1RWMA

Crystal structure of human caspase-1 in complex with 4-oxo-3-[2-(5-{[4-(quinoxalin-2-ylamino)-benzoylamino]-methyl}-thiophen-2-yl)-acetylamino]-pentanoic acid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwmA00
1CP3A 1IBCA 4NOMA 3QNWA 3SIRA 1GQFA 2H51A 2QL7A 5IARA 4DCJA 3S8EA 3R6GA 1RWPA 2H65A 3P45A 2AR9A 4FDLA 1I4OA 4NBNA 1F1JA 4NOKA 4ZVTA 3PCXA 4M9RA 4QUDA 4D3XA 5IBRA 2HBQA 3DEJA 2P2CA 4ZVUA 5I9TA 4JJEA 5LUAA 1RWWA 2CJXA 1JXQA 4IEFB 2XYHA 5IAKA 1NW9B 4QU5A 3R7NA 5K20A 1SHJA 4IYRA 2FUNB 1K86A 3R7SA 4I1PA 5IABA 3H1PA 3NR2A 4QUIA 4PS0A 2J30A 3GJTA 3DEKA 4JR0A 3EDQA 3R7BA 4JR1A 4NOLA 1I4EB 3KJQA 2QLBA 3NS7A 3H11A 3KJFA 5IAEA 1RWMA 3DEIA 2J31A 3NKFA 3H0EA 1K88A 3DEHA 4EHFA 1M72A 2DKOA 4N7MA 4JB8A 3GJQA 2K7ZA 2CNKA 2C2ZA 1I3OA 4QUBA 3V4LA 4D3ZA 1NMEA 1RHUA 3V4OA 4EHNA 3UOAB 5JFTA 4D3YA 2H54A 3GJSA 1RHRA 1SC4A 4HVAA 3PD1A 3EDRA 1GFWA 4PRZA 1ICEA 3D6FA 4QU9A 1KMCA 4JQZA 4DCPA 4JR2A 1NMSA 4FXOA 1CVRA 1SC3A 4NBKA 5LU9A 4QUGA 4JJ7A 1SC1A 1RWOA 2CDRA 5IBPA 4DCOA 4PRYA 5IBCA 1PYOA 1QTNA 4QTXA 4QUAA 2XZDA 2QL5A 2J32A 4AWAA 2QL9A 2Y0BA 4N6GA 2FQQA 2H4YA 3R5JA 4ZVPA 3KJNA 2CNLA 2H5JA 2CNOA 2WDPA 3BIJA 2NN3C 4N6NA 4AWBA 4PS1A 5IASA 3PD0A 1PAUA 1RHKA 2QLJA 3H11B 4FGUA 3R6LA 4QUEA 4I1RA 5LUBA 4EHHA 1RWVA 2CNNA 1RWNA 4QULA 2H5IA 4N7JA 4LSZA 4HQ0A 2C2OA 3V6LA 1RE1A 1RHMA 1RHJA 2FP3A 5I9BA 2XYPA 2QLFA 2C1EA 1I51A 2C2KA 4QUHA 2CJYA 1QDUA 4NOJA 4AW9A 5IAJA 3V6MA 1QX3A 5IAGA 4EHLA 3D6HA 1F9EA 2HBRA 2Y1LA 1SHLA 1RWXA 4N5DA 4EHDA 3OD5A 3S70A 4QU0A 4NBLA 4EHAA 3E4CA 2XYGA 3K7EA 3IBCA 4N6OA 4QU8A 5IC4A 3ITNA 1BMQA 4ZVQA 4QTYA 3R5KA 3SIPA 2C2MA 5H0IA 3UO8B 4JQYA 1RWKA 3V55A 1NMQA 5IC6A 2J33A 2H48A 3H13A 4ZVSA 5IANA 4HQRA 3GJRA 4JJ8A 2HBYA 3RJMA 4QUJA 4ZVRA 4EJFA 2H4WA 1RHQA 4ZVOA 3V3KA 2HBZA 3D6MA 5LU8A 4FEAA 3P4UA 3IBFA 4EHKA 2XZTA
chains in the Genus database with same CATH superfamily
3TGLA 1UC5B 2CL5A 2KLBA 3A6ZA 3FSRA 3OLYA 1ESEA 4EOGA 4L28A 1XFDA 4M76B 1CY6A 2WVAA 3JZIA 4EQZA 1ZGAA 5DXJA 3ENQA 2W6PA 5LBUA 2Q7XA 5BNFA 5L3VA 1IBKB 2A0UA 5ALRA 2ZRMA 1N5LA 1I8TA 2ORYA 3IB3A 3TQFA 1KAQA 2LIVA 1OFVA 4I1UA 1Y6JA 4L9AA 2B82A 4ENSA 4ZYVA 4Q5IA 5IPFA 1VE6A 1DBWA 2EZUA 1WSWA 4C14A 3AVTA 3FSJX 3FSGD 1E2PA 3WB2A 4HWPA 2P5YA 3C5HA 1A97A 3FUUA 3PXXA 3SBEA 3IVCA 1KSGA 3VDNB 1SFRA 2FSVA 2UZ1A 3JRXA 5CDTA 3FWYA 5FR1A 3HCFA 3K0SA 2O8CB 3PF8A 2DOKA 1W85A 3GXBA 2D1FA 4L8GA 2QLLA 1SQ6A 4QXOA 1G4HA 2GVNA 4Y6OA 5CAEB 1XDDA 2YDXA 2WG1A 4KGXA 2NPFA 2VHEA 3PWTA 4RVOA 3MT8A 5HTKA 2FWBA 3M6IA 4JITA 3JALA 2PMEA 3RHFA 3OTOB 1CUJA 1OFGA 1XMXA 2XDQA 3SJ7A 1E3IA 1JYEA 1UQRA 5KKNB 2GEBA 4J8PA 4UVDA 1RW4A 4MXDA 4TKUB 4PYRA 5JAUA 3U17A 4JBWA 5EJ8A 1HBJA 4YJ2A 4RZUA 3AG5A 1JIUA 3OZFA 2V7WA 2XADA 2IOHA 3E03A 4Q3KA 1E59A 5JEDA 1M2GA 2YVLA 2VK1A 4Z7JA 4IV5A 2IS4A 4K2AA 3RH0A 2IPLA 4DNXA 1CJUC 4TSKA 2VT6A 3C7KA 3KO8A 3M5PA 4WVFA 1LVGA 2GZAA 3M2PA 4GU5A 1MJNA 4RNDB 2BEUA 3FDFA 4TTPA 5CDHA 1SULA 4LE2A 3GYGA 4A92A 2VF5X 1ZCFA 4EDFA 4KPEC 3AOGA 3R9XB 1CUBA 3M49A 1D0IA 4M9QA 1RRGA 4G5RA 4LK2A 1X1TA 4E7PA 3PGKA 3DHYA 1B6GA 2A1IA 1W7AA 1E2EA 1EVJA 4CT4B 4CQMD 3QM1A 4GBGA 3CZAA 1DDIA 1FXUA 2C20A 4RANA 1L4MA 3L7DA 1IXRC 1NI3A 1G0OA 4HN9A 3TNLA 3N5CA 1N36B 3R7WB 4RCYA 2G04A 3I9KA 1VA4A 4ZEVA 1ZSNA 2CLIB 3G8AA 3OU6A 2IV3A 5JROA 4FMBB 3A3YA 2DR2A 3QLVC 4G2TA 1E89A 4KH1A 2AZMA 3C87A 5JRJA 2CMKA 1OREA 4NG5A 3DJFA 1KDRA 1J70A 4NONA 4YP6A 5IDVA 2XXAB 5K6TA 1AV7A 2YJGA 2F8SA 1QFXA 5JCOC 4GOMD 1A4XA 5E6RA 4AMBA 4ODIA 4ARZA 2FN3A 1U2TA 2ATCA 4MWCA 1HC7A 4ESEA 4EUHA 2KWIA 1GY8A 5K8VA 4B44A 1JHYA 4TMKA 1CR2A 1OBHA 3NMUF 1YVEI 2H4HA 3HN7A 3OUZA 3GVCA 2C92A 2PL3A 4ITVA 4BO6A 1UINA 2D1QA 4DMCA 3LDAA 3ACCA 2XQGA 1TFUA 4JL5A 4K6HA 2LIPA 2REOA 1HDXA 1L3IA 3C24A 4BUZA 4C1BA 1EU1A 2DUMA 4RBNA 5FJJA 4ARBA 2J3MA 1S1MA 5AT1A 1U63A 1EWKA 3B2QA 1CUWA 4NZMA 1ZVVA 3IT0A 3VNAA 4DV6B 2B30A 2PLFA 3DEJA 5CVVA 1FXSA 4YMSA 5KTKA 2OZEA 4KXUA 2VTBB 3FA2A 1P5HA 1GPYA 1E0KA 3I04A 1R1DA 1YR6A 4Z1MA 1M2OB 1JKJA 1YR9A 4Z4CA 3CIOA 2NXWA 4GQIA 2DCMA 3IVMA 4WW0A 4YMVA 5HW0A 1IPFA 5JSFA 4PZPA 4KR7A 1C8BA 1J22A 2VHTA 3K31A 4GGMX 3Q1KA 2C57A 4XPIA 1GWNA 1UKAA 1QH9A 3K0CA 2ZDHA 2C7QA 5JASA 3AKYA 2Q21A 2OBFA 3VXKA 2ZU0C 4MWZA 4II2A 1D0VA 4AURA 2QD3A 3DJYA 3LP8A 2YUIA 3GFFA 4OXQA 4XXHA 5BT9A 3UKOA 3ISVA 4NZYA 4DKJA 1TJPB 4LIPD 3I5XA 4KR6A 1XELA 1SO8A 2QTAA 1Y1LA 2D5BA 4NH0A 3OF3A 1YRBA 4XYMA 3C5CA 4YUYA 3LJKA 1GO2A 1T1JA 3A9TA 4GFDA 4DCGA 2CZCA 3K0BA 3QELA 4RDIA 5MFZA 2M6KA 1JNYA 1LXCA 3T5DA 4P5EA 2JATA 5DGXA 5TR9A 3VR5A 5LN1A 1CVIA 2JIBA 2QTRA 2H3HA 2Y71A 3ZE1B 1HEYA 3A2NA 2C97A 1BYUA 2PMDA 4L50A 4M87A 2VBIA 3WYBA 2C5LA 1VYHA 2FMTA 3DBVO 3H6GA 4EAQA 5AUPB 5F4ZA 5GOTA 4C04A 5KPDA 3CNNA 1DBSA 2JG3A 5FXMA 4FTWA 2IDMA 1A76A 3CC8A 2A1UB 2XCOA 4P3PA 3M1YA 5AKHA 5KHAA 1OLUB 1A5SB 2RDMA 1RAEA 3ASYA 3VZCA 4XWOA 1QF7A 1P8JA 3MGKA 3QGMA 2CJWB 4NU6A 5AVTA 4EI7A 3QBJA 5C5EA 3DVSX 1SUCA 4QUEA 4F3CA 3K9FC 4NQZA 4I8DA 5KX5A 4J4BA 1DXOA 1GZDA 1XA4A 1ZMRA 5EMMA 1CU1A 4TMYA 2R1ZA 3TLEA 4AZ0B 4BMSA 5F2NA 3OQIA 2G5TA 2P9QA 4CQLA 2RCNA 3HPRA 3ZXSA 4TYYA 4QBFA 1D2HA 3M4NA 3IPAA 1SQ0A 1C9DB 4PPGA 1B8PA 3E7XA 5TF0A 1BJRE 2VDUE 4AW9A 4H35A 3DBLB 1GV0A 3O4JA 3V00A 1B26A 8ATCA 5EIXA 4DSOA 4XSHA 4M0LA 5FUYA 2ZSDA 1ENPA 4HL6A 3GROA 3RR2A 3OKCA 1YFKA 4QWMA 3QMWA 3L4JA 2PZMA 3QSGA 1XROA 3QUSA 5K1ZA 3AKZA 2OY0A 1VZ3A 3FHLA 3V4PB 3KT0A 1R88A 2OV4A 2OTCA 2H57A 3QFCA 1O57A 2IEIA 3QYJA 3V4SA 5AHKA 4DUZB 1T2UA 4XFJA 1U8ZA 5DVZA 2IDZA 2FHPA 2NV0A 3S6JA 3P9CA 4IKOA 5KKCA 1C4XA 2C2YA 3PWKA 4DJAA 3SZLA 1RABA 3F46A 5CK5A 2YN0A 3AWIA 3EFHA 3QKRB 1RQNA 3TZLA 3SZGA 5AJHA 4FNGA 4OGWA 3HN6A 2Q7DA 1UBRS 1ZH2A 1EFCA 1G1MA 1LI5A 2A59A 3BFJA 3N1UA 4QBGB 2ZPUA 3UH1A 1ECFA 3TCKA 2BMEA 3R2JA 1DWQA 1Q83A 2KW5A 4R9NA 3ZTTA 5I8ZA 4BN4A 3IB6A 4LYFA 5HJ7A 1A9XB 1Z4LA 2GVZC 2OMKA 5JNSA 3GJZA 1N2BA 5ALPA 3O6VA 3NTXA 4B0OA 4CQMA 3OESA 4E88A 3AI2A 1IZ9A 1FRNA 5HIMA 3JQ7A 1CERA 3Q7IA 3AFGA 4D43A 1POXA 4NHEA 1N2CA 3OZRA 3TLMA 3G5AA 4IYRA 4AY5A 3ZDBA 1K5PA 3RT9A 4Y2SA 5G0UA 4X62B 2P5SA 5NULA 4JP1A 4KE7A 3RBZA 4BQQA 2FPOA 5DDIP 5IF9A 2ZJFA 4QZVA 5LMNB 2QZZA 3MUNA 2WM8A 2QTVA 3NX4A 1K88A 1ZZEA 2FPUA 5COAA 3IPXA 3K71B 3D1LA 2MHCA 3SIWA 2CKMA 2ZU6A 1YKGA 4H4CA 1QIMA 5B58T 2MSCB 1LRKA 1GIAA 2V7EA 1U80A 3SYMA 4WKGA 4BV2A 4QNNA 4AY6A 3GFRA 4RZHA 3HWRA 2DWUA 2QTGA 3A4YA 2R8BA 1GFWA 2QBYB 4NXNB 1JVSA 5EE9A 1M2KA 5I7SA 1JG3A 3UOGA 1J0BA 2XUOA 1KY5A 2I7DA 3MRVA 4F45A 6ABPA 4YAFA 4W5HA 5EQJB 1IM5A 4KX3A 2VT7A 4WA7A 4YRDA 2EW2A 1YBAA 4JQOA 3DCJA 3UK0A 2WQ6A 3DXFA 3PNPA 1UT5A 3AF3A 5AKIA 1CZOA 4P4GA 1Z29A 4IGEA 3JVIA 3O9MA 4K81B 2OHGA 1ECLA 3D8SA 3FCXA 4BWFB 4TWZA 1Y1KE 4INOA 3DZJA 3MB8A 2FPPB 3DM9B 3DOIA 4XWYA 3TUIC 1LDNA 1IQRA 2ONCA 1YO6A 1VI2A 3PEVA 4UNSA 1VIYA 4IGFA 3ZZTA 4ACBA 1MDFA 3FWZA 4IFBA 4IDAA 1Z3CA 1RYNA 2VRWA 3FMFA 1SVWA 1WSDA 3WWPA 5J58A 2AN3A 2ZR0A 2VHWA 1WY5A 2YFKA 1A2QA 4AP9A 1XA3A 3AUXA 3OUUA 4GKAA 1P1HA 2IC5A 2JGIA 1N9GB 1XWFA 2UDPA 3OWOA 5FBWB 4OB7A 3RRNA 3UJDA 3ZGNA 4DJEC 4YAGA 1LS6A 1HZJA 2F1JA 2X3FA 2W8BB 3M82A 3THSA 4DLYA 3R0JA 4FP9A 1NJGA 4XOIA 4QSHA 1O9BA 4Z9BA 3IUEA 5BV2P 5LQRA 3K96A 2G5PA 2L82A 2BGRA 3GJXC 1SCNE 3ZEAA 1Z0DA 4IQGA 3I52A 1HI9A 5IVHA 4EENA 4H15A 4I6EA 1XX6A 3CUKA 5JIBA 1SXQA 3QE0A 3JSXA 2ID4A 1L7BA 3HB7A 5KWIA 5I7WA 3PR3A 3V1YA 3ZHZA 3FTEA 1XTJA 1DQYA 4HEQA 4E5YA 4PC3A 3KJZA 1FBTA 2Z3WA 3M5CA 4Y2RA 1UMCA 1P3JA 2BZGA 2CDAA 1BDBA 2EGUA 4X1YA 1QQTA 4U2FA 5LZ8A 1UIMA 4X0EA 1XD8A 3EGXB 5JJ5A 1KR5A 4J3FA 4BMYA 2POQX 3IQIX 3SM9A 1TYEB 2WWRA 3QG1A 4MV1A 5E6UA 4L27A 3WGYA 1FFXA 3AMVA 4G89A 3WBKA 2GFQA 3ZK8A 3EUWA 3Q3EA 2P1DA 5I7EA 1V5GA 3QE2A 1WZIA 2OPHA 1Q84A 2ID7A 4HY3A 1PJSA 4XW2A 1VCIA 1OAKA 2WKPA 4H18A 1EPUA 2V6GA 3PCRB 4KAXA 3HZRA 5G1OA 4PGHA 4JFRA 5AJVB 3C4JA 4YP7A 1P9OA 4P81A 1LA2A 2A33A 2ZUUA 2Z5GA 3G8YA 5KYVA 1SHJA 4RGBA 1DG9A 2OYRA 1M6YA 4D74A 3MAAC 4WESA 3OJ0A 2F17A 4ND6A 2V58A 2J0VA 2O23A 2YWXA 3BTUA 4JR0A 3L7NA 4LNUB 4YMGA 3OU2A 4HDMB 2P8SA 2I9KA 4TGLA 4XRRA 4AJ9A 3PHJA 4CODB 1REQA 4BRSA 3AEQB 4WCFA 4B3BA 4N0EA 3I5YA 1Z06A 1BWQA 2ZTLA 1IQUA 3ZWNA 3GH1A 2WUDA 2IUFA 2CNKA 1IVYA 1I3OA 2ZDGA 4NCNA 1FTSA 1X0XA 2AMYA 2H1VA 1NNLA 4IS2A 2UAGA 2ZZMA 3HPQA 1IOWA 4LPKA 3TOVA 4HUJA 3ZDAA 2C4NA 3B6IA 4YRRA 4IYJA 1CX9B 5E7MA 1IEQA 1FNCA 1HYGA 2VPPA 4Z3KA 1X7GA 3CRRA 1AQJA 4AFNA 2YHIA 2HADA 5JBIA 2IOYA 1NUQA 4U7DA 3WLPA 3NM6B 4GOND 2HLNA 4TTRA 4BLRA 4ZI7B 3F1LA 4LW8A 3UB2A 3PICA 1T0IA 1J33A 1WHSB 4M0DA 2WAYA 2UXCB 1YJBA 3ER6A 1J2EA 1BE1A 2JLSA 1GL3A 2DMRA 3N2EA 4DLWA 2BSAA 2PR2A 1LZLA 3FY4A 4WV3A 1U9IC 3H11B 1TM3E 1DRWA 3QTTA 4NS4A 2R1VB 3SLRA 3FF1A 3B9RA 1LU9A 1NI4A 1Z08A 3SHWA 1E2HA 3U4MA 4BX2A 3IKLA 1NATA 1RAGA 2JD1A 5GINE 4IO1A 4XYGA 3VISA 5T4HA 5ENZA 4GR9A 1U8UA 3G17A 1E1KA 4Y2HA 5EE3A 3EQ7A 3L6CA 5IS2A 1XEWX 2BI8A 1I30A 1F5SA 4FYYA 1H1DA 1KI6B 1JDNA 4LKRA 1O6CA 2FEKA 2G72A 2Q9CA 4EG6A 1NP7A 1VJRA 2XUKA 1BHQ1 4MKRA 1A5AB 1MMFB 5AKKA 4HN4B 3LFUA 1C2YA 3BULA 2KBFA 3R3YA 4G1UC 4B4WA 2CF6A 2BHSA 4QPDA 5DM60 2O7NA 3NKLA 1JHOA 5KNBD 2CXTA 5JYDA 1Q1NA 2UZ0A 3H13A 5L6MB 3GT7A 4YJGA 4IDNA 1X2EA 1IJEA 1ABFA 4C0WA 3NDBB 5LA6B 4D2IA 2OXIA 5DNVA 3ETEA 4JUDX 4PAWA 1YHZA 2Z98A 2XVZA 4S2UA 4FFPA 4AZSA 3CUWA 4DIEA 4L7QA 5BURA 1DBPA 1JXOA 1T8RA 2BR5A 3LY7A 1P80A 2BTQA 3AM3A 3ORRA 4R9UC 4TL8A 4XOUA 2DWPA 1H1LA 2FLVA 2HA0A 3C7TA 3MJTA 3DE5X 3F98A 4MAAA 1SBYA 4R05A 3TZHA 2GEDA 4Q3LA 2PZGA 4ZU3A 4MLCA 1KJIA 1NBOA 3H2YA 4MWBA 2QPAA 3OZGA 3RUAA 3UF0A 3V4VB 2HR1A 1TE2A 1Z3IX 3SCZA 4PTZA 1EHIA 1PFGA 2ZB7A 1HG0A 3L5KA 2G7MC 5EJ7A 4ZCQA 4LRSB 2P2CA 5TJ9A 2ZRLA 2OCGA 1W4AA 3WYEA 3BPSA 1CUFA 2R97A 4QVKA 3CNLA 3CLUD 1CWUA 1TGYA 5E3JA 3VPFA 2R7LA 4QUIA 3RQIA 3B6JA 2O8FA 1T4DA 1TC1A 4M0CA 3R7BA 3SSAA 2O48X 5FIUA 4DCNA 4YIHA 3ZI7A 4DEVA 1C8LA 1QK3A 4I6JA 1N5OX 2O2YA 3B20A 4FR0A 1NNSA 3STVA 5JSKA 1YCFA 2W6JA 1A4IA 1Q20A 2W6NA 5LOVF 1EVEA 3ML1A 1W47A 2ZPAA 3ZU2A 2HMUA 4IEEA 2Y27A 3VC3A 5T7BA 3KVYA 1JAXA 4PINA 3SJCA 3AVYA 3TKLA 3AY7A 5DEOA 4TTTS 3ZU5A 3MIIA 4DRXA 2XQIA 4GDMA 5IJWA 5KS2A 4QARA 5G0SA 1T91A 1OLXB 4NPHA 1IB6A 5CIWA 3FDZB 4YAJA 1UWKA 4MKFA 1LX7A 4KQXA 2D7DA 3M6LA 2X14A 4BNNA 1TF7A 4WINA 4L2IB 4CEJA 1YJXA 2RB4A 1OY1A 5CA1A 5H16A 1QNFA 4MS3B 5PGMA 3TOXA 2XBLA 3ILSA 4FE4A 4ECEA 4F1KA 2Z2KA 1SEPA 4JJ7A 4N3AA 2FSGA 2NSDA 2P5UA 1INLA 3U4QA 1KF0A 2P6PA 3WKAA 3B38A 4QE3A 5AQ1A 3J80A 2PCJA 1G8JA 2M6LA 4LMRA 2QL9A 2VI5A 5TRTA 3N2YA 3HSKA 4H77A 4HDCA 4JC0A 1Y9JA 2CFOA 2QTNA 1R6UA 3ELBA 2O3RA 2QAGA 1KPHA 3L49A 4BFXA 2QLJA 2Z5VA 1EGHA 5B37A 3OTIA 2NSJA 1TZBA 2Q49A 1U0GA 4L3WA 4Z8YA 5EKUA 1JR2A 3GFTA 3OKFA 1Z83A 1KQGA 2O54A 5TGZA 1IUKA 4Y30A 2WB4A 3LX8A 1NBEA 1P39A 1DAGA 1QJ4A 4D4GA 2ZM5A 5ICCA 4QNMA 1Q92A 1R0YA 2CV2A 4PTYA 1GFSA 4HNAA 5TMEA 2C5SA 1GPJA 1EFVA 2ZG6A 1A9QA 5DLPA 4AY3A 1QRUA 1QTRA 4PRKA 3I01M 4TQUS 3LPMA 4HBZA 4L7VA 1MV5A 3E9CA 3H2SA 5CT6A 5KSZA 1G8HA 3OPQA 1EWQA 3TVDA 4QTYA 3LUBA 3O1LA 4K9MA 1RMYA 3FZEA 4MUIA 2HNAA 3RWOA 1DGQA 3MK31 1UT6A 3T1NA 4DVGA 3D81A 5IANA 1TUBA 4MGYR 5FNZA 1E9RA 1ISMA 5ILQA 1EE2A 1CJVC 2X2OA 3M6FA 4H7PA 5HE9A 1U5BA 3RJMA 3X44A 4B6GA 4D96A 2DLCX 4N0MA 2PRJA 1XEFA 3AKCA 3PYMA 2H17A 4DHEA 5JNTA 2IP1A 2AX4A 121PA 2XWPA 1JQDA 2YR0A 3AJ9A 5FTMA 1K92A 4D8YA 4ETIA 5M5BA 3STHA 1A88A 3UJBA 3LUAA 3KK0A 1Z5ZA 1L9XA 2ZWPA 3Q0EA 4RENA 1RXVA 2HJSA 5AQEA 3ZIAA 2XUPA 3DOFA 3TQQA 2B7CA 4KIWA 4MVJF 5FPHA 2PN1A 1JGTA 3P94A 1Y8ZA 4OXNA 6REQB 3UJHA 5D00A 5AO9A 3L1IA 3TSAA 4C3ZA 1USWA 5BN5B 2PSDA 2PUDA 1XJWA 3TBHA 1ADGA 4QICA 3S2IA 1Q77A 4EKNB 4TS1A 5B4VA 4TM7A 1W5BA 1DQZA 3AL3A 4NNOA 1QRAA 1U1IA 1GNSA 3PF9A 3G2LA 5JEEA 2IOFA 5CYOA 2FUG6 1B00A 4MDHA 2FUG1 3L6EA 5K51A 3BIWA 1UKYA 4NFSA 5B1HA 3CN9A 3KJQA 1QZTA 1LK0A 2FXVA 2QLBA 1EUDA 3DO6A 3RC7A 3RAPR 2RGBA 1IVNA 1E2GA 3SHOA 5JNRA 3KZCA 3V1UA 4DA6A 1BGVA 2ZRCA 4FZJA 1L8LA 4GD3Q 1WBDA 3D5QA 3MB5A 4J75A 1DZ3A 4MUXA 5LQKA 5HEKA 2IKQA 3F9CA 4DPMA 1YGYA 3GFVA 2WAXA 3KQNA 1U7ZA 1UJ4A 2X2PA 3K1TA 3DVLA 1L5KA 1WOYA 3FPEA 4N7BA 4MICA 3D2BA 3LP6A 3W2EA 5KTYA 3WYDA 2HXGA 1ZGZA 1DFGA 2OKCA 2WU8A 1CQIA 1V39A 2JAQA 2QS9A 2ZI3A 1P4AA 3A1UA 3KQOA 4DLSA 1LRJA 3K6SB 2F7SA 3O4GA 4FUQA 3VYVA 1DDOA 1U8CB 2Q29A 2WJHA 4RULA 4L5BA 3OIYA 2E87A 4G4JA 3MPOA 2F8MA 2CHFA 3UYKA 1GPMA 4FGZA 4RM2A 3KEQA 4Y6PA 1EBBA 5JU6A 3DQQA 4YRKA 1NC3A 4OK6A 3B8EA 4RAOA 1KZHA 1U3WA 3STYA 2QN7A 3R5JA 4LK3A 3ORYA 2H5JA 1IBLB 2QUHA 1Y8QA 4LE0A 4RPHA 4JYPA 4I1RA 1DX6A 3DPIA 4Y6SA 1G20B 4KIUA 3TTWA 4HLUC 5CXUA 1A2BA 1NQXA 3VO8A 3FOCA 4UVIA 4CKWB 2D59A 4LA4A 5FADA 1D0SA 2BHLA 3G2NA 3WYGA 4AUMA 3NW9A 2HPHA 4GL4A 2FZVA 4WL0A 3UJ9A 4D1YA 3HO1A 3AKEA 1J5PA 4FE3A 3F9IA 5T6BA 1EK5A 1GPAA 4MQEB 1ZNWA 2FSIA 4KWCA 3KZKA 3WRYC 2F3RA 3QPAA 4D9EA 1T9BA 1MC1A 5KQGA 4QU8A 8MHTA 2AXQA 4N6OA 1KHHA 2Y99A 4OQQA 1MENA 2QLTA 3GIDA 2E4AA 3LC7O 3FRJA 2RJOA 2IWRA 2ZCVA 1V7CA 1BKSB 4XFKA 3AR2A 3EBLA 4JVMA 3SICE 1TCUA 1BDJA 4KRGA 3ET4A 1JEOA 3EPRA 1HYBA 3HGQA 3K5WA 4GPIB 4KOAA 3FHJA 3NJRA 4FDVA 2A5FA 1LJUA 4LZJA 4WLEA 5A9TA 1IULA 1NZFA 2QYHA 3JPWA 5K5EA 2CHUA 1NE7A 2O2IA 2Y1KA 3CX6A 1U0EA 4FGLA 1DU4A 3ZNNA 4FEAA 3NTQA 4YXWD 1ANKA 1NSYA 2WT4A 3A7EA 3NWBA 9ATCA 3H04A 4E2WA 2PGOA 3PLNA 3MOIA 5D1NA 2CFRA 4P31A 3RSFA 3NC0C 3PV0A 4YGYA 2ECOA 4FKBA 3HCPA 4A1FA 1O5IA 4JLUA 4Y9UA 5HQ3A 3G1WA 3NBMA 1GGVA 1MABA 3LYHA 4H1WA 4RV4A 5FUMA 2II6A 1WV0A 1XCLA 2FGJA 2WIAA 3IAXA 3Q72A 1J42A 1J8FA 2H18A 4F46A 2I1WA 2BUCA 3KETA 4DA4A 4RK1A 1DTWA 1JXQA 1ISSA 4G01B 2XJ4A 3NWPA 1VFNA 1HURA 2ENWA 2XB6A 3GRVA 3IAFA 1U0LA 3L0ZA 4HDRB 4Y1EA 3KPJA 3PA8A 3OTWA 4A3SA 2JBAB 3PDJA 4J16C 2J9FB 2VHZA 4OHYA 3ENNA 4WZAE 5AOCA 2YC2C 3FLEA 1G2OA 2JH3A 3I5MA 3T3GA 3QWIA 4I1OA 4NV0A 1VJ0A 3KYDB 4ZZ3A 3KQHA 1NFRA 3FZYA 4P32A 5CD1A 3IP9A 3E9MA 4E2ZA 3MMZA 2OZLA 2Q27A 4N7MA 3E23A 4M99A 5ESDA 2HU8A 1K4MA 3TQRA 2XA9A 4IXWA 3EZ2A 1X74A 2ASVA 2I65A 2PS3A 2QU8A 3ESCA 3M1LA 3DM5A 1HYEA 3B1VA 5DHSA 4BS9A 3EAFA 1SB9A 2PT7A 3P2MA 3VVCA 2TMDA 4BC1A 2Z4SA 3NHYA 3QLUA 3FHOA 4WXRA 5LP6A 3ECSA 1GPBA 4S24A 1NZDA 5AOAA 1TA0A 3KTDA 2Z6UA 2PPVA 4RVGA 2C31A 4B3RB 2ZVDA 3C15C 1V8PA 2J3JA 2AFHB 2SBTA 1F5NA 1SVMA 4I8IA 3V1TC 2CW5A 4CF3A 4BO8A 1NBIA 5DM70 3AF1A 3VKGA 4C4OA 8OHMA 2P11A 3AJ8A 4BAZA 1NOIA 3A1CA 4B32A 2DQSA 4BUJA 5BVHA 3GEMA 4MAFA 3DE3X 5DYGA 1X1RA 1N4AA 4CDRA 2BFDB 2Q41A 3GRPA 4G4SO 1YXMA 3IUJA 4IY1A 4GUDA 4RK7A 1PNVA 4TUYA 1GZ5A 4DCMA 5BSWA 3REOA 4PS1A 2VEOA 3A3OA 4ERXA 5KEIA 4JEIA 3WHLA 3VDMA 1VC2A 1JU4A 1GAXA 3ZKWB 3AVVA 3LI2A 1CPYA 3Q0IA 1JEJA 2Z9BA 2JFHA 3T38A 4DIUA 2VP2A 2XYPA 1FDVA 1CEEA 3LKZA 4XX0A 3EVNA 3W7BA 4BLTA 2BMFA 3DHEA 4LY3A 3K1YA 1W19A 1QX3A 2JLBA 1OVMA 2P78A 2VLIA 4M1SA 2CSXA 1DTSA 1RJFA 3UG7A 1YE5A 1NVUQ 2VA9A 3IEIA 5CR9A 4BLPA 4D9MA 4KLAA 3NGLA 2IF0A 2EX4A 3MUOA 4EPVA 3PKZA 3RVOA 2ZRKA 3DZBA 2WTUA 1EX7A 3IEXA 2VUSA 2FZ4A 3RRBA 4KX5A 4E4TA 3L7JA 3U4GA 5K8LA 2GK7A 1DG1G 1E20A 1F2TB 2XMSA 3ZXXA 4DANA 3LLCA 1VJCA 1AA6A 4ZIRB 1IK6A 2D4AA 4NYMQ 4C0HA 4BFLA 4HQRA 1CJBA 2REQB 3ILXA 4BX9A 2BM1A 3B3AA 4CMJA 1QTQA 2BY4A 3L7CA 3GLIB 2XGMA 1YZLA 2BEVA 2YN4A 5CDGA 2ZATA 3A3NA 1JALA 1X7WB 4Z9XA 3TXYA 1TTTA 2W2NA 1BXZA 3IOCA 1LSUA 1I3CA 4X7BA 1E7YA 1O5TA 1O97C 4GLBA 4RK0A 3LWZA 3VU1A 4CCYB 3PPYA 3ENWA 1P5RA 4CI9A 3ER9A 2IZ6A 2W4IA 1ZUNA 2CKDA 5EIHA 2P0EA 1J39A 1DE0A 5IJAA 2GVDC 4F9EA 3I6YA 5D3MA 5LMCA 1X39A 5JQWA 1KKUA 2ZVJA 3H19A 3L07A 2QM8A 2XMDA 5AI5A 1XSEA 1GZ4A 5DIZA 4JXZA 4BV3A 1PVVA 4AAYA 1IXYA 3SYKA 4TZ6A 5FPSA 4N01A 4O4LA 2F67A 4F3NA 3EZFA 1QOZA 4CR7A 2WF6A 1MC4A 1T4BA 1I94B 3ZGZA 3UT0A 3WJ2A 1OZAA 1YQDA 4EL0A 1V8ZA 2G9ZA 1KMHB 2F1HA 1GGHA 4KZPA 3P97A 1QCYA 1U5AA 3FVRA 5ALMA 3GJTA 2O2GA 1C1DB 2V1XA 3EIEA 3LPDA 3ZV5A 2BFNA 5I7OA 1CQJA 4DT1A 3BA1A 1F2VA 1VPEA 3PQDA 2Q8QA 1WUKS 2G80A 3D4OA 3MAJA 3ANTA 1P7CA 2KB0A 4M9SA 4AUKA 2HN9A 1E9SA 5BW5A 1L7NA 2QX8A 1AQNA 1HV8A 3KOMA 3G0OA 2QVYX 1IK4A 2XKAA 1O77A 2ZYAA 3EIUA 3LE8A 4QQNA 4QXPA 3PFNA 3UWOA 4DC1A 3OOWA 1HE3A 2QX4A 1OX5A 2WVHA 1O5OA 4DNQA 1UAAA 1OIWA 4QM7A 1TFRA 3L7LA 2V9PA 5JY6A 3DMFA 1M83A 1NDHA 2J3EA 3PDUA 4R8KA 2H7CA 5DLDA 3ZDXB 3NT2A 4MUJA 4E51A 5IT5A 5KQPA 5F9MA 4RVCA 3T5BA 1OH6A 2C0PA 1FMLA 2JJMA 4Q82A 3NHPA 4OI0A 2HRBA 2O1XA 4BBJA 5JZMA 3TVYA 3WKEA 5EHNA 4IOJA 4RVSA 4GMGA 1VYUA 1P9NA 3FR8A 4YUXA 3TH5A 4DV0B 5AVKA 3DMHA 1TM7E 1HQYE 2WIFA 3P96A 4FILA 1MB4A 1SCAA 3TW0A 4LVNA 4X91A 4YAOA 5U4XA 3DWFA 1WCV1 2C3YA 2Y1XA 3KLPX 3ZVNA 4XAQA 2TRSB 3I72A 2O05A 4MEAA 5EWJA 1FFSA 1H2HA 1DARA 1XZGA 1G5PA 4DPKA 2X8WA 1IY2A 1GNVA 2R86A 3K9CA 2MT9A 3LX5A 3MZ0A 4X1IB 3UFBA 3WGZA 1Z75A 5J4YA 5KJ1A 2V7VA 2NUPB 5GONB 2ZAOA 1GN9A 4W1PA 3VKHA 3OE4A 3VOBA 4JUCA 5CH8A 3WK9A 2AA3A 3JXEA 5EPEA 5HMLA 1XCJA 5DCLA 3G9TA 4KV7A 5A1TA 3FZNA 3RVJA 1WZNA 1U2GC 3L9XA 3RSOA 5LOVB 3U5TA 2XE4A 3VR4D 3IR5A 5IAGA 1S3IA 2F1KA 2HJVA 2WRZA 3R3VA 1HL3A 3PC3A 3PRJA 1ID1A 1KK1A 3IR7A 4XGNA 4F0JA 1R3DA 4PAQA 1CS0B 3QWFA 1A9TA 1LVHA 5IUNC 1X7XB 2A94A 3A4IA 1Z6TA 2B78A 3A6DA 4GOKA 4HNSA 4PGGA 5LMZA 2R8RA 4IQ0A 1MQ9A 1UKCA 2OM6A 2GNOA 3DMRA 3N0RA 2W4QA 4FFDA 4W4TA 3AOEA 4Q18A 1PV1A 4I55F 4E5VA 3U60B 3HA2A 3LA6A 3D7RA 1ZEMA 1TVKA 3EX7C 1C3OB 3ZV7A 4OHKA 4QUJA 2O3UA 5M04A 5CJPA 1GHTA 3NAZA 4R1OA 4Q4LA 2XODA 3WSTA 4AF8A 821PA 1U2PA 3D6MA 1T0BA 3A2LA 2OB2A 2E18A 1U2RA 3D3NA 2CXHA 3EDMA 3HO8A 4M83A 4Y2YA 3TNDA 4JIMA 3ESQA 3FCUB 3V8NA 1TUEA 5L6LB 4D42A 1PNRA 3HYLA 1V11A 4X3CA 1MB2A 3B85A 3E84A 1FUEA 3QENA 4R54A 2F59A 3UFXA 4EY7A 4EABA 1YHYA 3ZXIA 3ZUPA 1V8BA 1R2QA 3VU3A 4CV2A 2PJDA 5LDDC 4ZALA 1SKUA 1XZHA 5I51A 1VDZA 1BU5A 3PSAA 2NAFA 1HGXA 2X5NA 1NV9A 2XNJA 1LI7A 2ZAYA 4KQFA 4DUYB 1P19A 4NAHA 3WRXC 2IY9A 3OZCA 4G2NA 3ZGVA 1Z0UA 4KXQA 4FYJA 3WZMA 1VJ5A 2JARA 3KKEA 4GRDA 2I6UA 4GYYA 3I3SR 5JANA 1WULS 5KYNA 1U2DA 1ZJWA 3AINA 4JUBA 1ZN8A 1P2DA 3SD7A 4NRDA 1J9EA 3PR1A 4MR7B 3VJKA 2W83A 2IL1A 1ZD3A 1NU6A 3CEHA 3N70A 1V3UA 3G5LA 2W0MA 3DTVB 3GJQA 3AP1A 2BHNA 3LIIA 4V03A 2QMHA 2ZRFA 3KD3A 5F35A 3RFXA 2XD9A 4FHCA 4B46A 1CP2A 1GU0A 2GYUA 4CCSA 1JFSA 4HXEB 2GF0A 4X71A 2XYVA 5SYAA 2WVGA 2BJVA 3OX2A 4JXKA 5AUOB 4P93A 3LOQA 1TKCA 1TX4B 2BGUA 4UNNA 2YW9A 3GCXA 1RADA 4XVHA 4NIMA 2DY0A 1PYDA 4IMIB 3TNFA 1T36B 1J8DA 2PS0A 2GN9A 5E7QA 1R4ZA 1I4TD 2GESA 3E48A 3KD2A 1NPDA 5JALA 4JLDA 4LZAA 2G40A 1L7XA 4RVUA 1TK9A 1DC7A 3LG2A 3QVKA 1RBQA 4PNHA 2ZI7A 1W94A 1XTSA 3QVOA 1GQYA 4P5PA 5J5CA 3M83A 1TCCA 2X7XA 4UMVA 3AUSA 2KSQA 2JVKA 5D86A 5E1MA 3AIKA 4BNMA 2G0NA 1B8UA 1ESNA 2P6NA 2ZBEA 2YHBA 3GLVA 1XU4A 1QLWA 4WY8A 3LY8A 2DULA 2D4HA 4UDYX 4LJSA 4CFYA 4NBSA 4YUWA 2XB9A 3GWZA 1IE3A 4HDKB 4N47A 4UFPA 4KI0A 2ZKIA 1Z8DA 5EUBA 2UUCB 4R41A 5A04A 1KVQA 1E1QA 2PDAA 1BDMA 1VCOA 3B2NA 3CH6A 4QQRA 3IQWA 1DRJA 2OM2A 1RC0A 3CUSA 1WOMA 1QGED 3KT8A 4IO0A 5TEVA 4U5QA 4XD7A 3VR0A 1CF9A 5B5SA 2CV1A 5G1PA 4E5DA 1RCTE 1B43A 4OYLA 4QWWA 1BXRA 1V2GA 3LT5A 3ZLUA 4QJ3A 4RD4A 1II8B 1EX1A 1UDCA 3QBDA 2Y67A 3F47A 2OGUA 2P90A 1W5AA 4A0FA 3AVWA 2BM9A 3WIUA 2PH5A 1G38A 1P7PA 1T10A 4BUCA 5CNKA 3NEAA 1UAYA 5AK3A 1PX2A 4EK9A 4RCZA 1UBUS 4JKOA 2ZIVB 4UUBA 3USCS 3RU3A 1T6XA 1Z6YA 1JR3D 2O7VA 2ODWA 4HK4A 2QRQA 3CNOA 1EDZA 3MCZA 4ZGBA 5DWDA 3KKQA 2I6FA 3VBCA 5CYGA 1ZH0A 3ND7A 1QFYA 2XEXA 5B4UA 3HC7A 4FKZA 4FX2A 2HF9A 5GQSA 4M0UA 5H5JA 3NRBA 2HT6A 1I3MA 3WGLA 2W2OA 3WKDA 4GXNA 3CMMA 1IZYA 3FMOB 5FP0A 1L3CA 4BQOA 1R0KA 5FNVA 2B1GA 3TRIA 5DTIA 4KYTA 2POCA 3FTPA 5CW1A 4LJ4A 3EEYA 5D6NA 3FPSA 2PAFA 1XYGA 3AHGA 3MSCA 2A5LA 3QIVA 3PUXA 4DIOA 4U9IS 4WH0A 2YIMA 1SQFA 3NHMA 2BEWA 3QA9A 4OB8A 1CZUA 2RGEA 3HCRA 2VH2A 5BRNA 1GCIA 2HSGA 1LUAA 1VLMA 1ZUD1 2GH1A 2JFZA 5CITA 5ADVA 2Q5HA 2RHGB 2DFVA 3EQZA 5FORA 3JQ9C 2M98A 3LL7A 3DD5A 4YS6A 3TTXA 5ICMA 5JC8A 1E1CA 1OV6A 5B7PA 1E0AA 3O8OB 4PX2A 4L85A 1GTSA 1EDOA 5I45A 2HJGA 2QJWA 4P7FA 5M7EA 2K7FA 4DDUA 4XASA 2ZB8A 1J9GA 2PTGA 3G7NA 2I6XA 3PJFA 4MIEA 1UZUA 1N25A 3LNTA 2VDKB 4O2AF 5DOZA 1JJIA 4IJQA 4AN1A 4C6TB 3TLGA 1KVUA 1ST2A 4PZ9A 4ZOLB 4PC2A 5T8KA 3SHFA 3T7RA 3VNVA 3JPYA 3LWDA 4I50A 5ALHA 5JYCA 4OX9Y 4O29A 4M37A 5LQJA 4BB9A 1L7RA 2B3DA 1E1MA 1ST3A 2E82A 3ZJUA 1Y7PA 1E1RD 2E48A 5CB4A 1J5EB 1CUVA 1XBTA 3COYA 3KQSA 4EJ0A 1B14A 2GUGA 1G2PA 3D3JA 4G0MA 1GNTA 3AH8A 2GK3A 4O6VA 4HNGA 5H7XA 1ZU4A 2YRWA 3OPXA 4X6YA 5H70A 4B2PA 1N6PA 1JMYA 1U2SA 2A6PA 2WTAA 1Q3HA 1GRRA 2ZJ8A 3RYHA 3T3MB 4Z54A 5IAAA 4EHIA 3HYRA 3GRFA 2IHVA 3PXGA 4J7XA 2ZE8A 4KLCA 4MHTA 2HQSA 3N7UA 2NU8A 1QHHB 7REQA 4K86A 4AJIA 3NRJA 3VDRA 5KNDD 5KTMA 2ET6A 4EYKA 1FVHA 3VPGA 4M7OA 4F4CA 3L6BA 4CDMA 5DTJA 1TGVA 4E5UA 4JB0A 4UHKA 2E37A 3RNOA 2HQOA 2XOEA 3E9ZA 1C3VA 2I76A 1VIDA 2IIBA 2OG1A 3HYSA 3RVBA 2TSYB 4NBLA 2OB1A 2X1HA 3HB9A 2Y93A 2I78A 3L6DA 3LQRA 1DJMA 2VSNA 1EUQA 2P65A 3NIFB 4E5SA 1J7JA 1OILA 1V5WA 2CYBA 2RH4A 2A0KA 4K1LA 1QR2A 1DS6A 1LV7A 1X86B 1A95A 1O96A 4YJ3A 4MI6A 2OWEA 5A0VA 1UM8A 2F8LA 3T35A 1ZLYA 3OE1A 5JCJD 2VHQA 3S81A 1ZMTA 3CF0A 3QOWA 4LKOA 4UTZA 2VHCA 5LU8A 2D1SA 4P33A 4ZICA 3O8QA 5L3QA 3NYQA 1BO6A 2REXB 4FFLA 1WUJS 3VNRA 3A37A 3OE7A 1XN4A 4Y1GA 4GKJB 2GD2A 2QTTA 1TJ3A 1IZZA 1FNDA 2Q3LA 2WU1A 4FMPA 2C5BA 4NFLA 4OLFA 4ZJYA 1TLTA 2B2CA 3IALA 2C5GA 1ND6A 4MRMA 3VSEA 2PFGA 1KQFA 2WJZB 2B6HA 4C0XA 5JV5A 1F2UA 1X0VA 1V7ZA 3EGCA 3TRDA 1YQQA 2RHRA 2YNMD 2WSSD 3B1XA 3K05A 5ALTA 2BUAA 2FPMA 3EN0A 3NM5A 4E5NA 1VG9B 3OZXA 1GSAA 2MINA 4U0KA 5GWXA 1SBHA 3E4DA 2P40A 2EHJA 2I6GA 3HKCB 5BR1A 1XDWA 3KDPA 3H2KA 1PDWA 2P6UA 3OURA 3VAYA 4BMOB 1M2HA 4I3FA 3H5NA 2AB0A 2AOUB 5DSTA 4C06A 4G97A 3G0HA 4TM8A 2YUTA 3MT0A 4LF8B 4I0WB 1Z34A 3O4RA 4MHSA 3O3MB 3TQCA 2NQ8A 1GAWA 1XMVA 5CW2A 5EOVA 4B0PA 1EJBA 3PIDA 3JWGA 1LPNA 3I5UA 2GETA 4KHZA 1Z13A 2E4UA 1ENOA 2WF9A 4J0JA 3T4UA 1RU3A 5A4MS 5JFTA 4MA4A 2A9OA 4M9ZA 4RFSB 3ZG6A 5CFOA 1N5RA 2WSBA 3IOBA 2CFIA 3K0KA 4JGBA 2QE7A 3COZA 1UEJA 1U8EA 4XZ3A 5CT5A 4G1BA 4A8PA 5FH9A 3P5BA 4QDUA 2ZUSA 3QFHA 4C88A 3W2GA 2EG9A 1XC7A 3T6KA 3LTNC 1NQTA 2D8AA 3I9OA 2VDPB 5BYJA 3ZNPA 4F84A 2N47A 1U65A 2HDWA 2YIJA 5KOHA 1RC8A 4OAPA 3CFYA 2QUIA 3ZE6A 3IXMA 4EJMA 1GGMA 5K8IA 3F6EX 2OC4A 3R74A 4ALJA 3DOHA 1XR3A 2B1RA 2PY6A 3AY3A 2IU3A 3GVIA 1BOOA 3LY9A 1XEXA 3KJXA 5EJ6A 1U0OC 4TYQA 3DB1A 2PWZA 3V9AA 3NIGB 3VNQA 3UMCA 3ZWDA 4JH0A 4CF7A 5JVDA 5IM4F 5L53A 4RTJA 1SKYB 2RGDA 3H5RA 2RAFA 3OCYA 3VPCA 1T2FA 5ABPA 3G2OA 1U0TA 1VG0B 4N7JA 4F8YA 5A6SB 2IPOA 2C4HA 2P9ZA 4MVYA 3V6LA 5K09A 5KYUB 1CUDA 5CA0B 1M10A 4U7FA 3N3BC 1G8AA 2XCLA 4HUTA 1J97A 3WB0A 4B43A 2KM1A 3KHKA 3B6MA 1XTUA 3PJDA 2VZ0A 4ROSA 3GDOA 2WAAA 4UBKA 5EXPA 1JIIA 1MAWA 1OTXA 1T5OA 1W52X 2Q62A 4IHJA 3V7UA 3GJ8A 2I8CA 1RKBA 2X8JB 1WABA 3DE0X 3N07A 4EH1A 4W99A 5NLLA 1NRIA 4TZTA 3G82C 1OXBB 3N6XA 1PQWA 1YNSA 1WUIS 1N3LA 1DZIA 5IJXA 1NUHA 3U26A 2XE8A 3MQ4A 3CVXA 4D6PA 3RLIA 4JBXA 1T9AA 1VSBA 1TYCA 1QGUA 2HIHA 2QMQA 2V8BA 3QPVA 1NTRA 4ZRNA 2NZJA 1E5QA 2DY1A 4CM8B 1NVEA 1NY5A 1V95A 3I9FA 3AIIA 4TYPA 1KDZA 2O6LA 5K7SA 3BT7A 4XIFA 3I4CA 3KOYA 1JNXX 1X1SA 4YCSA 9LDBA 1K6IA 2AN4A 2WMDA 4JENA 2EP5A 2PH3A 2PX4A 2XUIA 5H80A 4BQFA 5GIOE 5JZOA 3ESZA 3IHTA 4L57A 1UR5A 4EEKA 3LUDA 1JDSA 1OFIA 3IKVA 3VZSA 1YQGA 1RXCA 2YWCA 3BL8A 3G79A 5G0TA 5A6VA 1AX9A 1CB7A 1F48A 1Y1RA 3EMBA 3H42B 2Y1DA 3G9QA 3E3MA 3NEPX 5KNDA 1P0CA 1PGNA 2A9VA 1S8NA 3ETGA 3LGXA 4V0KA 4XUCA 3OECA 5AKLA 3ZDRA 4RORA 2J8ZA 1DX4A 3N2ZB 3P7MA 4BCDA 1RC1A 2P9GA 3H0CA 1C3LA 3GBPA 4K1XA 3UGJA 1W59A 2NZXA 2LUOA 1ZK4A 1J07A 1BE6A 1K8XB 3BE4A 4TKLA 5CCBA 4NQRA 2C7GA 4IUDS 2QRVB 1G6Q1 2HLPA 1I4EB 3DE2X 3WZ2A 4EB6B 3GBSA 2NZUG 1T9KA 2FW9A 3H4TA 3GNTA 3TLAA 1LPPA 3V1MA 3DMPA 3B3JA 4KODA 4CN8A 4X1OA 1EFKA 1Q0HA 2HJHA 3E9DA 3LZ6A 2WD7B 4RIFA 3N86A 2PRYA 1YB5A 2LNDA 5HBGA 2CDNA 2PD6A 2I67A 2RCYA 1VI6A 3PGLA 4Q02A 4QUBA 1OH7A 5IXYA 3RVQA 4RQTA 5JCJA 3MWGA 4JLJA 1QONA 4G41A 2DQKA 4KB5A 2FMFA 4D3YA 1YVPA 1Q0ZA 2GO7A 3IUMA 3NJ4A 3DUFA 5B1IA 1QDEA 1GXSB 1EK0A 1X15A 2PQ0A 3VOSA 4AQYB 2OP0A 4HX9A 2RKBA 3TEMA 4XJVA 1Q19A 2EV9A 2Q0QA 4TLEA 4US2R 3RIEA 3PQCA 3PC6A 4LF4B 1J8VA 1E6UA 2GK6A 1K5HA 1NVTA 1ULAA 3BA6A 1HDGO 3JQFC 3SDBA 4KYIB 4PLTA 3FSEA 4O4IB 4PG4A 2PIDA 3OFND 3S99A 1AE1A 3SS9X 2JK0A 3TRKA 4F85A 3TD9A 1SIWA 2XTNA 4GOLD 5KMGA 5MN5A 2EKZA 4NY1A 1RJ9B 1Y5RA 2Y0BA 3UNXA 3EJ6A 3IIMA 4V0SA 4YRLA 3HLKA 2GBLA 2WSSA 3F6RA 3HEBA 4EF6A 4KLZA 3VNBA 5KHLB 3M33A 2FH5B 4YRFA 3CV3A 2ZS9A 4X65B 3GEDA 2NYUA 4RIIA 2NUTB 3U7QB 3BXEA 4OLJA 3MCVA 1YDWA 2NU9A 3UT5B 4ALMA 3MGAA 4URUR 3U09A 4KE8A 1JP7A 2HA7A 2BBOA 2JVIA 1ESMA 3NVDA 4FGWA 3ROZA 4BQIA 4EJSB 3BCRA 3V80A 1CUZA 2H7VA 4P7BA 1ZW6A 3GPCA 2FDRA 1UFVA 1X8XA 1LF5A 2VJMB 3MTGA 4MAMA 1XRRA 1UJNA 3AB8A 4GT1A 1GILA 1J0DA 1EQUA 3EXEA 3FIUA 4DOMA 2JCSA 3BMCB 3COJA 4GI3A 4C3VA 1CHDA 3NJ8A 4B6EA 1RWQA 4IDGA 5FUXA 5HZHA 1SXIA 1UT8A 3DKPA 2AR7A 1VE3A 2IA5A 4NC9A 2AF3C 5UKDA 5BNZA 5A06A 1Q0TA 4CTMA 2CLFB 3T52A 3TX6A 1YIOA 5K3BA 1JMVA 1NNI1 3GRAA 3DZHA 4PIMA 4PYKA 1WEKA 4RJKA 5FBRB 4IRMA 4ZVRA 1Q3TA 4W1QA 3TUZC 2ZUCA 3CGWA 2UUAB 2Y9PB 1UXGA 3M34A 3TMKA 2FSVC 3ZXYA 4ZTUB 2L0XA 2AFIB 2P0AA 4FYHA 1L4NA 1PJRA 2A5YB 4YC7A 3QRWA 3UPDA 1M8FA 1Y3FE 4CF6A 5JYEA 3DUWA 3L18A 1KQ3A 1ODIA 3R7DA 3T7EA 3TLCA 3HXKA 2Y1WA 3QUQA 4X5OA 1RYEA 2PA0A 4QYTA 3X43A 4B7UA 2VNSA 1MHTA 2VAPA 4H6VA 2YQ5A 3KOOA 5CHEA 2FRDA 3EMDA 3IUSA 2IU6A 1L5YA 3COVA 4KVAA 3INNA 5KVQA 4DGQA 3ZY2A 2CLLB 3EXFB 5H02A 4D0LB 2QMYA 1ZJ5A 3QKIA 1V1MB 1T8TA 1NXVA 4OP2A 2I62A 2PXAA 4CM5A 1V9CA 1UJCA 1RRVA 1GPLA 2YJ6A 1DL5A 1ZOIA 3LWNA 1OXKB 4MKHA 3ZZ1A 1MJHA 5CDUA 4RQBA 4WGFA 3A9UA 2DEUA 4HNRA 1G8GA 1V3VA 1LKZA 3K1JA 1W9HA 2P9CA 2FEMA 4A8JA 4AZVA 4BLUA 3CSSA 3PPIA 4DV4B 1XVLA 3BB3A 3IO5A 4YP0A 2VHXA 4F12A 2W6IA 1Q3KA 3S2UA 3A4TA 1GADO 5JMTA 3HEMA 1V35A 4L22A 1F3LA 3AYXB 3JAWB 1AGRA 1D09A 3ZCQA 5F23A 1U8XX 5D6OA 1E4EB 1DMSA 4Q12A 3MTIA 2H31A 3SX0A 3V33A 4JLNA 4OYHA 4UUPA 5AW5A 3T7DA 2EATA 4LXHA 4BJ5A 1JLLB 5JFOA 5ALJA 3PTAA 2AC4A 2ISQA 1C4KA 3I9LA 3P4YA 3ZVRA 3GQBA 1T8SA 3DZFA 1WBJB 4TRNA 3L8YA 4R7TA 2HJ9A 3EY4A 4NBKA 2W2QA 1U7PA 3DE4X 2I9PA 4BNDA 3OIFA 1CB0A 4WADA 3VR5H 5BNWA 5CIYA 1EXNA 2NO6A 4K26A 4D56A 1JJAA 1TOAA 3HP7A 4M55A 1IUPA 3Q6IA 4DUPA 2RE8A 4E3ZA 3AUFA 4JN6B 3OOEA 3P27A 2EX1A 2W2KB 1QP8A 4QAJA 4QECA 3LC1O 3NC1C 4DUGD 3U3MA 3AUKA 4ML3A 2IYNA 3O0DA 5ADUS 4BVJA 4FFBB 4G37A 3ZWKA 3ZYZA 1RKVA 2A3NA 1H5NA 4F8JA 3Q7TA 2QX7A 1LK5A 4PZCA 4GVLA 4HAZA 5F98A 2UUOA 2B4AA 2D6FA 5EXDA 1PR3A 2GRUA 1TQ6A 1EE1A 3I6BA 3I04M 4GR5A 1OC4A 1V41E 2VJAA 1R8QA 3L1JA 4NABA 5K0NA 1ZRMA 2EBWA 2OOSA 4H0FA 3U6BA 1HORA 5DV9A 2X77A 1HOTA 2XD4A 3BMNA 4BDSA 4PZEA 1DO0A 2IU4A 1E1LA 1UKBA 4CIDA 1PNOA 4H16A 1QWSA 1M8KA 3AVPA 1L5SA 3FYUA 3NONA 4MH0R 4O2AB 4B8WA 3JASA 1RJDA 3CY6A 2RKWA 5JI2E 3MXTA 1N5KA 2PH7A 5FEMA 3U3XA 5A9SB 2OZPA 1X14A 4N9WA 4ZU1X 3TUJC 3Q3JB 1VRWA 2DLDA 4H0CA 4YLEA 4FXPA 5J43A 1AKYA 3IP3A 3L9WA 4BO2A 4BAUA 4EFMA 4XQ9A 1JHZA 4K9PA 3I1IA 4LSGA 2Q6KA 3MWJA 5F1YA 5KYYA 2BTEA 2G1PA 2DPLA 2QQGA 4YY3B 4HZGA 4KOEC 2RHJA 5DM2A 3TTTA 2PWBA 3FXAA 3FOFC 3KZ1E 3OFNA 3OPNA 3UAOA 1AURA 1ETHA 1O7JA 1QPZA 4YA6A 3UUWA 4R5MA 2ECFA 2CXOA 1UDAA 2WU3A 3ZYCA 5C34B 3I12A 4UCQA 5AVWA 2FX3A 1KK3A 2FK7A 4OHWA 3D6VA 3GBVA 1L0BA 1LBSA 1M2JA 1I2CA 1NQOA 3OKAA 3RM3A 4NFYA 3RRMA 4G9GA 1PR6A 4DN6A 1KO7A 2RGNA 4ZDIA 1S3GA 1YQEA 4QUDA 2H2DA 1X70A 2HBQA 2PLNA 3ESAA 3KUXA 2O7QA 1DC5A 3HYNA 1AMOA 1CVLA 2OHJA 2HJRA 4CM7A 2PLAA 1OCEA 4MO9A 4JBIA 3M0EA 1E9CA 1OLOA 2Y6UA 2IELA 2ILTA 2RHDA 2QIOA 1XRNA 1ZD8A 3OM1A 4DILA 1NN0A 2QI9F 1PWZA 3CW2A 4MKXA 4P36A 1JEYB 1E7WA 1W30A 2C04A 4LI0A 5BWNA 3WK5A 4OBEA 1A69A 4M36A 2JGEA 4ZHSA 5TPZD 2GN1A 2J9ZB 4OHPA 2DHDA 4BLOA 5ADHA 3OQ6A 4V0RA 5DRYA 1U4OA 3ICWA 3A28A 4ZHQA 5I6DA 4MZDA 1EK6A 2IPNA 2V6JA 2FSUA 3LC2O 1EKXA 2H0RA 3QKSA 2OXCA 4M6WB 4J0CA 2ZOSA 1UJ5A 1HYHA 3V1LA 2ZTVA 3BXHA 1KC1A 2ZJ5A 2DC1A 3SOPA 1W34A 3ZDYB 2HL6A 3FDJA 4FZRA 3EOZA 5FA8A 3P9SA 1SK8A 4P38A 4EFNA 2OXRA 1L5OA 5JQGB 3B8HA 1LJLA 2XUDA 3HBAA 3FPJA 3PQ3A 4PC6A 4PRZA 2WIDA 1I9CA 2X76A 1NHWA 4YWJA 1E9VA 4CM6A 1JYFA 1RJGA 5K4HA 3PJRA 3ZCRA 2AG0A 3QWAA 2FRXA 5DH9A 4L74A 3WJ1A 4ENRA 3SNHA 5CEJA 4YCLA 4V0ME 2P9BA 5A3SA 2BLNA 1IAQA 2VF7A 2IT1A 2WDZA 4OUKX 4M9UA 2A5DA 2IGTA 1O95A 3I1YA 3O95A 4UBLA 1DIHA 2ZBPA 4R9RA 1FMTA 3GEHA 4PSVA 4RVDA 2FPSA 1TCAA 5HM6A 5A0TA 1QZZA 2OC9A 4XUDA 3F6CA 4N6NA 3WGKA 4BYGA 3AF2A 1KYWA 5C52B 1D6JA 1FDUA 4G0OA 4JD5A 1RWVA 4ND4A 3RF6A 1SIBE 1JHUA 1TW3A 1G5TA 4RIEA 1Z7YA 4FOLA 4OK5A 4AMZA 1MX1A 5ALXA 2B8EA 3PTZA 4PGAA 3VGJA 1ZI9A 3O1HB 5BOSB 4EYEA 3RC3A 4MQFB 1NBMD 1HYQA 4IDBA 1E9EA 4OJYA 3WIEA 4WLFA 2EERA 5COBA 2CE2X 4HV4A 1G66A 1GUAA 2O0MA 4MV3A 1N5IA 2XMGA 2F9LA 1G291 3MJDA 1BCSA 4YHBA 2HW8A 4V1CA 2NP7A 2PX0A 3P2KA 3WWYA 1AGXA 2VVTA 3LZCA 2XDWA 4RQAA 2R1TB 3V32A 4RJTA 4D4LA 5ITWA 3LUFA 5BSEA 3VI4B 2IIVA 5L7YA 5BUZA 3ZJYA 1N9KA 3QW4B 4PR0A 2WKSA 1K97A 1IHXA 2GN8A 3CTPA 4BVBA 4GZ6A 4KDFA 4ZDJA 1FUIA 1WKBA 4G09A 4L6IA 2PQ2A 2GYVA 3HU5A 1P60A 1QS0B 4OX9B 4Q7EA 1P45A 1TIKA 3DXYA 4RH0A 3G68A 4DUGA 3SOZA 1QH1B 2MIIA 1QK5A 1VLQA 3JYQA 1FFHA 4QYSA 4F2GA 2V8OA 4A6PA 4MV4A 3TMAA 5TQJA 2X42A 2EP7A 5F12A 2QI9C 2ZT6A 3UK2A 1G60A 1SUSA 1HE4A 1NTOA 1SCUA 4H1VA 4OCZA 2CMGA 4OXXA 4JYZA 2CB0A 1JUDA 1WZEA 4JJAA 2XHZA 4TQAA 4U7GA 5JAIA 4FBLA 3ZIAD 3WHKA 3ONWA 2GHIA 3PXCX 4FHFA 1BRTA 4W82A 2QG4A 4JVSB 5HKLA 3ZWVA 5HUQA 3HB5X 3AEUB 3T5PA 3JZDA 3ZY6A 2PKXA 1EJ6A 1M1XB 1P7VA 3P0EA 2QM3A 2ZR8A 1S3SA 5GVRA 4ALKA 1QIEA 1ZP6A 4B4OA 4OFWA 3EZNA 3IP6A 3ZHVA 3S68A 1T29A 4L8LA 4UQOA 5ALWA 5FV4A 1I3LA 3GG9A 2QTWB 4EUKA 3DL0A 4Z1OA 4OXIA 4K87A 3QXSA 1RFLA 4NMWA 1Q0SA 1QRSA 5CU7A 1RE0A 4V0MA 4S1TA 4F5YA 3KOUA 4RFLA 5FBVB 2EBHX 1BTOA 3VTKA 1BFKA 2HNBA 2B35A 4FQ5A 3RSGA 3ED1A 4YB8A 3NBZC 1FNBA 1S5PA 1R27A 1I0ZA 1XVVA 2XMQA 1BA2A 3OTHA 2JW5A 1X3LA 2Y4OA 3Q8XB 3QMPA 3K5IA 1R9GA 1C7FA 1J23A 3LAWA 1NF8A 4MWEA 2QM0A 5C8XA 3MWFA 2GXSA 1L6IA 1W4ZA 3HXMA 1UBCA 3H6HA 5TMDA 1B8OA 3W04A 1V3TA 2GJ4A 1PJ2A 1WDTA 1TVCA 2EW1A 5EYPA 4RJLA 3OFSA 1M66A 4G0PA 1UZLA 1YU6A 3WI7A 1TU0A 2UZ1B 4PICA 2VBFA 2BFOA 2BKAA 2NN3C 2ZVPX 1W85B 3BTVA 4PIPA 4U7PB 5IYZA 1P61B 2E4VA 2QE6A 3ZOKA 4UC0A 2QSJA 4XGIA 1EGQA 3ZWXA 2XZPA 4OBBA 1BCRA 5TPZA 1ZU5A 1ZSYA 3JALB 1XPOA 4OV6B 1P1JA 4RPGA 1FZTA 2HA6A 1ONBA 2XDQB 2BIFA 3F2IA 3P9XA 1JPJA 1NVMB 1N6HA 2I7CA 4GMKA 4F1JA 1EXVA 1HTWA 5LYJF 4I5FA 4IG4A 3GP8A 5AVYA 4B45A 2PEZA 3DEZA 2B21A 3WZLA 3T1YB 4UBMA 4NATA 4YJ2B 4D45A 1GZHB 1UK7A 3VGPA 5TS3A 3TVTA 1QZ3A 3CT6A 4O08A 3SJAA 2UYOA 3GJ7A 2ERYA 3REFA 1KQOA 1DSSG 2G28A 2V7TA 1TB4A 2ODQA 4N65A 4NHOA 2O7SA 4YRQA 3VRHA 3ED5A 3IERA 4ABYA 3NWOA 3MTAA 4ER3A 3IGFA 1KI2A 3EDOA 3JQPA 4E21A 1P2BA 2OXEA 5L3SA 2XGSA 4HFMA 2CE7A 2JGJA 2BEUB 1K6JA 4XJSA 3UC9A 1SNYA 4F93B 2COUA 4M0EA 3H2ZA 1D2CA 2QORA 4UXHA 3T06B 1JYSA 5LFAA 1VLJA 1XAGA 1ZD9A 5KOHB 2DBQA 2CHVA 3CVJA 3TFWA 2JI8A 4INJA 2E9SA 3MJVA 3QNWA 1XJ5A 2GFHA 1BSVA 4OKNA 5KBYA 1XDUA 3A6JA 3MGGA 2BWJA 4KO3S 3ZWBA 2HUNA 5MFPA 1QLHA 3T9CA 4ZQHA 1IM8A 1JIKA 2DHQA 3CS3A 5JFGA 5J1SB 4DM3A 4MUAA 1XAIA 1EWVA 1OX6A 4D4MA 4DQ0A 4HNQA 4ZDKA 1KYXA 2YY7A 3ZD8A 5B57C 4HHEA 4JX8A 3RVMA 4H4EA 2XTZA 4G25A 3WHPA 1AHPA 2F4NA 2P8JA 2VYVD 2FJ0A 3DLAA 2C94A 4IEFB 5FYQA 4YPOA 1N0UA 1B73A 1NBMA 1ZXBA 2HMSA 3L7KA 2GYYA 4G5XA 2W6ZA 1L5RA 4QA9A 4Y9SA 5F78A 4D9IA 3KJEA 3H1PA 2G88A 2XUZA 3QVLA 4OYYA 4PS0A 3VVBA 3QY0A 3DAOA 4TROA 4XM0A 5KHOC 2RHOA 1WUHS 4GZLA 3RROA 4FYVA 1ZGCA 4Q9KA 4C76A 3DKKA 2VRCD 3TW8A 5E6RB 3HXOA 5EEHA 4ND7A 4Q9LA 4ARZB 1MZVA 2GDZA 3AR4A 4HS4A 1KBZA 1PWYE 1UXOA 2G9QA 5ALUA 4ZVKA 2PKCA 4R2IA 3JQAD 2QU7A 1F14A 3DOUA 1AQYA 1OSNA 2Q3BA 3F0TA 5AR1A 2CVFA 4RL6A 3ONEA 5AXBA 3T1TA 5DPMA 4QJ4A 3VJMA 3L8FA 3ZKAA 3EUFA 1TMGE 1XL1A 5A4IS 1S2GA 2RMKA 4WX2B 2OBYA 3H17A 1D2RA 5CXXA 2I33A 1FDTA 2VDNB 3R77A 3UHAA 4EA9A 2ZYDA 1GTRA 5LZ5A 4HRYA 1N1EA 2YJ4A 2VYFA 5GM2A 5HXAA 1NMSA 1TMOA 3AW9A 5EE0A 3LOPA 4F72A 3L77A 4WBSA 1FYVA 2AUNA 2AT1A 2M6SA 2CDRA 2QZ4A 2ZI9A 3A6EA 3FUVA 3R9KA 1GKIA 1NLZA 4WA8A 4YCDA 1JKJB 3UXHA 1G59A 2KJQA 5K0EA 1F8YA 5CX1A 1U7OA 5T3YA 3BJEA 3E05A 4NAUA 3VKUA 3DNPA 1FSZA 2EXXA 4TL6A 1WB5A 2AWOA 2VSOA 2W0SA 4JDPA 3RFCA 4TS9A 3ZWQA 4HR7A 4XPIB 4DLBA 4E46A 3HP4A 4FNOA 2YHAA 2FZ5A 1Z15A 5B3AA 3UIEA 4KWHA 3N8DA 4MW7A 4KFUA 1ZWKA 3F4BA 1OBFO 1UJBA 5FOSA 4CTKA 1G9XA 5LD2C 1JHPA 3TIFA 2C1EA 3HCOA 1ORWA 4NCIA 1PNTA 5IAJA 3IAAA 1QO0A 1TO2E 2ES4A 3QELB 3NNSA 1A0OA 1KEUA 4MITA 4WN3A 4Z99A 4B34A 4IIHA 4LZWA 2PHZA 4ZMSA 2C4VA 1KAMA 3R0IA 4DA7A 1ZK2A 3GZ4A 4N40A 4WMLA 1P5FA 3ZIUA 4PZZA 3F1KA 3FFXA 3C8HA 4KAAA 1QIIA 3B1WA 3LHDA 5THQA 3V1NA 2GJAA 1GPH1 3A6KA 4GLOA 3HKBA 1IN1A 4DG5A 1SQGA 3ECAA 2CJFA 3LNCA 3IVRA 1Y34E 2C59A 4RPKA 1ODKA 1GZ3A 2Z09A 3PX3A 3N39C 4KR0A 1XPUA 3HVJA 1NZJA 2QRNA 2GZ1A 3V3KA 1D2GA 1PL0A 4K0RA 1D1QA 4G5YA 5KX5B 4S1VA 4MGHA 3C6ZA 4M0PA 1VI5A 2EF1A 2GSDA 2NLOA 3RUCA 3OQIB 1WU7A 4WJZA 3CUYA 4CQLB 2BONA 2QGZA 4M3NA 3EXHC 3JQDA 4J43A 3KELA 3OZDA 2BI4A 2R8OA 1I5RA 2VJQA 5F9HA 4OHXA 2OUKA 3OPVA 3O8BA 4TVSA 4KK4A 1KMIY 1PFVA 4WFQA 2I91A 1MRSA 2I2AA 1BQ3A 2V4MA 1IIRA 3BSFA 1T0PA 4G9BA 5B3LA 2OGZA 2OHOA 2A58A 4W63A 3TM5A 3VMMA 5LIPA 5JTTA 1ZISA 3L4BA 1IU9A 3D59A 4P58A 4PM4A 3FVQA 2QIPA 3GRCA 1KR2A 4II7A 2QR5A 1QWOA 1B6SA 3F4KA 2X40A 5EJGA 3RHZA 4C3OB 2LR0A 4QDZA 3NPMA 4DQDA 2Q1TA 2YWHA 4YLYA 2QQEA 3GRYA 3H97A 5ALGA 1O3YA 3GC6A 1CY7A 2OXFA 1EFDN 4HZIA 3BKWA 4LMAA 3SYTA 3A0RB 2E21A 2P2ZA 5LSAA 1OWNA 2QAGC 3PQ8A 5L95A 2QN1A 5P8WA 5IMSA 4CV0A 3WTCA 1TT7A 5KNBH 3D5TA 3GLUA 1F0KA 1O89A 3SU8A 3TLYA 3Q8LA 1KU0A 2QSUA 4G36A 3L05A 4NDNE 3KSAC 1E94E 1AM4D 2QN2A 1ZK0A 4GSLA 4I1SA 1DOHA 4EGSA 4TRJA 2BMAA 4MPRA 5KTNA 4J0FA 5ESWA 4MIOA 2CLDX 1BW9A 1GNLA 4PE5B 3GNLA 3OHPA 3SVZA 4CQMB 3JQ7B 1JIQA 4DLVA 2MOKA 2Y9MB 1XA0A 4Q9HA 1N2CB 3PB3A 4DADA 1FBNA 1MJ5A 1LRLA 3AJEA 1ZINA 2YV2A 1PUXA 3L06A 3U0BA 1PZGA 3ICQB 2RGGA 3E53A 1TKAA 3FVVA 2VYVA 3EW7A 3ZLTA 1YIAA 5CFPA 5T41A 2A7XA 5K6RA 1IDN1 5T4EA 4ILEA 1IAVA 3W90A 2OHFA 3R6LA 2PSHA 2YY6A 4IJVA 1XQ6A 3CEJA 2QTVB 1I32A 4NMHA 1CQWA 3C45A 1ZVJA 2BEKA 2VL7A 2QGFA 5BNIA 3P9ZA 1RE1A 2EJCA 3HMKA 2PAAA 5F5LA 2VRCA 5HRCA 2DQ4A 2Q4OA 3FCAA 3UVEA 1VA5A 2JIDA 3A36A 1UMDB 4NAVA 6CHYA 1H2BA 4CETA 1MD9A 1ZUHA 1PD1A 3LCCA 3ZD7A 4Z4IA 1BMDA 4HVCA 2C00A 3DV0A 3EWIA 4FFMA 4M1KA 4N0DA 5EIBD 1ZN9A 4ZO8A 1FC0A 2WYOA 1E99A 1C0LA 2DBRA 3AQ4A 5CUQA 5LYYA 2P79A 5F7ZA 5J5AA 2Q2OA 2HU2A 4LCJA 4U9UA 3DV9A 4DE5A 2OAP1 4DLRA 4UM7A 3U16A 3ILHA 2EFDB 5TMPA 4DV1B 2I66A 1MA3A 1YRWA 3HDVA 4F5ZA 1KP2A 5HSGA 4WKCA 1QIDA 5KTSA 3VNUA 4LF9B 2CSUA 3G0CA 5JMOA 1W0JD 3MLBA 4NCAA 3RC2A 1I3KA 3U80A 1IY9A 2DRIA 3MTBA 4TT3D 3KT3A 4R16A 1Q1BA 3UOWA 2PUFA 4GDFA 1ZBQA 2PKYX 3HKDA 1UBOS 4UBIA 3RU7A 1VMAA 5CH5A 5HQJA 1VKZA 4G4GA 2A5GA 4KNVA 2BP7A 1C7JA 4ZYZA 5F77A 2O5RA 3SBDA 2BGMA 4WLVA 3AL2A 4MIKA 5CVUA 3S3TA 3SHQA 1IYZA 2XWJI 3EZ7A 3KQTA 4IKEA 3FZQA 1U0JA 1FDSA 2CUTA 4OGLA 2HV9A 4GPEA 2H07A 5JPDA 2XLCA 4B80A 1ZHHA 2RI1A 4PCUA 3RG8A 4FONA 4FQ8A 1RTKA 1S8OA 4CIVA 6PFKA 2NACA 4H27A 3UUFA 5E9WA 1DAOA 1MT0A 2DZDA 1MB0A 2OO5A 2QRGA 2FZCA 3FN4A 3GY0A 3PGXA 4MKGA 1VP9A 3PUZA 4OSPA 1M76A 3IOMA 2VNAA 1UMCB 2V7PA 5G2OA 4MB2A 4X1YB 1M34E 4OOEA 3K6JA 4QX6A 4KE6A 3SI7A 3U3DA 5LP6F 4W5QA 2D2VA 5DNDA 2IEGA 3CLUC 5E6SA 4D3ZA 3C3PA 3FWHA 2W6QA 1KVTA 3D8BA 4M53A 5E6UB 1FFXB 4HRVA 3T0GA 4CPDA 4YDQA 4RZ3A 5L51A 1MH1A 4TMZA 2Z57A 4GS5A 3DB2A 2LW7A 3V42A 3O4HA 4KLRA 3NHUA 2JBHA 4RKQA 3TOZA 1ES9A 1XD2A 1KFJB 4ZU6X 1IVSA 2WJIA 2DR3A 3SZMA 5LBIA 3GEPA 4C7XA 4KGVA 2BMWA 3CLSC 1NLUA 5JXJA 2HO5A 3E7PA 1Z47A 4ZCLA 1V5IA 3VNSA 1ICIA 4FHDA 1QTNA 1ZL0A 4U2EA 1M7BA 3WLNA 1CUHA 3EPPA 5DE3A 4MPTA 1HLGA 4WESB 4ZC1A 4WGGA 2IU0A 4RAQA 3WP1B 2W4MA 5C32A 2ATXA 3HVHA 4YRCA 4KQGA 2C77A 3KJNA 4MLPA 3UMGA 1NT4A 2G1KA 3F5DA 2ZWMA 3VH4A 1MXFA 2ZJYA 5KO2A 5IDYA 1IG0A 4WCFB 2DHEA 3KFLA 5JO9A 2VNJA 2ECPA 3QXXA 1L4UA 3GMSA 5G53C 4D82A 3FETA 2XNCA 4IJ6A 3SG0A 4YTEA 1S2MA 4UZFA 4R1NA 3KR9A 1PQYA 4BMZA 2Q1SA 4KVZA 2AJDA 2I3GA 2JJ2D 1JJVA 4RTLA 5ELXA 2AG1A 4KKXB 1Y98A 2D1RA 2DP4E 1JSLA 2IV7A 3S2YA 4JJKA 2Q3DA 4R7GA 1GD1O 2GHRA 2XHEA 2ZSIA 3COPA 1SXJE 3MYYA 3QLJA 4BLVA 1BAPA 3V3TA 2PTHA 2I6TA 1H5QA 1EE9A 3O2JA 4EHDA 5AW0A 1V8DA 1AXGA 4PU0A 4ONEA 1HRKA 1GA6A 2YHIB 3QLEA 2Q6LA 4A23A 1VP3A 1KNXA 4XGQA 4DLKA 1QIHA 1EDDA 4MV7A 5ADWA 1YZ3A 2HIAA 4ZO7A 2M2IA 1X7HA 5F1OA 2YINC 3KB6A 1TADA 2ISSD 2WSLA 1I24A 4MQ6A 3WC4A 2EARA 2O3QA 4PLVA 3SDZA 5ER6A 3NBKA 4AX4A 2ZRBA 1MG0A 2BV3A 3OCXA 3OF2A 3O38A 3V9PA 5MF6A 1NI4B 2H2AA 4XCXA 1C4WA 1EFLA 1K7CA 1NXOA 1Z39A 2X5OA 3H86A 3MD9A 5G3ZA 4NR0A 4CL0A 2OBMA 1N77A 2CUKA 2AFHE 2QK4A 1U98A 4AZ3A 3EGVA 4DYVA 1Z4KA 3HR8A 3IOYA 1UWLA 3O8NA 4B33A 3OPMA 5C1BA 3SQOA 1APBA 4NBNA 4LCBA 1UL1X 3OA2A 1PNQA 2A3RA 3PC8C 5A3VA 1YUBA 4I2NA 4J9UE 4GC5A 1G16A 3DONA 3QLUC 1QOPB 4Q93A 5EQTA 2LBPA 5LP6C 1WTCA 2GZRA 2QW8A 1TNDA 2OFPA 1RRFA 4HNHA 4V39A 3FHTA 1V96A 1DLJA 4I5DA 3FYTA 4JR1A 1SH7A 1LFDB 3KAKA 3RASA 3E70C 3PGVA 2ZJ0A 5LCXA 4HAIA 2A57A 2FN4A 2R4TA 4U6SA 3E5HA 3WYCA 4BWYA 1KMQA 1AO0A 4YJGB 5AICA 3ONDA 1PR5A 2W8ZA 4YV2A 4Z5XA 1C4OA 3F5SA 4JS0A 3R1IA 3CUTA 4YQYA 4DMLA 3HNRA 2PMBA 3N6VA 5DNWA 1UBJS 3KQPA 1V5EA 3HA3A 2ATVA 1YBVA 1THGA 1E0SA 3QVSA 1ZNXA 2UYYA 2BTQB 4KXYA 1P81A 1Q12A 2H4FA 2PVCA 3MINB 3QU9A 1H1LB 3IXLA 3PDHA 4R2XA 5DN6D 5J1TB 1G41A 1TT5A 4A8HA 1W0JA 2RGYA 4DEXA 5GJWC 5CT9A 1DCFA 1P4SA 2W37A 4HDSA 4TT3A 3SXUA 3T1VA 5JDIA 5KTPA 4ASUD 1I2AA 1SC3A 4OK3A 4H9GA 4CR8A 3RFTA 1Z16A 1I1NA 2FFJA 3GLIE 2QD5A 1Y6QA 1VMDA 2G83A 2JJ1A 1YVUA 1Z5NA 2LV8A 2X3YA 3LVRE 1Q0LA 1A8HA 1YULA 4GICA 3TQSA 4BU0A 4CG1A 4EKGA 5DJ5A 2O8FB 2HRQA 4IFTA 3KQYA 4Y6RA 5EINA 1A9RA 2AN5A 2HZBA 3GFPA 5CBPA 4YNBA 1H94A 1Y8AA 4GBMA 4RKEA 3FNIA 2F62A 4HYEA 2NUAA 1SXJA 4B5LA 1JIJA 2B9VA 2VJCA 3CJTA 4CHTA 3LVFO 4NVRA 1G5HA 2EJVA 2V4UA 2Y1FA 4OI1A 3EXHB 3KUCA 1II0A 2G70A 3E5NA 5HA5A 4AM8A 1U02A 2AXNA 3HI6A 4RWEA 2X6RA 1XMOB 4DRXB 1OXMA 2CJYA 4I2VA 3M81A 3QNUA 3HV2A 1ESDA 1HNNA 1PJ8A 2PV0A 2EYUA 1Y48E 3STWA 4NNPA 2P2SA 3HO6A 4CEJB 3RC8A 4C29A 1V7QA 2IYYA 1C0EA 5CA1B 3G6WA 3OCZA 4I8XA 3KZNA 1Z4NA 2WFAA 2B83A 1TQ2A 4EGJA 4C2UA 2WUFA 3U4QB 3ICCA 2XVXA 2VKQA 1TYZA 1PN3A 3OT1A 3Q5EA 5EWLA 3HDYA 4LVOA 3PFIA 3R20A 2PFSA 4IR7A 5PNTA 3KVOA 2HMWA 3AZQA 1CKEA 3EBOA 4N41A 2QAGB 4MYUA 1ZUIA 4WKPA 4F7DA 3OFJA 1RZRD 1Z26A 2ACWA 2Z56A 4RA9A 1KTVA 1RYFA 1P9WA 1RXYA 1JT2A 4KWIA 1VB3A 2H2HA 2CZQA 1XTPA 2JFNA 3ETNA 3SZRA 4KXLA 4HNAB 5K0CA 1IZ0A 4AP6A 2EHDA 2HA4A 4G23A 4B17A 1EFVB 3BE5A 3FPGA 4R40A 3CX3A 3OBIA 3K53A 4ZYUA 1DAEA 2HOQA 1YAHA 1D04A 1RWWA 3DOEA 1E3JA 2JJ2A 1T6YA 3CISA 3ABZA 4KGDA 3VPAA 4A82A 4F9GA 2I1LA 1D5CA 1NMYA 2PNJA 5CFMA 2CV0A 3B2EA 1U3UA 4HFJA 3S44A 5BUCA 4DR3B 4O63O 3RG2A 1R37A 4EG8A 4G0WA 2GBGA 1E3TA 1FX0A 3H4VA 4K6KA 2P77A 4WBNA 3F5QA 2ZPTX 1BHO1 3PK0A 3W8RA 4WI1A 1F4LA 3DW3X 4MS1A 3KQUA 2EFHB 1G6HA 1U5BB 2F43A 1SVSA 3EF0A 3PENA 3TD6A 1PLJA 2BSXA 3KBOA 2VPIA 4Q1DA 1Z62A 4NXMB 1G8FA 2VH5R 3BDAA 1P4RA 1Z0AA 1SQ5A 1W44A 5EMLA 1MRNA 1RAAA 5DWVA 4CE6A 3HSSA 3KHTA 1S8FA 2GHQA 2VXOA 1QE0A 4BWVA 4B74A 1Z2DA 2GZ3A 2RG1A 1FUUA 1XDGA 1UXKA 1NLMA 3AJRA 4NZNA 1XZFA 1JAIA 2F00A 1WG8A 2H92A 2JEYA 2O0KA 4MV6A 3ZBQA 4B47A 3GEEA 2VF4X 2QLMA 4B76A 3GRZA 5HFJA 2YXLA 2PO5A 3OOHA 4Q1BA 3R7LA 1SVKA 2OORA 3BWBA 3Q2OA 4BB6A 3PYXA 5KOIA 1IRXA 2C9YA 2G1UA 2YVKA 3SZ3A 4IH4A 2JRCA 1QKJA 1DCKA 3GAMA 4FW8A 3ZEIA 4YAUA 2BCGY 5L9AA 2C0CA 3I37X 2XE7A 4HSGA 3ZWMA 5KYKA 1ECGA 1CF2O 3BREA 5TMBA 2J5XA 1UP7A 4C0LA 2QXTA 2Q2VA 2W48A 2QRKA 1ZO8A 4KQJA 2WDPA 1EUDB 4I19A 4L4SA 2QRUA 2YVAA 5ALOA 3M9LA 3VH2A 4EW6A 1YK1A 2J5RA 3AOEC 1LBQA 2YBEA 1CFZA 3Q88A 2PUBA 3MS7A 5FA6A 2AQKA 1XO1A 2OT3B 1UODA 2PMFA 3IAHA 4M46A 3YASA 2DTDA 4ZI5A 3TI9A 1WBBA 2B4KA 3OX1A 3DVQX 2VZLA 4P1ZA 5AI0A 1B0ZA 3RARA 3NYRA 1CQIB 4PLYA 3R7AA 3SC4A 2CMHA 3H65A 1GR0A 4TLBA 2G67A 1RAHA 3C6YA 5DB4A 2BFWA 3UUEA 2HC9A 1DHRA 3D3EA 5GM1A 5AI8A 3WIVA 1DC3A 2CJPA 2J0UA 5EQDA 2FSFA 4Q01A 4KREA 1UZAA 1TK2A 1Z0SA 2RGCA 5U4QA 3S2FA 4BMNA 5HVNA 3GFOA 5IZCA 3MBOA 2CF5A 1DXYA 2ODEA 4BATA 1HLDA 2RI6A 1WXWA 1Z8HA 1TZCA 5CNMA 5I8WA 1THMA 3I6ZA 4D41A 2BSQA 1SK9A 1D1SA 1JDVA 3NG1A 1U2DC 1DKOA 4FYIA 3ZE0B 2YL2A 1H8ED 1HRDA 2UZ3A 1YRQA 1YJQA 1L1EA 3NTOA 3GMDA 2V3CC 1XMJA 1L4GA 3VDXA 3TLZA 4C4ZA 1NR7A 1EZZA 4CBVA 2E4XA 3GRRA 3ND5A 3LDGA 1EFTA 1GOTA 1A96A 2V7BA 4QXQA 3RS8A 4BO0A 5KC8A 1N3IA 5LUAA 3CCFA 1S2LA 2HGZA 5HF8A 1KI3A 1SM4A 3L1UA 4NG4A 1RQPA 5IABA 4ZARA 3NR2A 1QVRA 2DFPA 3FBTA 4E15A 1Z7GA 1II9A 1ZCBA 3VR4H 2YWDA 4RUKA 1U5CA 2XDAA 2IHJA 1FOEB 4Q1FA 1PW7A 1JDBC 2Q1UA 4UARA 5F76A 4I50F 2O2HA 2DWCA 3TL6A 1DIAA 3FCSB 4BGEA 5H8WA 5I7UA 4KFSA 1M2FA 1N2ZA 1N6IA 3K8YA 4XCVA 4AKSA 5LWQA 3D7KA 2HA5A 2FVYA 2ZE6A 5ES3A 2IZZA 2V9ZA 5EESA 2I4NA 1XK6A 4O4JF 2Q1XA 4ETWA 1DHTA 1QRRA 4EKDA 4BQPA 3Q3VA 4I9FA 4YCCA 5HTOA 3DDNA 1QAMA 5F64A 3N75A