5KVAA

Crystal structure of sorghum caffeoyl-coa o-methyltransferase (ccoaomt)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
227
structure length
227
Chain Sequence
KSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHDRLLKLVKLGGLIGYDNTLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords caffeoyl-CoA O-methyltransferase
publication title The Structure and Catalytic Mechanism of Sorghum bicolor Caffeoyl-CoA O-Methyltransferase.
pubmed doi rcsb
source organism Sorghum bicolor
total genus 88
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5kvaA00
4GOND 1Q0TA 1KR5A 3LCUA 3MTEA 4RTRA 3WSTA 2Z6UA 5BW4A 10MHA 2AOTA 2VDVE 1D2CA 5DPMA 1IXKA 2PX8A 3NWBA 1TPYA 3KPWA 1VPTA 3DMFA 3DOUA 4O29A 4RTQA 2ZWVA 3GRZA 5GWXA 1INLA 4EKGA 5BP7A 4E33A 3K6RA 5KQSA 2FK7A 1G6Q1 3EEYA 3BGVA 4OQDA 2LD4A 3NDJA 3G2OA 3FPEA 2BM8A 2C7RA 3LCVB 4RTPA 3GO4A 4OX9Y 3FPJA 4RX1A 3THRA 1BC5A 2P41A 2UYOA 4YUWA 4AX8A 4RTJA 2FRXA 2PBFA 1WXWA 4PYQA 4A6EA 2UYHA 3FPGA 5HIKA 3NMUF 3HP7A 4KDCA 3KQWA 1JG4A 3E7PA 5LQRA 5K01A 4CKEA 1RI4A 4EMSA 2QM3A 2R6ZA 4QTTB 2YVLA 5DTQA 5CUQA 3G2MA 5EQJB 4FT4A 4GC5A 3DP7A 5EGSA 3AXSA 3R9XB 3CBGA 5M5BA 4C08A 2UZ4A 3DMHA 5DXAA 3DLIA 5K0GA 2VZ9A 2B3TA 2UYQA 5DX1A 5LQNA 1R74A 1RJEA 4ZTBA 5DSXA 4IV8A 3M6UA 3B3JA 5EOVA 1NW7A 5FCDA 3X0DA 4C05A 3I9FA 4YUXA 4P7JA 5DTMA 3FRIA 1ZG3A 5CVJA 4CTJA 1VQ1A 1AV6A 4PIMA 5DM4A 3BWBA 3VC1A 5K0BA 3G2QA 3P2IA 1RJFA 3ANXA 4XUEA 2AVDA 4G56A 5GP1A 5CCXA 3NVMB 2B9EA 3TM5A 2B78A 1XCJA 3ELYA 3PLAE 4RWZA 3LSTA 5E9QA 5ICCA 2PWPA 3OPNA 1L3CA 2PT9A 3G2PA 3EGEA 2P1DA 2EG5A 4RVGA 1YZHA 3HTXA 3G88A 3LPMA 4KW7A 3A7DA 5ICEA 2CL5A 1JSXA 1WZNA 2WA1A 3C6MA 3HCAA 1PJZA 3HVIA 3FPHA 4PYLA 3ELWA 3HCBA 3HEMA 1O9GA 4FP9A 3T7SA 4AZTA 4AZVA 2C7PA 2NP7A 4R6XA 1NW8A 2I9KA 3FUVA 5BW5A 2NYUA 1R18A 3OFKA 1I1NA 3K0BA 3EVEA 1X19A 2FPOA 4E30A 1Q0SA 4OA5A 2V74B 3H2BA 2Y1XA 1T43A 3F4KA 4P7KA 3MQ2A 2PT6A 5KQRA 4M36A 2ZW9A 3LL7A 3SGLA 3G5LA 4C4AA 2QRVA 3PT9A 2ZIFA 1VP3A 5B1SA 4BLVA 2A14A 3L8DA 1EG2A 4QVKA 2FK8A 1ZGAA 4M37A 4PCAA 3RW9A 3NJRA 2CWWA 1RI3A 5EEHA 4EK9A 5E1MA 3TM4A 3Q7EA 1TW2A 2O0LA 3O7WA 5HZMA 2PWYA 4FR0A 1VBFA 1VL5A 5EG5A 2P7IA 5GM2A 1AQIA 2NXEA 3KU1A 2AVNA 1D2GA 3P9CA 4C06A 1I4WA 5GIPE 3S68A 3KR1A 3I64A 1ZGJA 3BWCA 3UWPA 2BR5A 2AS0A 4CKCA 4DM3A 3GDHA 3BZBA 1IY9A 3EVFA 2OZVA 2YXDA 3E23A 3EMBA 3HA7A 3M6VA 4HSGA 5CVUA 5DXJA 3UA3A 4ER7A 3ELUA 5JR3A 5LQJA 3NW9A 5DM2A 4H0NA 3T7TA 3U81A 3QOWA 3ELDA 3OU2A 2ZLBA 3HCEA 2ZZNA 2B25A 2BH2A 1SUSA 3BXOA 3BGDA 1D2HA 3GCZA 3QOXA 2OKCA 3G8AA 4PONA 3OE4A 4PINA 1ZKDA 1SVUA 1BOOA 3KQQA 3I58A 3MGGA 2ZFUA 5EZSA 2DULA 4AZSA 4EQZA 5LQCA 5HOQA 4XUCA 5LQUA 2PLWA 4FT2A 2O06A 2G72A 1V39A 4QVGA 3KQVA 4AZWA 5E9JA 3KKZA 3R24A 3CJQA 3P9KA 5T64A 4YUZA 3O4FA 3KQPA 4E70A 4RTKA 5EHIA 4FS8A 2I7CA 4Y30A 2P3LA 2F8LA 2ZBPA 1QANA 5EZQA 3T0IA 2EFJA 3C3YA 1JG1A 3G5TA 3KPVA 2E5WA 4MWZA 3LX6A 3GXOA 5CVDA 3OZTA 4YUVA 2H00A 2PGXA 4PYKA 4OBWA 4X60A 3REOA 1KPGA 3NDIA 2QE6A 2I62A 2JHPA 3PFHA 5FA5A 2Z6QA 3BWMA 3GRUA 2JHCA 5IH3A 1QAMA 4KIGA 5HIJA 4F85A 3V97A 1Y8CA 3FTEA 5FQNA 2O05A 4ER3A 3DH0A 2NP6A 2VDUE 5C1IA 4POOA 1AF7A 3LECA 1H1DA 1XDUA 1JTEA 2N47A 3CVOA 4WVLA 1NW5A 1G38A 1P39A 1JTFA 5G02A 3SX0A 4YUYA 4HTFA 2IBSA 1VIDA 1QYRA 2PY6A 4BY9E 3EGVA 5EIFA 5C9ZA 1NW3A 2O57A 1X1AA 1WY7A 1KXZA 2GAFA 3OFJA 2OY0A 3HCDA 1SKMA 2NXCA 1M6YA 1R00A 1O54A 1KYWA 2XYVA 3OE5A 4R05A 4R6WA 1RI2A 5FADA 2C7OA 2ZBQA 1N7IA 1N2XA 4DMGA 5E8RA 5EMKA 2JHAA 2C7QA 2IH4A 3A4TA 5FHQA 2I6GA 5H02A 1FP2A 3A7EA 4YMGA 3JWGA 3CKKA 5K05A 3FUWA 2OPBA 2AOTB 3EVGA 2P3OA 2OB1A 2YXEA 3BKWA 3MB5A 4QPNA 5JUWA 3Q87B 2PJDA 4ISCA 5D1NA 1YUBA 3UA4A 5LQAA 3QV2A 2BM9A 1FJXA 2GH1A 4HC4A 5ICFA 2IH2A 1NBHA 5E2BA 3KR0A 3GRVA 5CVVA 4E2YA 3E05A 3EGIA 1JQ3A 3OU6A 3TKYA 4R8SA 1R8XA 4MTLA 1DCTA 1UWVA 1UFKA 3LHDA 4PGGA 3PS9A 5CIYA 4X61A 1NKVA 3B3GA 2GB4A 2ADMA 4GC9A 4K6MA 5EKXA 5ICGA 5K0EA 3CJTA 4PYOA 3KHKA 4M7RA 4R8RA 5HILA 4EKIA 1UIRA 3C6KA 3CC8A 3HNRA 5F2KA 1Z3CA 4HG2A 2PXAA 3GWZA 4QQNA 3CJRA 1BKYA 3HA5A 4GBED 2JH9A 3C0KA 5C0OE 4RTMA 3M4XA 4C07A 3M70A 3P97A 1OR8A 2HV9A 3GRYA 4HH4A 5FWDA 4RV9A 2JG3A 2JJQA 4X41A 4GUAA 2P3QA 3RIEA 3TKAA 1EJ0A 4HGYA 3HCFA 3SSOA 3TR6A 2IP2A 3IV6A 2GA9A 3G89A 4C04A 3ERCA 5LSAA 1KYZA 5E1OA 3VC2A 2ONYA 3DR5A 3M6WA 2IDJA 1G60A 2PX2A 2GS9A 4KWCA 4LWOA 1F3LA 3DUWA 3EVAA 3UZUA 3FRHA 2Z6AA 1DL5A 4BLUA 2ZTHA 3HM2A 3MCTA 2BR3A 2ONZA 3UJAA 3UJBA 5E9WA 5EMMA 4RYLA 4RTOA 4E31A 4OA8A 1NV8A 3HVHA 2AOUA 4DZRA 1YFJA 2HWKA 3TFWA 3VYWA 4UOEA 5DTRA 3IEIA 3BT7A 3EPPA 2AZTA 2P35A 3R3HA 2WK1A 2NXJA 3NTVA 3PFGA 4XCXA 3THSA 4BLWA 4DA4A 3CGGA 5DM1A 1KPHA 2PVCA 3P9NA 1JR4A 2HTEA 3M33A 4IWNA 2AN5A 4GOLD 4YV0A 5EEGA 1XXLA 4YMHA 4DF3A 1XDSA 5EPEA 3LDUA 2ORED 3SSNA 4E2XA 1IM8A 3PB3A 3PTAA 2OYRA 2ZBRA 1VP9A 2QRVB 5GM1A 2H11A 5GIOE 4KDRA 2HR1A 4P58A 1DUSA 3B3FA 4HRAA 1MHTA 2ZZMA 4RTNA 3KQTA 1SQGA 2ZWAA 4PWYA 1ZHFA 4ER0A 4LG1A 3TQSA 2JH8A 2EJTA 2VDWA 3HVKA 1JQDA 4GEKA 1ZQ9A 4GOMD 4P7FA 4QDJA 1WS6A 1U2ZA 4RSRA 5DM0A 4PYMA 4GQBA 2VP3A 1NE2A 2YQZA 1FP1D 1BHJA 3P8ZA 1P1CA 4OBXA 5P8WA 4CTKA 2XVMA 2IIPA 2IBTA 3FZGA 2H1RA 3LKZA 5DT2A 2ZULA 4KIFA 1KP9A 3FUTA 3DTNA 3BUSA 3UFBA 2G70A 1X1DA 2KW5A 5MHTA 3DULA 1NBIA 5T67A 5K8VA 3I53A 3FTCA 3ID6C 3OU7A 3MAGA 1F38A 2ZZKA 5K0CA 4PYJA 3TLJA 3UJ9A 4RVFA 5HIIA 8MHTA 4FSDA 4IV0A 1L1EA 1EQAA 5CD1A 4MHTA 4A6DA 1G8SA 2PX4A 2YXLA 1X1CA 1KPIA 3LBYA 3PVCA 1KIAA 2PKWA 2YUIA 5E1DA 3E8SA 5CM2Z 3P9IA 3P2EA 4BP3A 1FPQA 4E2ZA 5HEKA 5FA8A 2AOVA 5EHGA 4PYIA 1L9KA 1SG9A 1QAOA 3ER8A 3KQMA 3OCJA 3UJ8A 1KHHA 2IDKA 3KPJA 3LDGA 4AUKA 2V7EA 4F86A 3IHTA 3OZRA 4RVHA 5FQOA 3GGDA 5K09A 3ORHA 1XCLA 1R8YA 2PXXA 3LBFA 3EEOA 2IGTA 2NXNA 3JWHA 3B5IA 1P1BA 5F2OA 4WXHA 5K0NA 5K03A 2ZVJA 3EVCA 1RJGA 2FCAA 1QZZA 5E2AA 5BXYA 1B42A 1EIZA 2P7HA 2AR0A 2P8JA 3MCZA 5GINE 4LECA 4XUDA 3TRKA 3VSEA 1L3BA 3HCCA 4FZVA 5EC8A 3RODA 4DQ0A 3PX3A 3D2LA 1ORIA 3EVBA 2Q41A 2IFTA 3MTIA 2WA2A 3OZSA 2DPMA 4RTSA 5HFJA 3AWIA 2XYRA 1JSZA 3UJDA 4U7PB 2HNKA 4GF5A 4C03A 1M0EA 4HTFB 5F2NA 2P40A 1VLMA 5DX0A 3FTFA 3TOSA 1AQJA 4L7VA 4FSXA 4DKJA 4IKPA 3NWEA 1G55A 4U7TB 1G8AA 4B17A 3MERA 3KQOA 5KYGA 4ATNA 3KR9A 3GJYA 4CKBA 3TMAA 2IPXA 4YV1A 2GPYA 1YF3A 3V8VA 2AN4A 3CCFA 5EVJA 2ERCA 3A27A 3GU3A 3P71T 1NV9A 1M6EX 3SSMA 3TPZA 3HA3A 3JWJA 3SMQA 3UJ6A 1O9HA 3GNLA 3UJ7A 3SM3A 1NT2A 4E32A 1YZ3A 4NECA 1HNNA 3M6XA 3C3PA 1FBNA 2CKDA 3KPUA 2YTZA 4DCMA 4GOOD 4YV2A 5LR6A 2ZSUA 5DWQA 4FGZA 1XTPA 3G7UA 1RJDA 4MIKA 2OBFA 3AY0A 3LKDA 1JG2A 1XVAA 1SQFA 3FTDA 5DSTA 3IYLW 2AN3A 4X1OA 3T7RA 5LQKA 3R6TA 1JG3A 1YFLA 3BGIA 5FWAA 3DXZA 3UJCA 4CWAA 3MHTA 5DRTA 2YX1A 1YB2A 4HGZA 5D1HA 5FTWA 5K0JA 4Y2HA 3B7PA 3JWIA 1I9GA 2G71A 3ER9A 1QAQA 1L3IA 2OB2A 3LCCA 2FHPA 4ER6A 2OXTA 3FYDA 3BWYA 4PCLA 5FUBA 1N7JA 1NW6A 2QY6A 3A26A 4E2WA 5K0FA 1EAMA 3GRRA 3O31A 4LWPA 5EIWA 5EMLA 5IKMA 2PSSA 1VE3A 4F84A 2PX5A 2XYQA 1XJ5A 2ZIEA 4ER5A 2EJUA 5CVEA 2PXCA 3KPYA 4OQEA 4P7GA 4MQ4A 3SXJA 2HMYB 3SR4A 3P2KA 1P91A 3KR2A 2R3SA 3FUXA 4PIPA 1SUIA 4KRGA 5HIMA 5U4XA 1RI1A 4PYNA 4QTUB 1HMYA 1WXXA 2Y1WA 3UBTA 2PV0A 3FYCA 4JXJA 4CXMA 3ME5A 2GLUA 2CMGA 2YR0A 3DXYA 3EVZA 1JQEA 2AOXA 3LDFA 3A25A 4QDKA 9MHTA 2ZCJA 2FYTA 3FUUA 1ORHA 2AOUB 5KS2A 2BR4A 1WG8A 1RI5A 3DLCA 5E1BA 4Z2YA 5ERGB 2G1PA 5K0LA 4PNEA 4RTLA 3DXXA 4KVZA 5EMJA 3LGAA 3B89A 4M38A 4RVDA 4X63A 5FHRA 3I5UA 2IH5A 2QYOA 4EVIA 3GIWA 5DX8A 1EJ6A 3KQYA 5DLYA 3SVZA 5FULA 1X1BA 1TW3A 3HVJA 4QQKA 4V0QA 2UYCA 2XBMA 2EX4A 2O07A 5CCBA 3EMDA 2VS1A 2OO3A 2AOWA 3AXTA 3G8BA 4PGHA 2BZGA 2CMHA 5DRYA 5E8JA 3KQSA 2K4MA 2ESRA 5EKUA 4QPPA 5KVAA 3FPFA 3DMGA 5T6BA 3BKXA 3R0QA 5GOZA 1XDZA 7MHTA 4DCGA 4BP1A 2ZIGA 3EVDA 1R6AA 3PX2A 2XVAA 1PRYA 2B2CA 3NVKI 1MJFA 3AJDA 2G8NA 4V0RA 2NNWB
chains in the Genus database with same CATH superfamily
3BXEA 4INOA 4DEVA 3BIWA 2FW1A 3QLTA 3LCUA 4Q9DA 1TUBB 1HT1E 1Y3AA 3QNWA 1XPOA 1B8OA 4RESA 4W5WA 4ISBA 1NY6A 4IJWA 2Z3ZA 1ZS9A 4GXNA 1R9MA 1DU4A 3A11A 2HGSA 2Y66A 3KOZA 3MT7A 4IFBA 4QOSA 3PWTA 3MMNA 1KE1A 2IRWA 1N36B 3FPEA 2PRIA 3CEAA 2FFQA 4K2HA 3OBIA 4GVXA 2P4UA 1DC5A 4QYTA 4IJKA 2H18A 3TEFA 4HDSB 1ABFA 4YUWA 5HPYB 1WXWA 2O54A 1LPMA 4MO2A 2EFDB 3FPGA 4C6TB 2PR2A 1IVNA 3F6EX 4YACA 5SY4A 4NH4A 3RRBA 5LU9A 3HJFA 3LX5A 1YRLA 2WAOA 2V0CA 3RJ5A 3RYFA 4AKTA 4M9XA 1OAOC 4DA8A 2J6BA 5EQJB 2H51A 4BC0A 2R751 1U3FA 3M5PA 3EZ2A 4JBGA 2UZ4A 3ROPA 5K0GA 5GMOA 4B85A 1FE8A 3KBBA 2VLIA 4RFLA 2CDAA 2HDNB 4RNDB 3RC8A 4RGBA 4C2TA 2PU7A 3B3JA 5JDCA 5DE3A 2YVUA 2WFZA 3I9FA 5FORA 4LZJA 1J06A 5DM4A 3HB0A 4Z5XA 1T9DA 5K0BA 1Y5LA 3CSDA 1T8WA 2MMCA 4F6RA 1EM8B 2IYNA 2LBPA 4IIHA 4N6NA 1UKZA 1C9JA 2PD4A 2WMOB 1X7XA 3L0SA 4II3A 3TTVA 4EG5A 3U37A 2F8SA 4Q15A 4L8FA 1CWUA 2A9QA 1N2SA 3NHSA 4M9CA 3M9LA 4GMDA 3TRJA 3HTXA 4ZCQA 4IIBA 3CEMA 3DQPA 3H17A 1M1YA 1T9GS 3ICWA 3SXUB 5JNLA 4BO2A 3IAFA 4V02A 4E14A 1AKNA 4B75A 3C98A 3NC4A 4HWPA 5CYGA 5JMWA 5KTYA 4N48A 1QZTA 1XKQA 2IKSA 3GGOA 4R8LA 1KDTA 2DQKA 4E5SA 4FD2A 5JYEA 3NNSA 3RFCA 3P94A 2ZR8A 1P5FA 1R0CA 2GBLC 2O23A 3DMRA 3IB3A 1GZUA 3NALA 4O5AA 2AH5A 4AN0A 2Z04A 4MRPA 4OAPA 1E0AA 3SGLA 3VNQA 1H6AA 1H0RA 1PWYE 1MQ8B 1C3XA 2G5GX 5DHSA 3S5JA 2KI5A 3SNKA 1ISFA 4K05A 1QUFA 1ZD8A 4WZZA 1T1SA 1VP3A 4KV9A 2VK1A 4N5HX 4U6QA 3S1AB 1B76A 1P3Y1 4IYJA 3DEZA 3E7DA 2YJGA 4NOLA 3U7QB 3V6MA 2VHVA 4GVPA 3RSZA 5IABA 5KYYB 1IY0A 3BCRA 2ZJ4A 3KV1A 1PO7A 2H5IA 1G291 1FDOA 3ENWA 2H2DA 5E1MA 3GP5A 4V0SA 3DMNA 3WHKA 1VBFA 2R1ZA 1Z22A 3MILA 5IVHA 2CZCA 4R1QA 4BNLA 4M0UA 1JIKA 5DBIA 3KU1A 5KOYA 2HLNA 2WIDA 4AAYA 5ALJA 4NTZA 4ZYTA 1YDHA 1W52X 5JECA 2CFSA 2ZIXA 3F49S 6LDHA 2ZYRA 4MCHA 1XXHE 4JOBA 4P0TA 4IY1A 2WSMA 3TB4A 4BLPA 4YWHA 2HPHA 5JR3A 1N78A 2FTKE 3K92A 3V9PA 4QUEA 3UHFA 4NI5A 4EPVA 1DDOA 1X7DA 2G3YA 3DXFA 4NCKA 4NE7A 4NZYA 4ZT3A 1Y3BE 4GZ5A 4A73A 2PQMA 1GO2A 1O95C 1IN4A 1R4ZA 3BXOA 4PLHA 2Y1DA 1AS3A 3RFFA 1UBNA 1JAXA 2Z3VA 2QDKA 3MGGA 1GZ5A 5EZSA 5FWXA 3RABA 3HKEA 1RM4A 3DZBA 1M66A 3TCNA 2REOA 3E1KA 4DIUA 4XUCA 4E5DA 1KYQA 5ELMA 2HWXA 4WESA 3HJAA 3SBEA 3UT6A 2ZETA 4MLZA 2E4YA 2G67A 5ALXA 5IZCC 1Z29A 3AFMA 2WJ4A 3VC7A 2IODA 1CJKC 3RC1A 1TRKA 3N07A 1VSQA 4JDPA 4BYMA 2BEUB 5J2UA 2W6MA 1QZXA 1EVKA 1BN7A 4V24A 4MR9A 3EGDA 3GXOA 1EWTA 2ECQA 3OZTA 1OX4B 4H1VA 5LMCA 2PGXA 3UF0A 2X8JB 2AHRA 3I4CA 4XH9B 3TTTA 3MCUA 3L8YA 5FA5A 3WXMA 5D5PA 3JR7A 2LDXA 1CRZA 4OG2A 1UBEA 3KJQA 3RUPA 3OEEA 4DNPA 1KA9H 4D0LB 1DRJA 1GYQA 4ER3A 3ZWDA 1JFLA 3QEBZ 3OOSA 3JYLA 1AF7A 3LECA 2PFGA 4U63A 3U60B 1XJWA 3P4XA 4FFBA 1ZR2A 1J9ZA 1I4OA 1YS7A 4AKEA 1V4BA 2C9DA 2L69A 4H08A 4LV8B 3FDIA 4U2DA 4N0PA 4DCPA 5JLJA 3EGVA 3OUTA 4HDAA 4XIGS 4JFAA 3EXAA 1A9ZA 3ELBA 4Q3DA 3E8MA 2PWZA 2QLTA 4GRAA 4R2KA 4UBMA 4OATA 3WJ1A 1ZL0A 3UAWA 1CS4C 1GY8A 2BP7B 2CCGA 3R3XA 4IZIA 4JK3A 4XEUA 5EMKA 2C77A 1KZGB 2XEXA 1BCRA 3H1AA 2I6GA 4CLHA 1P1IA 4YMGA 3ZLTA 3JWGA 5M34A 3HB5X 2PRKA 2RMKA 2XITA 3DD1A 2HIMA 4QEZA 3ADKA 4D82A 4LQLA 2FQQA 4Z3KA 2HM7A 6REQB 1QOQB 1NNEA 2WEKA 3NG1A 3EQ8A 2XNSA 3PNOA 1YOVA 1Q0QA 1YRYE 3LZDA 3O75A 1JJIA 1ADYA 4XJVA 3KEQA 3GRVA 3WNCA 4CRWB 3QWBA 5B1YA 4ZVLA 2V7PA 2ECFA 2IBMA 2WF6A 2OCKA 3DKVA 1SVOA 3EVTA 2CWDA 2O1XA 4BTLA 4TLEA 2O8FB 3AW9A 3B3GA 5EKXA 1RP1A 4EHNA 1V8ZA 3D7KA 1H2FA 2VFAA 3MGCA 3CC8A 3OZ7A 4ZMSA 5DGCA 3ZUPA 3D6UA 3UT5A 5IAJA 3DZGA 4DQVA 3M70A 5GQSA 4HDQB 4BN4A 4HH4A 3IEXA 5FWDA 5KNBD 4OI4A 1T5DX 4F6CA 3TNFA 1T6YA 2OYSA 3VX4A 3NU1A 4XYBA 5JYDA 4EKDA 2O2GA 1P5HA 3W8FA 1Q21A 1N5IA 2OQRA 1JJAA 1TM7E 2V7VA 1YQGA 3M6WA 1BN6A 4MB6A 1PZFA 1R9GA 4MYTA 5ALIA 5TS2A 3W6PA 1I7QB 1I14A 2Y0CA 2GS9A 5CGQB 3EVAA 2V7XA 2NIPA 1A2OA 1QIIA 3GLHA 3DMTC 4B0PA 3CUTA 4GFDA 1CE8A 5L7WA 3ZS8A 2A5JA 3K0SA 2OVFA 3HVHA 2CHFA 2ZYVX 4JR2A 1D0VA 2RH5A 1H6BA 4IL5A 1E2MA 3E3LA 4PG4A 4RV5A 3RJMA 2IUYA 2YV1A 2O8EB 1ENOA 4MDFA 4QQRA 5HTKA 1W36C 4GI5A 3BXPA 5JI3E 3S7ZA 2JA1A 1CQXA 3ET5A 3COZA 4G1EB 3ZLJA 5JS2A 4OMDA 1YL5A 2BN4A 5IH7A 2P2ZA 1K8RA 4MVJH 2JHFA 4R3NA 1XXLA 4NARA 3DAYA 2XMZA 1SQ6A 4LWQA 4RW0A 3BH6A 4TYYA 1NQOA 4B2YA 1EQ2A 2WAYA 5ETJA 4EHFA 1UUFA 5JAMA 4XLZA 3A0UA 1WCYA 2WVJA 1KOGA 2H11A 5LZ7A 3RK4A 3IFSA 2GBGA 4X6UA 4N0QA 4N3BA 1D2RA 2W90A 4X90A 2BFFA 3V9AA 1Z5OA 3A6KA 3GCWA 4AJ9A 5HVNA 3KQTA 3S7TA 1BAPA 2ZWAA 4AQ7A 5JANA 5AW8A 1ZHFA 2J09A 1YD7A 2Q8NA 4B47A 3DHEA 4BX0A 1H2ZA 5K0SA 5HF6A 1E2NA 2PUJA 4E11A 3CPJB 3UMMA 1R9NA 3EIXA 2F90A 4J1QA 3C7KA 3ZHSA 1P1CA 3N39C 4YNBA 4GZ6A 2AF4C 2ZT6A 4WERA 3VSDA 5CITA 2IBTA 1PEDA 3T52A 2D0PB 3VSBA 4UAVA 3ZJYA 1P72A 3U3ZA 3WNZA 4IF4A 4PEVA 1MNAA 1EUCB 4XQ9A 1N2EA 4IUYA 4ZV9A 2C4KA 4ITVA 2F3QA 2VSXA 1Y4AE 2OC4A 1GQOA 1YVEI 3V34A 1SCDA 4I1YA 3SZRA 1YBVA 4FSDA 3DLHA 2O8BB 1EQAA 1PVVA 2ZUSA 3WAGA 4JI4B 4MHTA 2C03A 1QO9A 4YQZA 3VKUA 1G19A 1BXRA 1NTOA 3PGKA 1YQQA 3GQVA 4MVWA 3BYZA 3JWPA 5AKJA 3E9NA 3H9QA 3K0FB 2UXCB 1Z9BA 2PVPA 3E8SA 4EX6A 3OLCX 2DT5A 4JAVC 4M4SA 3FBTA 2IJGX 3Q0IA 4R9VA 1C7FA 3LP5A 2XB4A 3MCWA 1FMFA 1UBOS 3FKJA 4F9TA 3SY8A 4F86A 2QUHA 4L75A 1CEQA 3AM4A 3GP3A 2QHXA 1F2TA 1R8YA 3BD7A 4H15A 4JUBA 1W0CA 4O4HB 2P4HX 2Q8QA 4I99A 4X64B 5TJ9A 3R7BA 3WX0A 4E12A 4EYQA 4XRGA 1F0KA 2CVZA 3JV7A 5BQXA 2HV8A 1FW6A 1JEYA 4F4DA 1T0UA 3AEZA 4X66B 5HE8A 2W98A 4A6PA 3DPIA 4R0VA 4YRTA 1WMEA 3K09A 1L3BA 1KMCA 4M9SA 4MINA 4JGIA 3TCXB 2IYRA 1LSUA 1JLLA 2IFTA 2WHPA 3UKJA 2HF9A 1SO8A 2A33A 4KO4S 1OH6A 1G41A 1OWLA 4XWWA 2COUA 3BMCA 4YRLA 4AYTA 2UDPA 1K97A 1HE3A 4MPRA 1VPLA 4WN9B 3KLPX 5DX0A 1ZCJA 1DUIA 1M9NA 5ERYA 5EUBA 1K86A 5ITVA 4IAOA 3R0VA 4IIXA 3AETA 1KAMA 3MJDA 3M5CA 1V1MB 4OUKX 4B17A 4GEGA 2OAEA 3KQOA 2QUJA 2CT8A 3ZGXA 1Y81A 3MW8A 4MVJD 5DYGA 1P2SA 3LZ6A 5BSKA 2QRLA 2AE1A 1M6EX 1QQ6A 4YECA 1ND5A 1GEGA 2Z2XA 1LX6A 2GHTA 1DKLA 3F1LA 2C29D 5SZJA 3ZG6A 4DDTA 3HP1A 3IDSA 3SHFA 3U4GA 4D4LA 5C1OA 1LSJA 2A7QA 4FNAA 3HL4A 4TXJA 4FCWA 5ALSA 4PAWA 4GOOD 1UBLS 2GHQA 4GIBA 4A8JC 3UICA 1JP7A 2ZRCA 4MIKA 4BBZA 5JIBA 5FJJA 3VZPA 2BMEA 1I7LA 1HSOA 1M1NB 3CLHA 3HB9A 2I4IA 3I9KA 3N8DA 4LVOA 3SU8A 4JLUA 3UMJA 4N1AA 5AIBA 1YMVA 3NUQA 3LCRA 2C4HA 4V3BA 1T0BA 4XCQA 2ZIAA 3WAKA 5C51B 3BILA 4UHEA 1ECJA 4YPVA 5KX5B 2C59A 3FSGA 1E9AA 1V11B 4GE3A 4LOJA 2M6LA 3J80A 3FDFA 4D79A 1R66A 4KQMA 1K6IA 5K6RA 2VWHA 5JYCA 3GA5A 1CRPA 1R1DA 3H5RA 1W88A 2H3EA 4POAA 4WBNF 4O2BA 4S1WA 1WHTB 2BFNA 5G3ZA 4QUBA 3CUWA 4G8BA 3C4VA 4HYEA 3WYDA 4YAJA 3GRCA 3ZWNA 1SUIA 2ZE7A 1KY2A 4RIHA 4W8GA 1COZA 4XD7D 5EHNA 4QTUB 4CLEA 3F6RA 4Y9TA 1K5HA 1ECFA 3DHVA 4JT4A 1ISRA 3BTVA 4D44A 1U1IA 1OYYA 3ZPXA 3UHJA 4FM9A 3QVKA 4BKUA 2RGDA 4C0WA 1X7GA 2VT7A 4HV4A 3QEKA 3OIVA 1QS0B 4W99A 1ISPA 3NV9A 2R2GA 4YY3B 3GVHA 3HBNA 4M8LA 3K4QA 5LP6C 4EY4A 2PUDA 1KO1A 1I5OA 1PK9A 3DXXA 3LUKA 4KVZA 4US0R 4JKOA 5EMJA 2GZ2A 2IWHA 2RHRA 3SCZA 5HR5A 3KFVA 1W36B 1TOAA 2ABWA 4FYJA 5GJVC 3UHAA 1FYEA 1RPTA 1X1BA 2Y6VA 3B3QA 1W1WA 2Q99A 2XUDA 1RBZA 4WMLA 5DU2A 4IGFA 3QOFA 3WIOA 4LZPA 1ZFNA 1UJMA 2AOWA 2O7RA 2Z2KA 2Z9BA 1A1SA 2BBSA 3Q3IA 5FPQA 4HB2A 4LIPD 4KACA 1J0CA 2Q3CA 2NGRA 2YV4A 5F7XA 4P5PA 3KKQA 4I4NA 1ZD5A 3CW8X 3N3AC 3T5GA 4QT4A 2FWPA 5SYMA 1PFVA 3WGLA 3WK7A 1MAUA 2BBTA 1R0WA 5EMNA 1RYBA 4A27A 2WKPA 5CXUA 2FJPA 1BDIA 3R9XA 4OYLA 3RF7A 1QX4A 1TQ8A 3L2OB 3PCRB 4I55F 4J29A 1QC5A 2D1RA 1G2PA 2EFGA 4TUYF 5DCUA 5LQSA 1PG0A 3HU1A 5BW4A 1CR6A 4PQGA 4TGLA 5F4ZA 1C81A 3KPWA 3O8QB 1EFTA 3AOEA 2C9CA 3DOUA 2XVZA 3GRZA 4X85A 3S8MA 3W2IA 5B2EA 2GEVA 3JAKB 2WU3A 3RYCA 4BC1A 4MICA 4P3KA 4C22A 2WLTA 2VH2A 3IQXA 3PGA1 5KSPA 4PLTA 2RARA 4UZFA 1DAHA 3THRA 1L5MA 2C8KA 3C3XA 2B3DA 3EEIA 3F8SA 4ARIA 3AT1A 4Y18A 2OLJA 1OQAA 2FRXA 5FAXA 3ROTA 3RIXA 2PSFA 1FS5A 4PXAA 3FI0A 4M21A 4H1WA 1E7MA 1DRUA 3GJ7A 4P6VF 4TLMB 2XZDA 3WR5A 4HAYA 2EQ5A 1GA1A 3OT1B 4UHKA 1IB6A 1QYXA 4GLBA 2FPXA 5J2TA 1FSPA 2YXNA 3C3CA 4LYGA 2HL6A 3IE0A 4ALLA 4R1TA 5SYAA 4AZ0A 4EA9A 1QU3A 4OHZA 1NR1A 3ZE7A 1E1QA 2HIAA 2FEAA 2I55A 3PIRA 4JHXA 4KQFA 3T54A 1N34B 2G5CA 5LZ8A 3IMKA 3URKA 3GLRA 2XDQB 3K6KA 4N7MA 1Y82A 4ARBA 4JYPA 2HZ7A 2AJCA 5BUSA 5L3QB 4RSMA 2D6FA 5CFZA 5L4LA 2D1SA 3TL3A 1XA0A 4K6CA 1JB1A 2AG5A 4ETIA 1ZWKA 4JV5B 4O1IA 5LBTA 3NETA 5E7QA 1DQRA 1M6VB 1GTVA 3HY4A 3V7WA 4DMFA 1ILWA 1N0VC 2QGFA 3A7DA 1CQZA 3JSXA 4LHSA 2G0AA 1M8FA 2VNIA 5EE9A 5FBRB 2ZI4A 5FT9A 5DNYB 4ZT5A 1J2YA 3GEHA 2YCLA 2LP4Y 5KSZA 2BHSA 3CRVA 1CDZA 5B30A 2NP7A 5JAHA 4PU0A 3BREA 2BV3A 2GMWA 3WJAA 1XXHB 4P3NA 2PL9A 1IEQA 3PD7A 2GNPA 3DF7A 4J16A 2JLRA 3ZE0B 1X19A 3FSRA 4WQMA 5ILQA 3RQIA 4JSRA 4YJ3B 1WEKA 3LLSA 3Q9UA 4HH3C 4DV6B 2GK7A 3R6WA 2WMYA 1F0YA 4FU0A 3G68A 4JBYA 4ZREA 2Q1WA 2V45A 2NOAA 1C3LA 1Z0FA 2HHLA 3EQ7A 3UXYA 4BGDA 4EJMA 1SXJD 4LOKA 2J9ZB 3QPCA 3D0QA 3L8DA 3NBFA 4C7VA 3NJ8A 4PCAA 1L4BA 4ND8A 5JWRA 5KNCA 3T4PA 2P3SA 2WLSA 4MA5A 3WYNA 1EEXB 5FIUA 3CSSA 3O7WA 3ZX4A 1BG6A 1X7ZB 3L92A 3WQRA 2I3GA 4CM1A 1SCBA 3RRXA 2QZPA 1LDNA 5EIEA 5AI6A 1XO1A 1LQ2A 4K3VA 4DSAA 4K5QA 4M60A 4E51A 1XK7A 4KN9S 3N3BC 4NIMA 5CLLA 3WWPA 2YHIB 3G82C 1DRWA 4A8JB 3IL2A 5FI3A 1N9GA 1R6XA 4JVMA 3M0EA 3U5ZB 3IEVA 4KG7A 3BMOA 2WPDD 2J41A 2PQ2A 3OE7D 4G1FA 2AS0A 3VZDA 4RM2A 1EFPA 2CCJA 2IYXA 4MRAA 3TRKA 3WYGA 3UA3A 1R0KA 5B5SA 1A98A 2IZZA 3MIZA 4F92B 3VPGA 1KARA 2XCRB 3WHLA 4HFMA 2E4ZA 1DG9A 3PVZA 1D09A 4GDFA 2FWNA 2B25A 2BVNA 2OLEA 3OTHA 3PNLA 4BMYA 1XUOA 1YBAA 1EG7A 2VSQA 4BMOB 1WMFA 2R7MA 2N42A 4G3XA 4PINA 3ZGVA 3N05A 4AK9A 1BOOA 2O8CB 3BH7A 2OFOA 1SHZA 2FPIB 5HOQA 1VA5A 1NR5A 3V4ZA 2C0QA 3QE0A 3RT9A 2FP3A 1T36A 5GY7A 3MINA 4Z0HO 1UIMA 3WGQA 4D9GA 2QQEA 2VUUA 5G53C 1DAIA 1R6TA 2P2CA 3MN1A 4OXXA 4UULA 3UO8B 3W05A 5C52B 1QYWA 1QANA 1N8SA 1L4EA 2ECKA 2YS7A 5KVSA 1JLKA 3WTCA 1H4SA 1Z7GA 4Q48A 3ZCTA 4B7UA 2OHHA 1EXDA 4C30A 2CEAA 4RHEA 2HB6A 3NBKA 1ZGBA 1YIDA 3P19A 2JHPA 4I4CA 2EGHA 2IYTA 4QRIA 1X3LA 4Z0TA 1C80A 5LP6B 2ODTX 4UXIA 2F6RA 1MJGA 2PGNA 3WGYA 1B74A 4DSUA 3G8DA 4R2JA 5KKAA 1ENYA 4N3AA 3U44B 1E69A 1Q3HA 1G6HA 2QTFA 4IILA 2E3JA 4Z9XA 4PTLA 5K3AA 2QM7A 1G38A 2JIMA 3R5TA 2AJLI 4TLBA 4B6GA 3ZK8A 2IBSA 4BY9E 1FTQA 1PBNA 1PGQA 2XJ4A 3TKLA 2FAXA 1E3IA 2YVQA 2FSGA 4PG6A 3HCDA 4ITUA 1GU0A 1QF7A 2BLNA 5FADA 4KODA 6AT1A 3C5EA 2VJMB 3QPUA 5KQRA 1JA0A 2VT6A 3QJ5A 4IYRA 1R8JA 4JB2A 2VDPB 1D2AA 3IA2A 5BY2A 4RXMA 2VQEB 1ZM4A 3A7EA 4BGIA 2XLBA 1GCUA 3ETEA 3PUVA 3QU7A 2H0QA 2W2LA 4UAJA 3N2KB 2R5FA 1ACJA 2WWHA 2XF2A 3E03A 5HIAA 2E1RA 3LD9A 4PNPA 2JHGA 4ZOCA 1IXYA 4IDBA 1D5CA 4F2GA 1KYVA 3CB4A 5JS6A 1Z6XA 4UCFA 4A8TA 3KR0A 4B43A 1IDOA 3ZBQA 5H82A 3ZW8A 4PO3X 2BTEA 1VE9A 5CA0F 4I50F 2XPCA 1A4XA 1GKLA 3IULA 1ZIYA 2NUTB 4IFEA 3RHTA 4IHJA 5JW6A 1UWVA 1UFKA 3P2JA 3SIWA 3KE9A 3NTRA 1EVYA 3FVVA 4UBKA 5I9BA 5HS4A 2FPGB 3CVYA 4QO7A 1KY5A 2BKEA 5CK4A 1E3WB 5BWBA 1MXFA 2VNSA 1FMTA 4WOBA 1A96A 3RWBA 1V3QE 2XQIA 3OECA 3QX9A 4RD6A 3I76A 3CF6R 3CJRA 1ICEA 1VHDA 2JH9A 4KYTA 2W2QA 4G9GA 3NOVA 4PHFA 5C0OE 3PTLA 5IK2D 1NN3A 1U28A 2NG1A 2H4YA 2VUIB 1HPLA 1F8XA 2AWOA 3DM9B 4RV9A 3C1TA 4QJ3A 5BN3A 1XC7A 5G41A 2NAPA 2P3QA 1BMFA 5CTJA 2OGTA 2XV1A 3L8MA 3NHUA 4NMMA 4G63A 4W5OA 4EENA 4U4AA 4AXBA 1XPRA 1HURA 4ZEWA 1KYZA 3GB9A 1ZC4A 4MIYA 1AKTA 6GPBA 1G60A 1GU1A 1LS1A 5SY9A 1QIEA 2WSSD 2R60A 4MR7A 4ALMA 4ZYZA 1X86B 1IN1A 3PDWA 1ZM3A 5D3ZA 5KKCA 2AD5A 1KMHA 1R8QA 3VSAA 4L4UA 3WQHA 2GBCA 2JFZA 1GZVA 2WDPA 1DLIA 5FUYA 2DCMA 3U62A 4RYLA 2GJ8A 3LFHA 1MOQA 2OGUA 1WUHS 1J8QA 3A37A 1ZK4A 4BMCA 1ESZA 4GKBA 5EZYA 1E2QA 4QEKA 1GEEA 1KPHA 2CF5A 4JUDX 3HHEA 1UAGA 2XE4A 3FYTA 4Q7JB 1VLHA 3U48A 3W5IA 5IDQA 4QGFA 5FF9A 3F5QA 3VR6H 1L2TA 1ZRHA 3DUFA 4QFDA 2POCA 3OT5A 3MM4A 4HB0A 1N0HA 5T4EA 1U7XA 5J5AA 4DA9A 3BC1A 2C92A 2V7WA 1XRLA 3OTWA 3IRUA 4Q12A 3V55A 2GM3A 2QRVB 1I1OA 1MVLA 4FGWA 4KDRA 3FOBA 1K8QA 5HK8A 2OAQ1 4HNUA 3CZMA 3L1JA 4LC1A 2PZKA 2XE7A 4YASA 1GRQA 2JGKA 3ZBUA 5JZMA 4YRBA 1H2WA 1LLFA 3H1GA 5K8UA 2Q4BA 3HO6A 4FWIB 4B73A 5INTA 1ZU5A 4MVXA 1IEWA 4QDUA 1QGYA 4P5DA 4RS3A 3FWNA 4CMEA 3BIFA 1KMNA 3H99A 2PMWB 1ESCA 4F4IA 3AYXB 1OKKA 3LNTA 3OQ6A 1N6IA 1N5OX 1XMOB 2IIPA 4TKMA 3VZQA 3K3PA 5DN6D 5ELXA 3QYAA 1KEEA 1X1DA 2H7VA 2KW5A 4JJFA 2AGVA 4UUQA 3PGXA 3OF3A 4H4EA 3J81A 4AI6A 2RGNC 1EDOA 1ULHA 1QIGA 3FROA 5K0CA 3TLJA 1GSAA 3KV3O 4MDEA 1E1CB 2DU8A 4QOHA 4F96A 1UBRS 1Y1LA 1M5UA 1XTBA 3M83A 3P96A 4HX9A 2Q5IA 4S3MA 5TPZA 3VDRA 1JDZA 4U5QA 1FTSA 4JOQA 2YYAA 3U3MA 1W4LA 2FR0A 1YACA 2CMKA 4UUPA 2YNMA 1HM5A 3O3CA 1Q77A 2B1GA 1J0XO 3NIFB 1O97C 4ZRDA 4RGYA 3DZHA 1E5LA 1NN0A 3QEAZ 1KHHA 1QG6A 2XMPA 1ECGA 3CNBA 2F7SA 2VWGA 3IR7A 4BDTA 5JARA 3KB1A 3DVAB 3VPFA 3GPBA 4EIWA 3TRFA 1WSBA 2OOKA 4P32A 2AJDA 3JAWB 3B5IA 1P1BA 1P2BA 3UMFA 1DXQA 4WVLA 1E2HA 2P9EA 5E2AA 4R2WA 1RXWA 4JH0A 1B42A 2NADA 2RCYA 4EKEA 3QU4A 1RM0A 2P6RA 3M49A 1I2AA 1XDDA 3Q72A 2QG9A 2DR0A 2WJJA 4BO6A 3OPVA 3ZDDA 4OQNA 5IN4A 2BEKA 1VI6A 2CHUA 2Q28A 1ONPA 1W1IA 4DVJA 1LRLA 3BHIA 1OGJA 3CR7A 1Y6QA 3JQFA 4JP1A 3ZKAA 5BMVA 2H4HA 1PW7A 1A4IA 2QT0A 3PI7A 4LI3X 1QP0A 2IS6A 2OV2A 2TYSB 4UTOA 3V8BA 4BQSA 4C03A 3L41A 1OFTA 4HGRA 5LYYA 5K5EA 2LTAA 4WOCA 3H8JA 3V46A 1H2BA 4L7VA 1U9CA 4DWOA 2F55A 3RDPA 2Y9MB 1S0UA 2XWBF 2W70A 1G8AA 2RGXA 2H9AA 2I87A 2O1WA 3OLWA 3M2PA 4JL8A 4C7MA 4JN6B 5FOSA 1QRSA 4WZAE 5HF9A 2IPXA 1CK4A 1HE1C 1Q11A 1Z0KA 1MVNA 2AN4A 2FVYA 3HCPA 4QPZA 1V4VA 3F6CA 3V8VA 1AJEA 4CTMA 1CQWA 4JI1B 3WDKA 1YA4A 4M8IA 3QFFA 2IYZA 3GFFA 1LLDA 1NXTA 4HGNA 2NU9A 2JGJA 1Z63A 2BH9A 3VRHA 4QDXA 2G1UA 3MJSA 4QOGA 1ZGGA 4UMFA 2F48A 1NQXA 1PKXA 1AOXA 1NVVQ 4JCCA 1RWQA 4YRDA 5FBQB 3V1LA 2YWXA 2H5JA 3DEKA 3IOMA 3UMRA 1XZLA 3F7TA 3CVVA 1JJFA 3ASYA 3GDFA 4X7MA 1QUEA 3RVDA 1SQFA 5J5VA 4YXWA 2MMGA 3KRTA 5AHKA 3D3WA 3D5TA 4ZDJA 2XMDA 1YFLA 3C48A 4CQLA 1CUDA 3PF8A 1OZGA 3A1UA 3IXMA 4UZSA 4WNAB 3L0YA 1W4BA 5D1HA 2I8CA 4NU8X 5IF3A 4B6SA 1CVLA 3IPLA 3JCZA 1II9A 1QAQA 2YJ5A 1YHNA 1RMTA 1RRFA 1KEVA 1TGVA 5JXHA 4EGCB 1ZH4A 2MSEB 3F3KA 4QXOA 4HEJA 3MD9A 4MWDA 3ZE1B 4MRMA 4KZPA 3OIFA 1DIGA 3L9WA 4NE2A 3GLKA 5T7BA 5KO2A 4URHA 3R7WB 4OJNA 3IMFA 3D81A 1FK8A 3D4PA 2GN4A 1TZ2A 5AMXA 2KHZA 2IYVA 2ZJ0A 1NYTA 3UV6A 1SCNE 4MI9A 4E5KA 3PEYA 3LT4A 4OXIA 3BD8A 1N1GA 1R0LA 1W44A 2C5FA 4L1KA 3LWNA 1ADJA 2DFPA 3K1TA 2RB4A 2RK4A 1Q1QA 2B0CA 2YFKA 3LDFA 3OLXA 2WNHA 3OJWA 5EMHA 4C0HA 4JS0A 4UC0A 1P77A 4XX1A 1X0VA 3OSZA 2Y2VA 3TI7A 1KOLA 3HJRA 3ETLA 2ISSD 4R98A 2Q1YA 1EX6A 3QX8A 1K3UB 3BZWA 4M8SA 1CUAA 2HA5A 3JX9A 3CX8A 4TV9A 2Y0EA 4JI8B 1DX9A 4HUQB 1A71A 4MGIR 5FI5A 2IYFA 2YN4A 3AR2A 4LOAA 1IQRA 5DX8A 3OPYI 4FI3F 1TMGE 2PUTA 4PHHA 1PUXA 1IPEA 3FNQA 3IB6A 1G18A 1UXOA 1UM9A 2WHRA 4YRIA 1WMSA 3DGEC 2ONCA 2HMAA 1ZOLA 2ZJAA 3FGPA 1CXZA 3I01A 5GOZA 3V1UA 4GPD1 1MTZA 4KOAA 4ZQCB 4BP1A 4DPKA 2QRGA 3VOBA 3ZHZA 2CZGA 2XVAA 1EIWA 3AV0B 1POXA 3TFQA 3IUQA 3D7NA 4GYYA 5E4YA 2HH9A 2V55B 4IVPA 3NVKI 3AEQA 4OP1A 3Q8MA 3I45A 2E48A 1HL7A 1Y5NA 5EIOA 1E4YA 2RG1A 4C9BA 5F1KA 5LDDC 4GO1A 4L5CA 2HWWA 3FZNA 4MWCA 5KWSA 4P5EA 1IJEA 4D45A 4KLRA 3ZQUA 3A4VA 4FNGA 3CFYA 1DWUA 3GLSA 2A67A 3IP3A 3AUTA 1Y89A 4FONA 3UXMA 4EF4A 1KEKA 4PLCA 1C0IA 3X2EA 1ANKA 1N5RA 1FUIA 3R5HA 4S1TA 1JZQA 1MC4A 1REQB 2B94A 1E9CA 4DRYA 1E98A 2OOSA 4O4IF 3Q8LA 2CNNA 4C20A 1XWIA 4OJTA 4P54A 1HQDA 1Q0PA 2J87A 4LBVA 2BFEA 2ZUVA 1W7AA 1H42A 1UBCA 4FDVA 1H8EA 4EQ6A 2UYHA 2GI4A 1ZH2A 4MQFB 1WNTA 3COJA 1D03A 2HCFA 3AESA 2NSJA 1JMVA 1TO6A 4Y8VA 4CE6A 1HEYA 3AK4A 3NGLA 5EE3A 2VPQA 4Z2AA 2G80A 5AJHA 5JFOA 1SVSA 3CBGA 1Z88A 3TD6A 2ZTVA 4S2EA 1SUWA 4JBXA 1ZUIA 4NF2A 2GD0A 5D5QA 4F0JA 2R1VB 2VWQA 1VHLA 3E9EA 3TD9A 1L1RA 4DA0A 1PGNA 5FTJA 3BWBA 2GHIA 3RYHA 9ABPA 1HQCA 1RJFA 4KXNA 3RGGA 3Q7RA 2W8ZA 3DJYA 3NVMB 4XR9A 2J7PA 4YJ2A 3NGMA 1OOEA 1YI0A 1SRRA 2A88A 3PUYA 4IJ5A 4NU0A 4OJQA 1FRNA 3MS7A 3SJUA 3A32A 1RACA 4EPWA 3ZH2A 3IP1A 1J25A 2FUNB 5HSGA 2BZSA 5CLIA 4Z7JA 1PJZA 3RKRA 4OHCA 3D8UA 1AH2A 2QTVA 3NVDA 2YOHA 1SCIA 2ZSKA 1NW8A 2XZPA 2HRBA 5G1OA 5BVHA 5KYXA 3VHQA 2I9KA 4PO9A 3SE0A 4JP2A 3EYAA 3KNZA 2Q49A 5AKKA 2XRZA 1XN1A 4M8NE 1M6HA 2X0IA 2YXBA 5BWMA 2GM4A 1UBTS 2I80A 1GQSA 4BWYA 4MQEA 4E07A 2GKSA 3WLOA 2BSQA 4NK5A 5KAPA 3FFWA 3SHQA 2RK3A 3DTVB 3GD5A 5CYFA 2EHJA 5FEUA 3L8HA 1AGNA 1UZNA 5TV2A 1K3TA 1CJVC 2P6NA 4EUSA 3FVTA 3R0JA 1LWNA 4J0QA 1TJ5A 3ASZA 3GLTA 1AC5A 2Q4EA 3P52A 1PLJA 4YAFA 1TW2A 3TM4A 2BHTA 3JVVA 4HRVA 1AIPA 1B23P 1CNMA 1D04A 3R4VA 4L9WA 4M22A 1EDZA 4QELA 4RKRA 1UFVA 4WLFA 4XJSA 5HKLA 3VPHA 3JTMA 1JT9A 1H0HA 3QTLA 3QEOA 3SJBA 1RXEA 1ZGJA 3LDHA 3D5QA 3QE4A 4LAFA 3WWYA 1TADA 1GDDA 2MJLA 2PGOA 1UPTA 3GDHA 3DOIA 3BZBA 1FFAA 3LY5A 4EYGA 3QIVA 4PANA 3L8FA 3LLMA 1OLSA 1T1IA 3JQ9A 2VYFA 5KSWB 1M1UA 4PG7A 2X5NA 1HH4A 2IUSA 3ZHXA 3FUCA 1LPSA 1VL8A 4MHSA 4ANFA 1GPKA 3H16A 4JLDA 5A6SB 1ODJA 2QTLA 3FKSD 4KE7A 1T35A 3U0BA 5ILOA 1U3VA 1XZAA 3C8MA 3KVYA 4OEHA 4GP6A 4XCVA 5AJXA 2DULA 3T15A 3OJOA 2QTBA 2W7TA 1TKBA 1Q19A 3IKVA 3G9UA 4RMJA 3H4IA 3WISA 4E5PA 1DDGA 3EDRA 2CXSA 2O4CA 1O87A 2VAVA 2GVNA 2REBA 3FTNA 2C4WA 4CTOA 4GR5A 4E21A 5ULLA 2D8MA 3THXA 4LE2A 1N9ZA 2UUOA 3D7RA 4MUEA 1VYVA 4LDJA 1FA9A 5JZVA 3V4RA 4CV3A 3ZNNA 2V3VA 4M9QA 1JI3A 4QATA 3IPXA 3K31A 5C3UA 4DRXA 3WMGA 3KQKA 3D8BA 3U4IA 1SVLA 4ZOLB 5KHAA 1RXIA 3CRRA 4ROTA 3QYFA 3FTEA 4E03A 3TK1A 4KXWA 1VPWA 5AUNB 3F9IA 1PLLA 3QKUA 1YULA 2AFVA 1OC2A 3ZJVA 4O4HF 3AEKB 4PYRA 5IYZA 5CYOA 3H5OA 3TBFA 4F56A 3LXXA 4NMXB 2WIAA 1JDNA 3E9ZA 4YUYA 2VYCA 3TTSA 4OD0A 1WNFA 1RBYA 4NDAA 4V3CA 4LY6A 1U1FA 2DJ5A 3PD0A 3GZ4A 4MA4A 5FLEX 3N2GB 4CUKA 1XMJA 3GJ5A 5KDLA 1KYWA 1B8UA 4RJKA 1KK0A 4BKQA 3W3AA 2Z8XA 2GD2A 5E8RA 4DMGA 4FBMA 1Y33E 3GFPA 3WGUA 4PG5A 2E18A 1L5WA 1GSHA 3SF8A 1UBKS 2CMFA 3WADA 1N5MA 1NBME 1XK6A 3LY9A 5CH3A 1FF9A 2FE1A 5AI8A 5SY6A 3H6KA 3ZWBA 3TZ6A 5I7OA 2IS4A 1XALA 1SIOA 2VRWA 2AFRA 5IVIA 1NF9A 4LGYA 1FJXA 3TLYA 3PUZA 4LQCA 5E38A 2OV4A 2ZU0C 1JX6A 2HWYA 4I1VA 4L0DA 1PQ4A 5EWJB 4JKYA 4TV8A 1LDBA 4WY2A 5ESRA 1RWWA 1XQ9A 2XTZA 2C2ZA 4AN1A 2AR9A 3ESYA 4HNSA 2GN6A 3L1KA 4X61A 3VKWA 1MAVA 1N8NA 1N6RA 1OFUX 2BJVA 1B0ZA 3DV0B 3MPOA 4K87A 2GESA 3HCWA 4U5XA 1PSZA 1RQNA 1ZK3A 2F3TA 2XSZA 2A5FA 4Z4CA 3LF1A 1YS2X 4TKZA 1Z3CA 3Q40A 3C41J 3STYA 3L0BA 2PXAA 1I3CA 1QKKA 2ZE5A 4OHMA 3RM3A 4CIAA 1X1EA 2JBHA 1Z3IX 5A5DA 4QBFA 5JXIA 5J43A 3LM8A 3QW2A 1SIUA 5JTTA 3UMBA 3CEJA 1XTTA 1EJ0A 2O2XA 2VJDA 1J4AA 3DEHA 2C84A 1G3IA 1Z5VA 1T6XA 1ZVJA 1RZUA 1VSUA 1X8KA 2AT1A 3NV7A 4H77A 4EUEA 2D1QA 2XD4A 2GCOB 4D57A 1DIAA 4O5OA 2OZKA 3FHJA 4TKUA 1C2TA 5KX5F 4F1JA 4O8CA 4OI1A 2Y0DA 5HNKA 2Y05A 2FKAA 2HXSA 1T3GA 2AX3A 2ZTHA 2A57A 4IEEA 4TWJA 2DTEA 3ZZTA 2UZ0A 2IT1A 1UPBA 4FJ0A 3GFGA 4CN8A 2C94A 1IZ8A 5CFOA 1QP4A 1YJ5A 1NJGA 2RGCA 3BGSA 3PA8A 4GNRA 5IDYA 1VYUA 5CRIA 4UOEA 5A0VA 2EBHX 3PFGA 3NTVA 4CR8A 3IKLA 4MWEA 4FFSA 4H4DA 5BSEA 1OB5A 5AVVA 2GRAA 2CL6X 3T5CA 2C54A 3GUUA 1Q7BA 1RFGE 1SC6A 1SAYA 3OZGA 1KSFX 4CKWA 4HWOA 4WOKA 4ZYXA 4KNWA 1KP2A 3PTAA 2OCGA 1MOPA 4MYUA 2RH8A 2ZBRA 4HZUA 1F48A 1HLFA 4RCYA 5C8XA 3SZGA 1WXEA 4MV6A 3ROEA 1OWMA 3B3FA 3TW0A 4CG0A 3L0PA 3OZIA 4G41A 2XUAA 2R66A 2NVBA 1JSCA 4EGAA 2FPUA 1JR3E 3RJTA 1FNBA 5AW1A 4P4SB 3TR0A 4JA0A 3HVKA 2VDWA 4LSWA 1MFPA 3D59A 3W2EA 1LK0A 3MFQA 4Z1MD 1MP0A 3G7SA 4LE1A 1BS1A 2PMBA 2JVIA 2R5WA 2R8RA 4MYCA 3ZD8A 2O3SA 4MUXA 1DCFA 1WKCA 3CLTC 1YJAA 3D02A 4H2DA 1WUYA 2H1RA 2QD2A 3KJEA 1NLZA 1U2TA 2ZULA 3KSUA 2CLMB 4KHZA 3BXFA 3DTNA 5BR8B 3OA0A 5A7GA 1Z15A 3ITEA 1ID8A 1PR9A 4ZQEA 2XMQA 2V65A 4GQAA 1OBOA 3MAGA 3VMFA 1M72A 2GDJA 3KWMA 1NPDA 3ZVLA 4TVKA 4RZXA 1RHRA 2ZSDA 4RVFA 4EP1A 4ZZ1A 3I5YA 4MAMA 1L1EA 3WLFA 4BNUA 1GNTA 2O50A 5KVCA 3ND7A 3QM1A 2DG2A 4ZVNA 4U0KA 3PUKA 4BMXA 5I8WA 1B0UA 1PK7A 5FKJA 3JVUA 3S5UA 2B8EA 4BTVA 1M2NA 1KPIA 5EJ5A 4CQMD 4ZCSA 5EIBC 1KIAA 5F73A 1IWOA 5JPCA 4NABA 1GYRA 1KRXA 2BHRA 4LDZA 3EFOB 3WLJA 1KVSA 1RBQA 1X1SA 2BBWA 1Q7RA 3MG9A 4OKSA 4G89A 4DBLE 2H1FA 3BS4A 1IY8A 1I7NA 4MLPA 4WZAB 4LCEA 2O20A 4ZCRA 1XPJA 4XTRA 1GSIA 3I12A 5HS6A 1OHHD 5EYPB 4H31A 1J0EA 3L3BA 3KG2A 1OTHA 5EXPA 4CCWA 4DIEA 4BXOB 3LBFA 1TVMA 4LN1A 1ZSNA 3EEQA 4XD2A 1T4DA 4BFLA 3NAGA 4V0LA 4C7OA 4DARA 2E9SA 3JYQA 2Z8YA 1G4AE 3UQYS 1AUVA 4Q37A 1WQ3A 4MROA 2P8JA 4IHKA 1YZUA 3FF1A 1ZUWA 4ZYVA 3T7DA 3W8NA 4MV5A 5CFPA 3W06A 3PJRA 1NPYA 2YN0A 1NMZA 5FB3A 4ZI7B 4KR7A 2I76A 4TS1A 3EGOA 2FZLA 2W5UA 4WWHA 4C4OA 5HK9A 3UJDA 1U4OA 3WE7A 1YZLA 4B6JA 3B2EA 5F2NA 4TYWA 1VLMA 3B1ZA 3JQRA 4INJA 2QUZA 4Q7EA 4TM7A 4XYMA 3TE6A 2B20A 4BQFA 1YRBA 2HHJA 5ES3A 3L4SO 2OWEA 1FFEA 2B35A 2C9OA 1NRJB 1V3UA 4FDLA 3MGBA 4LYYA 2C31A 1R6DA 3PDCA 3L7LA 3SYLA 2TECE 4TTVA 4ZOEA 2JZOA 1ECCA 1JU4A 1N7HA 1RJ9A 1RYDA 2DZDA 2QN2A 3B3AA 2RB5A 3GU3A 4INZA 2VOEA 4TOIA 2RBKA 4MGHA 1U3UA 5JVDA 2WFMA 4CKYA 2APJA 4YLEA 4MIOA 4QXQA 1T3LA 1RZVA 2DHQA 1TU4A 2GJKA 2EERA 1W2WB 2ZPTX 3AR4A 1SUDA 1ZD2P 3LHIA 3T94A 4IDEA 1SBTA 3V1YA 5CA1B 1FBNA 4XQGA 4YJ3F 2GJAA 2PV7A 3DCJA 4G5YA 1S2LA 5C8YB 3UUWA 3KFLA 4DCMA 4U7JA 1EGQA 3II6X 3SOPA 4U9UA 4FGZA 1GUAA 3U7FB 4E15A 2XZOA 4J16C 1D4AA 4BKMA 1WY5A 3HFJA 3OOYA 2QD4A 2VTBB 2WYUA 3DQZA 1QFMA 2WHEA 2R44A 5KYKA 4YHBA 2XBLA 4TTIA 2VCYA 5FTWA 3DKIA 1WHSA 4IDFA 3T1NA 1U8UA 1JF8A 1CP2A 5D8DA 4LF7B 1EFVB 2G71A 1NUUA 2VJNA 1E96A 1VRWA 1IZ9A 1KQOA 2VJPA 1TC2A 1OW3B 2DBYA 3BWYA 3FYDA 3IP6A 4IIJB 4OHKA 4TMKA 3SDSA 2PHZA 4MJLA 3U7EB 4DLLA 2F64A 1IN8A 1XD2B 1CY0A 3E82A 3EWIA 2ST1A 4URYR 2OCBA 2XYQA 1NZFA 1RC0A 4QUDA 4HH1A 3U4AA 1VCIA 2XE8A 4CDNA 2ZYAA 4I7EA 4N41A 1Z62A 3SXJA 2XODA 1LVGA 3M6FA 4YAUA 2OFPA 4MQ5A 3HA2A 1CFZA 1EXVA 1WDMA 3R44A 4TTJA 4MS1B 3CUUA 3H1PA 1G64A 1HMYA 1S89A 1W76A 3A9SA 4XARA 4CKZA 5KMGB 1QQAA 2I2XB 3E8XA 2V6JA 4F4FA 5GTDA 1CY8A 3NKFA 5FBKA 3UAXA 1AMUA 4QDKA 4EYEA 4KITB 2HFKA 2M6RA 4HQNA 2V6FA 3O2SB 4N3NA 4W9NA 4GWGA 1ORHA 1CEXA 2VAPA 4MS4A 2Q7DA 4MARA 5I9SA 3HBMA 1RFLA 1VBMA 4N9QA 4DV7B 1KDOA 3IBFA 4PNEA 4DYHA 2WT8A 1XBTA 2I67A 3V4LA 3R3JA 3B1JA 2VRBA 3PPYA 4D7AA 1C7EA 1OSNA 3M7IA 4NP6A 5AYVA 3T9EA 3GIWA 4GLFA 1U94A 3C8HA 5IKOA 3OM0A 1TK9A 4AY3A 2XMBA 4FYIA 2XBMA 3E9RA 2XQVA 4URFA 1QGOA 2EX4A 2G7MC 4RWEA 1V16B 2OO3A 4PX9A 1ZLXA 3KJNA 4DLBA 2QIPA 4EG8A 1V47A 5E8JA 4E4TA 2RI1A 4KPFC 4FGSA 4X7BA 1CHNA 3DVQX 5LP6F 4HADA 3WMWA 5LNK1 3FYUC 3QLVC 2B2CA 2Z2IA 3HUUA 1K0UA 3CZPA 3PJGA 1ND6A 4CZ2A 2C5LA 3L1HA 3ZU5A 5CLQA 1IBMB 3I28A 2B7LA 3EAGA 2CKMA 1OLUB 3BDAA 4QAJA 2PKYX 1L4FA 1V4NA 2YYSA 3KVOA 4RVUA 1T8SA 4RGVA 1RYNA 1TQ2A 1ULUA 3A9RA 4LGVA 2AQHA 1D2CA 5A3VA 1H1LB 5K3DA 5H3HA 1V45E 3EIUA 4ZKEA 1VPTA 4MZDA 4YTEA 1AHIA 4NS1A 2VHYA 5BNZA 2FK7A 4QJ5A 3ISTA 5CW2A 3THYB 7ADHA 5DFAA 1U0NA 2FW8A 2Q3BA 2DECA 3ECAA 4RTPA 3BGWA 4E5VA 3A8TA 3JQBC 4WKNA 4WEQA 3TQIA 2AN1A 3GCXA 2OZEA 2P41A 1ZH0A 2ROQA 1JLHA 2J9FB 2J48A 3G23A 3OZFA 4M0CA 2J3LA 3WL4A 1XWFA 4NFSA 3MT8A 2J85A 4PQFA 2J3MA 5E4JA 1KDRA 3MFYA 3ZVKA 3THWB 2Q5FA 2V1XA 4JASB 4EMSA 3LTNC 2P2GA 4QA9A 4IJVA 4U7HA 4F46A 1OXXK 4MVJF 4UM7A 3RI3A 4BUJA 1FFHA 5FBWB 3TCKA 3R9XB 4L28A 1GAJA 4TL7A 3VBCA 1QC5B 3GV0A 1CQJA 3KYDA 4U6NA 3REFA 1GGNA 4K46A 3RFVA 2PM8A 4P8RA 4B34A 2OESA 3I8SA 1RLIA 4MV8A 4Q02A 4RFSB 4DLSA 3I09A 3BA6A 4NSNA 1WOMA 1RKBA 1CYDA 5FOWA 4O1MA 3T4XA 3VC1A 3H3XA 2QK4A 4C21A 3CS3A 1E9RA 1P44A 4G56A 4YJDA 5AI4A 5KQMA 3RAEC 2VP5A 4MYSA 4RWZA 1V6AA 4LJRA 3VR2A 3IX7A 3WK9A 4Q00A 2HJRA 2QW1A 1TQ4A 1FNNA 2PYDA 1DO0A 2CJWB 1IAQA 1UL1X 1Y37A 2P1DA 3LFUA 5C80A 4HAZA 3T9AA 3TLGA 2QN7A 3BULA 5ICEA 4IOKA 1F5SA 1MMFB 1QYVA 1Z5PA 3NAZA 2FX3A 1SBNE 3HI6A 1ZUHA 3U19A 4MUNA 3T7SA 3FPLA 4YYZA 2R8ZA 1HX7A 4QJ4A 4U9IS 1AQYA 1H93A 1YR8A 3FZEA 5H59A 3W04A 4WNIA 5J4HA 5TEVA 3KC2A 2NYUA 1TVCA 1RMQA 4I4IA 4ZHQB 4C87A 4L16A 1SXPA 4D25A 2N1BA 3CSUA 4U2BA 2H8GA 4FPXA 4C0SA 4X1YB 2OUIA 2DPYA 3QUAA 2DPXA 2QAJA 5EXSA 5CBKA 1KAOA 1E60A 3VNRA 3RUIA 4YRMA 1NIPA 3JS5A 2Z5VA 3L01A 3HUDA 1FU7A 5J59A 3GPDG 5JJLA 3S99A 3PKJA 2HO4A 2JARA 2YJZA 2QRUA 5A5FA 1EG2A 4DBLC 2E2WA 1XZMA 4OKNA 4Q39A 5AVXA 4LWZA 2ID4A 2WD7B 2BJWA 2ZTMA 3R7SA 1BDHA 3TEMA 5AM1A 4OMCA 3CURA 1A7UA 5J1SB 3AG5A 3S4YA 2GK3A 3F97A 3TMKA 2J0UA 4Q7MB 4CV1A 4DHEA 3Q7TA 5ISMA 1XZCA 4JODA 3TPCA 3A2MA 2O0MA 3BEOA 3C24A 4BE9A 2JBAA 2AVNA 4I08A 4W1QA 3DOHA 1RLTA 4RKWA 3CNHA 2QX8A 2ZDHA 3NFRA 1ZOOA 3PK0A 3UWPA 2VIIA 4JQSA 5BWOA 1IY9A 3TPZA 1W46A 5H4HA 3B6KA 1QRAA 2Q2WA 1ZBDA 4KQKA 2X7HA 1UDAA 5HKKA 4TM8A 5LIRA 2ZCVA 2QD3A 2ZSFA 3QOWA 4Y2QA 4BX8A 2ZLBA 1U63A 1IN7A 2CVOA 3EAQA 3OFSA 4PC2A 1WTAA 3RUFA 3ZWMA 3KUCA 4B7XA 2WJYA 4P4LA 5A04A 3IKMB 2ZFUA 3M1AA 1IBRA 4MV1A 1ECPA 3L0OA 1KNQA 3TLXA 2P90A 3TXYA 2G72A 3W4KA 5DNUA 1M2EA 4RPGA 3LQYA 1NDQA 1WVMA 2ODPA 3KHSA 4OHPA 3T7AA 4EG1A 3UXHA 5T6MA 4YMTA 4A15A 4ZEOA 3FLMA 2GCPA 2UV8A 1NRWA 1I4EB 2VVTA 4JLJA 3G9XA 4L3OA 4JQOA 3RSCA 1EP3B 3VTZA 4HMOA 5B64A 1ZK1A 5CVDA 1YGYA 2FRDC 1SU4A 1C3JA 2PS9A 2YHSA 1MJGM 3H18A 4YQYA 3DAGA 3RYIB 4HNAB 4FINA 3ZIAD 2I6QA 4A1FA 2XXAB 3BWMA 3NM6B 1ESEA 1QAMA 2EQBA 3IP7A 4EI2A 2X76A 5TX7A 2NSHA 2C8LA 4J0KA 1JFTA 1C1YA 1LW7A 3PZBA 1XB2A 1XP5A 3BRWD 2BZ0A 3OH8A 5CNMA 2WWIA 2CFOA 4CNQA 2P0YA 2QUAA 4EBFA 1YI8A 4Y6QA 1ARZA 2ZPUA 2I3BA 3IMCA 3FFTA 3MJTA 4X94A 4N47A 1Z6PA 4UZEA 2IHZA 3CX3A 1J23A 2PN1A 1KNXA 3ZZ0A 3CF0A 3MTQA 3DFMA 1SKMA 3W2FA 3TOVA 5FPSA 4LF9B 4D2IA 3K1AB 1U0BB 2WFLA 2GD1O 1HZZA 1SIWA 2HQRA 2WTMA 3EXFB 4L4YA 1JHUA 1Z12A 1UOEA 1GGVA 1JKMA 3FYUB 1Z0IA 3A1FA 4YWJA 1X9IA 2FDXA 4CFSA 2J9YB 2O2YA 1AB5A 3LVQE 4Q1VA 4RFVA 2VYNA 4YRAA 3CKKA 5K05A 2VPPA 2OB1A 2JJ1A 2WF9A 3WRYA 4NCHA 2NM0A 3VJMA 2BM9A 2CNBA 5ICFA 1P9RA 3QF7A 2J5KA 4MJ3A 1GN8A 4X9XA 1SA0A 4EY5A 1MRNA 2VWPA 1GUYA 2A8YA 1HDZA 2DHCA 3IT3A 1BW9B 5EESA 3TKYA 3H97A 1CUWA 5I3ZA 3PPVA 4PPNA 3CIOA 4YP6A 1P6QA 3T35A 2CSXA 3LHDA 4N01A 4QNRA 4D4JA 2HPAA 4JFRA 5CIYA 4DE5A 5JAZA 1ZESA 2EWVA 3NIGB 4NEGA 4DJJA 1AQNA 1DC3A 3SIPA 5BORA 5K99A 1SURA 4DOMA 4HD8A 3KHKA 3HJCA 3JQAB 1QDUA 4FTWA 4TT3D 3X2SA 4EFKA 2QN9A 1LI5A 3KX2A 5F2KA 3WYBA 4CKEB 3ETNA 4EA6A 1DHRA 4ETMA 1GZ3A 5DKFA 4FEGA 1JEQA 1W19A 1A2KC 1VCHA 2PMDA 3AFNA 2ZTUA 4RF5A 1R10A 4GX5A 4CDMA 2BGWA 1YF3A 2IVZA 1A72A 1W0JD 3LO5A 2BPOA 4BMZA 4UEJA 3H9UA 3OZUA 3CH4B 1BOFA 5DSZA 2C4NA 1NYQA 2PRZA 2Z09A 1PS0A 1KAHA 4I5FA 3MOSA 1GUDA 1A9PA 2AC2A 2L19A 3BHJA 4ARZA 5MFZA 4DCJA 1JH8A 3PWZA 3UUEA 2P11A 4BZXA 4CU5A 3HGMA 2ZR7A 3IIIA 4O6VA 3IGFA 1GTL1 3KB6A 4H3SA 5B1IA 4DRZA 4BLUA 2R6FA 4UJ5A 5JSZA 2A5DA 5I7WA 2X1LA 3BIJA 3UJAA 3E0XA 3RVLA 3EZLA 4IOLA 5TGZA 4YRGA 4IWXA 4RTOA 3WZ2A 2FFJA 1O6ZA 3GAFA 4V2UA 5FL7A 2Y77A 2VQ6A 4AXXA 3OQMA 1Y4DE 3KDSE 5G1NA 1M10A 1NG9A 1B73A 1QLWA 3MWFA 1FFBA 2GUWA 4BUCA 1Q7TA 2HMSA 2IYUA 1QGED 1ZCFA 2C2YA 5DN9A 1BSVA 2NXWA 3UWOA 2GASA 4XLLA 3QWFA 3RVBA 3JVEA 3WDSA 4BLSA 2AC4A 5JATA 2BM0A 1EEHA 1MIOA 3ZZUA 1W85B 2PWAA 2CLSA 5CFMA 2TMYA 2GYVA 5AJZA 5DI3B 1EDDA 1YZTA 4RD4A 1QH1B 2LIVA 1AUXA 1VG9B 4HAWA 4MKHA 3DW3X 5KOIA 3AFGA 3WC4A 4L76A 3HR8A 4REQB 4PWYA 3D0KA 4ER0A 3KWLA 1HTWA 1PJRA 2FFRA 2FPSA 4LTNA 5EXTA 5FYQA 1EFRA 3OHMA 5TQ2B 1DFHA 2PANA 2YDXA 4KAFA 1BU5A 5LD2C 2W6ZA 3D4IA 4N0DA 3ES9A 1PAUA 1FP1D 4I8IA 1QF6A 4OBXA 1VL2A 1ZM7A 2QLNA 1QZUA 2YINC 4JY7A 4LDAA 4LSZA 5ER9A 1SKAA 3DZFA 1CUSA 1W49A 4ZVMA 5TXGA 3ZQJA 1PJ2A 3KLMX 3QI2A 4AYWA 2Q3JA 3FUTA 2Q29A 4XYGA 3UFBA 1HYHA 1PVOA 2R11A 2J6CA 3V2UA 2QNIA 1DINA 1L6IA 1NF2A 2PKEA 3RU2A 3ZGLA 4PYJA 5CK5A 3CLRD 3FWYA 2EYUA 1GAQA 2Q0HA 4HK4A 4PLGA 3ZXYA 2QNRA 1BO6A 3T3GA 1T5IA 5LC1A 4AF8A 5KTRA 3LC2O 3WQQA 2ZB3A 3Q9NA 3LA6A 4UM8B 5B12A 3JR3A 3ZD7A 3GG9A 2AX4A 4LY3A 5M7EA 4TSRA 3C1OA 3CKMA 3ZUGA 3TGPA 3WZLA 1NNSA 4BP3A 1FPQA 4MGKR 3WIUA 3AY3A 4WLEA 4C6HA 1U8XX 2Y1EA 1JMYA 3HE3A 2PBRA 4OHOA 4IXMA 2ZKLA 3S8YA 3ORFA 4Z7NB 1GQ2A 2F3UA 3O0TA 5C32A 1Y6JA 3PGMA 3GP8A 1M1XB 4GWKA 1FLDA 2JLSA 3EDQA 4WCFC 1KRWA 3A1SA 3OAAA 4UNQA 5LOVB 4JSTA 1B2RA 4F4UA 3Q7QA 4A2QA 4ID3A 4EYOA 4KLAA 3EXEA 1IRXA 1EXWA 1Z6YA 1PN3A 3RTGA 2P7HA 4P3XA 4ZAZA 4KKXB 3OMLA 4L8GA 3AUYA 5AM0A 5TE9A 4DPLA 4EFNA 1WDLA 3K0AB 4JLKA 2CV1A 3AVXA 4OUDB 1FFYA 4PHTA 3KWFA 4J90A 1R5NA 3LOPA 3EVBA 4PHCA 3ND8A 1L1FA 3HXLA 4LHVA 3IAAA 4F3CA 4V39A 4HO1X 1MOSA 4DGQA 2YJTD 4HVCA 3BE8A 1MDBA 3K0KA 2A92A 3GLGA 1V7QA 5CXXA 3A9UA 4G07A 4EW1A 1TZBA 3WGHA 1ZZEA 5IMBA 5FTKA 2JD0A 2NU8B 3IOBA 3OHSX 3ESZA 3A9CA 2RAFA 5EFZA 2XX3A 4L07A 5H3LA 1WXGA 2QQ5A 1ZONA 3MERA 1GG5A 1HO3A 1WJGA 2IKQA 2X13A 3CF4G 3K9QO 2AV6A 3RUDA 2CE7A 2VSNA 4OQQA 4YV1A 2JI7A 1J09A 2Y92A 4RZQA 4AWAA 3DYIA 2Z1DA 1KXJA 3ZHRA 5MGBA 5KYTA 3ND5A 3SSMA 2XDYA 2PTGA 3FNRA 3BOSA 4MQLA 1XMIA 2ZSBA 4KRFA 1HNWB 3A4IA 1TEVA 3LBNA 4J4BA 3UWDA 1YZ3A 3G0GA 3UKDA 3TDNA 1NIJA 3ND6A 3DHNA 4YMWA 5J58A 5PNTA 4ARVA 3AEUA 3HJUA 5DWQA 2YWDA 4KDFA 3MWGA 1T9GR 2EZTA 3VO8A 1G3QA 4DCOA 1DZIA 3T7RA 2JLXA 3WB9A 1M2VA 3HFRA 4P1ZA 3NATA 4YN3A 5BURA 2FHSA 3IMGA 1SVMA 3KUUA 2DC1A 3VFDA 4B09A 1IBLB 3T5DA 1QV7A 3C3MA 3LG2A 3ZKWB 4WBNA 3F2VA 1JTVA 3NBQA 5DRTA 5K8LA 1F4PA 3TRIA 2I6FA 3GELA 1K5DA 4B6EA 4QOEA 4ESHA 1DEAA 1TQ6A 1W5SA 2D74A 1L3IA 1T0JB 2C5SA 1V8PA 5ALFA 4ER6A 5IVDA 3UW3A 4II7A 3AZPA 1F17A 1H3FA 4IO0A 1AK1A 1UPFA 4O3FA 4YLGA 1J1IA 1UQRA 3OTOB 5EQFA 1U4SA 3GRRA 1FW8A 3KXDA 2PSSA 1LLCA 3PXEA 4HDKA 3EZFA 2CYAA 1JXQA 3CT4A 3EODA 2PO5A 3IAM6 3TB6A 3D6AA 2BZ1A 5ESDA 3U4DA 4HQKA 1EFKA 5JD3A 1XRMA 1FBTA 3KKPA 3IVGA 3PHJA 2KMLA 2XNDD 4KYVA 3GBSA 2ZRDA 3U3XA 1RI1A 2CHGA 2Q62A 4YRSA 3FBWA 4G86A 4M7WA 1E1DA 1WPXA 4YPOA 1BRTA 1FNSA 1GLNA 1X38A 1U0SY 3B9QA 2CMGA 4EATA 1UWLA 3FCOA 4ENWA 2JNWA 2P9FA 5D3MB 5B6JA 1E3EA 1KYYA 3Q5EA 3ZBPA 2FYTA 4S05A 2J5XA 1U31A 3VH4A 3D1JA 2WHQA 3IAM1 4Y2UA 1G66A 2ZBEA 3MWKA 1ZPDA 2CD9A 1PJQA 3EGXB 1WLSA 2O48X 4NJOA 5EI5A 4IVRA 5LN1A 2A84A 3R0XA 4RH3A 3IIKA 3KTAB 1KKUA 2LIPA 4ZPXA 3FJ1A 4N39A 3H5IA 3HVJA 2JI9A 1NNUA 3H0EA 3LQ2A 2V5AA 3GUZA 4I55A 1D1SA 3DG9A 1KO8A 2XT6A 4TUYA 2PKQO 2YWGA 2ORVA 4ZOLF 2F17A 5T6BA 1ML3A 4Y6PA 4UUNA 1L5YA 2PH5A 1R6AA 1X7YA 2QJWA 1DHTA 3UCFA 3OETA 5DBHX 1C41A 1ZI9A 2CVQA 3CW9A 5AUPB 4MCAA 1C8KA 3WI7A 1FUUA 1PCXA 2ZAIA 4BTEA 4X1KA 5LD2B 2HFJA 4BMDA 5A06A 3E3NA 2AOTA 4KQ2A 4LMPA 2ZQ5A 4TYMA 1CUZA 1QONA 1RXUA 3MOGA 4K88A 1OIWA 1TXGA 1Z2CA 3CUEF 3QJGA 4MLDA 1A8IA 1JGTA 4ALKA 5GWXA 2AMJA 2ATIA 2DUNA 1XOIA 2TSYB 3DO8A 3I72A 4FFOA 3TEJA 3EEYA 1G6Q1 3ZHBA 4B31A 2W22A 4M54A 2AJBA 2RD2A 4NG4A 3O4VA 4F2PA 1QQTA 2VF8A 4URWR 3LCVB 4P9NA 2GETA 4UNSA 4WDQA 3RC2A 4G0QA 1QE3A 1HE8B 2NO9A 5JFTA 4MAAA 2BBOA 3N0RA 2D7DA 1XU7A 1CLUA 1JG4A 3DF9A 5K01A 2EFYA 3PRYA 4LNHA 1RI4A 1DFGA 4PAQA 5HM6A 4JJ4A 2IHJA 3OZAA 1A9TA 1Z2NX 3L1UA 4MOWA 2PKQP 1PBTA 1WZCA 2PL5A 2B83A 2ZIUB 3HCNA 3P5SA 3IODA 3G2LA 1A9XB 4IGIA 1YNOA 3C6QA 4XSHA 1UBHS 1FRZA 4WY5A 5FBLB 4BNKA 4D9BA 1JKJA 3Q12A 1ZVQA 1Y9EA 2B3TA 3LRPA 3T0FA 2BFBB 2BEWA 3EIQA 1IUKA 1QYDA 2XOKA 2OHJA 3IESA 3QU2A 4R3WA 1E0JA 3X1KA 3OC6A 1MB3A 4CG3A 3ZXIA 1NW7A 4TPKA 4LFBB 4IDPA 1S2MA 3SX2A 3NNDA 1O96A 1KQFA 4MR8B 4NCNA 1EP1B 3CLVA 3A1TA 3L7YA 5IG2A 4LV6A 4W6ZA 1OLXA 4WCFB 1I94B 1T1EA 2B78A 3ELYA 3I4FA 1YJXA 2PWPA 2GWHA 4JJAA 3TX6A 4BVAA 4ZEMA 3ZR4B 2XXJA 1MW8X 3EGEA 3IVCA 3GG2A 4TZTA 1JFSA 2FFAA 1UC5B 2ACEA 4ZCPA 2R7NA 2A5LA 4LZLA 4BQPA 4ZMRA 2H1VA 2W6CX 3VISA 3I6ZA 3T3EA 2Q0SA 3AVUA 2F59A 3HEMA 4FP9A 1ZKMA 1E9EA 3GF4A 3PPWA 4GBMA 5CBPB 4H18A 1GDTA 2OXEA 4JJ7A 1W5AA 2VJKA 1I1NA 1YQ9A 2JGEA 2YIMA 3LW7A 5A3RA 5HX7A 1Q0SA 4OA5A 1D4OA 2YFHA 3MMZA 5L7YA 1I1HA 4CL2A 2WUGA 4ZV4A 2JLAA 1N57A 3DBLB 3FNIA 4F45A 2YYZA 3D6JA 3UHPA 3RUCA 3DWGA 1C9MA 2Y1OA 4Q9JA 2XNKA 5TQJA 2ZIFA 3O93A 4FGKA 4YMIA 5IXYA 1OI2A 1YKSA 5EGNA 1AX9A 5IT9A 3JXEA 2C98A 3VR3A 3FVQA 4RQBA 1RI3A 4OLFA 1JS1X 3ZWKA 2IYQA 4DQXA 2JS7A 1Z75A 4JLPA 1OWOA 4G0WA 1AHNA 4L50A 1W87A 1X39A 5DULA 2QSZA 1GR1A 1T25A 1USKA 5DW3A 4NXMB 2P7IA 4URXR 3OQBA 3CLSD 2QTVB 4GBJA 1DKPA 4WFIA 2GZMA 1I13A 1KJZA 4CLOA 2ZJBA 3SC2A 4UU0A 2IWRA 1M67A 5B1HA 2X41A 4ZYWA 4F7WA 1ECBA 3O38A 4FYPA 4G8CA 1DXYA 4MQEB 1CQIB 5CNJA 2H54A 3U81A 1KOJA 1UF9A 3MJVA 4H0NA 4QQFA 3WRWA 5LQDA 1VYTA 1RZRA 2AK3A 2CVHA 1YVRA 2H0RA 2O8NA 3U3DA 1DBWA 5EXXA 4BFVA 2D7CA 2BH2A 4JMLA 4C6SA 2ZM6B 3BGDA 3LBAA 5LWQA 3LAWA 2JIQA 3N5CA 3UN1A 3A6GA 1EHCA 2ZWOA 3KAPA 2BRUC 3QA3E 3T8YA 4DA6A 2IDMA 4PXSA 1Z0AA 2LVBA 3ZGYA 2BFDB 3D8RA 1TCVA 1UZAA 3UBMA 1C1DA 4S2UA 4IMJB 4RLFA 3K9NA 1DTWB 1UDWA 2O5VA 5A4AA 4RD2A 4IZOA 4KFUA 2F8LA 1G59A 3TE7A 3L0IB 3C3YA 2J3IA 5H83A 2D8AA 2OORA 3DVRX 3ETGA 1OJLA 5E3HA 4HWGA 3L6RA 4YUVA 3TWOA 2QP3A 3WBKA 4FQ7A 4A5SA 3VR5A 1VCNA 1SC3A 3AL3A 3I9OA 5JCOC 4JI0B 3NDIA 2EQAA 3U1TA 4AMVA 4Z0PA 3LFTA 1OLSB 3JQ6A 3K0CC 3OJLA 5H16A 2VK2A 5HGJA 2QN8A 3TQTA 5B2FA 1RXSA 4V1CI 6ABPA 1QH8A 3O8RA 4I1PA 4LZZA 3CRW1 3OOWA 5BWLA 4KFTA 1UCFA 4C2BA 4GI3A 3SX4A 5IWAB 1OI7A 2QGNA 4F1KA 1KMMA 4G9EA 4RSHA 3CVOA 3H65A 3PDHA 4UE2A 4PZ9A 7REQA 4KO2S 1IK6A 2FN7A 3SKXA 1QYRA 1UP7A 4TVSA 3WA7A 1PT6A 4RK6A 3H2ZA 4YX9A 2NT3A 4A9AA 3D4NA 4E5YA 5CDUA 5EWMA 1M6YA 2O5RA 1KZ7B 2QOEA 3ETDA 1C9KA 4L2IA 1MKYA 3A06A 2QBYA 4BATA 1QCCA 3BMNA 1QO0A 2FMHA 5CDHA 1RC8A 3IDOA 1FFWA 1R88A 5CA0A 2YMMA 4I50A 4PR3A 4X24A 5FHQA 4JDUA 2EARA 4GMFA 1CJUC 2JIBA 4U02A 1KAQA 4WOPA 3U3JA 3GJ8A 2KX7A 3HADA 5AKIA 3FUWA 3OEED 4ZFNA 3C8DA 4P08A 1NVTA 2HX1A 2PRJA 3ANSA 4QHYA 1HETA 1YUBA 3DL7A 4ZTUB 1F6BA 1U8FO 3Q3EA 1SUAA 3RHZA 4ILKA 1TLLA 4GS5A 1CTQA 1XVVA 5H68A 3DE3X 2PLRA 3GROA 1UEIA 4R84A 4EKYA 3CVWA 1NVKA 1QRTA 1HTBA 2FLKA 2NX2A 2ERYA 4KH1A 2J07A 1NUTA 1TYCA 1V2GA 2CV0A 1R5OA 1GL6A 5ADHA 4KRXA 2GB4A 3VO2A