5KVAA

Crystal structure of sorghum caffeoyl-coa o-methyltransferase (ccoaomt)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
227
structure length
227
Chain Sequence
KSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHDRLLKLVKLGGLIGYDNTLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords caffeoyl-CoA O-methyltransferase
publication title The Structure and Catalytic Mechanism of Sorghum bicolor Caffeoyl-CoA O-Methyltransferase.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
total genus 88
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5kvaA00
2P40A 3ELDA 3UJ6A 3DP7A 4PYJA 1EJ6A 3P9IA 4V0RA 2ZIFA 4CTJA 4RVHA 1FJXA 4EKGA 3R6TA 3FRHA 3SSMA 2Z6QA 1RJGA 1VLMA 3NDJA 4QVKA 3KU1A 5E1MA 4E31A 1JG3A 4YUWA 2CMGA 5DT2A 2IIPA 2V74B 5CVDA 5HILA 5FCDA 1UFKA 2ZW9A 5T6BA 4U7TB 1UIRA 2Z6UA 4HTFA 5DX8A 2AN5A 2XYQA 3AXTA 3GGDA 3GRRA 2UYHA 4ZTBA 2ZFUA 3DTNA 3HVIA 3V8VA 1F38A 3KHKA 2ONYA 4QDKA 3NDIA 5DTMA 2P1DA 5E9QA 2JJQA 5CM2Z 5HEKA 4PNEA 2H11A 3BWMA 4CXMA 3EVAA 2DULA 2E5WA 2NP7A 3UZUA 3PS9A 4BLVA 1VP3A 2AOWA 2P8JA 3IV6A 2ZULA 1X19A 3B5IA 4FT2A 2R6ZA 4KVZA 2ZWVA 3HTXA 4ER7A 2FCAA 2GB4A 5JUWA 4PGGA 1JTFA 3TOSA 1ZQ9A 2ZCJA 4PWYA 5DRTA 3BGVA 3DLCA 3MCTA 5KVAA 3LECA 3OE4A 3KPUA 5FTWA 2FHPA 1JTEA 4IWNA 5GINE 5GIPE 4FT4A 1WZNA 2EJUA 3FZGA 3P2EA 1R8YA 3I9FA 4F85A 3FPGA 3UJ9A 3NVKI 1YFJA 2FK8A 4R8RA 4YMHA 3P97A 2A14A 5F2NA 4CWAA 5D1NA 3B7PA 3AJDA 4PCAA 1EQAA 3PFHA 2VS1A 3UJ7A 3PFGA 3UJDA 3ID6C 3FUUA 5EG5A 2PX5A 1JSZA 1KYZA 1VPTA 1RI5A 2AVNA 3LX6A 5HFJA 4ER6A 2PWYA 3LDGA 1WY7A 3G5TA 3I53A 4XUEA 4KWCA 1NBHA 1YZ3A 3P2IA 5DM2A 3KQTA 4PYLA 4EQZA 2IDKA 1SUIA 1EJ0A 3ER9A 3CC8A 4P7KA 3THSA 3S68A 4CKEA 4C05A 3E05A 1YF3A 1IXKA 2EJTA 1IM8A 2N47A 2Y1WA 4MHTA 8MHTA 2JHAA 1L3CA 1Y8CA 3EMDA 4WVLA 5E2BA 2GLUA 5FWAA 4E2XA 3G8BA 3SMQA 3UJBA 2FPOA 4BP3A 5FWDA 4PIMA 2QRVB 2BZGA 2PXCA 2HNKA 2JHCA 4C4AA 3GJYA 3GXOA 2P7IA 1YZHA 2VZ9A 1SG9A 4QTUB 3GO4A 2OB2A 3KQOA 3G2MA 3LKDA 3MAGA 5LQKA 1P91A 4K6MA 1AF7A 5EMLA 4RTLA 3TPZA 2VDUE 3G2PA 4E30A 3KPYA 5DSXA 2PXAA 5KQSA 4KW7A 1O9GA 4YUVA 3KQQA 1QYRA 10MHA 4PONA 3UFBA 3I58A 4RTRA 1VE3A 3LCVB 4MQ4A 1DL5A 1FP1D 1NE2A 1AQJA 5CIYA 5U4XA 5ICEA 4C07A 3A7DA 4RV9A 3OU7A 1SKMA 3DULA 4C04A 1EG2A 1PJZA 1T43A 3OFJA 2H1RA 3QV2A 4FZVA 2I9KA 4XUCA 2CKDA 4A6EA 2VDVE 5D1HA 2UYCA 2AOUA 3R9XB 3F4KA 5FHRA 3FTEA 3FPHA 3SSNA 1ZG3A 1QAQA 2WK1A 1XDZA 3C6MA 4CTKA 3EEOA 1M6YA 1WS6A 3TM4A 2AZTA 1FBNA 1Q0SA 3IHTA 2O06A 3CVOA 4L7VA 5LQRA 2NXCA 2Q41A 4GF5A 1KPHA 2EX4A 2G70A 5K05A 1NW5A 1D2HA 3ELWA 5B1SA 5T67A 3C3PA 3BKXA 4AX8A 5HOQA 5MHTA 3LPMA 3HCAA 1JG1A 4F84A 3PTAA 2OBFA 4M37A 4YV1A 4LECA 4ER5A 2VP3A 5EPEA 3FTDA 5CCXA 3GU3A 1KPGA 2V7EA 1ORIA 2LD4A 3UJCA 3P9NA 2Z6AA 4GBED 2P3QA 2QM3A 2ZSUA 4RTJA 3OU6A 4HGYA 4NECA 2IH2A 3DUWA 3GCZA 1P1CA 2ONZA 4M38A 5BW5A 1G8AA 1JR4A 3G88A 1RI4A 1Z3CA 4GQBA 5HZMA 3EGIA 3M6VA 2ZBQA 2BM8A 4PYMA 3TM5A 3BGDA 4E33A 3OZSA 2BR3A 3ELYA 3FUTA 4PYOA 3MTEA 5ICFA 4PYIA 1VIDA 3JWIA 3QOXA 2NXEA 5FADA 3TR6A 4P7FA 1G60A 5GOZA 4YUXA 4YUZA 3ERCA 2G72A 4MIKA 2NNWB 4OQDA 3HCEA 1JG2A 3SGLA 1BKYA 1KP9A 4OBXA 1Q0TA 4IKPA 1XDSA 4IV0A 1M6EX 3CKKA 1X1BA 3FYDA 4U7PB 5E8JA 4XCXA 3M6UA 5ICCA 5E9JA 4X61A 4CKBA 3GDHA 5HIJA 4X60A 1V39A 4R6WA 4OX9Y 5F2OA 4BP1A 1TPYA 4WXHA 5T64A 1P39A 4YV2A 2YVLA 3NVMB 3GRUA 5GIOE 3LGAA 5CVJA 2G1PA 5E9WA 2ZZKA 4X63A 4E70A 1EAMA 5K01A 3G2QA 3DOUA 5EHGA 4AUKA 1N7IA 2AOTA 1DUSA 2NYUA 4XUDA 3A4TA 2OO3A 2YXEA 3HA7A 4FS8A 4KRGA 1M0EA 3DH0A 1VL5A 3P9CA 4GOOD 3LCUA 1X1CA 3JWHA 4FP9A 4C03A 1R6AA 1MHTA 3RODA 4RTOA 2PX4A 4E2WA 2QYOA 3MERA 2AR0A 5LQUA 1NW7A 1R74A 3DXXA 3G89A 2AVDA 5DX0A 3HCDA 3U81A 4GEKA 3EPPA 3FUXA 2ZVJA 3IYLW 4ATNA 4QQNA 3AXSA 4E2YA 2GA9A 2EFJA 3O4FA 2QY6A 2PX2A 2FYTA 2XVAA 3GRYA 1QANA 3HA5A 2UZ4A 3VC2A 3E8SA 3C0KA 2I6GA 3AY0A 3UJAA 1KR5A 3ELUA 2F8LA 4AZWA 2HR1A 2B3TA 2WA2A 4M7RA 5DXAA 1O9HA 3KR2A 1FP2A 1SQFA 3FYCA 2ZIGA 3OCJA 3R0QA 3HVKA 4R8SA 5EMKA 5K0NA 3G2OA 1N7JA 4A6DA 1HMYA 3EMBA 3OZRA 3HVJA 2DPMA 3AWIA 4RTKA 2ZIEA 4V0QA 3HCBA 5HIIA 3G8AA 4YV0A 5KYGA 3EEYA 4RTSA 1RJDA 5DPMA 1AV6A 4X41A 5K8VA 3ANXA 3KQMA 2IH4A 3LHDA 1HNNA 1AQIA 2KW5A 3HCFA 5EKUA 5FQOA 3T7RA 3BUSA 2BH2A 2AN4A 2IFTA 3R24A 2OYRA 3OZTA 3UWPA 2O07A 3QOWA 5G02A 1YUBA 3DXYA 4YMGA 4HRAA 3WSTA 5EEGA 5H02A 3B3JA 5F2KA 4DM3A 4HTFB 1I9GA 2ZZMA 3ME5A 5K0LA 4DQ0A 3LCCA 1KHHA 3P2KA 1L3BA 1JQ3A 1NKVA 5EMJA 3E7PA 3I5UA 3TQSA 3REOA 3X0DA 3SVZA 3VYWA 2PT6A 4LWOA 5ERGB 2HWKA 5DM4A 1QAOA 4B17A 4C08A 3DXZA 3T7SA 1FPQA 2XYRA 2JG3A 2YUIA 2PGXA 3B3FA 4GC9A 4GOLD 4CKCA 3HVHA 1ORHA 4RVDA 4PCLA 3HNRA 2B25A 5K03A 3P9KA 3K0BA 4ISCA 4KIFA 4E32A 5LQNA 5DTQA 3HP7A 3KQYA 5BP7A 3KR9A 1EIZA 3SXJA 3VC1A 5M5BA 3MB5A 3T0IA 2ORED 2QE6A 4BLUA 2O0LA 3T7TA 5HIKA 4PYKA 4PIPA 2CL5A 2AOXA 5LR6A 5GM1A 1KXZA 3I64A 1R8XA 1G55A 3B89A 1D2CA 1NT2A 2OB1A 3BWCA 3M6XA 2I7CA 2IGTA 3MQ2A 2AN3A 3FUVA 1RJFA 4RTQA 3G7UA 3NTVA 2P3OA 2OPBA 1R18A 3OE5A 1QAMA 3LKZA 4QDJA 3SM3A 4DCMA 2JH9A 3DLIA 4E2ZA 2PWPA 1ZGJA 4PYNA 3LL7A 3PVCA 3MGGA 1BHJA 3TLJA 4LG1A 3EVGA 4KDCA 1I1NA 4OQEA 4ER3A 3O7WA 2ZBRA 5FA5A 2O05A 4GOND 3EVFA 3ER8A 1INLA 1RI1A 2NXJA 3B3GA 3BKWA 2YQZA 3FUWA 3H2BA 2AOVA 4LWPA 5DM1A 4RVFA 1VQ1A 5EZSA 5P8WA 5DWQA 1XCLA 3SSOA 4YUYA 4DKJA 3UJ8A 5E8RA 9MHTA 5EKXA 3P8ZA 2IBSA 4JXJA 3VSEA 3KKZA 4KDRA 3GNLA 5E2AA 3RW9A 1YFLA 5EQJB 3SR4A 1QZZA 4P7JA 3A25A 2P3LA 5DTRA 4GUAA 4OA5A 5IH3A 4Y30A 4EKIA 5ICGA 1O54A 3G5LA 3CGGA 3M6WA 4BY9E 1ZGAA 5KS2A 2IPXA 2UYQA 4QTTB 4C06A 1G8SA 4EK9A 3M70A 3BXOA 3FTFA 1R00A 2BR4A 3EGVA 2GPYA 2B2CA 7MHTA 2YR0A 3KQSA 2QRVA 4O29A 2XBMA 5GWXA 3HEMA 5K0GA 3BT7A 1TW2A 3HA3A 3OU2A 5EOVA 3JWJA 2GH1A 1PRYA 3CCFA 2HTEA 3EGEA 3GIWA 2PV0A 2IBTA 1RI3A 1XCJA 5C1IA 2AS0A 2YX1A 2ADMA 3EVDA 3EVZA 2PLWA 5CVEA 1B42A 4FSXA 5DRYA 2PY6A 1L9KA 3BWBA 5EHIA 3RIEA 1X1AA 2NP6A 4DF3A 1JSXA 1H1DA 2G71A 1WXXA 3KQWA 2AOUB 3OFKA 2GAFA 4POOA 3KQVA 3KR0A 1JG4A 5JR3A 4UOEA 1NV8A 2HMYB 5EC8A 4DMGA 3LBFA 2UYOA 1OR8A 1BC5A 4RTMA 2K4MA 1JQDA 1RI2A 1U2ZA 2B9EA 2CMHA 2H00A 2NXNA 1XVAA 2PX8A 3FPFA 3LSTA 2CWWA 1SVUA 5DLYA 5GM2A 1G38A 3KR1A 2IP2A 4HH4A 5EZQA 4HSGA 4FR0A 5EVJA 3PB3A 3GRVA 5EGSA 4X1OA 2YXLA 2OKCA 1KPIA 3CJQA 5CCBA 2IH5A 5E1BA 3NMUF 3FPJA 3TRKA 3CBGA 2EG5A 4R6XA 3NWEA 3NJRA 3CJTA 3LDUA 5E1DA 1G6Q1 1TW3A 2JHPA 3KQPA 5FQNA 3MHTA 3E23A 5BW4A 3V97A 4DCGA 4Z2YA 4RTPA 1RJEA 2ZTHA 5FULA 2FK7A 3A27A 2ZLBA 3DMGA 1N2XA 3L8DA 3NW9A 3BWYA 3BGIA 4HG2A 4RWZA 1NW8A 3PX3A 4QVGA 3UA3A 5K0BA 2P7HA 2XVMA 3DMHA 5KQRA 2IDJA 5DX1A 1MJFA 4DZRA 2I62A 3K6RA 1XXLA 3M33A 4MTLA 3O31A 1NV9A 4GOMD 2PKWA 3DMFA 3KPWA 2ZWAA 1XDUA 2PXXA 4H0NA 1SQGA 4P58A 5DSTA 5EIFA 2C7OA 3HM2A 5LQCA 1XJ5A 3C3YA 3SX0A 4EMSA 1WXWA 5K0FA 2C7QA 5CUQA 2YTZA 3LDFA 1L3IA 1UWVA 3EVBA 4OA8A 1NBIA 3KPJA 4R05A 4OBWA 3NWBA 4QQKA 1KYWA 5LQJA 3HCCA 3EVEA 4GC5A 4AZVA 4QPPA 3UA4A 4BLWA 3PX2A 4MWZA 4FSDA 3PT9A 4P7GA 5FA8A 2ESRA 2YXDA 2ZBPA 3GWZA 3UBTA 3TMAA 3OPNA 1IY9A 3JWGA 4HGZA 1NW6A 2GS9A 3LBYA 3EVCA 3FPEA 4RYLA 5C9ZA 2PVCA 5LSAA 5GP1A 2PT9A 2AOTB 3FTCA 4AZTA 3CJRA 4QPNA 4G56A 4RVGA 2BR5A 4EVIA 5K0CA 5EMMA 2P41A 4IV8A 4PYQA 2FRXA 2C7PA 2BM9A 2OZVA 1L1EA 1D2GA 2P35A 3ORHA 5HIMA 3A7EA 5C0OE 2OXTA 3MCZA 2WA1A 1KIAA 2O57A 3A26A 4ER0A 2Y1XA 4Y2HA 3KPVA 5K0JA 3C6KA 5BXYA 1VBFA 5CD1A 1SUSA 1WG8A 3TFWA 3DR5A 2C7RA 3GRZA 4HC4A 4RTNA 3IEIA 3Q7EA 4RX1A 2G8NA 1YB2A 4AZSA 2B78A 3PLAE 3D2LA 3P71T 5E1OA 2XYVA 2PBFA 2R3SA 1JQEA 1F3LA 1X1DA 5K09A 2OY0A 5FUBA 3MTIA 4PINA 4RSRA 1P1BA 1I4WA 5DXJA 2HV9A 4M36A 5CVVA 3TKAA 1DCTA 2ZZNA 5EIWA 3R3HA 5LQAA 1NW3A 5IKMA 2PSSA 4F86A 3Q87B 3BZBA 5DM0A 4DA4A 1BOOA 4KIGA 3THRA 1VP9A 1XTPA 3TKYA 2PJDA 4FGZA 2VDWA 1ZHFA 5CVUA 5FHQA 3M4XA 1ZKDA 2JH8A 5EEHA 5K0EA 4PGHA 2ERCA 3FRIA
chains in the Genus database with same CATH superfamily
5ADWA 1ECCA 1UKEA 2OBYA 2OGSA 3TAXA 4N4AA 2HN9A 1PT9A 5KOIA 5CDGA 2WTEA 4UHDA 3EZYA 2H7CA 2X3YA 1TIPA 3NBAA 3K8OE 4UNRA 3OG9A 2ATVA 2ON6A 3TIXB 4Y98A 2PGIA 3CURA 2ZBEA 1SK8A 1ZUNB 3F9RA 4ON9A 2V74B 1DQPA 3J80A 1XU9A 2VTEA 1R6DA 2W93A 3L8YA 2YS6A 3TZBA 4GZLA 4DMCA 4QC2A 3H0EA 4HJRA 4B2YA 1PWXA 1J07A 4MYRA 4NE7A 2MIIA 2PKCA 3IALA 4R51A 3EFEA 2BEVB 3JQBA 4CKCB 2WJIA 3T34A 3ZCTA 2J8ZA 1RLMA 4KLRA 4GR4A 3IIEA 1ENZA 5FD8A 3IQXA 3DV0B 2POQX 3THXB 4MA4A 1NUAA 2QLBA 5D51S 1NM5C 5AUNB 3IV6A 2Q4OA 2GZAA 5CFQA 1L8AA 2DWPA 3I5AA 2R6ZA 4AJ2A 1F48A 2WAAA 1OXTA 3KD2A 3DZHA 4IH9A 3W79A 3ZD9A 3TOSA 2PGJA 3QG1A 1W1IA 4LQCA 1WV0A 3NHAA 3I83A 3TGWA 4WNAB 3DLCA 4C2TA 1NX6A 1OJLA 3UYLA 4KR2A 3H6KA 4DTIA 1UMKA 3R4VA 5BYJA 3PUJA 1ZUWA 3F7TA 1EFTA 1HZJA 2GM3A 1Y37A 2QRGA 3PK0A 4N5HX 3FPKA 5FA6A 5K8JB 2XUFA 5J63A 1YFJA 1FLAA 3H9UA 4C2UA 2FF5A 3O2NA 1V71A 4IIYA 3PKJA 4LF4B 4YMHA 3PUZA 4TYNA 1JB1A 1ESMA 1DG1G 2QWXA 4M89A 5D1NA 1V95A 2VS1A 2M6SA 2Q46A 1CHDA 2Z57A 4PLGA 2ZTSA 3C3EA 2YV3A 3SZMA 2PX5A 2XUDA 4O4JF 2D54A 3A1VA 4PG7A 5ALUA 4DARA 3IMKA 1SUPA 2JEYA 2X1VA 2IS6A 2GPTA 3G5TA 2W4QA 4XUEA 1IBKB 3OIYA 1IY8A 1ZD8A 4Z9BA 3B2NA 3WJ1A 5JD4A 3P4XA 2OAP1 2FLWA 4M8LA 1CRPA 3CSUA 2ZJYA 3IDSA 3EWNA 1FX0B 2CVHA 5NULA 4RFVA 4GH5A 1ZNXA 3R3WA 2YMQA 3DNFA 3TLGA 1OH6A 3G8BA 1JFVA 3EWIA 2G1AA 4ZN6A 1CS0B 1S7CA 4L9RA 2WHXA 5E4YA 1BWQA 1RMQA 2HNKA 3EXHA 4Q93A 2XSZD 4WN9B 5FKJA 5K1ZA 2CD9A 3CB4A 1JF8A 4NYJQ 1XE3A 5IEBA 3W9BA 4DPMA 1C7ZA 1F0YA 3F6SA 4OK5A 1QXSA 3DO8A 3KV3O 1Z33A 5EMLA 1VPVA 5IJXA 4WK4B 1A7UA 4J76A 2VJKA 4G09A 3EUWA 2M1XA 2HCRA 4BNLA 2O8CB 2V54A 4CHGA 1JEAA 4WECA 1YE5A 3RU3A 5J2UF 2FETA 3UBMA 3L0YA 2PN1A 3KWLA 2VT3A 3ONFA 2CNOA 3OZAA 2C5BA 4RMJA 5SYNA 3ZEIA 1WR8A 1DCKA 1P4HA 5JDIC 2GETA 3UHJA 3HS3A 3HUEA 2OCYC 4YRMA 2FEMA 3UY4A 4ZGBA 1EG2A 2H1RA 3FOEC 4QDXA 3RC1A 4DBLC 4OHFA 4A6EA 3D4OA 3KOOA 1E8NA 1W5EA 2DF8A 4ACBA 1OXKB 3G0IA 4X97A 2DX7A 3EHDA 4LBZA 2OKGA 1R64A 4OV6B 3ZQKA 3CVOA 3K1ZA 2HA6A 4KQHA 2OK8A 1X39A 1Z74A 1PF7E 4MEBA 1NJ1A 4RF3A 3L3BA 4DJEC 4J0KA 1SCIA 2PMFA 4F1KA 3LPMA 4PLVA 3BE8A 5HQTA 4R5HA 1YR6A 3PTAA 3QUQA 1LSOA 3ODPA 1K97A 3HJGA 4OQNA 3OA0A 1KH1A 2ERYA 3DHYA 1Q1QA 3CCCA 4KXLA 5FEUA 1W8IA 3A1CA 3F1KA 2H65A 2XLBA 1B43A 2QT1A 4A0QA 1M2KA 3IQFA 2IH2A 4LZNA 4GIBA 1EM8B 4LX8A 3P45A 4XGNA 4XSVA 4ZO9A 2OHFA 2OHXA 4YWHA 4C0KA 1Z62A 2X22A 4EVQA 1UZUA 2GKGA 1XWWA 1AGRA 4FEAA 4L4RA 1P73A 1UJCA 3OICA 3W4JA 4G81A 1U04A 4FUTA 2WZBA 4MS1A 1V8ZA 2ZI3A 1Z5WA 4HP8A 3FUTA 4J6EA 3MTEA 4JC4A 3HP4A 3V6MA 4BVHA 3V46A 4S04A 1E62A 1ACJA 2NXEA 2BYTA 1UJMA 4MV6A 4B80A 4CM4B 4I14A 4N5NA 4WZZA 5IK2A 4RZ3A 1FTWA 4EW6A 1SCQA 2ILTA 1IUKA 3ERCA 16PKA 3JQGB 1P2DA 1U8ZA 1AKYA 1REQB 2WUWE 4RPJA 1ZD1A 1ZSVA 5JD5A 2J9YB 3PIIA 4G5SA 2BEUA 2H85A 2NOAA 1ZIXA 3OHPA 4MUNA 5ECYA 3B1YA 1RACA 4X60A 4B8YA 2VK4A 4OJQA 4WSOA 1RYYA 3O3OB 4IFEA 1TPYA 1Q7BA 1QNLA 2G77B 2ZRGA 3F67A 4L6IA 2E85A 2PNFA 4YCMA 2JAQA 3ADPA 3KQUA 2ERXA 2HWYA 4IHJA 3S29A 3BXZA 3LXUX 5K01A 1P0PA 2VNJA 4MR7B 2ORWA 3IV7A 2DXIA 2R66A 2QLTA 3OQJA 3ZLTA 4JLAA 1PD1A 1LEHA 4I7EA 3F6RA 2QM8A 1UBSB 1EUQA 5L40A 2YZ7A 1PQYA 1L9XA 3DM9B 4S2UA 5HRUA 1SBNE 1JA0A 2QN2A 1T5TA 2PQMA 1GUBA 2QLFA 1O87A 1NW7A 1AC5A 3RIMA 3F74A 4J4BA 4N0QA 1JDUA 2WVAA 4NBVA 1HYEA 4ATNA 1YR7A 2VPXA 3NO4A 3IB6A 2RJOA 2NM0A 5ENVA 1YDFA 2ZU0C 1OAAA 2IXFA 3LZCA 4M1ZA 1FP6A 1BHSA 3E8SA 1XQVA 1OT3A 3IAM1 1EGVB 1EHIA 2JFOA 4LRYA 3UT0A 4MH0R 1PZHA 1SQFA 1I1HA 1K86A 1QPBA 1NXVA 1ZC3A 4LXQA 4ZK6A 3LO5A 2DCUA 1X2EA 1M5UA 2ZI5A 4MQFB 2RGWA 4D96A 5KWJA 2B20A 1IHOA 1M2NA 2XCTB 1KH2A 2YJ5A 4HZGA 5HIIA 4CLRB 2HU2A 4YV0A 3PGMA 4B6OA 1JU3A 3JRXA 4R83A 3UG7A 4E5KA 4G5HA 2IH4A 3KSRA 2QRQA 4RH1A 4M9CA 2C7VA 3C4QA 5TC4A 3FMOB 1GNTA 3JQCA 4HLUC 4X7MA 1XA3A 4ZT5A 5FYDA 5LIPA 3GAFA 5E7IA 2IW1A 1CYEA 3LT4A 3AIMA 1DKNA 3BERA 3PC4A 3FWPA 2VDKB 1ABEA 2BP7A 4KQWA 2ZZMA 1PL6A 3EZLA 1U0RA 1D2RA 2GX6A 3CFYA 3K15A 3PV0A 2QPAA 2IYEA 1U5CA 3E9CA 5FOXA 2R11A 3I1JA 4RH3A 1LRKA 1V9LA 2HDWA 2P9TA 1THZA 2JJMA 2Q9AA 4W5RA 2Q5CA 3IBCA 3K1YA 2ZITA 1E7MA 4XX1A 3REOA 4DRZA 1N6KA 1W49A 4LWOA 3U9TA 5BWOA 1AUOA 4PZDA 1S2NA 4WOBA 2AXQA 2XODA 2HU5A 4BUZA 2F67A 3RWOA 4F3RA 1APBA 1ZNYA 4Q7MB 1YASA 4Q9NA 2WU3A 5F3WB 4QX6A 5DVZA 2Q4RA 2ZAOA 3PNLA 8ABPA 1LK7A 4YCBA 5COBA 4MA0A 1EFDN 5TQ2A 4BGVA 2YRFA 4LMRA 1R6BX 1H0RA 4AJJA 5IM4F 5CT6A 4FLFA 4IO1A 3B36A 4NCHA 2Q3DA 4OO3A 2X9NA 2B6NA 1G21E 2YOHA 3FPLA 3ZWVA 3NIBA 2VXBA 1C3LA 2LCQA 1I10A 4PG5A 4OHWA 4Q02A 3K3PA 3FW1A 3NBMA 1BE0A 2OB1A 3DNPA 1T3GA 1AQUA 4LFAB 3AG6A 1TUIA 5CT9A 3IE0A 1KZ1A 2PH7A 3NLLA 2QUZA 4L4ZA 4HZIA 4HKTA 4X6UA 2I2FA 3QFSA 4DCMA 4RK5A 2GN2A 4RESA 1CJTC 4ZI2A 1FTYA 3DKVA 8GPBA 2FVYA 2VTBA 1GM5A 4UBIA 3VI4B 1Y7LA 2VF5X 3K9NA 4GVPA 1L7AA 1H2RS 5ESRA 2DT5A 3ONDA 5INTA 4EHFA 1M0TA 4G0XA 2FR8A 4F2GA 3SN6A 1RI1A 3B3GA 5EJ9A 3VPCA 4DKJA 2FZWA 2HJHA 4HH1A 1K9SA 5KX5B 1JEYB 4R2MA 2ZJ8A 2E1RA 2HRBA 2FSGA 2VAMA 1AXEA 5IJWA 3KKZA 4LE0A 1Z5VA 3Q7RA 4BZZA 1RQNA 1YULA 4Z9XA 1XYGA 3VHXB 1E58A 1U3TA 2RGEA 4KE8A 4JT9A 4FD3A 2A0KA 4IY1A 1JHAA 4RELA 3NTRA 4Q6BA 2AFIA 1IEVA 4RYDA 5FXMA 1O6GA 3FTFA 4EA6A 5J2TA 1MF7A 3RS7A 1THGA 3KQSA 1U11A 3KZVA 3L1KA 3D8BA 3PVSA 4Q0MA 3WDLA 4ENPA 4S05A 4DV3B 4A82A 1JEQA 1VDZA 1VKZA 2OK7A 3I01A 3U7EB 2HNBA 3T9BA 2NU9B 2O4UX 2Q7DA 1HEYA 1Y33E 2I78A 2GH1A 2P2YA 2GHRA 3GIWA 4WAUA 2DFNA 4W1PA 3G02A 2M32A 1UIMA 4OKIA 2GBCA 5FPQA 2V6JA 2Z2YA 3BK7A 3HQ4O 3DSRA 5CVEA 3BMQA 2OCXA 3TMYA 1IRXA 4ZXFA 3MMNA 3T5GA 1GYPA 3BYZA 4JUFA 3WGZA 5JFOA 4KVAA 2QG6A 1IOZA 2DC1A 4O2BA 1D2MA 1XNRB 3DVLA 3I6MA 4GZ3A 3S2ZA 1PQWA 3HEBA 1ZNZA 4KP7A 3S5UA 1KQFA 1N6IA 4KLAA 4BFXA 5FPKA 1YNOA 5DK4A 3AK4A 3T3IA 1BO6A 3WGOA 1OWLA 3NHLA 3TZHA 2TMDA 4B8ZA 5CA1A 4N76A 3GA5A 4HNQA 1HUQA 1RFLA 1W19A 4I81A 1VG1A 1JILA 5F7JA 5D3MB 2Q4TA 5K3BA 1SVUA 3KU4A 1DQSA 2J4FA 2P5YA 4WBNB 1V3UA 3KJQA 1PU2A 2PZJA 4FGWA 4J2TA 5FAXA 3UMJA 4N0MA 4ZCRA 2ATIA 3JWEA 3KJGA 1PO7A 1QWSA 1UZAA 1Q16A 2GK6A 2QMOA 3PC8C 5E7JA 3E7FA 4DEVA 4Q4LA 4W1RA 2WE7A 1NI3A 3QGMA 1L4EA 3VUFA 1CETA 5BVGB 3QNMA 3T5AA 1HT0A 3ZX4A 1QNFA 1QHIA 2CLSA 5AI6A 3PRJA 4RPCA 2J41A 2Q0XA 4UVIA 5IAGA 3N2EA 3NW9A 1LJ8A 3E9NA 3WRXC 4BB5A 4B2LA 5CAEA 4JR1A 1IJEA 2D1FA 1K7XB 3LXXA 5EWLA 1DARA 2WQ7A 1L4GA 1YRBA 2OBXA 3AJRA 4OH7A 1JJAA 4TLLB 4RMNA 2XR1A 3O3MB 1ZN8A 1Q11A 3O5AA 4C6SA 1AHNA 1OHHA 4D3FA 3BSSA 1RWBA 2VF8A 4LUCA 1KJJA 3LY9A 4FOOA 4Y67A 1E3IA 2AFIE 1EWQA 3NBQA 1OD6A 4MRPA 3VSBA 2CV0A 1A8IA 4MZDA 3TJMA 1PZFA 3ZE9A 1MX1A 4IIJB 1ZH6A 3W5SA 2W98A 1JIKA 1MAWA 2CLHB 4AZ3A 2WSYB 1V41E 1H3EA 4I6EA 3I5YA 1E3LA 1CJCA 3LZDA 3NHYA 4G1VA 3OCWA 1ZGBA 4IDCA 2AJTA 2H2AA 2JRLA 3D3KA 3G59A 4QE3A 3ZD8A 1KO7A 4AKEA 3BD8A 3R9WA 1GGFA 5EMMA 4A9AA 4GRIA 1E1RD 2BM1A 4M1SA 1ICIA 4ZI5A 3ZCRA 4F4CA 2J3LA 2X5OA 2ISSD 1L1EA 4YXWA 2XT6A 4W7IA 1JX6A 2JHFA 4BWGA 4QWWA 1IOVA 2OXTA 3WGVA 4FFPA 1KIAA 2VQ3A 3E2MA 1E5LA 1DAIA 3KCNA 1E89A 4MMYB 3GFPA 4XM2A 3MCVA 4OGKA 5G3YA 3TX2A 2WYIA 1PN3A 3TNYA 4U1RA 1ZN7A 3RE1A 3WFZA 1QMPA 2ZQZA 1PUJA 3WYEA 3BPSA 1UBGA 5SY6A 2ATEA 3D2LA 4OEHA 4JR0A 2PBZA 2X4DA 2R8XA 2PL1A 3D31A 2P0YA 2XMQA 2LUOA 4BPBA 5I8WA 4FNOA 4I55B 4NS1A 3VTAA 2QSJA 5FORA 3TPCA 4AS2A 1L7MA 4LAFA 1IB0A 3R3HA 5BN5B 2PZMA 5TMDA 4BQEA 4F86A 5DM0A 4ZCPA 5DHSA 2BGWA 4QKQA 3QJGA 1CEYA 1Z6XA 2Q1TA 2W6MA 4CQMD 3KB6A 4DNQA 2YINC 3ZNQA 1ZKDA 3GUVA 1OFGA 1N3YA 2PK3A 3S70A 3OTQA 3QLUA 4OYYA 3ZH9B 4UZSA 1E3WA 1ZUHA 1SA0A 1GITA 4PYJA 1XZHA 4I1VA 4P3KA 1RXWA 1T2FA 1HE8B 2CYAA 2PL5A 3GYGA 3N2YA 3PI6A 3VU1A 4KK4A 2HHLA 2W58A 4K6FA 4CT0A 1TOAA 3TW0A 3IELA 1DBVO 4BQFA 5LP6B 1JG3A 3OQIB 2A2ZA 4G5YA 4CF6A 3MT8A 4NQZA 1T8TA 3GEEA 1PGNA 1RAFA 4R1UA 2AN5A 4C3VA 5DI9A 4MUKA 5COAA 3EGCA 1HBJA 4H0FA 4ITUA 3LKVA 3L6BA 3O2QB 1ANKA 4INPA 1QRRA 1TA4A 1VCHA 2P1DA 4OL0A 4YIKA 3PJGA 3HPQA 3R3VA 1XXHA 3SZRA 3ZZNA 4NYMR 2WIDA 4HAXA 3UW3A 5C3MA 1GGEA 3QE3A 2DHRA 2WU0A 4B2IA 3KTFA 1WUIS 5ES3A 1BMQA 1C8KA 5JI3E 2P78A 2EWMA 2O2HA 1U31A 3OJEA 5DHAA 1SH7A 2NO6A 3DUFB 1GRRA 2A88A 1IAVA 3WMXA 3F6EX 3GJ5A 1L5LA 5KVAA 1WXQA 3D7LA 1U0BB 1H85A 1Y89A 3L1UA 5K5EA 1U6KA 2VJCA 2C1EA 2C5EA 2EZ8A 3KVNA 3P32A 2A9JA 1QC5B 2WABA 2FR1A 1X7WA 1LDMA 1ZINA 4JLWA 5F1PA 3ZGNA 4BX9A 3B6EA 5GJBA 1XRJA 1SULA 1YA4A 2DM6A 5T8KA 3R2JA 3F3YA 2QE7A 4WK6A 3UJ7A 3HMQA 4DL9A 5LMCA 1C9EA 2G08A 4BO7A 5LOVA 1WNFA 3BBPA 3DC2A 3OPQA 4LNHA 1KAGA 4C3ZA 2RBKA 1NF8A 1YR2A 4CM5A 4CW7A 1RI5A 1CZOA 4I5IA 3DMRA 4ZHQB 4XI9A 5BWMA 4FWTA 1GV1A 2GBIA 1QFZA 5KX5F 1SU7A 1BU5A 2BWJA 3GQBB 3IMCA 5JRDS 1PJ2A 1J8VA 2ECKA 1SUIA 3FFBA 1WDLA 3T5MA 4XYBA 1WSAA 4DUGA 1RPAA 4M99A 2J9RA 5TGDA 3HY4A 2XKKA 4EL5A 1D7OA 2CK3D 1X7YB 3MINA 3PR3A 2YYSA 1H1LA 1GLGA 4E6EA 2DY0A 5DK6A 3TVDA 4E2XA 5AQEA 1SQ0A 1L5MA 3UB3A 1E6WA 1C4WA 1UKCA 4FWBA 4G85A 4P93A 3D2AA 5FWDA 2COEA 4DV5B 2X1MA 5CHEA 2HD4A 2YBDA 1XTJA 3A6DA 4Y7DA 3IDOA 1JHOA 3UPTA 3KSZO 1KEWA 1T6YA 2ODNA 3AUSA 3MAGA 4ZQGA 2JD1A 5CBPB 3I62A 3WKBA 1GGNA 1E9FA 2RH9B 3U3OA 3C14C 2GHTA 2G8LA 1YL6A 5CW2A 2XZTA 4PONA 3DAFA 3F90A 5KPDA 1FRFS 1XTQA 3OE7A 1XZPA 2KJQA 3C3KA 3RJTA 5KAMA 3JYPA 4MV7A 1AURA 4OLFA 4HQ0A 4FSHA 1NJSA 1AQJA 1XXHE 3FI9A 3MLAA 2ZOSA 5AM2A 1EE2A 1NLYA 4HZUA 4Q7KA 2OGTA 3OU7A 3HY6A 2AMYA 3PNKA 4J9VA 1EGAA 4ZFNA 4P4UA 1SQ5A 5P21A 4D80A 2RJ3A 4OXRA 2ZTUA 3DZJA 5FFFA 5LB4A 4ZKDA 4HDMB 2PJUA 3ZHQA 1IB6A 2YICA 5DWVA 4W5TA 1V35A 3HDGA 3QIVA 1NG9A 2GEFA 1J2YA 1VTKA 3DO6A 4ZWNA 4WBNF 1JMKC 5DM60 1F0NA 2GLXA 2LZ0A 4FMPA 2WWVD 3N6VA 2QN7A 3W2GA 3RTDA 2J3EA 4P5PA 5K05A 5AJYA 4GXQA 2B8TA 1GAJA 1LBSA 2KE5A 1EAYA 4WZAA 5JPDA 1SO8A 3AEZA 2MCFA 4EARA 1OKKA 2DSTA 1FLNA 2ZI9A 4E5UA 1PG5A 1LDEA 4PQFA 3DYBA 4FMBB 5IUJC 4ZQBA 2GYUA 3HRIA 2CLEB 1R7RA 1Q50A 2JIQA 5D3ZA 4EQ6A 1MQSA 3EH1A 4XFKA 2FWBA 4HGRA 4HQLA 4D3ZA 5KYVA 2ZIVB 3S2GA 3DUWA 1L5FA 4RKYA 3FKSA 1HLPA 1VMDA 3BJRA 3GPCA 2PZLA 4ZO8A 1XEXB 2FP4A 1Z6AA 3K30A 1KI6B 3L06A 1ND6A 4O59O 4FGLA 4PYMA 3SYMA 4CNQA 1GZ7A 1J2UA 3IIIA 2X9VA 2Z2JA 3DYIA 4GO1A 4OMUA 4RSHA 5E4TA 1VIDA 1RBYA 3O9VA 3PSHA 4E7OA 2GFQA 5IHPA 4IIJF 4J0DA 4X64B 4FEGA 4HYEA 3ZXYA 1BKYA 4UUBA 3B1KA 2DBYA 1XDSA 4IXNA 4REOA 3RVKA 1SELA 1LWNA 1XCPA 1B2RA 4WLOA 1X1BA 2XYHA 1X7DA 3ZY4A 5AUPB 1UAAA 4TT8A 4ZYUA 4ZYLA 4AIRA 1EDZA 1RJ9A 4RQAA 4RIHA 4KV9A 1EZZA 4DMMA 4BP1A 3Q8WA 1NBAA 4Z86A 1I7PA 4JIMA 4PZPA 2YVLA 3TVYA 5K0ZA 2WWIA 3PDIB 2GEKA 3EAQA 4E70A 2XOKA 4HWRA 3WJ2A 1IN8A 4JROA 1LBTA 2ENWA 5DE3A 5F5NA 1MD9A 5L3ZA 5KWIA 2Q6TA 4G41A 1FFWA 4TV9A 3ZXSA 1BXGA 4B4OA 2IYZA 1FSGA 5DJ5A 2VAWA 4HN2A 3OZEA 1R6AA 4C03A 2G9NA 6REQA 5JCZA 2P77A 4HEJA 2WTBA 3SJAA 4ZEWA 1VGRA 2QENA 5LQUA 4D02A 1OFUA 1SVIA 1VG0B 2F90A 2AFHB 4JVNA 4L2IA 4ZVUA 2BELA 1MO6A 4UNSA 1ZBQA 5HYVA 2GA9A 4YJ3B 5AUQA 5JEDA 3QUBA 4I55F 4CF4A 1G20A 1MA3A 2FYTA 3TZQA 3KAKA 4WZAE 1YK0A 2FA9A 4TTAA 4UCWA 2PJZA 3JU3A 4Y2TA 3FF4A 4AZWA 3EPKA 5E4FA 4IAOA 3VR5A 3EY9A 3KR2A 4ZGWA 2QSYA 5K0NA 3V3TA 4MUIA 1T4MA 4HUTA 1TUEA 1QGUA 1TD1A 1H2FA 1Z37A 3HVJA 2HUNA 2ZIEA 4I5DA 1EFPA 4KI7A 5AJUA 3R7WA 4BC1A 4CEHB 3CWCA 2HQBA 3IAUA 1NIPA 5DPMA 4KPEC 4WOPA 3ANXA 3G49A 4Y2VA 1AQIA 4LJYA 5LDHA 2G36A 2IZ5A 4N5DA 3LL4A 1NUSA 2IFTA 1EX9A 3LQRA 3LSYA 1SOUA 3QE0A 1L7BA 2BGKA 4JNCA 3ZY2A 4C4XA 1LUAA 5HVNA 5LP6F 4BVLA 4MAAA 1MC5A 2VJYA 2X0IA 1E79A 2C88A 4MW4A 4Q3BA 3RR2A 4P83A 4MSUA 3SC2A 4F38A 4H3HB 2DFPA 5BMVF 3GLGA 1VI2A 2PMCA 1RBQA 1U0JA 3DBOB 1XTBA 4BDSA 1P77A 4L8YA 4KU4A 3WKCA 2H06A 2XUPA 4D8WA 1L3BA 1JQ3A 1PJAA 5TT1A 4ARZA 1EFVB 3QFHA 5L3QB 2CBZA 3ZU6A 3GP5A 5ALRA 2JFFA 2BL4A 3VYWA 3ROMA 2HA5A 1GA4A 3T7SA 5FT9A 3A28A 2QW8A 3DE1X 2YUIA 3OZ7A 1JLSA 5AXDA 1UPBA 3ZYCA 2DOKA 3QELA 2G9VA 4C6TB 2HYIC 2RC6A 3PD1A 4NYIQ 3SQMA 1ORTA 3RUPA 1A50B 2B21A 1V1MB 4U6QA 1RSZA 3TAHA 3BVPA 1R5JA 4PIVA 1FNSA 1S3SA 2AT1A 4MVJF 3K0FB 4YJ2B 4HY3A 4CKXA 1KWGA 3Q5GA 1XVTA 4RY8A 1UMCA 1R9MA 2O48X 3P9XA 4OQQA 2AR7A 2ZU6A 2FMTA 4BO0A 1QH1A 2YZNA 1TFUA 3CKMA 4KO8A 1WEHA 1KXZA 1BVRA 2C0QA 2VT7A 2B1GA 3M6XA 2WJHA 5D5PA 3NASA 4HRXA 3BG5A 5FDFA 5L8VA 2C4UA 4Q4HA 2CCKA 2P3OA 1QGED 2OPBA 1E3QA 1Q77A 3SM3A 2JH9A 2FEPA 2IPLA 1QR2A 3HKDB 4ZHQF 1T5SA 2Y0EA 3OKCA 1ZOLA 3IV9A 4LG1A 2VQSA 3B3AA 4ALKA 1BDBA 3DFUA 3KVYA 3RS3A 5C8ZA 5FA5A 3IEMA 3A36A 3Q0IA 5CLHA 5H83A 4ZVVA 4MO9A 4XWAA 4HAZA 2OV4A 1BCSB 2GLTA 3PXXA 4UBLA 3GLFB 1IU9A 1R15A 1UADA 1D2EA 2C96A 3A05A 3AB3A 4GPTA 4IPTA 3UNXA 1ZRHA 3W9YA 3WFIA 4COOA 3QZUA 2IOFA 2QZPA 2R8RA 2H5IA 4R2HA 3RW9A 5JPIA 2BISA 2NU6A 4P7JA 2D2EA 4P3XA 5EERA 2P30A 3K70B 1QRAA 3BHIA 3I42A 1KETA 1ML4A 2CDCA 1KZ6A 1XZ8A 1Y8RA 1JEEA 4KFUA 5C37A 5KS2A 2XIJA 3I0MA 4UXJA 1N1MA 4RW0A 3A0RB 4DLUA 4E1BA 1E5VA 3C8HA 2YHIA 1PW5A 3OCUA 2D5LA 3IUNA 4HNVA 3R9IA 2FRVA 3N70A 3M83A 2GZ2A 3QYAA 4ESHA 3BT7A 3ENNA 1TW2A 1JHPA 2CWDA 2CXXA 2PGAA 2VDQB 3OU2A 4PO8A 3LH5A 1KSGA 1Y6FA 1G2PA 3CCFA 3ODGA 2MOKA 3A4VA 2HHAA 1C8LA 3KX2A 4KZPA 3ZE7A 4AJIA 1XK7A 2YX1A 1EUCA 4Z1MA 3EVZA 3NV9A 1G8KA 3HXMA 4QYWA 3P2YA 5D7BA 3FPSA 3FFAA 3HKCB 2FZVA 2A1UB 4J9UE 3OFKA 4QHYA 3USCS 1FYWA 3WFJA 4C21A 4QG3A 3I2HA 5JY1A 2XE7A 3KQLA 4CN9A 4N54A 4B7UA 1QV6A 3I0ZA 4HNTA 1CT9A 1X8JA 2QB5A 3G1TA 3LK7A 1BWRA 4QJ4A 1CQZA 5HF9A 3SX4A 1II9A 3GY0A 1BC5A 1Q21A 3PC7A 3V2HA 1U9IC 2P5UA 4YJGA 1ODKA 2PX8A 2B9VA 5B3JA 2HLDD 1XVAA 2PUWA 3ZDFA 1ACLA 4XOUA 1G2IA 2B35A 2IP2A 4WK2B 4KFCA 1NZFA 4Q05A 4V1CB 5BSRA 2MMGA 3QXHA 2UZIR 1ONSA 3OZIA 1QVZA 2OORA 4MS3A 4AJPA 4NNJA 5H8WA 3ZCUA 3NIWA 3KS9A 2IKSA 2RHMA 2LIVA 2O3RA 4O4HA 3LWZA 2CV2A 1GZHB 5IAJA 3KQPA 2JHPA 3L93A 1NSFA 1YI8A 4YVFA 1WOYA 3IBTA 4C7OA 3JSXA 3PEWA 5HCNA 5DOVA 2Z4SA 3R0VA 4RWZA 4WXYB 3AT1A 4PSCA 3WDKA 1E3TA 2FTKE 1TTQB 2CXRA 1MJFA 3GRAA 1AQLA 3UF0A 2GOYA 2FQQA 3WIVA 4MTLA 1BDMA 4P7BA 3MA0A 1MOZA 2QI9F 1Z25A 5HF5A 1LSSA 2JA2A 3DMFA 2ZWAA 5B1EA 3SVTA 3QXCA 4I2NA 4UE2A 1Y4DE 3HM2A 4A8JC 3JQPA 1VA4A 4LKOA 5CA0A 4RK0A 2GXQA 4OGFA 2UUAB 3NHMA 1MIOB 2B4AA 3IMFA 4CL0A 4I6JA 4OA8A 5JDCA 3E5MA 5BQXA 5JCXA 1I2CA 3KYCB 3HCCA 3C6QA 2GQ0A 3FMGA 4HPJB 4LZAA 4RH0A 2W2NA 1L7OA 4P7GA 2LKCA 3N5CA 2JATA 3PRHA 2YXDA 4BP8A 4QGAA 4W8GA 4XYMA 5AJTA 2G7ZA 2VXYA 1Y8QA 1AK2A 1NW6A 4BJ5A 2AK2A 5DASA 4BCBA 4PC6A 5H9WA 5LSAA 1GU0A 4RIFA 2AUNA 3N2IA 5B64A 4QPNA 1JAZA 4PHHA 3CVVA 1TO6A 1CUXA 2AFRA 5B3AA 2BFBA 5L9AA 1GTG1 4W7HA 5JSZA 3W2IA 3CUUA 4IJVA 3RG8A 1GAQA 5EIHA 3PYLA 5EKDA 4TKUA 1QZXA 4MLZA 5AVOA 4DWWA 3H7IA 1NLFA 1FW8A 2IHYA 3QWBA 3D3WB 2X7HA 3C3MA 7REQB 1VE6A 2J1LA 3NHPA 5M7EA 2AYZA 2PKQP 3IRVA 1F4LA 4JHXA 3VR4A 3PL1A 3MJFA 4BV9A 1NM5A 2VPZA 2UZAA 3DAYA 3AONB 3LLSA 2NO4A 4O4IA 1ORDA 1MU0A 2ZEJA 1YRQA 4DV4B 3SR0A 3R8CA 1H65A 3PUVA 3R5TA 1UJNA 3K0HA 2PWBA 4N7RA 4WE3A 2L18A 1T5OA 3T3HA 5K0SA 4PPNA 4WNIA 5E0KB 2GXAA 1RHMA 1XMXA 3D6NB 1G0NA 1DIAA 3I52A 4ZCLA 5LQAA 6ABPA 1LGYA 4I1UA 1MO2A 1KXJA 1Q5PA 4WESB 1UXKA 1H8HA 5ALEA 3EN0A 3THRA 2W6CX 1XTPA 3QQ5A 4QXMA 1SXQA 3WWCA 4UHJA 4KR0A 2GWRA 3AF1A 5EHQA 2JH8A 5HFAA 2CNWD 1N0VC 1JP7A 3AY6A 1NBEA 5TDHA 4FN5A 5B2EA 3RVSA 4V0RA 5C4GB 3AR2A 3ENZA 3N7TA 3OTWA 4QUEA 2PRKA 2FMXA 1PZEA 2CJWB 5DYWA 1QOQB 1VLMA 1HI9A 4QQFA 4AY6A 4BZQA 3U7RA 2IWHA 5DBHX 3FOBA 4CEJA 2LDBA 3AW8A 3JVIA 4EBBA 4HB3A 4QBTA 1QO9A 3PFBA 3PNBA 4NDNE 4QREA 2Z9DA 1RWVA 3I76A 4H15A 3ZIDA 4RF4A 4ZQCB 3E48A 4YRSA 3MBOA 4OM7A 4DS3A 2WZCA 1PDWA 3W06A 2UYGA 3M1YA 1I2BA 4W63A 1N34B 5HK9A 2ZI6A 1E60A 2E5WA 4LV6A 4BXOA 1U8FO 3FFTA 4R1PA 1L7DA 1DUIA 1PV1A 2Q62A 3A4YA 3TQFA 3VHLB 4D4MA 4R68A 4EUKA 3GJ6A 1CDDA 2LWIA 5BUZA 3NATA 1QIGA 2RHJA 4WL0A 3VU8A 3ZGOA 1N77A 1XZIA 3WGLA 1K4KA 1LC3A 4FOTA 4QHTA 3I45A 4YYZA 1GADO 4X24A 4DMGA 4ZTZB 2Z3WA 5IDQA 3T1TA 1YO6A 2OZKA 3QNUA 4Q7QA 1BW9B 1M2FA 1LLDA 4YP1A 1DOHA 1QYDA 2EJUA 1YC2A 4KI0A 5C53B 3O2JA 3OBBA 5JDIA 2ZBFA 4OI2A 5BSVA 1HRDA 2ZQYA 1YI0A 4DHWA 3P9YA 4B6SA 2A14A 3LUAA 4PCAA 1PG0A 2ZB7A 3QI2A 3H1AA 4JY7A 2ZJZA 2V45A 3WLIA 2HZBA 1FFEA 4F0JA 1JSZA 3BE5A 2LNDA 3ZKAA 2VK2A 4Z3DA 2GVZC 3W9SA 1RWXA 4FDMA 2NUAB 3RQSA 3ZZUA 3N0RA 2NUPB 2B7LA 4D0GA 1NURA 3EF1A 3EOBI 3WHIA 4MUGA 1GQFA 1MAHA 2IJGX 3F6BX 4PYLA 2YWEA 3QMPA 5JJBA 3E3MA 1U1GA 2HV8A 5CDHA 1KL7A 2YUTA 2GF0A 1ADGA 1DEHA 3AZOA 3EVTA 1XLUA 3KL4A 8MHTA 2C20A 4A0RA 5HKKD 3Q5DA 5CLGA 4OB6A 3MYRA 4MCAA 3HYRA 1H0HA 3OLWA 4KPFC 1WZEA 5FOTA 4BKRA 4CGYA 3ZVKA 3L49A 4C4AA 3GJYA 2Z2IA 4N49A 4DQDA 1Q6ZA 2W2KB 2FAXA 4MW6A 2R2AA 3KQOA 4NG4A 1LF0A 3F3MA 4YS6A 4BAUA 1MJGM 4ZPJA 2XSZA 2FPLA 3EWSA 1DQRA 1ZMXA 3HA2A 4E7PA 3H4MA 3KUUA 4JLNA 3AMVA 4GX2A 4MQ4A 1L4HA 2ZS9A 1MZPA 2XTZA 4CV1A 3S1AB 1GRNA 2ZYGA 3KSMA 2JB9A 3IX7A 4PHTA 3TRIA 4B43A 1V3VA 2HDOA 1E3SA 4E4RA 3DBRB 2FFRA 1K3UB 1CEEA 4G8JA 1FU8A 3BSYA 5EXPA 1OTXA 3RT7A 2AUMA 1PJTA 1SIBE 4HD8A 4US0R 2C3PA 4L50A 3ZHSA 1J6UA 1P2SA 3CW2A 4EUFA 2YL2A 1R66A 3DDNA 3FPHA 1BVHA 5HTOA 4YP0A 3T94A 3I04M 5TY0A 2G0AA 1KAHA 2IXDA 3JWPA 3PQFA 1ELOA 1FBNA 4PTYA 4ZQIA 4F5YA 5KAPA 4L7VA 2NXCA 1QFJA 4MO2A 4DDHA 4EELA 4EUSA 5KREA 3H86A 3Q5EA 1GO2A 3ZDRA 4JS0A 2VJNA 4GYWA 4FMCB 4UEOA 1AGNA 1KJ9A 2PDAA 3BK2A 2GK3A 3PFCA 2CV1A 5AI0A 2VF2A 4FZJA 4DBLE 4L3VA 4R71A 2AK3A 1Z0ZA 2WE8A 1Z6PA 3MGKA 4AK9A 2D4HA 1QIEA 1QGAA 4R9RA 2JFYA 2VP3A 2GA8A 4WCVA 4RD0A 1X1EA 1DJNA 3MN1A 4XGQA 4MB2A 3L01A 3SOZA 4YRBA 4HGYA 4NECA 2KSQA 3QF4B 4X93A 1W4BA 1O0SA 4I1RA 5IC6A 5BO5A 4HQFA 2PU7A 3LIIA 5A3QA 2JASA 1QRTA 4Y6PA 1I4DD 3GJ3A 1JLLA 1IXZA 3ZBTA 3OZSA 4J0CA 2JLYA 2V6MA 3RYHA 1L7VC 4KEAA 1UMDA 3Q3VA 1XRLA 3ZWQA 3ESCA 1LV7A 4V0LA 2VSQA 3F4LA 3M6MD 3HCEA 3TMAA 4OBXA 1FP4A 1Q0TA 1HLGA 1EM6A 3QEKA 5EJ5A 4QZVA 3A2KA 3OUTA 4LC0A 4UEKA 4PLZA 4HLUA 3WB1A 2Q50A 2NZ2A 1PR1A 1B16A 2RAFA 3R9KA 3B6KA 4ZCTA 4LHSA 3CUKA 5BRJA 1ZXBA 3AHCA 3O1HB 1JA9A 1DBRA 3SQNA 2ZRKA 3GF4A 3ZXXA 5IBRA 4DAEA 3RSHA 3U3KA 1GNLA 2IHBA 2GYWA 4EENA 2HMVA 4X3CA 2BGLA 4H3VA 3FYTA 4F5DA 5CFRA 3SMVA 3EFHA 2YXEA 1A76A 3S27A 4TKLA 3ZPXA 2VJDA 3H5AA 2HWXA 1GPNA 3AR3A 2YVKA 3II6X 1W25A 1E66A 4RTOA 2PX3A 1FC0A 2V1XA 2GI4A 5AW4A 2R62A 1A4RA 4RK1A 3WNZA 4U6NA 5CJJA 4ZO7A 5HZKA 1G0OA 2F48A 1P1RA 2X4IA 4K81B 5IZ4A 1W44A 3IYLW 3K72B 4O1IA 3N8KA 4I1OA 4KNYA 1V4NA 1M2HA 4X9XA 4PAQA 2NUBA 2WWYA 4R31A 4TVBA 4GKBA 1S2OA 3NUGA 4QELA 5LBIA 3V1TC 1Y3HA 2C2ZA 2FSUA 4QDZA 4RMIA 4BJ1A 4OHKA 2F8LA 5KYNA 1H22A 3L0BA 3A6PC 1LVUA 2ZIGA 2C2BA 2Z1DA 1N6RA 2O52A 2W4IA 3CNHA 3H9JA 3KT0A 4Q1DA 2F4NA 2YY5A 4MWCA 4MNTA 5KQGA 1HMYA 4FKZA 2QL9A 4WXMA 4HDKB 5AP9A 1USIA 3U17A 4P33A 3H6GA 1IATA 1FDOA 1D04A 1OPRA 1SHJA 2CFCA 3WOVA 4UFPA 2ZDHA 5F52A 5JZ9A 1UQTA 1WVIA 3O9ZA 3KDPA 1TF7A 4YRKA 3UC9A 1J8DA 3TS1A 1TUGA 3RFUA 4BLPA 4NU5A 3HCFA 4Q7JB 3TDKA 3L9XA 2F3PA 1SVWA 5DHUA 4ZVPA 3F8TA 1XC7A 2HRQA 3OZTA 3H8WA 4IDGA 2EW2A 2ZWPA 1ECPA 3NYIA 4UD2A 1H05A 4DLBA 4ZVSA 2ODBA 2OECA 2NTNA 2JFXA 4YQFA 3DE4X 3ZJUA 1DADA 1M6VA 3ZC3A 1BX1A 4F2DA 2ZJ0A 3QRWA 3GJQA 1SKYE 1BH6A 1B6SA 3QLEA 3FKJA 3NBYC 2IYWA 1MGOA 4ZANA 3MCUA 3HLTA 3KDAA 2BGIA 4NDZA 4RHCA 4IDFA 1XNHA 1L8LA 3GARA 2PT6A 3IP7A 3T35A 3QYJA 4HUJA 3UVEA 3ZWBA 5G0TA 5E6SA 2JG3A 4YRJA 1T9AA 3F8SA 3GLRA 4WKBA 3SIRA 4GOLD 4JU8A 2ZR8A 4MROA 2DKFA 2AWNA 3COSA 1JA1A 2HIHA 3GGGA 4JOQA 2R7LA 2ZUDA 4ONEA 5BNFA 1K3TA 2SKCA 5EXEA 2Y99A 2ZIXA 5FOVA 3K0BA 5ES4B 5K99A 2XZOA 3DMYA 1AXRA 3PX7A 2RGNC 2EBWA 2ZYHA 3VYUB 3WWPA 1OH7A 4IF4A 2BONA 2HX1A 1CDEA 1S2IA 2ZIUB 1W46A 4LOJA 4MVJD 5HCUA 2O0LA 5DMHA 3T9FA 2OENG 5I9BA 3TSOA 1VMEA 3IQDB 1V8PA 3CRVA 5FNVB 1PR9A 1KEEA 1GRQA 3EZGA 3GAZA 1WJGA 2W2LA 4M3NA 4DVJA 3HN6A 5JW6A 1FLVA 1D9ZA 5EPUA 4EHHA 1F5NA 8AT1A 5A4DA 1RJFA 1BEUB 3CONA 4L02A 2CVOA 3IBYA 3FCOA 2C98A 4UJ5A 3ZG6A 1Q7RA 4KSYA 2TRSB 2AW3A 4LRXA 1U8CB 1GL6A 3AVPA 3UMCA 1BHJA 1GEEA 2FRDC 2DUNA 3G6WA 2AFVA 2X0JA 3DHNA 5KNDD 1VXOA 2DHEA 4UNPA 1ZH4A 2FVXA 1BCRB 3DPIA 3ZI7A 5HKLA 1NF2A 2ONKA 4U8GA 2IUUA 5HIAA 4F5WA 2NXJA 1H2XA 2WINI 5ALDA 4RUKA 2FX3A 3DV2A 4LWPA 3K5HA 5EZSA 3HSSA 2X4LA 3HXLA 1I2AA 5LP6C 3EZ9A 2CKMA 5CB4B 2H2IA 3RHZA 3H13A 3PC8A 4G0ZA 4YLEA 3U3JA 4NC9A 2F4VB 3PHCA 1P0QA 3IIMA 4Z7NB 1ZP6A 3A25A 4RACA 3WQHA 1TF2A 5TNXA 4D44A 1JB9A 4MEAA 1NVDA 4FW9A 4MVWA 1FS5A 4B35A 1C30A 2IHNA 4JJIA 3OEED 3WRXA 3G17A 1J97A 4DRYA 4ALLA 2PBRA 2O3UA 3C8UA 3HZRA 1P2TA 4J43A 2QMEA 3LBAA 2A1IA 4IS2A 3BCRA 5ALFA 4URZR 2ZWOA 1RCUA 3GMDA 2PR7A 2P9ZA 2CMFA 2R25B 2J9XB 3M7IA 3ND9A 5EKTA 3VZDA 1EGQA 4LZPA 1WDKA 1CUEA 1CBUA 1XCJA 2AS0A 2HSWA 2VOEA 2ZPUA 3OCZA 2ADMA 4L0QA 2BJWA 4ZI7B 3T7DA 4AM8A 5EHIA 2PMWB 2PY6A 1TYZA 4DF3A 1EFHA 2G71A 3QVJA 3TLXA 3W5CA 2GTHA 1PFQA 2R86A 4PLPA 4ETMA 3PQ4A 3LP5A 5CX4A 4WWHA 3TOCA 2P2NA 4KAXA 2VBGA 2AMLA 2VH1A 1XK6A 4ZOLB 3SDSA 4Z4IA 2Y6VA 3VNSA 3KR0A 1JG4A 5DGHA 4ZHSA 3KEFA 5AM5A 5I9MA 1PK8A 5A4IS 4UQPA 3QWFA 4H1HA 4ZQEA 2X8WA 3O8QB 1CFZA 2H2WA 1DJLA 3QKSB 4MICA 3STVA 1Z35A 4FFLA 5JZSA 1FDVA 3QYPA 1B1CA 1EGMB 2ZWIA 4FMCF 1VKNA 2JCXA 4X95A 1GL3A 1KH3A 2EFEB 5EL0A 4BMYA 4BRZA 5J4VA 1Z7WA 3HO6A 4DOMA 3GCXA 1CR0A 5B7GA 1LX7A 2V97A 3TW8A 4DY4A 2E48A 2PZKA 3N39C 5YASA 5AO9A 3ED1A 2EG5A 5H70A 4EG0A 3BCSA 2WG0A 5TJHA 1O6FA 2XNHA 3DE7X 2VLBA 1NJ6A 2ID4A 4ND3A 3MHTA 2O8DB 1CZRA 2XUZA 3R44A 2IV7A 1NIJA 1GZUA 3SYKA 1NW8A 4I50B 1NQOA 1Z7GA 1P8AA 2O7RA 3CX8A 4ZIRB 1N36B 2BSQA 3ORRA 5KQRA 4L8VA 1NMZA 3TI9A 2ODPA 1NUTA 4H7IA 1GG8A 2ZYUX 2HLNA 2OV6A 4G5GA 1Z73A 5JSYA 2PKWA 4G63A 4P58A 3UUFA 1XDUA 3OEHD 5EIFA 5BOSB 1YHYA 1N0IA 3EEBA 3WWEA 2DBVO 3B48A 2EGHA 4EM6A 3VDRA 1MR3F 1MC8A 2FY8A 1II8A 4XWYA 5EE0A 2AJ8A 3P9QA 1PUIA 4I08A 5GMOA 4BFYA 4A2CA 1N57A 1FIUA 2OXFA 4MR9A 4XSGA 2BHTA 5CFZA 4AO7A 4NX2A 3HYSA 1EDBA 2JGDA 4DQVA 1C3EA 2IZ0A 3K4PA 2PL3A 1ACMA 3B70A 2VUSA 2EP7A 5D3KA 2WIFA 5B2ZA 5JD3A 4CKBB 4B45A 2KBEA 3EVEA 2YZ2A 4AJ4A 2VJQA 1YZTA 2CE2X 3PT9A 2I91A 2LPMA 2XKJE 2WJJA 5JAUA 4XCQA 3TINA 2GHQA 1MQ8B 3D5QA 5DT9A 3IEVA 1Z38A 2DKNA 1GFIA 2BFFB 3FGOA 4JJEA 2ZRHA 2AOTB 2MYUA 4GOJA 4KACA 2D2IA 1Y9JA 3OMLA 1CUSA 4K26A 1ZVKA 1DRKA 2P6RA 3QOFA 3NUZA 3P0RA 3UHPA 1U4OA 2KI5A 3T5PA 2F8SA 2HA0A 2TS1A 2NU8A 4CLOA 4A5SA 4AX4A 2Q4DA 2P35A 4J1SA 3RQIA 5K51A 1NUPA 3RLIA 1E4VA 1L4FA 5J43A 1AKQA 1E1RA 2X40A 1Z4NA 4RIEA 5IVPA 5M34A 2VVTA 3AOGA 1WLYA 3AKDA 5ALIA 2D1TA 2IZZA 1AH2A 2XCUA 3CBQA 3UGKA 3CVWA 2XHEA 3PXDA 1XJQA 1VBFA 3KM0A 2FEOA 4C30A 5CD1A 3GOHA 3EF3A 3OPYB 3H1GA 4A36A 3PNQA 2AKEA 4CTNA 3FAZA 3W8RA 3EAGA 1JJFA 2Q6KA 5BN4B 1KJNA 2OAGA 5ESXA 4H60A 4QYTA 4P4NA 1DBWA 4JYAB 2Z04A 4JP3A 4BNFA 3TDMA 5JCJD 2A6PA 4RJ2A 3BFVA 1NN0A 3LQYA 4UMFA 1XZKA 1RRFA 2PSSA 3J7TA 4ZP1A 3RYFB 2IX3A 2F3SA 2OV1A 4NENA 2WSSD 1RLIA 2IYYA 3IR5A 5A9RA 5KVVA 2QI9C 1X0VA 2YWBA 3MMZA 2H2FA 3GMIA 2C82A 1DLIA 3PFKA 1LI5A 3P96A 1QORA 4YV7A 1PWHA 2FDRA 3EFOA 2G1JA 4LE1A 5FV4A 3DEZA 1YH3A 3ZXUB 3JQ7B 4MVJG 1ZD3A 1S2DA 2QPLA 4CQMA 1EJ6A 4IXMA 4PF1A 4WEQA 1ULUA 9ATCA 4I5EA 1F2TA 3WGJA 3TOZA 3NDJA 2ZT7A 3KU1A 1AKMA 1GZ6A 1NLMA 1H0KA 1TC1A 2H16A 4M7WA 3SI7A 1LXCA 2ZSHA 3IVCA 3NH6A 4I5GA 2AMFA 4IOJA 4QJ3A 1KMHA 5ADUS 2ILVA 1QG0A 3O21A 4C6RA 2XYQA 4IM7A 3JAWB 5BQ3A 3PE4A 1O95D 1F38A 1VPEA 3G9QA 1G9SA 5LLDA 5E9QA 2DGDA 3V3KA 3T5CA 1LFDB 1HE3A 1TZKA 4KO2S 4YO8A 4BQQA 3EVAA 1T2VA 3K94A 3WHLA 2XQVA 2AEMA 1SIOA 2X1HA 2P4UA 3EIHA 4N7JA 1VLJA 4C89A 5KQPA 4H77A 1G19A 2VK8A 2YYZA 3IUSA 4GI3A 3TVTA 3BL6A 5JCOA 5KWEA 3HTXA 4ER7A 1C3OA 3EXIA 2XMBA 2ONCA 4ICIA 4PQGA 4YCDA 3GA0A 5FNVF 2BFCB 1QB7A 3ND6A 4ZQFA 3VR0A 3WLQA 4DNFA 5DRTA 3N0TA 5FLYA 3VKHA 4TTRA 2XA2A 4J7AA 2I3BA 5JXIA 4OQPA 4RJLA 4OSEA 3FZGA 1JSCA 4EPRA 1P9NA 1C0EA 3BK1A 4L27A 4X54A 1YJAA 2IOYA 4LV5B 4M0FA 2FK8A 2W83A 3A9SA 4CEIB 1YE8A 4PPFA 2NW6A 2VJAA 5JZVA 1Q1BA 1OW3B 2DHQA 4AXBA 5DCUA 4X8LA 1T8YA 2QROA 4JBWA 4V0NA 2QY9A 4DR6B 4O2LA 1DCMA 1VLHA 3NZEA 1QFYA 2XQKA 3LX6A 4ER6A 4IDOA 1JI3A 2XNDD 2Z2ZA 5AK3A 4KMSA 1PSWA 3NETA 1HFKA 1R16A 5LVAA 4R0NA 2H2GA 2C9CA 4O4JA 2IEGA 4Y1EA 3ZU2A 1U3FA 1YF3A 4AI6A 2Q2QA 4KXWA 1FPMA 2IE0A 2Y1WA 4NF2A 3K70D 1T2UA 2FG6C 4OOEA 4WX2B 2WDPA 4WVLA 5EFOA 3ADDA 1DKUA 3GRKA 1DPFA 2QNBA 3GZJA 1MX9A 4LBVA 1JAXA 1E1KA 3VGJA 2G1KA 2QORA 4Q19A 2BUBA 1X80A 5HBGA 3WR5A 2CK3A 4X8OA 1NI5A 1JKIA 1O95C 3AF2A 2D1YA 5CCEA 3NXKA 1WIWA 1NMSA 4EB8A 1FUIA 4D5GA 1N5OX 1NUQA 4EGCB 3LRPA 3G2PA 1ZK0A 3R74A 2WP8J 5C7IO 5REQA 1QYRA 1RHJA 1PWYE 2FFBA 3HDHA 3QWAA 5CM9C 3UFBA 3SXUA 1UBOS 1H42A 4RTRA 2W2OA 4BTEA 2VBCA 3KG2A 1Z5NA 2UZ0A 1DL5A 4IDNA 3UMRA 3UANA 2DG2A 1TO1E 1M1YE 3DLPX 4ZOLF 4TKVA 1U1EA 3ETGA 1A97A 2ATXA 3DULA 2FN7A 2V58A 3NYQA 4BVJA 1EX7A 4RDXA 5F9HA 3WHKA 2AC2A 2WLTA 4XUCA 5J2UA 1GQYA 3R9XB 2V7PA 1DKPA 4S3MA 4HNAB 3MS2A 2YHUA 2A9KA 3RT9A 3N2LA 1E4EA 4C14A 1WS6A 3QQPA 2E3JA 4X3PA 3NDBB 1QG4A 3KFVA 1NVGA 4BWVA 1Z7EA 2Q41A 4GF5A 5L45A 1QFSA 4YK7A 3TTWA 1GPKA 4DLVA 1NW4A 2H0AA 3TZEA 4CMAA 1FFYA 1ITZA 3GLQA 2XBLA 4FBMA 4GOKA 5L4NA 1VCMA 3M6LA 5KYYA 2C9ZA 1BZYA 4S1NA 1QZUA 4TRMA 3U37A 3N2GA 1U7PA 4I50F 1Z22A 4GWGA 3ZJVA 4INJA 1I7LA 4KX5A 3E9QA 5CRIA 3K70C 2FSFA 2RI6A 4D9NA 2AJLI 4JZYA 4X20A 4BBJA 4GYYA 3CB2A 4MRAA 5AOVA 3CEMA 1T9GR 3JQ8A 2ZS7A 2D0PB 4F3NA 1JR4A 2B94A 2NZYA 1TMOA 1F51E 4QJIA 4UU1A 1QCYA 3P4YA 4BJ6A 1N5DA 1U6IA 2OV2A 2MDTA 4ALNA 3FBGA 3KKOA 2HMTA 5A4JA 1LW7A 3W9UA 2ROQA 1CULC 1X87A 2WAXA 3ZEAA 3ZIUA 2F3TA 2I7DA 1XTZA 3OIFA 3U3ZA 4B6PA 1H4TA 5ADHA 3S8YA 5IVKA 3IE1A 1G60A 4IVRA 1EK5A 1KS9A 1JKJA 4YUZA 2Q7XA 3G2LA 4LY6A 1EESA 1DEOA 1N3IA 1ZWKA 2CEAA 2OM2A 2OXRA 3C74A 5FO0A 3R7LA 4QDTA 2GEDA 3DEHA 3QYFA 4CKWB 3HYNA 1D8AA 2ACKA 2Z9CA 4GX1A 4BQNA 1VSTA 1JKMA 3DCIA 3CKKA 2DTEA 3HVUA 3GLKA 3V1UA 3KIPA 4JYPA 4O63O 4M1WA 1AUXA 5EJAA 5CFPA 3AX6A 3MTJA 1HDCA 1SWWA 2C31A 4AKSA 5AVSA 3EIXA 1W88B 4JGGA 4UXHA 4N3AA 4YV2A 1W36D 1TO2E 2QX6A 1FYVA 1ZOOA 5HE9A 1NVMB 5EHGA 3VH2A 3SC3A 1OE0A 1Z45A 2XTMA 4CMHA 1XMVA 1BH2A 2BFMA 2JARA 4KXXA 4N82A 4YMUA 2C58A 2SICE 4Q9AA 3ZNPA 3TF5A 3GLHE 1TVCA 2REQB 1HL3A 2CXTA 2B2NA 2G3YA 1MHTA 2VQDA 2YFQA 3HBMA 4J4TA 2I6FA 4JJ4A 3VPBA 2X15A 4RK7A 1LPBB 3ZJYA 3FPAA 3G89A 1V5FA 1Y1LA 4R9NA 4L15A 2QUBA 4XYLA 2I4LA 4AG5A 4RVCA 5C8YB 1X9GA 3N7AA 1XR3A 1AJEA 3D1VA 3I5MA 1Q7TA 2HO4A 3SE0A 3D6HA 2HPAA 4G97A 1MUUA 3AHFA 4B73A 5JY6A 5SYAA 1Y1QA 1DHRA 2I55A 1S1CA 3NT2A 4G89A 4UTOA 1XRMA 4YRDA 3R0QA 2REXB 2QN6A 1L7QA 3HRHA 3LWDA 4AQDA 4F2WA 3ZBUA 4J16C 4B3MB 3OZRA 1WZUA 4EMBA 5BVHA 4JLPA 2V3VA 1E0JA 1F9AA 3F2VA 4UUMA 4ZRMA 2EKQA 4DLZA 3E27A 3RADC 3BSFA 5HF6A 1KYYA 1UBEA 3PXBA 2VUHB 5A7GA 5HCIA 2BH2A 3G0DA 3RIYA 1TT5B 1HYHA 2VP9A 4KCGA 4QDOA 3O73A 1UMBB 4GVXA 2EQBA 5LXTB 3EZXA 3D3NA 5H02A 1B6GA 3NIGB 1J2JA 1EI9A 1LA2A 1NAIA 3BIOA 3NV7A 4HJXA 3TLKA 1BRMA 1E2PA 5I9TA 1MX5A 1CEXA 1U3VA 1P9WA 2ZETA 4INOA 3RIHA 1W36C 1FEZA 1KEPA 3P2KA 4GP9A 4RD4A 4FINA 1ZUNA 1JKXA 5F35A 3U49A 4K0KB 1BGVA 3VO2A 4N3NA 4QYMA 3UUWA 4C08A 1V48A 3OX2A 4LEIA 1VZ3A 3BH6A 3HYCA 2BEVA 3A70A 4CKCA 3MMXA 1OLSB 1XJ0A 5KDDA 4PCLA 2Q0QA 1FVOA 3WGTA 3THXA 1U2GC 3DV0A 1ZEJA 3L6UA 5HFNA 2EERA 5TVGA 3SKVA 4LY3A 3WZLA 2HRRA 4FYMA 4D57A 4GS5A 3BB3A 1FDWA 1OX4B 2YWJA 3GFGA 3KOYA 3MB5A 1OFHA 2HB6A 5LLSA 2DLNA 4DIDA 5HIKA 1G21B 2Q4EA 3ZI4A 4LXTA 4MEJA 5ICSA 4DJTA 2I2XB 2ZE8A 1JQ5A 4UW9A 3KZNA 4WNAA 5FPHA 5IM4A 4HNGA 1K63A 5G3ZA 3JW8A 2OP0A 3VHQA 1DXYA 2X5JO 2Q9CA 3Q12A 4GICA 4UTPA 1TVMA 1TQ6A 5CFMA 1Q7GA 4LXIA 8LDHA 4EY4A 3BXXA 1KMIY 3FTNA 3RRZA 4B84A 4BMVA 5B3LA 1KQOA 1Z2NX 2WP0A 3DLTA 4XB6B 5EZYF 5F4ZA 4CU2A 1N0UA 3ADCA 3NOQA 3ONNA 1S0UA 1X94A 3P0EA 2HBZA 4EG3A 1Y5MA 3EQ6A 1O7JA 4Y18A 1U9IA 4K5QA 1TEZA 3U4MA 4KDFA 3ETEA 1B3RA 2Q8QA 4DIEA 3E61A 3HXQA 3UH1A 4CKEB 1LZKA 3JX9A 1IG3A 1XZBA 2AOVA 2J08A 4IIFA 2DT8A 1WNTA 2NU7B 2ZRQA 4OU5A 4AG6A 3Q3JB 1JDBB 4L5IA 3T61A 1H6DA 1QQ6A 3UOGA 4ML3A 1XGKA 3P8ZA 1IFXA 1YQUA 1PHPA 2PLRA 4KDRA 3WL8A 5LYJB 1Z6ZA 3URKA 3I8XA 1U28A 2DPXA 3LLCA 3QUAA 3X43A 4Q1EA 4UCFA 5H4GA 3R5KA 3EY4A 4MCIA 2UUPA 1A4UA 3GD7A 4PN3A 5JRZA 1YI1A 4MJXA 1FX0A 3ZCPA 2Z58A 4BJ3A 2QW0X 4C06A 1Y3AA 2WOJA 2XCIA 4JFRA 1VECA 3PWSA 2R7MA 1DG9A 1CS0A 1G8YA 3A3PA 2FEAA 2PA0A 5BMOA 4WN9A 4AECA 4M8KA 5J58A 3T1NA 1W9MA 2QGNA 4QT0A 4QXOA 4XPZA 1WP9A 1KMMA 2G80A 3ABZA 1J0DA 5A4FS 5BR8B 1W4RA 2F1OA 2WDZA 5L53A 1OBHA 4CYMA 3HB7A 4CM7A 1DJQA 4FHDA 4IQGA 2Y1CA 3NIDB 2C83A 3IQIX 2J7PD 3PHLA 4BQRA 1AS0A 2F8TA 4TYYA 4RJTA 5AESA 2OXIA 2GK7A 5H59A 5IN5A 4E5VA 3GZ4A 1NVEA 3UMGA 2OHIA 1GTJ1 4LJKA 5F3DA 1EQUA 1ADFA 2D1QA 3I30X 3DOEA 3N8HA 4QUIA 3ZCQA 3SAJA 4KSBA 1RPZA 4JSRA 3MLBA 2ZB8A 3SQXA 4YCJA 5KKCA 5CLFA 2XUHA 3JTEA 4WLNA 1C1HA 1WMBA 2ID9A 1J5EB 4I66A 5BV7A 2GDJA 2PCJA 1HOTA 3ND5A 2FZCA 5GM2A 4D4KA 3MS7A 3KR1A 4BNGA 1H1TA 1C3XA 4M88A 3O8OB 4R9SA 2I4OA 5MN4A 3FDIA 3GRVA 3HXPA 4LOLA 2HLDA 3GUZA 4NTZA 2DCMA 3QXJA 4HWOA 4XOIA 2CDRA 3CBGA 3VZPA 821PA 3F5SA 4LJAA 3PCTA 1PHRA 3D59A 2HZ7A 2UUOA 1RKUA 4ZJUA 1NAHA 2NMVA 4P86A 1PFKA 1MVLA 4HAIA 3OQMA 3TTSA 5JNWA 2J6BA 1MB2A 4CMCA 1EWKA 4TS1A 4ND8B 4HG2A 1B8VA 4QT4A 2JFQA 3MVEA 2R79A 4CM1A 4D8UA 3OCXA 1BWPA 4HEHA 2HF9A 3PPXA 4DZRA 4JA0A 5ALKA 1ZL0A 4EY8A 1XDWA 2VFAA 1TECE 2XTAA 3KO8A 4GOMD 2BW0A 1EM8A 2ZRJA 2CNBA 5KC9A 1MB3A 3QX7A 4BKOA 2IIVA 4ECEA 1OZAA 4KE7A 3FSEA 3D64A 3FI0A 3OJCA 3TW4A 4CZ2A 2PUGA 4UVEA 3THYB 4OATA 4TL6A 1FYEA 5EP1A 2WIGA 1Y7TA 3DV9A 3OJFA 4I19A 2ZJ2A 5EXSA 2HU7A 4CQJA 1L3IA 4KBGA 3EVBA 2O50A 1FXUA 1AB5A 1HE1C 2HNAA 2Y1FA 4GPAA 1T3TA 4CM4A 2QDKA 5H3LA 1Y6JA 3UT6A 2E5LB 4WZ6A 2JIPA 3O0DA 1L4MA 3JQGA 1AA6A 3RDPA 4X94A 4F92B 1REQA 3NEPX 1EBFA 3BGOS 2VYVD 4I4TB 3JWGA 2PLNA 2PKRA 2YFYA 3BILA 1OIVA 4RYLA 4DJJA 3FPEA 4DLTA 5BR7A 1U7DA 5I5EA 3EOAI 2ZRCA 3K2IA 4PSKA 4FOPA 4MPPA 4PCUA 3VYTB 2I66A 3DZIA 4P84A 4UU0A 4OHUA 2P41A 3RVOA 5A9TA 1CIPA 4HXGA 2H5LA 2MSDB 3CLKA 1OB2A 3R8XA 1DC7A 3V80A 3O4VA 5C35A 4MR7A 1UK7A 4AULA 2R4TA 2JLCA 2RKWA 4HDCA 2OFWA 4QYXA 1U7ZA 4XE5A 1R50A 4BNKA 2VK1A 4B3JA 1JIJA 4K9QA 4D4LA 5C8YF 1YB7A 1KVQA 1N8NA 4BN0A 4ME6A 1FYDA 1CLUA 4U9UA 1DVRA 1FJHA 1G18A 3QLTA 1RKQA 4YTEA 3LOQA 4HB4A 1YHNA 4B44A 3F47A 3NJ8A 4N5IX 2XYVA 2C03A 3LYUA 4Q3LA 1X1DA 2Q8PA 5TE9A 3MUFA 3WO1A 5JWOA 1HPLA 1K7EB 1LRLA 1S3FA 2ZRBA 2HCTA 3CV3A 3O03A 5C8XA 3AYXB 2GNPA 3IAS6 4DUPA 4YIHA 1JZQA 1AZSC 2HYDA 5BRNA 3BZBA 3M3HA 4D6PA 4F6RB 2YOGA 5DYNA 1WPRA 2J45A 1GG5A 1GT91 1SBCA 1TXGA 4ZQHA 4Z0NA 3T7EA 1WKCA 2QLMA 4NCJA 2H1CA 4TV8B 6YASA 1KI3A 4HH0A 3TKYA 3LY7A 4DUYB 1NNEA 2GN8A 4MQFA 5AOCA 4B71A 1N5IA 3EXG2 5C8DA 1U0SY 5LXTF 2BFPA 2NPIA 5KYWB 3ZW9A 1OLUB 5DNDA 1DZ3A 3T7CA 2I76A 6ADHA 3OSZA 4WVFA 4CHTA 1KJZA 1XPJA 2CDNA 4IUCS 1HT3A 1H69A 2IZ6A 4GXTA 2Z6QA 1FSSA 1RJGA 3WGYA 2E37A 1DDGA 1P9OA 2P67A 1OXXK 3WGKA 4UREA 3WK5A 3WLLA 2JCSA 2F1KA 1Y81A 2FW1A 1TAGA 1W5SA 2Q27A 2XXBA 5T6BA 4F71A 2H18A 2OLJA 4GNRA 2FWJA 4ZJPA 2OBMA 4Q9JA 1E3JA 3HCPA 4R16A 1BVYF 5DX8A 4B48A 2I8AA 3UMMA 1SN7A 2W6IA 4ENRA 3DTNA 5KQMA 4M4SA 2MSKA 2ZYDA 4AKTA 1J56A 2DBZA 3FROA 4QNMA 1T9DA 2G63A 1GSOA 3W3AD 3TEMA 4I4CA 4IIDA 2E18A 4IKOA 2QTVB 2Z9BA 4XSHA 1JXOA 1LJLA 1H2YA 1ULBA 3AHEA 4QUDA 2GRAA 3QMMA 3V4PB 5IDWA 3IEPA 1CQWA 2RJNA 4GBGA 2BSAA 2EQ5A 2Q5JA 2GB4A 5FOWA 1GA1A 3F7OA 1KOGA 1U2SA 3ETHA 4W9RA 2FKNA 4JVOA 1I6WA 1NHGA 1CUBA 3L7JA 4FHFA 4WADA 1TCCA 3DEFA 2AG6A 1YJ5A 3PVZA 1IQPA 3CUTA 1LLFA 2ZAIA 1FFAA 1QCCA 1RXVA 2ZBDA 1E1YA 4D9EA 1EVIA 2W2XA 2JL1A 3U5ZB 1HR0B 1IWOA 1PS8A 2F2TA 3S28A 5F2NA 1IY1A 3QVKA 5BSWA 1ZM3A 5G1OA 1XG5A 4B5LA 5EG5A 4BNIA 2BPOA 3ZV6A 1SUDA 3BDVA 4A26A 3FCUB 121PA 4RKFA 5BSHA 2B8JA 2V6BA 2XOXA 1NKTA 3COZA 2R97A 4NQRA 4K9LA 2ONJA 3ZQJA 4OJMX 4BLOA 1TZ2A 3P2IA 3N9IA 3OF3A 4V02A 1GG2A 5LYJF 1IZ0A 2WNIA 3CC8A 5DGIA 3UAVA 1FSFA 3W5BA 2MR5A 1E7YA 3CT6A 3E05A 1RRPA 3S68A 3DFIA 1RRCA 3M9WA 4OXXA 1H6AA 4GP6A 5FWAA 3VKUA 3VX4A 4XIIA 5KX5A 1JEYA 1IBLB 3H99A 1UAGA 4OIFA 1H5NA 3VA7A 1TTHA 4O5OA 1G3MA 5CIQA 3ZDXB 3VHXA 1GTMA 4X6YA 5IP5A 1CY2A 1SG9A 4GMKA 4LZOA 2AN9A 4X7RA 1OFUX 3BM5A 2FSPA 5ITVA 2HUPA 1CF2O 4K9SA 3L6CA 5KQSA 4KW7A 1ZA2A 3O95A 1D1TA 2W4MA 3ADKA 4C7JA 4L07A 4JELA 1J8QA 3ZDQA 1JQLB 1UKVY 2NU9A 4D9IA 1ZITA 4JMLA 1RAEA 2HKIA 4HGQA 5FJIA 2H4JA 1NR1A 4MRRA 4BN4A 1QHHB 1M7HA 5CP8A 3RKRA 4PHCA 3CNNA 1T1EA 1QVWA 3AHIA 1EINA 1UDXA 2RHBA 4W7SA 5C31A 1V8DA 3QV2A 1KQGA 3I73A 3BC1A 2NSDA 1TZMA 2A5FA 3G0BA 3AV0B 4JI7B 4M6WB 1CV2A 3OPXA 4FWIB 3GELA 4HQKA 5FNZA 4QU5A 3BRSA 3S7ZA 3VTZA 4H6XA 4RZUA 4WJKB 5ALSA 3TCNA 1MABB 1YB1A 2FGKA 5H1YA 5C1OA 3AHJA 5C1BA 5IASA 3N8NA 4CR8A 1VHJA 1T3HA 2N3ZA 3F49S 3V8PA 1K7SN 3DD1A 4IRUB 2V96A 1XHFA 4CMIB 1EB8A 3CRW1 3R5SA 2GNAA 4LY9A 5D3MA 4UBMA 3KXPA 4GW3A 1USGA 3IKLA 3C3PA 2GM9A 3BKXA 2NIPA 4RV4A 3UKDA 4WBNA 2K2WA 4PPQA 2CHUA 3K71B 1VBKA 3WGUA 3H42B 4Q3DA 2DLCX 2FWIA 1PT6A 3F71A 1AKVA 4K40A 4NU8X 4TM8A 3KKMA 4B9AA 2O5CA 3A32A 4AJ9A 1JFRA 1RYFA 1UBTS 2I6XA 1T6XA 4WT7A 3WLKX 1T0BA 1X42A 3G68A 4HBGA 4V0KA 4WPGA 5BVGA 4H1UA 3OU6A 3DQZA 4LCBA 5KNBH 4F5EA 3S81A 5CK4A 4QYSA 1GPLA 3EC7A 3CM0A 2BDTA 3ZVRA 3TFOA 4US1R 5ECWA 1IZZA 2ORVA 4KAJA 3L7OA 3GEMA 3EGIA 4EABA 5LA6B 2WMOB 2Z30A 4DG9A 4AF8A 2PQ0A 4DLLA 1M34B 1R4MB 3PRKE 1JMYA 3RFTA 4LF5B 3QA3E 3PNMA 5ALVA 1IPEA 3LUHA 3QOXA 4Z8YA 5FADA 4ZJYA 1Z0SA 4ZV9A 1U1CA 1E4OA 4NV1A 2QUIA 1Z6QA 3LC2O 2QD3A 1JG2A 2GCPA 3DWFA 2N75A 2UYYA 1FUYB 1J0BA 3BSWA 1N2GA 3KFXA 3O92A 1F0KA 3OD1A 4I4TF 4QLOA 4RDHA 4UEWA 4UNIA 2CBGA 4YFVA 3U7JA 4LXXA 3GR6A 1F12A 1OF1A 2J7KA 1A9XB 2WI8A 3AETB 3JALB 1NBMD 4IIJA 4LY0A 4DJDC 4AJKA 4F21A 1E1CB 2CFOA 2O7VA 2NV2B 5T64A 4D74A 1QYXA 1GTSA 4C0QC 1ADCA 3QUSA 4IOMA 2ZZKA 1HLDA 3GCWA 4LBWA 4M76B 3CO0S