEA 1TUEA 1QHIA 3K8YA 1QHYA 1EK0A 2GHIA 2IXFA 2RGXA 4PC2A 1K8RA 1E9SA 2YWFA 3GLHB 3FOZA 1YQTA 4AY2A 2XEXA 4F4CA 4QOSA 2DY1A 2O8DA 1G64A 1KJZA 1E6CA 3SR0A 4TYYA 3DM9B 3LBHA 4C0HA 2A78A 4LPKA 3OAAD 1BMFD 1TEXA 1XMJA 1OYWA 2REXB 2O5VA 2AX4A 2QUZA 4XD7A 5DSZA 2I1QA 1NF3A 4DHEA 3SE0A 4DCUA 3QBTA 4GOXA 4OQMA 4DZZA 1DELA 2JLSA 4EFLA 1Z2CA 2YZ2A 1OXUA 3ZQJA 3GPLA 2WKQA 3CRMA 3CW2A 1Z2AA 1AA9A 2JLRA 3VQTA 2ZI6A 5GJWC 4NCNA 4UNRA 4XVRA 1F2TA 1N6KA 5E7JA 5SZIA 2PLRA 2RGBA 2GILA 2C96A 2H7VA 2N1BA 3BGWA 4HEJA 3SC3A 1VHLA 3FDIA 1E96A 3ZS9A 1E2IA 3X1XA 3TJZA 4FCTA 2GEVA 4M9SA 5EXSA 1NBME 2J0VA 3GLIA 3GLGE 2F1HA 1I4TD 5HE8A 5KO2A 4KSBA 5F3WB 4B33A 3QEJA 1S2MA 3L0PA 4Z51A 1DARA 2V7QD 2OFOA 4PZLA 3CO5A 5GJBA 1N6RA 5JBQA 3CPJB 1U90A 1NVVR 4LJ4A 1Z29A 3ZIAA 5IRCD 4PC3A 1XXHA 4D81A 1GNPA 4JVMA 4KLZA 3LD9A 3KB2A 4DLXA 2ZS7A 3D3QA 1DAKA 3SYNA 3B6EA 1YRAA 2AK3A 3MWJA 3KUDA 1DAFA 5JMTA 5AUOB 4W9MC 2IXEA 3K0AA 3EW9A 3WXMA 4C30A 2OV2A 4L5BA 4LHWA 2RKOA 2C78A 2G83A 3ECCA 1Z3IX 4QG7A 4V0KA 2JIZD 5DNYB 2OZEA 4BFSA 1GKUB 5JJIA 1W5SA 1HEIA 2D4HA 3BB3A 5B64A 2OCBA 1P73A 4GOKA 1E2NA 4MDEA 4TL8A 1OH5A 1KSHA 1KAGA 2J7KA 3OIVA 4LWZA 5JRZA 1W7AA 1IAQA 4DJTA 1XWIA 1DO0A 5IK2A 1ZVQA 4M1SA 2ZANA 3QF4B 4QBFA 3EPKA 3LX5A 2OXCA 1H65A 1XZQA 2DWPA 2V6IA 5CJ2A 4FCVA 4NCKA 2REBA 4TMTA 4M0LA 1P2SA 5TB5A 1LS6A 4KJZA 2QAJA 1CR1A 1Z8FA 2FGJA 2DFNA 4RZXA 4V0MA 4MH0R 1OSNA 4TMZA 3MD0A 4LYFA 4KU4A 4MYTA 4GFDA 2OFXA 1AZSC 2QY9A 1Q1EA 2VL7A 4WAUA 3UG6A 2A5GA 2RGEA 4Q1CA 1G291 3SJAA 3TAUA 2EQBA 5EP4A 4JLBA 3THOA 4JKIA 3N5CA 3R8FA 4KHZA 2WIAA 3RS2A 3VR6A 3CLVA 4IVPA 5ELXA 1P4SA 2QN6A 3U7HB 2QTFA 4D80A 3VX4A 4E22A 3TVTA 1COWD 1YZQA 1OB2A 2WMNB 3GJ7A 2RGDA 3K70B 3B2EA 1ZNYA 4WXPA 4IKEA 2YVUA 1A1VA 2XNSA 2QAGB 2FN4A 2GJSA 2WWIA 2EFEB 3TBKA 3VU9B 1A82A 2QMEA 5J5CA 1F5NA 3ZZUA 2ZREA 4XIGS 1OB5A 3VKWA 3C14C 1A5TA 3BAFA 4GSYA 1KK3A 2C2HA 4AIIA 4CW7A 4KFTA 4FMBB 2OT3B 1P3JA 5HCNA 2W6JD 3EZFA 4CEIA 2VO1A 2E9SA 1TTTA 1FPMA 4YMVA 3AB3A 1EGAA 3LVRE 1QBKC 3KXIA 4MKGA 3RS7A 5FPKA 4POAA 2J9RA 4X8OA 4YDSA 2I1VB 3WRXC 4MRRA 1T3SA 2EYUA 3K53A 2CJWB 3WMEA 4D4JA 1ZAKA 2AD1A 1WE2A 2H92A 2XTMA 4URYR 4RZ2A 1M34E 4GP7A 4PZYA 2Z5FA 3GLGB 1FX0B 1SXJD 2GVZC 1NVUQ 2V55B 5FBWB 3RYTC 3LWNA 4G5OA 2ZRKA 2CLSA 1YHNA 5EXXA 2XB4A 3BERA 1S0UA 4AC9A 1ZM9A 5FTMA 4ZI3A 2IYUA 2R6CA 3OE7D 1XDBA 3WNCA 1G1MA 5TVKA 3M6AA 1G7SA 1KMHB 4XVQA 1CU1A 3D8BA 1UKZA 3WNBA 1L2TA 2ZVPX 2DWOA 2FF7A 1II8B 1G19A 1W1WA 4HZUB 5JCZA 3HYTA 3RRYA 1HURA 1ZU4A 1ZP6A 4S2EA 3THYB 2QI9C 4P4TA 3A4MA 1RE0A 1W48A 2AD5A 1KDPA 2O0KA 1HQYE 1XU4A 3CH4B 3BE4A 3GD7A 3VR1A 3GJXC 4US1R 1XEXB 2PJZA 4M9QA 1DEKA 1N5KA 3PEYA 3WYAA 1NLZA 4I99A 4IDHA 3U6KA 4YONB 1Q1QA 4HZIA 1AKEA 3W5JA 4B47A 4F91B 3PUZA 3ASYA 1CR0A 2IYSA 3D6TB 5CDFA 4EDHA 2O8BA 4IHQA 3QIAA 4CT5A 2O8FB 3TNFA 2NG1A 4XD7D 1Z0KA 3LX8A 2YNMA 2ZITA 1JJVA 4XVUA 3DO6A 4DB2A 3ZYCA 3MUFA 3Q7PA 4QGAA 4JVSB 4HB3A 4DDWA 1RC8A 3QOFA 3CR8A 2OHFA 4X8MA 3LV8A 2MSDB 1LW7A 4B3XA 1NLFA 1JB1A 2R8RA 3EASA 4YLGA 3RABA 3U3KA 4CEJA 1E79D 2RH5A 1Z0FA 4F4JA 2VHQA 4NCIA 2ZU0C 3G82C 3T1TA 3U44A 3CX8A 3D7MA 1T5IA 4GBMA 5D3QA 3OF5A 1WF3A 4PPGA 3MAAC 4PHHA 1GKIA 1SVSA 5DH9A 2OCAA 3AEZA 3AQ4A 3K9NA 1UKEA 2WOJA 3D31A 1OIXA 5IHPA 2VP6A 4CEHA 2FNAA 2PEZA 4D4LA 1OXSC 1GDDA 3DZDA 3DDCA 2QENA 2BMFA 1U9IC 4RY2A 2VYFA 4Z1MA 1JECA 1FMJA 1N6HA 2VRWA 2QBYA 2IBMA 3HJNA 4HAVA 1XTSA 5C1BA 1EXMA 2YC4C 2D2EA 1S9DA 3GLFE 3QKUA 2GCOA 3ZIAD 4NYIR 4NBSA 2CDNA 1DADA 4BFUA 2ZJ2A 3WBJA 1DG3A 3KDSE 3QY0A 2XGJA 4XWAA 4ZDJA 4A4DA 1BOFA 3L2OB 3Q8XB 1G7CA 4IDNA 1RRGA 4Z8YA 1XD9A 2HDNB 4YDHB 3N70A 4A2QA 4EPRA 3BXZA 4OK5A 4AYXA 4TL9A 4C0AC 5JJLA 3BFXA 1NJFA 3ONWA 4ZDIA 1XPRA 1D5CA 2DFLA 3RS5A 4MGYR 1IBRA 4BLOA 1J7KA 4WVFA 1T0HB 2J87A 1QVRA 1GM5A 2H16A 4A8JB 4LBVA 721PA 3A1UA 1UFQA 3L0IB 3TR5A 3J81k 4D25A 1SULA 4HAUA 4W5JA 1R5BA 2PLFA 5KSPA 1GITA 2A2ZA 4EKDA 5L3SB 3GJ8A 1F2UA 3OEHA 2W0MA 2GAAA 3QG1A 3CONA 1CR2A 4RZ3A 4M53A 5IK2D 3TW4A 1U8YA 2N42A 4M1TA 3C16C 5F98A 1OW3B 3U4QA 4ARZB 4EUNA 4N1AA 1W4BA 3FYHA 4PC7A 4JKYA 4MUBA 1UDWA 3I5YA 1OIWA 1XTJA 4PO9A 4PO8A 5IF9A 2XXAB 3DMNA 3RC8A 5H1YA 4OYHA 4HAYA 1JALA 3U3JA 4B6EA 1T91A 2GXSA 1CLUA 1X86B 2H18A 3I5XA 2LCFA 3EA5A 3K70C 4PXAA 2VF7A 4LHYA 3IDQA 2ZYWX 3CF6R 2FFAA 2ZRFA 3A58B 1DPFA 4OHXA 5JI3E 2GWHA 2QAGC 2YYZA 3VX3A 1MH1A 4OKSA 4B35A 3MWKA 5KDLA 3AVYA 4C9BA 1CJKC 3T5GA 2Z6VA 1TQ2A 1RYFA 2G77B 4Q02A 5KDDA 4JJZA 1Z08A 4M21A 4KFRA 4IJMA 1XFAA 4EJSA 1U2RA 2ZE8A 2RGNA 4B2LA 5DISB 2OO7A
chains in the Genus database with same CATH superfamily
1YGPA 2RJOA 1KY3A 3T5TA 1ZIPA 4QTTB 3ZV4A 3JQGA 2C29D 3O1LA 2Z98A 3PPIA 3MMSA 3UMCA 5LP6B 1DIBA 1E66A 1US8B 2KYRA 3ENKA 3OESA 1T4BA 1YIOA 1RZUA 1AO0A 3VTAA 2XHEA 1JG2A 4FGUA 4HB0A 4RK5A 1NE2A 4LY6A 3MCUA 4CQLB 3OFNA 4DNFA 2QGZA 1KBOA 2ZULA 4P36A 4MROA 1BX0A 1SCAA 2GJ9A 4CKXA 3T7DA 3B85A 4EO4A 1MBZA 3UFXB 4GZMA 1D04A 1RWVA 3NW9A 3EIQA 1YS9A 1FMFA 1NJ8A 1WUJS 1CUVA 2E4UA 3HLTA 3RLFA 2RAFA 3W5IA 1KYWA 4C4PA 3RJZA 5H81A 4Z7JA 4ZYXA 2EL9A 5BN1A 4YRDA 1FLAA 2X5NA 3HZZA 2MR6A 3KHSA 4LOJA 5FOVA 3W7BA 4LF5B 4LNUA 4J2TA 4RKYA 5K0NA 3IL2A 1FP4A 1RABA 1TIPA 2QRGA 2O1XA 1UC8A 3O75A 4GMDA 4HGQA 1BCSA 2POQX 4DRYA 1QTIA 2MT9A 3AR6A 3DOOA 1AXRA 1XA0A 2VATA 3DWEX 1IHXA 4Q93A 2H0RA 2B2CA 2WUFA 5HFJA 3IP1A 3VSEA 1YCFA 2BMAA 3L8MA 3ROGA 3S5JA 2V97A 3QTLA 4BNMA 4A7PA 3WB9A 4RVSA 1UC4B 1D1SA 1X80A 2PZGA 2WAXA 4IP0A 4ITRC 1R27A 2GI4A 2YWJA 3F78A 3ABQB 4KREA 3PHIA 4FYKA 4BUZA 1LJ8A 1PD0A 4PG7A 4N82A 1QRDA 3T99A 1NJ6A 3SK0A 2VPWA 4DAEA 2YWXA 3TE6A 4FW9A 2AV6A 1Z8DA 1GU7A 4TX1A 4U2EA 4Y9TA 5B12A 1E4VA 5K8CA 2L42A 5MDHA 4MUNA 3X43A 3L4BA 1F3LA 1C5KA 2HO4A 3PGLA 4HLDA 4W1RA 1O89A 4FGWA 1CE8B 5K99A 5CB4B 1XGKA 1LEHA 2Y6VA 5AM2A 1ECFA 4PONA 3VRHA 4CFZA 5JAIA 3KXDA 3HO8A 2D00A 3HU2A 4L7VA 1IQPA 4BJ3A 1W8DA 2ZTUA 4L1KA 4HDQB 1ZJJA 1FVHA 4M46A 4NK5A 2V0GA 3GLHE 2A7QA 4DADA 4UBNA 3AOEA 3H9EO 3T12A 3R5TA 1JEQB 2FN7A 2OBBA 4P0PB 3N8IA 1ZL2A 3WXBA 4WACA 4AG6A 1FSSA 4M60A 1DTWB 4G5RA 1V1RB 2VI5A 3I28A 4L02A 1O96B 3WGKA 2DBRA 1UBEA 3Q2IA 1FNNA 2XUIA 4W4TA 4F38A 2R1ZA 3AIKA 3OOYA 4HGNA 1V8OA 4G1FA 3UT6A 1LQ2A 2AOVA 3V2IA 4AY4A 3FX2A 3O8CA 1NMSA 1YONA 2PO5A 2NXCA 1IN8A 3WL3A 2ECQA 3ICQB 3NJRA 5CLGA 3ZV7A 1EG2A 1RJEA 2QPAA 2HYIC 2Z8YM 3BILA 2B6NA 3TRKA 1YBAA 2IYYA 2Z8ZA 4JLUA 1R9NA 2AHRA 5FTKA 1PR2A 2CEAA 4I5FA 1TYCA 4PS0A 1WHSB 3EZ2A 4QPJC 3UCFA 1FQWA 2NVUA 3TW8B 4P81A 4Y2RA 3MJTA 1KC1A 3D4IA 4HLUC 3BIOA 3AETB 4YMTA 1IN6A 3IH5A 2XUPA 1VIYA 3G7UA 5AI9A 4GMXA 1GFIA 5HQJA 1G5IA 1K4KA 3IIKA 4CL0A 3B13B 3IVGA 3PI6A 2JPDA 3DZ8A 3GEIA 2CCGA 3IDAA 2J5RA 2PA3A 1VE3A 1KE2A 1H6CA 2HLDA 1PFGA 3TPZA 2ORWA 4JHLA 2C57A 1YH3A 2IHJA 3WLQA 3CUWA 3KALA 3QF7A 4MJ7A 1DDGA 3R20A 1K7XB 2Y71A 2FR8C 4Q9JA 2X0FA 5BRAA 2WPNA 1KWKA 4AS1A 3KPWA 3ZGNA 1LRKA 1JSCA 2PU5A 3IJ5A 1LX7A 3S8EA 1O3YA 1ZGAA 3DVAB 4N9WA 1P5RA 4WXRA 5CVTA 5HM8A 2PMBA 2B8WA 5EZQA 5CGZA 3Q8WA 3IAS6 3KSDO 2ZRJA 4KLCA 4BFYA 4A8JC 1K6MA 1R4NA 3EWIA 5J2UB 3KK0A 1BU5A 5E95A 1XCMA 1X8LA 2VYQA 3IYLW 3R7SA 3UIEA 4D97A 5K0EA 4UPVA 1L7BA 2M6SA 1J0AA 1BFKA 1ECJA 5ILQA 3QOYA 3WLNA 8ABPA 2O2EA 2DHCA 2ZM5A 3FHTA 2AFRA 2B30A 2W83A 2UYGA 4ABTA 2DGDA 2HCJB 4B34A 5LWHA 5CA1B 3HKDA 1TVEA 4BO0A 2YXLA 1U7TA 4MVCA 4AK9A 4DCGA 2Q7OE 1JAIA 2DP4E 4NVRA 4Q9LA 3TFOA 1XZHA 5DLEA 4RXTA 1SU8A 3SJCA 1PD1A 3W9UA 1EXVA 4LE1A 2HHLA 2D13A 1X7DA 1MKYA 1SY7A 3AVOA 2NU9B 5C81A 1K5DA 1WPRA 2DM6A 1PR4A 1CUGA 1Y9DA 2BFEA 2C83A 1GDHA 5FBKA 5K8IA 3KQNA 3JQ8B 3L1KA 4DWOA 5I01A 3RFTA 3AM5A 2RI1A 2OK8A 3HKBA 2BKUA 5EQTA 4NG5A 1FBTA 1EIZA 4ADSG 4JWKA 3UMGA 4MRSA 1NDQA 1XUOA 2KWIA 2NV2B 4ZARA 3RRBA 4JI6B 5LQNA 2XOXA 3RO7A 3MWLA 2WINI 4N3GA 3B8HA 1A9OA 1M76A 1NZDA 1SXIA 3QKIA 5FUVA 2QW1A 1HYHA 2PKQO 3QWIA 4BBJA 4LGVA 3BGIA 5DM1A 5DRTA 2Z56A 2W6NA 2FUG6 1UBSB 2Z6UA 5ADUS 4PPQA 1J33A 2HU5A 3NIGB 4TM7A 5CB4F 1C7FA 4BVFA 5IZCC 3VPHA 2MIIA 3FN4A 1E2HA 5LP6C 5FV4A 1KO7A 5E6RA 3Q3JB 4AW9A 1MA3A 4I4LA 1K6XA 4OJQA 1KDOA 4UE6A 2QYOA 4NBWA 4YC7A 3V6LA 4HP8A 2XYGA 1I0IA 2YJNA 1EWRA 1P9WA 2A67A 1PQWA 2I6QA 4EG3A 4EHLA 4L28A 4ONEA 5J1TB 4XIYA 3ZWDA 1P9LA 3ZW9A 4QTXA 1SCNE 3RIXA 1SPBS 4JQYA 1BQ3A 3TBHA 1X7XA 2EHJA 1E7WA 3DE3X 4ZRMA 2H3EA 3DOUA 4P54A 3RUDA 1M3SA 3BD9A 1LS1A 1IK6A 3L40A 4WZBA 3AVWA 2VDWA 2BZ0A 2POCA 3FUVA 1UADA 2NVOA 4XOUA 3LFTA 5F23A 4BMZA 4KPYA 2FPIB 1TF5A 3QLTA 1NIJA 1X7ZB 4PYRA 1P5HA 4I4IA 2QRZA 2BFFB 4GX0A 3UJDA 1JJBA 3M4XA 3G49A 2I66A 1IUOA 1GPUA 3IAFA 1GA4A 3R0VA 4BQEA 5ALDA 4C06A 1DG9A 2EFJA 2PYIA 3EOZA 3T9FA 4UVIA 1H1LB 3VAYA 4C7OB 4PHTA 1G20A 1V1JA 2XQKA 2RCNA 3PICA 5BQ5A 1XP8A 1GTSA 3T3IA 4N03A 3N6RA 4CQJA 3N74A 2P7IA 2PR7A 3OPXA 1A9TA 1CIVA 4CPDA 3K2BA 1CUFA 2D1SA 3K5WA 2GYWA 5TQJA 1IJEA 4DEVA 2JEOA 5A5FA 3DL0A 4DHWA 1BWQA 2UVPB 1VMDA 3E2IA 3TD6A 3HEBA 4M83A 2IZ1A 3KKZA 3KU4A 3RVSA 4BB6A 5HGXA 4I1YA 1DZ3A 3RU3A 3PJDA 5AI6A 8ADHA 2XWJI 3OKCA 3RVOA 1E60A 2UUPA 3LKBA 3P32A 4RDIA 2CJXA 2M1XA 2QGNA 4CMIB 4LHVA 4DMMA 4P86A 2AX3A 3GYBA 3WIDA 1IBMB 5K01A 4HVCA 2XLBA 2XOKA 1WIWA 2IPXA 2Q6LA 3IPRA 1E1RD 2GAJA 3JAKA 1F60A 1MXHA 3DDZX 1EXWA 1ZCAA 3MGBA 3OEYA 4V2IA 4ZO6A 5IAEA 1GGJA 3ZLJA 2A94A 1FSGA 2VUHB 5J2UF 1YMVA 2P62A 4BC1A 3U26A 1SUCA 2BI7A 3WLRA 1XD8A 1ZJYA 2XCIA 1N25A 4N65A 4V0NA 4XM2A 1E2DA 3AUSA 3W7AA 1NASA 1X19A 3H9BA 1N2CA 1Z56C 2GZ2A 2N1MA 1X7YA 2GFHA 2WUVA 5DTEA 3OFVA 5IVDA 1EHYA 3RVQA 3TIIA 1RP1A 3M4JA 1KL7A 1NYQA 3DMFA 3FSRA 4OQLA 1J39A 2A1TR 4ESVA 4GNRA 4K2AA 4NFSA 5CA1F 4C76A 5K45A 3UKDA 4W6QA 3STUA 3WWOA 3FCEA 5JG7A 4DQVA 4UCQA 1PFYA 2TYSB 1NQXA 3G9ZA 5LUBA 3EJ6A 4LZPA 3DLTA 4UC0A 4RDXA 5LZ4A 2ISSD 2WZBA 1XELA 1ISRA 2AFIE 5DLQC 3DP7A 1W93A 2V7VA 4JJGA 3E1SA 5EJ7A 3GNSA 1E4EB 4YY3B 1BDBA 1RZRA 2FHSA 1O87A 2OESA 4TMWA 3A9RA 4XH9B 5TXGA 4NJOA 2HF2A 2V0NA 4FCCA 5E6UA 5FULA 2GO1A 1YHZA 4E13A 1ES9A 4DMUB 4D9HA 4NPCA 1DXOA 3DBVO 4UASA 4GVLA 3TR0A 4E07A 1GZSA 2RD2A 4LEIA 1UJ2A 1ZYUA 2XA9A 4A15A 2P3QA 3FZQA 5CM9C 3STHA 2GCNA 2PSEA 4B83A 4A91A 3LHDA 4B45A 5AICA 2A5JA 2YH2A 3NHAA 4FJ1A 4M49A 3MZ0A 3NO4A 4MS4A 3HA3A 1IMJA 3N8GA 1BQ4A 1YK1A 2XZTA 4KVAA 3C5HA 1PL0A 4UVGA 3RASA 2JARA 1IZ8A 1EZ1A 3GARA 2C3MA 2R68A 3PQFA 5DGCA 4GICA 4DVJA 1WZIA 3LUCA 4BGEA 3KVYA 1QG6A 1PX2A 2ZROA 5I9MA 3UOGA 1G16A 1EFCA 5JYDA 1YE3A 4POOA 4ZV4A 3NB0A 4XEUA 5A6SA 4QUJA 5BWOA 5ITWA 1M2VB 1PZMA 3AM4A 1LF5A 3O3CA 1ZW6A 2ZP1A 4RS4A 2RH9B 1K8XB 5JBIA 5IJ9A 3K09A 3UMBA 1NOKA 2OBXA 3T35A 1BMQA 4C2TA 3Q9SA 3FVRA 4CGZA 3QKTA 2ZJAA 3ZN2A 4C3UA 2JJ8A 3JZAA 4E1VA 3EZ7A 2GD0A 3DBRA 1TQ6A 2JD2A 4GOJA 4LISA 4DCSA 4OH7A 3FWPA 4FYMA 4F45A 2NUPA 3VHLB 4MV0A 1Z17A 4ZJPA 1GNRA 4MEAA 3SYLA 2GF0A 1CUCA 1EVZA 3BXEA 3QMWA 1XZEA 4FEAA 4HQFA 1OROA 1CY2A 5CX4A 1CUHA 4IXMA 1ZOLA 4ZC8A 1O94A 4B3RB 1WXEA 2COUA 4Z2AA 2REQA 3K3PA 2BEUB 2FR1A 3AY0A 4JCCA 4HEHA 3H2ZA 1A96A 2I2WA 3EPJA 2JKZA 1EBUA 1V8DA 3ZJ5A 2DUJA 1AHNA 4TXNA 2HUPA 2I34A 4GI7A 2WSLA 5DYYA 4TWAA 1MP0A 3K0AB 1ZGJA 3VPDA 3FH0A 1FW6A 2J3QA 4E4YA 5DEIA 4DUGA 4KYTA 1YJQA 2AHOA 3JTMA 4JJIA 4KPUB 1WR8A 3ZU6A 4JQSA 4X00A 1ULHA 5FI3A 3N3BC 3GRRA 4L9SA 3MQ2A 1U2GC 1FQJA 2BW0A 4HWPA 5CBKA 2BGMA 2H7XA 5CDFE 4YI3A 1B0ZA 1TA4A 5L7WA 5BW8A 5AUQA 4YXWA 1E8MA 2P6OA 2QTLA 1XEAA 4FFSA 3DHEA 1JA1A 4RMJA 5F1KA 4I2NA 4IYJA 3SG0A 3G5AA 4GNKA 4CL2A 1D9XA 2CVQA 2NADA 3PZBA 3OU2A 1F6WA 3WOVA 4G0XA 4F60A 1SCQA 1KIFA 3GOHA 1AJEA 4Q3NA 4GS5A 2GS9A 5B7NA 5K4HA 3MJCA 1JFLA 1OU0A 1PT7A 2C7GA 2XTZA 1Y5RA 2A86A 3AU9A 1RAIA 2ZTHA 3E70C 4HS4A 4N0MA 4BRSA 4BVJA 5IG2A 1CKEA 1S3IA 1YB7A 2R11A 3C87A 1L9XA 5UKDA 1QOZA 2ZT5A 4U9UA 2FWNA 4L3VA 3HM9A 1ODIA 3W5CA 1JLRA 2ZR9A 2J48A 4QX6A 4BS9A 1NYTA 3RC2A 1CC1S 1XOIA 2D0OB 3NWOA 2WW8A 4UE3S 2R7MA 3BE5A 4PZAA 1CJUC 5D8DA 4AN0A 3ND9A 1D2EA 2OHGA 3P5BA 3C6ZA 4RH3A 1G17A 4XTCS 3VO9A 1F6DA 1RKQA 4GZ5A 4YAUA 4OQDA 4JAVC 1ZG3A 3TUIC 3OBIA 3JARA 2NGRA 4JR1A 1EDEA 4OH1A 3FI9A 3KCNA 2IPMA 5FBZA 2CZQA 3HBAA 1C9YA 2LE0A 1PYDA 3TL2A 4C87A 1G55A 4FN4A 4H0NA 3CJQA 4CF3A 3W78A 1Q95A 3COJA 3OMLA 1MAWA 5CK5A 2B82A 1IIBA 3B6ZA 2AQHA 1OFIA 1QO7A 3EBPA 4JJEA 4QLOA 3FRJA 2QY6A 1OFTA 1X77A 3LUJA 4L22A 3BMNA 5AOCA 1RC0A 4ZVNA 1JR3E 4ESHA 4E12A 5DBGA 1Z5OA 1Y1PA 3BA1A 1ISJA 1V7ZA 2IF2A 3GXOA 4Q21A 1DCMA 1T8TA 1KHTA 1V3VA 1KK0A 2REOA 5T4FA 3DFFA 1N2OA 2OORC 4L4YA 2ZYHA 4X41A 3L4KA 2VC2B 5I8WA 3DGFC 5HDQA 1IHPA 3R9KA 5K20A 4ASUD 5C7LO 3E5MA 4UVEA 2LWIA 5TEVA 4I81A 2P2YA 3FF1A 1X39A 3O31A 5L3ZA 4F96A 3D0OA 4UQOA 4NARA 2H2AA 1S2LA 1P6QA 4RAOA 3OU6A 2PANA 1MAUA 4ZFNA 4EJFA 5HVNA 3NM5A 1F12A 2IZ5A 2BTOA 2PGOA 1ZD1A 1FK8A 3HVHA 1JDPA 4DJAA 1I10A 1OREA 4Q1FA 1EVEA 4UEKA 5EYPA 4H3SA 3G2OA 2GH1A 2QG6A 1VPLA 2H2IA 2FOIA 1QVAA 1TUBB 1ZUIA 1NRJB 3AZOA 4ALJA 5L45A 4QT0A 2WWGA 4ENPA 3DF7A 2Q3JA 1T3ZA 2DTXA 4GG1A 3LQ4A 1UXGA 4Q1EA 5CURA 3EISA 1NW5A 1N2ZA 1SQ5A 4DLPA 5AP9A 4OVKA 2OV4A 3C6QA 2EGHA 1E92A 5C52B 1RKUA 2G08A 2I3BA 4GI5A 1TT5B 4U7PB 3HY4A 1YRWA 1L6RA 1WCV1 3IPCA 3B7PA 3JALB 4WUTA 4KMMA 2WTXA 5TT1A 4DILA 4MDFA 2XAAA 3B9BA 3UXMA 1XQ1A 5JFGA 4RA9A 2WSMA 3H0CA 1JDBC 1TW3A 4QJ5A 2CLFB 2JFNA 1ITZA 1NUHA 3LW7A 3OT1A 4S3MA 4DMLA 1K75A 3H1PA 3UFBA 1TM3E 4ALIA 1KU0A 1SFRA 4AQYB 1D1QA 1MQ8B 4IW3B 5F76A 1QVWA 2C3UA 3C8DA 3H5LA 3LT0A 1JKXA 2O6LA 4XI9A 3IEPA 5CVCA 3ZXUB 2MSNA 5BN5A 1E3QA 3EA4A 2YW9A 4ZP1A 3PC8A 3TEJA 1IFXA 2AKAB 2VAWA 2AWNA 3FJOA 4YRSA 1DQRA 3DPIA 2HJVA 1MMFB 4R1PA 1T0JB 2X7XA 4MYUA 1KE1A 1QHFA 1YA4A 1DLIA 2QXTA 2WIFA 2P90A 3D1LA 4J4TA 4XIJA 2JI4A 1DXYA 2GF9A 1U7WA 5I7EA 5TIIA 1ZUHA 3Q7IA 5C4GB 2EP7A 2OCDA 2W00A 2YRFA 2HT6A 1VBNA 4UFPA 1Z4MA 4ZZ0A 3ZDRA 2QE6A 3KB1A 4BC0A 3LQRA 2C2ZA 2IGTA 1KZ4A 3KOUA 4M9XA 4Y2HA 2NXJA 3ZZNA 2K7FA 3CV3A 1HG0A 1LJLA 5FAXA 3RANA 3EQ2A 3M2TA 3QK7A 2J0EA 1IN4A 4F2HA 2KB0A 3WJ7A 3QPUA 1Z5VA 4WNYA 2WFAA 1KP9A 3G8BA 4Q00A 4CIVA 4MHTA 4N9QA 2CLCX 2O0HA 1BA2A 1N8KA 3USCS 1Z25A 5HQ3A 5JH7F 1VCOA 4M6WA 4BO3A 2CVPA 3KL4A 1JH9A 2WZQA 1BCRB 2DBYA 1PHRA 4KXUA 4DA8A 3ET4A 3P26A 1X38A 3QQPA 1KJYA 1N9GA 4CEJB 5JD5A 5L6LB 1XZFA 3KSBC 2X6RA 3HM2A 2IYNA 3PPVA 5DCUA 3CTPA 4MRNA 3KV3O 4IIJB 2IY9A 3H99A 2L2QA 2VCEA 1BXGB 4EF5A 3NALA 1FXWA 5C80A 4LF9B 1T6XA 3MPOA 1JXMA 3HO1A 2VTEA 3QFSA 5JSKA 1U8ZA 4MW7A 2IXTA 1TXGA 2SHKA 4UFNA 4JI0B 1P45A 2YY6A 4NS4A 1J09A 1NRXA 1YR3A 5CDHA 1HX7A 3TI9A 2BDEA 3NDRA 5EG5A 3ABRB 1YIAA 1X1SA 4TN1A 1NXVA 2C0QA 4Y6GB 4PSUA 4OLAA 2ZS8A 3VOAA 5JMWA 2EL7A 2R8XA 1D2CA 2EKQA 1WKVA 5DOVA 1DQPA 4XX1A 2XUFA 3PCXA 4PX5A 4R2HA 4B2IA 3AKEA 3BWVA 4G63A 4HNRA 3NHMA 1NHGA 3GLFA 2GSDA 2J31A 1BROA 2X58A 4RSGA 5IHXA 1W4CA 1E62A 3FIJA 4AD8A 5B2FA 2FSFA 4I1VA 1ECCA 3RYCA 4ZOQI 1YTLA 4JLNA 1G98A 1F51E 3I9FA 1C7IA 1OBCA 1PE0A 2FPRA 2QRHA 4KH1A 2HOQA 3M4ZA 4OQQA 4WN9B 4TV9B 5M7EA 4GVXA 1RPJA 4MV1A 4OHKA 2D1FA 2XDYA 1QSGA 4DC1A 1T9AA 5IASA 3N2EA 2FW1A 2BFAA 4P3PA 1DFIA 1XRMA 2ID8A 4RD6A 3HJHA 4YRPA 3SBEA 4D82A 1K89A 5JECA 3CLTD 4YWHA 1V2HE 2WHPB 3FA2A 4LDNA 4H1TA 3LA6A 2UUOA 3ESXA 3OTWA 4RM3A 4BP8A 4P22A 4CIYA 5JLJA 4UBMA 1EIWA 5FNVA 2AZXA 5LZ8A 4MWOA 3OTOB 3DO8A 2HMVA 2DUNA 2OG1A 3QVXA 4JOQA 1CG6A 1ICIA 2H63A 4QVGA 1U2TA 2ACWA 1E1LA 1LPMA 5B1IA 4I3FA 1N2SA 2YYSA 4OATA 4LIPD 1OYOA 3A1VA 4LI0A 4B31A 1CEQA 2KW5A 2Q29A 5D86A 3A3NA 1E20A 5FWYA 2YVKA 3SXPA 4QOJA 3HN7A 2YXNA 4AJOA 3QVUA 1QH8B 2QT0A 3U4QB 4GHWA 3GV0A 3EIUA 4X85A 5KNBA 1PDOA 2KHZA 2VIIA 5FYDA 2NAFA 3CLRD 4A6PA 4KBYA 2BHNA 4B8YA 4AJ2A 2VH5R 5FBRB 2ZB4A 5HF6A 3LUPA 1V16B 4ZV9A 3TAXA 3TQHA 5BUSA 4LJ7A 1A7AA 5EIFA 3DAPA 2ZVJA 4ZANA 1TJ3A 1R8JA 3FFAA 2GD1O 1ADFA 3IFSA 1CQZA 3N0RA 3OLZA 3PVCA 4PV7A 4NR0A 1E9CA 3N2IA 3OH8A 4BWYA 5AIBA 4G0VA 4NG4A 4BNUA 5LYJB 4JOSA 4FIDA 2WIKA 4P53A 3F9RA 2IBSA 1O58A 5EMMA 1PYGA 1V11B 5CIYA 3O8LA 3RWOA 4ER7A 5A7FA 4KRYA 1TLTA 1OFVA 4Q4HB 5EVJA 1KERA 4Q66C 5D6NA 2GPAA 5H3CA 2P8JA 5DSTA 4KPFC 3UGKA 5K3FA 2BF4A 2VHUA 2XVAA 3DCJA 3PYLA 1WDWB 4JL8A 1N1EA 3W4KA 1WEHA 3G79A 1H1DA 4MO9A 3T3NA 4JUCA 1WRBA 1BG6A 4A2CA 1A2BA 1PBTA 2KBEA 3EARA 3EEQA 2C04A 5EUMA 1JFFB 1C7QA 1G60A 2V8OA 3G0BA 4IR7A 3WK9A 1KO1A 4BKPA 2C7BA 3LFUA 3JVVA 3VC1A 1AS3A 2JGJA 4UU0A 1GZ3A 3SY8A 5KSOA 3S0JA 3ADKA 4RTQA 1XJ5A 2FFJA 2A88A 2I6TA 5COBA 3QSYA 2NZ2A 4EIWA 1U5CA 5T41A 2Q1UA 3WNDA 3WWEA 2B0JA 2VT3A 3QKWA 4HQKA 3V8EA 2F8LA 1SVKA 1U31A 4MA4A 3GI1A 4TUYA 5JYEA 4JI8B 5DGIA 1AH2A 1WMSA 4CQMD 2GLUA 3G5UA 4IZHA 1NBAA 1SHTX 1FNSA 1O9GA 2ZYDA 1H2YA 3W2TA 4EGQA 4OD0A 4EA6A 4U63A 2IV2X 1BIFA 2VPZA 4YIKA 4J1TC 3LWBA 4CM4A 1JAZA 4U00A 4MJ3A 3R7WB 1Q5PA 4H3VA 4OMDA 4I3HA 4F4HA 3RUHA 2R1VB 2XECA 1WULS 4B3IA 4GXRA 2NO5A 2XJ9A 1IXZA 2GBGA 1Q91A 1G21A 2Y1KA 3D4BA 3FNBA 1NA5A 2FUCA 2ZBPA 2IPNA 1W96A 3GJQA 3KTAA 4WLEA 1O0CA 5EIEA 1XDWA 3AO0B 4J2OA 5BP7A 3MCVA 4K9NA 2F3RA 2UUCB 3BMQA 2D7DA 2YJ3A 1FRVA 1Q3TA 5LIPA 3P5SA 1RBMA 3KWJA 4JJ4A 3UMJA 3JCZA 4Q9DA 4TYMA 3SVLA 1XMVA 1W85B 2ZB8A 3HADA 4HXGA 2QL6A 1U4NA 4X97A 5CLQA 4AFNA 1AVTA 5CNKA 4H18A 4JHXA 3HE3A 4NKRA 2DLNA 4GPZA 2PMCA 2JK1A 1IEVA 1V5GA 2JFZA 3NX4A 2GA9A 2H5IA 4IXNA 2CCJA 1A2KC 4MB6A 1D1PA 4M86A 4KL8S 5FDFA 1QZTA 4OBBA 2FE1A 3CVJA 4ZOBA 3WFJA 1XMPA 2JDIA 4H6WA 3ZHRA 4ZMSA 3KOWA 1TRHA 2IBTA 3ZGVA 1ULBA 2DH6A 5BN3B 4F0JA 2H4WA 1VB5A 2FJ0A 2FZVA 3TS1A 4DZRA 2AR7A 3AF6A 3UK2A 5A4AA 1GY8A 4D9BA 2VFAA 2HT1A 3KQOA 4XD2A 1GUAA 3IP7A 5LB2A 3UPDA 4CKWA 5K03A 4BX8A 4ZAGA 3ICCA 5DKFA 3M9XA 4A82A 3WYCA 1EGVB 3C8ZA 4NCXA 5DPMA 3SVZA 4NMXB 4QQFA 3ANYB 1GKYA 1WSBA 3RK4A 2IYPA 5CCXA 1K5GA 1Z0DA 4ARIA 2FMUA 1RQPA 3LU1A 3PLAE 4M22A 1V45E 3E15A 2AH5A 3AUJB 3D8SA 1Y1SA 4TYPA 3I2FA 3WS7A 2LW7A 3EC1A 4WA7A 1VCNA 2PO7A 4Y1EA 3TSZA 5BVHA 2G5PA 5E1DA 3ESDA 4MRMA 4G4SP 1M2HA 5FR1A 3WLIA 1HYEA 3P7MA 4XDGA 3RGGA 5E7IA 2IPOA 2C4WA 3GJRA 3SS9X 3O4FA 2VYND 2X2OA 3DQPA 1N9ZA 4J16A 3I4LA 4KP7A 3UGTA 3AX6A 2JLZA 4KTVE 1STOA 3GLKA 4KCGA 1XSEA 2C9ZA 5GAJA 2VYVA 4P3NA 4Q18A 4ZIRB 1YVUA 5D51S 1S2DA 1MAVA 1OXMA 3GRVA 4H7FA 1VMEA 5G1NA 5LYJF 1H5QA 5BVGA 3VOSA 2YTZA 3CXUA 2R7KA 4IX9A 4JI5B 4MDHA 4XUEA 5CAEA 3LZDA 2II6A 2IOQA 1SC9A 1CF9A 3ND8A 2HSWA 4X91A 1EFPA 1ESNA 4TKLA 3NDBB 3PGKA 2XCQA 4RDCA 5CJPA 2H1WA 5A71A 3GFGA 4NJEB 3SC6A 5D2CA 5TJHA 3GJ3A 4FVTA 3S2SA 5AUNB 2VUIB 1QO0A 3PQ8A 2QR5A 5HTOA 1K9VF 2QQEA 1QX3A 1UM9A 4O2RA 2R8PA 5FXMA 3GFRA 5AK4A 1ZIYA 2ZJ3A 3K5IA 2ZDQA 3LDAA 4LN1A 3H11B 5EMHA 5AI5A 5FTWA 3WMWA 1CB7A 3UUEA 5EJ8A 5I9IA 1W73A 4OOEA 3UJ7A 2EW1A 3E2MA 3G2IA 4L9WA 1XPOA 3LKZA 1Q0TA 4Z4IA 3IIJA 3ZWBA 1LDYA 4MQ6A 2GBPA 1IM2A 3IMFA 4A6XA 1XXHE 4PTZA 4C05A 2ZIEA 1RXSA 4BKUA 1TK3A 5AVKA 4B3JA 1U0RA 2GARA 2I4IA 4HY3A 2P2GA 1C1YA 1QH0A 3I9NA 3LHKA 2P3SA 4MEJA 1AQUA 5JTTA 1C80A 3CISA 4JGIA 2ZTLA 3PENA 2XT0A 1G7TA 1ZI6A 3WLFA 5KVCA 3VU0A 4NU0A 4Z7QB 2QE7A 2ZAIA 2W2KA 1A77A 3KVOA 1CFZA 4OFZA 4R0VA 1UPXA 4YMGA 5JC1A 4W5HA 5F2OA 3LLUA 3B3QA 2ODBA 2YOHA 1C4XA 2C99A 2ZDHA 3V00A 3NS7A 4RVGA 3RS8A 2YV3A 4ILKA 1GPMA 2WSSA 5DHTA 1CY1A 2ZT8A 3U48A 5DRYA 4UKDA 3GMTA 1PZNA 1E3WA 3FPHA 5GZ3A 4GKKB 2H4FA 1TVKA 1XQVA 3L06A 2FFRA 1IPHA 5TLSA 3OTIA 4EKNB 221PA 1EFUA 4J0FA 1ZD2P 4BQSA 1K7SN 4FEEA 3WSVA 4TL7A 4BQIA 2WU0A 1I33A 1U0OC 4MI1A 4RMHA 4LJYA 3SEZA 1P0IA 1JIQA 3CYFA 3P9KA 4A2PA 4RTSA 3AUFA 421PA 5F5XA 1GLVA 3PWSA 1KYTA 4PYMA 2NPOA 3NT2A 3IBCA 3L8GA 3PNLA 3VZQA 4IMPA 3F73A 4XWWA 1KQGA 4V0ME 1W5EA 3LS2A 2AEFA 1EG7A 1QG4A 3C8MA 5I9TA 4BPBA 3EGWA 5L7YA 3OUZA 1WMDA 3R7AA 4CKBB 5A2GA 4TKZA 1P2FA 3RFUA 2XIQA 3FHCB 3IV9A 1E7QA 1V4BA 1XVAA 4EF6A 3GEHA 4U0KA 3QLJA 3BZUA 3U7QB 3EOAI 3LA8A 4H7PA 1GN9A 1U0GA 3WSWA 3K9QO 3I01A 5ALLA 4OU4A 1C1DA 2EEPA 3TRJA 3CUVA 3VR5D 3IBYA 2TMKA 1OWLA 2OBLA 3CW9A 4X0EA 3PCTA 5B3LA 2J9FA 5CA0A 1XEWX 3NV9A 5J2TF 2DFPA 1J42A 1UR5A 1Y4ZA 2YZGA 1PLLA 4JI1B 1KMIY 2D5BA 3FE2A 2ZT7A 5YASA 4EPXA 1PR9A 4XDHA 2JCSA 5C8ZA 2JRCA 2ZG6A 1T13A 2CKMA 2JLAA 3BWCA 3QFRA 2XD4A 3R09A 1E0JA 1ZCBA 4O59O 5A2QA 5CLJA 3UCEA 2EG9A 3P94A 1JPUA 3MBOA 2ADMA 1DQYA 3F4LA 1U1GA 4JS0A 5DK6A 2RJNA 3ELBA 3EIFA 2BEJA 2IS2A 2ZSEA 1FFAA 4I6GA 4P32A 1KI2A 4G5SA 5SV2A 3NXSA 1V8FA 3GLUA 1K8YB 3K0CA 3F0TA 3A1TA 4KTTE 5BV1A 5DBFA 5DN6A 4BU1A 3L8ZA 1WXXA 3V2GA 4BMPB 2DCMA 4PAGA 1R0WA 3DHWC 2YCBA 3UBMA 3R3WA 4ND1A 3OM1A 1XK7A 2APJA 2C88A 3VV3A 3QEBZ 1RCUA 3CM0A 3KQSA 5FKJA 2GSWA 4EY5A 4I9NA 4MLDA 4PLTA 2ODAA 4YRNA 3H84A 1EDOA 3JRXA 5E38A 2E2WA 4H7JA 2XCTB 1Z6PA 4GLOA 2AN9A 3HL0A 1SZJG 3GAFA 4FFPA 1S8AA 1CUXA 2BHSA 2QGFA 4J0JA 3OEED 4M0MA 4UNNA 2J0UB 4YO7A 4ZVLA 3VFDA 1VJ5A 2EZTA 1BHO1 1XJWA 2HL6A 3QXGA 4ZCMA 3V1UA 3BRSA 1L7DA 4U7FA 1XNQB 4YP1A 3QLUC 5HJ7A 5KCZA 4Z3DA 4PO3X 1KZHA 4QPCA 4XGQA 2DB3A 1ECGA 3NEYA 3CZ5A 4PGMA 5DN9A 4GX1A 1F17A 4MLZA 3VJRA 3LCCA 4FYVA 1Y9ZA 3RVNA 1E1KA 1L6IA 4UXIA 4UCFA 2XNJA 3O84A 4UU7A 3TG8A 1JEAA 3ZVNA 2DMRA 3DDHA 4O8ZA 4AZ0A 3ZUPA 3M9LA 4FOPA 1XXHB 1NG1A 1QIMA 2C59A 1A9RA 2HDOA 3HDYA 3S1SA 1FFGA 1NN1A 4H0FA 3QLVC 1CF4A 1E3LA 2VOEA 2CLLB 3OHMA 3WKEA 1JHOA 1YCHA 5E2BA 1MB4A 3THYA 3WWYA 2JHGA 2WBLC 3KPJA 3V55A 3VC3A 3S8MA 2A0UA 2BFNA 4TYQA 5I8PA 1ZM2A 3ZVLA 2WKRA 3O6VA 5REQA 1SBNE 3RIHA 3GPBA 5CB8A 5BNIA 3O9MA 4KN9S 1E6KA 3DDNA 3OZUA 4RGVA 2LD4A 1P0MA 2PWZA 5MFPA 1V95A 2WTEA 3FFWA 3IXMA 3WL4A 1CNEA 3G6KA 2NSJA 3P4UA 2I8LA 2AYYA 5KNCA 2FEWB 1D2NA 3KDPA 1I51A 1NP6A 1RD4A 2J4CA 3IHTA 4LXQA 3VU1A 1XQYA 1KGSA 4UJ5A 1CY7A 1YUNA 4PE5B 1NY5A 3AHFA 1S2NA 1J8MF 2F8MA 3FGZA 1MB0A 1ORIA 3KSZO 1K7CA 3NKFA 4PHCA 1FP1D 2QM8A 3AFOA 2IYVA 4D8UA 3KYBA 1UJBA 2DT8A 2VHEA 3TEMA 4GGOA 3TWOA 2FSVC 3BSFA 1AGPA 2VDUE 3FSGD 4KBGA 2NO7A 5FBLB 3H2SA 4JEMA 1JF8A 4DLKA 2X19A 4YJHB 1LF0A 5KTOA 2HRDA 2HK7A 5T64A 1QQBA 1AZLA 1UMBB 2E37A 4J03A 4YJDA 1EFRD 1EFHA 1NDHA 2VT6A 3KXKA 4DBVO 1EUQA 4FNGA 2V9PA 1TM5E 4HNTA 3WLMA 4O33A 3WG9A 1LLFA 1VKRA 2OSBA 3KJHA 1FP7A 4KW7A 2VZ8A 3QU5A 4LOKA 3K9GA 3I1YA 5EJ4A 5FWDA 5I5GA 4Y8VA 2UVDA 1CW2B 2JCGA 3F8TA 3OPYB 3SIRA 1Z6ZA 1R10A 4I9FA 3V32A 4EBBA 2J0QA 5ELMA 1H42A 2QIOA 3ZCPA 4Q7EA 3A1WA 1NVVQ 4JP3A 2JGLA 1IG0A 2HBZA 4NHEA 2Y3IA 3HP1A 5FJIA 3HV2A 4BVKA 2C9CA 2GO7A 3GJ4A 4HLUA 2G5TA 2YV1A 4NF2A 1IEQA 4RPIA 5JIBA 4B9AA 3RWMB 5KIAA 3R5JA 1DRJA 1DX9A 3C98A 3NIDB 3IOMA 1FFXA 1HG1A 3SDZA 4C0XA 4KQJA 1KI3A 2P4EA 5KOIA 4P7BA 1NMZA 3D54D 1P3Y1 2Q46A 3JQ6A 3KYJB 3UYLA 2IHTA 4CETA 2YASA 2WUEA 3CH7A 1I3NA 2ANCA 4WHMA 1HA3A 2HU7A 2W4MA 4IWNA 3SF8B 3ADCA 2JD1A 2V59A 4N39A 3MCAA 4R1NA 5KVQA 4G86A 1KKMA 2EDAA 2VLIA 4DR5B 1QF6A 4FZRA 2OL4A 2FR8A 4I2VA 2XAUA 3TRIA 3OZBA 5JHHB 1JEJA 1ZFNA 3QSGA 1UBCA 1YUBA 5CW2A 5SZHB 3LSTA 1WNTA 2JAUA 2J0SA 1R37A 2GETA 4YASA 3VZBA 2ICAA 1QAQA 1VG8A 3LLMA 1BX1A 3TOVA 4TS1A 5JE8A 3IOBA 4MMYB 1QKKA 3WGMA 3KT0A 1RNLA 3AXTA 4A8JA 4EHDA 1OBHA 3OMWA 3GAZA 1E2MA 4Y9RA 1HE8B