5KVAA

Crystal structure of sorghum caffeoyl-coa o-methyltransferase (ccoaomt)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
227
structure length
227
Chain Sequence
KSLLKSDDLYQYILDTSVYPREPESMKELREITAKHPWNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDDLIADEKNHGSFDFVFVDADKDNYLNYHDRLLKLVKLGGLIGYDNTLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADERVEICQLPVGDGVTLCRRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure and Catalytic Mechanism of Sorghum bicolor Caffeoyl-CoA O-Methyltransferase.
pubmed doi rcsb
source organism Sorghum bicolor
molecule tags Transferase
molecule keywords caffeoyl-CoA O-methyltransferase
total genus 88
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5kvaA00
1P1BA 3EGVA 3ELDA 5GM1A 3FTCA 4RTKA 2H1RA 2O06A 2PKWA 1BKYA 3CC8A 4RWZA 2QYOA 4C08A 2XBMA 3GGDA 3OFJA 1EJ6A 3UJAA 4FT4A 3DLIA 3ERCA 1Q0SA 1NBIA 4RVHA 2NP6A 1VQ1A 2CMGA 4MTLA 2P7IA 4R05A 5KQSA 5DSXA 3GRRA 1RJGA 4ZTBA 2JJQA 4KVZA 2AS0A 1YB2A 5GIPE 3HVJA 1QAOA 2PLWA 3FPHA 5GWXA 4XUEA 2HR1A 5DX1A 2NYUA 5M5BA 3B3FA 4KWCA 4E31A 2PY6A 4LG1A 2Y1WA 3LX6A 5FWDA 3TQSA 5ICEA 1NV8A 3ANXA 4FSXA 3V8VA 1XXLA 3CKKA 4PYOA 1RJDA 3E8SA 2P3LA 1AQIA 2FYTA 3HCDA 5EC8A 3C0KA 3PFGA 4BP3A 3A7DA 3OFKA 3BGIA 3KPUA 2EJTA 3THSA 2PGXA 3TRKA 2P8JA 1P39A 4HC4A 4C04A 1YUBA 4OBWA 5GOZA 5CIYA 1BHJA 1PJZA 1ZG3A 1I9GA 3ELUA 2Q41A 2WK1A 1KIAA 3EMDA 5DXJA 3T7TA 3DH0A 3HTXA 4Z2YA 4FGZA 2YR0A 3M33A 1VL5A 4EKIA 1VP3A 1YF3A 1JTFA 1BOOA 2N47A 3BWBA 3O4FA 1NW7A 3DXXA 4GBED 1KXZA 2QE6A 3G2PA 3OZSA 3FPEA 1XJ5A 3K0BA 4HSGA 3U81A 4E2ZA 3I53A 4EMSA 3GRVA 3MTIA 2DULA 5JR3A 4GEKA 2UYHA 2ZWVA 2NXNA 2ZVJA 5E1MA 4AZTA 4OQEA 2NNWB 5K0NA 5CVUA 3CJQA 1DL5A 1WXXA 2GS9A 4X41A 2QY6A 1IY9A 2H11A 3HP7A 2HNKA 3LHDA 3EEYA 3R3HA 1D2GA 1YZHA 5LQUA 3DP7A 2YXDA 3OZRA 2CMHA 3CCFA 5CVJA 4YUVA 4CWAA 5DM1A 2AOVA 2ZTHA 3G5TA 4E33A 1FP1D 4P7KA 5DTQA 1NW3A 4RTQA 3DOUA 3UWPA 3CJRA 5LQRA 3TKYA 1M6YA 3A26A 3C6KA 3H2BA 3ME5A 2C7RA 3ORHA 4FSDA 3ER8A 3DLCA 4QQKA 5CVDA 3NTVA 3OU2A 2K4MA 2PX8A 5EOVA 5ICFA 3P9NA 3OPNA 3B89A 2B78A 1P91A 4O29A 5BP7A 4E70A 5U4XA 3BXOA 4RTSA 4KDRA 1VIDA 2ZIEA 2P35A 2WA2A 3DXYA 3A25A 4QVGA 4RVFA 4CTJA 5D1NA 4L7VA 4M38A 5CCBA 1JSZA 2EX4A 3BWCA 2Z6QA 4RV9A 3BT7A 2ZW9A 1XDUA 2GB4A 3G2OA 4MHTA 1INLA 2IIPA 2Z6UA 3UJ7A 2EJUA 3P2IA 5DPMA 1VBFA 5EIWA 5F2KA 2AVNA 4QPNA 4F86A 2EG5A 3UBTA 3C3YA 4OA5A 4C4AA 2FRXA 3P97A 5CUQA 4PYQA 3TLJA 4CKBA 2OY0A 3HA5A 5EZSA 3BKWA 3P2EA 3QOWA 4GOLD 3E23A 2G8NA 2WA1A 5KS2A 2IBSA 2ONYA 3LSTA 2JHPA 4HTFB 3P71T 3DUWA 3I5UA 5DTRA 4XCXA 3L8DA 2C7OA 3FUXA 5IH3A 2CKDA 3MGGA 1PRYA 3IHTA 3NW9A 4QTUB 4YMHA 4WVLA 2DPMA 3TR6A 5HZMA 5K05A 5EKUA 1KP9A 2OKCA 2YXLA 1G38A 2BH2A 2O57A 4U7PB 3KR2A 3HVKA 5KQRA 3KPJA 3TPZA 3AY0A 5LQCA 4RTPA 1UIRA 5FTWA 2I6GA 5LSAA 2H00A 3MB5A 3UJDA 5EIFA 3HVHA 1KYZA 2JH9A 3EGIA 1R8YA 3KQWA 4P7GA 5P8WA 1ZHFA 4AUKA 4DF3A 1UWVA 4E2WA 1NW8A 3KKZA 5EEGA 2ZIGA 4RVDA 5C9ZA 1T43A 4PYMA 3JWGA 4X61A 5EGSA 4DZRA 5FADA 3GO4A 5CVVA 3GJYA 3Q87B 2OPBA 3P9IA 4ATNA 3MQ2A 3CJTA 3NVKI 4ER7A 2JG3A 4PYNA 3M6VA 3KPWA 2GLUA 5KYGA 4RTJA 3KHKA 5LQJA 4PYLA 3VSEA 3WSTA 5E9WA 4OX9Y 5C0OE 4QTTB 3PFHA 2YUIA 3F4KA 1O9HA 1NW6A 1ZKDA 3BWYA 5H02A 2BR4A 1FJXA 1UFKA 1YZ3A 1DCTA 3LL7A 3PB3A 5E1BA 3PLAE 3A7EA 1EQAA 3JWHA 5EMMA 2PVCA 3T0IA 2VDVE 3X0DA 3HCCA 2VDWA 1JSXA 2ONZA 5T6BA 3E7PA 4AZVA 4FZVA 1HNNA 5FHQA 5DM0A 4C05A 3HVIA 2B3TA 3UJ6A 5IKMA 1VPTA 2GAFA 1R00A 3FRHA 3KQYA 3LCUA 4Y2HA 1M6EX 2IP2A 2XYVA 4AZWA 3NMUF 2HWKA 2FHPA 2AN5A 5ERGB 3CGGA 4C03A 5ICGA 3ELYA 2B25A 5EHIA 4ER6A 3EVBA 1KPHA 3AXSA 2ORED 1H1DA 3SGLA 4E32A 3HA3A 5LR6A 5FCDA 2ZZMA 4HGYA 1RI2A 3GIWA 4E2XA 3G8AA 3OE5A 3LDGA 5FQNA 5BW4A 2EFJA 3C3PA 2AOUB 4AX8A 5B1SA 1N7IA 4X1OA 1FP2A 2AOWA 4C06A 1QAMA 2E5WA 3SX0A 2IFTA 2UYQA 2OB2A 1NW5A 1G8SA 1WXWA 2Y1XA 5CM2Z 1NV9A 3VC1A 2IDKA 3TMAA 4B17A 5CVEA 3GWZA 1G6Q1 4V0RA 4P7FA 3EVGA 4F85A 4DKJA 1M0EA 2ERCA 3SSOA 3GNLA 3GDHA 3T7RA 1JR4A 2OO3A 5EMJA 1I1NA 3I9FA 3KQQA 5DT2A 1QAQA 2OYRA 4EKGA 1O54A 4RSRA 3PVCA 3DMHA 3HA7A 4GC5A 4DMGA 4HGZA 4M7RA 3EVAA 2P3OA 1XTPA 5E9JA 3NWBA 1ORHA 4DM3A 1BC5A 3KQPA 3SXJA 4EVIA 5C1IA 4U7TB 5FULA 3TM5A 3IYLW 3RODA 3P9CA 3M6XA 4PWYA 4XUDA 2UYCA 5F2OA 2FCAA 1B42A 3FPFA 2I62A 1SQFA 2QM3A 3DMGA 5E2AA 2HMYB 1RI1A 1F38A 5E8JA 5BXYA 1JG1A 1F3LA 3BWMA 5EMLA 3UZUA 4QDJA 4K6MA 5K0GA 2QRVA 2ESRA 3MAGA 3G8BA 5HIMA 4YUWA 2GA9A 4QVKA 5LQKA 4OBXA 5F2NA 3K6RA 3JWJA 2VZ9A 5EQJB 1G8AA 2G1PA 3KU1A 3MCTA 2AR0A 3MCZA 2ZSUA 3KPVA 5GIOE 3G88A 1NE2A 2VDUE 3HNRA 4CXMA 3MTEA 4PIMA 4POOA 5EEHA 4BY9E 1VLMA 5LQNA 3DR5A 2FPOA 2G72A 3KPYA 3NDIA 4RX1A 4IKPA 2O05A 1EAMA 4KIGA 3PS9A 3R0QA 3REOA 4LWPA 3FPGA 3M4XA 3E05A 2BR5A 3M6UA 1AQJA 5MHTA 7MHTA 5EMKA 1AF7A 2QRVB 4RTOA 2A14A 4G56A 4HG2A 3DMFA 2ZCJA 4GUAA 3BKXA 2AOXA 4KIFA 4HRAA 4RTNA 3LPMA 1G60A 4YUZA 3EPPA 3FTFA 5K0LA 4XUCA 2V74B 4YV2A 2XVAA 2O0LA 1JG4A 1SVUA 2JHAA 4C07A 3KR1A 2PX5A 5HEKA 3UA3A 1R6AA 2ZLBA 3LCVB 2ZULA 3NDJA 3GU3A 9MHTA 4LECA 3SSMA 1JQEA 2KW5A 5EHGA 1SUIA 3B3GA 1SKMA 4RTMA 1KR5A 3ER9A 3KQOA 2F8LA 2PJDA 1RI4A 5E2BA 4KDCA 3OCJA 2Z6AA 3FUTA 2PX4A 2ZZNA 1U2ZA 1L3IA 2VP3A 3R24A 5K0CA 4PGGA 4A6EA 3ID6C 4IV0A 2AN4A 4ER3A 4IV8A 4PONA 1N2XA 1X1AA 3SR4A 1X19A 2PXCA 3I58A 2IDJA 3OU7A 4MQ4A 2OB1A 5DTMA 2YVLA 8MHTA 3HM2A 3KR9A 3EVFA 1XCLA 1XVAA 2OZVA 3FUWA 2PBFA 3GXOA 3OE4A 5GP1A 4M36A 3EGEA 3FYCA 3KQTA 3SSNA 5K8VA 4F84A 3GCZA 4R8SA 1SUSA 1D2HA 2PWYA 5EZQA 1VP9A 2ZBRA 3UJCA 2FK8A 3AXTA 2AVDA 1WG8A 2YTZA 2ZWAA 3G7UA 4X63A 4A6DA 4JXJA 4R6XA 4R6WA 3LKDA 3KQMA 2V7EA 3VYWA 4ER5A 4KW7A 3BUSA 4YUYA 1EG2A 1JG3A 1MJFA 2NXCA 3LKZA 3TFWA 4P58A 1TW3A 3KQSA 1X1CA 2PT9A 3EMBA 4QPPA 3UJBA 3A4TA 4PGHA 1QYRA 5HFJA 3TOSA 4BLWA 4GOMD 3DXZA 2P3QA 4GC9A 4E30A 1HMYA 1L3CA 2CWWA 5HIKA 3THRA 3LBYA 2NXJA 2ADMA 1JG2A 2PT6A 3D2LA 2BR3A 5HILA 1XDSA 2P41A 3ELWA 3G89A 2VS1A 5EG5A 1KYWA 3BGVA 5FA5A 5K09A 2IH2A 1O9GA 3EVDA 4BP1A 1RJEA 3AWIA 4DQ0A 2ZZKA 2YXEA 4RTLA 1Q0TA 1MHTA 1L9KA 1R74A 1X1DA 2IH5A 3S68A 3LECA 4GOND 1V39A 2AZTA 3M6WA 4PCLA 1D2CA 3KQVA 4FP9A 4FT2A 2I9KA 4FR0A 5FA8A 1YFJA 2YX1A 5GM2A 1KHHA 2FK7A 2R3SA 2C7QA 2BZGA 2C7PA 5ICCA 3PX3A 5LQAA 3O31A 5DX0A 5DRTA 4E2YA 1KPGA 4WXHA 1EJ0A 4M37A 5K0FA 1JQ3A 4RTRA 1QZZA 4BLVA 5HOQA 3I64A 2ZBQA 5E9QA 1VE3A 1JQDA 3B3JA 3GRUA 3UJ9A 3P2KA 1WY7A 2PV0A 2HTEA 3HCBA 3G5LA 3T7SA 2GPYA 1YFLA 2AOTA 3G2MA 4RYLA 3TKAA 4YUXA 3GRZA 1ORIA 3AJDA 2P1DA 4OA8A 5K01A 10MHA 1EIZA 1WZNA 1G55A 2PX2A 3FUVA 2P40A 3UFBA 1OR8A 5JUWA 4DA4A 5K0JA 4HH4A 2O07A 1Z3CA 3SVZA 1TPYA 2PXAA 2G71A 3HEMA 4HTFA 1FBNA 1AV6A 2AOTB 1QANA 2B9EA 2UYOA 3NVMB 1SG9A 3LCCA 4MIKA 1NBHA 1P1CA 3TM4A 4YMGA 5FWAA 3IEIA 4DCGA 4Y30A 4FS8A 3P9KA 4R8RA 5GINE 2NXEA 5DXAA 1IM8A 3B5IA 2XYRA 3QV2A 3G2QA 4KRGA 4QDKA 3EEOA 3BGDA 5CD1A 2G70A 3Q7EA 5DM2A 5DSTA 5G02A 4PCAA 2OXTA 3FPJA 3HCEA 3MERA 5HIIA 4MWZA 5KVAA 2B2CA 3A27A 3EVEA 3NWEA 1RJFA 1IXKA 3FUUA 3FYDA 2ZFUA 4ER0A 4LWOA 1FPQA 3NJRA 4ISCA 3JWIA 2XYQA 3C6MA 5EVJA 3FZGA 5CCXA 3RW9A 3UA4A 5DLYA 2YQZA 5DX8A 5T67A 1WS6A 4X60A 4IWNA 2IH4A 3CBGA 4CKEA 1ZGJA 3FTDA 3LGAA 3PT9A 3UJ8A 2R6ZA 2IGTA 1X1BA 4PYIA 2GH1A 4YV1A 2BM8A 2HV9A 1N7JA 5FUBA 3SM3A 3O7WA 3OU6A 5DRYA 4OQDA 2AOUA 1R18A 3HCAA 5HIJA 4H0NA 2ZBPA 2IBTA 2NP7A 3CVOA 4YV0A 5K0BA 2PSSA 3R9XB 2PXXA 5E1DA 2PWPA 4GF5A 2UZ4A 3KR0A 4BLUA 3SMQA 1TW2A 2IPXA 2JH8A 3GRYA 3P8ZA 4NECA 5K0EA 3FTEA 1L1EA 4GOOD 4RVGA 3HCFA 4UOEA 3DTNA 3QOXA 2JHCA 3RIEA 4EQZA 1I4WA 5BW5A 4CTKA 3LBFA 1RI3A 5T64A 3LDUA 1ZGAA 2AN3A 3EVCA 3V97A 4EK9A 2BM9A 4PNEA 5EPEA 2CL5A 3VC2A 3R6TA 2ZIFA 5DWQA 1SQGA 2XVMA 1KPIA 5FHRA 3DULA 5E8RA 5E1OA 1L3BA 3OZTA 4AZSA 1DUSA 3M70A 1Y8CA 3PTAA 3MHTA 4DCMA 3PX2A 4PYJA 3B7PA 4QQNA 3LDFA 3IV6A 5EKXA 5FQOA 4V0QA 4CKCA 5D1HA 2OBFA 5K03A 4PIPA 1XCJA 3BZBA 1RI5A 3EVZA 1R8XA 2LD4A 4PYKA 1NKVA 4P7JA 5DM4A 1NT2A 1JTEA 1ZQ9A 2I7CA 4GQBA 2P7HA 3FRIA 1XDZA 4PINA
chains in the Genus database with same CATH superfamily
4YRBA 1OX4A 1ETHA 3VC3A 1A97A 4IIYA 1NC1A 2PX0A 1U2SA 2YWGA 1T2DA 2QLBA 3FMPB 1UJ6A 2H1HA 2O1XA 5EP2A 4M83A 2QZ9A 3T15A 2IWHA 3NHPA 4EG4A 2Q45A 3OIUA 1G2OA 3THYB 3EE6A 1NLMA 1EDDA 3OQIA 5T4BA 1FU7A 4CMCA 1VSQA 4M9UA 5JZMA 2XCLA 3ZDEA 2PLWA 4JVOA 2RH8A 1UBNA 2DPLA 4NBSA 3HFGA 3E6AA 3E3LA 5DX1A 4YMLA 4MWTA 2HZBA 2YW2A 4M1QA 1DJLA 3EULA 4LZWA 4BFLA 3T5AA 3PENA 2IQIA 3G82C 3JYOA 3LFUA 3MB8A 1Z56C 3A3PA 5DP1A 2WQ7A 3OZWA 1XAHA 1CC1S 1KS2A 1Z5OA 2V1UA 1U0SY 1VTKA 4INAA 3D6HA 1SA0A 4AC9A 4UU1A 1CUUA 1K7SN 1EZ4A 1VG0B 3HKEB 1R0CA 3D0RA 1NURA 4G23A 3U1BA 4JYBA 3D3JA 4Q0MA 1X80A 2PRYA 1WZIA 3GLVA 1RKBA 2WIBA 3Q88A 6Q21A 1MA0A 3B6IA 4PBRA 1YS2X 2XXAA 2DM6A 4P80A 4P3YA 2ISSD 4DE5A 3RKUA 4EKIA 1SKYE 3PHBE 4EZBA 3TIGA 4X91A 4KITB 1P2TA 1G5PA 1SVOA 5F2EA 1SUEA 3I3SR 3OZSA 5C53B 3C7KA 3EZ2A 2QZJA 3U81A 3VYTB 4CLXA 1CY6A 3I53A 2YYZA 1XZFA 3BVPA 3I73A 4URHA 1QRTA 2ZVJA 3FOFC 4AZTA 4OQEA 2I80A 1WXXA 2PSJA 4ZEXA 3VMFA 2QY6A 2G83A 2D2FA 4GXTA 3B20A 2AZ4A 1DC6A 1D2GA 3I30X 3OZRA 2H9IA 4WLVA 4YUVA 5I7RA 2ZM5A 1YVRA 2JIZA 1H93A 2IZ5A 1W4AA 2OG1A 2XE8A 2HRZA 1F48A 4L9AA 3A0RB 4OP3A 4YT5A 3L05A 5JPIA 3WKAA 4B0PA 1QG0A 2HK8A 2HYIC 1WLYA 3DTYA 2AMLA 3INNA 5JRZA 2IA5A 5T6MA 1Z88A 2C7RA 4IJ6A 1V11A 1NI4B 3MINB 2C88A 1QFYA 3KT0A 5EQFA 3REQB 1EVYA 1A9ZA 4CR8A 4LVUA 1KEWA 1KI6B 5IDYA 1KQGA 4LRYA 1RXUA 2EEZA 4ZQIA 4D43A 4G85A 3ORFA 1FS4A 3LNCA 4U2GA 2FUG6 1YI0A 1U1IA 3DEYX 3VISA 4D3ZA 4UOZA 1ZD1A 1Y5NA 3VR6H 1CFZA 1QMGA 3KIPA 2IIBA 5I4KA 1F2TA 1VJ1A 4G67A 5IULC 4JZKA 5DNVA 4ITRC 1IZYA 1DC5A 1Y3HA 3AWDA 4J76A 1RT9A 1Y1SA 2AVNA 2FU5C 4QPNA 5DZSA 4J4HA 1OKKA 4MCAA 2W2NA 5AI5A 4C4AA 4UEQA 2PBRA 4Z6KA 1IRXA 1PHRA 2YCLA 3EK2A 2Z6UA 2G8NA 1OIVA 1H2WA 1E63A 1TA0A 4JP2A 3AINA 5TJ9A 1KJQA 3ONNA 1TB4A 2IRWA 5HRUA 1DTWB 3GLRA 1VMEA 1EVJA 1FRZA 2I4LA 2XMPA 3DWEX 3KB2A 3LUFA 4Z4QA 2CKDA 3MGGA 4IF4A 4BO5A 3I1IA 4YMHA 4QUDA 1GGMA 2NWQA 4PRLA 2I6UA 1XXHE 1U8UA 1PVDA 1ZAYA 1O2DA 2C92A 2VZ0A 4M9SA 4ZAYA 3U0VA 1JFRA 3L6RA 4IXMA 3GUYA 2EOAA 3G02A 3TPZA 1XWWA 1TADA 2O19A 4FBMA 1GAEO 1NQOA 4C7MA 3DDOA 1WXEA 3AUSA 1QM5A 1PIWA 2C00A 5K3FA 3L92A 4EP1A 5EIFA 3A05A 2X2PA 4MYTA 1R8YA 4DPLA 5HX7A 2XCTB 1CTQA 3Q11A 1KTVA 4P2BA 3G0OA 3PICA 4NCIA 1NLUA 1MB9A 1YSCA 1E2HA 3PR2B 1E92A 2WP0A 3L3BA 3OTHA 2B4YA 3QVSA 4JCOA 1RQ7A 3ZWNA 1WD5A 3VU8A 2OPBA 3P9IA 1P7CA 3CJTA 4JI5B 3WK6A 2Z8YA 4WK4B 2Y27A 1PR0A 1KK2A 4NPHA 4LJ7A 4QHSA 5AFSA 4PLWA 4UULA 1UXHA 2ZS9A 4I9HA 5IUKC 5DNYB 4OX9Y 1DO0A 2P6UA 3HZRA 1R10A 3DFKA 3RFTA 4B2IA 3KQUA 5DTJA 2CGEA 4MWBA 4BU0A 2M6KA 3V4OA 1CYEA 1NW6A 3ROKA 4K87A 4KDEA 1BGXT 5F98A 1K8RA 3B1WA 1TA9A 2ACVA 2DFNA 4WCFC 3FCEA 4XX0A 4F3NA 4HD8A 2FG6C 4COKA 3M4ZA 4G5FA 4DJFC 1EQAA 1LK7A 3ZXSA 1P60A 2RAPA 3M83A 4DDWA 1Z7WA 3IKVA 3KK0A 5DBGA 5ALLA 2PBZA 3C7DB 1O77A 2JI8A 4Q7LA 2Y3IA 2CYAA 4MUYA 2GAFA 1R00A 2ZB2A 4IX9A 4B3BA 1KK0A 4PTYA 4RIHA 1XA3A 1JR6A 1E64A 3PHLA 4K9DA 3S29A 2M6RA 2QPOA 1EBUA 1KZHA 3NTXA 2FPPA 5EMNA 5CJ2A 1I4DD 4CQMD 3TIFA 4NK5A 1CUHA 2EP8A 4J29A 4MQFA 1NVVQ 1ZNZA 2VCHA 2GYYA 4RGQA 1XTSA 1AUXA 2VDQB 4KACA 5K03A 5H4HA 1UBMS 4DV4B 1I2ZA 3Q1LA 3I09A 2ZAIA 4OXXA 1NV9A 4J0HA 2IDKA 4JLNA 1N34B 3DTVB 1DCMA 3RVJA 2VWPA 5K6AA 3CO5A 1OB2A 1EK0A 1KZ9A 1PVOA 1HDCA 2DE0X 5K8LA 3IP5A 4MCJA 5G1NA 3KAQA 1S1MA 2DXIA 2DR3A 2G0AA 2I2BA 3VNBA 1ZI6A 2YJ6A 3K1AB 3ZC3A 1V1MA 2PS1A 5GGXA 1IHUA 1E6UA 4WCDA 4ZREA 3VVMA 4BN0A 4TYYA 1RSZA 5PGMA 4DM3A 5HSGA 3QWIA 4EI8A 4U7TB 3WG9A 1J8DA 4GBMA 4D79A 4FHCA 4LDQA 1QZ3A 3T7KA 2O8FA 4IXTA 1T34A 1W0CA 2JJ8A 2I2AA 4MARA 4DQXA 4X97A 4PLYA 5F2OA 3ZI0A 2UYCA 4GX5A 4BGIA 4EY8A 3P9XA 3LZCA 3RLIA 1W5AA 1JIXA 5JG7A 4ECEA 1CUEA 4EA8A 4G0MA 4EEXA 1BGVA 2BSQA 1GLNA 1A2BA 5AICA 3EB9A 3UZUA 3UMCA 2I33A 4PC3A 4HB4A 5CHEA 3PUZA 2DJ5A 4IWXA 1AB5A 1EGHA 3FDIA 4LVCA 5BWMA 5IYZF 3LO5A 5JO9A 2YJNA 2H0AA 1UFOA 3W8RA 3PUXA 1T5SA 3GBPA 3K70C 1TZMA 5JJCA 1CY8A 1NQVA 1JT9A 4F04A 1WF3A 1WF6A 3OIGA 4LF8B 3TLKA 1TIKA 1RQNA 3MJSA 5FBRB 3IO5A 1DAGA 3C1AA 2EQAA 4LDRA 1VMAA 3E22B 4CM4B 4F4UA 2J0UA 4UVIA 1U1CA 2IGBA 1SFRA 4CFYA 2B9VA 4N4AA 4YJHA 2CHQA 2Q2WA 2XUZA 2H8KA 4G56A 2C1EA 1P81A 2WKSA 3C24A 3LRTA 4GUAA 2V55B 3ZV6A 1GIAA 1JXMA 1ISJA 2AOXA 4BLTA 1QP7A 1S7GA 1G42A 1QHYA 5AVOA 3IELA 1RWOA 1CSEE 1R4MB 2HJVA 5KSWB 4EGQA 2IXEA 3EGOA 4BWFB 3UA3A 5HEKA 5KU7A 3H11B 4AMVA 3NAGA 3UMGA 1N6KA 2X8LA 1FQJA 1RNLA 2KS6A 4ZANA 1VIMA 4PQFA 5CGQB 2O8FB 2VL7A 2WKWA 2VPIA 1PEKE 4TTSA 4BNVA 3ZW9A 1EEHA 3FVQA 3GVCA 3L4SO 1OASA 1WTAA 4DYHA 2QS9A 4KGVA 3L0YA 4PAGA 2C57A 3AHGA 2ZZNA 3IB6A 3PWSA 3SIXA 1HYEA 3TDMA 3VO1A 3HXTA 4IJMA 5FYQA 4PBSA 2V96A 3HB0A 4MEBA 3SYLA 1KQ3A 3F6YA 2WBLC 2AN4A 4ER3A 2JEOA 5KJ1A 1IBSA 3F7MA 1XTBA 4L08A 2Z1MA 3CSDA 4P86A 1IOVA 1KI2A 3ASVA 3DPUA 3I58A 4PFJA 4PS1A 4RSGA 4FGJA 5DOVA 4R0MA 1TEZA 1OZ0A 1D4FA 1RM4A 2CBGA 2ZBDA 3CE9A 3RNOA 2JF0A 2HLDD 4BJ6A 3T9EA 4TV9B 2GVZC 1KK1A 4N0QA 5BYBA 1WB9A 3GWGA 1HE3A 3AVWA 1JKJB 2A9VA 1NMYA 2HBRA 3A3YA 4FC7A 4FVTA 5BOVA 5ED4A 3CVJA 2H1WA 1ATIA 2SHKA 1J00A 2WFLB 3O8OA 5L51A 3IQDB 3LT0A 3TSWA 3T35A 3UXEA 1JG3A 4ZMBA 5BT8A 3S8MA 4B46A 3LKZA 1RRKA 3PD0A 2JD0A 3JAWA 5EWLA 4RD4A 3PD1A 1ACJA 1B6SA 2GAJA 4WFIA 4ZAGA 4EG1A 1R88A 3OZFA 3RC8A 1SXJE 1OT3A 1FFAA 4IEIA 4DNXA 5C32A 2E55A 2ZRJA 4KE7A 1RQ2A 3ZQ6A 2WC1A 2VH5R 4HTAA 4NFLA 4HL6A 1P7WA 5JV5A 1GAXA 4HDCA 1QMPA 5ALOA 3H2GA 1GILA 1VHWA 2B20A 3HB9A 4BMSA 4EH1A 2ZRCA 3HXLA 3BGVA 3NBFA 4F9TA 5I7EA 1FW6A 4J6FA 1RJEA 3I2KA 3MTDA 1GARA 4MYSA 1A8IA 4YP9A 1FNBA 2R86A 3BH0A 3UM9A 3CNEA 3KU4A 1H6BA 3ZZMA 5T41A 5I7AA 2JKYA 4LDAA 3GEGA 1NAHA 2XH8A 1ONSA 3M6WA 3NHWA 3GJTA 3NIGB 4FP9A 4PX3A 4G25A 3O90A 5IK2D 5JMOA 5LWHA 3SQLA 1WNFA 4DQKA 1IN7A 4BGDA 2CXUA 2JAUA 1UBLS 3G3EA 1Y8ZA 4MV6A 3BWVA 2C7PA 3RE1A 1ZEMA 1JH9A 2M32A 1V95A 2FFHA 3KSMA 3TLAA 4DV3B 1M1YB 4JL5A 3DLAA 3GT3A 2VRCD 4DLLA 1P2FA 4BLVA 3W9BA 3AF5A 5DCWA 2MSNA 4WNAA 5BSRA 3SHOA 1KVTA 1SBHA 4HNAA 4N3AA 1I7QB 2HTEA 2PGJA 1LQTA 1Q74A 4HLDA 1PZXA 4PV7A 4N18A 1YFLA 4BFCA 1U6IA 1UKBA 3G2MA 4OHPA 1N0VC 1BMDA 2WRZA 5E0OA 4MCIA 1QGUB 3CLTC 4JR0A 4BLSA 1G55A 1THTA 3FUVA 4ZIRB 2JGDA 3LC7O 3IXQA 3TCKA 2NVUA 1OR8A 2G77B 1A5SB 2CFIA 1GR1A 2Q46A 4LHVA 5CH8A 3HU1A 1I80A 2E85A 1TPYA 3I9V6 3VHQA 4IDCA 4XIIA 2G71A 2J0SA 3D1LA 3S7TA 2OO5A 4EZEA 3E22A 4XWGA 1QANA 2W2QA 2B9EA 3G0IA 4N0DA 4Z99A 5GJCA 1G8FA 3QPWA 4QZVA 1S3FA 1MBZA 2BGLA 3TK1A 3HDQA 4FDMA 4F60A 1ISFA 2D2XA 5JY1A 4NBWA 3PNSA 3QFFA 5BR8B 4J3JA 2I7VA 4BO1A 4OXQA 4PICA 2HMUA 1M5TA 4M0UA 3QV2A 4XQ0A 4MAAA 2HHLA 4LHSA 2PUHA 4BVLA 4EUSA 4M76B 1HWYA 2WQ6A 3D7NA 3W90A 3STYA 4KR2A 1RJ9A 2QP9X 2X14A 3BSSA 5J2TF 2VNHA 5H59A 4IVNA 5DM2A 1G16A 1II8A 3BYZA 5FI3A 3QYPA 4YXWA 2OXTA 3ZGOA 4AD8A 5I6DA 2WOJA 5IFKA 4R7ZA 2ZTLA 1JIUA 2XMDA 3G2LA 3HBJA 2AT1A 3EVEA 3R3SA 2Y05A 2IKQA 3K4PA 3QUQA 4G5RA 4L85A 1U4OA 1KVSA 4A2QA 5THKA 1K8YB 3HXQA 3GH3A 2XTJA 1PKXA 4TT3A 1Z63A 4WZBE 3CE6A 1NHGA 3I61A 3FZGA 5ALJA 1RE0A 3M9WA 4PPYA 3SJCA 3RVRA 3VBCA 2GRUA 3W6ZA 1MJHA 1KI1A 1VL2A 1T2VA 2B1RA 3GJRA 2IU4A 4HDKA 4NATA 4X60A 4V38A 4FS3A 2VQFB 2X6TA 4HYQA 1K88A 3C87A 4RHFA 2BGMA 2W4MA 4PYIA 2AFHB 4X0EA 4BCBA 2P2DA 3VVLA 2GLTA 2X4IA 1CZOA 1Z0FA 5I51A 1J22A 4TZ6A 1BDHA 1GAJA 5BMOA 3BULA 3CY6A 2Y93A 4QSMA 2P75A 5AVJA 1ECPA 1ISPA 1EFVA 3EFHA 4ZGGA 2VTBB 2QUIA 3TG2A 2YN0A 3KR0A 2MU1A 1VYHA 3ABSB 4DZTA 2ZWMA 3OPQA 1U0LA 1YFZA 4NBUA 5CPFA 2VYFA 1GV1A 5JH7B 2QTRA 1NIJA 5D3MB 3WBBA 3Q7RA 4EFKA 1XYYA 1DFIA 2IF2A 5T64A 3FHLA 3EFOA 1Y5LA 2C4TA 1YONA 4EPWA 3HJRA 4RJJA 1WHSB 2R7KA 4QUIA 4D9MA 3BXPA 2WAOA 2YWRA 1D8TA 3IEPA 1X80B 2JFXA 4F5YA 4JXZA 4UBMA 3SQNA 4S1VA 4J0IA 3V4ZA 3BL6A 4BWVA 1CUSA 3FNQA 4AWAA 4DCMA 3WB9A 3L5KA 2F3UA 1U80A 3G0GA 4XUGB 3U7RA 2B1QA 5CCEA 5B58C 4D4KA 5EP3A 2XZDA 4WFJA 4K9SA 5AOVA 3RRYA 4J0KA 1IIBA 4CIBA 3VZPA 3DV9A 1V6CA 4O8ZA 1RCUA 1K0FA 1LLCA 1U90A 2Z9CA 3TB4A 4C08A 2J5RA 4MPPA 3ZI4A 4M9ZA 4G0YA 1VBMA 4HQRA 4QPDA 3L0DA 3O91A 4FT4A 4W8HA 4EMTA 1DWQA 2ZR9A 1G98A 3MWEB 2PH3A 5G0UA 3R3UA 1BH6A 1MAVA 1I10A 4IW3B 4X00A 5H3CA 4AKIA 1CRLA 1L6RA 1PFYA 1SG6A 2I3AA 4E5NA 3HYNA 4OP1A 3PDHA 2G06A 4RACA 1UQTA 4RZQA 3L6OO 1X94A 2XNJA 1RR6A 5ALFA 4CKXA 4NZMA 3WK9A 2F1RA 4ZVOA 2Y1WA 3UPUA 3GROA 1L4LA 1NV8A 3LY5A 4C4PA 4UTNA 1PK8A 3COJA 1XN1A 1ZOPA 2QR2A 1TQ8A 2BLLA 5D3MA 5AKXA 4Z4HA 1Q14A 2AH5A 2FVXA 1ISGA 2NUAB 1AGXA 2KWIA 2VK4A 3K1YA 4C4XA 3T5TA 4DMCA 2IUFA 1H2BA 3N3BC 4OJKA 5JZOA 4HUQA 4X44A 2JLYA 1GEEA 3R8XA 2WU3A 2C3PA 2OHXA 1T5TA 2XJ4A 3VGPA 3WGNA 1BEEA 1DTEA 1JR2A 3LFHA 1SKQA 2HMWA 2VXYA 3K35A 4GZMA 2ZSKA 4JK3A 1CRPA 2WTNA 1H65A 2H5LA 5E38A 3QX8A 4KQWA 2BKAA 4WK2B 4DCVA 4MKRA 3DL2A 1WQ4A 1GOTA 2Q5JA 1DG1G 3CZ9A 3G2JA 3O26A 2FZCA 2O50A 3D3NA 2WLTA 5DVZA 4TMVA 2L42A 1Y1PA 2PXHA 4GM4A 1HUQA 1KAEA 2HIHA 5HKBA 4E2ZA 2I22A 5ESRA 3RT9A 5B4TA 4AKHA 1ADBA 3M6MD 3F78A 3QFSA 3QKWA 3VOAA 5JR3A 3K96A 1RXIA 1XZMA 2OESA 2ZIZA 3NUQA 3QU5A 1X14A 4F6RA 1SCIA 4M0CA 2IYPA 4FDUA 2FW9A 4ND5A 2PO5A 3B78A 4D3FA 1OU0A 3R3HA 5M04A 1APBA 2NPFA 1V7PC 3HHEA 2F55A 4R41A 2JJMA 5AOBA 5CG1A 3IO3A 3DPSA 3T4EA 2P91A 3FVVA 3F97A 1Y33E 4FILA 3P94A 3OEHD 5AJHA 3Q40A 2NQ2C 5JTTA 5AXCA 5B7QA 3NHZA 3PDCA 5B3AA 5CFRA 4M53A 3UQYS 2QXYA 4JD5A 4BJHB 5ITWA 3HNPA 1M1ZA 3LRXA 4OTZA 1RPTA 2MT9A 3I76A 4GNKA 5HF9A 3ROQA 4D42A 4W1PA 3E9RA 4IY1A 3K05A 3WRVA 3BZWA 1XCBA 4PSUA 1XZCA 2XA9A 3DB2A 1T6NA 4R5MA 5DBHX 3NHRA 5KYWA 4NARA 2Y8EA 1D6SA 4QOJA 4G84A 1YUNA 2W6QA 3PDUA 5FR2A 4C43A 4Q3AA 2WV9A 4J0CA 1VBFA 2VI5A 1B8UA 1LF5A 1KI7A 2WF8A 2G5CA 3AK4A 4N0EA 4ESVA 1GKKA 4F86A 3UBTA 5CLLA 3WL7A 4C01A 2OY0A 2E4XA 1CY1A 2IBSA 2XE6A 4K6HA 5AJZA 1FDWA 2X5JO 1N5DA 4RVOA 1YOBA 1M74A 1PW5A 1GTSA 3AOGA 1T3GA 3UT5A 1NP3A 1AGNA 1E4EB 1JYEA 1ZRHA 1LTHR 3EZLA 3FWHA 4LMBA 4MB6A 3T3MB 2XEDA 3VPCA 3ZN2A 1QZUA 1NGSA 2EVWX 2O2JA 3K0KA 4HWSA 4U7WA 4CEJB 3AO0B 4WVLA 3GP8A 3EPLA 2JKZA 5EQTA 4CMJA 2CFOA 2CMFA 2N1BA 4BYGA 2GX6A 1SOUA 4N65A 1AUPA 4OI1A 5KQRA 2PQ0A 3LK6A 5B6PA 4YXFA 1YTLA 3B1ZA 3HUUA 4GECA 1S01A 5DWDA 3ZBPA 2WHEA 4JV5B 1I6KA 1POXA 3W2IA 1N33B 5KYTA 4XD7A 2V7BA 2DUUA 3EGIA 4KWTA 2QRLA 4TT8A 4IIFA 1ZHFA 3OTQA 4CM9D 1CNEA 8ADHA 2QQ5A 1JLRA 1SUDA 4X61A 2BJVA 4JJ7A 5JSHA 1NJ6A 1SURA 1U3CA 5KYXB 4AJHA 3WLTA 2VJYA 1Y3DE 4KR9A 4IIHA 2P9EA 3E0QA 2NTJA 2YL2A 3C3CA 3H7AA 5EZ6B 1ID1A 3GFGA 3E48A 3WZ2A 1E18A 1XEXA 2VNKA 3FCSB 4OI2A 3QPAA 5DEOA 4AUNA 1WU8A 3KOZA 2WJAA 1B0PA 1QWSA 3GRAA 3PPYA 2EL7A 1C0LA 4JVSB 1FK8A 2YN4A 2GPBA 4N7JA 4WERA 3U62A 1DCTA 4IM7A 4AYXA 1P3Y1 3C16C 3EQ7A 3T0IA 1GL9B 3WL6A 2P9QA 4DN6A 3CZQA 3MNFA 2EJCA 4S1NA 5CLQA 5TQ2A 2NO0A 1PF7E 1T9GS 5G41A 4ARCA 2WVJA 1ZY2A 3JQ9A 3HVIA 2OFWA 1SKBA 3DD1A 2Q0XA 4HAZA 5FBLB 4NJMB 3B8HA 2VK2A 3LLUA 4IFBA 4TS9A 1M6EX 1NOIA 2AN5A 1O8BA 2DHCA 3OPMA 2VLIA 2G36A 3KZ1E 1EINA 5DBFA 3UC5A 3WLKX 2GN9A 1U0FA 4XW2A 3A4LA 4M1KA 3TNDA 2RH4A 3VYVA 1PK7A 3D6UA 3QFRA 2ZZMA 5DP2A 2QB5A 1YIAA 4FDTA 5A7GA 3VU1A 4KVGA 4AJEA 3OLVA 4MRAA 1JPJA 3RREA 1J2JA 2EFDB 2VJMA 4W9MC 3H1GA 3L0PA 3FSEA 3UGKA 3WRWA 2HMSA 2QRNA 2HDWA 1QCDA 4UC0A 4DG8A 1GPH1 2YQ4A 5CVEA 1K7FB 1F0NA 2W7TA 2ZRDA 4TKUA 1SVNA 1XKXA 1LX7A 2FLWA 2CJWA 3BMQB 2K87A 4M8IA 5P21A 4RY9A 5KQPA 3BMCB 5JC1A 1O54A 4Z4FA 3H2KA 4KR3A 3HJNA 1L2TA 1A77A 1B6TA 4DILA 2EL9A 1EA7A 1Q15A 4F2DA 4C0LA 1AV7A 2VSXA 4HVAA 5IT9A 1DJMA 1YR3A 3LA6A 4JEMA 5F1PA 1JFFA 2EDAA 2JFWA 1JV2B 3H2ZA 3N2GB 3M6XA 1U7UA 2GD1O 4XUDA 4BFVA 1NMXA 3D9QX 2H2FA 2A7XA 3K4HA 4F2PA 2IPAB 3ZDYB 4KXQA 2R6R1 4Y1RB 4NICA 3OQNA 4UZFA 4JI1B 2G82A 4A8JB 4JVLA 3M3DA 5K0CA 1GG5A 3OG9A 2C3OA 1U6JA 4GR5A 4U6QA 2A1UB 2BEVB 4XXHA 2CE2X 2H59A 1FYXA 4TS4A 3VH1A 1MR3F 4HLUC 1AN0A 2O48X 3GQBA 4W8GA 4MS4A 3SWWA 4PLFA 3K94A 3Q2KA 4HWRA 1KE1A 1I01A 4DJ5X 4EUKA 3ILYA 3KLPX 1H9AA 4G63A 1Z13A 3THXA 1R4NA 5D01A 1VLMA 2FZ4A 2A3NA 4ZYZA 3NDIA 3T9FA 2O05A 3LKBA 2FN9A 3ONVA 5EE3A 1YJ5A 2MOKA 1W94A 3O2SB 4NZNA 4UKDA 1EQ2A 1WB6A 1M6VB 3V8BA 1RP7A 2C03A 1C9MA 4JL6A 4HG2A 4Y9RA 3RV3A 2GK3A 3J80A 1YHZA 3U4DA 2XXBA 2OSVA 3BKXA 1G2IA 4Q9HA 3SF0A 2O8CA 4X20A 4UDYX 4HRAA 4MKGA 5FLKA 1G60A 1ECBA 1XLTC 1MTOA 2V74B 3CF0A 4LPKA 4XZ3A 4BQSA 2PS9A 4R1TA 2PUBA 3F8WA 2EARA 3RJ5A 1K0UA 1L7DA 1GPKA 2PK3A 3KR1A 4QBKA 1TVCA 1CR0A 2OXFA 3LCVB 3N1UA 2TECE 5LZ5A 4F5ZA 1GPDG 3QSGA 3WX0A 2IHUA 2Q5OA 4AVYA 5IXSA 3ENQA 4L57A 2KBEA 2HF2A 4G2NA 1MABA 4EITA 2FKAA 1BQ3A 1RIIA 1DCFA 2A1TS 2OGUA 3KQOA 1UDCA 4ZO4A 1YIOA 5E2BA 3R7FA 3AP2A 4TTQA 1JRLA 3NC4A 4JT9A 1VA4A 2VJCA 1X42A 5C18A 4WN9A 3TJMA 2E48A 3A6GA 1EVKA 1MN6A 3V80A 1C7RA 3UWOA 3RH0A 2WU1A 3ID6C 2JGDB 4MW9A 1X1AA 2AD5A 1XHFA 5IVPA 3V4VB 5AKIA 5D6NA 4KMSA 3Q3EA 2EFYA 4QXRA 1O5TA 1DEHA 3SVTA 5C4IA 4A0SA 3Q15C 4NDZA 3FUWA 3GL9A 2PBFA 3IQHX 2YWHA 2CXTA 1QOZA 2PJZA 3AHEA 4WWHA 5CNJA 4WNAB 3Q1KA 3L1JA 3IXLA 2GD0A 2R8OA 2RGUA 2FK8A 5JFTA 2YV1A 4BNTA 2AC7A 4X63A 4JXJA 4C88A 2G25A 5HUHA 3KQMA 3L6DA 4A16A 3SNKA 2CXOA 4KW7A 1L8QA 1P5JA 3QVGA 4MUNA 5DJ5A 1XEAA 3TL6A 4ETIA 3FI0A 1OAAA 1T1GA 2DPHA 3E1GA 3EZNA 2A9JA 1XZ8A 2GN4A 3CNOA 3ZV5A 1QC5A 4O8CA 3GFTA 3ZGZA 4G5QA 3T95A 3COVA 4ID3A 4BZQA 4ZIRA 4DR3B 1SHTX 3G9UA 1ENYA 1DQNA 1P1HA 4FNMA 4NHOA 3VDRA 4OQLA 3WJ7A 1L7XA 1P5HA 1OX5A 1HFJA 2H85A 4IHJB 4PXYA 4YQYA 2V54A 3I9MA 3FMOB 2XUKA 4BP1A 4FTWA 4JA0A 3GFQA 4AG6A 1LC3A 3RS2A 1A82A 1SOVA 1HDXA 3A3KA 4CTOA 3LCMA 3WYEA 3HO6A 5JPCA 2WY2D 3U44A 2NADA 1C3EA 3V3TA 1JH8A 2OQVA 5JD4A 1FEZA 1LI5A 4DNFA 1F51E 5JXHA 1NQXA 1X1TA 2YWFA 3N2IA 5GM2A 4OUDA 3IOEA 2R3SA 3CB4A 3CH7A 2R79A 3LWNA 2PEYA 3WLLA 2J48A 3VZDA 2MSEB 1MRZA 1A9XB 2PBLA 2GNPA 2RGDA 4IUDS 3ZU2A 4EGCB 3F5DA 3GLIA 2Q6LA 1IM5A 1E5TA 1R4AA 5DRTA 3ZGYA 4TWBA 4M37A 2BTEA 1Q7EA 1A5BB 4NV0A 3PNQA 3W5JA 4MI9A 1I4LD 2ONJA 2OXIA 2W70A 3SFTA 1MQ8B 3LI2A 4TQ9A 4JXXA 1I7PA 3BD8A 2JAHA 1UZUA 2VDWB 5EKSA 3HMKA 3H1EA 4ZEWA 1D2EA 2FUCA 2QD2A 2V6FA 2OILA 3CV3A 2YVKA 2DFKB 2WMOB 4HWTA 1GNQA 2JZNA 1BFDA 3AKYA 3R9IA 5B7GA 3HWRA 4NXNB 1Q11A 2R25B 3NCHA 4LGVA 1KWKA 1OTXA 2C7BA 5JNUA 4OQFA 1FDVA 3BD7A 4JB0A 4DLKA 4EHNA 4ZXFA 1Z37A 3W04A 1NVBA 2PSHA 2GBCA 3ZDDA 3UMYA 3MJRA 3E1SA 2ZJ4A 2YXBA 1M2OB 1X7ZB 4H1HA 1GQYA 5TMBA 1IM8A 4K1XA 4LYDA 1EP9A 4A2CA 4BV3A 1DKLA 2HA6A 4FJ1A 1UM9B 4NNPA 4C29A 3Q7EA 4GO1A 4HAVA 2ORVA 1RLJA 1AE1A 3NWEA 3A1CA 4MWGA 5DYGA 2P9TA 1JDTA 2F6RA 1W4RA 2GDZA 1UWLA 3ABQB 3CPSA 3D2AA 3LW7A 4LWOA 4WOPA 4BNGA 4R1UA 1GM5A 3MT0A 3C6MA 1S8AA 4XDHA 4FLEA 1F8UA 1P0QA 3KKQA 5CVCA 3HN2A 3ZDBA 3H5RA 4N3NA 2EBUA 3DMNA 1QJ4A 1J7KA 1E3SA 4M89A 4WEQA 3K16A 1G20B 1S3GA 3GT0A 4KQEA 1DAHA 3ZXXA 1QE5A 1XTJA 3RUEA 4LOHA 5ESXA 4W6QA 2OHOA 2PRIA 5DO9A 3RF7A 1Z0ZA 4PU0A 3TSOA 1Q44A 1NVKA 4RD3A 3O7WA 3EY4A 5TLSA 3CLSD 4KSYA 1YASA 5DRYA 3VR4H 1QGUA 4H0NA 3IEVA 2DFDA 1NLZA 2LUOA 3AZPA 3CVOA 3KE9A 4I08A 3RRMA 3RVOA 4F6LA 4HNHA 4H60A 5FTJA 1WXDA 3EC2A 1YVPA 3CX6A 1Q17A 4AKSA 3O7MA 3D02A 4BLUA 3GRCA 2RGCA 4QYMA 4FEEA 4LSWA 3X1DA 2YHIA 1CUIA 1E3WA 3F0TA 5C34B 3ZNPA 4CKYA 1SCAA 3FPSA 3LBFA 4HAYA 4YJHB 3EVCA 1U04A 1YE5A 8ATCA 1DE0A 1DT5A 5H81A 2X0EA 3O5AA 4BNLA 1PYDA 1CERA 2H5JA 4W6ZA 2AQHA 1ABEA 1W85A 4PLPA 2YOFA 3CXUA 3K9GA 1LRKA 2JLZA 2RI1A 4LV6A 1EUZA 4C2BA 2O14A 1ZXLA 1GXSB 1QIHA 2ZSBA 2VXCA 5JXJA 1PFVA 1LY1A 1U7DA 4QQNA 3NLLA 5KHOC 2DQYA 5FQOA 5JECA 1N2EA 3MAAC 1QYWA 2FOIA 1RCFA 1TJ3A 1Z6PA 1TGVA 2C2BA 2R6HA 3G13A 3GVPA 4RM3A 2A7QA 5A1TA 5B57C 4MAFA 1ZMRA 1ZJ5A 4ALJA 1JTEA 1JKMA 2VF4X 3AF2A 1G7RA 4RPJA 1Q7TA 4GQBA 1ZCAA 2NQ8A 3GYBA 1NBMD 5CYFA 2LE0A 3EIEA 1P1BA 3HKCA 1GA6A 4RTKA 2H1RA 4YAWA 2WR8A 3CISA 3HWWA 4KR6A 1QK3A 2GEBA 3JSXA 2F59A 4JA2A 2E1RA 4CLRB 4TXMA 3I1JA 1HTWA 1VQ1A 4MTLA 4MVJI 3TPFA 1AKUA 3AUFA 4JYCA 1SULA 5LNK1 4JUDX 1M8JA 2QR3A 2XUIA 4F2WA 1JQAA 1PEDA 1GY8A 5MGNA 1UJ2A 3U9TA 1GJRA 3CEJA 3QXHA 3GLGB 4JJEA 4KMRA 5F3DA 1Z2PX 2AG5A 1MB2A 2GYWA 3OHMA 1KOJA 3ESXA 5A02A 1HZZC 2P6OA 2WG1A 2W22A 3M1AA 4ZGWA 5KPDA 4ZJZA 4B45A 3I0NA 4EYGA 3NFYA 3ILVA 5CHYA 4D3YA 2QU7A 4Q48A 3OBIA 3DL0A 4JROA 2JIOA 1NNEA 1I3NA 3QWAA 4B3TB 1YC5A 4WNYA 1Z2NX 1PL7A 1JPNA 3H9UA 5BN5A 1F2TB 2HCBA 2VO1A 4BVHA 5AOCA 3FLAA 3MGAA 2D1RA 3GCDA 4NOLA 1M6WA 3PF9A 3T5MA 3TGWA 2JBHA 2B94A 3GDOA 2GZDA 3K09A 1OV6A 2WJ3A 4UNIA 5B6JA 2HHCA 3O95A 3VKGA 3AY3A 2VJAA 5SYAA 4F4CA 5DHFA 2R66A 3BMXA 3ZCSA 3H4IA 3K6SA 4LSGA 4UTXA 5K3SA 1JHPA 2QMEA 1V8BA 3A37A 4YWHA 4LJKA 4XVCA 3GZTB 3FNBA 4BAZA 3F98A 4NF2A 1HT0A 2ZRAA 1N2GA 4OXIA 1OTYA 5ALTA 2DULA 1DX4A 3S27A 4H6VA 2OVFA 4CTNA 1JNYA 2JIZD 3DPIA 1ZD2P 1DJPA 4I55A 1VA5A 5K0NA 1PS0A 4QU5A 3UK0A 3SX2A 3R0VA 1IN4A 1OH6A 3WMXA 4WDQA 2JCYA 1IY9A 2QLJA 1EVEA 4FGUA 3LHDA 3KOXA 5B3JC 1YZHA 2BONA 3MJFA 4RGBA 3ZCQA 3QNWA 4HQKA 4AKGA 1UCFA 2ZTHA 1G3MA 5FO1A 3PT5A 3JQ8A 4LJRA 2NG1A 1VPLA 3N86A 3DOUA 5GQSA 1NN0A 3NOOA 4G0UA 1P74A 2X76A 3E9NA 3LT5A 2HZ7A 5BQ3A 4IJKA 3QI7A 1RWNA 4FSDA 5AJWA 1CQZA 1B14A 2H29A 3I9V1 4QQKA 4RPIA 2DR0A 5DMXA 3GLFB 4E5MA 2C31A 2NYVA 3Q7SA 3TRIA 5ULLA 1P91A 1YB6A 1LVHA 1RBQA 4UEOA 4FOTA 4CQLA 4FGSA 4E1VA 3C97A 1J2TA 2ZIEA 3LT4A 2UXDB 1I4OA 3R5FA 5DGHA 4H16A 3PNYA 5C80A 1KI9A 1YOVB 4M38A 1H2ZA 1JSZA 4MEJA 4ZVPA 2PQ6A 5IW8A 3ZXIA 1RLMA 4PR0A 4I4NA 3HFRA 3EIOA 1TM4E 3NB0A 4Q4LA 2ZETA 4QQRA 5FUQA 2DUWA 3MJDA 2H51A 1FFGA 3NIBA 2FHSA 1CD5A 1O94D 1ZN7A 2AV6A 2EG5A 2HRRA 4G86A 5DNWA 3LDAA 1SQ5A 1ZNXA 3P97A 4RXUA 2IH2A 4WY5A 1NI4A 1WM1A 4LJLA 1NUAA 1OGYA 3PGXA 1CQJA 2OFPA 4FFLA 1IEWA 3PJDA 3RRFA 1Y37A 4U2KA 3QWFA 2C3MA 4CHGA 5JHHB 3ZHOA 3ZVMA 3HCRA 2YOGA 1H1LB 4LZPA 2P30A 2C42A 1M6VA 2OHFA 3AI2A 3QXJA 3EG5A 1KJNA 4GG1A 4L9RA 4DW8A 1KC1A 1Z5WA 2A30A 2W58A 3NKVA 3NTUA 1A96A 3FVTA 4HDOB 1X0VA 5JATA 5BR7A 1Z8FA 3WFZA 1JDSA 1CULC 1WVGA 4KXLA 4JI3B 1Y7PA 4DM7A 2I87A 1PEYA 1E2EA 1M2VA 5IJ9A 4ZAWA 1A27A 1MEEA 4KXNA 4DNOA 1EUCB 2VZEA 3FWNA 4QGFA 4MIYA 4LC9A 1P62B 3WYAA 2D4HA 4CFSA 2PYZA 3AKDA 4LXIA 2GPSA 2SKEA 3H4MA 3VZBA 3HK2A 1TZJA 1VJGA 2ZS8A 4TVBA 4C0JA 5C9ZA 1V47A 2RI0A 3A11A 1GSOA 5AR1A 1BU8A 2NZVG 5FADA 1PWHA 2YWBA 1BWSA 2X7HA 4QDOA 5IVDA 1D8AA 3C6YA 1Y98A 5DF1A 4GRAA 1LNZA 5D3KA 1B8OA 5DW0A 5BUSA 1BDIA 4Z53A 2GLUA 4LDZA 3SS7X 2GEDA 4UASA 3NBXX 3EDCA 4GZ3A 4O2AA 4DDMA 1KJIA 2GM5A 3D3EA 1XNRB 3UTCA 5J4KA 3Q6MA 4QOFA 2ZATA 4YAJA 4UVHA 5JD3A 2YUIA 3RC9A 1BE6A 3ZJ5A 1KP3A 2HIGA 3KXKA 2BFMA 3LUDA 4YCDA 1M34A 2XGMA 2Z6VA 1D1PA 1WB4A 1T9HA 3QA3E 2R62A 1EXNA 1PTJC 5EMMA 2MYUA 5ELMA 1KEEA 2B1GA 2Y2VA 4CDRA 5D5HA 2VC2B 2C20A 2ZIAA 4LNHA 1MUUA 2B69A 3ND5A 2HO5A 3OO1A 1MB4A 1G1MA 3GFBA 4ZPJA 4B4OA 1UXOA 1MNAA 4ZU1X 1K98A 4Q6WA 2SKDA 4WOJA 3ETLA 3TOCA 4BGEA 2DQ4A 3PEVA 2FE4A 3N6VA 1NJFA 4R2LA 4F3RA 2FZKA 2IOYA 2XNKA 1S2GA 3N2KA 5DYYA 3JARB 1PE0A 1YJXA 2ORED 1PTKA 3LLVA 3O2JA 4IHAA 2DLNA 4UAGA 4EPVA 3VAAA 1VB5A 4H7EA 5DBOA 3A9TA 4AW9A 4E2XA 1WNTA 2J4DA 3OE5A 4MQMA 4HFRA 4U6SA 5FQNA 4O4HB 5BW4A 3P9ZA 1EK2A 5DN6A 4FCCA 4OU4A 4UDNA 1ST2A 3IE0A 4Y9UA 3TBKA 4ZGBA 2F8MA 4BQOA 2DETA 2E5WA 1PJ2A 2GEFA 1NW5A 3RIMA 1YB7A 5MN6A 3VC1A 1E9SA 1WX1A 2HH9A 3QEOA 1G6Q1 1ZNWA 5ICMA 3OFND 1U3FA 3GNLA 4GL4A 4Q4DA 1STOA 2AN9A 3H04A 4C5BA 5F9HA 4EW2A 3DHWC 4HWGA 4XQCA 3I23A 1QAQA 3NXSA 1TKRA 5F7XA 4RQTA 2QQ0A 3TZ6A 3PVCA 3FW1A 4WOCA 3EPHA 2W6OA 4CQLB 1IUOA 5CM8B 3LK7A 4LZOA 4U2FA 2QJFA 1JU3A 1UBOS 1MOZA 3B36A 3PNMA 2DEUA 1CUFA 3NRBA 3THXB 1Z0KA 4DQDA 3RU7A 1XTQA 3IKJA 3QXSA 3VZSA 1MLDA 4DREA 5CXSA 4GYYA 1YR1A 1C9DB 1KBQA 1DUIA 4OLFA 1RI1A 4U1RA 3EZ6A 1VDZA 1EFCA 2ECFA 4A8TA 2DERA 1Z74A 4MLCA 1I4TD 2JFOA 1OAKA 1KQPA 1XRSB 3OJWA 2PHZA 2PMKA 5BQFA 1XRJA 1DIHA 4PX5A 2MSCB 4QVKA 4K1LA 3VJMA 1R0XA 3K6RA 3L84A 5EQJB 1FDUA 4S1PA 1M7HA 2XUDA 3MUNA 4FKZA 2NPIA 1PTJA 2ZSUA 1AURA 2FPIA 1PSWA 5F1KA 2RFLA 4Q05A 3P9RA 3SAJA 3WL5A 4ASUA 4Y2VA 4POOA 4EELA 1YU9A 1M34B 4BY9E 1DX6A 3DR5A 2N0SA 4P3KA 3QHAA 1Z12A 3OUUA 2I78A 3LPCA 4TVOA 4PY2A 3OKCA 5J59A 3MC1A 1GNPA 2H6EA 1W5TA 1J0XO 4M54A 2WJ6A 3KSBC 2KI5A 2E2WA 4QJIA 5KBYA 2BFCB 3B6ZA 1SUBA 4HQOA 2ECOA 2ZAMA 4JFAA 3RFFA 2GN6A 3PG5A 5M3BA 3H5TA 3LQFA 3O9ZA 1Z7BA 821PA 1ZU4A 3CNBA 4PVDA 4WBXC 3KYCA 5KAPA 5JTUA 3F96A 3IVXA 4Q9LA 5FPSA 4IIJB 3MJTA 3NORA 5H80A 3RTBA 4QYIB 4C07A 1EUCA 1AKRA 2HW8A 1GFZA 1OSNA 3IC5A 1EXMA 1QPZA 1BXZA 2D0PB 3H3JA 2CVQA 1J09A 2JFBA 1V45E 2BFNA 3KAJA 3W7AA 3RC3A 1TFRA 1U2PA 2CXHA 1JA9A 3EMVA 3Q6IA 4HAUA 4EUNA 2ZYTX 5A2QA 4HHEA 4C3VA 4ND8A 3WHPA 2D8MA 2DHEA 3GA7A 3NNSA 1ZIDA 1L7VC 2EJBA 1NI3A 2RHHA 3H7IA 1QS0B 2A86A 4UM7A 4UHKA 1U0RA 2YWXA 3D8RA 3FBGA 4MQ4A 4XVQA 1SK9A 2OB1A 3O94A 1XMSA 4Y2RA 4NMLA 3TTSA 2FW7A 1DBQA 3ODGA 4AF8A 4M60A 2ISCA 4HJRA 5AXDA 2OCBA 4GLBA 4JAVC 3BE4A 2FXVA 4NYIR 3GCZA 1OZHA 4JASB 2PR2A 5EZQA 5LLDA 1H4QA 5DNCA 3G0HA 4YB8A 1VZ2A 4DR2B 5AW0A 1PG5A 4LJ6A 4PZDA 4URZR 1L5LA 1E1DA 3R3XA 1RMQA 1Z75A 2QGFA 4MW6A 4Y0VA 4GWKA 3ZZ1A 4BNKA 1GCGA 3MT7A 3N0XA 1NVEA 1C1DB 4FYHA 3V8NA 3I45A 5JNWA 4GUDA 5MF6A 3C6BA 2ZYHA 1Y8AA 1QTNA 1I6MA 3PC3A 3PC8A 1U7WA 3UJBA 4CM8A 3RC7A 4R3WA 3RRNA 4DIOA 2HQSA 4XI9A 2HPVA 3CF4A 2YBDA 5KSOA 4GC9A 1E5VA 4MO9A 2VPTA 3IQEA 1ICIA 1VB3A 5LBIA 3OZ7A 1QZXA 4TQAA 3H4VA 3KT6A 4U63A 1R7RA 3R6LA 1EWRA 3L1VA 4RH3A 5BSEA 1TQ4A 4G81A 1T2CA 1N5JA 4YMVA 1BE1A 2W6ZA 3OLQA 2VRWA 1BQ4A 4NZOA 3Q98A 2Q0SA 3A4YA 4UQLA 1ND5A 2IH5A 3S68A 5T5QA 5IZCA 4GOND 2CVFA 1C3XA 1WPXA 3I04M 3F2IA 4O2LA 2I9KA 3IJRA 2ZJ8A 4WW0A 2GXUA 2I8LA 1VKJA 4MWSA 4TSRA 4DR6B 2H57A 2IJGX 4B3GA 5JAMA 1C81A 2P4EA 4LHXA 2VWHA 2VHJA 4HQFA 4QXQA 1M76A 3N6XA 1LNQA 1GKUB 3JWEA 4GPTA 5LFAA 1LLUA 4DTIA 3O6VA 4ZO8A 2FN7A 2C8VA 3NT5A 4EW3A 5K0FA 3UV6A 4XYBA 4OQXA 1YKGA 1KO7A 3PGLA 1MENA 1R12A 3DFIA 3ES9A 2O6LA 4IDEA 4MAMA 1PSZA 1WY7A 3T7SA 3PF8A 5CM9C 4H6XA 3BFKA 4HNGA 1XRLA 2I3GA 1C1XA 2CHUA 1EIZA 2WB4A 4C0HA 4KLNA 2EKPA 3D43A 1USIA 3NDPA 3AHIA 3ITEA 3N39C 1K2VN 1ZN9A 2GXQA 2VHVA 1VXOA 2Z57A 1KJJA 4HH4A 1XVTA 1UDAA 4GM0A 4JWTA 4FOOA 4P2GA 4X24A 4JBXA 1RHKA 3AZQA 1FJ2A 4LAFA 1X3LA 4DT1B 2XUHA 2I6TA 3DAYA 3ZV4A 1G5HA 5K7SA 4YMGA 2D00A 1MORA 4UFOA 5TVGA 4GKJB 1K63A 4LC1A 1GFWA 2FEWB 1PX2A 2FZ5A 2HHJA 3FPLA 2F7SA 1D1QA 1E3JA 1YZVA 2PSDA 3FCUB 4D0LB 3EEOA 4PGMA 2QMUA 2XQKA 4AB1A 3BGDA 2OQ2A 4DCOA 1CZNA 3D0OA 3AGQA 2ZJYA 1TM5E 4YI5A 2VR1A 1GV0A 1WSBA 2H48A 3OJFA 3PPVA 1A4UA 3HGMA 1Q3TA 4EYEA 1IXKA 4ENPA 3FOWA 1IY0A 1UXGA 3PSHA 1RP1A 2AK2A 4TLDA 4EI7A 5IT0A 1FPQA 1RFGE 3KT3A 4JB8A 2BPOA 3PIDA 4L8FA 3RYIA 4ASUD 3RVLA 1MNQA 1X8XA 4N8DA 4CT5A 3SZRA 3UB4A 4V3BA 4HVLA 1GWNA 3RW9A 3V7UA 5KQLA 3DEZA 2BGUA 2IH4A 4N3GA 4WH0A 1IK6A 2HMVA 2QK4A 3TCNA 4LF7B 4RIIA 1BXKA 3EC7A 2B4KA 1GFSA 3HL4A 1BMFA 2J6IA 3MW8A 1FS6A 4PZLA 1TPZA 2AJ8A 1AGRA 1S2MA 5TDHA 3T7IA 3ZY2A 4DS3A 3TNJA 5EJ8A 1L5RA 4WCFB 4JP3A 4MUEA 2OXRA 2QX8A 1ACMA 4FHGA 5EPOA 2VDMB 3PHHA 5KZMB 1OLUA 3FNHA 2VF5X 5CA0F 1E1YA 2C54A 2RBGA 4YEDA 3OOSA 5I47A 4FIZA 2OPHA 4CTKA 1FFXB 3C3MA 1E9DA 3DYIA 3N87A 3TZCA 4MVJD 1A69A 4JI0B 4J03A 2HBZA 2X0IA 3CXRA 3PUKA 2JS7A 1NSTA 2B99A 5FHRA 4O25A 5ARBA 2AE1A 4PLCA 4YQFA 4RD1A 5JU6A 3UGTA 4AZSA 2Y99A 4FFDA 3TQHA 1QP0A 3QLVC 2ERYA 1FXWA 2XDAA 5K4AA 2IF0A 5KNCD 1S96A 2A3RA 3F6PA 1CETA 1SD1A 4KV9A 4OXNA 2P9JA 2P5YA 2OORA 3IV6A 3ZTWA 4DABA 4BKPA 1XMQB 2C99A 2EW1A 1JTVA 3L0ZA 3IHKA 4RF4A 1GPJA 4Z9FA 4UBIA 4HDSB 2J3KA 1ZQ9A 3E3AA 4IAOA 3K1TA 4YCMA 1Q19A 3ABRB 2XRMA 1B4DA 2SNIE 4Z8YA 4FE3A 4X8LA 3FTCA 1U2RA 4K6CA 4F0JA 5AW6A 4KJZA 4ZCTA 2RHDA 1KVRA 1AXRA 1MRNA 5THXA 1GRNA 4W7SA 3G0CA 3A4VA 2R8EA 5H8WA 1M2OA 2ZPUA 1E2LA 2GZ3A 4BDSA 3QPVA 2GUGA 3G79A 2XUQA 2YHUA 4JJAA 3HJUA 4Q7KA 5EIAA 4OHZA 3TBHA 3TZQA 5K8IA 2M9MA 3FPHA 3AM4A 4D9EA 1CJCA 4R8VA 4YMIA 4P83A 5E7IA 4ZICA 2CF6A 2VA8A 2YDYA 2NU9B 4ZJPA 3E81A 4HV4A 1GU0A 1EVQA 5BVHB 4MGHA 1HE4A 1WCXA 1VJ0A 1CX9B 4HLCA 1AQIA 1LSUA 1VM6A 2FDXA 5EC8A 3U61B 1GPBA 2FGKA 5BMVF 3A7DA 4MPTA 3U5TA 1XELA 2IEDA 3ASUA 3TINA 2WICA 4CUZA 4RQAA 2FQYA 2ADOA 3TRKA 4B81A 3GYGA 1X8LA 1G3UA 1E8MA 1QIGA 1IVNA 3VFDA 1IXYA 4KBFA 4EJSC 2Q41A 3VHXB 2V97A 4HUJA 1RM0A 2QTGA 4ZEOA 4R16A 4CU2A 4FWTA 1AG9A 3CZAA 3ZE2B 1QIMA 5A5GA 5FNVF 2RG7A 3M33A 1VP3A 1FJHA 1XQ6A 3ADBA 3FWZA 1RXSA 2QQGA 2QX7A 5HK8A 2ZI9A 1ZH0A 4US1R 5A5VA 4L73A 4PQGA 1UF9A 3PVSA 5BWCA 4NXMB 2QGNA 5BYJA 3N8GA 1ADJA 3QKRA 1R5NA 1WDLA 2IYEA 1QHGA 4PZAA 3OIVA 2G1JA 2DB3A 1FRQA 1SXJD 3CJQA 3UKOA 1WVMA 3KLNA 4LS3A 4ZYWA 3EIXA 3FGZA 4EGJA 2CHVA 2HNKA 4DOMA 3M9XA 2CNWA 2J3IA 2DOKA 2CZQA 4MIOA 4EIWA 3TXAA 4JJ4A 4BUJA 2PL5A 3GUHA 2O8VA 2P1RA 1PQUA 2VRBA 3MXTA 3IT0A 3T0GA 5IM5A 3T7EA 3A6PC 2UUOA 3VOSA 1HETA 1C7JA 1ODLA 3M3HA 4CV1A 3H13A 3JQFA 3T1TA 5IC6A 1TMGE 2PLNA 3I8XA 3V00A 3NHFA 3VMMA 2FZVA 5EXTA 3TOVA 1TF2A 4AWBA 1ZCZA 1LPSA 2BKUA 3HBNA 1KNQA 3EEFA 4LZNA 3UY4A 4D1YA 2ON6A 5BP7A 5AKHA 2XT9A 3SYKA 2GILA 1A8PA 2UUAB 1ESDA 1G8MA 2OBBA 4QG7A 1RD4A 3PE4A 5B2FA 2FJ0A 1YZGA 3O1LA 4GU5A 1D5WA 2OGTA 1HDEA 4PTLA 3U80A 2DT5A 2QJOA 4MHTA 3PRYA 3I1YA 3Q8KA 3P2IA 2B5OA 4KC0A 3V4LA 5DHAA 5CBKA 3H11A 3JRXA 3EXHB 3OIWA 1XPUA 4J7UA 2GZRA 3W78A 5IBQA 2OAGA 4PHCA 1O96A 1FMCA 1NE7A 3MJCA 1PKEA 4PM4A 5DLDA 1BMFD 2DGDA 5TS3A 5KS2A 2QTFA 3HC7A 4IJVA 1H4VB 4QUEA 4E51A 3O8LA 2YWJA 2WUFA 1ODCA 4H77A 3BORA 4RZSA 2VPWA 4HDAA 4PFQA 2QD5A 4I7EA 2CSUA 2Q5FA 4NJEB 4Y98A 4E4RA 1V8OA 3UWKA 2HI0A 4WBSA 4EGAA 3ADDA 2OMKA 4WE3A 3E0XA 4K9OA 3C1OA 1ZDMA 2AWNA 2QRQA 3V32A 5JNVA 4RTPA 1OXKB 1RBYA 1S3SA 1IFXA 1X7YB 1XMVA 3L8CA 3MELA 4HK4A 4QPJC 4B7XA 5L45A 4DCCA 2JH9A 3JAKB 4A27A 2HEIA 2XUPA 2H5IA 5JI2E 3WJ1A 4DB2A 1Y1QA 1RRPA 1ODJA 1XO1A 1BDBA 1QLWA 1YMUA 3G2IA 4ML3A 1X2EA 3VKFA 5E3IA 4DV5B 4RVDA 2I2XB 4W82A 1XLTA 3B7WA 3HYSA 3H1FA 4I4TF 1OBHA 2WWHA 2X5OA 4L4UA 3OEYA 3V4FA 1P6XA 5M2QA 4E0BA 3BMCA 3Q87B 3IDFA 4PN7A 2WWWA 1KI6A 2XDQB 5ER9A 1LEHA 3CPHA 1QFXA 1UZLA 3FYSA 3HBAA 2XYPA 3FCOA 3E9MA 3HL0A 4OQPA 4UFNA 3A9RA 2PZBA 2Q3MA 1G3IA 2GPNA 4R3UC 4RKRA 1FQKA 4WKBA 5BVGB 3NDRA 5DYNA 1LBSA 1F12A 4N7BA 4OK3A 3A32A 4KLZA 4N49A 2BR4A 1NQUA 1AKYA 2OD2A 2X4GA 5FIUA 1UFKA 1YZ3A 2OBLA 3RFUA 4BNXA 5JADA 4MDFA 3MGKA 5E1BA 1OKKD 4U2CA 2ZROA 4G3XA 2P6PA 3IVRA 4N7MA 2XB6A 2QL9A 4BMPB 3F7OA 4LY0A 3X0DA 1R0LA 3PWZA 1TQ2A 3KNZA 1OYOA 5FUYA 2J3HA 4UHHA 4ICIA 1VPVA 1JXQA 3ZVLA 5CPBA 2RC6A 1X1EA 5C7IO 2I65A 4QNRA 3OPXA 1KY2A 3FFBA 4AKEA 2QTNA 1KMIY 4AZWA 5G2OA 1N0IA 1RPAA 2A5FA 2ZI7A 5ERGB 2QLLA 5D87A 2AG8A 5EHIA 4OK5A 3BF7A 3LVRE 1WOYA 4EX7A 2WUDA 2JEZA 3W5AA 1AOXA 2B34A 1GTJ1 3A2LA 5LPNA 3PL1A 3KVYA 5CNIA 1IJBA 3CUYA 2HGZA 1XLWA 4IZHA 2C2MA 2V6MA 5CITA 4N41A 3M0EA 3GLUA 3KHUA 4PLVA 1FU8A 4N6NA 4TUYA 3HKEA 5DEIA 3TMAA 4LX0A 1RW4A 2REBA 4G0XA 3HBLA 4YP0A 1IJEA 2DQKA 2OO3A 1WQ1R 1TA4A 3EWSA 4CLOA 3AEQA 3MUOA 1G5QA 4WZZA 2P2SA 5IHXA 3ELBA 3R76A 1DV1A 2PD4A 3VPSA 4AN4A 4DBLE 2QQFA 5JXGA 1XB2A 2OCGA 2BKXA 2Z2IA 3CKYA 1ORHA 2R48A 4PF1A 5IYZA 2V45A 1RWKA 3CZPA 5EIOA 2ZDGA 4FBLA 5FULA 4X71A 4N5DA 5LQSA 5C8YA 4AJLA 3WGIA 2PU5A 2UZ0A 2BDEA 2BFAA 3EZGA 3PX7A 1S2OA 4KYUA 3RYFB 4KPUB 4H7HA 4XWWA 4Q4CA 5GY7A 4NYJR 1Y7IA 2VOJA 1XTRA 1PGQA 4W7IA 4QSHA 3DQZA 4FOLA 2BFCA 1JXOA 3KAKA 4DCNA 1DX9A 4H7IA 4IH4A 3CRQA 1XVUA 1UPAA 2PZEA 3WIOA 5ALGA 5HJ5A 4HEA1 5K8CA 4M0LA 2GTHA 1E2PA 1W0JD 3FD8A 2VZ9A 1XIVA 1ZGHA 4OB7A 5A6SB 1KKLA 2QRUA 3AI7A 3RYTC 1XPJA 3KPVA 2DCUA 3E27A 5ALSA 2M6LA 1USUA 4XDZA 2WE7A 4WN3A 3WGMA 3K0CA 3K20A 5LU8A 3TFOA 5AJTA 4KFUA 5JS8A 1E0AA 4ZT3A 3A6LA 2WJIA 2QF7A 4IKPA 4OP2A 3FNEA 4W7HA 5HMLA 5AK4A 1W59A 4NU6A 1DAPA 3FPGA 4D4HA 1W8DA 1VJ5A 4JENA 4LHWA 3JR3A 5CT9A 5F3WB 1I5RA 2AF4C 1OI2A 2CNNA 2DHQA 3N0RA 1YBVA 3D3WB 4KXMA 2Q99A 1AF7A 2QRVB 3N8DA 4OGKA 5AQEA 1DDIA 3ZWKA 3TG8A 4JI8B 3I37X 1DIAA 4Y1EA 4KMOA 1ZA1A 3PQEA 3ECSA 3WWDA 1OTHA 3LPMA 1FFYA 2MYTA 5JQGB 4FLFA 2YMLA 4PRKA 4IWYA 2MDTA 2VTDA 1I8TA 3HZHA 5B4UA 2NOAA 2D0IA 1XQ9A 1JWAB 3UAZA 2P9BA 4UE6A 3T5PA 1J4AA 2D5AA 1TQ6A 3W05A 3QPDA 2ZYDA 4QREA 1SCDA 1WIWA 4TS3A 1RMYA 4ID9A 4Y0NA 2YVQA 1SOMA 3TTUA 1GDDA 1SUIA 2OP1A 3K8ZA 4D8TA 1UC9A 3O38A 2W11A 3GBVA 4IVPA 3ZHRA 3N2EA 5AM0A 3K9FC 5B58T 4DBZA 2E82A 4N5NA 3WDLA 3FNGA 4BFSA 4J49A 1T9AA 3EZ9A 4CMIB 2VBGA 5AVXA 1NBME 2JFZA 1T36B 1VKNA 4NOMA 1VE9A 1JEEA 2NT4A 3HRKA 4EB8A 1QDLB 1Y8QA 3QRWA 1TLFA 1X19A 1T24A 2AW3A 1AKWA 2IC5A 5DU2A 4EMUA 3IRUA 4D97A 5IHPA 2CLEB 3QG5A 4IMRA 2YVLA 3TOXA 2X5XA 2FE1A 3U3MA 4G4GA 5L9AA 4J9VA 2OZVA 3BERA 3H8WA 1Z35A 4CL0A 4W5QA 3AKZA 1HOTA 2FRVA 5MN5A 4M8LA 4R84A 4ZO6A 3F3SA 2PWYA 5LL6P 1DQZA 1X7HA 1ZL2A 5KTKA 1JHAA 4GR4A 3VVCA 1FNCA 2WTMA 4W9RA 1MX9A 2BP7B 3U0BA 5B64A 2ZYGA 3G68A 4DWJA 4BNZA 1PLKA 1W5SA 4JXKA 1UKZA 2BT4A 3WB2A 4G5HA 4LISA 1ZAKA 3ZJYA 4YRMA 4BECA 3TFWA 2FQQA 5JS7A 2WSYB 4RJKA 1NG1A 1NZJA 1L4KA 1KO1A 3B82A 3MWDB 3TAHA 4AQ7A 4WNCA 4BLWA 2QI9C 2F1JA 1XE3A 1QHNA 3BH6A 4A8PA 2QTCA 2AX3A 3DGEC 3AOEC 2EJWA 1QX4A 4E30A 5B55A 2VWGA 4GLOA 2CLSA 2XRZA 1BE0A 4QVIA 4N3CA 3OCWA 1XDSA 1DC7A 1HO3A 1N75A 1PJCA 1UOQA 1KYWA 1HE8B 2X22A 2QUHA 1FLDA 3PLRA 5BYAA 5I7SA 4U8HA 4GPZA 3DG9A 1L9KA 3AJAA 3OAAA 4NTZA 4Z2AA 3WLIA 1OFVA 3AM1A 3D2CA 4KPUA 1HR0B 5JJKA 1L7MA 4PO8A 1PD0A 5LU9A 2CCGA 2YX1A 2Z95A 4HN2A 1E2IA 2GFIA 3F74A 3KJEA 1Q2UA 3OCZA 1F6BA 2GZ2A 2M98A 5EXPA 4BU1A 4N40A 4BX9A 5K2MA 1TD9A 3ZDQA 1DG9A 1JQ3A 2QROA 1E2GA 2Y1FA 5ALQA 1Z4JA 4DSUA 2HRBA 3PLNA 1VE3A 4NBLA 1DC4A 5A3SA 5DYTA 4DQLA 3KTOA 2NSLA 4JGIA 2PV0A 2LTAA 3WNBA 3WNCA 5K8TA 2GPYA 5BRJA 3NU1A 3OI7A 3OJEA 1KMMA 4ZO9A 4XD7D 5ALXA 3L7JA 4V1CI 1QH0A 4ZC8A 4QDTA 2XI4A 2WZQA 4C2TA 4H9GA 5JRDS 5JUWA 2PU7A 2BCGY 4FYPA 1O6ZA 2ZJBA 3G5AA 3NGLA 3T4UA 1BA2A 1ICEA 1WCWA 3FY4A 4MVJE 3R4VA 4NEGA 4OLHA 2PD3A 4Q9DA 3UV7A 1KGDA 4KQ9A 5J2TB 1O95A 3P27A 5DB4A 1IN1A 3URKA 4Y2TA 2OGZA 4TV9A 5EIXA 2P4SA 3VPFA 2C9YA 1U3GA 1IN8A 3LXXA 5HF5A 3IQZA 4DIUA 3KSAC 4A9AA 1UODA 2VNJA 4R8RA 2QX6A 2W0MA 2NXEA 2B30A 4ZT6A 5TXGA 4PSVA 1KRWA 1NX9A 4TYWA 3B51X 1P0IA 3TE6A 3I9LA 1EHYA 3H9BA 5FL3A 3BK2A 1CUXA 1SQSA 2QE7A 4QBIA 5E4FA 2AR7A 3FYTA 3TTTA 3U1TA 4CLDA 4PWZA 3CN7A 2GCPA 4CMHA 3FPJA 4G0PA 3TMYA 3S1SA 3IT3A 2EBFX 2I6XA 3BE8A 1ZOIA 1H0RA 3DAFA 2EHDA 3WLRA 3WGTA 4G26A 4JYZA 2YQ5A 3NJRA 1J8YF 4ISCA 3KQHA 2Q5QA 3U3ZA 1V5EA 3RTEA 2P78A 4A10A 1W88A 3ACDA 4JLVA 1JEAA 4MI3A 1M1YA 2VJPA 2XDQA 3AF0A 3WLHA 3ZHZA 1M72A 1EK5A 3OOYA 1NJGA 2VH2A 1E0SA 3DYVA 4YAGA 2RDMA 3WNVA 1UANA 2ACEA 2CLIB 3MTQA 3ZIAA 1N2CB 3FF4A 4M49A 3SQWA 1W1WA 1L5FA 3K0FA 1Q0ZA 4UCQA 3DO8A 1G8YA 1SXJB 1UKEA 3AM5A 4A6XA 3OLCX 4PSDA 1AKTA 3EFOB 2VSFA 3P52A 1Z7GA 1LQUA 5E1DA 4X7MA 4R7GA 1Z07A 1OY1A 1CEYA 1B6RA 1T5IA 2A1IA 2VF2A 3E61A 4JODA 2ZJ6A 3K73O 3PGKA 1EFTA 4EQZA 2A5JA 4JHLA 2AI3A 2P1ZA 4NG4A 3MJVA 1TUIA 4P4NA 4NABA 1EFVB 1S1CA 2AN3A 3I6YA 4UOQA 5IBRA 4PNEA 1X8JA 4L3VA 3SJUA 2ZB4A 1YZKA 2J32A 4UUMA 4RBNA 1F2UA 3CH5A 1RWMA 4J0JA 3S1AB 2GERA 4QDZA 2F8SA 2WLSA 2OAP1 4Q02A 1DRUA 2YH2A 3OZTA 1GQOA 2GKSA 3D64A 4RE5A 3HKBB 5FPTA 2VT3A 4JI4B 1HX7A 1UM9A 4L4RA 3ETHA 1C8BA 1DRWA 4LRUA 5K0ZA 3SIPA 2KBFA 4A5OA 2F9MA 2Z0MA 3ZV7A 1NYRA 3OT4A 4BV8A 4J9UE 4DLXA 4GMFA 4N12A 4KXXA 2R5NA 1NXQA 1N5KA 4WXYB 1JKJA 1K3FA 2I7CA 5C46F 4MVWA 4OHYA 4O0LA 4MLZA 3H9GA 5LZ8A 4Y9TA 5CYPA 4TV8F 1Y89A 4UDOA 3MD9A 3DMTA 3G9ZA 3UO8B 3OZEA 3QY0A 4YO8A 4ESHA 2EP5A 3EUFA 4GIBA 2OSBA 4XB6B 3QU9A 4A2WA 2YZ7A 3GJ7A 2ECKA 2PX3A 4WGGA 3B2NA 4EFLA 1ID8A 4XM1A 4PZEA 3R3VA 2XCQA 2A0WA 1X7YA 2C58A 2TSYB 4LV5B 1H69A 4XR9A 3TCXB 4HNVA 2EQ5A 4KVZA 1RC1A 1XMXA 2G9ZA 3ABIA 4Q1VA 2YHBA 4CQJA 1UXJA 3OJ0A 3LA8A 4RPHA 4WAUA 1FZQA 3IQIX 3IP8A 3GJ3A 2ARKA 1RZVA 3H05A 4HLQB 4PSAA 3RD5A 3TQSA 1UQRA 4YDSA 3AUJB 3E8MA 4OGFA 4Z51A 3B1KA 4OATA 3KT8A 1BJTA 2P3LA 1H85A 4B82A 2PZAA 4BMVA 3QXXA 4EFMA 5EJEA 2B0JA 3OFKA 3BGIA 3F3KA 1DJNA 3WI7A 3L4EA 1GNRA 5KAMA 1Q0RA 3ZKWB 1YD7A 1RMTA 4C04A 4OBWA 2WFLA 3VR6D 1K75A 4L8WB 4MGEA 1PFWA 1S6YA 2IZ6A 3AEQB 5GONA 5J63A 3S44A 6ABPA 4MDEA 5LMUB 3A2NA 2O2SA 1KMHA 2GFQA 3ETCA 3MFQA 3PXGA 2RD2A 2PUFA 3WHIA 3MWLA 1A2OA 4INJA 4JC8A 3HYTA 1ZA2A 3LVQE 1RPNA 2YZMA 2D5BA 3LC1O 3O1IC 2ZUDA 1X8KA 3L8HA 3OHPA 3W8DA 1N78A 4QGBA 4QU9A 5AK6A 3ZOZA 4BE4A 2R47A 3PFBA 2FPGB 1O95C 3WKBA 5KX5A 3GRVA 3MTIA 4P8RA 3L8FA 3E2IA 2RK3A 4BN5A 1SHZA 4EATA 1IXRC 4BLQA 1SU4A 1V35A 2C8KA 2HA7A 3EBLA 3ZHCA 4OBBA 4EY4A 2V8OA 5BSWA 3T3NA 1YVDA 5AESA 4XYLA 3J81k 1VKRA 3X1XA 2JDID 2CMHA 4KVFA 4UVDA 1TZCA 5EFOA 1X39A 4RD2A 3DV0A 5JZ9A 3L4KA 2YCBA 1SZCA 5CDFE 1KU6A 4NE9A 4P9NA 3EXG2 4Y2GA 1AM4D 4XGQA 1O8CA 4QXAA 1W96A 3A26A 1RM5A 4N8SA 3TSAA 3ZU4A 5KWIA 1M10A 2IUTA 1L8AA 4KUGA 4P3XA 5SICE 5DNUA 1FYDA 2H9YA 4ZZ0A 1FSSA 2O8EA 3IAXA 1M2WA 2L19A 3A28A 2PA3A 1V1MB 5CT5A 3KD3A 2QG6A 1QRUA 4BZPA 4H0FA 5BVGA 2UDPA 3RSZA 1YZYA 3L7IA 2DT8A 3H99A 1FFWA 1DRJA 1E1RA 1PFQA 2C59A 5KOJB 1YFKA 4W5HA 1V41E 4PFKA 2JGEA 3CNNA 2EIXA 5HTKA 4MHOA 2G9NA 2O8EB 3M7IA 3QVWA 3E7FA 4CG0A 5BN3B 3PUIA 3UXYA 5KNDD 4G8BA 1A1SA 4WESB 3ZE6A 5F9FA 1GGHA 2PFGA 2XRFA 1LWNA 3QBJA 5JD6A 2AYZA 4QQ8A 4EO7A 4HN4B 2V9PA 4Z1MA 3RWOA 2VQ6A 2F64A 1VLVA 3BCRA 1DAEA 1XPOA 1NRXA 2AG0A 4TSKA 2CV0A 3NATA 2ZRMA 4JNKA 5AKLA 1SWWA 4GMDA 1M8FA 5KNBH 4DLSA 3JZDA 3UXMA 4BO0A 4LZAA 4HDNA 1Z17A 4I55F 2R6GA 2NTEA 3R1IA 2PL9A 5ADUS 3BL8A 3WFJA 5JAUA 2G67A 3MMSA 4PC1A 5LSAA 2IW1A 4GVLA 1EVZA 1WP9A 2GZAA 1Y7HA 5JMWA 1QHHB 2P9FA 4AJ4A 1Y82A 4ZVQA 3CLUC 3BAFA 1T43A 2X0JA 4ZV4A 1XMIA 2RKBA 1L8LA 1VXRA 3FLEA 3BRWD 3QKUA 1Z6TA 3LTEA 3A70A 2ETVA 2XOXA 1FXUA 1WE2A 1E9CA 1NUHA 5E6UA 5LQJA 1FVXA 4WV3A 4Z9BA 4HAIA 1LV8A 2J9GA 3HJHA 3I0MA 4LKOA 2QJRA 2LDBA 4ZOEA 1U5AA 1Z2EA 5BNWA 4Q1BA