1RWMA

Crystal structure of human caspase-1 in complex with 4-oxo-3-[2-(5-{[4-(quinoxalin-2-ylamino)-benzoylamino]-methyl}-thiophen-2-yl)-acetylamino]-pentanoic acid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwmA00
3R5KA 3GJTA 4NOMA 3V6MA 1PAUA 1CVRA 2H51A 1I4OA 3K7EA 3GJRA 1KMCA 2HBZA 3KJFA 3KJNA 1RWMA 2QLBA 5IAJA 1RHKA 4IYRA 3V4OA 4AWBA 4EHKA 2FUNB 2C2OA 3KJQA 3DEKA 2C1EA 4ZVRA 1RHUA 4JQYA 2QLJA 4FEAA 5IC6A 4JR2A 2AR9A 3SIPA 1SC1A 3V4LA 3NR2A 2NN3C 5LU9A 2WDPA 4I1PA 3R7NA 1SHLA 1K88A 3D6HA 4JR1A 2C2ZA 4EHDA 4N6OA 3QNWA 2J32A 3BIJA 2CNKA 4PS1A 4M9RA 3D6FA 3EDQA 2H65A 2H5JA 4PS0A 4ZVTA 3V6LA 4D3ZA 1PYOA 2H5IA 5IARA 1GQFA 1RWXA 2XYHA 4QUDA 4N6GA 3H11B 4ZVSA 1I51A 4JB8A 2CJXA 1RHJA 3NS7A 4HQRA 4DCOA 3H0EA 1NW9B 3DEHA 1F1JA 1QX3A 4ZVQA 1SC4A 1RWKA 2C2MA 2CNLA 4NBLA 4NOKA 1K86A 1RE1A 3UOAB 4QU9A 5I9BA 4HVAA 4EHLA 3RJMA 2Y1LA 4AWAA 4EHAA 2QL9A 4DCJA 3DEIA 4N6NA 5LUBA 4QU5A 4D3XA 2XYPA 3IBCA 3OD5A 5LU8A 3D6MA 4N5DA 4QUHA 1ICEA 3E4CA 5IBPA 3V3KA 3GJSA 4FGUA 5IANA 4ZVOA 4IEFB 4QUIA 1SHJA 2H54A 4JJ7A 3DEJA 2HBYA 4DCPA 1JXQA 2H48A 4N7MA 2XYGA 1NMQA 4D3YA 5IAKA 4EHNA 4FDLA 1SC3A 2H4WA 1I4EB 2HBQA 1BMQA 3NKFA 4QU8A 5I9TA 3UO8B 5JFTA 4JR0A 5IAEA 4NBKA 2CNNA 3PD1A 1CP3A 2H4YA 2FQQA 3V55A 2CJYA 5IASA 2J33A 3R5JA 2HBRA 3R6LA 4NOJA 4FXOA 4ZVUA 1RWNA 5H0IA 4ZVPA 4I1RA 4N7JA 3PD0A 1QTNA 4JJEA 4QUEA 4EHFA 4AW9A 2C2KA 3PCXA 2DKOA 2XZDA 3SIRA 1RHQA 4QUJA 5IBRA 4EJFA 5IABA 2FP3A 4QUBA 5IBCA 3H11A 4PRYA 2K7ZA 4NBNA 3H13A 2QLFA 1QDUA 2J30A 2CDRA 1RWVA 4JQZA 1RWWA 5IC4A 3R7SA 2QL7A 4LSZA 4QUAA 2CNOA 1RHMA 4HQ0A 2P2CA 2XZTA 2J31A 3R6GA 3S8EA 3EDRA 1NMEA 1RWPA 2Y0BA 4QTYA 1NMSA 4QU0A 3S70A 1M72A 4NOLA 4QULA 4QUGA 3P4UA 4EHHA 3ITNA 5LUAA 4QTXA 5IAGA 5K20A 2QL5A 3P45A 3IBFA 3R7BA 1RWOA 3H1PA 4PRZA 1I3OA 4JJ8A 1IBCA 3GJQA 1RHRA 1F9EA 1GFWA
chains in the Genus database with same CATH superfamily
1V39A 3ER8A 3SCZA 1Q14A 4RTLA 1LDGA 4IFEA 2C7PA 3DDUA 2I3ZA 2HU8A 1X13A 4HAZA 3W77A 1XJ5A 3KO8A 1EAMA 2PH7A 3HABA 2ZIFA 4RM3A 1NIPA 4G5YA 3K2QA 2OXEA 2AE2A 4RH1A 1IVYA 1G8MA 4JP5A 3A4IA 2OV3A 2AG5A 3MTBA 2CC2A 4TXMA 5LDGA 1WBDA 2O5EA 5FOWA 2K87A 1FP6A 1WEHA 3DT6A 4WI1A 5F9FA 5K0LA 1JQAA 1YQQA 2BKVA 2XB8A 3ZJ4A 3VKFA 3LRTA 4HWSA 2QUBA 1BYUA 1E96A 2DLCX 2D2FA 5GIPE 3RGGA 1KKMA 4O8CA 3ULKA 5BUSA 5HQJA 4OI4A 3ZQJA 1RACA 1UDXA 3D6FA 3I6BA 3PNBA 1YDFA 2JH3A 3BX1A 3QVMA 1G98A 5JG7A 4E07A 3K0SA 1STOA 1CFJA 1IZZA 3OZRA 4M1YA 5FI5A 1XXHA 1BXRA 3RRZA 4IS3A 1P4GA 1AF4A 1TJYA 1QGAA 3QX8A 2I80A 4GRDA 4KQWA 3TL3A 2PZ8A 3CNBA 4P1ZA 4DCNA 4KE6A 4CCWA 1XTUA 4FDUA 5HPYB 1DJNA 2X6TA 1AZSC 4UULA 5SY6A 1HFWA 2NWQA 1RT9A 1ZUNB 2BI4A 4HVAA 2K2QB 3BWDD 3OU2A 4C0HA 2CFCA 2XWQA 2H8KA 4KXVA 4UMFA 5K4AA 1LSSA 1ISGA 1FXWA 2G5PA 1D1QA 4CEHB 4MUXA 2FX2A 4H7EA 5BQPA 3ZS8A 3TECE 1CJSA 3R3JA 1E2DA 1DC7A 1L5ZA 1ORHA 1XDUA 3IMCA 3QWAA 1PWXA 4H6PA 4K9NA 2ACKA 3EIOA 2VJMB 3ACBA 4D96A 1CRQA 3UV6A 3QPCA 1X1TA 2OKGA 3T6KA 5EXSA 2ZLBA 3W5AA 1J70A 1T2NA 3NGMA 1V8FA 1VBNA 4CT5A 1IY2A 2G63A 3HJRA 4HQOA 3TZBA 4ARUA 1JIVA 3N2KA 1OWMA 4YIHA 5EZSA 1JG3A 3AEXA 2GEKA 3NIWA 1R6UA 2QTZA 3VPBA 3BOSA 1RVDA 3KTAA 2VZEA 4LFCB 1PJAA 4N82A 1MUUA 1KAHA 4RZSA 1GJRA 2EIXA 4ZRNA 5AXAA 2B69A 4B2LA 3W9SA 1RJWA 3ANMA 3NAMA 4CKCA 1AQLA 5JSYA 4YPOA 2FPMA 1JA9A 5HK9A 4C4YA 3H3FA 2IKSA 3AP3A 3H11A 1QVZA 4GZLA 2L17A 2HRZA 2ZVQX 3KQVA 1MXHA 5EZ6B 3RU9A 3W4IA 1ZVMA 1Y6JA 2AZMA 2FFRA 4M98A 5SYAA 4H08A 4MJXA 3D8RA 2QL7A 3UJBA 2I7CA 2FGKA 5FTKA 3WLFA 2WD8A 3HSYA 4X1KA 3MAJA 3CT6A 1PGOA 2QMYA 3GW8A 2WHXA 3B9QA 3N8KA 3REFA 3R20A 4WECA 4FLMA 4HDQB 4HJRA 2V03A 3KPVA 1M2KA 2W22A 2YZKA 3BWYA 4DQDA 1Z18A 2WTXA 3JZAA 5AHOA 2ZSUA 3JD2A 3S8YA 121PA 1M5UA 1VIMA 1HLDA 2ZIXB 1EVJA 2OSBA 1ID8A 3C16C 2C5BA 4HWOA 2PX3A 3A25A 4BNTA 2B9EA 1X1EA 2WPDA 4LXTA 3OPYB 4B3BA 1NV8A 3GG2A 4IRMA 4BU1A 2BMWA 3FCCA 4MAAA 4WOCA 3TSCA 4KQXA 1PU2A 1WPRA 4U0KA 3R24A 3PHHA 3UJ9A 4HWGA 1B8NA 3PC8C 5BWLA 3TOSA 3IAM1 2JBAB 1E6EA 2ZSFA 4ITRC 4JL8A 4CMEA 1XQYA 4G4SP 3QX9A 1EEHA 4MSUA 4OCZA 1J56A 3UMSA 2OKCA 1TTHA 1IHDA 1SXJC 1T1SA 1NG9A 3JRWA 5HZMA 3HO1A 1OZGA 2NU8B 4LOJA 3KFVA 4YRRA 4URUR 1W7AA 3RHFA 1BAPA 2IE8A 4EY7A 3CVUA 1NBMA 3L4BA 2QG4A 4UNPA 5GJWC 2PS9A 2GKGA 1Z73A 1FNCA 5CH3A 1UBKS 1SA0B 4JB3A 5EY5B 2ODAA 4I5GA 3IDZA 2LXNA 2PG3A 3IOEA 4BO4A 5L4LA 2XECA 4OK5A 4B3IA 1F9AA 1G3IA 1KZ1A 1XRRA 1K6MA 2PZFA 4GPD1 2C20A 2GEDA 1OC4A 3T7CA 3ONEA 2WSBA 1T36A 4I6GA 4URYR 5A5VA 3DQPA 3II6X 4BWYA 4JC5A 1XPJA 2FJPA 4IIJF 2PUGA 3TMKA 5EE9A 1OSNA 4HSGA 1SNYA 2Q4BA 2ZGVA 2RGWA 1HF3A 4FJ1A 4XQ9A 4DCJA 1XNQB 1I3LA 1X1DA 3FE2A 4JNCA 5NLLA 2VDRB 4ZDIA 3C3KA 1HWYA 1RQRA 4IGAA 1E69A 3QKIA 4MYHA 4INZA 3E4CA 3FKQA 4FGUA 3I9OA 1M2GA 1PJ4A 2CHVA 2VNJA 2MMCA 3P9IA 1YZYA 3NTUA 3LF2A 1UKBA 2OA0A 2G77B 4LQ4A 1K7YA 4XFKA 4G8CA 2XOKD 3AXSA 4RV9A 4CMAA 2D0OB 3A3NA 1KTIA 1FYXA 3CVVA 2NT4A 3WNCA 1AUXA 1ISRA 2FY8A 3PUYA 3Q3IA 5HQ3B 5BMOA 3KPUA 1SBIA 2H4YA 3ECCA 1YR7A 5IKPA 4RPKA 2F43B 2RGYA 3O2NA 3QBVA 2QZPA 2ZZKA 3PICA 3FVTA 2XEXA 5KVCA 1SO8A 5KVAA 2WG0A 2NUAA 3VI4B 4ZHQB 1T9CA 2M9MA 4F5WA 3BS4A 2GA9A 3JAWB 4MKXA 5EZ5A 1QANA 5J1TB 5AFSA 1NBHA 5CT4A 4IRXA 2DY1A 3MMZA 3WK9A 1HEYA 3FN4A 3KUUA 2EL9A 4K9MA 3SC6A 2FOIA 5ARDA 1KDTA 1WCYA 4NCKA 3Q7EA 3V9PA 1VLQA 4QGGA 3QVGB 1DPGA 1TFRA 3BDIA 3OLCX 2DQZA 3SSNA 3U3ZA 2EFGA 2F1IA 1PG0A 5EJ6A 3PX3A 4DKXA 4L08A 4EW3A 1YZGA 3AKCA 1BDBA 4PSAA 4L4XA 1WPGA 3GZNB 1ULSA 1PQ4A 1IMOA 2OMKA 2EFJA 4OXYA 1RQGA 4PTZA 3FLAA 5HILA 4QU0A 2GK3A 3DFIA 4HNAB 1U3CA 4PSUA 4FGJA 2PJZA 4HDNB 1YU9A 3FAKA 5GZ1A 3CRW1 5KTOA 2HUPA 2W70A 1V41E 1ZLXA 4MRVA 1SD1A 5LYJB 3KE9A 2I4RA 3AVPA 4GC5A 4R9VA 1ZL2A 3R9XA 1SVLA 5DHUA 3K1YA 1OLSA 1WTAA 1YHZA 2QX4A 2X4IA 3W0LB 5K05A 5I4IA 2B4QA 2HA5A 5EIBD 2WTUA 3EEBA 1T6YA 1GLVA 1A8IA 3EJ6A 2YHBA 2ZWAA 4IY1A 5AKHA 5BR8B 3DZCA 4NMLA 3HGMA 5ALFA 5DU2A 5EJMA 3RTBA 4D81A 5KSWB 1PO7A 1V2HE 3T7IA 3AL3A 1L5WA 2P90A 2B6HA 3DEZA 3F8TA 2CVOA 1TW2A 4QQRA 1ZUNA 2IZ5A 2J9GA 5LU9A 1XBTA 2G06A 5HCUA 1UQUA 4O4IF 1YJ5A 2IYYA 2X9LA 3DAYA 1E6LA 1XMXA 1B43A 2C4VA 5JSZB 4CEHA 2OZVA 4FNGA 4EP1A 5TX7A 1V95A 2Q5OA 3GCZA 4OSPA 3REGA 5AW6A 1LPMA 4CQMB 4ENSA 5HKKA 3UM9A 2VJMA 4QBTA 4QDJA 4KVAA 1Z13A 4O4LA 6REQB 3DE5X 2CF5A 4JBNA 4Z2YA 4BFTA 3RVRA 4O1HA 2C99A 2XE7A 3WJAA 5K3EA 5GP1A 1QVRA 1QV6A 2XYHA 3OOHA 2RAVA 1BIFA 1GQYA 2X6QA 1T5BA 4Y9SA 1RHJA 4GZ3A 3U56A 1T5IA 4IKOA 4YFVA 1OWOA 3HJBA 4IGEA 5BORA 1EH5A 3ZIUA 1XE3A 3QLUC 3IXLA 4RKEA 2HZ7A 1EIZA 1KI1A 4UREA 4DL9A 5CDHA 4PQFA 2X5OA 4M37A 3B52X 3EN0A 5AVKA 3N76A 4K6GA 2D1RA 4OSOA 3O31A 4YIKA 5MGNA 4L4UA 4QXPA 4NONA 3LKBA 3JQ6A 3C7KA 4X61A 4LF4B 4JXZA 1JHOA 3P9QA 3VU8A 4WIAA 3RHTA 1IUOA 3PVSA 3AR6A 4MQMA 10MHA 2H48A 3CSDA 3MBIA 1PNVA 3HTXA 5FPQA 4YDSA 3HEBA 4FKMA 2HRRA 1S89A 1Q83A 3MCAA 3CBQA 4WBNF 1HNXB 2HJWA 3ZCXA 3DONA 1QH8B 1U11A 1ZOPA 3I12A 1B16A 1L4UA 5KDOA 2DERA 4DMKA 1ZCAA 2XGOA 3LX8A 2D4HA 1P0PA 2ZIXA 1CTQA 2O2DA 3INRA 4RQTA 4BEWA 1V8DA 4BMNA 1E5TA 3MOIA 2QRKA 4YP7A 2Z8YA 1WZNA 5EHXA 3A27A 1HQKA 2GBPA 4MVJI 4QC2A 5BOVA 3HA3A 3VOAA 3CLTD 2XOEA 3MINA 1OHHD 1W73A 4X6UA 3DOCA 2A5DA 4MMZB 3WWYA 2H29A 2H00A 4WLUA 1XTKA 3HACA 1P60A 1FS5A 1TEZA 1NC3A 1NNI1 1MN6A 3ENQA 3KVOA 3WRWA 1ETHA 1W48A 2YFHA 2DULA 2ST1A 3QNMA 2IE0A 4CU2A 1YI1A 1X6VA 4DMUB 1OC2A 4RX1A 1ZYUA 3KCQA 1L6IA 1YH3A 2D59A 2J46A 2RJ3A 5HIJA 3VPDA 3CS3A 4GLOA 3FFWA 2GN9A 3GJZA 3U5TA 2NU8A 3I2IA 2ZRNA 3PLAE 3OJCA 2H2IA 3EA0A 1L7PA 1MGPA 4QOFA 2G67A 4WFJA 1P7WA 4DLUA 5E6SA 3SHFA 1D2MA 1ZU4A 1EK1A 1N2CB 1WY5A 2JPDA 3PD7A 1IXZA 1H2AS 4A0QA 2XQVA 4LW8A 3DA8A 1SA0A 3ON5A 4RH3A 3IP5A 5COAA 3RASA 3UGTA 5GJBA 1WMFA 3G2NA 2WJ3A 4JXKA 5F51A 2GAIA 2I2BA 3CH4B 1DQRA 4MOWA 5E9QA 3T1QA 4ABTA 3TSYA 5TF4A 2PD3A 3RADC 3KDAA 2O0KA 4U39A 4Z9AA 4PLTA 1FFYA 2EARA 3C24A 4YI3A 5KNLA 3TW0A 1R0ZA 3DWIA 1FBTA 3UB2A 1LTKA 5LA6B 1NJ6A 5H3HA 1VHDA 2C98A 3FUXA 4RPLA 4G9EA 1F3LA 4UJ5A 1H42A 2GPYA 2I4IA 1B1CA 3EXEB 1W0CA 3O95A 3IYLW 4EO7A 4H7KA 2EQBA 1XU4A 1RZUA 1KJZA 3GFQA 3O8QB 5D5HA 3TKAA 2ZXEA 4B6EA 1C3OB 2F2TA 3PQ2A 4U0JA 3KT0A 4WRRA 1UJMA 3WL3A 2F8SA 4HH4A 1GQRA 4K6FA 3IP1A 4WZZA 4JBWA 1FFBA 2GR9A 4QGBA 2YYAA 2XXJA 4MUNA 5J1SB 1OH8A 1NBWB 1Z0ZA 1R6AA 1QRDA 3R0QA 3TRIA 3ZE2B 3N58A 4GOXA 1I51A 2FSGA 3LLVA 3D81A 5IAAA 1GTG1 4FI3C 4JFAA 5HQ3A 3O47A 3SYKA 5I9IA 2MSWA 2V98A 3MMXA 4ENQA 2OYSA 1R0CA 4AICA 4AZVA 4KHPB 3F3KA 1YSCA 2OGWA 3B5IA 2XTJA 1JQBA 3OTIA 5AI6A 4ZOLA 3JAWA 3T15A 5HIIA 3V3TA 3X3HA 4DNFA 5KU1A 4JSRA 2C5SA 4BVHA 3F9RA 5G0UA 4IO0A 4V24A 1WHTA 4Z9XA 4DG5A 1UMBB 3ZG6A 4CQLA 1LBIA 2J9FB 1QX4A 3D4NA 3KSRA 5H8WA 3VU3A 5B3KA 4D0SA 2CZCA 1L8AA 1TQ6A 1ZZGA 5FUMA 1DQSA 1E2LA 2F8LA 2R751 3DE7X 3DULA 3VOBA 1O0SA 2PX6A 3A1WA 5JLJA 4EHNA 3GZNA 1V4NA 4GYYA 3C5HA 1DWOA 1E4EB 3KQNA 2QMOA 4FR5A 1RTTA 4IHKA 5CVJA 1U2EA 1Y48E 1VMDA 5E9AA 1OWLA 4CL0A 1HZJA 3QVJA 1ZXLA 4HNAA 1RQ7A 3IESA 1DO2A 5DM70 2WYUA 3DDHA 2QGNA 4LWQA 1AGXA 3N0RA 5LYJA 3ZZ0A 1UQTA 1YQTA 2P35A 3NX4A 3VR4A 3I61A 4O33A 2WIGA 5TR9A 1O96A 4GBGA 1N3IA 2E18A 3AG6A 1K8XB 2AXQA 2JGAA 1FTWA 1G6OA 1T1RA 4LRUA 4ZT7A 1BVUA 4DA4A 3U2QA 1TM1E 3IAAA 1GILA 2O20A 3MMPA 3UPUA 1A9XA 2GAOA 1RRCA 1YVEI 3STYA 5COQA 1MFZA 1FNBA 2QM3A 2FVXA 2AMVA 4EA7A 1P9RA 1Q20A 2R6JA 1KGDA 4XGRA 3RT9A 2NT3A 5ECDA 4NHOA 3OESA 1LI7A 4V2UA 3B1YA 4MKZA 2EHDA 1F4LA 2X86A 7ABPA 4NECA 3I0MA 2SCUB 1Y34E 1ZK4A 3DV9A 3KOZA 4Z8XA 1JBKA 5JSZA 3JQ9C 1XROA 4YAFA 4ZARA 3T9AA 3QHQA 5DF1A 2ZRKA 4IR7A 4PXSA 1EUDB 1M34B 4CQMA 4EY4A 4L5CA 3PIIA 1RWOA 4PRZA 5TGDA 5L3QB 3GDHA 2PLRA 4FLFA 1CS0B 1SWWA 3L1HA 4FFBA 1GU1A 4HRXA 3PPWA 3DTVA 1AZWA 3QUAA 4Q3OA 1YDMA 3H6KA 1FTGA 2KLBA 4DV3B 5EXPA 4EF5A 3NEPX 3O5AA 3TSZA 3KFXA 4KGXA 1TUBA 2O3SA 3BJIC 2WA2A 3COYA 5A0TA 5H80A 2G9VA 1FNMA 3G82C 3HR7A 4LXYA 4RZ3A 1CF9A 1M0SA 1GGVA 1QKJA 2ISSD 2XOKA 4JI3B 4IXWA 2D2VA 1G5RA 4DIFA 4HVLA 2NQ2C 3HCRA 3MB5A 4MYCA 4DLNA 4RTJA 3FHOA 1DQYA 4WKNA 1MP0A 4V0LA 4PAQA 5CIYA 1ESMA 1NSYA 4QYSA 4GQAA 1MB2A 2XUJA 4RORA 5LBUA 2PA0A 4AJ1A 1DG3A 1Y33E 3KHUA 4TXHA 5AI8A 5ILQA 1T3TA 2I4MA 3AUYA 4H3HB 3FSRA 4E12A 2QX9A 3IPLA 4KR9A 5I45A 4BJ6A 3HVJA 2FMUA 2PU5A 3AJAA 3BXPA 2SKCA 3CLRD 3NW9A 2R7NA 3U60B 5GM1A 4LYJA 1DUVG 3URKA 4CKWA 1KH2A 2AEEA 1QH8A 4IDBA 2PWBA 2ZRIA 1RYHA 1QJCA 2I7TA 4IJUA 4FUQA 4TV9F 1T1IA 4AURA 5JQWA 4QXOA 1PHRA 3GJYA 1VCIA 4RJIA 2PXAA 3NDJA 3C70A 1ML4A 3G2JA 3U44A 4J8PA 3Q0EA 3B12A 1YULA 3D3JA 4MW5A 3W04A 2XQIA 2ZATA 2P2YA 2W0SA 5LOVB 4EBBA 3IIEA 2ODTX 3KLNA 3KWJA 1AQJA 3BH6A 1E2KA 3D8SA 4LHYA 3K6RA 3PE4A 3DHWC 4IINA 4LTDA 4MMYB 3AVYA 4YAEA 4MV1A 5AJTA 3PWZA 2IJGX 4ZAZA 5B3AA 2WKQA 5DXAA 5JWOA 3O3NB 1H4TA 3HXLA 3I2JA 1ZO8A 4PNPA 4GSLA 1SG9A 1UBOS 1U0HC 2KI5A 3EQ8A 4LGMA 2WUDA 1Q22A 5JQGB 5I9TA 2JLRA 5JNWA 3Q8KA 3KR2A 1G64A 3PDWA 4NBKA 5C7YA 1IAQA 3A3OA 2JLSA 3WQRA 2IYVA 1GFSA 4FHDA 3GBVA 4YUWA 3HGTA 5KNCH 4P5EA 2WWWA 3LOQA 4YASA 1ONSA 1C4XA 3OJ0A 2OY0A 3R9WA 3D4BA 4TS1A 3ZIDA 2VH2A 2WKWA 1IN1A 3UHAA 3T1HB 3O84A 3O3OB 3OE1A 3KR0A 4I1UA 5JHGB 1CCWA 2JVIA 3FTNA 4S1WA 1VL5A 5CP8A 2WZCA 1VPDA 2ZREA 3CR7A 5AIBA 1ADBA 1KK2A 2V6GA 5EIWA 2IIPA 3T95A 2E89A 2OXRA 3B1WA 4WFKA 5FFMA 4DDKA 4MKGA 2GF9A 1ORVA 3EDRA 4KSCA 2JGFA 5E9JA 4D9JA 5TVGA 3TB6A 3BILA 5JXHA 1T8WA 2CWWA 1U81A 2NXEA 3QOFA 3T3MB 4DT1A 2IXGA 3L8MA 1YR2A 5I4KA 4MUHA 2YX1A 1C3OA 1P9NA 2ID7A 4DXAA 3WMRA 4X24A 5KQPA 1BX0A 3IKLA 4LSWA 4MIOA 1YZ3A 3QFTA 3IVRA 1SOUA 3I6MA 5JAOA 1YAJA 5JVDB 4BZZA 1ZL0A 4HDCA 3QTLA 1J5PA 4IILA 2A0WA 4C43A 4F60A 221PA 1LPSA 1H2XA 4JLJA 3AY6A 2A9RA 2B1IA 2KBEA 5IYZF 1EJ2A 3VZQA 4B3JA 4URVR 3ZNNA 5H83A 3OPVA 4M3NA 3OD1A 3UVEA 1E2JA 4ZHQA 2VNKA 2W2LD 2NO0A 2M6LA 4PQRA 3A1DA 3NJ8A 3K92A 4FDAA 2L69A 2WA1A 3N7TA 4Z51A 4G8DA 4TLMB 4AUMA 1RR6A 5L3SB 2C5HA 2PZGA 1TMGE 3I04M 2JCBA 1XQXA 2J9FA 3NKVA 4F93B 5FNVF 1EVQA 1CJTC 2R7MA 3JWIA 5FR1A 5H59A 4YT2A 5JS1A 2AUMA 2IXFA 1OPXA 2AQ8A 4F12A 4S1NA 3F46A 3V8RA 4BVBA 2BTEA 1BCRA 1E4EA 3M1IA 4IIVA 3RSCA 1MOSA 2OORA 4LQDA 5FPPA 3HBFA 3N2GB 2VC2B 2ATCA 5EJ9A 5LQDA 3CLKA 4L8YA 3C6XA 2QP4A 2QG9A 1LLUA 2RH9B 1M6EX 4CI9A 3PHBE 1S9HA 1ADFA 1ZJJA 3RVQA 5K0FA 2HPAA 1JG4A 3GCWA 4KNVA 5ER9A 3MT7A 3Q7TA 5EUCA 1KJIA 5JIBA 2X2PA 2ARKA 1G5TA 1FVOA 4G3XA 4KFTA 1CDZA 1W4ZA 1AKQA 1KORA 1EX1A 4OFWA 2BF7A 4N18A 5FT9A 3RSFA 4PLZA 1WZCA 2SECE 3LBYA 2JIMA 1LPNA 1UBLS 5IWAB 3VR2A 1XPRA 4BXOA 3Q87B 3RB8A 3HJFA 4X20B 5L7WA 1XEFA 4ZU1X 3W90A 3SQXA 4DCPA 2INGX 1R4AA 3CB4A 2NM0A 3H84A 3P5SA 4FYXA 1M6VA 4MS1B 4V0OA 4X90A 1PEDA 1IN6A 2FVYA 1Z7YA 3D2AA 3NRBA 5C1DA 2SCUA 2XVMA 3GVIA 2JH9A 1NTOA 1ZUIA 2RHLA 3DFUA 4JC4A 4WVLA 3AR9A 3DL0A 1QQ5A 2ODPA 4P80A 4HNSA 4CIAA 1NX9A 1R50A 4DXDA 5MN5A 1R0WA 1FIUA 3HJAA 3HNRA 1CRPA 2I3DA 1OBOA 1RPTA 3KL2A 4AQ7A 4H0CA 4WCFB 1D09A 2GM9A 4C7JA 1CS0A 3LVFO 4PZCA 2JFZA 3KQSA 1AIPA 4DPMA 1B23P 3SC3A 2O5VA 5BWNA 3MWYW 5ES4B 3CIOA 4FIDA 1PJQA 2P9HA 2XR1A 1GO2A 2G17A 1XZCA 2HJRA 3RCBA 2APJA 4UBMA 1DOHA 3PQCA 1EFVB 2ZT7A 4FE3A 3CNEA 1IDN1 2VDNB 2Q7XA 4BBAA 7GPBA 5LIRA 3OT1B 3CUWA 1RHMA 3DGFC 5LMNB 2FA9A 3D8NA 5JARA 4XVRA 3LQ1A 1ZH2A 1Z62A 4R81A 3QV2A 1CF4A 1T9HA 3CR3C 3D3QA 4Y0VA 3D7RA 1EXNA 1UKEA 5B2EA 4IJMA 1R4NB 3SLGA 2Z1MA 2PRSA 1XRQA 1P80A 2HDWA 4L1KA 4JZKA 1W75A 3NI2A 4N01A 4QRHA 3A4YA 3O6VA 2JI8A 3P2EA 5ENVA 5TJHA 4ADSG 1R88A 3D4OA 4JJ8A 3TEJA 3L4EA 1K7SN 3Q6IA 5IWCA 3D4LA 2DEUA 3GELA 1N8NA 1ULUA 1JEJA 1LLQA 2WZDA 3BK2A 5B1IA 2HBZA 2FZGA 3EJWA 3H17A 4FYKA 1IRXA 3I2HA 1CJVC 1ARZA 1F20A 2ZUUA 3NB0A 3OIWA 4G85A 3FNRA 4ZJZA 2ZRBA 1NBIA 3JZIA 1D2HA 5KWIA 2HHHB 3BK1A 2OCKA 1JA0A 1EP1B 3ABSB 3NC4A 4LJ4A 4OY3A 4ZDKA 2WM9B 3L46A 5EJAA 1SHZA 4WE3A 2H1CA 2I3BA 1NTRA 2NN3C 1PYDA 3KEGA 1IY8A 1N8KA 2E6UX 4FD2A 4MYDA 5ALXA 1XVTA 2AFVA 3KWFA 3B2EA 3LUBA 3N28A 4F3NA 2QBYB 4B9EA 1IMJA 5CLJA 5AI4A 1J07A 6ABPA 2WIJA 1WJGA 1IZ7A 3EF3A 5KI6A 4TGLA 2EYQA 1DQPA 4CKBB 2BEWA 1IJBA 2H06A 2ZDHA 4ZVTA 1ECPA 3OZFA 2EZTA 2NO9A 3QWFA 4PC1A 5DBHX 4YPFA 1TDJA 2HSJA 1G8HA 2Y2UA 4OQXA 2F3PA 4GW3A 1H1TA 4UZSA 1KFCB 3GWZA 4ZZ2A 2R0QC 1NT4A 1XTBA 4RF4A 5DSZA 1S8OA 1EDDA 2C5AA 2N46A 1KZGB 2JJ1A 1QO7A 2FZEA 2WJGA 1O97C 3OIYA 1M2VB 5KDLA 2C0PA 2WSLA 3U40A 2Z30A 4E11A 4W1RA 1U9JA 1T5DX 2PUJA 2QIOA 3QPWA 2XDQA 4Z3DA 1NQ5A 3EUEA 4P5DA 5IPFA 4A82A 3FZNA 1V7PC 4MPDA 3OPYI 3W7AA 2BDEA 4ODIA 4LEIA 3RGWS 1DWQA 1GPYA 1MABB 3TM5A 2IW1A 2VBCA 3F9CA 1DCMA 3FMGA 5T41A 4CETA 5HKAA 1AXGA 4GWGA 2CFOA 2FWRA 2H54A 3V33A 3R8CA 1Q5PA 1P17A 5CRIA 5G2OA 1N34B 2NP7A 4HLDA 1AGYA 3T41A 1NXPA 3CJQA 1UJ4A 3MSXA 3D7KA 4CG2A 3L8YA 5IAEA 4LDZA 3SVZA 4FQ7A 3VV2A 5AJVB 4IAOA 4J91A 2GYUA 1DELA 3MRVA 3PDUA 4BU0A 5IASA 2V7UA 4WSOA 4UEKA 1D0IA 2NG1A 4OQ4A 2G1JA 4INAA 2A84A 2WFZA 3KOUA 1QLHA 1TEXA 1MAUA 3TQSA 3O4HA 4KWHA 4M55A 1ADGA 1R0SA 1UF9A 3NKLA 3OEHD 4FMPA 1FZTA 1JKXA 2ZYDA 4JT4A 2YYZA 4B79A 2L42A 1R7RA 3C5EA 5ALQA 3KQQA 3VSAA 1YDHA 1Y5IA 1X7WB 2H9AA 1AA9A 3KAQA 4UNRA 2XI4A 2CYAA 4LNUB 1PZEA 2VT7A 1L8XA 1P61B 2KJQA 3GPIA 3V1NA 3HBNA 4HX2A 1HKHA 1NOKA 5C37A 2BD0A 1V7ZA 4OA8A 1E9FA 2YH2A 5A5EA 1ZD3A 2DPGA 4C3VA 5AUQA 2NU7B 3WGTA 2V0GA 2ICAA 3U7RA 1TVEA 3BSSA 5AUPB 4O4HB 3VZDA 4GT1A 4DS3A 1TVCA 1YOVA 2DBZA 2N0SA 4N8DA 1K9VF 5FUQA 5LOVA 1LBHA 4BVLA 1NFQA 2I66A 2VJCA 1NP7A 2ZXFA 3GGDA 2JD0A 2JGNA 1ECBA 4K9RA 4O5OA 4UKDA 4ANFA 1I36A 1GTSA 2QTTA 4ER6A 1NJ5A 1UK7A 5HF6A 5AVYA 2D1FA 3F2VA 3NGLA 3AG5A 3KQMA 3PQFA 1Q92A 4HZUB 3HU2A 1ZM3A 4S2EA 1KDYA 4N41A 3SVTA 2HFKA 3CNLA 1NVUQ 4U2BA 4A5OA 3KL4A 2RCYA 3N2GA 4BVKA 1RIIA 1R9MA 3NDRA 4YRCA 5KKAA 4Q3CA 2PUAA 1NI3A 4I36A 4B85A 2GO1A 5EXDA 1GXSB 2FEXA 1ZGGA 3G17A 1EJ0A 1A77A 4NYJQ 4QRIA 5FULA 3UAYA 4E7PA 5FOQA 1P2FA 1ES9A 4RD6A 1JALA 1QK4A 2R60A 2JCYA 1Z08A 2AQKA 1JRLA 4IVRA 1F4PA 1F3OA 3JD1A 2O5RA 2JFXA 3M7IA 3OIGA 4U2DA 2JGKA 4WNCA 1CHNA 4AZ0A 4KDCA 5DYWA 5K1ZA 1GGHA 2OZLB 3TNDA 3UWSA 2XDYA 3RU2A 1ZM9A 5E4JA 3DKVA 3K05A 1A7JA 1F8YA 3JY6A 2PUEA 3VTZA 2FE4A 4DPKA 1BKDR 1S01A 1XI2A 1YD7A 2Q21A 3I9KA 4MS1A 4OQDA 5FL3A 3UK0A 2V4ZA 3IBTA 3K0KA 4QAQA 5KQRA 2OL4A 2PUWA 1XO1A 3OECA 3RQIA 4MV0A 4P86A 3MHPA 3FM9A 2CW5A 3KWMA 3Q8XB 3ER6A 3UHOA 4A6PA 5J9FA 2ZZNA 4UTOA 4ESHA 2E55A 2ZR8A 2GDZA 2JIPA 3JASA 4MR9B 3KB2A 1PBNA 5A2GA 4EJ2A 2X4GA 2DG2A 1K4YA 1V5WA 1R9GA 4KHZA 4NU5A 2ETXA 2DY0A 4WCFA 1KE1A 5J2UB 1QE0A 3C7AA 4EF6A 3RJTA 1H8ED 1OD6A 2FG5A 1XCOA 3ET4A 3HMQA 3L0YA 4TMVA 4UUPA 3AF1A 3ISTA 4XSVA 3DFZA 3L0OA 4Q4JA 3AVVA 4CODB 4FCVA 4CMEC 4E5SA 3O1LA 2NV2B 4GWLA 1EFVA 2GQ0A 2JFFA 3HDHA 4EBFA 3G0CA 3EZLA 3OT1A 1XK6A 4A16A 1E3EA 5F1YA 1FL9A 1YQUA 4YRIA 2H4WA 1BMQA 2NZJA 2VWPA 1W6RA 1W2WB 1ZH6A 1C9MA 3QP9A 3L4BC 3DB1A 4RENA 3PFGA 4TMFA 3SQLA 4E33A 1FSZA 3FYDA 2QKYA 3ISVA 2RGDA 3AB8A 5E9WA 2QZ4A 3UH1A 3V55A 4NNOA 1Z3IX 3AV0B 1SVMA 3EGCA 1SVOA 4DV0B 4B32A 1RWNA 4ND3A 2PAAA 3VAYA 5JJKA 1EJ6A 4LXIA 1CK4A 1YR8A 4YP6A 5MHTA 1T3HA 2XJ4A 4HX5A 1N6NA 4CEIA 4A92A 2A5FA 3T4PA 1K8ZB 2PQ6A 5TQ2A 1ZR2A 1EFPB 1A98A 3PL5A 3S1AA 4EUHA 3S7TA 3TAXA 2HCFA 1C1HA 4QFBA 2HV9A 1RLUA 2WF5A 2D54A 1GPUA 3F6SA 3KHSA 1CYEA 2FEKA 3NHLA 3FUTA 4PCVA 1JR6A 4RWZA 4KDFA 2R2GA 1QJ4A 1WZEA 3BHMA 4CDRA 3W3AH 4W4TA 2F8MA 5KQMA 3WFZA 2QBYA 2BZSA 3ZS9A 1DOZA 3UAOA 1G3UA 1WMEA 2GETA 2QD5A 3AUXA 4YJDA 2WUEA 1KVQA 5IN5A 3F5FA 2AFIE 4IMPA 4MUIA 3NWOA 3HXTA 1Z6YA 2JLCA 2O2CA 4R40A 4YREA 4AO8A 4CKBA 4KBGA 3L1UA 2AC2A 1JEAA 3H83A 1NP6A 3MD9A 4G5FA 3QNWA 5CD1A 2QSYA 4AS1A 1N7IA 1P6UA 3BB1A 1CRLA 3IQZA 3LVQE 2J9YB 2UZ4A 1QAOA 1H69A 1UXKA 4LI3X 4DWJA 2BP7B 3EF1A 3MRTA 5AO9A 1THMA 1M2VA 2GGSA 5EZYA 3KJQA 4MB2A 4C4XA 3OPQA 1T34A 1RKQA 3W5SA 4JT2A 4EY6A 2O2XA 2EBFX 5T6MA 3KS9A 3NTXA 1Z5ZA 2P67A 1CUJA 2CYBA 3NHUA 4RVSA 4DLPA 2P9CA 1TYAE 1SHLA 1W96A 1MZVA 2I34A 4OPMA 1VOTA 8GPBA 1UJ6A 1MABA 2V65A 5KJCA 5L9AA 3WLEA 5CB4B 4PS1A 1NXXA 4F8YA 1G4AE 1LDEA 1Y82A 2HRDA 1UBRS 4O2AA 4BO3A 5C8DA 5AVVA 5JC1A 4F3TA 1C3VA 1NVTA 1DBIA 1UIMA 2GZ2A 4QPDA 2YICA 3C41J 1UPXA 3KJZA 4MR9A 2NSLA 2PGOA 5D86A 1R4MB 3UMJA 3W6OA 2BMAA 3PFNA 2H59A 2J0SA 2ID9A 2ZUDA 1NVVR 2X4LA 4IWYA 2FPXA 4LE0A 1P1CA 2EV9A 4ZVQA 4Y2YA 3RBAA 3WL6A 5TVKA 2ONCA 3BGDA 4NOKA 4OP3A 4PLYA 1NIJA 2EF0A 3H2JA 3C8UA 1MB4A 2QTNA 5BVGB 5AHXA 3L9XA 5EAIA 3L4JA 4RA6B 4V0MA 2JFGA 5EL0A 2GM3A 3FPAA 4LRXA 5IVIA 4B0PA 4Z54A 3BDAA 3H65A 2JJMA 3A4TA 4BRWA 1BDHA 2PT6A 3HYSA 4IFTA 3MD0A 4BUZA 3R7FA 3EVDA 3SSAA 3W78A 1GGNA 2ABWA 1IY1A 3SR3A 1JHXA 3S1SA 5KNCD 2IOFK 1Z38A 4BYGA 5CIQA 5CT6A 3KBOA 1C7QA 1PKXA 1KE2A 5F78A 1VM6A 1AKMA 1Q50A 4OXIA 5DI9A 1AKEA 3U17A 2MSDB 3G7NA 3LD9A 2IY8A 1BROA 4O4HA 3C5WP 2O4CA 3CJRA 4CIDA 5AW2A 2ZJ7A 5JDCA 2GM4A 4GFDA 3V8NA 2F4NA 1AUPA 4JS0A 4UNNA 4ZD6A 3FTEA 1MC4A 3H19A 4YRPA 2WFAA 2IS6A 1UT6A 3GH1A 4HZUA 4BNUA 3LWNA 1T0HB 2X9NA 1FLNA 3U3MA 3HDQA 16PKA 3RIMA 4V1CA 1DRVA 3KJIA 5H3CA 1YC5A 1L5HB 4ZI3A 5KQGA 1RWWA 1DAPA 2XWBF 4KXYA 3KZNA 2G3YA 3EMKA 3HCBA 1CUXA 3U4HA 4CT4B 1P73A 2JGDB 2ZBEA 2YZ7A 3QPDA 5DI3B 4KO3S 2HDNB 3OWHA 4HSEA 1REQA 1O8BA 5FLXA 1N32B 3U13A 2I3GA 3WRXA 4D0LB 3IELA 3ROTA 1UJ2A 3GEDA 2Z4SA 2I2XB 3VVLA 4OHCA 4DJ5X 4EEKA 1AS3A 5C4GB 3GAZA 1D2CA 3GCXA 1KBOA 5JFOA 1PZHA 4C0QC 1FX0B 3AKYA 1QOPB 3TXXA 3W5JA 4DHEA 5K03A 2VK4A 1FB5A 2WNSA 2GD2A 3HR8A 3MWGA 4FGLA 4RUKA 1JAHA 3BMQB 1OXXK 3PXCX 4QGHA 3AUFA 4UEOA 1JKJA 1XZQA 3BERA 1NAIA 1NMYA 3MLEA 1I6MA 1ZBQA 2R1ZA 3NORA 3OX4A 5TQ0B 3N8HA 4OAQA 5DEIA 2Q50A 4YK7A 1R8XA 3U4DA 4ER5A 2JFHA 1YR9A 1KEUA 1XRJA 1JF8A 1VSTA 3HB1A 4WH0A 5AVWA 1MORA 1HNZB 4TS3A 1GR0A 1VIVA 1J8MF 3TZ6A 4BTLA 5J2UA 1ESNA 2UXBB 3BYZA 3GPDG 5C8ZA 3NG1A 3IDOA 2AC4A 4FBMA 5EKXA 3GJ3A 2WDZA 3PXUA 5EUBA 4AMYA 5A03A 1PYGA 4QPJC 4CFYA 2PPLA 3FCYA 3NBXX 3UK6A 3UMGA 3BWMA 4RMNA 2FN3A 5DHQA 2OFFA 3WB9A 1XJCA 1UBMS 3Q5GA 8ADHA 4E51A 2BKXA 3RBXA 1H9AA 3ND7A 4GOMD 3ZIAA 2VPTA 3A9CA 2B37A 3AF4A 3A2NA 3PUXA 4N5HX 2J08A 2PGDA 3WLOA 5DGTA 4BAZA 3L3BA 1TA9A 1AB5A 4KC0A 4O02B 4X44A 5C5DA 4FUTA 1ZK3A 2H11A 1MOQA 4DSZA 3R44A 2G1KA 4GOLD 5EFZA 1EXDA 4HAIA 4LC0A 1L8QA 2QXYA 3ZDFA 5IRCD 4BECA 3C3YA 1FYEA 4MRAA 1GAXA 5CM9C 4DAOA 3NC1C 3R0IA 2W2QA 2W11A 1PSDA 1IHYA 3E2MA 2IHKA 4R5MA 1JT2A 5JBIA 5JU6A 1G3MA 2GILA 4LOKA 4Q82A 3L43A 4RTPA 1V9CA 1YR3A 1EFPA 1JW9B 4F06A 2R8OA 4Z0TA 4JN6B 4V0NA 5KAMA 3RWMB 5J4KA 1B3BA 3A6LA 3E7FA 4ZV7A 4PE5B 4YRQA 3JD4A 2HSWA 5EP1A 1BEEA 1GZHB 5TPWA 5JROA 1DADA 4AQDA 2CK3D 3DAGA 1ICIA 4U6NA 2ZP1A 1MC1A 4F1KA 4OFZA 1PJBA 2HTFA 4D4GA 1XMSA 3KKQA 1H2YA 1G20E 2PMWB 2UV8A 3QY9A 3SKYA 4DJJA 1OB5A 3WOVA 1DFHA 2KS6A 1GT91 1MIOB 2OCAA 4K86A 5DPMA 1C4WA 2QQ0A 1WEKA 1FU7A 3BMOB 3IURA 2ACVA 3HM9A 1W30A 3QWIA 4R16A 1DC8A 4DTIA 4ENWA 2J3DA 3VNAA 1V6CA 2C59A 3TR6A 2WAXA 2BP7A 1SJ9A 1PD1A 2RAFA 4IQ4A 3M6AA 1TM5E 4L78A 4FS3A 1JU3A 1A2QA 3B3AA 2VQFB 2VG8A 1DEOA 3SF0A 1BEUB 2E7ZA 3FZGA 1HOTA 4BO6A 4UNQA 3FZQA 4HQFA 3WZLA 5KWVA 1VP9A 2IPNA 3QSYA 2REBA 5F7XA 1SHUX 3K9FC 4YXFA 2ZUBA 4NZ9A 1ZH8A 5BSHA 2PX8A 3Q5DA 3TLYA 3OEED 3W2IA 1Z75A 2J3EA 3BMCB 4KKXB 4CN9A 3P4UA 4F11A 3FUCA 2GF0A 3NH9A 2FW1A 5CB4A 3N7UA 5DT9A 1RC8A 4R2XA 2GXAA 4DB2A 4KXLA 3QEMB 1HI9A 5DK6A 2XDWA 4CN8A 2Z5LA 3H2KA 2KB0A 2WF9A 3CN7A 3ZW8A 2EJBA 2FSVA 1AT1A 3RS5A 1JDNA 1NW8A 5IJAA 1SBCA 2VDMB 2F1RA 3OEWA 4BNKA 2A59A 1IE3A 3PEUA 3BQ9A 4L5IA 1N0WA 4WLVA 1KOLA 2CMHA 3RBZA 1YWGO 2VXBA 4NTZA 2QNRA 2AJBA 4G81A 3THRA 3ZI4A 3U80A 1NW4A 1DC5A 2XMQA 1ZAYA 1CDOA 4IV5A 5B6IA 3NHPA 2H2GA 3P19A 5LA6F 2OCPA 3DWFA 4UUBA 3D6HA 4BFSA 4RA6A 1X1BA 1K3FA 1MJGM 3AR7A 2BUCA 3DFMA 2GXQA 1V16B 3GLHB 4WXHA 4X6XA 4JI5B 1BA2A 1JJIA 4JBIA 3WB2A 4U7DA 4K03A 2I7DA 1QORA 1B6TA 1HG1A 2Y05A 5G53C 4ZKDA 5D5PA 1N4DA 1U6IA 2ONKA 3UZUA 1P4AA 3OE7D 4YAIA 4H31A 2ZI5A 4PXYA 5CFOA 5ICGA 3CZ4A 3TUJC 1P3DA 4DLBA 3E9CA 1B8VA 1OLXB 1XTPA 1FNSA 4HDAA 2EDCA 2GZ1A 2JK1A 2RHCA 2IDMA 2OUKA 1AUVA 3IJ5A 3QVWA 3DKKA 4JJAA 4IDEA 4XAQA 5DRYA 2R8PA 2CDCA 3C7DB 1ZOSA 5KWSA 2AOXA 4M54A 4WXYB 3IO5A 3DL4A 4R98A 4M88A 3SEZA 1E9CA 2H1VA 3GD7A 4L6CA 1FDIA 4CL3A 4ZEVA 2PCLA 3GLQA 1NWHA 4FX5A 2ZJYA 3A0RB 2CV1A 1BDJA 3PEFA 1E20A 1H23A 3SHOA 4PBRA 4EECA 1W2GA 4EJ0A 1EG2A 1TT7A 2FUG6 1Q16A 2MSEB 2VZLA 3CRRA 3LFTA 4GI5A 4ZC1A 1L5HA 3W1WA 4JUCA 4PYKA 4RY8A 3U9LA 4Y2QA 4DIOA 5BR4A 1US8B 5K0CA 3PHLA 2C29D 5CDTA 3KB1A 3E9ZA 4BQOA 4JGGA 2AFHB 4AYTA 2QJRA 3L49A 2X7XA 1Y1LA 1H0HA 1Q17A 2JAPA 1EXWA 1N5OX 1IH8A 2XXAA 1IIBA 2VDQB 5LMUB 1GGJA 1D2EA 1NASA 3OZGA 4UDNA 3MC1A 3RIGA 3ZPXA 1WMBA 2OP1A 2WD7B 1N0UA 5FD8A 3LQ2A 3BMQA 2BFNA 3IUEA 1TVKA 1YR1A 4TT3D 2GPTA 5HYVA 2QQ5A 4ZODA 1DQNA 2DT8A 4CCYB 3NO4A 5TLSA 2O8FB 1CYDA 2BCEA 3DBVO 1RKXA 2ZIVB 3L0BA 3WXMA 1C0IA 1CUYA 4KBYA 4YQEA 1A27A 3L8GA 5T3YA 4BO8A 3F6CA 2YRXA 3Q9NA 1SBNE 2GNOA 1HPLA 2ZBGA 3K9WA 2H2AA 1TNDA 4HBGA 2CNWA 1Y5RA 3IP8A 2VTBB 2H7CA 4BQQA 4YCCA 3FNGA 4GXQA 4OU4A 4CF5A 4PANA 3FNIA 5LP1A 2FWMX 3COSA 5AM2A 1T6BY 1VIAA 1N1GA 3GLFB 2H92A 4FHCA 4HWTA 4D9BA 5CEJA 5EIBC 4IV8A 5IXSA 3T12A 4I4TB 4YJHA 3TDMA 1OREA 2QVXX 3EDOA 2PTHA 4F92B 3IDQA 2AOTB 1NVXQ 3FMVA 4GL4A 3MTAA 4EPTA 5IJ0B 2YY5A 4L75A 4XGNA 3VH3A 1MD9A 4EHKA 3W6ZA 3ZGYA 1M1ZA 5BUCA 5KZMB 3CA8A 3C6QA 1GLNA 3IILA 3AOEA 4KRYA 3KXIA 2HY7A 2OM6A 1EHYA 3TTXA 3GRZA 5AWFC 2D0IA 5JANA 3BJMA 3HE3A 2Y99A 1S2OA 1JMYA 2C3UA 2CV2A 1YJ8A 2AD1A 1LLCA 2O48X 2RMKA 1SG6A 1M8PA 2PZMA 4L4ZA 4ZK2A 4YCSA 3RABA 2VHJA 1ISHA 3RTAA 2G36A 3D2BA 1HT0A 2BGNA 2O3JA 4M6WB 3RAFC 2FRXA 5FEMA 1JAYA 3SM3A 3OBBA 3PJFA 4L6AA 4B4OA 2ZT6A 4KQEA 1YZKA 3O4FA 4C5CA 3R23A 4P7KA 1MC5A 4K6OA 2JFBA 4IJKA 3UGKA 2HWUA 1EFCA 3I2GA 4RO0A 1Y8ZA 3SSMA 2QU7A 4YRLA 1WDWB 2O8EB 2YIVX 1MIOA 1QGDA 3OT4A 5D1HA 3ZOZA 4LPKA 2CVHA 1GAWA 1WNTA 1KPIA 1PDWA 3BMOA 1JQ3A 4P4TA 3TIXB 3H4IA 4PPGA 2PQMA 4MW0A 4WFQA 4CG0A 4OI1A 5C4IA 1NONA 1T91A 3HCFA 3IAHA 3JQAB 3TR5A 2CXPA 4BLVA 3A9WA 2AHRA 2A4KA 4CG1A 3EZNA 2D3TA 3BMNA 4IQ8A 2ZT5A 1FFEA 4L5YA 4JAVC 4M9ZA 4MGHA 2PK3A 2X42A 3DT8A 2AJTA 5I01A 1JBQA 3HC7A 1H4QA 1SVNA 3CZCA 4OXKA 3QXGA 1TUIA 1OFHA 4Q9JA 3C3MA 1X14A 3DFFA 3KP1A 1TAUA 1PZNA 4I3FA 2ET6A 3TGLA 2ISCA 4RZXA 1N78A 4WXPA 1Y1PA 2FLVA 5JQGF 1G60A 4RADA 2ECFA 1NLZA 3BMCA 4Q05A 1DNPA 2NMVA 3G5AA 4Y6LA 2DOKA 3BL6A 3VI3B 4DV2B 1NYQA 3TQRA 3ZJ5A 2R44A 4A2QA 4D4JA 3SQWA 5DTMA 1Y3DE 4BE7B 3WGGA 3QEMA 1E7YA 3S81A 4YJ3F 1B1AA 4LVNA 2OORC 3VC3A 1HX7A 3I2YX 4EFDA 1SQFA 3ZCPA 4IGIA 4UNIA 2V7WA 1VPWA 3K3PA 2QLFA 3IA2A 4HXFB 5AJHA 2BGUA 4EB6B 4JVOA 1N1DA 4ITVA 4U6SA 1LPAB 2XMBA 2X2FA 3ZVRA 4E5YA 2IU0A 1U98A 2YW9A 3KU4A 1DBWA 2WP8J 4QICA 5C8YB 3PJEA 4JI7B 2YFQA 1QRTA 2HRQA 3KXLA 5ADUS 3PQ5A 4CI0B 1U9IA 3T38A 1DC6A 3EQ2A 2IZ6A 1TFUA 3L6EA 4HLUA 4UUOA 4AO6A 5IT5A 1O7JA 2B8WA 3LBFA 3MWLA 4BFZA 4RCZA 4UC0A 1OBCA 4UAJA 5SYNA 3RUCA 4EUFA 1I2MA 5A3QA 5BSFA 3JQEA 3RYIA 3TD2A 4HWKA 2YKGA 3PI6A 1H9BA 2R6FA 2ZTLA 3HCAA 3K71B 3WKDA 5AVTA 2EDAA 2J7KA 4XB1A 3T06B 4BPBA 4YJ2A 2H1FA 1IL0A 4XDHA 3ABZA 5JVDF 4HK4A 5B36A 4N0PA 1J8YF 2NPOA 4R41A 4Z7NB 4NL4H 4PG4A 4LNHA 4RMHA 1GNLA 2AOUA 4KMSA 3RD5A 4EFNA 4TMWA 4BQRA 4KNWA 3M83A 2CK3A 5HNKA 1YB5A 4YROA 2XXBA 1IDOA 3ONDA 1WG8A 3QITA 4FD3A 2K5UA 2FZWA 3O0TA 2JARA 2Z9DA 1J5EB 3RYCB 4JL6A 5KNDD 3IUBA 1J1IA 4JB0A 4FS8A 4FQ8A 1C0EA 4WKOA 1C5KA 2FPOA 4IDGA 4EPXA 5CG2A 1GKUB 2WTBA 4PYJA 3ADDA 4RCVA 1V3VA 1XRPA 3GUVA 1UL1X 1H3NA 4JA2A 5AOAA 4K9DA 3V4ZA 3V8PA 3O8CA 2HA7A 5KYXB 3KZKA 1UINA 2NXJA 4L5JA 4ZI5A 4NV0A 3TE6A 4M1OA 1KYIA 3KM0A 4C6TA 5AXBA 3D6TB 1WUJS 4KAAA 1AK9A 1OTYA 3AQIA 3KKKA 2KYRA 3OM9A 3QXSA 4G1EB 1L7DA 3FFXA 1TA4A 3FRHA 4B81A 3UFXA 5HM6A 1JNXX 2ES4A 1CVIA 2WD7A 4ILKA 1G59A 2W2OA 4TM7A 3RW9A 4BO7A 4F72A 2C31A 2OBMA 5MN4A 3UH0A 4BEVA 4UHHA 3KEFA 1FFGA 3GLKA 5HFJA 3TUZC 1X77A 4PNZA 4YRJA 2ZYRA 1TCAA 5CDGA 1CQJB 1O0BA 2O8FA 4B4VA 5C8VA 4V1CI 4NBUA 4IFIA 4DDUA 1V3UA 3WAGA 3KAPA 5CDFE 3RUHA 1H0KA 3NOOA 3T4XA 2RCNA 3GPLA 3DZKA 3CF4A 3JAKA 1EX6A 1J22A 4V2IA 4YJFA 1F1BA 2BKLA 1H5UA 1P8AA 2Q6OA 2Q6KA 4JR0A 5F64A 3ZBQA 5IKEA 4NEGA 1XLVA 3K4PA 1KEEA 3NUQA 5AVZA 2PSEA 3KQOA 8AT1A 1HE2A 2YHSA 2LD4A 1FCJA 5DBOA 5DFAA 5KDDA 4LECA 4HP8A 2D62A 2YRFA 1EGHA 2ZPAA 3PPXA 5H0IA 3TS1A 1IZ8A 3T8YA 1D4FA 4IMRA 4XXHA 3FNBA 2FWJA 4XX0B 1OYYA 3M9WA 1M5TA 4A03A 4I4TA 2A9QA 2JRLA 4EI7A 4BIIA 1AY0A 4QBHA 5IN4A 1NOJA 1CX9B 1JG1A 1QCZA 2AG1A 2AOTA 5AI0A 3G8BA 2NYVA 1H6DA 1IBLB 2OD9A 4KQHA 2ESRA 5IAOA 5GJVC 1KJJA 2EFEB 4P36A 4HPWA 1N5RA 1Z5PA 2D5IA 1G38A 3PF9A 1BDMA 4E1VA 2ZS8A 4ZOEA 1E9SA 1C3JA 4F4IA 1ZAKA 3OE7A 4CM8B 1MO4A 4PLHA 2W6IA 1XIVA 1E1YA 1CUFA 2DC1A 2J3KA 3BTVA 3EY9A 1FJHA 4KMMA 3UNXA 4F3RA 4HDKB 3E1KA 4DYDA 1QSGA 2PKCA 3E22B 4YX9A 4DM4A 3EIFA 5DCWA 2IXDA 3LL7A 3CTPA 3CKKA 1B42A 2VQEB 3OKFA 2O8BA 1AHNA 3ND5A 2CEKA 3N3BC 4H7IA 2RD2A 2HXYA 1U4SA 3WGNA 1M2FA 4M6WA 2I6QA 4Y2SA 4AUEA 1CE8B 2G9QA 3V1LA 4ZN6A 5LPNA 1E7MA 1F9EA 2CVFA 2SHKA 3U37A 5IZ4A 3HDGA 2PUDA 5DHFA 3RUDA 1JLHA 3JARB 2BZGA 1KMCA 2O2EA 1U6KA 4REMA 2QLBA 3I45A 2WQ6A 1J0EA 3AVXA 3STWA 3V7FA 1JB1A 3KOXA 4MVJG 3GA7A 3UEOA 2FPIA 4GXRA 3L7OA 1UBGA 2CJWB 2O59A 2HLNA 4LCBA 4UDXX 3STTA 1XX6A 1MO6A 1S96A 5EA2A 4M0DA 2X58A 4U5XA 4Q9LA 3LA6A 3W34A 1KOFA 4ZZIA 1YJXA 4FVTA 4Q4CA 1VLHA 3B9RA 3JQAA 3P97A 4FZVA 1TO2E 1I7SB 5A0VA 3DHYA 1UCFA 3C7CB 2D06A 5REQB 2WSYB 4AJ9A 1RAAA 2HJSA 3NTRA 5C8XA 2QE7A 4B2IA 2Z8ZA 3ADOA 4IHQA 3GROA 2WMYA 4TT3A 5F12A 4Y6GB 1RYYA 4D56A 3SP1A 4Z86A 1GR1A 4IEIA 3GGPA 1XZGA 3TRFA 1O89A 3H8SA 1DRKA 2VO1A 3OC0A 2WY2D 3JW8A 4H4DA 4ZV4A 2L19A 4A0HA 2BFBA 4CMJA 3OA2A 4G84A 1G5FA 3RV3A 3ZCUA 2ZWVA 1IBSA 4FYHA 4X94A 2ZTSA 3VOTA 5BV0A 2JIQA 4A4DA 5IDWA 3CWCA 1E6MA 3ILYA 4U7PB 2DXIA 4FFOA 4E2FA 1OFVA 3ESRA 4O3FA 4F6RA 3WKBA 4J76A 1GKKA 4YP9A 2QY6A 2ZZMA 3MTJA 4O08A 4R2WA 2IODA 1ZK2A 4Y30A 1AKTA 1CZNA 3O4RA 4Q00A 1P2DA 1WCWA 4QFMA 3W2HA 3FRIA 1YQDA 4Q4DA 4PIVA 3IV7A 3L7JA 1GGMA 1V37A 4WKCA 3QBJA 2ZAMA 4BCCA 1CY1A 3DUWA 3ICVA 4HYTA 4XKJA 1DZIA 1WABA 5T4HA 3V9AA 3IKVA 1TYEB 2VJAA 4XH9B 3RFTA 5JYCA 1P5HA 1Y6ZA 2ZIAA 3G0HA 2A33A 4TXLA 3IPAA 2X0FA 4UTPA 1UFOA 1RWQA 1Q7EA 1ATIA 1XZJA 2P69A 3FNEA 3IEKA 1IWPB 1KSHA 3AEUB 1WL8A 1K5HA 3DXXA 2GVZC 3G68A 4I5DA 4ID9A 2P68A 2QGZA 5HFAA 3RG8A 1JJAA 1QH9A 1SK9A 3BF8A 5BV8A 4LFBB 3HKCB 4K9SA 1OQAA 3DE0X 1FFHA 4XTCS 3G2HA 3SX2A 2PUFA 2H8GA 3GG9A 3OU7A 2VYND 2A30A 4AYWA 1M0EA 3P94A 4B47A 3VDRA 5IBRA 5BYKA 5C51B 2OVBA 2WVHA 1Q0ZA 4R3UC 4XA8A 4NPCA 4YP0A 3AERB 3Q0IA 3KQKA 4JYAB 3T61A 1T9ZA 1IK6A 3PB3A 2W6ZA 4AZWA 4AXXA 1S2NA 1HE4A 3FOFC 2YCLA 5FQNA 4WCFC 4CFSA 1ZOLA 2Z04A 3DL2A 1YRWA 3EULA 1HLGA 1TUEA 5H68A 3TOVA 3VKWA 7MDHA 1I4DD 4PINA 4UPEA 1PR3A 2J3JA 4AY4A 4D6PA 2Y6UA 4KQIA 4RIHA 3ZLJA 3IQDB 4DQKA 2QRVA 1OJ7A 1DCKA 3I28A 3QUBA 4G1VA 4K9PA 3VUEA 4O4HF 3ZQ4A 4ZCIA 2WU8A 3G8YA 3BT7A 4JHLA 1EYZA 2BMVA 3AX6A 2VSXA 4JODA 1CWUA 5J2TB 4BRZA 1S2IA 3T5DA 3W5VA 4ZYLA 2VA9A 3SEFA 1D6SA 4DLAA 3R3UA 4FSXA 3SKXA 5ICFA 1ABEA 4I2NA 2O0MA 4FMCF 4YUAA 1G1MA 4IIFA 2NZ8A 5C52B 4I14A 2XIQA 4CYMA 1CNMA 2QTCA 2H1WA 3QLJA 4EMSA 2YJ5A 5FDFA 5KOJA 4KP7A 3IP9A 1Q0QA 4LZAA 4QOHA 4MB0A 4L73A 4PR3A 1E1KA 3TCXB 3WB0A 4MWCA 2YMMA 1YNSA 1QCDA 1SVIA 1PK8A 5JAHA 2G0NA 4BCBA 5JS6A 2Y8EA 2ZULA 3CUTA 1VG9B 2Y92A 3OZEA 1W85A 3QFCA 2O3UA 4N6OA 4B3FX 3MZ0A 3QHPA 1CQJA 1OROA 4PZZA 3L1VA 4UBNA 4M1QA 3D8UA 5SYMA 2PSHA 4RXMA 2EU8A 1XZMA 5CAEA 3G6KA 1MVOA 3IIIA 1FMJA 5CFZA 1JDZA 1PQUA 5B58C 2RBEA 1PJSA 4MW2A 1NVVQ 2VYVA 3TMYA 3TNFA 2WWXA 1Y3IA 3ZWOA 4JEHA 2WJ4A 4BZPA 1PGJA 1V1JA 3OOWA 4UOEA 2CD9A 3BD7A 3GFGA 1CIVA 4C7XA 1U0JA 1GDDA 2O14A 1RM0A 2ZRLA 4QRDA 2YZNA 4ZQEA 2PWAA 3TLEA 4BB5A 3N0WA 3O3MB 1GOTA 4FFWA 4DA6A 3I3SR 1ITZA 2GLTA 1DKNA 1WP9A 1MDBA 3DMPA 4BLRA 1NXTA 3WE7A 2I8AA 2WJIA 4KH0A 3T54A 3RUEA 2MYUA 1UXHA 3OZDA 5CCBA 3GEEA 3VSDA 3MJCA 3FBWA 4J2HA 3CNNA 2BGKA 2JKVA 3RVLA 1PJLA 4B4DA 4BE4A 3HRKA 1VYTA 5SICE 4B7XA 1IZ9A 1YBVA 3FF4A 4FDMA 1E61A 4UQLA 4CM8A 2ATXA 1IB0A 4GX0A 5JFTA 1EPUA 4RTSA 3JRXA 4EI2A 3O74A 4GWKA 5KCMA 3PX7A 2V6IA 3E22A 4CDGA 2D4AA 1WV1A 3O8OB 5CBPB 2FF7A 1F17A 3USES 2D2EA 3CVYA 2AN3A 1YB2A 3B7WA 4IVPA 2O2ZA 3HN6A 1CE8A 3HSSA 2YWCA 3L7CA 1GNSA 2HMSA 4YV7A 5LL6P 2XYRA 2WT9A 3AM3A 3KQYA 5FBZA 3V4VB 3NV7A 2CL5A 1YJQA 4H77A 4X97A 3GZJA 3PT9A 5DBFA 5DYYA 1IQPA 4B6QA 4LV6A 3GLGB 4OBXA 4FYYA 2WI8A 4WDQA 4ZV9A 5ULLA 5KTKA 2AS0A 2FPLA 1EB8A 1CVLA 3OIUA 4MPJA 1NNLA 1GL9B 1YIAA 2PO7A 3L79A 4OXNA 4RABA 4WXMA 2QXTA 3KUKA 3W3AA 3FTFA 3ZYZA 4AQYB 3DUFA 4MXDA 4MW4A 1CC1S 1L9KA 3A70A 2WNIA 4MVJE 1JXOA 4W5HA 1BU8A 3BSFA 1ZSVA 2PRKA 5BV1A 4TV8F 1RRGA 1KJNA 3OZ7A 3WDLA 2ZJ4A 4E2YA 1XZEA 3NHKA 5REQA 1K63A 4HEA6 1VJTA 1Z2PX 3MLAA 4P4SB 5CNJA 3USCS 2P2ZA 4MUMA 4O2RA 5HMMA 2DCUA 3LQFA 4H1TA 3T9FA 2QE6A 4E2ZA 5IF3A 3LX6A 2E4AA 5ITSA 3G5MA 4NCNA 3ONWA 3ZZ1A 5IS2A 4LRSB 2JHGA 2P0AA 3AUTA 3KLBA 4ENTA 5A4JA 3KJFA 4QFDA 1GRVA 2FU5C 4L8VA 4ARVA 1JILA 2NUPB 4ZT5A 1QP0A 4M22A 1DCFA 4I3HA 3LQQA 5JDCC 2E6KA 3OP1A 4MB6A 2EZ9A 1MJNA 4JI2B 3G8AA 1RYFA 3W05A 1ZFNA 3NAQA 2J5RA 4MLZA 2GAFA 1O77A 5T4BA 2XY4A 4KVZA 4HH3C 1NY5A 2SKEA 1DIBA 1Q1NA 4GMGA 1VHLA 4Q93A 3GJ8A 1B3RA 1A9YA 2HA4A 1OAKA 4L0DA 1NQXA 2R6AA 3P7MA 4M89A 4XJVA 1LRJA 1TTPB 1HL3A 4G09A 1ZIYA 2YN4A 2YXBA 3AKEA 3DBHA 3DVAB 4X7BA 1T9AA 2VIIA 4C1NA 1MTOA 1ND6A 2EWVA 4D42A 4D98A 3QELB 5JC8A 5KYVA 3WRXC 1KNQA 4N6GA 3ZLBA 1KDVA 1ULAA 2WNHA 4IHJB 1OFUA 2QTBA 3CW2A 2XD4A 4F6LA 5F2NA 1FZQA 1F1JA 4G37A 1HEUA 3Q12A 3DO6A 4C04A 1T5OA 1ZJZA 4WK2B 2HIGA 2WTEA 4GOKA 3WL8A 1NFRA 2OHJA 1YCDA 4RLQA 1E94E 3KG2A 4O8ZA 5JAMA 4N6NA 5LD2B 5EQFA 4QFCA 3RSOA 3FPEA 4NMWA 1Y8AA 2Y4NA 1AO3A 3G1TA 4U2CA 3VISA 1XDDA 3I39X 1LUAA 2HXSA 4IDCA 4JUFA 3RK0A 3AERA 2DHQA 3HCOA 3UWKA 4RVOA 3ZXIA 5IANA 3ZLVA 3EIUA 2FMKA 3ZH2A 4K8OA 1NMXA 5DNEA 5AVRA 3LUPA 4U3JA 3GT4A 4WINA 5B7NA 3MTGA 4PRLA 3SZLA 4YAGA 3GYBA 2HI0A 1ZPDA 5JE8A 3HKDB 3MRSA 2C88A 2ID4A 4KQ6A 1LQUA 1Z8HA 2CL0X 3PUIA 4PTLA 2VWGA 4EARA 1X94A 4PSVA 3F7OA 4LHEA 2HHAA 1CEQA 5JALA 1BG6A 1NI5A 2R79A 5AP9A 1E60A 4K3UA 2H1LA 1QV9A 4MRPA 1Z39A 1WXGA 4P6VF 4ECEA 4I1IA 3WWDA 1GL7A 4WA7A 1BWRA 5J2TA 2ZT8A 4IMJB 4KV9A 4K6MA 2IBTA 3MIIA 1UBCA 2GD6A 4X7PA 3L1KA 1YS6A 4O59O 4YCBA 4NF2A 5DEOA 3WLMA 4LF6B 2W93A 2VFAA 1CULC 1A3CA 1O3YA 3RVDA 3LT4A 3R41A 3EWNA 5BN4A 5FTLA 3VDXA 1AC5A 1QOQB 3D0KA 4Z0PA 4GI1A 3R6GA 3F8SA 4I1SA 3TLBA 2JCVA 3O7WA 3S55A 1LJLA 1E4YA 2Y77A 3EG9B 4TQ9A 5ALEA 4AJKA 4QJ4A 4FB5A 1ZM2A 2XGMA 3IQXA 1HTWA 4RKRA 5E8RA 1ONNA 4R69A 3UA3A 1J2TA 1J8DA 3U62A 1AXRA 1TLTA 3N70A 2G07A 3IAUA 2XRZA 4M1TA 3H5LA 3L06A 3PTAA 1C7ZA 4FGZA 1SUEA 2GWHA 4EPYA 2RGNA 1W29A 1C8BA 4PO3X 1RI4A 4YMVA 3T1NA 1QG0A 2KWIA 3FVWA 4H18A 1V96A 4ZRDA 1CUDA 2OBXA 3RRNA 3W8RA 4DGSA 4PLGA 5TRTA 4EW6A 2QR2A 1IY9A 4G9BA 4U9HS 3W2GA 3MJSA 2QRUA 1MIHA 2CF6A 3KVNA 5ALNA 5EGSA 2MR6A 4HI0E 5BSUA 2ZROA 1FFXB 3W8FA 1RZ3A 3DCJA 4FONA 5K8CA 3W5IA 5TQVA 3N5KA 1XXHE 4LV5B 5DTJA 4BX0A 2XNHA 5A1TA 4N47A 4QPPA 2HAEA 2W71A 2PRZA 4KIWA 2GHIA 1GV0A 2VK1A 3QXCA 4OMFG 1L1FA 4B71A 4OLBA 2GHRA 2GBIA 1QU2A 2R7KA 4A6EA 5GPBA 3WLSA 4L7VA 4DIBA 2W83A 3VVMA 2TECE 3AMVA 2ZKLA 5CA1B 5FJJA 2MDTA 1IUPA 3UMBA 3BB4A 3OQIB 3K8YA 4D4MA 1WUYA 2CUNA 3OU6A 4OI2A 1RC1A 4TMTA 5DN9A 5G1NA 4W9NA 2BFDA 1VIYA 3B2QA 3D43A 5CX4A 5BQXA 3AVTA 2FPRA 4EW2A 1RAGA 1WU7A 2FSVC 5T7BA 4ZMBA 4FMDB 5IP5A 3IAM6 2PKYX 1E79A 3C3JA 1P2TA 3E5RA 3JR3A 1G5PA 5ELMA 1NBEA 3V3KA 2YXDA 1GRRA 3MUFA 4HNQA 4NK4A 3ZHXA 4I3GA 3MJVA 4UU8A 5DHSA 3WGVA 4YLEA 1KDRA 4L28A 3GLGA 1H6BA 1H3FA 2QENA 1B0UA 4HAOA 1FMCA 1VB5A 1JAIA 2VP4A 1AX9A 4FJ2A 1K98A 1CR4A 1A72A 1O8CA 1R2QA 4I6EA 3RC1A 1SVKA 1PL0A 4RFSA 4QJ3A 4JJIA 1X7XB 1KQNA 4HB0A 3EZ2A 4KQMA 1UPTA 1M75A 2H07A 2OHIA 4KQ2A 5D1NA 4PCUA 1G8FA 2XRFA 1ST3A 4G89A 3EAQA 4MP3A 3VBCA 4TWIA 3FSJX 1LSUA 1ZD5A 2C2HA 1NP3A 1F5NA 3O83A 3P52A 3PIRA 3PK0A 4IO1A 4P4SA 3IHWA 5EMJA 3JQ7B 2FJUA 4RTQA 3SY8A 1VKHA 1E1CB 1CY6A 1PVVA 3WGJA 4R1MA 3PX2A 4QTZA 4EHJA 4Z4QA 1MEEA 1SCDA 2NUPA 4FHEA 3V7YA 2ZK7A 5M5BA 4P3KA 2C4KA 4KXUA 5H4GA 1V6AA 4MI9A 4GOJA 4TL9A 4XOIA 5EJ8A 1E5XA 1T4DA 2Z3ZA 4GVXA 1E0JA 3LFHA 2XNDA 1WLSA 4P0TA 3QU7A 3P71T 2IYFA 4ZDWA 4AJHA 5ITVA 1VE5A 1XEXB 2C1ZA 1QK3A 2A5YB 2M6RA 4BE9A 4CNQA 1U7UA 1XQ9A 4Y7DA 5EQJB 4LV8B 4L5BA 3VBEA 2GEVA 3DVAA 4P3YA 3E61A 2EW2A 3IUPA 4HDRB 3EODA 3Q2IA 1MOPA 3UT5B 3CLSD 3LX4A 1YUBA 4UOQA 5EN4A 2PA3A 5GIOE 1YRLA 5BNZA 4N0MA 3HVHA 3A9RA 1TQDA 3JQFA 3N8GA 3SIXA 3EOAI 4B0OA 1TTQB 1UOPA 3K0AB 3WYGA 2OYCA 1OXTA 4OHOA 1GZ6A 1KVTA 4XIIA 1L3CA 1T25A 4RSGA 2Q3BA 4MS4B 2VHXA 1WZIA 1KOJA 3CZAA 5F73A 5FYDA 5IKMA 5IXJA 1AO0A 3H5AA 2B3TA 1P18A 1JJVA 2EGUA 3CURA 2WJVA 3DVSX 1YU6A 3U4IA 3RV4A 2ZIZA 4O2BB 3A26A 2P0YA 4G0VA 1URPA 2H5JA 3L8EA 5JCJD 3BEOA 1VPVA 2JEYA 2GTPA 5SY4A 2F55A 2IYEA 5D2CA 6AT1A 2O8VA 4PX9A 2CXRA 4C0SA 5JY1A 1UM9B 1LTHR 2J6BA 3TPZA 4I1VA 4DOMA 3HKDA 1E5DA 1GPLA 3OEYA 4LSMA 1L1QA 4MQLA 4Q1CA 4R9RA 4B73A 5BPHA 1H2FA 2GUWA 4BZQA 5JEEA 3AYXB 3HVKA 1UZNA 2JDIA 1ODKA 3AK4A 2HLDA 4YRKA 1SC4A 2IU6A 5ERGB 1GUYA 2COUA 4JXXA 2XB9A 4H16A 3TPFA 2D7CA 4X45A 4B5LA 4JMPA 3L7DA 1P2SA 4PAMA 1JLLA 1X80B 1UDRA 5C5EA 1OF1A 5KC8A 5DYTA 3IBCA 1W5TA 4JKOA 1XTVA 1AB6A 1AQYA 3CW8X 1T26A 4RVCA 3PFCA 4BGDA 2E49A 2H2WA 3AOEC 4N4AA 1RTKA 1KXJA 4BFWA 4FBLA 3LRXA 4P2BA 2XYGA 3IQWA 3G9UA 3WWOA 4BMSA 4C9BA 3MGKA 4ZI7B 2E4YA 4LE2A 1SC3A 1WD7A 1K92A 3NKFA 3N2IA 4WUVA 5F7JA 3WWPA 3CC8A 4P82A 2GCOA 1VCHA 4RHEA 5B1YA 1QIHA 1EWRA 4XD7A 4INOA 3EG9A 5I7WA 2B1QA 4X00A 2BKAA 2DZDA 3IOMA 4M2LA 4D26A 2Z2IA 3BHIA 3RF6A 2C03A 4DLWA 2R97A 4BASA 2P91A 3X0DA 4CDNA 5D85A 2ZJ0A 1DU4A 2Q45A 3IC5A 2VKQA 2V1XA 4YRZA 2I62A 3Q3GE 2O54A 2DQKA 5ADVA 2FMIA 3ZWKA 1N77A 2OCDA 4IS2A 4KO2S 3JSAA 4M1MA 1AURA 3JVUA 2QLNA 2BGLA 4BNFA 3BH7A 2FWNA 4RA9A 2RGEA 3ZGZA 5AM1A 5EKSA 2I6FA 3C1UA 1PBTA 3OF3A 1WF3A 1XCLA 4LRTB 5KC9A 3GBPA 1EQUA 3TEMA 2OCGA 3WHPA 4BNGA 2P9BA 2Z8XA 3HB7A 4B83A 1SFRA 2N47A 3PUKA 2LP4Y 3GB9A 5JAZA 3PVZA 4W5RA 1WVIA 3OCUA 4WBXC 3CMCO 2G40A 3VSBA 3E48A 2FUEA 2HCJB 4WKPA 3KETA 4X3OA 5K3FA 3ADBA 3WS7A 4BOYA 4WLOA 5JSKA 3GXOA 2WTNA 4M87A 1P31A 5AKXA 3SZOA 4ZOQI 3I3OA 5J40A 3OTOB 3BMXA 1NFFA 1QYWA 1TQ4A 3CVXA 4I4TF 4NG5A 4LX8A 1Y8QB 3EFHA 3N6XA 3V7UA 4LQCA 1DKPA 3E3AA 1CUAA 3IQEA 1PX0A 3C14C 2LTAA 1W19A 4IYRA 4KQ9A 4Q21A 4R8SA 5AM0A 5E4TA 1FP2A 1JIQA 3P9XA 1QLJA 3NNNA 2J0UA 4K9KA 2Q1SA 3R4VA 3SLRA 2QRHA 4M4SA 1II9A 3PNMA 1S2DA 2JHPA 1OKKD 1EK6A 1VE1A 1T3GA 2ECOA 1SB9A 5IKOA 1TK3A 5GWXA 3VNRA 1RXIA 2JIRA 1I4LD 3HR4A 4URFA 3C87A 2AL7A 3TLJA 3I76A 1MX9A 1T4BA 2ONJA 5LQRA 3SF8B 1IOLA 3T0IA 3AI3A 3JQPA 3RODA 4C4AA 5AW4A 1YMVA 4F56A 1ZY2A 1E3LA 1U3FA 4BGVA 3U4QA 1U9IC 2B25A 3I6IA 4JLDA 4ETWA 3EZXA 4CMBA 4KQFA 3HXOA 3HXMA 2EKZA 4HLUC 3F6YA 3LUHA 4UHFA 1XQ6A 2FEMA 3DQZA 3I73A 3ZHUA 2PWYA 4ZJYA 3ETJA 4WACA 5M04A 1JFLA 1GL3A 2JI4A 3H2HA 3IDAA 3LP5A 2C2MA 4A91A 2QTRA 5L6LB 4DY4A 3I4FA 1CUWA 3DF7A 1KO4A 1NATA 1TW3A 4I9HA 3HZRA 5GONB 4BMYA 1RWBA 3I34X 2VQ3A 2A5JA 3GEPA 1GEEA 1K27A 1TQ8A 2GUGA 4RNDB 1PT6A 2BR5A 3GL9A 4IFBA 4QOSA 2FPGB 4IX9A 1DG1G 1E1CA 4V0RA 5AW0A 1DEHA 1O6ZA 1PS9A 1Z2NX 4HX9A 5G0VA 1GKLA 2PMFA 1M8JA 4GYKA 3UHPA 2F1JA 2Z5GA 2AUTA 3L0DA 4DZRA 4LPSA 2AKEA 4TWZA 1IVSA 1MFPA 3DEJA 5JR3A 2REXB 4B3GA 7REQA 2XF2A 1T1JA 4P08A 1SKAA 4DDVA 4QPNA 2PEZA 2PSFA 2VK8A 3V4FA 5CCXA 3DXYA 2ZIGA 1E2EA 1XNGA 2LUOA 3PD1A 2Q9UA 4Q34A 3E15A 4YHBA 1JVSA 3AVQA 3G2QA 3HCPA 4GX2A 2GZDA 3NWPA 4ZDJA 5ADWA 3THXB 1G8GA 1EJBA 1UPBA 4ZTZB 4DADA 2XYVA 4NOJA 3NRJA 2B35A 1LNQA 3ZHQA 1C41A 4BBPA 1XTQA 3DE2X 4RK6A 4HDRA 1SQGA 2XZDA 5IVPA 2IL1A 2RGRA 4MVJH 4D0NA 2AD5A 3E53A 2Q3CA 3ZZMA 3LUCA 4MVYA 1Z7WA 4RD0A 4L8GA 4LBYA 4E94A 1Z6QA 1MJHA 1Z0DA 1N2GA 2R3SA 1ODTC 2BUBA 3G85A 2QV7A 1HEIA 1RRPA 1T3LA 3A1UA 1LDNA 5T67A 3SMQA 1MXFA 3WLNA 5HW0A 2Y1EA 3LXXA 4IJWA 1QGYA 4MI1A 3HI6A 1Z25A 3LBNA 4E1AA 5C1BA 1R0XA 2F4VB 1LVUA 3A4LA 1JI0A 2ZR9A 5FOUA 5C8YF 1FRFS 2Q5EA 1NDHA 2ZB7A 4LA4A 2X7JA 3I53A 4ZAVA 4LDPA 3WLHA 3QEBZ 4LVOA 5IVDA 2A1IA 4JI4B 3FKSD 4HY3A 2YXEA 3LAWA 1GTMA 3EGVA 4C0AC 5DTIA 5LQNA 1BE8A 1G7RA 1WQ3A 4WL0A 3DE4X 2JFUA 3R0JA 1MB3A 4HH0A 2IYAA 4C0KA 4QATA 2LRHA 3E6AA 4IJQA 4NU0A 4WZBE 1U2SA 3MELA 3GUZA 3BICA 5CEEA 1SUAA 2HW8A 2CV0A 3LY5A 1J2EA 2W43A 4JEMA 2H1HA 2P5UA 2B8JA 2B78A 1FDUA 2X1LA 1T4MA 2Y3IA 4LF8B 2KW5A 2ZXUA 1X80A 4H17A 1R27A 3W79A 2P9TA 2C96A 5J43A 4ZAYA 3TB4A 5BV2P 5KKNB 4DM7A 1Z07A 4RGQA 4D8XA 3GT3A 4QREA 4YT8A 1E3WB 4ENRA 2Q99A 5E2BA 5C3MA 3BRCA 2NTVA 1UODA 4Q1DA 1HQCA 1UBNA 3FGOA 5FOVA 3AP1A 4Z49A 1GN9A 3D3NA 5GGXA 3K6JA 5GOZA 4Y0AA 4ZI7A 2D1QA 2NZWA 4WLEA 1WMSA 1IJEA 2KPOA 1KI7A 2W2XA 3AHIA 4BEJA 2Y9PB 1OXUA 4Y1FA 3K2BA 2NGRA 4X1YB 2HDHA 1O6CA 3P2JA 4F4HA 4UM7A 5IKXA 3I09A 1U2DA 3ASYA 3IB6A 1KVRA 3IVAA 5BNWA 1R1DA 4RACA 2XCTB 3WMWA 3AESB 1XOIA 2Y27A 2WVGA 3ZC3A 3FCSB 2CLIB 2XVYA 3HFRA 1WDMA 3KSDO 1UPCA 4G67A 4QGSA 3LKVA 4G24A 3KJGA 3A6EA 1NKTA 3HY3A 5B64A 4D9FA 3NIBA 4ZCRA 4GGOA 4X3CA 1OXMA 1F0NA 3L7LA 2PUTA 3M6XA 4OGWA 3ZVKA 3EGOA 3QEAZ 3CR8A 3KQTA 1N2JA 3L82B 2FZ4A 1JS1X 4H4CA 5AW1A 5T5QA 5A4IS 2PL1A 5TGZA 2B20A 1KPGA 1NHWA 3WK4A 4BNMA 3M0EA 5ERYA 4L3WA 2BISA 2OSVA 4N3GA 4B3MB 1NN1A 2FR0A 5BUZA 2FN8A 1I1NA 1J2RA 2DFDA 3DBIA 5HEKA 4WHMA 2WIDA 3BKWA 5LUAA 3ICQB 3IEPA 1QIKA 4DR2B 3RUFA 2PS0A 1PNTA 3ZTTA 3G1UA 2XUAA 1D6NA 2WC1A 4JJGA 4OHBA 1H6CA 3JATB 4ZYXA 3A32A 4HEJA 4B2PA 3ADCA 1EGVB 4M1WA 1JG6A 1L5QA 4JX9A 5SZKB 1CHDA 3EEFA 3M9XA 5IBCA 1GWNA 2ERCA 4PZEA 3GD5A 6ADHA 4N0EA 4P4NA 1SY7A 2ZB8A 2Y1KA 1MRSA 3ITEA 1S02A 3H4TA 3UCEA 2RG7A 1Y63A 3DZGA 4AG6A 1SR8A 2XW6A 2B4AA 4ZYWA 2RARA 3IS3A 1K0FA 5ICEA 3CINA 3NTLA 4Q0MA 2PYZA 1L5MA 1NRIA 1FY2A 3LC1O 4HPJB 4NG4A 4UXJA 4QTXA 4M76B 3TDNA 4BLSA 2W2VA 4BUCA 1LI4A 1ZC3A 1ZW6A 2GRJA 1PWHA 4EYQA 5HE8A 4NLLA 3SF8A 2VA8A 1OX5A 2XUZA 3RREA 4HNHA 4KGVA 4WESB 3W7VA 4EKEA 2VJYA 5JSFA 5KYUA 1EFUA 1GFZA 2IP4A 3PTLA 1JB9A 1XZNA 2H51A 1JBEA 2WJHA 3A7DA 1T8YA 3IQIX 4FMBB 2ZCVA 1JDPA 2OFPA 3KYDA 4KUEA 2V6JA 3GVHA 5EP2A 3W9UA 3Q2KA 5EE5B 3FVRA 3U48A 4BMPB 3TG8A 1HTBA 1KFJB 1XA0A 2R47A 2WM2A 2ZBVA 4GUAA 1QM5A 3ZJYA 2P5YA 4L2IA 5GONA 3LWZA 1V3TA 3N0VA 4UZEA 3TF5A 1MG0A 4LBWA 3RS9A 4DFDA 2YWEA 3U7IA 5HA5A 1LKZA 3U3KA 2XITA 1P2BA 1IAVA 3S2FA 4WK0B 5CLFA 4DB4A 3EZ6A 3FPBA 2LR0A 4TROA 4BQFA 3ZVNA 1F6WA 4OIMA 5J47A 1LDMA 721PA 4QE3A 4NP6A 4R1LA 2HF7A 2NTNA 2ZU6A 5EJ4A 1GUBA 1QCYA 2PZLA 1L4FA 2ZW9A 4IXDA 1SURA 3CX3A 3F9IA 3R5TA 4BN4A 1PX2A 3S5UA 3ZDRA 3LSYA 3G2MA 1UZAA 3BIOA 1I01A 2W5UA 1TCCA 2CMKA 2IQ5A 2IKQA 3DPSA 4KU4A 4ROSA 4TX1A 5EPOA 1KGSA 4BZXA 1AHHA 5AJZA 2QI9F 4GEGA 4ZOCA 2PEYA 3LXMA 1BX1A 3KEOA 2NADA 5JJIA 2RB5A 4QG7A 4HYYA 1OVGA 1FUYB 1G20A 2I55A 1U0LA 3GHHA 4WJKB 5AXDA 5BNFA 2RIPA 1G8KA 1ICEA 2D5AA 1NI4B 1MKYA 2E1RA 3GJSA 1GPKA 3LK6A 1ZJWA 5B1SA 1JLSA 3GJ5A 2RK6A 4GKKB 1TEHA 4P4GA 4F4UA 4DMMA 3PQDA 4JT8A 3H9GA 4TKVB 4J1NA 4BB6A 5LJIA 1LU9A 1B8PA 1AV7A 4E6PA 2DBRA 1Y9AA 4GECA 1N2CE 1U8TA 2P4SA 1JFFB 1QO0D 1Q2UA 3QENA 3M6LA 1Z6AA 2ZIWB 3TQCA 1QG6A 2DX7A 1IQRA 5JASA 4HTAA