2FGJA

Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
241
structure length
241
Chain Sequence
DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title A structural analysis of asymmetry required for catalytic activity of an ABC-ATPase domain dimer.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 63
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fgjA00
3TGPA 1U8ZA 4XSGA 4E07A 3T1TA 5EUMA 3AF1A 3TR0A 2H7VA 4LYHA 4G5QA 3U6KA 4CEHB 1P9RA 4P32A 4EQ6A 1NN5A 2FF7A 3DM5A 4GRAA 2ZRGA 4Q03A 3KQHA 1I2MA 3RC8A 2F9MA 1JNYA 1DO2A 3QKTA 2OT3B 1E2IA 1T3HA 2E1RA 1MO6A 4G0NA 2YWFA 3N2IA 2YINC 1GAJA 2F43B 3V9PA 4TYNA 421PA 3THXA 3E2IA 4S2EA 5C18A 3W8RA 1W4CA 1KK2A 1P60A 2HV8A 1Q1EA 3IIMA 3VKWA 2YYZA 1M1YE 3I73A 4PPFA 2EWWA 1GG2A 3DKVA 3ZYCA 1IXSB 5FUXA 3IBYA 2EFHB 4PAQA 2AWOA 5IF9A 4RD1A 1W36B 4XIGS 2F1JA 3U7EB 2P5SA 3SQXA 1E9CA 3B85A 2O8EB 1JAIA 4KSBA 2QGZA 1N5LA 3B78A 2BOVA 1HV8A 2C04A 4CZ2A 1Z0KA 4JBXA 1AS3A 1JBKA 4XVUA 3FGNA 4JVLA 3F3YA 1N6RA 4IKEA 3X1YA 3WNDA 1CS4C 3SFVA 5C46F 3H84A 4A2WA 3QUSA 4KI0A 1XD2B 3OAAA 1S96A 3AEZA 3OF5A 4P4UA 3ZD7A 1G4AE 1VKJA 5EP1A 3OESA 2FFHA 1T9HA 2JDID 2G88A 5CJ2A 2QORA 5DN6A 3P1JA 1ESMA 1G17A 4KJZA 4I99A 2CLSA 2OCYC 2WWGA 1DS6A 3TR5A 3ECCA 4AG5A 4C0SA 1F60A 1DO0A 2YZ2A 3Q9LA 5E7IA 2Q9CA 1GRRA 3W6OA 4QHSA 4DCVA 4CW7A 1JALA 5E7JA 5J4YA 4DJTA 2FGKA 2N42A 4YMVA 2V3CC 5AWFC 1G6OA 2OAP1 2BMEA 1NN0A 4RZUA 4FMDF 3UG6A 2WAXA 2OM2A 1E0SA 2HF9A 3L8ZA 5H1YA 2QBYB 4C0QC 4KFRA 3T5DA 4CF7A 4NYJR 2CNWA 5IT5A 3FKSA 2EYUA 2ZS9A 3MG9A 3U5ZB 2ZITA 2AK2A 4DT1B 2YV5A 4X8LA 2XNSA 2IEZA 3ADCA 3EX7C 2DFTA 4Q1CA 3QEOA 3HYRA 1UADA 4D6PA 3OEHD 1Z0JA 5JI3E 2VL7A 5DGXA 1F2TB 1OLOA 5DHAA 2QE7A 1UFQA 4KFTA 4DCUA 4FN5A 1KO8A 4RFVA 4YMTA 4HZUA 2R6CA 4LDJA 3LD9A 2F1IA 3RS4A 4TMZA 2RB4A 4QBGB 4MKGA 2R6GA 2C2HA 3WHLA 1IJEA 1QRAA 3CBQA 3SQWA 4ACBA 2QRZA 3VU9A 1BH2A 5KPDA 5JSZB 1A82A 1NI3A 3C15C 3SYLA 2VP0A 1HE1C 2LKDA 2GJ8A 5HZHA 1PUIA 2IYVA 2VO1A 4AK9A 3QPVA 2BM1A 1MV5A 3SU8A 2KBEA 2HF8A 3M4YA 4GSYA 2P6UA 4M9XA 3KJGA 2OCAA 2ZE6A 4PPGA 2HCBA 4NTZA 3WBKA 1SXJB 1GSIA 4JLVA 4B71A 3PUYA 3BC1A 3KQUA 4P31A 3NH6A 4L4UA 4IXNA 4LC0A 4IEIA 4XOIA 5KNDA 3R20A 4IOKA 2YKGA 3KFXA 5JBQA 2R6AA 1DBSA 4K81B 4POAA 3D31A 4JL5A 4KV9A 4LJAA 1HE8B 1LS6A 1IOZA 2EFEB 3R9XA 1KI3A 3QENA 3TUIC 4IDQA 1EFTA 5CK5A 1BS1A 1MH1A 2ZI7A 2J87A 4LHXA 5TDHA 4D82A 1U8AA 2FSGA 2J9RA 1QVAA 1EWRA 4YMWA 2WJVA 5FTNA 5EZ6B 3T35A 2REOA 4NDZA 2NO1A 5AJVB 4KLZA 2JLVA 3IEUA 4JLOA 1P2UA 3WMFA 3L43A 2WZQA 1T3SA 4HB0A 3C7KA 1W0KD 1P3JA 1UDWA 2Q3MA 2QM7A 3P4XA 3MUFA 2J1LA 5H8WA 1YR8A 2A7QA 5HKKA 1UDXA 2GNOA 5CLLA 5HCIA 1S1CA 3TH5A 1SVWA 1TU4A 2B8TA 1Q3TA 5JWOA 2I1QA 4OI2A 2QG6A 3LXXA 3M0EA 4GI7A 1NBME 3T1QA 4EPYA 4ON9A 3LQRA 4UXIA 1SVIA 4TLBA 1AJEA 4U00A 1NVUQ 4B3GA 4G5RA 4YXWD 2IYLD 1X8JA 4QRHA 2ZEJA 3BD9A 1R2QA 3A8TA 1XD8A 2ZRMA 1Z5ZA 1Z6AA 2GJKA 2OBMA 1G291 3IHLA 4LV5B 1SZPA 4LWZA 3B1XA 4V0MA 2OCPA 3L2OB 1YZTA 3SJAA 4HAXA 4XD7A 4Q66C 1FZQA 4MUAA 3AKCA 2ZYUX 3C4JA 3PV0A 4AIIA 1DADA 3NIBA 3B82A 2NO7A 2GCPA 3GD7A 1OXXK 4ASUA 2FPMA 1YJ5A 2NOAA 3GLFB 1N6LA 1NMZA 4V0NA 3HYTA 1NG1A 2WSSA 1YZLA 5AJZA 1EFRD 5DLQC 3Q5DA 1U9IA 4DCTA 3TQCA 3HU3A 2C77A 1VDZA 1Y3AA 1N5IA 3B1VA 4US2R 4BASA 4PPNA 2FE4A 4AG6A 4DLZA 2VEDA 2WMOB 3EWAA 5JI2E 3KB1A 2ZAMA 4BE7B 1DE0A 3QOFA 4BZXA 5CK4A 1TQ6A 4CEJA 1NN1A 2R44A 4NYIQ 1VIYA 1T5LA 2IK8A 2ZQ5A 2ZJ2A 1I4TD 1G1MA 5JCPA 3AM1A 2K5UA 4Z51A 1GKUB 1U99A 3KJIA 1T0HB 4KBGA 4M21A 3E5HA 3SN6A 1SVKA 2WPDD 4MRRA 1XMIA 1NJFA 2XTZA 4NONA 2RGGA 3KKPA 4B3BA 2C78A 3HPRA 2FH5B 5F98A 4C9BA 3I1FA 1L4UA 2WKPA 3L0OA 3I72A 3GLIB 4IJMA 2JLWA 2ZETA 2XJ4A 1AK2A 5FPKA 2RCNA 2B7CA 4QNRA 1Z47A 3QXSA 3GCGA 1OIWA 1G5TA 2C5LA 4Q4LA 1HA3A 4PQRA 1W46A 3SC3A 3CNNA 3GJ4A 4OI0A 4NMMA 3SBDA 1R7RA 1YZKA 4A92A 1N5JA 1NMXA 1H65A 1XEWY 2GBLA 1FL9A 1TUEA 1GILA 2PT5A 2Z0MA 2XITA 2IWRA 5L3SA 1AZSC 2DWPA 2MSEB 2Q21A 4HAVA 4JMPA 1JR3A 3FMIA 3B13B 4A6XA 1ZD9A 2PX3A 4GOXA 1SXJE 1TF7A 5AK0A 2D3WA 1W0JA 3NBXX 2AHOA 1M8PA 1LW7A 4OQMA 1XMSA 3ZGXA 3EA0A 2EVWX 4DUGD 3UPUA 1ONBA 3I62A 1CJVC 2KE5A 3IQXA 1PV4A 2IF2A 2YNMA 4Q1DA 2GK7A 3MRSA 4HYYA 1E9FA 3ASYA 3FFAA 1E2PA 3TLXA 3VAAA 4R71A 4A15A 4BQSA 2R8RA 1J2JA 4G5OA 4KITB 4TL7A 2J41A 2IHBA 4PTLA 3WNBA 3U4QB 2IW3A 1G6HA 3JVVA 4CEIA 3K09A 3GJXC 1A5TA 4WZBE 5DO9A 2P5TB 4KVAA 5IDVA 2ZRIA 4Q1AA 3FMFA 4LV6A 2IS6A 1JEEA 4JS0A 3TAUA 1KO5A 1XMJA 2AD5A 2X2FA 3AF2A 3CWZA 3K9LA 5B64A 2VH5R 4TYQA 3M6AA 1N6OA 2C9OA 2EWVA 2JEOA 2BJWA 5DH9A 4BFSA 4LSGA 2O8BB 1CBUA 1AM4D 3RRMA 1ANKA 3CPEA 4QGHA 3T61A 1N2CE 2R6DA 3K0FA 4BFUA 1WBBA 2AXPA 1E0JA 3A1VA 2P6NA 5DI3A 2GBLC 2MSDB 5C2JB 2J0UA 2YOGA 1T8TA 2P6RA 4JKIA 4PZZA 1UEJA 2ZYWX 1Q22A 2WJIA 1Z0FA 3BBPA 2ZRLA 5TMPA 4B33A 4E5UA 2CHGA 2E87A 3VHLB 3DKPA 4DKXA 3KUDA 2ODBA 1IN5A 3MFYA 4EPVA 1VMAA 1X86B 5KSPA 3ZQ6A 1ZM4A 4UJ3A 5E95A 1R8QA 3AF0A 2G77B 4QBIA 3N2EA 1OXVA 2IL1A 2PJRA 2ORWA 4DZZA 2OG2A 1XTKA 3GLHA 3CONA 3VFDA 4BECA 2RGDA 5E7MA 3GLGA 4F4JA 4CIDA 3K09C 4PX9A 3U7FB 4P4SB 1NSTA 3RSOA 4LX0A 1UBEA 4DSTA 5DN6D 1IQPA 4LCBA 2GRJA 1E1RA 3A4LA 4UNPA 1OH5A 3Q7QA 4OHYA 3QXCA 1E2MA 4HLDA 3GLFE 1Z0AA 5AJXA 3PEWA 4ITRC 4Z1MA 1XCPA 1P62B 3K0SA 4JJZA 3DHWC 2CE7A 3CX6A 4UXHA 1IY1A 2V55B 1OV4A 5G40A 4JLKA 1E9EA 1RRPA 2FZLA 4C30A 3NXSA 3AB3A 3C41J 3LWNA 4W5HA 4BLTA 2ZM5A 2ATXA 3LBNA 4JLAA 1ZUHA 3CM0A 4V0LA 4EFLA 4EPXA 2OXCA 4DDUA 3U6BA 4RZ2A 2W6ID 2CNWD 4TT3A 3FKSD 1DAIA 1E9SA 3NBYC 3RWOA 3G82C 1ZC3A 2WWWA 3QQ5A 2QI9C 4JZKA 4LY6A 5J4HA 3OE7A 4TYPA 3ZVLA 4BUJA 1E2JA 4DCSA 3GLIE 4A8JB 1VG1A 4FW9A 4JJKA 4R98A 5KYKA 1N0UA 2QE7D 3N70A 3AQ4A 2ZIAA 5FUWA 3VX4A 2Q3HA 4OYHA 1D8TA 4XWOA 1ZM9A 3DEFA 4QL3A 1ZC4A 4DXAA 5EE5B 1HQYE 3DL0A 4OK5A 3JVUA 2FX3A 3U7HB 3AVVA 2RAPA 5CDFE 3EXAA 5EXPA 4KXFB 3TNFA 2GF9A 5A4JA 4D4MA 2QU8A 2AX4A 1EGAA 4OHVA 3WY9A 5KDOA 2ZU6A 1D2EA 2AD1A 4Q9HA 4Q9KA 4QGAA 2WV9A 3LBHA 1JR6A 4UNNA 1OB5A 3U3OA 3FOZA 1JQJC 3THWA 2P65A 3WNCA 3AKEA 3M1IA 2YVUA 4LUCA 1XZQA 2Q3FA 2WWXA 1SHZA 4MRVA 3QI2A 6Q21A 3DDCA 4Q4HA 4RSGA 4Z8XA 1KI8A 3O8CA 3LLUA 5SZKB 1E96A 3T34A 2GTPA 4US1R 3SE0A 2OHFA 1ZNZA 4WAUA 4NYJQ 2WICA 2ZRHA 1VYUA 5J47A 1KO1A 2YOHA 1D9XA 5TY0A 5GJBA 3SI7A 5KNBA 1FMJA 2ANBA 2IXGA 1XXHB 2QY9A 2W58A 4MYTA 4URYR 4B3FX 1HEIA 2QP4A 1Z06A 1CR2A 1UKYA 1KI1A 3U60B 3KTAA 1XEWX 1EFUA 2F3TA 1YZGA 2GEVA 2HJVA 2OEPA 3O8DA 4Q02A 1Z22A 4A9AA 3OEED 3ZQJA 3R7WA 2GHIA 5EXXA 4D0LB 1G8FA 2CE2X 3ZDQA 1T6NA 3GJ6A 3BWDD 3AF3A 1G16A 3CO5A 5HKKD 2HYDA 1ZM7A 2W6JA 2DCUA 1E9AA 3PUZA 1VG0B 2JIZD 1N0WA 1EK0A 2QPAA 3Q85A 1T91A 2OO7A 1W47A 3CR7A 4KLNA 2HJGA 2V54A 2Z5FA 2PBRA 3OIUA 3AH8A 3SOPA 1SHKA 4ZDKA 1BMFA 1Z0IA 2OCBA 2IT1A 3K70C 4FMCB 4O25A 3RAPR 4IVPA 1WA5A 2X77A 3MAAC 3P27A 4TMWA 3QG1A 4ZDWA 3U44B 1P9WA 2OBLA 2AKAB 3HR7A 3Q3JB 3AVYA 2ZXUA 3TE6A 2VHCA 3CX7A 2HYIC 5JJIA 1GTVA 1OH7A 3CRW1 4M1WA 1W48A 2CBZA 1E4VA 2OILA 2R62A 4LJYA 1R5OA 4Q4AA 3B6EA 2D7DA 1XEXB 2GF0A 2B92A 3S1AB 1NLFA 1G21E 1Q0UA 3SYKA 4FCVA 2GXQA 2WSMA 2ZSFA 1TF2A 2J3EA 2WSSD 1NRJB 3EZFA 3MWLA 1XJQA 3FFBA 1U0JA 1E2QA 4EKDA 2EFCB 2KBFA 2FZ4A 2KI5A 3KQLA 3EPKA 2QMOA 4QM6A 3QJYA 3QF4B 1HT1E 1S9HA 4RD3A 4ZIRA 2EFGA 3FVQA 4M22A 1WDTA 3PJRA 4MYUA 2GZHA 1FQJA 2WKQA 2CJWB 1UEIA 4WA7A 4GNKA 5EP2A 4FCTA 1GP2A 2D2EA 4IFEA 4KU4A 4Q4JB 2F7SA 4GPTA 4AURA 2O8DA 2XXAA 2HXYA 4TLDA 1DOAA 4WBSA 1FX0A 3A6PC 2BKUA 1E2LA 2NPIA 4EPRA 4C2TA 3GEIA 4OL0A 5AJYA 2QAGC 721PA 4BPBA 1M6NA 3W5IA 3F5FA 1ZW6A 4GOJA 4UXJA 1Q20A 3I4LA 2X19A 2YHSA 4JYCA 4NP6A 4BFZA 3VR3A 2V6IA 3Q5EA 1RRFA 2LKCA 2VIIA 3AKDA 1A4RA 1FUKA 2YWHA 4RKFA 2PZGA 1D9ZA 2IUTA 4LJ8A 5AUOB 4XWKA 2BDTA 1JR3D 1U90A 1ZUIA 3KKQA 2G0TA 5CLQA 5D3MB 2KB0A 4CEHA 5B30A 1W0JD 3ADKA 4H1VA 5FTMA 1NIPA 1N25A 4MYCA 3THOA 3RRNA 2BJVA 4AD8A 3B5JA 2ZJAA 3EZ6A 4M9SA 1JAHA 3NBFA 3R9IA 3ZLJA 1OXUA 5FOVA 4M1KA 2CL7X 1QZXA 1T4GA 4WOPA 5CM8B 1L2TA 4MDFA 5FOWA 1W2HA 2Z6VA 1YQTA 1Z6YA 5DIFA 3PEVA 1XXHE 3W34A 2F43A 3KB2A 3W6NA 1WCV1 1E2HA 2L0XA 4LV8B 4AKHA 2ZJYA 4DC9A 2C03A 1OFIA 1P61B 2A5DA 2Q6TA 3DM9B 5JJLA 2JJ2D 3SS8A 1OXSC 1T3LA 2BV3A 4RCYA 1RC8A 2O8EA 3GJ7A 2HDNB 4Y0AA 4BRWA 3BAFA 2HUPA 1B0UA 1OH6A 4QGGA 5KUTA 1KAGA 3EZ2A 4PPQA 3F8TA 3B60A 4IDHA 4JVNA 2FFAA 2RHDA 1NBMA 5JEEA 2CLCX 3FMPB 2ZVPX 4DLUA 1GL9B 1XD2A 4MGIR 621PA 1RRGA 5EXSA 4DLXA 1ZNXA 1BOFA 3OIYA 4FMDB 4BLPA 1WE2A 3V4FA 5LD2B 4EPTA 2VBCA 1VECA 3ETLA 4BEBA 1KSJA 4OKSA 4II7A 1GNPA 3GJ8A 1IM2A 1NSFA 5G53C 1JJ7A 1VPLA 3TAHA 5HCNA 4JBWA 1N6IA 1ZU4A 4V0OA 4Q19A 2J7KA 1CJUC 4FI3C 4WIAA 1UKVY 1GUAA 2ZUDA 3D8BA 2WWFA 1CKEA 3HU1A 4Y0VA 3MSXA 1G8HA 3UWKA 3BK7A 3ASZA 1OXTA 3QXXA 2CMKA 1R0YA 4QNMA 2A5GA 3HJNA 2QBYA 2OV2A 2IA5A 1GRQA 1NJGA 1W36C 3REFA 1LF0A 3LRPA 2F3RA 2OSBA 2GA8A 1CR0A 1GKYA 3TSZA 4D25A 4DSUA 4DT1A 3BFVA 4D81A 2PZFA 4FMBB 5H70A 2O5VA 1MABB 3EW9A 5F2EA 5CIQA 3V4RA 3K0EA 3VTKA 4AYTA 1O87A 1II8B 5F9HA 2V8OA 2ZUBA 1RPZA 4C4PA 1F2TA 5J4KA 5BN3A 3EC2A 1N6PA 1ZD1A 1OYYA 5CJPA 1ZBDA 3BE4A 3W90A 4O3MA 3AVPA 4TT3D 5K8UA 4H9GA 4OI4A 3L82B 4DWJA 4RD4A 1A2KC 5UKDA 2OFOA 3QIAA 3IGFA 2NQ2C 4LJ4A 2J7PA 1KY2A 5HTKA 2CEAA 2ORIA 2VHJA 1BIFA 3OE7D 3IPYA 3PCRB 4PO1A 1LY1A 4PR0A 5JSZA 2ZVQX 1U0LA 1TMKA 2KSQA 2Y8EA 3TVTA 2FU5C 2WTUA 1S0UA 3CRRA 3GQBA 3U2QA 4X8OA 1N3BA 1KSHA 1QDEA 3EC1A 2QUZA 1NLZA 1Q21A 1ZD8A 4F4IA 5EE9A 2GK6A 4YMSA 3R8CA 2PJZA 4RY2A 1SXJA 3K0AB 3QY0A 4OQNA 4Q48A 4AYXA 5GJWC 4QJ5A 1ZRHA 1NMYA 4B43A 3B7GA 4G01B 4A36A 2ZJOA 1KNXA 4L9SA 1KY3A 5GVSA 2GXUA 4LPKA 3U3KA 4AYWA 2J0SA 2OUKA 2ANCA 4PAMA 2A30A 1V43A 4DVGA 3TW4A 2GCOB 2GAAA 4Q21A 2BBWA 1NKSA 1E98A 1US8B 3DOFA 1ZIPA 4DSNA 4U7DA 4NCIA 5DISB 1E3MA 2GETA 3B2EA 4TLAA 1G7RA 5FPYA 4CT4B 4V03A 4GBMA 1NNEA 2JLXA 4A0GA 1YRBA 5EE0A 4IOLA 1VTKA 3WXMA 3CH5A 3CZQA 5EE3A 3K70D 4HB2A 3SJZA 2FGJA 1Z6XA 1XTQA 3DVLA 5FBVB 4D4KA 4C7OB 1CR4A 4M1TA 1WXQA 1KNQA 4N1AA 4KODA 4BEJA 4I81A 3TBKA 3ICQB 1DG3A 5KSOA 2UZ3A 2JJ1A 3VNUA 3CWQA 4HAYA 2UKDA 1COWA 4JIMA 5E3HA 2PZEA 3C5CA 1T0JB 4Q9IA 2ZI5A 1RYHA 4JLMA 1CF4A 1P9NA 1B23P 4TYWA 1S3SA 5L8VA 4NHOA 2EFDB 3ND8A 2QP3A 2Z4RA 2VHUA 1W49A 5JWRA 2IS4A 2W00A 2Q9AA 3BOSA 4PC2A 2BCJQ 2W6JD 1OHHA 4PSVA 3ZD6A 3PUVA 1LNZA 2QPOA 2IUUA 1F2UB 4MRSA 4KSCA 2A3RA 3HU2A 1EX7A 1JXOA 1TNDA 1FQKA 5DYIA 1YHNA 4KO8A 1BMFD 4LBYA 1WP9A 1EFCA 4Q1FA 2W2XA 3TRFA 3CB4A 3GLFA 2OESA 3MWYW 4RZXA 4PSAA 5TB5A 5CYPA 4RCZA 3T1OA 1CLUA 3DZDA 1YZNA 4DRZA 3C8UA 2RGCA 3W8NA 4BRUA 4ESHA 1W5TA 3BORA 1IAQA 1QHNA 1P73A 1Z3IX 4QHYA 1I4LD 2ERYA 4DLYA 4JT2A 4GZMA 2XJ9A 2H17A 4ZCIA 2D2FA 4JVSB 4ZDJA 1W1WA 4XSHA 4PHTA 1XPUA 2ZRPA 1BKDR 2A5JA 2FG5A 1AA9A 1HY3A 1Q57A 2CVHA 2RMKA 1GITA 4GFDA 5TVKA 5KDDA 2AWNA 3NHAA 2IWHA 2AFHE 2DPXA 3KZ1E 4KAXA 3RS0A 1N6NA 1ZJ6A 4OK6A 1DEKA 2BMJA 2ZSAA 4D4LA 1IXRC 3FDIA 3E70C 2REBA 3VR6A 2XSZA 1KIMA 3GLIA 1YZUA 3NHBA 4A0RA 2GXAA 4MGZR 4HLQB 1UBFA 4QJ4A 5DSZA 2JCSA 2C8VA 3ZJYA 2AKYA 2IYYA 5JWHA 2F1RA 2P3SA 1S4QA 3ZZTA 4QOSA 1DAHA 3MCAA 3EZ7A 1PUJA 1TUIA 4LPSA 3E1SA 4TTPA 1NLYA 5CDFA 1P75A 3U3RA 1F48A 4M9QA 4MH0R 1P2SA 2J46A 1QHHB 4LHWA 3SHWA 1BO6A 1XD9A 2A5FA 4RD2A 3J81k 1WRBA 1DAGA 2DB3A 1FW6A 2LWIA 3UMFA 2ZYVX 5FL3A 4FINA 2CK3A 4GL2A 1NVVR 3OFNA 4PZLA 2C9CA 2JJ8A 1G8YA 4EAQA 3MD0A 3CIOA 3A1UA 3BFKA 3LA6A 3U4QA 5A0FA 4XWAA 5JCZA 2AFIE 3FHOA 5AUQA 1KKMA 1GM5A 1MT0A 1EX6A 2EW1A 4FIDA 4IVRA 3GJ5A 4EDHA 5IRCD 1E79A 5KO2A 4JLNA 1ZUNB 2H57A 3CF2A 1OW3B 1U9IC 5J40A 4YC7A 3BB3A 2IHYA 2QTHA 4ZV4A 1G7TA 2NGRA 3LXRA 4GP6A 1SVLA 1P7CA 2O8BA 1TPZA 1KZGB 3CR8A 2FFBA 3A1SA 5KDLA 4JT4A 1VG8A 4KYIB 4W9MC 2ERXA 2QSYA 3B9PA 2OZEA 2ASEA 3WP0A 5EUQB 5FPSA 2F55A 1KI9A 3TKLA 2GILA 3O8BA 1LS1A 4PC7A 3IO5A 2VYFA 4QXAA 3LLMA 3QKRB 5EJEA 4Z54A 1W36D 3QG5A 1NY6A 4B2PA 2FN4A 1EG7A 3ZS8A 4EFNA 1AGPA 1Z29A 4DDWA 4C3ZA 1LB1B 1GOTA 3IILA 4LYAA 1NBMD 2GJSA 5EQTA 4Q7MB 2VP2A 4JLBA 1ZCBA 2AK3A 3SFZA 2XB2A 4P4TA 4P4SA 1ODFA 5LBIA 3DO6A 4K8OA 4URWR 4JLPA 3WRXC 1I4DD 1R0XA 2VF8A 3RNLA 4DLWA 1C4OA 1II9A 3OZXA 4HZIA 1G5RA 4BLOA 2ZPTX 4I1VA 4F7WA 2QTVB 4LZZA 5CYOA 3MLEA 3UXMA 5FOXA 3AP2A 5GADl 4OJQA 4A0FA 2PMDA 1G8GA 2IYQA 3GFPA 2VP4A 1XEFA 4RFSB 3BIFA 4HB4A 5L3RA 2IUSA 2WOJA 4KBFA 1QVRA 4ACAA 5FFMA 3X1DA 5K8LA 1CJTC 4AI6A 3OAAD 2G6BA 4CYMA 2QTFA 3GJ3A 2H8KA 4XTRA 4BLSA 2D06A 4BFXA 3MMPA 3WYAA 4FWIB 4TN1A 5BYJA 3KQNA 3EIQA 4LBWA 3ZVRA 2BBOA 1M7GA 4HLUA 1E2KA 2O52A 4HUTA 1G18A 2QQEA 4J0QA 4ERNA 4A4DA 4QGFA 3H4MA 2ZJZA 1JPNA 2OLJA 5BQ5A 1U94A 2B21A 2QROA 4Q9LA 4A8JA 2QMUA 3B1WA 2CCGA 4G5GA 2O8CA 1TL7C 4URXR 3LDAA 2ONJA 2ZTSA 3RHFA 3BB1A 1J8YF 4EFMA 4NU0A 2EU8A 2ZE7A 2ZRBA 3CPHA 3EARA 1YE8A 3LO5A 1F3OA 3LY5A 3VQTA 4IXMA 2J7PD 1EWQA 2PCLA 4JSYA 1H8EA 4DLTA 4ABYA 4TQAA 4B32A 1OFUX 5FOSA 1KJYA 2O0KA 2ONKA 2ZANA 1U81A 3HDTA 1Y63A 3LBIA 4R7ZA 1SKQA 3ONWA 4CGZA 5GVRA 2IS1A 1NKTA 4A82A 3K8YA 3LH5A 1KI6B 1JECA 4OJKA 4FCWA 4Q9JA 2O8CB 4ZI2A 1TTTA 3HP1A 1DARA 1PLLA 4KFUA 2FPLA 3RDPA 2ZJ5A 2VSFA 4MYHA 1XTRA 1YR7A 3RS2A 1JXMA 2RGNA 1R0ZA 3H2YA 4HLUC 4B6FA 5EP3A 1D5CA 2C95A 2ODWA 3DMNA 4D0NA 4IOJA 3ADDA 2A5YB 1T5IA 1VYVA 2WJYA 5IHPA 2FSIA 3PFIA 4UNRA 4GMDA 3HWSA 1W5SA 4DLRA 4A8JC 1OH8A 3BB4A 5HZKA 3SJCA 2HT1A 4YMUA 1XFAA 1XXHA 2IYXA 3THYB 2FWRA 4MRPA 2HLDA 4Q00A 1WMSA 4TMVA 4UKDA 1DAKA 1R0WA 3NC0C 3PG5A 4IVQA 4L9WA 4PC1A 4GDFA 2H92A 3K53A 4RD0A 4M1MA 1NN3A 4LC1A 1JI0A 2FMXA 2I1VB 3KXKA 4TMTA 2OXRA 1AN0A 3I3SR 3K9NA 3CNOA 2IF0A 2PCJA 1YZQA 5H68A 4DDTA 4C0JA 1N0VC 2P67A 5JMTA 2QT1A 1E2DA 1P2VA 5FBLB 2YC4C 2BHRA 2YWGA 5JECA 4HI0E 2TMKA 4NH0A 4TTQA 1R10A 4A2QA 3W3AA 2JJ1D 1E1QA 3W6PA 1NP6A 4A0HA 1OYWA 1YR6A 2R65A 4JL8A 2W0MA 4LJ9A 5CB6A 2WJJA 2XX3A 5FL7A 2AL7A 2BBTA 4GMXA 4PSKA 2DWOA 1NF3A 221PA 2VSOA 4NE2A 4M9ZA 5JS8A 1QHYA 2XAUA 3K0CA 2WIBA 4W7SA 2Z4SA 2NO6A 5BW8A 3FHTA 2BM0A 4F93B 3U44A 1VHTA 1RE0A 3TUZC 1W7AA 2JASA 1OHHD 2WJGA 1OSNA 5ANRB 1KKLA 5SZJA 3QKUA 1GNQA 2D74A 2FJUA 4B48A 4D4JA 2JGNA 1XEXA 2VHQA 5KPJA 3S1AA 3G0HA 1GFIA 1KDTA 1JPJA 1YR9A 2W2TA 5FPHA 5FTLA 2KWIA 3BJIC 5FOUA 2CHQA 4KHZA 4W5JA 4EJSB 3SZRA 1W4AA 1C1YA 3UATA 4L15A 2FFQA 4N3NA 1EESA 2OLKA 1GWNA 1CRQA 3RLFA 2ZRJA 3KKOA 3QF4A 1AIPA 2ATVA 4KCGA 3PIRA 2P0EA 4LBVA 4B73A 2N46A 3R9WA 2Z83A 2G1JA 1N6KA 2BBSA 1W0KA 4P3YA 4PHGA 4UJ5A 2CDNA 4XD7D 4V02A 3X1XA 2CJWA 5KU1A 2VSXA 1HH4A 2YOFA 1LFDB 3K0CC 4Q4JA 4ASUD 4WW0A 3VX3A 1OFHA 2GCNA 1G19A 3NDPA 3SEAA 4BLRA 4ZO4A 2OFWA 1QHIA 4Q1EA 5FPTA 2CL6X 4MKHA 1IBRA 3LVRE 1GKIA 3K1JA 3L0IB 4OHWA 1R6BX 3ZZUA 4IW3B 3GMTA 4DIEA 2G3YA 3EPHA 4ARZB 3ZIAA 2C98A 3DOEA 1QHGA 1HUQA 5AJWA 2QSZA 3K9GA 1KI7A 821PA 2H18A 2ZREA 4JL6A 2FEMA 4HUQB 3I61A 3CW2A 1HURA 4FD2A 2R9VA 3KJEA 3NBZC 3I8SA 4Q1BA 2HEIA 4B3CA 1SKYB 3CF0A 1JEDA 1RVDA 4XH9B 5D3MA 1QHSA 1DVRA 4URUR 2ZR7A 3IDQA 1K8RA 3NKVA 2AR7A 2GDJA 1XPOA 5L3QB 2WMNB 1EFRA 5FH9A 3BXZA 1ZINA 2DFLA 1KGDA 3ZS9A 2CK3D 1G5PA 3AUYA 2WAYA 3JZMA 4AKEA 3KKNA 4H1UA 2QAGB 5SZHB 1IN7A 1Z2AA 4C0KA 3SBEA 2JA1A 1D2NA 2JLSA 3FKQA 4LBZA 3VR5A 4R2HA 2BMDA 4X8MA 3TQFA 3O47A 4Q5IA 5HPYB 2CL0X 2O0HA 2OFXA 1X6VA 5P21A 3UG7A 3CX8A 1LTQA 4UNSA 3P32A 2P2LA 3CKLA 4I1OA 4NKRA 1KDPA 2WVJA 3IHWA 3A36A 1GL6A 3AVWA 2QM8A 4DDVA 2A78A 1FPMA 1Q3HA 1ZIOA 2G0NA 4F38A 1RJ9B 2IBMA 2BKEA 2IXFA 3QBVA 4YONB 4DB2A 2O8FB 2GESA 1J7KA 4MRNA 3AVXA 4NL4H 3NWJA 5G41A 1G4UR 1Z28A 2ZRDA 3KJHA 2ZSDA 3CNLA 4B74A 1CRPA 1FFHA 3FTQA 4MQBA 5K8TA 2BEKA 2XNDA 4JVMA 2QT0A 2ZJBA 2JLQA 4V0KA 1XTIA 4EIWA 1TQ2A 1IN8A 3G5UA 3C16C 4NCHA 4WXPA 1KMHB 4B3DA 2XZLA 4EPWA 3PVSA 4DSOA 4O2LA 2ZRFA 1XX6A 4C0BA 1W4BA 1NVVQ 1VCOA 2F1HA 1IY0A 1KI4A 5BYKA 3L0PA 1XTSA 5JS7A 5DNYB 1ESNA 4D0GA 5FBRB 1O3YA 2VPPA 3QKSB 5C1BA 1MABA 2E9SA 1FTSA 1P4SA 1R5BA 1UM8A 4YLGA 1N6HA 3C5HA 3NG1A 3W9YA 2W2VA 3NEJA 2WIAA 3A4NA 1E9DA 1II8A 1KK1A 1TAGA 2XB4A 1VG9B 2QPTA 2IYWA 2GKSA 3CUEF 3GJ0A 1XZPA 1CXZA 5JHHB 4C0AC 4TWZA 3EZ9A 1E4YA 2WJHA 5LD2C 1CIPA 1ZAKA 1E1RD 3V00A 2JATA 1P72A 3AVOA 3EIHA 5E4FA 4ZPXA 1VHLA 3KXIA 5DE3A 4OQFA 1MO5A 2NTYC 4UNQA 2ODEA 4Z1MD 1KSGA 4NYMR 3C14C 2CXXA 5KNCA 3X1ZA 2FEOA 1KOFA 4CVNA 3MGCA 5FI0B 1JJVA 1FNNA 2OE2A 3PITA 4EQ6B 5EE1A 1H8HA 4NPHA 2PX0A 1M2OB 1M7BA 2VP6A 1OKKA 3MJHA 4DEYA 4GT1A 2HCJB 1M34E 1WBDA 3IIKA 3EASA 3SYNA 2DHRA 4TL9A 3K0AA 1G3MA 1UKEA 4ZI3A 1H8ED 3THXB 4QG7A 1KHTA 1SKYE 1G7CA 1GDDA 4Q7KA 3AV0B 1OFTA 2F6RA 2Q0HA 2XOKA 3AGQA 5B58C 2NPFA 1GNRA 1KDRA 2FNAA 1E94E 1ZU5A 3A1TA 1HYQA 3NTUA 3TSWA 2ZS7A 3X1WA 1KJZA 2GCOA 2ZSBA 4PO8A 2IYZA 1US8A 1G3QA 1XMVA 5JRZA 3F0TA 2ZI9A 1XJ0A 2ZAOA 4US0R 2V9PA 3GFOA 1UAAA 1XU4A 4C0HA 1Z8FA 2FOLA 2J59A 3B9QA 2CCKA 4JSTA 2X8AA 4B34A 2NZ8A 3AUXA 3BRWD 3WBJA 1HT2E 2W6IA 3LAWA 1G3IA 3ADBA 3U61B 4DEXA 3RRYA 4CDGA 1KK0A 4ZKEA 4C7OA 2GWHA 1Z83A 1G9XA 5AR1A 2QL6A 1W44A 2HLDD 1EFHA 3BERA 1QHXA 1L8QA 3RC3A 3P4YA 3T5GA 4LOAA 3I92A 5TV2A 4E03A 4MGYR 5IK2A 4YDSA 1RZ3A 4PZYA 3PENA 4URZR 5KSYA 2GEUA 1G8PA 4B44A 1G20E 4CRWB 3FB4A 2PLFA 3X2SA 5HE8A 3GPLA 2IX3A 4TMKA 1XB2A 4TSFA 1II0A 3NH9A 3I32A 1FTNA 3AVUA 4OK3A 2VRWA 4DCNA 3AF4A 3FYHA 2Z43A 2IYRA 2J0QA 1XCMA 4M1SA 3LQQA 5B57C 4LJ6A 4MITA 3WHKA 3T1VA 1E1QD 3FMOB 1F2UA 1CU1A 1E0KA 4N0DA 3PXGA 1S2MA 5BN4A 5FL7D 3PUWA 2B6HA 3MWJA 2N1BA 5KSZA 1E9BA 1TQDA 3EWSA 1SXJC 4LJ7A 1OT3A 1E69A 4HDCA 1PLKA 1UKZA 1KK3A 4TLEA 2V7QA 1U2RA 3KXLA 4HZUB 4CT5A 4S35A 4TL8A 1SVOA 2H16A 1Q1QA 2MSCB 2QQ0A 2W0SA 4HAUA 3CRQA 2QA5A 4HEJA 3I5YA 1A1VA 2FSHA 3I8XA 2IXEA 2ZRCA 4ZDIA 4U5XA 1XRJA 3VU9B 3CRMA 1DPFA 5ELXA 3RWMB 1F5NA 2FV8A 3WRYC 1GVNB 3QVUA 1X8LA 1AQYA 2UVQA 1L4YA 4DHEA 3UK6A 3AVQA 1QG2A 4I1UA 2VP5A 2GAOA 3RYTC 2GJ9A 4HLCA 4DBLC 3ND9A 3CLVA 4AY2A 3QVVA 4C0LA 2X1VA 3RVBA 3REGA 3TMKA 1QF9A 4LHVA 4MKIA 2X2EA 4M8NE 4O0MA 1Q1ZA 3OEEA 2CVFA 4TZ0A 1XBTA 4B2IA 1X1SA 2ZI6A 1TEVA 2ZU0C 3PEUA 1K5GA 3OIVA 1Z07A 5GJVC 2PMKA 3EIEA 3QPUA 4HAWA 3VR4A 4R9UC 1DAMA 2VF7A 4QHTA 1KO7A 4Q01A 1JB1A 4M2LA 2JIZA 3W5JA 1UBCA 3RS3A 4QKQA 2RGXA 1R8SA 1AKYA 2DY1A 3OHMA 1ZCAA 2OAQ1 4BZPA 2OBNA 5FI1B 3AP1A 3CZPA 1RYFA 3LVQE 4IOMA 2PEZA 5HR5A 1LV7A 1QHHA 2FPKA 2IC5A 3OIWA 4G1UC 4RKEA 3EA5A 1PJRA 2BCGY 4LHYA 4QBHA 4TQ9A 2NO0A 2PLRA 1Z6TA 3KKMA 4PXAA 3ZIAD 2DBYA 3QNUA 1S8FA 4LGMA 1IXZA 1FOEB 2GXSA 3DPUA 3IO3A 3KX2A 5J4LA 2REXB 1KJWA 4XVRA 1ZVQA 2DR3A 4GZLA 3AKYA 3IIJA 2D4HA 2EQBA 4BGDA 2VA8A 5JEDA 1J70A 3CPJB 4JKYA 4OQLA 3N5CA 3IKJA 3PR1A 4WZ6A 5KOYA 1CJKC 4E09A 5FUYA 3UIEA 2ZJ8A 4WVFA 1J90A 1D2MA 4ZCMA 1ELOA 3TK1A 4L16A 4JLJA 2VP9A 5CIWA 4BLQA 1G3UA 3ZVMA 4F92B 3SDZA 1XJCA 2AN9A 4QBFA 1WB9A 4TZ6A 2ECKA 1SVSA 2V1XA 4ILEA 2MMGA 2WM9B 1MRNA 5JZVA 3L8YA 1FMLA 5C4GB 4L8GA 2PL3A 1LF5A 1MO3A 2D62A 4TQUS 2QMEA 4BFYA 3WMEA 1K6MA 5LB2A 2RGEA 1ZYUA 3A4MA 4NBSA 1KSFX 3B8HA 4B2LA 3QKRA 3SHFA 3BFXA 3R8FA 1IN4A 3GEHA 4D2IA 1GIAA 4RVCA 5SZIA 1MKYA 4B47A 5JHGB 1M74A 4LRWA 5FR2A 2A9KA 3BH6A 2FDCA 1VCMA 5DYGA 4ZKDA 2C99A 2QP9X 5TXGA 1E9RA 3EPJA 1TX4B 2A2ZA 1E2NA 2XGJA 3EPLA 5EZ5A 5BN5A 2J45A 4C2UA 1U0HC 3ZH9B 1TQ4A 1XP8A 4OBEA 2YC2C 3LX5A 3GP8A 2V1UA 1XF9A 4LYFA 1VIAA 2ZI4A 3LW7A 3GEEA 3MJRA 2G83A 4HB3A 4CEJB 2UZIR 3A58B 4RJLA 3QXJA 4TMXA 1ZM3A 2GVZC 3IPXA 1PLJA 1RIFA 4WZAE 1F6BA 1CP2A 1BYIA 4HDQB 2XNDD 1U8YA 3UWOA 3PUXA 2ODNA 5J5CA 1OJLA 2CCJA 3QXHA 3VR1A 1SQ5A 1YRAA 2DWQA 1GZSA 4JYBA 1DELA 4GOKA 4IHQA 4RFSA 5BXQC 2GVDC 1PZNA 3EG5A 2IYTA 4DIDA 3NC1C 1N5KA 3JZAA 4O2RA 3A1WA 3GFTA 4JBYA 3QF7A 3TW8B 5JLJA 1KAOA 4QC2A 2BC9A 4B6EA 4WXRA 3ICEA 4R2IA 2D7CA 4LJ5A 4I1SA 5L3SB 3KFVA 2GJAA 2JJ2A 1E2GA 3CRVA 1GRNA 4BWYA 4FWTA 1K5DA 4URVR 3O8RA 2VQSA 5C4MA 5J4VA 1J99A 4PQYA 1DAFA 4HSEA 2QNRA 1LVGA 2ZYTX 1FUUA 2DYKA 3U7GA 1OE0A 2YJTD 4IEEA 4NCNA 5FBWB 2JLYA 4E22A 5FBQB 2GZDA 4L5BA 1FNMA 3BH0A 3HPQA 1Z08A 1G64A 5FTJA 1FP6A 2DFNA 1CJMA 2ZROA 3RANA 4CEIB 1E2EA 1GL7A 2RKOA 1CEEA 4G5SA 2FA9A 1H8HD 1XDBA 4XJXA 5HE9A 5A5GA 2YWEA 2XZPA 5DHFA 1KI6A 4M1YA 1OKKD 2QZ4A 3A37A 4GP7A 3IUYA 2V4ZA 3TSOA 1XWIA 3K0FB 1R4AA 4IDPA 1P2TA 5DI3B 2QMHA 2J0UB 4BFVA 4KYUA 1G3RA 4MDEA 4ESVA 4PC3A 5AUNB 1S3GA 3BS4A 1OIVA 2XOKD 5KTYA 1OIXA 2SHKA 4N0EA 2ORVA 2JDIA 1UF9A 4B3XA 2RHMA 2GEDA 2IYSA 4KFSA 3H1TA 1R5NA 1YU9A 4RD6A 3WYGA 4JLDA 3BH7A 3THYA 2I3BA 1AQUA 1UBGA 3GLHB 5FR1A 3P26A 4IDNA 3FPAA 3SNHA 1VCIA 5LB4A 1RFLA 3GLGB 1EXMA 4V0ME 1P6XA 1SXJD 3UMRA 2V6JA 2XTNA 3ZZ0A 4YQFA 1NY5A 1E99A 3D7MA 3HR8A 4W5WA 3W3ZB 2CHVA 2WWYA 3Q7PA 4YDHB 2GZAA 1TADA 2XEXA 2G1KA 2BEJA 1NVWQ 5CITA 1SVMA 4NYMQ 1J8MF 1S9DA 3RS5A 5IK2D 1WQ1R 4TTRA 3T15A 3H86A 1V5WA 1G41A 1W2GA 5M04A 2B8WA 3OEHA 2C96A 2ZE5A 1DTSA 1MOZA 4TL6A 4F91B 4B76A 1D6JA 1OF1A 2B7BA 2ZR9A 2XZOA 4TSFD 1FP7A 2RGBA 1IY2A 5G3ZA 3DZ8A 3LNCA 1NG9A 1T8UA 3LV8A 1MR3F 1KYIA 3BGWA 5GJCA 3VMFA 1YKSA 2CLDX 5DI9A 4NCKA 5AUPB 3NVAA 1XPRA 2J0VA 4M53A 4LHZA 2NO9A 2IYUA 3FHCB 4XVQA 3L0SA 3AVTA 2HT6A 1Z2CA 2QAJA 3KDSE 2RGAA 2ZR0A 1IN6A 2G9NA 4M0LA 3VKHA 1XNJA 1KO4A 4MA4A 1COWD 1G7SA 3UKDA 1PVOA 4U02A 2RGNC 4IFBA 1IONA 1UJ2A 2V7QD 1VCNA 1A7JA 2ZRNA 4QFMA 4EJSA 3KUCA 3RSLA 1X8KA 5FOTA 4NZYA 2ZSEA 5L3VA 1M7HA 1AZTA 4KVGA 4PHFA 4XTCS 2WWIA 3H0KA 1JR3E 1AS2A 2C9YA 1CULC 1S1MA 3RABA 2JLZA 3B1YA 1Z0DA 5G3YA 1HTWA 1AS0A 2JLRA 5JFGA 1X3SA 4I4LA 3THWB 1E32A 2LCFA 3UANA 4OHXA 4P33A 4D80A 2BVNA 1JQLB 1TF5A 2IEYA 2WOOA 1HQCA 1DAEA 3QPWA 3P20A 4PC6A 4B35A 2QEQA 4Q4HB 4MGKR 1RRCA 2IS2A 1E2FA 5F9FA 4A1FA 2XTMA 3WP1B 1RKBA 4UQOA 2NZJA 4ARZA 3K70B 1L7VC 4DLVA 5KHOC 5EP4A 1E0AA 3CF6R 3K9HA 2QN6A 4TLCA 4HUQA 3VNVA 3B1ZA 3U3JA 1KMQA 4NYIR 3FE2A 4Z8YA 3TJZA 2ZUCA 4OQXA 3TVDA 5D3QA 4EJSC 5B2ZA 1ZM2A 3SJBA 5CM9C 3KTAB 4EUNA 4AKIA 1TEXA 1IJFA 3I5XA 2MMCA 4RZ3A 4DLSA 5L3QA 3ZVNA 3RS7A 4A2PA 2XSZD 4HAZA 4YXWA 4B75A 3R7WB 2VTKA 3CH4B 3PQCA 3IEVA 1CR1A 1SGWA 3DMDA 4D26A 1ZMXA 4M1OA 1NIJA 2QAGA 2JAQA 2ZRKA 3TUJC 3MWKA 1W4RA 1WF3A 3LFUA 3T06B 1E6CA 1Q1BA 1UPTA 4F4CA 4OHZA 2O0JA 2BIFA 3Q8XB 2BWJA 2HXSA 3EAQA 3GLHE 121PA 2NG1A 4IDOA 4LI0A 1MRSA 4PO9A 4Q7LA 5EXTA 1MO4A 1C9KA 4Q7JB 5F3WB 2ZE8A 3GLGE 1KI2A 4BFWA 1RW4A 4IRUB 4AC9A 8OHMA 1A2BA 3QSYA 4BFTA 1ZP6A 1NL3A 4MKFA 2AXNA 2NMVA 1XCGB 2RH5A 1OPXA 1Z6GA 2I4IA 3QEJA 4A6PA 5K8IA 1IHUA 1ETUA 3RRZA 4BZQA 2NIPA 1YVDA 2FSFA 3AGPA 4QJ3A 1RJ9A 3OFND 4OI1A 2PEYA 1QG4A 1KTVA 2W83A 2ZRAA 2VLIA 3LW8A 1I2DA 4Q4AB 2QENA 1KZ7B 2O8FA 5CB8A 2J5XA 4K46A 2F9LA 1QBKC 3VHXA 4QM7A 3AP3A 3Q72A 3T12A 3SR0A 3NDBB 1AGRA 3QE0A 1E79D 3KL4A 4FMCF 4HDOB 4AKGA 4AWXA 2QGNA 3TIFA 4DB4A 2BMFA 2DFKB 4X8HA 1CTQA 1P5ZB 3NEYA 5FUVA 4PANA 3U3MA 3PEYA 2WPDA 5TARA 2R6FA 2KJQA 5JJKA 4PQFA 4PAOA 2ZS8A 1KMHA 4LK2A 1X1RA 2PH1A 5JRJA 4ZIRB 1SULA 1XTJA 3VKGA 3IQWA 4TYYA 4PHHA 3D6TB 4M4SA 4NCJA 1BYUA 4Q18A 3WYFA 4FXPA 4P0TA 2H1LA 1AKEA 4ZCLA 3KQKA 4PFSA 2O8DB 3VR2A 3LX8A 2WBLC 2ZI3A 3UMSA 2XXAB 1Z63A 4HATA 1NVXQ 1Q12A 1U98A 1TU3A 5LPNA 3QKSA 1FX0B 1ZNYA 2EYQA 3D3QA 3WMGA 3IBGA 3QBTA 2H5EA 2WKRA 4LYJA 1Q44A 2WHXA 2WWHA 4MUBA 1DG1G 2JLUA 4Q47A 521PA 2Q9BA 1VYTA 4DUGA 5LDDC 3FWYA 1ZNWA 2PT7A 5FTKA 2QRNA 5BWMA 1KDOA 1OB2A 4G3XA 2VHTA 2R2AA
chains in the Genus database with same CATH superfamily
1QNLA 1AV7A 4E07A 3NTLA 1DLIA 2QW1A 1ZRMA 3U62A 5EUMA 4YH1A 1UT6A 2GX6A 2H7VA 4ZFNA 3VPFA 1U2GA 1IIBA 4MV6A 3A32A 3H5VA 4HTFA 1CVRA 3U6KA 3U1VA 1GYRA 5F1PA 4Y6PA 1NN5A 2QX6A 5IS2A 2RAUA 3DM5A 2EF0A 4GRAA 4EUHA 3ZY6A 1W85B 2P40A 3HZHA 2HCRA 1F7VA 4JEIA 3QKTA 3A1EA 1M2OA 2B7LA 4FGSA 1E2IA 1T3HA 2B0CA 3K1YA 4X64B 3GT3A 1YBVA 2C42A 3DNPA 3R44A 4G0NA 1MJHA 2B5VA 4TWJA 5REQB 2OCDA 4EHAA 2YINC 1WB5A 1K66A 2F43B 4X7BA 3T3DA 5L4SA 421PA 2AZXA 3H2IA 3FGZA 4S2EA 1RFGE 4A23A 5T8KA 4AAYA 5ITVA 1W4CA 3JQ8B 4MMYB 4D3ZA 2HV8A 2WYHA 1Q1EA 2C94A 3A25A 1QIDA 1M1YE 1XLWA 3EQ8A 3M83A 2JGMA 3DKVA 3BEDA 3EQ7A 4B0PA 3DZBA 3IBYA 2AWOA 2I5PO 3UPTA 5GZ1A 4RD1A 1W36B 2HRQA 2P5SA 2HKIA 1I9GA 1EE1A 3HCDA 1XT6A 3QFCA 4FEGA 4P3NA 4P5PA 1TTHA 2C04A 2JCXA 2JD1A 2W6PA 1VL2A 1A2OA 3FZNA 3I2JA 3KVOA 1N2EA 1JBKA 1RP1A 2BFMA 4YREA 4XVUA 1IXKA 1FDTA 2CVPA 4LXQA 1HOXA 1N6RA 2O3QA 3IVMA 4IKEA 1FE8A 2HRZA 3IDZA 5ALOA 4BNUA 4EL5A 4KRYA 4A2WA 1JMVA 5C46F 5CFOA 1WV1A 4GKKB 1G4AE 3CUVA 1Q14A 1YZ3A 4YMHA 5CJ2A 2G88A 2Q8NA 3DF7A 4PZAA 2VA9A 3IV9A 2HN9A 2KLHA 3C39A 1ESMA 5JD3A 1YF3A 4I99A 4HWTA 3CZMA 3B53X 3PKJA 1DS6A 2IXBA 3ECCA 3TR5A 4AG5A 1P1IA 3B1FA 4XQEA 4FDLA 1N2IA 1QQ5A 3I2GA 1C30A 5E7IA 1FSPA 5H3CA 4N03A 3L7JA 1Q11A 4G24A 4QHSA 2BTOA 1I3NA 3VBEA 4O4LA 3IELA 3DT8A 2QNBA 5DGCA 5E7JA 5EJMA 2D54A 4MHTA 2FGKA 4YMVA 3M49A 1W5EA 2OAP1 5AWFC 2G25A 5DSXA 1YKGA 4X63A 4RTSA 4BB0A 2QLMA 1QOQB 3I9MA 2XUAA 1VC2A 2HF9A 3B6ZA 1RXWA 5IZ4A 3T94A 3TRJA 3HR4A 4DHWA 2QBYB 4KDRA 4KFRA 3T5DA 2CNDA 1ENYA 2RGYA 1G42A 3U5ZB 5AT1A 1YB6A 2PN1A 2AK2A 3A9CA 4YT8A 3I5UA 2GEJA 3LQFA 3KSZO 2JNWA 2YV5A 3OBIA 4QXQA 4X8LA 5CFRA 2GLUA 2XNSA 3D4LA 3RJZA 3WL7A 3TNJA 4BRSA 1QFSA 1UADA 4F4HA 3GOQA 1Z0JA 3BE8A 2QOEA 2XVAA 4KVFA 4QSMA 2QE7A 2EFJA 1BEEA 4KFTA 4NMLA 3PEFA 3D64A 5MGNA 3CISA 3HCAA 4MUYA 1KO8A 4R81A 4RFVA 4WZAA 2EERA 4J9VA 3TKYA 3UN1A 4CTOA 1KWKA 1K86A 4TMZA 1UK8A 2O3SA 3EXHA 4KGDA 4QBGB 1GZHB 5TGTA 1IJEA 1O6BA 4BYMA 1C4XA 2ZJ3A 2C54A 4MAFA 3RVOA 4N5DA 4KLAA 2YHUA 4MTCA 2WSYB 3EB9A 1BH2A 4HC4A 5KPDA 1A82A 1NI3A 1NI4B 5J1TB 1AGYA 1F1BA 3CJQA 1R4MB 3JQGB 1QE5A 2QYTA 3FUTA 2OPHA 2IH5A 3G17A 3VR4H 4AK9A 5DXFA 1OYOA 3HYCA 2BM1A 1RAHA 1PHRA 3IQEA 1JJBA 3VH1A 3VOBA 5I3CA 1UK9A 4GSYA 4LOIA 5JARA 4EX7A 2C4UA 4OJMX 3IYLW 3KJGA 3BF7A 4OB8A 1TMYA 4WDQA 4WESB 2RI1A 3TW6A 4E13A 1BX0A 4EA7A 4TROA 1SXJB 2DQYA 1GSIA 1I5OA 4K9DA 4ZT2A 5ENVA 1F20A 4B71A 5DF1A 5THQA 4L4UA 3WNVA 2DKNA 3EG9B 5D01A 2RKBA 1WTAA 1JDBC 3MELA 3PQDA 4GSLA 5E2IA 4BQFA 3R20A 4L7QA 5CVDA 5JBQA 4X9XA 3QVGB 3RO7A 3AY7A 1JJFA 4WV3A 4L74A 2QU7A 1LS6A 4RMJA 4UREA 4YR9A 3AJ9A 1B26A 4C0WA 3IAFA 1JA9A 3ZWQA 1EFTA 1BS1A 1MH1A 2ZI7A 3WJ2A 1A9RA 4MWTA 4UUNA 3F2VA 4WFIA 4EBFA 1HLDA 1U8AA 3L7MA 2FQXA 4A5OA 4H4EA 5IWCA 5KKNB 3DOHA 1NBAA 4RA6A 3ZHVA 2C5HA 5BOSA 3JALB 1XFDA 3Q7IA 3LC1O 4RHFA 5AXAA 2IV3A 1BEUB 5D6OA 4YALA 1DFIA 2I55A 1J06A 2HJRA 3IEUA 1V8ZA 7MHTA 3EBOA 4CCSA 3QVKA 1E3TA 1M2VA 3HB1A 3OZDA 4HSGA 4QODA 4QA9A 5I7OA 4GPBA 3TF5A 1N2CB 5KWSA 2Q3MA 2X58A 2P1RA 3P4XA 5H8WA 1GLVA 3F67A 4BVLA 5HKKA 2ZIXB 1VBFA 2XYRA 5IVPA 1TU4A 1DIOB 1QO0D 5AM4A 1XKXA 1JHDA 5ALVA 3LXXA 1BA3A 5BWNA 1L3CA 4RHYA 2VUHB 3T1QA 5ADUS 3LQRA 4UOEA 3TQHA 1RBQA 1SVIA 2WHPA 3CYFA 4BQIA 4GU5A 1ZHFA 1AJEA 1NVUQ 4JLUA 5AKKA 4G5RA 1C9YA 2JFQA 2AEJA 2IYLD 2VK8A 3HCBA 4YPOA 3FGOA 3AI7A 4CQMA 2OXIA 1K7YA 3A8TA 4WY8A 4IJ5A 4UARA 1Z6AA 4LN1A 13PKA 1G291 4I55F 2C7BA 1SZPA 1CNFA 4NOMA 2RDMA 5EIAA 4C7VA 6GPBA 5JNRA 1RM5A 3L2OB 3N8HA 1G1AA 2HHHB 3MTDA 4C88A 4XD7A 5CH5A 1K06A 1DMSA 1FZQA 2VJKA 3INYA 4Q66C 4UHFA 1YI1A 5ALWA 4EO4A 3HVRA 3RAEC 4GOND 4DGSA 4F06A 3LECA 3GD7A 2QUBA 4NQZA 1FU8A 1OXXK 1Y8RB 3KPVA 5B37A 2FPMA 3SX0A 3ZXXA 1XWFA 5A02A 4GXQA 3Q2OA 2JK0A 4Y6GB 3HYTA 3QUBA 3K20A 4M46A 4RGBA 2K87A 2KS6A 2QL7A 4LQLA 2WD7B 1FRFS 2WVGA 1E5XA 5ES3A 1GZ4A 4MP8A 3TLYA 3DB1A 3RTGA 3VPBA 2BFBB 1AN9A 4IFIA 1G59A 1Y3AA 1LLDA 4PPNA 4M6WB 3GAFA 3ROKA 4AG6A 4DLZA 1J25A 4X54A 1CW2B 2ZAMA 5JDCA 3CS3A 1C9JA 4PIVA 5LQJA 3PS9A 2AOTA 3Q3GE 4Y9DA 4JA0A 2QXUA 4M3NA 5YASA 2ZJ2A 2W2LD 5EYPB 3AM1A 5F73A 2K5UA 4L85A 4XW2A 4YP6A 4Z51A 1H4TA 1SIUA 3GPBA 5DGDA 1QP0A 1IVYA 1U99A 4MWCA 2CDCA 5CJJA 2NUAB 1MFPA 2Q5QA 4Z4GA 3IAEA 4AT1A 4M21A 3M5CA 1FFYA 4MRRA 4MLCA 2JVIA 1XMIA 3PGXA 5EZYB 3DV0B 4NONA 3LOUA 4GVPA 2C78A 2FH5B 1WSAA 5F98A 4I36A 3I1FA 4YFVA 2YH2A 2ONCA 3INGA 3KHKA 2JLWA 1A8SA 4ECAA 1FVFA 2RCNA 2YWCA 1SG9A 3OI7A 3AESA 2NYRA 4IAOA 4QNRA 2ZUTA 2P8SA 3V7UA 1FIUA 2WDZA 3MWEB 2HU2A 1G5TA 3QJGA 1M10A 3ILVA 4Q4LA 3C85A 1N8NA 5C37A 2FPSA 2Q41A 1DFGA 3G68A 3GJ4A 3QITA 1DQPA 4NMMA 1R7RA 1R50A 4U39A 4EHBA 4NV3A 4RMNA 3DTVB 1TDJA 5KQGA 1H65A 4OXQA 3SGLA 1QRDA 1BWRA 5L3SA 2XITA 2CFCA 1G2OA 5DLPA 2QUAA 1E5VA 2Q21A 2BUAA 4HAVA 1W88A 4JMPA 5EJGA 2W93A 3FMIA 4DDHA 4DG5A 3OZGA 4A6XA 4GOXA 4AF8A 1RI4A 1WB4A 4HRYA 1POXA 4WTOA 2NYAA 2XPCA 3F2IA 5B53A 1VLLA 1OI7A 1QH1A 2GHRA 2D3WA 3D54D 4LY9A 4PZ9A 1W0JA 2ZT7A 2AHOA 3JARB 1QU3A 4PYQA 3RFFA 3EA0A 2EVWX 4DUGD 5CDGA 3IQXA 3W7AA 1F14A 2IF2A 4H7FA 4KK3A 3SC6A 2Y0DA 4JB0A 3MHTA 3ASYA 3QW2A 2CLLB 2RIRA 3VAAA 5BNFA 3ZG6A 1NHWA 1VQ1A 1BA2A 1LLUA 3KPYA 4G4SO 4IGKA 5TQVA 3ZWCA 4AJPA 2MTBA 4ZGWA 1A8QA 4C4XA 3HV0A 3WNBA 2IW3A 5ED4A 4CEIA 5H9WA 4AULA 3K09A 4LF8B 5DO9A 2P5TB 3MHPA 4R5MA 4O8ZA 5JTUA 1PP4A 1OX4B 3FMFA 4YRIA 1JEEA 3LWBA 2C9ZA 2GYUA 2VCHA 5LBUA 1XMJA 2X2FA 4KGZA 4XDHA 2VH5R 2AG8A 3HJGA 1QH8A 3M6AA 1N6OA 1I33A 4TYQA 1FTQA 2Q2VA 1QVWA 2O8BB 3ENZA 2QTMA 2QN8A 3I61A 1ANKA 4H77A 2RHCA 5EIFA 1ISRA 3WQBA 1PG0A 4EI2A 2Q4RA 1ORIA 2DLNA 3A1VA 3B3QA 4IQ4A 4RMIA 3MSCA 6NULA 2C9BA 3CIFA 4KKVA 2WU4A 2YOGA 3E22B 3EY4A 3WYBA 1IQ0A 2ABWA 5C2JB 1PGNA 5AVTA 4PZZA 1UEJA 3A4TA 1TZCA 2P8JA 4M55A 1Z0FA 2ZUUA 2ZRLA 3BBPA 3M33A 2YFQA 3T1YB 3W5VA 2HIMA 4HF7A 5AH0A 1KEWA 1RI3A 1SUCA 2P4HX 3PUIA 3VHLB 2OCGA 2ODBA 4BMNA 1VMAA 4ZOLA 5KSPA 2PJUA 4DTIA 1C3LA 3AF0A 3DTTA 1CERA 1CJCA 2XT0A 3IXQA 3KOYA 4DZZA 3ZY5A 1ZVMA 2OG2A 1PQYA 2X9QA 3HEBA 3EPJA 2MOKA 3INNA 3MT7A 2P9HA 3VFDA 4K9SA 2YIDA 5LVAA 2ACWA 1KH1A 2PGLA 5FF9A 1JDUA 3GLGA 2DH6A 3R3YA 3QHPA 3ZU5A 3ABIA 5DGIA 1HNWB 4P4SB 4LX0A 4B6RA 4OLJA 4G67A 2NP6A 1MQSA 5L53A 4UBMA 2XV1A 9GPBA 3GT4A 5KJ6A 2V6FA 3IIIA 4OHYA 3AONB 3QXCA 4ZMSA 3BIJA 1E2MA 4HLDA 3AOEC 3I2FA 1JQ5A 3VUFA 2ZB2A 3MLBA 1Z0AA 1YHZA 3IKLA 3K7EA 1WO8A 4GM0A 3EFOA 1K3UB 1PFVA 4J7UA 4MW2A 5FLXA 2OV8A 3VM6A 1ZLYA 2BF7A 4B4UA 4BBJA 1S3IA 2X0IA 3H19A 2A5LA 3LUGA 4BP8A 1E9EA 1RRPA 5IJ9B 5ILGA 1VB3A 3IT0A 4REMA 4ZAFA 3EEOA 4BLTA 4MWGA 1ZDMA 2Q62A 2Y0BA 1REQB 3BFPA 3LQ4A 3DDZX 4JLAA 4DR3B 2O54A 4DQLA 4AUKA 3U4AA 2AN3A 4RK6A 4ZO6A 3PWKA 3N8IA 2JKZA 2E5LB 1E9SA 4CR7A 1FXWF 3D3KA 3WLNA 4BZZA 3NBYC 2QSJA 5EMKA 5HKBA 1E77A 4Q6WA 1ZC3A 2WWWA 3WKCA 1UMCB 1CV2A 1F06A 2IDMA 4LIPD 4K8RB 1Z56C 3COVA 4BUJA 2O2XA 4KZKA 2VT7A 3SEZA 4D98A 5IC4A 5K0EA 3GLIE 2XCLA 5KYKA 1U8FO 3TKAA 3AHFA 4WBNB 2QE7D 5J1SB 4FSDA 3OTQA 3O94A 2G76A 1D8TA 4XWOA 5LKRA 2R1VA 1LJ8A 2JCVA 4GBJA 3OZRA 3G2OA 3NASA 3AHJA 1X19A 5ECWA 3A3OA 4OK5A 2ZDGA 3CJTA 3JVUA 2FX3A 3U7HB 3UC9A 2RAPA 5EXPA 4KXFB 3TNFA 5A4JA 3SXUA 4D4MA 5JPDA 2HPZA 3O3OB 1JKJB 3LWZA 4KIWA 1M72A 2G08A 4FX2A 1D2EA 2AD1A 4Q9KA 2IEGA 4CMEC 2WV9A 4L6CA 4UNNA 2DQ4A 1JQJC 3DQPA 1SQ0A 3BWEA 4PCUA 5JSYA 5JNUA 4RPCA 1NUSA 4X85A 3VNBA 2P65A 1J49A 2AJ8A 4LX8A 1PNRA 3T7AA 2P2CA 4OCZA 2Z2JA 1L7DA 4XM2A 1N2BA 4QELA 3W78A 1XZQA 2Q3FA 3T3IA 3TL2A 1SHZA 3QI2A 1VJ0A 1EUCA 1X87A 4KQEA 4QEDA 3N28A 4FGJA 3CUYA 2R48A 1F0NA 4J8PA 1A7UA 1QORA 5EMHA 4HVLA 4OGFA 2ZB8A 3C8ZA 1DAPA 2FOXA 3LLUA 5ILQA 4AJIA 3K94A 3D7SA 3V4LA 4DCGA 2I4RA 1LFAA 4GM1A 1ZESA 4NYJQ 2J3LA 4O59O 3RARA 1JU3A 1WXHA 3VSDA 4QEZA 3CF4G 1A0OA 2RBGA 1Z38A 2DX7A 4TXNA 4ZQIA 3WGQA 3H9JA 5J47A 2C7QA 5KNBA 5GJBA 2ANBA 4RH0A 4D5EA 3I04A 2QY9A 3QLUC 4MYTA 1GZVA 4URYR 1TUBA 3P9XA 3AB7A 3STTA 1OU4A 1CR2A 2AIRA 4IMJB 4BO2A 2NXWA 1KI1A 3HGTA 3L6UA 1M1YA 1YDMA 3OUUA 3U39A 3QEKA 2NZVG 1PN3A 1U2PA 1U3CA 3MXTA 4KQMA 4HFMA 3T3PB 2P9GA 4HMQA 2DECA 4DBLE 3FFTA 3GG9A 4A9AA 2RD2A 5D3KA 1PYDA 1M2HA 3AU8A 3IQDB 2JCBA 3C3BA 4D0LB 4OLBA 1D8AA 3VYRB 3I1JA 3BWDD 4I8IA 4GPIB 4NBNA 4KP7A 3FZYA 5FA5A 1KQGA 5KYYB 5HKKD 3ANNA 1JDJA 1K5HA 3NLLA 1DIHA 5BMVF 1ZM7A 5KKCA 5DHUA 3WYCA 4M38A 2QPAA 1K68A 2ZIVB 3EZNA 4KLNA 1T91A 5TS3A 3SHVA 4RJTA 1P7YA 2H7YA 3NAZA 2PBRA 3SMVA 2W22A 2VF4X 4PBTA 4ZRNA 4TTVA 5JU6A 3N2KB 1BXRB 3DL4A 4FYJA 1MC4A 1Z25A 2QWXA 4YLYA 3ZK9A 2XDQA 3RAPR 5F77A 4IVPA 2ZQYA 4CQMD 2X77A 4WHMA 4MK4A 1NQTA 4XWYA 3RVDA 1Q77A 1RTKA 3OZTA 3Q3JB 4G56A 2JBAB 3KPWA 4LCJA 3TE6A 3CX7A 4HDKA 1E7RA 2Y1XA 1GTVA 1OH7A 3UAVA 3GYBA 1WHSA 1E4VA 4KH0A 4FBMA 2NZYA 3R0VA 4R1LA 3B6EA 5ENDA 2UU9B 2Y2VA 1SAYA 1CZUA 1ZK1A 4IL5A 5ENZA 4YP1A 1CUSA 3N39C 1MIOA 1NLFA 1NVMB 1FLNA 2OV6A 3P9ZA 5CRIA 2YS6A 1PNTA 3KBBA 3TQTA 3GLVA 4CBVA 5HF9A 4COKA 4QDXA 2ZSFA 4DUZB 4EF4A 5A9TA 5CDUA 2J3EA 3EZFA 2VQEB 1XJQA 4FP9A 2O2SA 2B61A 4DA6A 1ADJA 3A0RB 2EFCB 1RIIA 4J0IA 3USZA 4FLMA 5JE8A 2JCYA 2R1TA 4IGEA 2QMOA 5LFAA 3OM8A 4QM6A 4OFBA 3IUJA 1HT1E 2GD6A 4BUZA 3G0BA 3P52A 4J7CA 1CD5A 4BVGA 1VJDA 2IXTA 2YRFA 2Q4BA 4ZAYA 4CDRA 4EG6A 1NOJA 2Z58A 1C1XA 4MYUA 2GZHA 4PF1A 4YAUA 5A0VA 4LKRA 1UMDB 3ZJVA 2E82A 2NSHA 2IZ1A 1KYVA 5BW6B 2A0WA 2D7JA 3X1KA 2O8DA 2F7SA 1U7XA 3EXEA 4HFJA 2Z3WA 2XXAA 2A92A 1N1MA 4EY7A 2E4VA 1U31A 1IATA 1RAIA 1H9BA 3DULA 3P0RA 4HDNA 2RC6A 1T9ZA 4TVBA 2CLEB 1FX0A 1NNUA 1QXSA 2NPIA 1THZA 1DWQA 2C92A 3H1GA 3M7IA 3NB0A 4X97A 4OL0A 4EJ0A 5HKOA 5JVDF 4C2TA 2VWPA 721PA 5M29A 3FSEA 5AW5A 4DV7B 1G9TA 1GSOA 3ME5A 2OV4A 3DNFA 2IU0A 1L5ZA 4GOJA 4LVCA 2LBPA 3EVEA 1FRQA 1AG9A 1M73E 1DWPA 2ZYRA 3GPCA 3I4LA 1U1DA 3WC4A 1BU5A 1Z2DA 5FNVA 4Y2SA 3USCS 5AVZA 4NAVA 4CI0B 2YBEA 1RYNA 1XZEA 2HMUA 2NACA 2XF2A 2VN8A 4XVCA 1FUKA 4RKFA 3VDRA 3NBMA 1SUSA 1D9ZA 4LJ8A 1K3TA 3INRA 3WHPA 5AUOB 5B2EA 3KKQA 1XCOA 4FLFA 4ND5A 2G0TA 4AUMA 4R9NA 4KXWA 4Z4IA 2JIDA 4PYNA 5B30A 4TT8A 1W0JD 3UMCA 1FYDA 1FFGA 1EEXB 5J2TA 5JSFA 1N25A 4TTAA 3C7CB 3JV7A 4LTDA 1KDYA 3RRNA 3U4GA 4A6DA 2G06A 2ISSD 4GOMD 2RHJA 2ECFA 3DLCA 1XZFA 3NBFA 4M9SA 5AM2A 4Q12A 1C8LA 4KPEC 1QPGA 3ZLJA 1MRZA 1SM4A 2H11A 1ZJ5A 1QZXA 2C5AA 3CF4A 4GWGA 1L2TA 3UMBA 3C7TA 5EJ9A 2Z6VA 1FXSA 3PEVA 1XXHE 1N2XA 3ESQA 1KOJA 5F52A 2G63A 2C8KA 1DTEA 1GYQA 1U04A 4RGQA 1P61B 4NIMA 4XLZA 5HIJA 3T0FA 3W5HA 4CMKA 5JJLA 1ODSA 1ZJYA 3Q87B 1LC3A 1OXSC 2ZTUA 5IUNC 2I6TA 4DJ5X 4OJNA 4Q34A 1B2RA 3ROQA 2XZDA 2O8EA 2ZAYA 4Y0AA 2HDNB 3BAFA 3T9FA 4DLAA 1KAGA 4KRFA 4QUBA 4QTXA 3EZ2A 1EK6A 1CEYA 4JVNA 2VXYA 2TECE 2CD7A 3GHYA 1J9GA 2CV0A 2AJDA 2PKQO 3FMPB 2ZVPX 4D9EA 1XMOB 1U3DA 4OQDA 3A4IA 2ICAA 3F4LA 1TZBA 3D4OA 3MUEA 1UXJA 1WR8A 4S3MA 4RF5A 1WE2A 5IT0A 3ETLA 4QJIA 5BRAA 1OXMA 2TMGA 3EDOA 4II7A 2CXHA 4G4IA 1CQPA 1GNPA 4JDPA 1UBOS 4UFNA 3WIBA 2QS9A 1IBCA 5G02A 1KQPA 5LXTB 3LE8A 3O0DA 3FGPA 3OPMA 3CEMA 1O94C 3F6PA 4G9BA 4RXUA 3TAHA 4BGIA 5L4NA 2MSLA 2ZQZA 4V0OA 5IXJA 5JNWA 2HF7A 4Q19A 2J7KA 3QVJA 4DQKA 4H7PA 1SWVA 2ZSIA 5B7PA 2PKCA 1SG0A 3OC6A 5BP7A 5L9AA 1GUAA 1RLUA 1TGYA 1CKEA 1AUQA 4Y0VA 2VJAA 3U09A 2ZWVA 1OXTA 3ASZA 3P7MA 3WKBA 1A97A 4R9VA 1OREA 2A5GA 3B20A 3QK7A 3UFXB 3WB9A 2I78A 2NNLD 1GRQA 4Y8VA 5L3ZA 3I4FA 3REFA 1LF0A 1G66A 2RONA 3JWGA 2OSBA 4MYSA 4NBKA 3ODGA 2GA8A 5B58T 1RI2A 3TCXB 3TSZA 2QN1A 5E8JA 4AMYA 1W1UA 2I62A 1FJ2A 1RMQA 4KPYA 3FF4A 1C3OA 5F2EA 2J30A 5CIQA 3PGA1 2VJNA 1O57A 3K0EA 4G0PA 4LRQA 1ISJA 2Z2XA 4YUWA 4RDHA 1V37A 1W2WB 4FQ5A 5J4KA 5BN3A 1N6PA 4EY3A 1OYYA 1ZBDA 1R3UA 3KPJA 4ZVSA 4O3MA 3W90A 3JRXA 1OVGA 4OI4A 1Y89A 1A2KC 3N87A 1K7XB 3FNEA 3QIAA 2AHRA 1BZYA 4D9IA 3OTIA 3VI3B 1PQUA 3JAKA 5HTKA 5LL6P 2CXQA 2NVWA 2ORIA 1BIFA 3NUQA 2XWBF 5ARBA 3M5DA 4PO1A 2JH8A 3AEUB 2EX1A 4AXBA 2QLFA 1Q0QA 1QGYA 2QJWA 2HDWA 2QUHA 3G5MA 2O2IA 2Y99A 3FYCA 3GDHA 4ONEA 4Y18A 3U2QA 2WTUA 4MLDA 1UWLA 3X44A 1RM0A 3G79A 1GPLA 3U9LA 2Q27A 4RANA 2WY2D 4BNYA 4XCQA 5KB3A 1NLZA 3FLMA 4I46A 5HZMA 5A7FA 2QRJA 2AX3A 2QJTA 1HI9A 3I5AA 3BRSA 1YONA 4YMSA 2XZTA 3R8CA 3X3HA 2AOVA 3VVCA 5AVWA 4UBKA 1PVVA 1ZGBA 4JMLA 3GDFA 4Q48A 4HDAA 1PBTA 3RUHA 3CVXA 1H22A 5I4BA 1CY4A 1HSOA 4KE7A 4OQYA 5T64A 1MA3A 3SSMA 1XRLA 2QVYX 4G0XA 2HK9A 3RREA 5TEVA 1KNXA 1ZBQA 3ELUA 3JYOA 4FFBB 4L9SA 2A0FA 2PBLA 5DULA 3UOWA 3FETA 1HLFA 16PKA 2GXUA 3K92A 4ZWNA 4ZJUA 2OUKA 2ANCA 4TZTA 4DDMA 5LYJF 2GAAA 1A88A 1NKSA 1G5QA 2WNIA 3HXLA 3BMQB 3E9RA 1QFJA 3RI3A 7GPBA 1K7CA 4D3SA 5L45A 2G72A 4UW9A 2P9JA 5DISB 3OE4A 5EMMA 2GETA 5B1IA 2P41A 2HV9A 3MGBA 1BROA 3ZNOA 3JYPA 3LX4A 5SY4A 3IFSA 1SCUA 4HXFB 2VZ0A 1VTKA 2JI4A 2PGAA 3CH5A 1EDBA 4IOLA 5TQ2A 3KRTA 5IUKC 1MD9A 3GN2A 1FU7A 4MVXA 4QYIA 1QZTA 3L1VA 3K70D 1ZD2P 5AI0A 1WUYA 1K8YB 4NV0A 4GWKA 3SR3A 2XDYA 4HGYA 4E5MA 4YHHB 1T6BY 2HGZA 3EE6A 2GHTA 3HJAA 4DR1B 5K05A 4C7OB 1KMIY 2O3RA 1KNQA 3WDMA 1GGMA 2NTJA 4LY0A 3VOSA 5KOJB 2X4IA 3ZH2A 2PBFA 1Q7EA 3K0KA 2FQ1A 1VHQA 4E5PA 5KSOA 3ICQB 2JH3A 1RWOA 4JR2A 3ZCRA 2ATIA 1PR9A 4QUIA 5IEBA 3WQRA 4BO9A 2W8BB 1TUGA 4ZHQF 3HXOA 1T0JB 1ULTA 2BISA 2X6RA 2KHZA 1RYHA 2VWGA 1SKUA 4O0LA 5DCLA 1DKNA 4DLKA 1CETA 2DETA 1P77A 3A4VA 4C89A 4NBWA 5I51A 4NHOA 4PWZA 4C4AA 4UHDA 1B43A 2WTEA 1TLLA 2PUAA 2VHUA 1T9GS 1NP7A 3HB0A 2NADA 1MVNA 1RYDA 3BOSA 2EBUA 4PC2A 2HBRA 3TZQA 2X2PA 1F2UB 4MRSA 3N0XA 4KSCA 1S01A 1JYEA 2A3RA 2V5VA 4UD6A 1EVQA 3SSOA 4Z7OB 3MMZA 1FQKA 3GMIA 4A91A 1DKPA 2YXDA 3DKKA 2J9XB 2NO4A 3E23A 4BC0A 1B15A 4G6ZA 4LBYA 3T9DA 1EFCA 1TTPB 2W2XA 3CB4A 3GLFA 1MXFA 1EFPA 3MWYW 1WP4A 3GGDA 3MCTA 3MTQA 3T1OA 5H4GA 1AX9A 1YI0A 4HNHA 4U1RA 1JH8A 1YZNA 4EO7A 4GGOA 4ESHA 4BRUA 6REQA 2PLAA 2I6SA 1YAJA 1W5TA 3HTXA 3I5MA 1P73A 1TZ2A 1I4LD 2ERYA 4WASA 4DLYA 3MIZA 2BSXA 3AFGA 3BK1A 3I6QA 3LDFA 4DANA 4GZMA 5K45A 1TKBA 1XSEA 1JIQA 4HDSA 3NQ41 4Q82A 4FZVA 4UAUA 1W1WA 1K0UA 1MOSA 4WADA 4ZQCB 4CCWA 2PXHA 4ZYXA 4OOEA 3ZE8A 2A5JA 1Q57A 1XK7A 2GF2A 3FTDA 4MS3B 4YRQA 5TVKA 3LO8A 3NHAA 2CFIA 2WFAA 3OFSA 1L1QA 3D6MA 2VPIA 3STWA 4BIIA 4QTYA 5C5DA 2O5EA 1Y1PA 3IRUA 1N6NA 3OZUA 1ZJ6A 5T41A 2BMJA 3KDPA 2I29A 2H07A 3FDIA 3V1UA 4OYRA 2NAPA 2XSZA 4OH1A 3GLIA 1ZGJA 4DYHA 1SFRA 4ALMA 1MQAA 2GXAA 3I2IA 2E4WA 3ZWXA 2JFPA 1CFZA 1UBFA 1V26A 3D1LA 4QJ4A 4R7TA 3ZJYA 2P5UA 4TWIA 3O9MA 5AVVA 1P6QA 1EP9A 2P9ZA 2WRZA 2XQGA 3GW8A 3K2BA 4R1QA 1RKUA 2F1RA 1T5OA 3CXRA 2CV2A 2QLNA 1I3MA 1J42A 3H2SA 3COPA 3H4VA 4PU0A 1O4WA 5J3JA 1RCUA 1DAHA 1JZQA 1X7DA 2TYSB 1TUIA 3QPDA 3D8HA 3KKEA 5FP0A 5D1NA 2YHIB 3HH8A 1P75A 3BHJA 4Y2HA 2O7QA 5I9BA 3SY8A 1LQTA 1X77A 2CXNA 5TR9A 4H18A 2QIOA 4CNBA 2J46A 1IHXA 3EVCA 2H2GA 3SHWA 8GPBA 3TD6A 2X14A 3K5WA 1WCXA 5TGDA 5IVKA 5IBRA 1WRBA 5KI6A 2Q5FA 2R6R1 3CMCO 4R6WA 1HEYA 1Y5IA 4A3SA 2ATEA 4ER0A 4YRZA 4FINA 3KR9A 3JQ9A 4I50A 1T8RA 3TNYA 4EYQA 1AQJA 4N6GA 5F1KA 5ARDA 3QHQA 2NZUG 2JA2A 3MD0A 5HK8A 3BFKA 1S2IA 3U4QA 1PS0A 1MHPA 3FHOA 1JW9B 2V6BA 5AUQA 1SUWA 4WH0A 5JYCA 1MT0A 1T4BA 2EW1A 3OCCA 2Q6IA 4FIDA 5ETJA 4EDHA 5HDBB 3PCTA 4TLMB 4B3GA 3HNOA 4J91A 3MK31 5JMOA 3RF7A 1U9IC 4LA4A 5JOQA 4MUJA 4D1YA 4B3RB 2QVGA 4ZV4A 5C34B 1GPBA 1X7WA 2C84A 2GPNA 2JHGA 2VTDA 2WLTA 3FDZA 3RC2A 5IANA 1SVLA 2A0KA 5LP6B 2ZCJA 3ZDYB 1DINA 3CY6A 4EUKA 3CUSA 2PD3A 3DDSA 3V34A 5K20A 4B3MB 1M2FA 4YR7A 4FHFA 5T7BA 3K3PA 2FFBA 1VG8A 2V7TA 5KEIA 3DMTA 4DLBA 5AXBA 4HAOA 2AE2A 2Y77A 5E7QA 3Q5GA 5IYZF 3LCCA 1UM9A 2F55A 1KI9A 3ITKA 3DOIA 3RG8A 3O8BA 1LS1A 4PC7A 3IO5A 4MZDA 4M8SA 4PG5A 3X2EA 3ITNA 1V95A 2AG1A 4KO3S 4G89A 4I3HA 1MAUA 1GHTA 1KGSA 1YOVB 3SD7A 2AW5A 1Y3DE 3EIWA 1U0FA 2VRBA 4B2PA 3IULA 4DMUB 4MAAA 3C1UA 3DGFC 1S02A 4C6TB 3DBOB 4Q3CA 1ND5A 2JAWA 3CSUA 1I51A 4HGNA 4II3A 1EG7A 3T52A 4U3JA 5DP1A 4B0OA 1TRHA 1JQEA 2C8LA 4EFNA 4D79A 4G8BA 1OLUB 2WEKA 4ZZ1A 5EWJB 5B3JC 3I3OA 4LYAA 1A9XB 2CFSA 2Y1EA 3C3KA 5J5VA 5EQTA 3TLAA 2BFAA 4Q3DA 3KR2A 3H11B 4JLBA 3SFZA 1D6MA 1UL1X 3H1EA 2XB2A 1GSAA 5FUBA 5LBIA 1E61A 1G8AA 2ZJ1A 2DFPA 1NC3A 3WRXC 4UDOA 1TVCA 4Z1OA 3A6JA 4DLWA 3E2PA 3N58A 3OZXA 3AJRA 4QXPA 1WXFA 5MN6A 4I1VA 4BMXA 4MHOA 2JI8A 4LZZA 5BSHA 5CGQB 1WETA 2GD0A 1HX7A 3UXMA 4FFDA 2XMQA 5IPFA 3M2TA 3AP2A 2G4LA 5GADl 2J6IA 4AMBA 1EGMB 3L6OO 3O9ZA 1E1NA 1YS1X 2PMDA 3EIFA 2XUPA 5CDSA 4RS3A 1G8GA 2X5JO 5ALKA 2YNMC 1IHDA 4RFSB 3OWHA 1SKAA 1LUAA 1N2JA 3BQNB 5L3RA 4BO6A 3H1PA 3NTOA 2GN1A 1OILA 2PGDA 4KBFA 2H59A 5LQKA 2Q7OE 4H2DA 4Y67A 3IJ5A 1GZDA 2HBYA 2G6BA 2ZPAA 3FYSA 3LWDA 3GJ3A 3FPEA 4JUFA 3V8VA 3MEQA 5IXYA 4M8KA 2WTAA 4YJKA 5K3SA 1E7SA 2I2XB 4TN1A 4KHPB 2HTEA 2JC3A 1X7YB 2BBOA 4NZMA 4HLUA 4BNNA 1E2KA 1DPGA 3HY4A 1DBIA 4GZ6A 2JJMA 5AIBA 3UCXA 4ZCRA 4J0QA 5K51A 3WGGA 2PH5A 3H4MA 2AC2A 5ALMA 2B99A 4U7GA 2XTJA 3N8DA 4Z53A 4A8JA 2CCGA 2WABA 2O2EA 1SUPA 1O9BA 2R5WA 6ABPA 3RHFA 1IOLA 3P2JA 4NU0A 4X60A 2EU8A 4EB3A 4RORA 3PGKA 3M6FA 2Z98A 3LO5A 1F3OA 4RV9A 4BVHA 1JPVA 1XZCA 3BREA 3VQTA 2H51A 2PCLA 1VA5A 3V8RA 1F8UA 3H5IA 2Q5JA 5EHZA 1UXIA 1D1PA 3ND6A 4TQAA 4ER6A 2O0KA 3LLVA 2QD5A 3PP8A 3O3MB 1EZ1A 5SICE 1OA1A 4QDZA 2BE9A 8ABPA 5JUWA 2PYIA 2EP5A 5CX1B 3ADOA 2Q5HA 1W1IA 3TRDA 1SKQA 4J0FA 1T5BA 1U1CA 3Q7TA 3EMKA 3K8YA 1KI6B 5BQPA 1JECA 3KQYA 4OJKA 4EEXA 4FCWA 2O8CB 5BV7A 2X7JA 1ODKA 3GZ4A 4XX0A 1UAYA 1J1UA 4KFUA 1PLLA 2YV2A 2G80A 4ENWA 2HAEA 3C6ZA 1EUYA 1V2HE 1YR7A 1Z18A 1BD4A 1IZ0A 4YGXB 1Y3HA 3RS2A 1R0ZA 3UENA 2JH9A 3BMNB 1SCKA 4JELA 4RVDA 4YQYA 3WNZA 3ZXYA 1Q0PA 1WDLA 3R5HA 1VYVA 5AKYA 5KTSA 4UNRA 3UHFA 3JD3A 3E48A 3HL0A 4MA0A 1W5SA 4QYTA 2GN8A 3BB4A 5HZKA 4UEWA 2O20A 3Q7SA 4CLHA 2Z5LA 1NV9A 3HWWA 1XXHA 3BQ9A 3E5NA 4NEQA 2IYXA 4HAIA 2X2OA 1GGJA 3GA7A 5JZ9A 2HLDA 4P0QB 4KQCA 4TMVA 4CR6A 1R0WA 5K0CA 1JFFB 2QTCA 4IVQA 3UMVA 1HFEL 1TM5E 2CFOA 3K53A 3VO1A 5KQRA 2JD0A 1NN3A 4IKOA 4K6CA 1JI0A 2I1VB 4LC1A 2PXXA 3F3KA 4GI3A 4OF4A 3OG9A 1X92A 1UH5A 1GPDG 2AMFA 2BFDA 2O2GA 5L7YA 1K97A 5KYWA 3T5CA 1AN0A 3EVFA 2VJCA 5BW4A 5JMTA 1C5KA 1YZQA 1M0TA 4HR7A 2P67A 4FYXA 4AZ0A 4C0JA 4DDTA 4CKCB 3WGKA 2NQ8A 4D9JA 1AMOA 1U2DC 2NWQA 2W71A 3IPLA 3K4QA 1FDRA 3Q8WA 4D6YA 2YY7A 2QI9F 2X76A 4HI0E 2AUTA 4OEHA 2GNAA 5DXJA 5C8YA 3WV5A 3W3AA 5ICCA 4GNRA