1RWMA

Crystal structure of human caspase-1 in complex with 4-oxo-3-[2-(5-{[4-(quinoxalin-2-ylamino)-benzoylamino]-methyl}-thiophen-2-yl)-acetylamino]-pentanoic acid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
b'TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwmA00
3V6MA 3V3KA 1IBCA 1NMQA 4NBKA 4QUDA 2XYHA 3KJFA 3KJNA 1QTNA 4D3XA 2QL7A 4DCPA 1I4OA 1SC3A 2C1EA 2K7ZA 3NKFA 5IBCA 3DEJA 1M72A 4EHAA 1PYOA 1JXQA 1RHUA 4EHKA 4QU8A 2J33A 4ZVPA 1PAUA 1CP3A 4NOJA 4AW9A 2HBYA 2H48A 1RWWA 2XZDA 1RWMA 1NMSA 3EDRA 3PCXA 4QULA 3V4OA 5LUBA 3BIJA 3H11B 3OD5A 2HBQA 4QUBA 4AWAA 4EJFA 3DEKA 5LU8A 1RHKA 4EHFA 4N6NA 3NS7A 4QU5A 5IAGA 4QTYA 3D6HA 4JJEA 2QLBA 5LUAA 5IC4A 2QL5A 4HVAA 1QX3A 3E4CA 5IBRA 4AWBA 3K7EA 4D3YA 2P2CA 2QL9A 4DCOA 4N7JA 3PD0A 2CJXA 3SIRA 1I51A 1K86A 3PD1A 3GJSA 1CVRA 4JR0A 4NBLA 4PRYA 4NBNA 2HBRA 4QU9A 1BMQA 3IBCA 1RWPA 4FEAA 5LU9A 1SHLA 3ITNA 4DCJA 5IANA 4QUHA 2H65A 4ZVTA 5IABA 3IBFA 1F1JA 1RWNA 2H54A 2FQQA 4FXOA 4N6GA 2QLJA 3P45A 2CJYA 3R5KA 5IBPA 5JFTA 2HBZA 4HQRA 1NMEA 4JJ8A 4LSZA 4PRZA 3H0EA 2XYPA 4ZVQA 4QTXA 2CNNA 3S8EA 3V4LA 3R7NA 4JR2A 4JQYA 2H5IA 3H1PA 4JR1A 4ZVUA 3SIPA 5I9TA 1RWVA 3S70A 3RJMA 3EDQA 4FDLA 3R7BA 2C2OA 2NN3C 5H0IA 4EHNA 1RHRA 3D6MA 4NOMA 1GQFA 4IYRA 4QUEA 5IARA 2H51A 3R6GA 5IAKA 2DKOA 4JB8A 3GJTA 3P4UA 5IAEA 1RWXA 2WDPA 1I4EB 4PS0A 2FUNB 2CNOA 2J31A 1RWKA 3GJRA 4IEFB 1RHMA 2H5JA 3QNWA 1SC1A 3UOAB 4N6OA 4PS1A 3UO8B 3GJQA 4JJ7A 3R7SA 1KMCA 3KJQA 5K20A 2H4WA 3DEIA 2C2MA 5I9BA 2AR9A 4EHLA 3R6LA 1QDUA 4I1PA 3V6LA 3V55A 1RHQA 2Y0BA 4D3ZA 4NOKA 3R5JA 4HQ0A 1SHJA 2H4YA 2Y1LA 1RWOA 2FP3A 3D6FA 4FGUA 1RHJA 1K88A 4JQZA 2CDRA 4NOLA 4N5DA 4QUGA 3DEHA 4ZVOA 4EHDA 1RE1A 1ICEA 5IC6A 4M9RA 2XYGA 2C2ZA 2CNKA 4ZVRA 2CNLA 5IASA 3NR2A 2XZTA 3H11A 4N7MA 4I1RA 2J32A 2J30A 4QUIA 1F9EA 1SC4A 1NW9B 2C2KA 4QUJA 4QU0A 5IAJA 2QLFA 4EHHA 1GFWA 3H13A 1I3OA 4ZVSA 4QUAA
chains in the Genus database with same CATH superfamily
3ZY5A 1KP2A 2ATIA 2B61A 1PFWA 3ND9A 2CLHB 4RO0A 3D4PA 2QDXA 1TU4A 3P2JA 4IKOA 1IZ8A 3T5BA 4FWTA 1XVTA 4TTRA 1QH1B 2XB8A 1PYOA 3NFYA 3MXTA 1IJBA 4RADA 2GAFA 4KYVA 4CETA 1R4MB 1O94A 1Q95A 4XVRA 3EVTA 5T4FA 3SZ3A 4QBKA 4AP5A 3N74A 4NNPA 5FV7A 3EPPA 3FG9A 4NCIA 3WP0A 3KQMA 4PYMA 4C5AA 4NCBA 3A6EA 1CE8A 1QOQB 2LE0A 3P32A 4RIFA 3WISA 1MJHA 3T7JA 4FI3C 3PDUA 2H92A 3AB8A 1R0RE 5CVCA 1O1YA 3GCWA 4ER5A 4C3VA 1TJ5A 1ZGAA 2NU8B 3LF2A 2ANCA 3LHSA 4OI4A 4EHBA 4EW6A 4TYPA 2ROQA 1NQAO 1I51A 1EWRA 1W25A 2G36A 3B6MA 1RM3A 1BWQA 2GF0A 5CEEA 3ANYB 3KXIA 5E3IA 4MQMA 5J2UB 4DDHA 2FFHA 2W11A 3H75A 3IAAA 1RWPA 3M6FA 5AUQA 3K1ZA 3O3CA 1L5RA 5DTIA 4DMLA 3EMKA 3WQHA 4BLUA 1BQ3A 2M1ZA 1DEOA 3AQIA 4KOAA 5FAXA 5BV2P 5J4KA 3A9CA 1OB2A 1PKXA 2XTAA 1IMJA 1SGWA 2PO5A 1T9BA 2X5XA 2C0PA 4ZVQA 2HB6A 4X45A 3JY6A 3BERA 4E0BA 1W4LA 3E6AA 1S3IA 2F64A 4JR1A 1DIBA 3L6UA 3Q2KA 1XCGB 1GLNA 2XYQA 5CDHA 4OXNA 2I67A 4O4JB 2BCEA 1UBTS 3UWKA 3WWEA 4UHJA 1YDHA 1I1OA 5I3CA 1OBVA 5BNIA 1UAYA 1JKXA 2AN3A 4DB4A 3WQRA 1LRLA 1KC3A 3HADA 3PR1A 4C3ZA 5CRIA 5HX7A 2GPNA 1CIPA 3MJSA 3ZW7A 5KJFA 1MAHA 3TDMA 4Y0AA 1NRWA 3DOOA 4Q4LA 3M9XA 5DM0A 3A9VA 3ZCUA 4LNUA 2WJIA 4PS1A 1II9A 2R25B 2YC2C 2JDIA 5DM1A 3ZU2A 1U0HC 2ZI5A 1NSFA 3B53X 3HJRA 3I2FA 3I2JA 2FX5A 5JSUA 2QD1A 4I9UA 3EPRA 4YGYA 3F7MA 4M0PA 3OMWA 3VM6A 2RK3A 2IZ0A 1Z6XA 3R3YA 2JD0A 4NFYA 1HQCA 3OCJA 4HZGA 1TIBA 5E7MA 1AUQA 3E2PA 3NOQA 4QIHA 5HF6A 4DVGA 2PZAA 3TNYA 5KB3A 3EGXB 4CDGA 1Z2EA 1XSEA 2VPPA 3AEUA 3ISVA 2AE2A 3FLBA 3A4NA 5FA5A 4JI3B 1CK4A 2BY4A 1LBQA 3FX2A 3LLVA 4X0EA 4NABA 3RAJA 2C2ZA 3LQ4A 4ITUA 5BWBA 4JY7A 3MBIA 3RG8A 4RIIA 3MJ4A 3OOHA 6YASA 1HDRA 4IZ6A 2FUCA 1VA4A 4ZODA 3WAGA 2D0PB 3VO1A 4CLRB 3OJCA 4MWEA 2BCJQ 2M6KA 6ADHA 2V45A 4YCSA 2DB3A 5KNDA 1IM2A 5B64A 2HV9A 2Z5VA 3KJXA 1A76A 3KQPA 3NKVA 1SXJB 4YQZA 1Z5OA 4C20A 1FDWA 1RRGA 3GCZA 4HDRA 2ZJBA 5AM0A 5CLGA 1YV9A 2WFAA 5KWVA 3MGGA 4AS1A 2X4GA 5JBIA 2E87A 4PVDA 5IKEA 4RVNA 1V45E 1IY0A 4D0RA 5DCUA 2X9NA 5B53A 3HSKA 4N9WA 4NE2A 3VGPA 4G09A 4EYSA 1W4BA 1SK9A 3DTTA 5DGIA 4BVGA 4QULA 5FUWA 4FYXA 4F6RA 5KCZA 4H3SA 1A9ZA 2AUNA 5CB8A 2VSNA 2NACA 1PGPA 4HGNA 5DTJA 3RUCA 4JXKA 2PSHA 4ECAA 3QPWA 1G1AA 3HWX1 3UV3A 2KYRA 4WLOA 5T67A 5IDXA 1VIMA 2PDAA 2B25A 1OX6A 3KSMA 1AMUA 1LTQA 3N6VA 5DBOA 3RKUA 3UK0A 2RH4A 4TOIA 1V35A 5EMJA 1QB8A 4RDHA 1LDYA 1QM5A 2PFSA 3FCAA 3L8GA 4ZAZA 1RW4A 3T1VA 2QVZX 4BZXA 2C07A 4KFUA 5HKAA 4IQ0A 4MGHA 4CMKA 3D3QA 3EW9A 3HUUA 3T3EA 3RUFA 4UHDA 5LU9A 1TAUA 3KAQA 4QXMA 2C4NA 4QGFA 2E9SA 4DREA 1X87A 4F12A 5LOVB 4RABA 2R8YA 2PZMA 1GTJ1 4FGWA 1RLJA 3HN6A 5LNK1 3UGTA 1U0GA 2O8NA 2JI4A 3FFAA 4GLBA 5AKYA 1UWVA 5AVZA 3PDIB 1CY7A 1T9AA 2Q49A 4XSHA 3S8EA 2JVJA 3FTPA 3IUJA 2BLLA 4HRAA 3D2CA 4OA8A 5F1OA 5K8UA 2C0QA 4QSMA 4FDLA 3H6GA 4INZA 4NOMA 2DH5A 1IM5A 4WK6A 1MQAA 3HZHA 2RJNA 3QKRA 2FSIA 3W78A 2HT6A 1UADA 2ZCVA 1TJNA 3ES9A 3SJCA 3UF0A 1X15A 4JSTA 5CLJA 4AZWA 5AHRA 4ZMRA 4CIAA 5AVJA 3ZEIA 1T4GA 5JAPA 4OX9B 4GUDA 3ESBA 4EY3A 2EBFX 4H08A 1TE2A 5CA1A 3Q40A 2QMQA 1TO2E 1UBGA 3V1LA 3QE9Y 1ZNWA 3HE3A 1NXTA 5G4LA 4YPVA 3IVAA 2G1PA 1EAYA 1DRVA 2QR2A 2CDBA 3ILSA 4HBZA 3CN9A 4RE5A 2FDRA 3DP9A 1FFDA 1YBHA 1UR5A 4MMXB 5JZOA 2GCEA 4UTPA 2J9ZB 1HZJA 2D2VA 3L06A 1U99A 4L5AA 1J5EB 3X43A 2ZT8A 3REGA 4HRVA 5KIAA 3DT9A 4J4HA 4KFSA 4G36A 2GLTA 4HKTA 2QTHA 4NX2A 4OMDA 4AU1A 1FW6A 3U5TA 3QKUA 1H22A 3COYA 2O1WA 3DYIA 4KW7A 4OJYA 3L0SA 3R0QA 5EXSA 1TW2A 2J32A 2FPSA 2VCHA 3KR2A 4GPZA 4K87A 2HHHB 1FP1D 1WXXA 2V7EA 4D57A 3E1GA 1A2QA 1L9KA 2VT2A 2RGCA 2NQ2C 3NZEA 2OKGA 3PUHA 4FT2A 4F46A 4Z7QB 3GYGA 4FFLA 3LFTA 2BEVB 3WP1B 2QAGC 1C1XB 2XEDA 4GZMA 4IIGA 4KBYA 4R71A 2IL1A 3BXFA 4YJDA 4KQ9A 2CKMA 5IW8A 3W8DA 2K7ZA 2AEEA 4C0XA 1TMKA 1KQPA 3JAWA 3NHFA 4WNCA 3O0TA 3K70C 4D4IA 3B8EA 4Y9TA 2ZM5A 1YIAA 1CE8B 4QHSA 4YXFA 1ZL0A 3EZXA 5JNTA 2IHKA 5AD1A 2VF4X 5JAQA 5AKZA 3T3HA 4PYNA 4EEZA 2L2QA 4CR7A 3WDLA 1P1KA 3OQPA 4KSBA 4OU5A 3WICA 5IM4F 1HNZB 1KL7A 1SCUB 5CXUA 4N5MA 2JI8A 1XDWA 2V8OA 3V2IA 1RC8A 2P2SA 2UYCA 3BMOB 5AVWA 4ZK2A 4W7HA 1NAIA 2GPYA 1T5IA 2ZS8A 3W3AA 5F77A 4R3WA 5D3QA 1YZFA 4NS1A 4X71A 2B92A 4KXLA 1T5SA 2WYHA 2GOYA 1B16A 3IMEA 5A05A 3WQSB 1CY0A 1EE2A 4AJHA 1BDIA 4RESA 1MLDA 1GKUB 1X7WB 1IUPA 4LXUA 2D2EA 4R2HA 5HQJA 5CLFA 1D5CA 5MFZA 5BV0A 2XKBA 2AXQA 1PEYA 1KFBB 3MJDA 3L6RA 2R85A 4LOAA 5K8TA 5B55A 3DOCA 4IHJF 1ORRA 1LBTA 3JQEA 4JWTA 1RBMA 5FR1A 4A0GA 2EC5A 3GJ0A 1AU9A 4FXPA 5C81A 3F9CA 1DJOA 4UBLA 2JZNA 3R8FA 1D07A 1VRWA 2NO6A 4CQLA 1RPTA 4RX1A 2KW5A 5IJ9B 2BBOA 1G8AA 2HGSA 3CX3A 3UAGA 4Z4HA 2REQA 2OV4A 4XDZA 5FI5A 3DHEA 4MKZA 1U11A 1PZHA 4FFVA 3WK8A 1F2UA 2CCJA 1E77A 3IE0A 4PCAA 1GYRA 2HNKA 4LWOA 1E62A 3L0BA 1OV4A 1ZEJA 2R5NA 4A5OA 3C43A 4CF5A 2H85A 2BM9A 4QOEA 4UTOA 1EKXA 3AP2A 4XGQA 4CIDA 2PEYA 1JQ5A 2NXEA 4RJJA 3ADBA 1DO8A 1T5LA 5T5QA 3EGCA 2OM6A 3WLRA 2O2GA 1KEWA 3PNYA 2ZTMA 1AO3A 3LC7O 4KACA 5BN4A 1E2BA 1KI6A 3QF4B 4M6WB 1SU7A 1UMCB 4XCQA 1LBIA 2E4UA 1CUEA 1G8FA 2UUOA 4QXOA 3RYFB 1BA3A 4QJIA 3G9XA 5B1EA 1NONA 3AEUB 1SHJA 2H4YA 1DAHA 2JIPA 2GZHA 2OPHA 5DBFA 5KTPA 1NNUA 3IEXA 1T8YA 1UKCA 3KR9A 5IXYA 4TLLB 2GCOA 3KTOA 2FI1A 4Y2UA 4IUDS 3ZS8A 5LXTB 3SOPA 5JXJA 4YIKA 3WIUA 2FRVA 2W6ID 3D8RA 4ZHQF 2RE8A 2RGWA 3GN2A 3I5AA 4F3TA 2ZZMA 4P32A 3SR4A 1WMBA 4B4VA 2YV1A 3DE0X 1VHDA 3DTVA 3L7IA 1MW9X 4XJTA 3IV6A 1ZGHA 4HGYA 2ZRPA 4IXTA 4OGWA 1W29A 3VR0A 1A4XA 4LTNA 2F48A 2VZLA 2PT6A 3N7AA 3ZJ4A 4HDRB 1MEJA 1RYFA 1TMYA 2X6RA 3GAFA 3QJGA 2HMTA 1ABBA 1M7BA 3ZDCA 1ZX1A 2O5VA 2XXAB 3RTAA 1JH9A 1UQTA 1J2TA 3KWJA 4GECA 1OPXA 3DBHA 3RYHB 3ZIAA 3NDJA 4CTMA 1FF9A 4Y8VA 4YUZA 1EBFA 3TMKA 1EFRD 1NWHA 5F7XA 3D5EA 5JRJA 2Q2NA 3QY9A 3MRXA 3WGZA 3KVOA 1W52X 3FNRA 3FWHA 1IM8A 2P5SA 3KTDA 2XCOA 4A2PA 1KF0A 4MIEA 1QZUA 1OAAA 3JD3A 4IR7A 4AWAA 4NBWA 5BSMA 3ZHBA 5HGJA 821PA 1OI3A 2G77B 3U0VA 4NZMA 4Q3OA 3DLCA 3RAFC 3VPGA 1UBHS 4ZN6A 2JEZA 5KC8A 4AZTA 5JD6A 3FPCA 1L5YA 4DMFA 1Z2CA 2NSYA 2QE7D 1I2AA 2OOSA 1BMFA 2RGAA 5FNVF 3QLVC 2QTVB 1ITZA 2QU7A 2YUIA 5LBUA 2FXIA 4WZAA 1W88B 4M0CA 2I2AA 5IU6A 4E46A 3FMOB 2A57A 1JG6A 5JCJA 4BUZA 2X0IA 3VVBA 2R9VA 1R15A 3HJCA 3KXLA 2F7SA 4PRLA 2W2LA 2G04A 1PJRA 2CJYA 2ZRMA 1JZQA 2NVOA 3RWOA 2RFLA 1V0JA 3CR8A 3EIOA 2OQVA 3W5SA 1Y8QA 4AY4A 3HL4A 1TJYA 3EE6A 4BKQA 1SEPA 1UJ2A 4TWBA 1IEVA 2HWXA 1EG2A 3U4QA 1XKTA 4L27A 3QGMA 3HCDA 3I0ZA 4N5HX 1P45A 1IG0A 1GT91 2ZQYA 2RMKA 3A4LA 3BFVA 4JB0A 4YRRA 3R5TA 3F73A 1G9SA 3HKEA 1GGHA 4QTZA 3B36A 3LI2A 4G5YA 1BFUA 4ZT3A 2PZKA 4IIHA 4NYMQ 3VC2A 2REBA 5L3SB 3B9QA 1AGYA 4AZ3A 3GLFA 5CVUA 3HBMA 5FI3A 5ITZB 1SVUA 3RC1A 3CLUC 2HZ7A 3NX4A 1C9JA 1USWA 4EUEA 3IEMA 2ZAGA 2VRWA 3CX4A 2E5WA 4G4SO 5CA1B 3BB1A 1PL8A 3EC2A 3WV4A 3WQBA 1SVNA 1TUBA 3DZHA 1TB4A 2R6R1 4J7CA 4JCCA 2CLDX 3M6AA 4EB3A 3FSEA 4EQ6B 4Z9AA 4DV1B 5F3DA 1T9ZA 3QMPA 5F1YA 1PZEA 1EXVA 2HA5A 1PJTA 3K0CC 5HPYB 2QDKA 4BEJA 3ZVKA 4HATA 4ROTA 2I71A 2ST1A 4MEBA 4AYWA 1ZIPA 2X42A 4BLRA 1J25A 3N8DA 3NH9A 4DKJA 1TDJA 2PYDA 1EDEA 1ISSA 3UM9A 1NVVR 3E61A 1MF7A 1KKMA 4LYAA 1Z8HA 3OCWA 2GYWA 1YAHA 3ML1A 4G4IA 1KMQA 1P9OA 2QRVB 4KPGA 3LPNA 2C9MA 1CS0B 4RF3A 3CF6R 3WLFA 5CW1A 4ATNA 1OHHD 2QE6A 3AF2A 3CNBA 3FUUA 3Q9NA 1KHHA 3LC2O 3W79A 4PAMA 3VR1A 2PIAA 5EJ5A 1PV2A 1OGJA 1KMIY 1WDLA 2VTDA 2ZIFA 3A31A 3FNBA 4ALIA 2JLYA 1O87A 3NV7A 2PYZA 1PFUA 1S8NA 1TZMA 4MVYA 3CJRA 3MOGA 2FF5A 4LHVA 4TLAA 5FIUA 1M72A 2ZXFA 2NTYC 4RMJA 1CHDA 1RHUA 3M6MD 5E4TA 3L7JA 3SSMA 4Q1FA 1P77A 2R8ZA 5J3JA 3IKMB 3HXLA 3L7AA 4DG8A 1NMSA 1UMKA 3IPRA 3LIPA 4CODB 5MGBA 2ZJ6A 5AVQA 4K3UA 2I9KA 5JDCA 1JI0A 1PEKE 2CJWA 1YNSA 1T1GA 2AQIA 3ROQA 5BWLA 3AI3A 3HGQA 3PFNA 4KKXB 3HGMA 4OBBA 4XWGA 2BCGY 4NDZA 5JSFA 1BEUB 4RJLA 1HL7A 2X3FA 3KX2A 2JGNA 4EM6A 3JARA 2QD3A 3E48A 1JBEA 1PW7A 2GRUA 5LB2A 3HKDA 1A8SA 4MV4A 1N7HA 4FOSA 4LJSA 4M53A 4UMEA 2HWWA 1C7EA 3E03A 1FJHA 3IQGX 3OIVA 4QDXA 4E2YA 1UDCA 1UOOA 2R7KA 2G6BA 1NZFA 2QAGA 4DXDA 1JHAA 3IBCA 3N75A 1S9DA 2CV1A 3GEDA 3GK3A 5WRFA 4LJLA 3DEZA 4JUBA 1HKUA 2Q6VA 1AUPA 3LBHA 1X7GA 4UUPA 4FWIB 4YRPA 1K98A 1WUIS 1OROA 2PM8A 2QLJA 4G9GA 4GOND 2V6MA 2ZU6A 5EEGA 4Q7QA 4IEIA 3BFPA 5EA2A 3X1WA 4GL2A 2IYVA 1E8NA 2AIRA 1BE6A 2X0KA 4UNIA 5FTJA 5TDHA 1DWQA 3IAFA 4MWCA 4KITB 1UINA 4OQLA 1XOIA 3CLKA 1B2LA 1W19A 4BBZA 1PL0A 1FC0A 3GMIA 5E0OA 1EFPA 4ZVUA 2CWWA 1XRPA 1Q14A 4D9GA 2CMFA 2P30A 1XZLA 2OG2A 3EXHC 1E94E 3PC2A 1X0XA 1JLLA 2X2EA 1G2IA 1N0HA 3LCVB 4Q18A 5CB4A 3LYLA 3UBTA 2XCIA 3C3PA 5F73A 1U9IC 1F2UB 2I22A 2HPAA 3K20A 1EHYA 4K46A 1QC5A 1XNJA 1OXTA 5FBLB 3EXEA 1G7CA 5KSPA 2F59A 5JR3A 4BNIA 3H2YA 2W58A 3AUJB 4ACAA 2IUYA 1T8RA 3QV1A 4BGUA 5JYCA 1KDTA 3U7FB 5LN1A 3JYPA 4MIOA 5FJJA 5C7LO 4HL6A 2O3QA 1E3JA 2XGGA 3FUTA 3HHEA 1ORIA 1L5VA 3D5QA 3OX3A 2PJDA 5EC8A 2Q3BA 3NRCA 5B2FA 2WQ6A 2OC9A 5K7SA 1KI6B 1O57A 1L4UA 3DGFC 2OLJA 3KLOA 5E9QA 3BJZA 3DR3A 5BNWA 1YVUA 3MT8A 4P81A 3PXDA 2P2GA 3FFWA 4HQ0A 2ZE5A 3HV0A 1YE3A 3RKRA 2II6A 3EUAA 4Y98A 1WPQA 1Q84A 2PD4A 4O5OA 5ALWA 1KMMA 2Q21A 2QRPA 3SF0A 2NADA 3ZN2A 5BUCA 4UVHA 3GY0A 3ZTTA 3NIDB 4BQFA 2XNJA 3PNMA 4UFNA 3D3KA 4L75A 4H3VA 3H3JA 3WLJA 3DTVB 4GPD1 5HE9A 4EZEA 4MZDA 5EJ7A 4B6FA 2PS9A 3F3KA 4K3VA 4UUMA 4DJEC 1GY8A 1E1KA 4RTMA 4CCYB 3FVTA 5DNDA 1L5GB 1B3RA 1SXJE 3PE4A 1BKDR 2J5BA 2E5LB 5I9NA 1BGXT 3VYSB 4MKFA 5BP7A 4J6FA 2FTKE 4LCEA 3B5IA 4WNAB 2VRNA 2JGLA 1Q83A 2GKOA 4MPDA 2H07A 1L7EA 2B5VA 1EZ4A 1Z5UA 2EGUA 1JG7A 2FPGA 4EYKA 1UFRA 5BMOA 3HYCA 1MG5A 2P6OA 2PWYA 2GPBA 4CXMA 1ODKA 4IFTA 3FTFA 3HY6A 5CXSA 3M6VA 1AUOA 1T9GR 1DDGA 2JI9A 1ZJWA 2FPPA 4QPDA 1HEYA 2IUSA 3SDBA 4I55B 1KHTA 1ZCJA 1FUKA 2QLBA 4DMCA 4HVAA 3C7KA 4B34A 1P4HA 4LV8B 4URYR 4X90A 1YZ3A 3M3PA 1PWHA 3OI7A 2QUZA 4PV7A 5HE8A 2L0XA 1QHXA 2LD4A 1VPLA 3G2LA 3KQSA 5IJ0A 3QX3A 1FJXA 4KP7A 1VFNA 2JATA 3R09A 2GZAA 5FTMA 4AUKA 1NN5A 3BRCA 1SXIA 1ZC4A 3CZAA 1EFLA 1GPNA 1OWNA 3NHRA 5E4JA 5HJ7A 4BXOA 3RIHA 1RBZA 2INGX 4D4GA 2QRNA 1QIHA 4GBMA 4UQLA 1LPMA 2P7HA 4P9NA 2ZW9A 4C4ZA 3UUFA 4TV8F 1Q7CA 5F5NA 2BZ1A 2ID4A 1DV1A 2G7ZA 2PU5A 2ZI9A 1IMOA 1F48A 1ZHOA 1QQ7A 4NJOA 3TECE 1CV2A 2ADOA 3MTBA 1JLHA 5JJKA 3DOFA 3OVMA 2AOUB 3EASA 4LZZA 4E31A 4AQ7A 3I2KA 1S3SA 1NBME 1O08A 4F3YA 4MR8A 3CEHA 4LBZA 3U4QB 4XA8A 5HKKA 4JHXA 3WLLA 3WK7A 4LGVA 2XUAA 5MN6A 4AZSA 4C30A 3PEWA 1JTEA 5A4AA 4JJZA 1EEXB 1KMHB 3OUZA 5G2OA 4O63O 3REQA 3RJMA 3SSOA 5LKAA 2PO7A 4XWWA 3ODGA 2VVTA 1LX7A 2X22A 3MG9A 2P9BA 4FYIA 2GM9A 4GSYA 4BNMA 1YFJA 4HFJA 1GTVA 3F46A 1LQUA 4IDPA 3M9WA 4RIEA 3BCUA 3WC4A 2JGFA 2RC5A 3QJYA 1W34A 2RGYA 3FJ1A 4CGZA 2HOQA 2WTXA 2IFTA 3IELA 3C3MA 4UDXX 2WSIA 3UTDA 3RVJA 2CBGA 3H05A 2QVBA 5K3OA 3O8RA 1JTVA 4PR0A 5FTKA 2G9VA 3IEKA 3KEQA 2VA9A 2XUQA 5KHOC 3K6SA 2WJVA 2YN4A 2Z04A 4ZKDA 2AHRA 1B73A 2G1UA 1KFCB 3D54D 1LA2A 5ECDA 3AVYA 1B23P 3PTLA 1M2OB 5ITVA 4EEXA 2NV6A 1YZVA 1LF0A 1LH0A 5A5EA 4GUAA 4HGZA 2W4QA 1UPBA 4IINA 4X9XA 1ZNXA 3ZC3A 1O6FA 4MVWA 2VCYA 4GVLA 2JFQA 3JD4A 1PZXA 4JP8A 2YV3A 2HSGA 4OJNA 3IAEA 4RL6A 5TQ0B 1K7CA 3OICA 1HR0B 3FDFA 3EY9A 4D9FA 4Y6RA 5CVEA 3MNFA 1FMTA 1AKEA 4H0NA 1NATA 1QS0A 4KRXA 3KOOA 5AKHA 2IOFA 1JB1A 1AXGA 1Z6AA 4NJEB 3KKPA 1RTTA 2H7CA 5K0SA 1ILEA 3BJRA 5A3RA 1UK6A 5BSUA 2GD0A 5L8VA 3E3OA 5AW9A 1GZUA 1F38A 2XCUA 1KO5A 3MJVA 2JCGA 1GD1O 4ARVA 3L04A 3WGTA 2QL7A 3IIKA 1GRRA 3O4GA 2H0QA 5KVQA 3TOXA 4F04A 3K0CA 3KKEA 3ZZ0A 3RM3A 1IWBB 4G65A 3FHLA 5AUOB 4DR2B 3MGAA 3OG9A 3RS5A 3TJRA 4JI8B 4HQLA 4XDYA 4OQNA 3DA8A 4QGBA 4CLDA 2AXEA 3S6JA 1L8AA 4GQAA 3RBVA 5J23A 4MUAA 4QC2A 4L4UA 3MN1A 3P27A 4U2CA 1ZR4A 5JS7A 3C24A 3T1OA 5M7EA 1P74A 1UBUS 3CRVA 4LBYA 3NS7A 4EW2A 1MFZA 1FZTA 1Z6YA 3KETA 2QY6A 4NMXB 3BWEA 5ALOA 2OBBA 1EFVA 2EZ4A 4CMAA 3CUUA 4J1NA 4DLKA 9MHTA 4EJ0A 5G1NA 5F12A 4JSYA 1RZRD 3R0VA 4B80A 3SIRA 3D4OA 4XCVA 1KGDA 1Q0ZA 2NO5A 2NVUB 3PD1A 1OLUA 2R1VA 2AW3A 3UZUA 2C7QA 3EVEA 3JQ6A 4MUNA 1EBUA 1ADGA 2QAGB 2R6DA 3KDSE 2PCLA 3ZCXA 4BOYA 3L41A 2WJWA 3L1UA 3TD2A 3HI6A 5M29A 1PSZA 4TLCA 4ND1A 4PC1A 3LM8A 1BVHA 1ZRHA 4DCJA 1M66A 4BNDB 2OXRA 4C4YA 3K70B 2HCTA 3BCHA 3FTQA 3U7IA 3LDGA 1MABA 3DVAB 3H8WA 4W7IA 1YT5A 2Q99A 3JRNA 4Q47A 1VXOA 2C8KA 2WNSA 3R5KA 4XLLA 521PA 3VNBA 2V3CC 1GNVA 2ZDHA 3RDPA 2PQMA 1Y0BA 3F6YA 2QUBA 1BOFA 1V7PC 3QLUA 4EGQA 3RODA 2BD0A 4N54A 3ZWQA 4ARZA 3D02A 2LZ0A 3DOUA 2H4ZA 5BQXA 2ZVJA 3R7NA 4KVFA 2CBXA 1ZUWA 4J0IA 1Z0KA 1SVSA 1SA0A 1CWUA 3EIFA 2QW1A 1K06A 2WFZA 1H5QA 4CKXA 5EKUA 4QDZA 4M22A 1DDOA 3MWKA 4MW9A 4MQUA 1A72A 1QC5B 3CLHA 4B0PA 3EXEB 2DGDA 3GAAA 5BORA 4CKBB 2VH2A 3WGGA 3H84A 7MDHA 5D51S 3NYIA 2D1FA 1MB9A 4PNPA 1U3VA 2QD4A 4YX9A 1Z68A 1XMJA 3IQEA 1V8ZA 5KDOA 1IVYA 1P81A 4RTSA 3IOYA 4HDOB 1SM4A 2AD5A 2FFAA 1L8QA 3NHBA 1D7OA 4TTSA 2I4OA 1LK5A 5D6OA 1HQKA 4BRSA 1L2TA 2Z6AA 2LBPA 3GGSA 1WTCA 3G8DA 4FBLA 2QQ0A 2H4WA 3URKA 3FYDA 1DXOA 3DG9A 1Q0UA 3DDHA 1PJCA 1A8PA 2CVZA 2XTNA 4KQKA 2H2AA 3FI9A 1FFEA 1LGYA 2KI5A 2IP4A 1GL9B 2HM7A 4L3VA 4RGVA 4I9GA 4W99A 2R751 4X61A 4FPXA 2FHSA 4DUGD 2HHJA 2HWYA 4YB8A 4MMYB 1QOPB 1RS0A 2LXNA 3DC2A 5ILQA 4OPMA 1FQKA 2G08A 2ICAA 4KDCA 3BTOA 2FZCA 2EW2A 4D3SA 3I01M 2VQDA 1NYQA 3VDXA 4E1AA 1Z5VA 2C29D 3GT7A 4NL4H 1X39A 1RWBA 2QRMA 3LUCA 2AC4A 1QDLB 2V3WA 1XQYA 3O8BA 5K4AA 2O8DB 3LY9A 1XPJA 3S2UA 2PSDA 2WF5A 1C3VA 3M5PA 1J42A 2IV3A 4E4RA 1M6HA 2G8NA 2POQX 3A3YA 3FVWA 3FYUA 2Q4RA 2XQJA 1YDMA 2GJ4A 3I1JA 4IJUA 4R0NA 1QP4A 5CVTA 4MI9A 5GMOA 3KJIA 2OVFA 4G4JA 4F86A 1SKMA 3G13A 3SZLA 1M6VA 1E3DA 2CFRA 4WK2B 5DYWA 4QASA 5JJCA 2YASA 1QIMA 1C7QA 1AK1A 3ACCA 1DDIA 3MOSA 1OZFA 4WXHA 1ZW1A 5ERXA 3D3WA 2DR2A 5EWMB 1JT9A 4LJYA 3DE5X 4B46A 4BWFB 4ZTZB 4ENUA 1I32A 1OT5A 2VK1A 3GP8A 1OXBB 4RQAA 3TLGB 3A1UA 3A2KA 2REOA 4RLQA 1I5OA 2Q41A 3FDIA 1QIKA 2JH8A 5E4YA 1KY2A 5A5VA 1DUSA 1D1TA 2VHJA 4JJEA 3LX8A 1H0RA 2B0JA 1GL7A 2VJMA 3TAUA 4Q37A 1E3WB 1CUZA 5JJ5A 1TF7A 2JB9A 4ZZ3A 3E9MA 1TTTA 1XZCA 3ZD7A 1AF7A 3ORFA 2FSFA 2W83A 4OHFA 4W8HA 3J80A 1X8KA 4WZBA 3IHWA 1G6Q1 4CMEA 5KOIA 3UBMA 4MWZA 3D7KA 2G4LA 3QYJA 1NW7A 2NSHA 3WGKA 1P5RA 1T36A 1WOYA 2XYVA 4EDHA 4AIIA 4EI8A 1GWNA 4Q7MB 5FNVB 4AY5A 4DJJA 4NATA 4ZEXA 3QKWA 2EWMA 4RM3A 1PNRA 2JFBA 2NYRA 3M6IA 1XDSA 4OP2A 3AM5A 1N6RA 2UXBB 5CCXA 3T0FA 3OBIA 1ULBA 3A1FA 4UHKA 2O6HA 4TTIA 3SR0A 3W4JA 3WIVA 4XVUA 4YCMA 4XW2A 1R2QA 4TMYA 2I1LA 1CJVC 3PUZA 2OZKA 1I80A 5FCDA 3WG9A 4RTKA 4BZQA 1E7WA 4DARA 1VLZA 1E1RD 2FR8A 1WHTB 2A9VA 2Q6IA 3H65A 3REQB 4E21A 4E5MA 4DR6B 2JLBA 2DUWA 3BIWA 4X24A 4ZCPA 2A0YA 2G5TA 3T4EA 2HNAA 2ZTUA 4KTVE 1FFXB 3OQ1A 2VXYA 2AT1A 2BR5A 3HVKA 2HA3A 4V3CA 1YH3A 1FQJA 1W1UA 2H1LA 1FXWA 1CNEA 4KQEA 3FXAA 4KXFB 4OHBA 3R5HA 4NCKA 3T12A 1TKBA 2HLPA 4Z3DA 3KU1A 1ECJA 1WU7A 4BECA 1BU8A 3RS4A 5FWYB 2YHSA 3OKPA 3SPXA 3AF4A 4BO5A 1XRMA 4TWRA 4UD6A 3SYLA 4B87A 3AL0C 3UO8B 4GQBA 1Z75A 4IXWA 2DF8A 3H2ZA 4DEVA 2ODEA 4NICA 1TQDA 3G2PA 2Q28A 4YBRA 1U0SY 1XEFA 1QDUA 3G5AA 4A1FA 2O8CA 4YC7A 4HS4A 3QEMB 5E7QA 1Z83A 2QVCA 3H2IA 2P1RA 3V55A 4F8YA 2DQKA 1DEKA 2JPDA 4URVR 3KCQA 4WJLA 3AOGA 3GLIA 2VQSA 1XQ6A 2A1IA 1E59A 3BVPA 3O94A 2PXCA 1Q92A 4PN7A 2JLZA 2Z8XA 1Q6YA 2OGWA 2X0EA 1QZZA 3AY7A 4BASA 2C5FA 4DLZA 1X0VA 4QEDA 3NONA 3OLYA 4FB4A 1CVLA 1E69A 2A8YA 3STWA 3IFSA 3B3AA 4G6ZA 4HNVA 3O83A 1QS0B 2C5AA 2HH9A 3PVCA 4LYYA 3K73O 4OH1A 4YCNA 4S1OA 5IH3A 5BYJA 3B48A 3VZQA 3KQVA 1E3QA 3ZWVA 1X2BA 1VCHA 2YJNA 3ER9A 4U5QA 1MH1A 4IJKA 4CT4B 4OQYA 1GUDA 4Q4HA 5B58T 5A7HA 1NXQA 5SV2A 1XG5A 3UMCA 2FW0A 4PLPA 2O14A 3EGVA 3COPA 2HCRA 1CF4A 1F60A 4D9HA 3KKOA 1NVFA 4JYBA 4RHTA 5H9WA 1GU7A 5JPDA 4Q82A 1D8TA 3U3XA 2VDLB 3IRUA 4W82A 2PL5A 5IT5A 2WC1A 1A1VA 1GQRA 1L4BA 5DHPA 1K0UA 2SHKA 5A9RA 4WE3A 5JVDA 3I83A 4HV4A 3BIOA 4NZNA 3CJTA 2GFIA 3HJNA 5EXEA 1FTWA 2ZUDA 1XMVA 4YP6A 4ZAYA 4WBNF 1GYQA 1S2LA 4H4CA 3V4FA 3NOOA 1DAPA 1C7IA 3WLAA 3THXB 1B8NA 1CUGA 4L5CA 3R0IA 4PLFA 1CUWA 4D4KA 1F06A 1GNSA 3GFGA 1SUDA 2ZJFA 3JAKB 2XADA 3FYSA 1GR1A 2GAIA 4QAJA 3FWKA 4WWHA 4X91A 1ZUNB 4BMXA 3ZK9A 3AM1A 1PIWA 3CBGA 2QYTA 4Y1RA 4B35A 1U1IA 2Q5JA 4INJA 1JSLA 1R0YA 5I01A 1M0EA 4EKIA 1BJKA 1I5EA 2Q0HA 4GEKA 4NXMB 4KK4A 2CHFA 2YRFA 3WMFA 1EGVB 5JFTA 2WF9A 5JY1A 1UMDA 3FN4A 4F4CA 1FYWA 1SURA 4Q03A 4O5AA 4ARZB 1H2XA 4YROA 4HMOA 3UYKA 4RMNA 2JHGA 3FB1A 1JKFA 2UZIR 5DNUA 1MJGM 4P5DA 5D84A 3A1VA 1G7TA 2A35A 1SA0B 2HX1A 2IS1A 1W85B 5JSZB 3BT7A 1P0FA 1GHTA 1QHHB 3BAZA 3MVEA 5JXGA 3KQQA 3SX2A 4C1BA 4KQJA 1KAQA 1OAKA 1X1QA 1Z5NA 1KNXA 2FY8A 2PKRA 3IHTA 4C78A 2BYTA 3CMMA 5KDDA 4Q3BA 3MGKA 3JZMA 5D7BA 5IYZA 1X7HA 2EOAA 3AUTA 4WAUA 1ZHHA 4FLMA 5JS8A 3MWLA 1HTTA 4A92A 2YJ6A 1KYWA 1L5HB 1RE0A 1DCFA 1F8UA 2H4HA 3CU5A 4LOJA 3TK1A 3QU5A 8MHTA 3ITEA 4K6KA 4R1NA 2OMKA 4JJKA 4PQRA 3TI9A 4Y0NA 4X62B 3VNRA 2W6IA 4I1VA 4J2TA 1RP7A 3P5SA 1V8BA 2Q5FA 1WBDA 5CDFE 5C9ZA 2DBVO 3UYLA 3HCBA 2A1UA 4OYLA 1OIWA 1PGNA 2X0FA 1XR3A 4ESHA 3BEOA 5E6SA 3T5DA 3A1NA 4UEKA 2AN1A 4TTQA 3UB4A 3I8XA 2B94A 1Z16A 4N5DA 3EXHB 4AYXA 1K6JA 4TN1A 1Z5PA 3UCXA 3ZGLA 3G0DA 5HNKA 2W70A 2E55A 4B32A 1LB1B 4CKZA 1BYIA 1MXHA 2I65A 3D2AA 1LU9A 5E1DA 5KSOA 1GQ2A 3NTUA 1CUSA 1K3FA 2C4TA 2EFJA 5ANRB 2PUDA 1UBCA 1EFRA 4XSVA 4QE3A 3WZ2A 3RROA 2QU8A 5FHQA 1ZD1A 3F7NA 1A9YA 1FNBA 1RMQA 1O0CA 4ZO7A 2ZPUA 2ZCUA 4GOXA 5AKJA 5F7ZA 3BM5A 5EZ5A 3V4SA 1ESZA 3F5DA 1P2GA 1JJ7A 3CR3C 5BN3A 1ENPA 1Q6ZA 4M9UA 1X7YA 2GNOA 4MS3A 1M6VB 1I4OA 3LRPA 3NKFA 2XXBA 5K3FA 1Y7IA 1NQWA 2OSVA 3AEKA 1DAMA 1P2TA 4LFCB 2NO1A 4PF1A 1JFLA 1VSBA 1MC5A 4JR2A 3P9NA 3Q15C 3WKCA 1E4VA 4OIFA 4BX8A 5CH3A 5FPSA 2FSPA 2JAUA 4K9LA 2HMUA 1J49A 3GUZA 3OPNA 3IT3A 3NEAA 3PWSA 4BIIA 2ZJZA 3E7FA 2C4UA 5C7YA 2XWBF 3OTWA 1OWLA 3EZ2A 4JLUA 2VJMB 3SN6A 2OCBA 3PGLA 2RHLA 2WIDA 5H82A 5ULLA 4EVRA 3DE4X 1VG8A 1VHJA 3ZKWB 3O21A 1XRQA 4GAEA 4NV3A 4QVKA 3KSZO 4WZBB 3SJ7A 3BHIA 4PIPA 1EVEA 5IKPA 1RI4A 4KMRA 2ILTA 2ZJ3A 2IHYA 4C2BA 1J5PA 3FWZA 1AGNA 1BDBA 2P91A 3FCXA 3QWAA 3PQ6A 2GZDA 5CP8A 5CJJA 3M5DA 3MLBA 3SYNA 4D4MA 4LZNA 2ABWA 2FRXA 2I4MA 1B6GA 1T4CA 1AKWA 4W5RA 1WWKA 3OFSA 4XXHA 1Z06A 1A97A 2JGDA 3D8SA 3GZNB 3N05A 3SZUA 5KJ6A 4GRAA 2Z98A 4EKGA 4MUKA 2BIFA 1NJ6A 2M9MA 5ICGA 2HQSA 2AMYA 5AVUA 3OLZA 3ZWMA 4M89A 4OAPA 1D6JA 3K9WA 2ONZA 5TQ2A 3DCJA 1MIOB 1Q0LA 4ZPJA 2QTWB 4Q01A 3SC4A 3RBXA 1UKAA 1KJZA 3LRTA 3T94A 3PQ2A 3QFTA 4ZAFA 4EUSA 3GLRA 3L0YA 3O6VA 3E5HA 3IX7A 3OQNA 2BI8A 2KLBA 1YB5A 1Y7LA 1QONA 3CUYA 5FRDA 2VNHA 3B7WA 2JCVA 2R8XA 1BO6A 5L45A 1KY3A 4CKEA 2P69A 2VDMB 2Y1GA 5EMKA 5GADl 2NU9B 3SXPA 3PQ5A 4NONA 3OPXA 4DKXA 4J43A 4HAXA 2PGNA 2FQ1A 4PWZA 1JHRA 4UTNA 1JEAA 1IVNA 2IF0A 3CB2A 3KB6A 3KJQA 5EL0A 5K8CA 2H2GA 1ETHA 3LBAA 2P9EA 4D8TA 1XKLA 4OBWA 4BVFA 3HMKA 4AF8A 1U2TA 1Y8CA 3IKJA 3K6RA 1OHHA 4QO8A 2FSVC 4KE8A 3PC3A 3DFZA 4R40A 4WPGA 2PZGA 1XALA 4R1PA 4X7MA 5FLKA 3E4DA 3U39A 1NVUQ 1Y6JA 2XD9A 3N8NA 1JVNA 3NXSA 3KE8A 5J47A 2N3ZA 1EDOA 3CZQA 4KQMA 3UTCA 5AMXA 4JI6B 4OQ4A 4NULA 1M5RA 4K28A 4M1ZA 4QQNA 1J97A 2IQIA 2J30A 2YFHA 2Z2YA 3FH0A 4U7PB 4XUDA 3NHJA 3X1JA 3ZV4A 1Z18A 3E5NA 2WI8A 2HCFA 4OTZA 4HPXB 3VPFA 2B1GA 2YV2A 4XR9A 1SUFA 5HUJA 1JSRA 4WSOA 5BSRA 5B1IA 2XJ4A 1ZK0A 4O2LA 4CGYA 1DZ3A 4QKQA 1TKCA 3QIVA 4N41A 2Y71A 4LBWA 3RF7A 2DKNA 5IM5A 5FUMA 2VC2B 3PXBA 3TNJA 4US2R 3MIZA 3CRMA 4IOKA 5IBCA 2ZWPA 4PNZA 3G2HA 3M8KA 4ZJZA 9LDBA 2AW5A 2KS6A 5ALGA 3K1TA 4EPVA 2PWAA 2DU8A 3CTPA 3PNPA 5BV8A 3C7DB 2B7BA 3BD6A 4RPKA 2F8TA 3BSWA 2GZRA 3OT1A 1Y8RA 1BSVA 1EUYA 4HRYA 5A5FA 4MA4A 1HLPA 2YJZA 5TPWB 4FU0A 3CNQS 3UJ8A 2QL5A 4BNXA 5KU7A 1IYZA 3SAJA 3MT7A 1LWOA 1PR4A 3D8UA 2B1RA 2JFWA 4JZYA 1L5LA 1K8ZB 2C95A 4TKUA 3GIWA 1QQ6A 3AL2A 1ATZA 3NRJA 4C6TA 2GJKA 1CCWA 2YRXA 2YVKA 4M1EA 4R1LA 3RTBA 5CNIA 2A88A 1ZM4A 1PTJC 5YASA 4Q9NA 3SJBA 2H3HA 3N0WA 5MFPA 4K40A 2O19A 3VPXA 2IZ5A 2ZRQA 3D4BA 4FZJA 2H1IA 1P1JA 4EFKA 2P5YA 2YZ2A 1AHPA 4O3MA 1E2NA 3T3PB 1JIXA 4PZYA 1O8CA 3BL6A 4OATA 2IEAA 4JU9A 5IFLA 3JYOA 1MU0A 3R3JA 2VOJA 2ODQA 4RH3A 3GDHA 4F21A 4MO9A 3HU5A 2QZSA 2I9PA 1TECE 4OA5A 3H0EA 3SC2B 1V2HE 3H5IA 3UG6A 4QTXA 4OQEA 5DYGA 3JALA 1XK6A 1WXHA 5H7XA 3TGWA 4ZZ0A 2G67A 2OCAA 2C96A 4XLZA 5JRDS 5CW2A 4OXQA 5KYWB 2OUIA 1Y8AA 5CNKA 4JVMA 2WMOB 4F1KA 3FAZA 1RXYA 4QYMA 5AKXA 2FYTA 3G7SA 1C30B 1P9LA 1N7IA 3BQ9A 4N8DA 3V32A 5EKDA 1DTWA 2AJTA 2HTFA 2I87A 3WHLA 5IYZB 3EPJA 2PUEA 5A3JA 3U13A 4NI5A 4RDIA 5BSGA 3CCBA 3TW8A 1ESEA 1VBMA 4OO3A 1ZISA 2R1UA 2Z1DA 4YRAA 2XZPA 4WESB 2QRLA 1UC8A 1UP6A 1WSWA 2D0OB 2UVQA 3NUZA 4KSYA 4BO9A 4E1VA 1Y6QA 2C2MA 1Z39A 2XUPA 3MWFA 3N59A 1A5AB 2A1UB 3DEYX 4P3YA 4W1QA 4X54A 3S3TA 4AQYB 3ROEA 1QIEA 4PZLA 4JA2A 4DJFC 1Q3TA 1WXEA 2PKXA 4REOA 5LQNA 3B5JA 1DXHA 2ODWA 2HXGA 2Y68A 2XOXA 1RE1A 1ZRSA 2WHRA 4RAOA 5K0BA 3F9RA 1QMPA 5BQPA 5IZ4A 1NM5C 1WG8A 2AF4C 5FBKA 4MDFA 1G2PA 2E5FA 2OYRA 2WJ4A 1Z4NA 1DKLA 1NJSA 3E8MA 3ZXSA 2XUHA 1L7DA 5JI3E 5DV9A 4Y2RA 3UWMA 4FHEA 3DL2A 3UEOA 1GG9A 1NXVA 3CVYA 4DDMA 4KAXA 1FSGA 4LI0A 1I4TD 1NVDA 4R31A 5IKXA 1JHVA 1C50A 2OC4A 3BDAA 4BGIA 3K09A 4Y2HA 5CYPA 4NMWA 5K3FB 3WRYC 4D9EA 4C7XA 2EGGA 4W9RA 2YWXA 3VTFA 2B4KA 1QFXA 3DZGA 4BP8A 5B7PA 2VP4A 3RJTA 3SDSA 2HPVA 5ICSA 1UT5A 2GM3A 2HBYA 2W00A 5C1DA 4Y1EA 5AESA 2B2CA 1EK0A 1NFFA 5KTOA 3DCYA 3RSOA 4OLAA 1NNSA 3NBMA 3NAMA 2AFIE 1Y5NA 3H16A 3LUKA 3MK31 3CRRA 4RANA 4AO6A 4ZDWA 4L8LA 5DNWA 4MLDA 3ZS9A 2IW1A 5K8JB 2PFKA 1ESDA 3H17A 4KV7A 3SMQA 4PN3A 1G63A 1W96A 3D43A 3NWBA 3O1HB 2WJZB 2B78A 1J23A 3HDYA 3PICA 1ZS9A 5EUMA 4IBOA 2QL6A 1IB0A 3CUSA 4IDCA 3V8VA 4MB2A 5CMLA 1RRPA 3LPAA 1E6MA 1OY1A 2DUJA 3K72B 4HYEA 1HDGO 1AKVA 2HSZA 3K5IA 3WVNA 1SBNE 3ND8A 4DNXA 1NF2A 4HAOA 3PHBE 4C89A 4F11A 1SWWA 3UUGA 4AXBA 4UTVA 1VLJA 2AR0A 2Q2WA 2AMJA 4GLLA 5AHWA 3OKCA 5DBIA 3VPHA 3CCCA 1XK7A 1H42A 2BGMA 4I4CA 4JLAA 2JGDB 1YIDA 4I46A 5I48A 5KNCH 1M1YA 2J6HA 4KX3A 1Y8ZA 3OSZA 3QG5A 2J46A 1RAEA 5EE5B 6GPBA 2G8LA 4FOOA 2ERCA 1I4LD 3DFMA 4WINA 4R9SA 3LP8A 2PA0A 4HNHA 4LDZA 3MTDA 5AI6A 5EJFA 7REQB 2A9OA 4KU4A 2R6JA 2R65A 2Y4NA 3ETHA 5ALPA 1FDUA 3RT1A 4UCWA 5A4KA 5JARA 1R4AA 3HXMA 3AUSA 2VYCA 4GLJA 1E0AA 4JMPA 2XE8A 1E2QA 2RKWA 1R50A 3W4KA 1UBJS 3W8FA 3DLIA 4LF8B 3ICEA 1E3SA 4V1CI 5T3YA 2IXTA 1RQRA 4HDNA 4ALKA 4CKEB 1XZEA 3C8ZA 5EZYF 4EY5A 1Q1BA 2AR7A 3PIIA 3ICQB 2I0FA 2NV0A 3WKDA 2BGTA 1ZL2A 1OZHA 1YONA 5GP1A 4CDNA 3UHOA 5J40A 1RMTA 4DLTA 3TS1A 2I4LA 3PXUA 3NV9A 2XB2A 1Z12A 2AN9A 1GCIA 1XF1A 2WLSA 3EIEA 5L3ZA 3UMYA 2O8FA 4Z4IA 3JSXA 3H9GA 1SKBA 5HFJA 1K2VN 1XL0A 2WP0A 3ZVRA 4CI0B 3CTMA 3VR3A 1ODFA 5L4NA 2HIHA 4RYLA 1N33B 3LRXA 2H1VA 4BKMA 3NM6B 5KOJA 1NTRA 3CVUA 5INTA 1P1BA 3TF5A 3DDNA 2XRYA 5IT9A 3MAJA 4KQFA 1E64A 1P1IA 3EN0A 1RZVA 1M0TA 2V7WA 4W1SA 1N6HA 1XTKA 2IVFA 3L1JA 3UHFA 4BMOB 1SK8A 2GVDC 3IDSA 4YP7A 3JQQA 3CW8X 5HZMA 1YJBA 3B1KA 4MVJF 3DE1X 1HDXA 4N01A 5DI9A 3F47A 2NZVG 2PTHA 3T3DA 5DSZA 1P2FA 5T6MA 4JP5A 1RXVA 4Q7EA 1PGJA 4G63A 3EXG1 4M7WA 3RU3A 1E6WA 1M9NA 3SBOA 3TQTA 5G0VA 3S7TA 4D9NA 4JLSA 3HJTA 1SUSA 2ZAMA 2GEBA 1JG2A 1RZRA 4PANA 1GL3A 1U8UA 3DOEA 1OGIA 1KGSA 3JQAA 2YY6A 1DP4A 1XEXA 2YFKA 3QX7A 4LHSA 1QE0A 4I5GA 3I05A 5G41A 2QYOA 1L3BA 4XE5A 3V5NA 1NY5A 4GWLA 4Z49A 5JU6A 4QOHA 4EY6A 2YYSA 3MGCA 4AY6A 1GG2A 4NR0A 2B1QA 1OH6A 2P5TB 5PGMA 3V8QA 2H1RA 2P78A 5E8RA 3JWPA 1HE4A 1UODA 1PU2A 1SVLA 3HDVA 3HYRA 4ABYA 1IHOA 1K7SN 3W8NA 5IC4A 2FSGA 1VLMA 2X41A 5MF6A 3SXJA 1NIPA 3RI3A 1O6GA 2C54A 1NJ5A 1G16A 1MR3F 3AERB 2IOQA 3OJXA 4JVSB 4WX2B 2RJOA 1EESA 2WNHA 1ZNZA 2HDOA 4OSOA 3S2YA 4B6RA 4X3CA 1GVHA 1NJFA 1YCHA 2HBRA 4G5RA 4L4SA 4MWTA 3GWZA 2FZVA 4NFHA 1ZZEA 1Y7TA 4V2UA 4FYWA 4BNJA 4HLNA 2YMMA 1CQIB 1RBYA 1SB8A 1ZVKA 1VLHA 3GT0A 5DN6D 3UGJA 1AH2A 1QRRA 2F3SA 1HDCA 3EDMA 3MOIA 4NE7A 2IV7A 3NHUA 3LBIA 2W6PA 5JZMA 1ZYUA 3ICWA 3W2IA 3SS9X 4Z8XA 1OGYA 3OBBA 2X5JO 2Z6QA 4E51A 1T0JB 1UZAA 3EQZA 3LT5A 3WDSA 4L9RA 1X70A 3STYA 3I9V6 3CG4A 3Q3CA 3JALB 4M0FA 2P1DA 4M60A 5CVVA 1CRZA 5A0TA 3UFXA 1LJUA 3GRRA 3U61B 1VKRA 3DGEC 1P39A 5JS1A 2OENG 1ZG3A 1MC4A 2CL6X 4AUNA 5C4MA 1ZK3A 2EP7A 1YJXA 3IXMA 4XPIB 3GJ3A 2BBWA 2WG1A 2ZIGA 3WO1A 1Y82A 2R6ZA 4ZV7A 2FWBA 3DXFA 4BKPA 4ZJYA 1N1MA 2RHMA 1KQFA 1EYZA 4DIEA 2NTVA 3LWDA 4D0GA 4MITA 4OKIA 1XJ0A 4AECA 3TW8B 4N3CA 4QXQA 2NSLA 4TM8A 1Z34A 1LC0A 4HDMA 1KU6A 4CG1A 4DUGA 5JECA 3GGOA 2ODBA 3P9QA 2D00A 2C20A 3BF8A 1FLDA 5T57A 1YL7A 4NZYA 4GOMD 1Q7TA 2DHDA 1HMPA 1T0UA 1NUSA 1NLYA 2IVZA 2O6LA 4A0HA 2HW8A 1K1EA 3HI4A 5K9ZA 3LGXA 4V3BA 3U26A 2ATEA 1H3EA 3VU1A 3IIEA 1QHIA 2OA0A 3ZCRA 4P4TA 3LUHA 2CUNA 2JAXA 5F1PA 3W9YA 1Y98A 3KWLA 4BFVA 4D9CA 1UBEA 1KJYA 2YHIA 3RC7A 1IE3A 1ORTA 2FDCA 2WVAA 1E1QD 3C3JA 3A1SA 2A9KA 3HHPA 5MN4A 5DDIP 1E1NA 5C8ZA 1K27A 2F67A 4KZPA 2C2HA 4UVEA 3TKAA 3KG2A 1F0PA 4R84A 4BLSA 5JLAA 5CFZA 1KFJB 2ZJAA 1NJ2A 4HVCA 1PSWA 2WMYA 1VCMA 2ZSDA 3O90A 5G0SA 2E1RA 3D31A 4MI6A 1QGOA 1AG9A 1E3IA 2AZ4A 3CVJA 1XZAA 2YN2A 3EXAA 3GVXA 3IAS6 4ZEWA 5DNCA 3IUYA 1QVWA 2WG0A 3JPYA 3KEMA 4CL2A 1WMAA 2CEKA 3DLTA 4IXMA 4RA9A 5CB4F 5FUQA 3QKSA 4V1CB 2A33A 2W8BA 3ZXYA 3EG9B 3CNHA 1K92A 5B6PA 3AFHA 1M34B 4FJ2A 2O7VA 4PYQA 1QHGA 4CCWA 2CLFB 1FYXA 4GIBA 3SHFA 4JKYA 3AKYA 1ELOA 2J33A 3BGVA 4AF6A 1JBQA 3FKSD 3QM1A 1F2TA 3U1BA 5A9SA 3GPIA 1U4NA 3LHKA 4GDMA 4YAUA 1IUNA 2UUAB 3RUAA 4UBIA 1V4VA 1WKVA 5K09A 4B2LA 1P80A 3I1IA 4AWBA 3PSHA 5I5EA 3LPDA 3N58A 3WZMA 1ZONA 1BEZA 3PLNA 2C5EA 9LDTA 1SWVA 5CA0F 2JBAB 3U44B 1IN5A 1CUIA 1DJQA 2OFOA 1BXGB 1O4VA 2OQ2A 2WU0A 3DWFA 4Y2YA 5LB4A 4EPXA 5FBZA 3AV3A 3VNUA 3AF5A 1E1RA 3AVPA 3DAOA 2X0NA 3G0OA 1TT5A 2GBCA 3F8SA 5DGHA 3PUKA 2PKQO 2ASEA 5ALKA 3WRYA 3IAXA 2AS0A 3G49A 2MMCA 1NV9A 3GGGA 4MCAA 5I7FA 3ZD9A 1U1CA 2ZBQA 1KNQA 1RJDA 3ASZA 2GILA 3L0OA 2ANBA 4XDHA 1MRZA 4YJ3F 1EM8A 2FWMX 3VBCA 2I7CA 3ZWOA 1YCFA 2D8AA 3CKLA 3LNCA 4FN5A 3CNEA 3PHLA 4JJ8A 3LQFA 3PWKA 2PXHA 3G2NA 4GX1A 3NW9A 1W75A 4IX1A 4JLNA 1G6HA 3TUIC 1K75A 4A3SA 1AJEA 4YV2A 1WM1A 5CH8A 2VRCD 1H2EA 3BWVA 3SP1A 5C1BA 2AI3A 2IYFA 2D5IA 3LBFA 3O75A 3HKBB 4X20A 5AW2A 2QUIA 3ZXIA 4TKVA 1LPSA 5FBVB 3SQWA 3TLAA 2A9QA 1L7BA 1Z6ZA 4MO2A 1CY2A 1LV8A 2RI1A 1I7QB 2NU6A 3INGA 3EDYA 2V9ZA 3KUUA 2OFWA 3RSLA 3SQOA 3SE0A 4YJGB 1FJGB 5DX0A 1I1HA 2BE9A 3HJHA 3I9LA 1M6WA 3TLXA 4ZOAA 2J6BA 5F5XA 3ZNPA 3SEAA 1ZUHA 2DWQA 4ZARA 4AWXA 1PGQA 3O1IC 1YVPA 3ILHA 2H3EA 2B6HA 4WA8A 1D0VA 3WNVA 1F17A 3LKDA 2E21A 2AQHA 2QSUA 2ZB7A 2ZI6A 3PNBA 1BJRE 2BE7A 3F90A 3HTXA 4C0KA 2V6FA 3KKQA 4D02A 1RRFA 5ECGC 1WZIA 3NWOA 4P31A 1FVHA 2X15A 3BGDA 3QPBA 5ALIA 5EHIA 3WNZA 3FBTA 2BISA 4MUHA 2ES4A 3E70C 3ONVA 1JA9A 3MMZA 2PMBA 3B9RA 3EJ6A 1EMDA 4MR7A 4OEHA 5B57C 4O29A 5KOJB 4BO6A 3K0KA 4S0ZA 1ND6A 4R2MA 2I8LA 4XIJA 3T3GA 1N2IA 1U1GA 4ZVRA 3PV0A 2BHLA 1XBTA 3WDKA 4EFNA 1BHSA 5JZSA 1J06A 3QEBZ 1TVKA 1OFUA 2WB4A 4P35A 3BRSA 5IVDA 3UCEA 5LQDA 5IRCD 2YWGA 1P5JA 1BKYA 1RSZA 1X42A 2FR0A 4QU0A 4QQRA 4WCFC 3TPZA 1WZ2A 1HE5A 4QUAA 4X1OA 5B4VA 1YULA 2HREA 5LZ4A 4PYIA 1CZUA 3Q3GE 2VT7A 4LHWA 1D2EA 4A6XA 3MTGA 2ODTX 5EIBC 1NYTA 1KBOA 4NYMR 4JI5B 4B75A 1HYGA 3AEXA 2YV5A 1KJIA 4HLQB 3ZLBA 4TQUS 4MHSA 1ISIA 5C7OO 1U8AA 1JB9A 4ZZIA 1ZUD1 4K6OA 4WCDA 5IP5A 1F0YA 5DNAA 4DADA 2QF7A 3RJ5A 3IQDB 5KWEA 3DS8A 3HCCA 1L5NA 2D6FA 1ZCZA 4Z51A 2O8EA 1GJRA 1D1PA 1LKZA 1PD1A 1POWA 1ZESA 3LQYA 3N53A 3GELA 2D8MA 2Y92A 4AJ2A 1K63A 2HKIA 4I4TA 2OD2A 2UV8A 2XT6A 5IJAA 3T1NA 2WP8J 1PV1A 2KQUA 1HC7A 2ON6A 2P65A 4UHFA 4AS2A 2P6RA 1P3Y1 2OCYC 2Y6UA 2FLWA 1C1DB 1TZKA 3ZKAA 3LYUA 3G82C 4JD5A 5LR6A 1OA0A 5EYPA 3UB3A 5EY5B 2D74A 2CHQA 2WZBA 5GIPE 4F45A 3C7CB 3JQRA 1V1RA 5DXJA 3D8TA 1FRQA 3VH3A 1BN7A 1U8FO 1WHSA 2M98A 1X80B 4Z54A 4X85A 3L0IB 1G8MA 3K6KA 3VC7A 1MC1A 2P3QA 1M8JA 1ZM9A 2JVIA 4M1OA 4UU0A 5BSFA 1CUAA 4CL8A 2IIQA 2ZI7A 2CV0A 2XVZA 1CR6A 1KO8A 5E8JA 4IILA 3NIFB 3M0EA 2CMDA 1EK1A 3LXXA 2OXEA 3PEVA 3ESCA 1NR7A 4L5JA 4ZOLA 1T8UA 2BFBB 2ZR8A 1IZ9A 1MO5A 3II6X 3DKVA 1P8JA 2F3PA 2GH1A 621PA 1GPAA 1V25A 1RCUA 4NZ9A 1JR3D 3RVQA 5ARDA 1RIFA 3BORA 1OA1A 3KHSA 2DR0A 1R0BA 3PRKE 3HB7A 2ZG6A 1DBRA 4TZKA 2C00A 3RSZA 5AJVB 3NKLA 1E2LA 3Q4GA 3ADDA 1XZGA 2ZSEA 4B2PA 4W9MC 4AULA 3FDZA 4JEMA 3O3NB 4F4HA 4Z4QA 1G42A 1EK6A 3WK6A 3MQ2A 2ID9A 3WMRA 4B45A 2EXXA 1UEXC 3OSUA 1E66A 1QIFA 3FYCA 4XWKA 3W5UA 4AS3A 4QPPA 4U7GA 2QMUA 1M54A 1V11B 3FYHA 1KK3A 2Y1KA 3OCVA 3VHXA 5C5DA 4XIGS 4EENA 1CJTC 1CY4A 2OTCA 3BAFA 1WIWA 2WNIA 1V5WA 2O0MA 2R7NA 2XNDD 2YMLA 3IEPA 3LLUA 4XB6B 4A8JC 3CZCA 3LSYA 4N0QA 2VH1A 1QV7A 3S28A 5C32A 5KSWB 2AEFA 2ZR0A 4RF5A 2NNWB 1OOEA 4D6XA 3LUDA 1R0XA 1KVSA 1NP3A 3HQ4O 4FEGA 4S2EA 1W49A 4RA9B 3T5CA 3F7OA 1TLTA 2C3UA 4AKSA 1JL3A 2BUBA 3LBNA 4ZYUA 2G4VA 4ZV9A 4W5QA 3RC9A 1XA0A 2Z83A 3VYWA 4EQZA 1Y5MA 1NMQA 2MYPA 2JFPA 2OVBA 2I62A 3DZ8A 2O1EA 1FA9A 2QEQA 3I8OA 1AURA 2I6TA 4REMA 4OXRA 4OHZA 2AFHE 3I9KA 4DT1B 1GADO 1GSAA 4IDQA 5D3ZA 1XVUA 5EIFA 4B6QA 2WICA 4QYXA 4YRKA 3PCXA 3F1LA 4EPRA 5DHRA 1YK0A 4P34A 4GNKA 3RRZA 1JYSA 1LV7A 4A0FA 4E08A 1BH2A 4YAIA 1Y9EA 5ICMA 5JJIA 2YYZA 4XSGA 1E1CA 2BN4A 5IMBA 4JBWA 1WAMA 3T0GA 5IKOA 3KIPA 1R6DA 3QMWA 1ZC3A 4Y2VA 2HK8A 3T7SA 3RHZA 4TMVA 2OZVA 3LNTA 5KYYA 5AM5A 2X8JB 2VNKA 4JA0A 3V7NA 8OHMA 2GETA 4DXHA 5ERGB 5FPYA 5BW4A 4TWJA 1OLOA 1CVRA 4B3BA 4OHYA 1Z56C 4HDCA 1Q1GA 1OXMA 3K30A 4UNNA 5JAOA 1UF9A 1FW8A 2A9JA 3GRYA 3G79A 2H1SA 4TWAA 5DFAA 4DWVA 4XVCA 2ZUEA 2WIBA 2EV9A 2YXDA 4G5GA 4LXTA 4IHAA 1MDFA 3EGWA 4LXGA 4DIKA 1VHWA 3D59A 4M2LA 2ZUSA 4WY2A 1GXSA 1JA1A 1T29A 2EBWA 5NLLA 5L7YA 5KOHB 3RO7A 3E81A 4YUWA 2WHPB 3ER6A 3MT0A 2WFMA 5B6IA 3FMVA 2F90A 2YQZA 5HVNA 2DY1A 2MIIA 3A9WA 3ZJVA 4TXNA 3TRJA 1WQ3A 4QFMA 1PO7A 2B83A 4AJPA 1E5QA 1V7CA 1YCDA 2FWRA 3P0RA 1O9HA 3DQZA 4ICIA 4NK4A 2ZJOA 1G8GA 4E5VA 5LMNB 1TOAA 2HK9A 5JSHA 1ISRA 1EGQA 2AQ8A 2PZBA 2QTGA 4HHEA 4C5BA 1BW9A 1ZH0A 4EYOA 4PSVA 2V4UA 4L4YA 4IIUA 1M2HA 2V7VA 2CZGA 2DT8A 2IEDA 4ZAXA 3CNLA 3EWAA 3O2NA 4NCHA 4FHDA 2VUIB 4I2VA 2QSJA 3O47A 2WJPA 4QELA 3TB6A 2HF9A 4H4DA 3ABRB 1N0UA 3OHPA 3L40A 3OPYA 2C42A 2QSYA 5DHTA 1LLFA 4NCXA 1IH8A 5ICFA 3T7CA 1LD3A 3L46A 4YP1A 3PX7A 2DYKA 2NP6A 1XT6A 1CSEE 1MA3A 3AEZA 3VKWA 2PKQP 1KSJA 2CXNA 5KVVA 3X1YA 4YMWA 4MDEA 2VJKA 4FZ5A 5FO1A 1EB8A 5JS2A 5U9CA 2I6UA 1Z8NA 4RETA 5B7QA 3S70A 1YB7A 1ZGCA 4JQOA 3GBSA 2Q1YA 3RVMA 3M2TA 4XLTA 1DOHA 2YNMC 3RJZA 1FEZA 1RYZA 1IN6A 2I6FA 3IKLA 3C41J 3NNSA 1G60A 1YR2A 4Q5IA 3ZPXA 1ODLA 2HHCA 1EIWA 2WZCA 1P29A 4MYRA 2WJ6A 2WWRA 4TZ6A 2PSSA 3TD9A 4X63A 1SXHA 4OJKA 4EO7A 1B93A 5BWNA 2CXUA 5KZMB 2PUAA 2LW7A 1Z3IX 1K7XB 3KR1A 4CEJB 3KBBA 1U0OC 4KCGA 3L6CA 4CEIA 1Y9AA 1L7QA 3HJUA 2GKGA 2QG9A 2YFQA 4N18A 3W6ZA 3H1TA 4DDTA 2JF0A 4BWYA 1XTPA 2TS1A 1DG3A 1FXWF 2AUMA 3GLHE 5JNVA 2VYND 3FZNA 2GBIA 2WD9A 3N3AC 1XTJA 5M34A 1JHDA 2J4DA 3ZWWA 4JITA 4WJZA 2FZ5A 3ZZMA 1E9FA 4I6EA 1NOIA 1WY5A 2C2GA 2EJBA 3ROKA 3CURA 2CXSA 2QTLA 4HH3C 4LE0A 1VJTA 1OXVA 2K2QB 2WTNA 4GPAA 4NLLA 1RC1A 5DBHX 5SZHB 2KPOA 3WMXA 1RQXA 2R79A 3NETA 2I66A 4RKWA 5AVKA 4F3RA 2WFLA 5ITSA 3MWJA 1ZK4A 1NLZA 3VKFA 1XDBA 4CEHA 1ZCAA 1AA6A 3FPLA 1L7OA 2YWBA 4EH1A 4U8HA 4HNTA 3K5WA 2B7CA 4R8KA 1H1TA 4S05A 4GR4A 4IIXA 1SHUX 4NDNE 3MRSA 4ILKA 4WCFA 3LK6A 4FNMA 2PFGA 5BQ3A 1OC4A 3OPYI 3KQNA 2BM0A 2DHCA 4NMHA 3N2YA 4R0VA 2A30A 2PMWB 3EOZA 4RF2A 4ND8A 4H7KA 4Q1AA 2OCGA 1J21A 3F74A 2VLBA 2WD7A 3C3XA 3SFZA 1T8PA 4K7JA 3ITNA 3PDHA 2HXSA 3FDJA 3JQ9A 3PXGA 4F1JA 3LAWA 2BH9A 4OLBA 5KYNA 4PYKA 5E1OA 2QN2A 4HH0A 1NW6A 1C3JA 4FXOA 4RZSA 2FQWA 1Z5GA 1SC9A 4KV9A 4P92A 4DA8A 4WN9A 2QX7A 3IUBA 4BKRA 3WRWA 3UAVA 3GFFA 5KYGA 2Q9CA 3L01A 4MROA 3HWRA 2SCUB 3R9XA 1H5NA 4IY1A 1J8YF 4LUCA 1WRBA 1M6YA 1ONOA 3HU3A 5H83A 1AIPA 3WKAA 4ZOLB 4PO8A 2AG0A 1GZ7A 1VJ5A 2OY0A 1L7MA 3QVSA 4R2IA 4BX0A 4FMBB 5K4GA 1QGUB 1A7KA 4JJFA 4Z4EA 1KFKB 3EYAA 3R6GA 5C18A 2ZAIA 2XIJA 1H8HD 5C1PA 3H8VA 4JMLA 4A7PA 1GZ4A 1ULUA 3G9ZA 3IDFA 1DKOA 1WP4A 2BTQB 3P52A 3TKYA 4F9GA 4PZPA 4EHJA 5FWXA 1VLVA 1VE3A 1DKQA 1R5OA 2VDWB 3IPLA 3MMNA 3FDXA 4JT2A 3RVSA 2IUUA 4LX8A 5MGNA 2H1WA 2R66A 4WFIA 2YL2A 1C3OA 4P7FA 4R6WA 3X1XA 3U09A 3U3RA 3H7AA 3ZQKA 1X9GA 5FYQA 4D1YA 1R37A 16PKA 4BNGA 4JGBA 1ZJ6A 1AZLA 4K81B 4PAQA 4RW0A 5AKEA 3S1AA 4EHLA 3G5TA 5CAEB 2O2SA 4BB9A 3ENKA 3B2NA 2IEZA 1EGMB 1OFIA 1QYDA 2VUUA 5JQGA 2Z2JA 5D5PA 2DE0X 1YKSA 4S1VA 3ETCA 3ZGXA 1W5SA 3U40A 2AOXA 2BEJA 2WU1A 1WA5A 1M74A 3BOSA 4BWGA 2I4TA 1BKSB 4MHTA 5AI9A 4YCAA 3FGOA 5LQCA 1QYCA 5EOVA 1FFBA 1IHPA 1T2EA 2DHQA 2WM2A 4WKGA 5J43A 1QLJA 4M88A 3QMMA 3OURA 2FK7A 3Q0TA 4L73A 3VR5D 1LNZA 2B8JA 2GPSA 4LGYA 5G4KB 3NHYA 1NZJA 4JAVC 4M87A 4M8NE 4ZVSA 5D6NA 3EEIA 4L4RA 4BLTA 1BQEA 4CLHA 4MWSA 2ZYGA 3UK7A 2WYIA 2O20A 1BCRB 4IQFA 4OKNA 4WOCA 4UCFA 4GGMX 1JLSA 3MMXA 1WF6A 3OQOA 2H0RA 2KHZA 4IJWA 1NUPA 4XCXA 2IU0A 3DTNA 1GZDA 4Q3DA 1BYUA 3IQIX 3ZE6A 4V0MA 1MOPA 4N0MA 4A8JA 3BIJA 3H11B 4RLHA 5CM8B 5KC9A 4MK4A 4BGDA 2BFMA 1KE1A 3C0KA 3WK5A 1E98A 2WYWA 3TZHA 1A7UA 1MNAA 5K8IA 2WJAA 4U6SA 1YQWA 4U00A 3DSRA 3PG5A 3UUEA 3ROPA 1P1FA 1G6KA 4CF6A 1R8XA 4N7JA 2CNDA 4FR2A 4GL4A 2IPOA 1K86A 1KI8A 2YICA 1I24A 2A4MA 5AP9A 1DVRA 5EP2A 3ZOKA 1ECBA 1H69A 1YWGO 1DQNA 2W7TA 3GOHA 1VXRA 2FZLA 2I34A 2WM9B 2PRJA 4PAOA 5LQJA 3OZUA 5CA0B 1PFKA 2XB9A 3UT0A 2A86A 2W9XA 2XRMA 1DQRA 2ZYDA 3N86A 3FFBA 3MQ4A 1KTIA 5ELMA 2WT8A 5IJ9A 5EPOA 2HQBA 3GYBA 1XZIA 5K6RA 1YDFA 3F96A 4CCAA 3KVYA 2VDJA 4I1OA 3KP1A 4XARA 5EIOA 4C05A 4NPCA 4MUFA 1S8FA 3BD7A 1WCYA 3EOAI 4G0UA 4ROSA 1XP5A 3BHJA 4YJ3B 4BRUA 4EF6A 2QPAA 4XVQA 1GSOA 4GXNA 3CFYA 3FNHA 4FGSA 2HWKA 2GNAA 3NPMA 1R6TA 2FN9A 2QKYA 2V0CA 4L9WA 4RZ3A 3TX2A 4CUZA 3H8SA 1BVRA 3D6MA 4J3FA 4CF4A 3PL5A 2CD7A 4REQB 1YA8A 1D4ZA 1VL1A 2D5LA 1YXMA 5KJCA 1MO2A 2DKOA 2G4CA 3NT5A 2PD3A 5IAEA 2IHBA 4KLNA 4AL4A 3ZDDA 3TSZA 4TS4A 4MW4A 4ZI7F 1B0UA 3C5VA 1E2IA 1Z7WA 2GVZC 4WRRA 3OPYB 3GCDA 2PZJA 4HSEA 4RGYA 5FI1B 2I6SA 1LK7A 4IIJB 3R7SA 1NY6A 1MX9A 1OILA 1GITA 2BFNA 3HBLA 4J3NA 3RG2A 3VOAA 1GQQA 1P9NA 4TXMA 3QUSA 4IS3A 2QGFA 1KOJA 2J7KA 2RHCA 3E35A 4TUYB 1B0ZA 4BNHA 5C5CA 1RI3A 1CQWA 2QQ5A 3IR6A 3TEFA 5CGQB 3DW3X 1NC1A 2FP3A 4ZYTA 5GINE 2DLNA 1L6IA 1IY9A 3SQDA 2HF2A 2VBCA 4XB1A 5IC6A 3AF0A 2AG5A 3D6VA 3ZDFA 2EVWX 3BWDD 5HM8A 2CNLA 1I3KA 3BC1A 2GR9A 1HSOA 2X6QA 4JL8A 5HS4A 5IX8A 5GJBA 4O1MA 2PUWA 2QVGA 3JATB 3KJEA 5BN5B 5TVKA 4QFCA 3M4JA 3RLFA 1FFHA 3IOCA 3TBKA 3RW9A 5ABPA 4MHOA 1JPJA 1SHKA 5HGXA 3KDAA 2PV7A 3M6LA 4FCWA 1EU1A 1TQ2A 3D5TA 3JQPA 4ITRC 5EI5A 1ZRMA 2ENWA 4Y2JA 1C7JA 2YIMA 4XASA 4FUTA 4TVSA 1N4DA 3H1AA 1O0SA 4HJRA 3TSYA 2ZZNA 5T41A 2ZTVA 1RJ9B 5KWJA 3HH8A 5KAMA 4KC0A 1WU8A 2HMWA 2VJAA 1M8FA 4UUBA 2XBUA 4TXHA 3SLKA 2C84A 5AM1A 2D06A 5H81A 4AIRA 3EX7C 2PEZA 3PPYA 3C6BA 4DQDA 3O8QA 3CBQA 1E2FA 2R00C 1JN0A 4MV9A 2WFLB 4OBXA 4O4LB 1CJSA 2NUPA 5A7FA 2UVPA 1ADCA 1ZD4A 5DN6A 3GO4A 1CULC 3H0CA 1YFLA 5LUAA 1ST2A 3JQDA 4N5IX 4QARA 4HWRA 2P8SA 1JXMA 3DPUA 4K9DA 5FP0A 4WCFB 1AQ6A 2HSJA 1KOFA 4AMYA 1SPBS 3K4PA 4IW3B 1G6OA 1RXWA 5ALZA 1RKBA 4KL8S 5J63A 1IY2A 3OX1A 1ZJJA 3M7IA 4MUJA 4R2LA 4RY0A 2H2FA 3DMHA 1SMKA 1SULA 2FLVA 1BFKA 3JWIA 3OZEA 4Y7DA 5AYVA 4JFAA 1M2EA 4UM7A 4KHPB 1U94A 2Y1EA 1XLTC 3U7JA 4QFDA 2NAFA 2UYQA 2C2BA 1BAPA 2O57A 1XZDA 3LPMA 1TJ3A 4B85A 2K7FA 4S35A 5JJBA 5KTKA 2IX3A 2XOKD 5BRAA 2G1JA 2RC6A 2VBFA 3A27A 2E2WA 3GNLA 3DFIA 4R1MA 4UW9A 4I5EA 1GN8A 5ALYA 1VA5A 3AR3A 4MYUA 4PXSA 2J0QA 2X9QA 3WLPA 4OHMA 3OMXA 4R41A 4L74A 5JVDF 3ZV7A 5A4MS 1TZ2A 3IAHA 1T6BY 4B8YA 3CX7A 1JWAB 2BFDB 1XPOA 2AX4A 1A9PA 2Q1WA 1MN6A 3LL4A 4FKZA 3VISA 4D3FA 4RF4A 1KDPA 2B69A 3TLMA 1HLDA 5DM4A 4FVTA 5GGYA 1XTUA 3TQFA 2LGJA 2ZSKA 5LMCA 1I7DA 3ZCPA 2HIAA 4ENRA 2O2XA 1TJPB 2Q2VA 4LGMA 2HLDA 3PGVA 5E6UB 3UAXA 1EWVA 1RM0A 3BWMA 1HE8B 2V6BA 3EF1A 3KLNA 4LDQA 3K9GA 4QD3A 5F4BA 5AVRA 3EGIA 4DRXA 1HT3A 1TYZA 1YS4A 2ZIUB 3VO9A 2ID8A 1NI5A 1SUAA 2Z58A 3S1AB 3G2IA 4BNWA 4M37A 3PZBA 3DMRA 3EH1A 4HB3A 4CT0A 3L4KA 1AS2A 1KZ1A 2NZXA 1N5JA 3C39A 1GKKA 3OPVA 4HXGA 5DX1A 3RQIA 3X1MA 3U16A 2BHSA 4FMCB 1MJFA 3OUUA 4A8PA 5LDHA 4BFYA 4FHZA 4J2HA 5TGZA 3ADPA 3DBVO 3W8EA 1GNTA 3R9KA 3Q72A 4RACA 1P1HA 4IMRA 2OCIA 3NJRA 3NATA 1HQDA 2PUHA 4L7QA 1UKVY 4HLCA 4C22A 3MCZA 4MS1B 4N3NA 4Q39A 5J4YA 3FKSA 4TTAA 2K2WA 2BUAA 4P4NA 2QZ9A 2OXTA 4MULA 3ITKA 4K9KA 3VYRB 3UENA 1B8PA 1UK8A 2RAPA 4N47A 1E0KA 3QVVA 5TJHA 4FQ7A 2YZ7A 4HWPA 3ZY2A 4P83A 1TD9A 2P62A 3VZPA 1EP3B 1S01A 3E3LA 3QU2A 2W2KA 4Y2QA 2ZR9A 4D80A 1ARZA 5CIYA 1C8KA 3LECA 1EHCA 2PJZA 2X9VA 3T0IA 1NAHA 2WLTA 1KJQA 1WXGA 4A8JB 4CMGA 1YI8A 1PLJA 4H6VA 3OD5A 2YWFA 5TR9A 5IZCA 1IG3A 5TIIA 3V7FA 2R1ZA 1XAIA 2W6JD 1FL9A 3U6KA 1P33A 1LJLA 1DJLA 3IYLW 1E9SA 2JEYA 3BIXA 4O59O 4Q0MA 4QZVA 1F6WA 4Y67A 1WNFA 3NBFA 3CVVA 1WBJB 4D3YA 1IK4A 3QFRA 3Q8KA 3PLAE 3NNNA 1Y6ZA 2BV3A 1KY4A 1WCWA 3RFTA 2HXYA 1J2YA 2GA9A 1ULSA 4ND7A 1VL6A 4EW3A 1ZLYA 2VRCA 3VKGA 4WMLA 1PDOA 4YK7A 4L1KA 4PFQA 3N8GA 3MYRA 4BL5A 2AZDA 2J08A 4M55A 4IV8A 1Y81A 3DXZA 3EVFA 3RIEA 1E1DA 1H0SA 5IABA 2WUWE 3OEYA 1U5BB 3RVDA 2QRUA 2QXYA 3P45A 4ZEMA 1U7ZA 2RGUA 2VPIA 4HDSB 3WGQA 2YZNA 4F4JA 1V95A 1F5NA 4BJHB 3EDOA 1BXZA 3ST7A 1UPAA 2FZ4A 2GSDA 4XI9A 1UDAA 2JS7A 3TDKA 4RQUA 3G9QA 4NHEA 2OV1A 1NBEA 4JUDX 2CEAA 2JIZD 1N8NA 4YT8A 3KPUA 1Y5RA 3GDFA 4ONEA 3L8CA 4BCCA 5SICE 1U98A 1A9TA 3UH1A 3VC1A 2EW1A 3HR8A 3K1AA 2NM0A 3FPGA 3GZ4A 3HSYA 4HR7A 2ZWIA 4NV0A 5DCLA 1YQXA 4F5EA 2IYAA 2IYQA 2I4IA 3PKZA 4XD7D 1XD2A 2FN4A 3DV0A 3U5ZB 2GHQA 2J5RA 3QX8A 2UYHA 4MVXA 1NVGA 3MCTA 3THYA 1L8XA 1U0JA 1NQVA 2RI6A 4ZAGA 3TQHA 1SOVA 3IUEA 4GE0A 2YWJA 1OVMA 2D2IA 2GNPA 5AUPB 5JG7A 5JPCA 2HPZA 3H19A 3PXAA 3UJHA 1LSOA 1WVMA 1KO7A 1ZM2A 1T9KA 2GF9A 3RYIB 4S04A 2ZUVA 4JXXA 4PX3A 4F5WA 1GNPA 2XLBA 3P0HA 5KVCA 5CIWA 5HBGA 3UXEA 3LKZA 2W5UA 4M0UA 3VDMA 3VNAA 2FVYA 3PFIA 3AY3A 3HRHA 3EW7A 4PYRA 5EZQA 1JDBC 4OYYA 2PBZA 3ZHCA 1AKRA 1XP8A 3W5HA 4FP9A 5U4QA 2N9UA 1EJBA 2BW0A 3PJGA 1YC2A 2H7VA 3SF8A 4ZDKA 3HXPA 1KDRA 4EJSC 3IMGA 3GRCA 4BFLA 1GIAA 4EDFA 2QBYB 3ZW8A 3L0PA 1SXJD 1U2SA 2ZE6A 5EVCA 4DA0A 4B83A 4KIJA 4G81A 4W9NA 5BVHB 1SXPA 3T34A 1JJBA 2HA7A 2JCXA 5EIXA 1LI4A 1X7XA 3LS2A 4ME6A 5CTJA 5FPPA 3NVMB 3I09A 1NXSA 3V9AA 1SCIA 4DTCA 3QELA 1YDGA 2HI0A 4MVJE 1PS9A 3F3YA 3D6NB 4UULA 4B6OA 3T4UA 3QIAA 3OPQA 4KUHA 4RV9A 1PAUA 3QP9A 1G55A 2ZR7A 2FF7A 2CF6A 3B60A 4LX0A 1E2GA 4CFZA 4KR0A 3CYFA 1PJ2A 2IH2A 4IMJB 2ZIWB 1IUOA 4R8VA 5PNTA 1QGED 3TTWA 4DY6A 1AHIA 2EX1A 4KR9A 2QLMA 4GXQA 4BX3A 3ADCA 3W6OA 1D0IA 4GW3A 3TNFA 1NKTA 1E8MA 1X19A 3LF1A 4FKBA 3CISA 3RE1A 1TQ6A 1ZICA 2WBLC 3DO5A 3L6EA 4X66B 3K8YA 1E9AA 2GCNA 2NPFA 4F71A 5BMVA 3LZ6A 3KZMA 3V8MA 1Q3KA 3N2IA 3GC6A 1SG9A 3HFRA 2ZYAA 5HCIA 1DINA 2BT4A 5L7TA 4PRYA 1SBZA 4S0XA 1JU9A 4QJ4A 5K8LA 3W5AA 2YHAA 1NNEA 4FFDA 1N5IA 1RWQA 2J3KA 2D1RA 1ONSA 1DPGA 2ZSJA 4QPJC 4LV6A 2ET6A 3CZ4A 2FQQA 2GHTA 4B7UA 3A10A 4E2WA 3MCVA 1NBMD 4YRNA 5CFLA 5LFAA 1TCBA 2G25A 4WXRA 5BOSA 4RZQA 4RKQA 1KAOA 4DSOA 1NQUA 3NYWA 3VNQA 2VQFB 1MV8A 3WSWA 4KE6A 3ZHUA 4TL6A 2F3RA 1H2YA 4J1QA 1EFHA 1VHLA 1UXHA 2R84A 5H16A 2WPDD 3CNOA 4EA7A 2NXNA 4I1SA 5C8YF 2ACVA 2A59A 3B7GA 3QA9A 2YY5A 2DC1A 5JE8A 5THQA 4QDOA 5A4DA 4XYEA 1EM6A 2LTAA 1XTSA 4X93A 2C5SA 4H3HB 2P9TA 2JK0A 2VDKB 1Z8FA 5EIHA 3L7LA 3R76A 5EJ9A