5L4NA

Leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
253
Chain Sequence
b'TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTVKVDGGYSLTRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Chroman-4-One Derivatives Targeting Pteridine Reductase 1 and Showing Anti-Parasitic Activity.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 95
structure length 253
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l4nA00
3GH3A 4O63O 4N5NA 1K6XA 1VSVA 4O0LA 2DC1A 1R12A 3TDKA 1A71A 3ZHYA 4A27A 2W2LA 4RPHA 2F00A 1RM3A 1ZK3A 3GFGA 3B1KA 4ILKA 2PY6A 3MOGA 1KBZA 1DHRA 1PEDA 2VNSA 3WGOA 3KETA 3WLFA 3ZW9A 2AE2A 2QG4A 1OC2A 1XYGA 1I8TA 2CDAA 5IDQA 4KQXA 4OL9A 5JAZA 3F4LA 4J7CA 1BXZA 2NU9A 4QX6A 4Y67A 3PJEA 2HRZA 1Y8QA 2YHUA 5U4QA 3H2ZA 1FDSA 1SNYA 3BTVA 1QYWA 3GMSA 4MP8A 1LEHA 3RFXA 4ND5A 1HETA 2GZ3A 1PQWA 5A9SA 2PKRA 2PV7A 4OQYA 4UREA 6ADHA 1B16A 3PFFA 1ML3A 1DC5A 2VWQA 1YH3A 4PFJA 4IDFA 2O4CA 3ZWYA 4ZQHA 4RVUA 1TEHA 4IY1A 4DBZA 3GPIA 3I9OA 3M6IA 5BT9A 2B4RO 3TL2A 2WD7B 3G3EA 3HFGA 2Z95A 4IQ0A 4RZIA 3MJTA 5C3MA 1JN0A 5JMWA 4PG4A 1NR7A 3KXDA 4U6QA 3K31A 4RPKA 3WGZA 3GRKA 5JDIA 2FPPA 1O95A 1W4ZA 4L75A 2UDPA 3GRPA 2DBVO 3I9NA 1GYRA 2PGJA 4CUKA 4R3WA 3GZ4A 4YWJA 5IN5A 3PDUA 3ZHBA 4XZ3A 1KVTA 2NU7A 4PRLA 1GR0A 2YQ4A 3EUWA 4BO5A 1H94A 1LLDA 1NHWA 3FN4A 4IBOA 2PGLA 4R5HA 4DPKA 4MP3A 3I3OA 1BWSA 1KEVA 4MIOA 4OO3A 3D3WA 3IDSA 3NT4A 4O6VA 1FDVA 5IJZA 3E03A 3RJ5A 1NPDA 1WDKA 2VYVA 3DZBA 1U9JA 4MKZA 4TWRA 5ER9A 3WWZA 1H9AA 3DBRA 3LF2A 1GZ3A 3NKLA 4HP8A 4NBVA 2VOEA 1EDOA 1UDCA 4MP6A 4F6LA 1WLYA 1B2LA 1ADBA 1JDJA 3C3XA 3KV3O 3GNTA 4E5NA 1BXGB 1LLUA 3I6QA 4K26A 2EW8A 2RHCA 3JQ8B 2FN7A 3RC7A 3ON5A 4M55A 1R15A 3C1TA 4LISA 1HEUA 4TSKA 2Y1FA 3IQDB 1J4AA 2VHZA 2X5KO 3GZNA 4GL4A 5A05A 4CM6A 1PWZA 5TS3A 1V6AA 4DRYA 4OXKA 5KVQA 4DLBA 1D7OA 3A9WA 3HHPA 2PA3A 1NM5A 1SC6A 1ZO8A 4JIGA 5COBA 3PI7A 1NNUA 5CP8A 4AJEA 5JSFA 1DB3A 3V1TC 1DC6A 5JLAA 4J0EA 1PX0A 1XU7A 3WGYA 4CL8A 4DC1A 2HJRA 3EZYA 5I9MA 4PZCA 1Q1NA 2WYVA 3ZW8A 4CQLB 4CR8A 3INRA 4FGSA 4AJIA 1EFLA 2WYUA 1TT7A 2CF6A 1S7CA 1U7TA 3LDHA 1HWYA 3IP3A 4ALKA 1BW9A 4Z9FA 4MKXA 4N5LA 3MJEA 4NBUA 3AY6A 4W82A 2BI8A 3PTZA 4E30A 3QW2A 4YJGB 4WOKA 3H5NA 3VC7A 1HZJA 3A06A 2VHWA 3TZKA 1SB8A 3PZBA 2VOJA 4W4TA 4PLVA 2SCUA 4WLVA 3CKYA 1ZZEA 3TZQA 2Y99A 3E18A 2CNBA 4AG3A 2Q1UA 1PSDA 1E3IA 4PGFA 1QMGA 2IDZA 3M2TA 1LC0A 1KEPA 2PZMA 2C7VA 4NQZA 3RKRA 1BTOA 5IXSA 2FZWA 1NTOA 5G2OA 4GLOA 4R4JA 1YXMA 2BGMA 3FR7A 1IYZA 2WDZA 1N1EA 3F6YA 3K96A 3VKUA 2QRJA 3GF4A 1P45A 3JYQA 4XGNA 4CQMB 3E82A 2AG5A 3DBLB 2POQX 3VPSA 1KETA 3VVBA 1OAAA 1HDXA 3I23A 4BHTA 5B4VA 3BMQA 4RF3A 4DIFA 3O38A 2ZCUA 4XQGA 5IDWA 4EEZA 1GD1O 4XJSA 1WP4A 1KVUA 4BNZA 5I7FA 4BOYA 3ETEA 5L7TA 4DVJA 1N9GB 4FFRA 1FXSA 3HB5X 3FPCA 5CDTA 4BB5A 4XYGA 5ADHA 4PIVA 3IUSA 1UZNA 3PGJA 4LGVA 1E7WA 3HFSA 3DOJA 1HL3A 1E7SA 1T2EA 3P2OA 4RZHA 4NFSA 3D3WB 1GFSA 2DTDA 3GVCA 2EHDA 1E6WA 3N7UA 3WX0A 5KOIA 4E5MA 4JP3A 3RC1A 4RVSA 4DPLA 1H6BA 2P4HX 3G1TA 1RM4A 1IB6A 3SC6A 4WECA 4II3A 4MDHA 1JWAB 1NP3A 3H9GA 1ONNA 4TZTA 2B0JA 2NTNA 2FWMX 2X7HA 1GAEO 1H6AA 4IS2A 2P9CA 3RQSA 1PR3A 2NSDA 2Y1OA 2C2XA 3IOYA 4J1QA 2VWPA 1C1DA 1DFHA 4ZN6A 4YRAA 3OICA 1I30A 4NK4A 5FI5A 1WDMA 1N7GA 1K6JA 1MA0A 1ZMTA 2BF7A 2O3QA 3DMTA 4LVCA 5G4KA 2OXIA 2NVUB 3WS7A 4PN3A 5L4SA 3UN1A 3OJFA 3JD2A 5EMHA 1U5CA 2I76A 1CJCA 3RUFA 3VTZA 1LLQA 3WLEA 4BUCA 2I67A 4EJ6A 3NUGA 4JJGA 4MVJM 3L6EA 4DIOA 1GUYA 2VUTA 1SEVA 4XB1A 3DXFA 3KUXA 4CLEA 4NBRA 4YT8A 3D7LA 1I3KA 1CRWG 1BW9B 2F1KA 2ZKLA 1Y81A 4MVJA 2AHRA 2Z5LA 3ZN2A 2HDHA 2BRUA 3OMLA 3GVHA 5HA5A 3QWBA 4BO0A 3IKVA 3TFQA 5ILGA 1YL6A 2HKIA 4LMPA 1KEUA 3N58A 2D2IA 3KRTA 3OA2A 4BKOA 4GX0A 3A1NA 5DCWA 1ZSVA 3PZRA 2WMDA 5TIIA 1YQGA 3NJ8A 1ZK0A 4PLGA 4R01A 5I7VA 5AQ1A 1C0PA 4IGFA 3FTNA 1U5AA 4HADA 1PJCA 1Y8RB 4JK3A 4UEJA 3OJ0A 1EE2A 1ZSNA 1YJ8A 1EE9A 4QXMA 3BYZA 2RCYA 3KEQA 3BA1A 2BH9A 3CXRA 5CG2A 2DU8A 3DAFA 1Q0LA 2HMSA 4YYZA 4UVIA 5AVOA 3S55A 1A4UA 1JKJA 3C8MA 4JBGA 5TT0A 4WLEA 4ALNA 4CUZA 3DZJA 3ITDA 1QG6A 1XWFA 4XYMA 1LRKA 4NJMB 2BELA 3FBGA 1RYDA 1N5DA 4RDHA 1WZEA 3RUIA 3ZWVA 1EUCA 4BV9A 2VYVD 1X0VA 3UHAA 3GNQA 1U8FO 4FDAA 1I2BA 1HE4A 1IPFA 4I5EA 4PG8A 3UCFA 3FWZA 1BDBA 5IZ4A 1QYXA 4YR9A 4PLCA 4JJIA 1YDWA 1AE1A 5FF9A 3TF5A 2GF2A 4ND3A 4XQEA 3UKOA 5TQVA 5DOZA 3RKUA 1I01A 1H2BA 1UDAA 2HAEA 2RH4A 5C7IO 2QRLA 4RLSA 1YQDA 4WCFA 4XRRA 1LSOA 1HE3A 5MGBA 1HDZA 4LW8A 1MB4A 3TZCA 1SCUA 1P1JA 2V65A 3H4VA 1P0FA 3WB9A 1B0AA 3DZGA 4R68A 2Q1SA 3RUEA 2PWZA 4N7RA 1C14A 3HWRA 2VWGA 3FR8A 2BLLA 4OSOA 1C1DB 1T24A 4ZICA 4RPJA 1IZ9A 1NAIA 1VSUA 1M67A 3KYCA 4E5PA 2BI7A 1BG6A 3OIGA 1JKIA 3AWDA 4B4OA 2BFAA 4LCJA 3GLQA 4XGKA 3WFJA 4GKBA 2VT3A 1MV8A 1I2CA 1KVQA 1P1FA 5IN4A 5JPIA 5JYDA 3E6AA 5J23A 4GLLA 3V1YA 3QVTA 1U2DA 3DDNA 5JAMA 3MWEB 4HFRA 2QHXA 1FK8A 4YPOA 3W4IA 4J90A 2X58A 4AJOA 4EITA 4NU6A 3GDGA 4E2ZA 1NR1A 1H5QA 5B4TA 3SXPA 3TFOA 3KYBA 2GZ2A 3MJSA 2Q2WA 3P19A 5DOVA 4I9UA 1O89A 3OF2A 3VPHA 3E9QA 2OBYA 3V5NA 5JY6A 2H1SA 4RDIA 1ISIA 5K9ZA 3TSCA 4DXHA 1T1RA 1Z6ZA 1G1AA 4QFCA 4TRJA 3ZWMA 4EZBA 3GC6A 2O3UA 2TMGA 3KVOA 2YZ7A 2GN6A 4HBGA 5CPBA 3ROPA 1LLCA 1QYVA 3PQFA 5BQFA 1QLJA 4XA8A 1W6UA 2X8LA 2ZQYA 1MX3A 1U28A 1W73A 1Y9EA 1XQ1A 2GERA 4IIUA 2WJPA 2RHRA 4JGBA 4AJKA 4E21A 4BKPA 3RU9A 4UVEA 3Q9NA 4D3SA 3OA0A 2EKPA 4PCVA 3L4SO 2DTXA 1ZJZA 1UR5A 1GUFA 4RLHA 4CLOA 4WPGA 1ZXBA 1AN9A 4CUJA 3ONFA 1PQUA 4BO6A 1BHSA 1YVEI 2IXAA 3U49A 2OUIA 3GFBA 2PZJA 4XIJA 2YHIB 3DBHA 3GT0A 3U5TA 1LSSA 3RUCA 5L9AA 3E9NA 4WLOA 1F8FA 5THKA 5TT1A 4PG5A 4C4OA 4LCEA 5AXDA 3WGIA 5GZ3A 1DAOA 1DBVO 4NNJA 4WEQA 3LLSA 3TL3A 2AQHA 4FS3A 4GX5A 4WCFB 1QYDA 1AGNA 2G0TA 4GSLA 4MVJG 1J6UA 4PRKA 1PJTA 4ND2A 2J5RA 1DJNA 3JYPA 4FFMA 1J49A 1PGQA 3UAGA 2IZ0A 4AL4A 3DFZA 1HDYA 1LSUA 4MPDA 1GV1A 5LC1A 3L6OO 3BTUA 4WK6A 1A4IA 2CD9A 5FWNA 5JDCA 3E48A 1NX6A 1KERA 2Y1DA 2EV9A 1HF3A 2J3IA 3WIDA 2JKVA 2QYSA 4OKIA 3N74A 4YQYA 4MVJH 1YL7A 1NVGA 3D3EA 3C1OA 2PZLA 1C1XA 5JCJA 2P5UA 1TB4A 3SLKA 4B7CA 2A92A 3ZWOA 4K6CA 1QRRA 1XR3A 4U7WA 1DFGA 3HE3A 3EAGA 4MVJD 4LN1A 4U6SA 4E31A 4XX0A 4GGOA 5A9TA 1OI7A 1V35A 1E1KA 1VKNA 3HNPA 1LUAA 4WEOA 4YAJA 5IXYA 1WW8A 4Z6KA 5KTKA 2LDXA 4RQUA 4FJ1A 4ZGWA 4YJHA 4R9SA 2EW2A 2IE0A 2Q50A 3RBXA 1AHHA 1GYPA 1CF2O 1M6WA 5TLSA 2YJZA 3Q9UA 2W4QA 3D4OA 2A4KA 3L9WA 3OECA 4Q3CA 4R9RA 4CM7A 3MWDB 1ZIDA 2AEJA 3GUCA 3WJ7A 9LDBA 1N92A 4I08A 5I7SA 4ZQFA 4CMBA 2IEDA 3FRJA 3ULKA 3MCVA 2VYND 4MVJP 1UZMA 2OGUA 2ZYAA 5DZSA 4IDGA 4OOFA 3IJPA 1IY8A 5CEEA 3ONDA 4WUVA 1NBOA 1NWHA 5CDUA 1P1KA 1X7DA 4CMIA 1BSVA 3WICA 4BNNA 1DJQA 4ALMA 1EBFA 1H6CA 4ND4A 5A04A 3GVIA 3H9QA 1ENOA 3RIHA 4NJOA 3QHAA 3RUDA 5EESA 3U4DA 4ZRMA 1QKIA 2JFGA 2B36A 4HKTA 4IDDA 1E3WB 1MXHA 1P9LA 1RM0A 1UH5A 2V6BA 3LVFO 4CLOB 1NQOA 1HDOA 1MLDA 1CYDA 3H8VA 1Q7BA 2IODA 4J9UE 1AHIA 3DONA 4AJHA 1RM5A 4G5HA 4GWKA 3ZWNA 3F1LA 2Q4BA 4RQTA 3VH3A 3JQAA 2GNAA 3C7CB 4MVJI 2OZPA 2R00C 3WG9A 1WPQA 2W2KA 2J3KA 4YTEA 3PYLA 3H6KA 2OP1A 4R1UA 3TPCA 3F5SA 3BMOB 1OBFO 3VOSA 3LC2O 1T4BA 3M1AA 4IZIA 3GK3A 4BO3A 5IG2A 1ZK2A 4N18A 5DBFA 3DAPA 3UXYA 1LX6A 4R1NA 4EBFA 3UCEA 1JAYA 1YB5A 5KCZA 1TT5A 2VWHA 1YL5A 4ROSA 5IFLA 3NX4A 3G0OA 1R0KA 1YQXA 4R1SA 3GG9A 2GN9A 5B37A 4XIYA 4CM9D 3DZKA 1M76A 1E5QA 2G17A 3DC2A 1JQBA 5GZ1A 3GG2A 3AOGA 1VC2A 4NDNE 2IXBA 4FJ0A 4Q39A 2DBZA 7ADHA 2OORA 4H16A 2Q1TA 4UVGA 3TQHA 4AJ4A 4CPDA 3QJ5A 4PZDA 3AUSA 4GX2A 1PL8A 1ZMOA 3AJRA 1R4MA 2CDBA 2PK3A 4NFHA 1PGJA 3FWNA 2Z1NA 4PG6A 3DFUA 2P9EA 1ZJYA 5KJFA 4RVHA 5FEUA 3JV7A 4D42A 3T7EA 1DIRA 2VRBA 3HZZA 1EEHA 3ZHZA 3RBZA 1G6KA 2G82A 5T8KC 3U4CA 3W6UA 1HRDA 2W90A 1ISGA 1M2WA 4KP7A 4E2YA 2NV6A 3BMCA 1PJ2A 2WEKA 2X0NA 3WGTA 1U7HA 5IDYA 4IDEA 3ROKA 5U9CA 4B7XA 2XAAA 1A9ZA 4RVFA 3TWOA 1V3VA 3E5RA 3BMNB 4KMSA 3B20A 4UEKA 2VZ8A 3R3SA 2ZYDA 2EIHA 1ADCA 5JS6A 4J7XA 4M89A 3MTJA 4L8VA 5ICMA 3V1UA 4QO7A 4BNJA 3HADA 4BNYA 2ZCVA 3O8QA 1QSGA 3FF4A 3PQEA 3CH6A 4YJFA 2H9IA 2ZJ0A 3AM5A 2DFVA 2RIRA 3KSZO 2WM3A 2CVZA 2CDCA 1XKQA 3OEYA 3MJCA 2HRBA 5JNLA 4ZQGA 1L7DA 3PK0A 3BHMA 4N5MA 4B3HA 4IDBA 3G79A 2Q49A 4HFJA 4Z3KA 2EKLA 3EMKA 1M75A 5EIOA 1T2DA 3PHLA 5CPFA 2HMWA 3KB6A 1F14A 2FR1A 1Y5MA 2Y1CA 2NQTA 4J91A 3IP1A 1NFRA 2CMDA 2JCYA 2YY7A 3IL2A 3EZLA 3NYWA 3ICPA 1PJSA 2DPHA 1F12A 4TVBA 5U1PA 1A27A 2ZB3A 4HXYA 3GY0A 1GEGA 3ANMA 4CMGA 3ZV5A 3HDQA 3AUUA 4WASA 2BHLA 2C0CA 2PTGA 1A72A 1TT5B 1B15A 1EVYA 5KVCA 4I5GA 5JCJD 3FNFA 4BB6A 4O1MA 1K89A 5AYVA 2J3JA 2B37A 2UAGA 4K1LA 5L53A 5F1PA 2WSBA 3EVNA 1DLJA 5BSEA 1OFGA 3ZH2A 1XCBA 1ZBQA 4CM1A 5KJ6A 5G0WA 5B12A 4AJLA 3IKTA 3QV1A 3C7DB 3CMCO 5ICSA 1MC5A 2GCGA 4PLFA 2HK8A 3RD5A 2O3SA 1MC4A 1BVRA 3JYNA 2DVMA 5AXBA 1B8UA 1TI7A 1EVZA 3KEOA 3JQ7A 3SLGA 4CJXA 1U2GA 3C7AA 4DYDA 1DRUA 3W6ZA 1MG0A 2QZ9A 3AUAA 3AOEA 4ZQEA 4J1NA 5G0VA 1GY8A 4J6FA 1Z82A 4GSKA 3QRWA 3GR6A 4PLZA 4R1TA 1GYQA 1Y8QB 2UVDA 1H6DA 1U4SA 3EGOA 3GDOA 1MFPA 5TJHA 2O7SA 3ST7A 3F47A 4BQPA 1PGNA 3T4EA 4FJ2A 3V2HA 4G81A 1I3NA 1DC3A 5A3VA 2DKNA 3S2FA 1ZW1A 1YJQA 5A9SB 2E4AA 2AEMA 1ARZA 2NM0A 4DLLA 4D43A 3RFVA 2E82A 2FOIA 5G0SA 2I99A 2LDBA 3I83A 5TJ9A 2AG8A 3INTA 3UW3A 3FNHA 1MGOA 2VHVA 3WYBA 4Y8VA 2D5CA 1A7KA 1GUZA 2O48X 1R0LA 2X9NA 2XPCA 2BFMA 2EEZA 1P3DA 2PLAA 1ZFNA 3R3JA 4ONEA 2CY0A 4B8ZA 3E1KA 3D1LA 1DLIA 2BGKA 1P74A 1EBUA 5ER6A 3WIEA 3NGXA 2HMTA 4CM4A 1Q0QA 2AQKA 3K6JA 5BNIA 1J0XO 1TLTA 3H65A 4XEHA 2P4QA 1U4OA 1EDZA 4S3MA 3VZPA 1MUUA 1TVEA 2IZZA 3JQAD 1K5HA 2NU8A 2Y0EA 1ZEMA 2CFCA 2ZJ1A 2XF8A 5F3RA 1SOVA 3DZFA 1EFKA 4OQZA 2XXJA 5TNXA 4YAIA 3JYLA 3L9XA 4CM8A 1ULSA 2NTJA 4BMVA 3ZV3A 4IIVA 2HO5A 4ZJUA 3ADPA 2VTDA 4KTVE 8LDHA 3WYCA 1ID1A 4YEDA 1YBVA 2OBNA 4M86A 4HFMA 3OHSX 1VI2A 1B8VA 4HUJA 1GEEA 4AJJA 3AOEC 5ENVA 1U3WA 4QSMA 3DBRB 2NACA 3WXBA 5FI3A 3WNVA 4DL9A 2JL1A 4BKRA 3DHNA 4D46A 1O6ZA 2X4GA 4IJKA 4IS3A 2EJVA 4DYVA 3GVXA 4KUHA 2DLDA 3NJ4A 3DZHA 4CV3A 3QIVA 3HUDA 1E6UA 4GBJA 3WQRA 4NG5A 3WSVA 1E7YA 1BMDA 1X7GA 3JQDA 3GZNB 1W0CA 1I3MA 5A03A 3SVTA 1DOHA 1MXFA 2J8ZA 2PD6A 3AU8A 2FR0A 4JN6B 3LF1A 3ZV4A 1GZ4A 5EPOA 4OGWA 4KDFA 2R2GA 3H5RA 4UULA 5CHEA 1T2CA 2ZTMA 1O8CA 4D0RA 1MG5A 1LTHR 3RVDA 1JW9B 4DMLA 4FB5A 3AM4A 3G1UA 4LVUA 2JCXA 4F3YA 5EQDA 3AU9A 3GVPA 4GVXA 2BFOA 1HLPA 2EF1A 3RI3A 4A03A 3E5MA 2AXQA 4MJLA 3ZZNA 4BNMA 4EUFA 4FN4A 1NAHA 2FMUA 2X0JA 2YQ5A 4DLAA 3E9MA 4U5QA 2WD8A 3H9EO 6LDHA 5DN9A 2G5CA 2UV8A 4HWKA 5EN4A 1PJQA 3B1JA 2C5AA 1PTJA 2EGGA 3QWHA 1RWBA 1YWGO 2GRAA 2PZKA 2IEBA 1TA4A 5F1OA 3WTCA 4AICA 1Z73A 3MZ0A 3QE3A 4D79A 3VVCA 2D5AA 3QLJA 3P2YA 1GPJA 5EL0A 2QZZA 3S2EA 3GOHA 4TRMA 3PHHA 1ZK1A 3A14A 4GAEA 3QWAA 5T57A 3GN1A 2TMDA 2X1HA 1UP7A 4XYLA 5DBIA 5A9RA 5CFZA 4BO1A 4RPLA 1CWUA 2VYNA 3BIOA 2Q99A 1GU7A 2PR2A 1XHLA 3GQVA 1HTBA 2RH8A 3PXXA 3BMQB 4CMEA 2I6TA 3HN7A 3NT5A 4OHUA 4YAKA 4E12A 3JCZA 2JD1A 4NK5A 2GD1O 3ANLA 4XQ9A 2BGLA 1SZJG 3K73O 2DFDA 3AY3A 2VUUA 3EYWA 3WQQA 4D7AA 4E0BA 2X5JO 5KIAA 1PQPA 2W8ZA 1FMCA 3DO5A 3JD3A 1C0IA 4IUYA 3ETGA 2CF5A 1NFQA 3ORFA 3JTMA 3ZGYA 4BV8A 4JXKA 3SC4A 1B14A 4UEOA 2B69A 2IRWA 4YXFA 3LU1A 2NLOA 3H9JA 4UUMA 5G0TA 2I65A 4GKVA 4ALIA 1GCUA 4C7KA 3FCOA 4IJUA 5HTOA 2O23A 4MIEA 4MO2A 1HT0A 2HK9A 3ZWXA 4BO7A 2I9PA 1ZH8A 1PWXA 4CLDA 4JP2A 4BS9A 4ZA2A 3C1AA 4K9DA 2J6IA 3OBBA 4G65A 4CMHA 1QP8A 2HLPA 3K2BA 3PQDA 4CV0A 1JAXA 4Z9XA 2FSVA 3SJUA 1JA9A 1LJ8A 2ZTUA 3G49A 5G4KB 1UXGA 4P4GA 3G17A 3Q11A 1EUDA 1HDRA 5DBGA 3S2GA 3NRCA 4BGIA 4B3JA 1YDEA 3CTMA 4U0JA 4YRDA 4CM9A 4DQXA 5LCXA 1NQ5A 4RL6A 5IF3A 5JFOA 4DGSA 3LT2A 4CMEC 5GMOA 4Q9NA 2AW5A 4WOJA 1UXKA 3W8FA 4F46A 3BZUA 3WBFA 3WGGA 9LDTA 3RU7A 2D3TA 1ZXLA 2FZEA 1V0JA 3QP9A 3BTOA 2DM6A 4L73A 4U0KA 3RAJA 3TOZA 3C85A 4GGPA 1HYGA 3GUYA 3NAQA 3UVEA 2FRDA 1LI4A 3HN2A 5I9LA 4ND1A 3ENNA 5F21A 1R37A 1R4NA 3I5MA 4B3IA 2Z1MA 4NBTA 4CMCA 5L95A 1D4FA 8ADHA 2GASA 2ZK7A 3PHGA 5L4NA 1LRLA 3OP4A 1P77A 1VM6A 1DFIA 3F46A 3WQSB 2PD4A 2GYYA 4W99A 2VZ0A 3HSKA 5C7OO 1WDLA 4S1VA 1PZEA 5BNTA 3OIFA 1XQ6A 1UJMA 2A94A 2WE8A 3ZWPA 4J4BA 1U3TA 4FFLA 3GEGA 2Y05A 3LLVA 2UYYA 4E4YA 1SBYA 1BRMA 4ZU3A 2D8AA 5B1YA 2JFHA 5CEJA 4I9HA 4ALLA 3DTYA 3LQFA 4GWGA 2Y66A 3ZNOA 3AI3A 1K0UA 4E6PA 4YACA 5KWEA 3SBOA 1LDEA 3UUWA 2NUAA 4RV9A 2VN8A 3H7AA 4IDAA 2HMVA 2GLXA 2IYPA 1WMAA 3HJAA 1YE3A 3DHYA 3W4KA 3ZWBA 2VCYA 1R6DA 3FPLA 1HDGO 3O9ZA 3OJLA 3Q2KA 5HS4A 2CUKA 4QTZA 1VKOA 3ABIA 4XGIA 4R54A 5DF1A 1PJBA 2HU2A 4RORA 1NHGA 5JYEA 4B4UA 2C54A 1NYTA 2P5YA 5EINA 3S1LA 2V6GA 3EY4A 4WGGA 3RUHA 4D3DA 1JVSA 1YBAA 1ISHA 2HQ1A 4Y6PA 1LQTA 1ORRA 1EQ2A 7MDHA 3K9QO 1HE2A 3PWZA 3WGHA 3RFTA 4Q3DA 1YOVA 1UAGA 4XB2A 5T67A 4F6CA 2Q1WA 1JTVA 1XELA 4D41A 4QO8A 4IQ8A 3EHEA 4J43A 4QFDA 1O94A 5THQA 4BMSA 1E7MA 3EK2A 2OHXA 4YB8A 3GDFA 5EQFA 1R16A 3VZQA 1KVRA 1K6IA 1FJHA 5TF4A 2BD0A 4Z0HO 2YDYA 3CZRA 3DWFA 4UVDA 1D1SA 1N1GA 2GN8A 1XG5A 2XOXA 4DREA 1GQYA 2ZQZA 3CIFA 4XRGA 4WKGA 3D5TA 2X22A 2FSSA 2Y68A 4FFOA 4R41A 3EC7A 4JQCA 5CDGA 3GEMA 1WAMA 4BNTA 3KYCB 1I5RA 3NTQA 5DP2A 1N7HA 1KY5A 2ZB7A 1UXJA 4IXTA 1YRLA 3OQBA 1JWBB 4KZPA 2O4UX 4MIYA 4WLUA 1CIVA 4BL5A 4FQ8A 4BGUA 5ES3A 3FTPA 4YA6A 3I52A 1E1NA 1E3LA 1PGOA 3NGLA 2EGHA 3EVTA 3UICA 1O5IA 3COSA 3PRJA 1EMDA 1PJ3A 1ADGA 3TZHA 4INAA 1HZZA 1U1IA 3K2EA 4DC0A 1R66A 1YBMA 1IUKA 5JMPA 5KJCA 2R00A 2Y93A 3GAFA 1UZLA 2Q46A 4GI2A 1UP4A 1R4NB 3PWKA 1ENPA 4JX8A 1H2HA 4BNUA 1GADO 1W8DA 1VLLA 3LT1A 3VZRA 1UAYA 2VT2A 1SO8A 2P9GA 4ZD6A 2YV2A 3NTRA 2YDXA 4EJ0A 4BNHA 2G1UA 3ADOA 3ASUA 1PZFA 3F5QA 2Y0CA 3LT0A 3PWSA 4XJTA 2B4QA 1UUFA 3JQEA 4J16A 4A73A 3RJ9A 3KLPX 3L07A 3ZHXA 1B26A 3T4XA 4IPTA 3OEWA 5F5NA 3QQPA 3ZDFA 4FBGA 2C82A 3BHJA 4O5OA 4PZEA 4ZVVA 3WMWA 5I7EA 1K3TA 4M1QA 3KM0A 1O9BA 3K8ZA 4UVHA 3RSHA 3FNEA 1T4DA 3I4CA 5KJ1A 1O0SA 3AM3A 3ZU4A 4J4HA 4ZQBA 4C7JA 1PU2A 3L4BA 1LDMA 3GGPA 4N54A 4EUEA 3BTSA 4XDYA 4E13A 3DMYA 1NQAO 2E37A 3WWYA 2A9FA 2H63A 5I9NA 3IJRA 3NT2A 2GGSA 4NI5A 1AUPA 1P1HA 1PR9A 4P4LA 4R69A 3HQ4O 1HLDA 4Y98A 4XD2A 4RVGA 4PLYA 4BNVA 4YT2A 3U62A 3GEDA 3WOHA 3M1LA 3DBHB 1VJTA 5T8KA 1U3VA 1ZK4A 1T2FA 4XR9A 5IZCA 1X1TA 5KVVA 3U9LA 3KSUA 4OM8A 1P0CA 1VPDA 2YW9A 2OP0A 3CUKA 3DOCA 3W1VA 3L6DA 2FPGA 1JVBA 4XCVA 3FSRA 3FNGA 2WYWA 1OOEA 4J2OA 2X86A 1A5ZA 4Z3DA 3PYXA 3PLRA 1X14A 3FI9A 2FR8A 4NMHA 2D1YA 2HMUA 1HYEA 4UUNA 4CMKA 4NR0A 4Z0TA 1N8KA 2VRCA 4CV1A 2I5PO 1GV0A 3I9JA 5H82A 3V8BA 1MFZA 1PGPA 1ZNQO 5AXAA 5KJEA 1NASA 2I66A 3WBBA 1C0KA 1WZIA 1HSOA 1SAYA 1C1XB 4G2NA 3WTBA 3ZU5A 2PKQO 3JQ8A 2HCTA 1EVJA 3KTDA 2NQ8A 4PLWA 1V3UA 4K6FA 2C59A 5JAIA 3L4BC 2FPIA 5JW6A 3UFXA 4FFNA 3HDYA 4DIBA 3ZNNA 3GA0A 5JC8A 2V7PA 2GSDA 2VNAA 1WXDA 5DCUA 2OFPA 3AFNA 4QT0A 1JLLA 4RO0A 3F1KA 3DR3A 5GY7A 4MOWA 1ULUA 4W7IA 3GGGA 3ZV6A 4YJHB 2NADA 1LC3A 1I32A 1U8XX 3WNQA 4D3FA 3K5PA 1UXIA 1HXHA 5TX7A 1I24A 1Q2XA 3JYOA 3MJ4A 3GAZA 4KDEA 1XDWA 4YJDA 2DT5A 1PJ4A 5IZCC 1QLHA 2PH3A 4YJGA 4A0SA 3GMDA 4M49A 5CDSA 4BO9A 1IULA 4Q3BA 3JQGA 1Z75A 1I33A 1LA2A 1DIBA 4ESOA 4J3FA 4Z9YA 4IM7A 1E1LA 4FPXA 1WMBA 5H83A 3VZSA 1VE9A 2DBQA 3SX2A 4TVOA 5BNFA 3PFWO 4AFNA 4HY3A 2RBEA 4CMIB 1FDTA 1JU9A 4II2A 3JQBA 3OSUA 1GQQA 4L0QA 4FW8A 4IGEA 1E92A 3JQCA 3AFMA 1IOLA 5JAQA 4E2XA 4H7PA 4JROA 4CQMA 5A02A 4I8XA 2E48A 4YRBA 5KNLA 3VPXA 5JCXA 2WWRA 3DBLA 3QY9A 3PHIA 4A7PA 2DQ4A 2P68A 1QORA 1E77A 5COAA 5HM8A 1UP6A 3AW9A 5B4UA 3R0IA 1VL6A 2AE1A 3PEFA 1DIGA 4CM3A 2G76A 5KVSA 4XYBA 2I3GA 2Y1EA 4BIIA 1ISFA 4KWHA 2EP7A 4FCCA 3W8DA 3JQAB 1I36A 2HJSA 1EVIA 1Q0HA 2W2KB 2IYOA 3Q3CA 2DBRA 1DEHA 1N9GA 2GR9A 3KOUA 1G0OA 4BNFA 1OC4A 2NVBA 4BMNA 3H3FA 2X5OA 2I3AA 3PVZA 1GL3A 5DP1A 3NDIA 1GTMA 3OQ1A 3LSYA 1M6HA 2EXXA 1P31A 1DRWA 2YYYA 2ET6A 2UUPA 3PDJA 4QUKA 4Y6SA 3JD0A 4ZRNA 1OZAA 4AJ2A 3LK7A 3KLMX 4L4XA 3TN7A 3ENKA 3ZNPA 4XWYA 1LSJA 2X0IA 1P44A 2D4AA 3QVSA 4CL3A 4M8SA 3INGA 4EEXA 3GGOA 4ID9A 2O7QA 1PL7A 2QRKA 3VTFA 3AI1A 5L40A 3VH2A 2B35A 4KTTE 4JBHA 3DAGA 3JQBC 3LC1O 4OSPA 5T64A 1YO6A 2JAPA 3ICCA 5TC4A 1SOWA 1K2WA 3ZI0A 1V3TA 2NVUA 5BSFA 4DTIA 3RWBA 1PS8A 1R4MB 2E6UX 4BGEA 3AI2A 1EQUA 4MVJF 2ZYGA 2VTEA 4KQWA 4ZHSA 2C5EA 1P33A 4I9NA 5JC1A 4Q3AA 4XYEA 4OJNA 4E33A 1Z45A 3C24A 3NDRA 3OM9A 3BAZA 3IIEA 5TGDA 1XU9A 4OIMA 1IHXA 2CVOA 5JDIC 1LRJA 4J2HA 3FBTA 1R0SA 3PJFA 2VHYA 4J7UA 4OH1A 3DL2A 5A1TA 4R5MA 3W4JA 3B70A 4KUGA 1EUZA 1YONA 3RASA 3UCXA 3I6IA 4UUOA 5A5EA 1NQTA 3MOIA 3DHEA 3S2IA 1YGYA 2AQIA 3BMCB 5JO0A 2O3TA 3B1FA 4LK3A 5FYDA 4J0FA 4E5YA 1SEPA 3JQGB 2ILTA 4OOEA 3UOGA 4I5DA 3OJEA 1X1EA 1LDNA 1I0ZA 2AEFA 5I8WA 1B8PA 3AUTA 2X9VA 3VPFA 4L76A 1T25A 4FGWA 4LRTB 4J49A 4E2WA 3DEYX 4RGBA 4HX5A 1ONPA 4UAGA 5DNAA 2B4TO 4I1IA 4CLHA 1DIHA 1Y8RA 1XEAA 4CODB 2GZ1A 3ZWAA 2HSDA 3O8QB 2H5LA 2ZIZA 4UUPA 4YT4A 4WCDA 4WNCA 5HRUA 2Q45A 1A7AA 4O59O 1Y5RA 4YJFB 1E7QA 4IZHA 4MKRA 5K6AA 1D1TA 3WR5A 1CERA 1NXQA 5L7YA 4JJFA 4Q3NA 1LNQA 3IUPA 3QVXA 1CQJA 3U3XA 2C7GA 1Q7CA 1DIAA 1VJ1A 4OKNA 1I2ZA 1L1FA 4CR6A 2JJYA 2D0IA 3U4IA 1XLTA 4NJMA 5A5FA 4L4RA 2PGDA 3AY7A 5DCYA 3WFIA 4F45A 3P5SA 3LYLA 1Q7GA 2NWQA 3UH1A 1JKFA 2X9GA 4L4SA 2JFFA 3PIIA 3JQ9A 4DMMA 4A2CA 4W7HA 4L74A 3H9UA 5FFFA 1D8AA 3LT4A 1J5PA 3Q1LA 3U4HA 2JCVA 2VRCD 4BQRA 2ZTLA 1PS9A 1UXHA 1KS9A 2Q2VA 5T6BA 5JBIA 4CR7A 1YKFA 1E7RA 2ZATA 1Y9AA 2EWMA 3HB4X 1HYHA 5A4DA 1Y1PA 4FFPA 4J4TA 5ITWA 1DHTA 1EK6A 3JSAA 4GVLA 2E49A 1BXKA 1IPEA 3QWFA 1TXGA 2A35A 1UDBA 2Y67A 2Y0DA 4IJVA 4K28A 1KY4A 2IZ1A 4CMJA 1HSZA 4D0SA 1RKXA 3OETA 2GUGA 4JBIA 4L9RA 1RPNA 1X15A 1X13A 1IHYA 1E3JA 4BGVA 4KUEA 4AJ1A 3NTOA 4MINA 3E8XA 5GZ6A 5AOVA 2QYTA 5K6AC 1FF9A 4OYRA 4Y6RA 1WVGA 1DPGA 4JNKA 3SJ7A 4GMGA 3JD1A 3JQ6A 3JQ7B 4BO4A 4BVAA 3JD4A 3OIDA 2W2LD 5IAAA 4W6ZA 4DQVA 2DUWA 1RYEA 3VDRA 5KKCA 1A9YA 5EJ2A 5DDIP 3I9MA 5DT9A 5L4LA 3RCBA 1LDGA 4P22A 2Y1GA 4PLPA 3R6DA 1DXYA 3WMXA 1ISMA 3B6ZA 4LSWA 4EGFA 5CG1A 2OL4A 1DSSG 1I3LA 1LQUA 3VPGA 5ILOA 3JQ9C 3MEQA 2FY8A 5HBRA 5ENDA 4B8WA 1P1IA 1V9LA 1N2SA 1ZKMA 5JXWA 2FHSA 4P4NA 4QECA 4JLWA 4TZKA 2JD0A 4BNGA 4H15A 2YFHA 4LMRA 4LRSB 2JAHA 3D4PA 2ZTVA 4YAGA 2QW8A 2VHXA 5HWSA 4CQMD 3QSGA 1ZSYA 1ZCJA 4CLXA 4GQAA 4CV2A 3F4BA 3FD8A 4A5OA 1KIFA 4XKJA 4E32A 5L51A 2C29D 2UUOA 2V6MA 4CM4B 1VRWA 2C07A 3KSDO 4DUPA 3DB2A 3DTTA 1KVSA 3GPDG 2PD3A 2NNLD 3EW7A 3KZVA 3EDMA 4H3VA 3CE6A 2O2SA 1LXCA 4W9NA 2BKAA 3DMTC 4CM8B 3VAZA 1CEQA 2PKQP 4PLHA 1OMOA 1KYQA 2C20A 1ENYA 5JE8A 1C3VA 2PH5A 2VQ3A 4R51A 4TROA 1Z7EA 3U0BA 1KC3A 3NDJA 3GHYA 1GQ2A 4AJNA 5KKAA 3WDSA 4BKUA 5AXCA 1HDCA 4E5KA 3AK4A 1B3RA 4NH4A 5G4LA 1NPTO 1YB4A 3H3JA 3ITKA 1WNTA 4DWVA 4EI2A 4FC7A 2YHIA 3L77A 4XR4A 2VZ9A 4J1SA 1PS0A 3DOOA 4BNLA 2RAFA 5T5QA 4TRNA 4BNXA 1CQIA 4RF4A 1ISJA 2V6FA 3O03A 1P1RA 4URFA 4R3NA 1KOLA 1LU9A 4WLFA 4KWIA 2BFPA 5I8ZA 3ETDA 4DPMA 1G0NA 5BSGA 4B7UA 3WGQA 2J5KA 4EW6A 1X7HA 2EJWA 2X23A 1NFFA 1L7EA 1F8GA 3CZMA 2WTBA 1PJLA 4P38A 2YFQA 2AMFA 4GMFA 1CETA 4YVFA 4B4VA 4DA9A 5CAEA 3CEAA 1BVUA 2X6TA 4RF2A 4BNWA 3H2SA 4U8GA 3KHUA 3KYDA 4J9VA 1X0XA 1ADFA 3RBVA 4W9NC 2C2YA 1SMKA 1BDMA 1MP0A 1PZHA 4B79A 5F1KA 3UGKA 3PLNA 1IZ0A 4WNIA 3TOXA 4WE3A 1DRVA 4KOAA 2ZB8A 4TKMA 5C7LO 3PGXA 1F17A 3M2PA 2OO5A 1ZVMA 1EZ4A 3OH8A 4OMUA 4YCAA 3D5QA 4Z0PA 2GO1A 1ZUD1 2NTVA 2B83A 1RJWA 4YDRA 1DO8A 5MDHA 5TSDA 3JQFA 5LDHA 2GPTA 2O3JA 3PPIA 3V2UA 3I4FA 3ONEA 4NU5A 4WCFC 5HS6A 1T1SA 5BR7A 4IMRA 3D4NA 4Q3EA 1PL6A 3RROA 2AQ8A 1Z7BA 2B5WA 2AA3A 4FD3A 3WSWA 4YQZA 1GZ6A 4BO8A 4EDFA 4FC6A 5C37A 1E0DA 1NVTA 2JD2A 3L0DA 4EYEA 1S6YA 4BO2A 1B3BA 1DAPA 4P8RA 1QR6A 3GHHA 1DC4A 3R1IA 1WWKA 4RPGA 2B5VA 3D0OA 3MJVA 1AXEA 2CVQA 2HK7A 4CLRA 4X54A 1QV6A 3T7CA 1NVMB 3ROQA 4HNGA 3F9IA 4A10A 4Y9DA 2VUSA 3K30A 1E3WA 2QX7A 4OXNA 3CPSA 4RF5A 5JY1A 5K0ZA 4HNHA 1V8BA 3IC5A 5F5LA 2DAPA 3QWIA 4NBWA 4AVYA 3PYMA 1Y6JA 4FOOA 4RCVA 5A06A 1GPDG 2FP4A 3F3SA 2NVWA 1ONOA 3HDJA 2O3RA 2Q2QA 3S8MA 3W8EA 1M66A 3VH4A 3IS3A 4M87A 4JCOA 2YUTA 3PIDA 5IDXA 3X2EA 3DBVO 3H5AA 3NV9A 3O4RA 3STHA 3K92A 4ITUA 4TMFA 3BMOA 3QVOA 5G0UA 3WYEA 4GX1A 4NZ9A 3IMFA 1VL8A 1F06A 3HDHA 3NEPX 2ZB4A 3Q0EA 2DPGA 3TJRA 1QV7A 3JQFC 3OJOA 3ANNA 3PHJA 2BMAA 3RC9A 1XGKA 1XA0A 2DTEA 3ROMA 4CM5A 4DBVO 4NHEA 3ASVA 4OAQA 5A3JA 3ZWCA 3BHIA 2EG9A 1GDHA 4J1TA 1LDYA 3ZCXA 5CDYA 3RC2A 4PG7A 1E3EA 2P2SA 2GN4A 3FHLA 4IQGA 4EJMA 3P7MA 4A26A 3KYDB 2XXBA 4GH5A 4IMPA 3I1JA 4NPCA 3KO8A 4XDZA 2EERA 2W98A 3CINA 4FOSA 1XSEA 1QXSA 3V2GA 1AXGA 5CEFA 5L45A 3ZU2A 2P91A 4IINA 3DQPA 2JHFA 1NPYA 4GPD1 3I9KA 1IL0A 2NU6A 1DDOA 3OQ6A 3ZU3A 4B4WA 4D45A 1PIWA 2J3HA 5BSHA 1KEWA 1XIVA 2JHGA 1VJ0A 2EKQA 2HUNA 3TRIA 1D3AA 3PP8A 4BKQA 2QQ5A 5JO9A 3VH1A 1YS4A 4PVDA 4IJWA 3I9LA 1E1MA 4WLNA 1E6EA 4QEDA 3U09A 5L7WA 2QIOA 4ALJA 2O50A 3BMNA 3DZIA 4EUHA 1GCOA 2DUUA 3LC7O 1T26A 2PNFA 1FDWA 4OXYA 5H81A 2WD7A 2GDZA 1H9BA 1LDBA 3A4VA 2O2YA 4TKLA 3QVWA 5JDCC 3Q2IA 3QA9A 4YT5A 3VDQA 5DULA 4BNKA 3VKVA 4PLTA 1YOVB 4FSHA 3X2FA 1HE5A 1VL0A 4PVCA 3TZ6A 1T2AA 3WJAA 2EP5A 4CLRB 3A28A 4LSMA 2CZCA 2X0RA 3O26A 1H93A 3ZWWA 4R16A 4QQRA 4D44A 4RVDA 3RUAA 1ZEJA 3LZ6A 2Q3EA 4IDCA 3GNSA 3CMMA 1YB1A 4HV4A 1SPXA 2CSUA 1H0KA 4AJPA 1HKUA 5EERA 2Q4EA 2YV3A 4BNIA 3TNLA 2D59A 1ENZA 2H6EA 3ZNQA 1KC1A 5TRTA 4RJTA 1EK5A 5COQA 2OOSA 3BXXA 4CMAA 4M54A 5C5IA 4FIZA 3D64A 4HFNA 2R6JA 1E3SA 1U3UA 3SEFA 3IAHA 1QYCA 3PJDA 2YV1A 4NIMA 1BXGA 2PFGA 3Q6IA 1BGVA 4FR5A 1F0YA 2WE7A 4MVJE 3GN2A 1SB9A 1Y7TA 3CSDA 4TQGA 2OMEA 4E3ZA 1CDOA 4WJZA 3HG7A 4DQUA 3VHRA 1LBEA 1FDUA 4YBZA 1E5LA 1B7GO 2J5QA 5L3ZA 4NFYA 1PZGA 3OFSA 1I10A 4YAEA 3PJGA 4IXWA 5LDGA 3MTGA 4I5FA 4TRRA 4CQLA 5ITVA 3UF0A 1C0LA 3KBOA 1IE3A 4XQCA 1NWCA 1Z74A
chains in the Genus database with same CATH superfamily
1MQSA 1MC8A 2NUBA 3L04A 4IMJB 1K6XA 2ZSFA 1H1LB 1VSVA 1VB3A 4O0LA 4A27A 2OO7A 3ELDA 1YUBA 2YH2A 1W5EA 1X9HA 1IN6A 3GFGA 3H7IA 4V2UA 2VNSA 1XYYA 4J29A 4JVMA 3D31A 4EWLA 2BKUA 1E2MA 4KRYA 4G0WA 4RTNA 2Z56A 1GM5A 4EAQA 4BZWA 3AF6A 5JAZA 1AV7A 1CJUC 2NU9A 1GJRA 4QX6A 2I71A 4F2GA 4MR9B 4HC4A 3R5FA 1EU1A 5L3SA 1PLJA 5U4QA 4QHSA 4KKXB 5HILA 3IT0A 3H2ZA 2X2FA 4IIDA 1TQ2A 2GPJA 4P3OA 3PJRA 5FOSA 4ND5A 3FTQA 1UJ2A 3S0JA 5F9HA 1HETA 5HKOA 3RSOA 3H8JA 3K4PA 4Y2SA 5FJIA 2PKRA 2PV7A 4BEWA 5A9SA 4UREA 1YA6A 4NH0A 1DC5A 5AJTA 1UKEA 5AOAA 2GYVA 4GZ3A 4UARA 1NZDA 2WF9A 3PT5A 4IDFA 2PIDA 4G9GA 4Q1BA 3NEJA 3ZWYA 3U39A 1L4HA 4IHJF 4IY1A 5BWNA 1HEIA 3I9OA 1DCKA 4PANA 2W93A 3EZ9A 2WD7B 4KO4S 5D3MB 2VDMB 2Z95A 2WI8A 3TTWA 4PGMA 5K0BA 2ACKA 4AT1A 5JMWA 4H1HA 2HR1A 3A9RA 2JGAA 3K31A 3B5IA 5SICE 3CPHA 3NKFA 4EMSA 3T06B 1W30A 3UKDA 4L75A 2KM1A 4K9PA 2UDPA 3RVKA 1LI5A 4JSRA 1IEQA 2WWWA 2IK8A 3HR8A 2WJZB 4X41A 1MO3A 4LY3A 1D9XA 2HN9A 2ZRBA 4BZPA 3QYFA 1ZZGA 2Y6UA 1KVTA 3IIKA 2FSHA 4LZZA 2YXDA 3FJOA 3FN4A 2HIMA 3QXSA 4IBOA 5LDDC 3KJQA 4XD7D 3E27A 3LSTA 4D4IA 5EXPA 3UHPA 5IJZA 2DERA 4B1FA 3CR7A 3E03A 221PA 3C3KA 3RJ5A 3ZXXA 2D4HA 4BFTA 3VRHA 1U9JA 2W9XA 3RGWS 3SE0A 3RWMB 3OUUA 4K6KA 3A6PC 1WJGA 4RFSB 4MUNA 2WWGA 3B6EA 1XPRA 3OEED 3NKLA 3S4YA 1VDZA 1WXEA 4B40A 2GUWA 2OCDA 2P69A 1TEVA 3HK2A 2POCA 4PZ0A 3EH1A 2ORWA 3QUBA 4F6LA 1JDJA 3AH8A 2ORVA 4HX2A 3E1SA 1S2OA 3GNTA 4E5NA 1BXGB 3I6QA 5CA1B 4K26A 4F4UA 4NCKA 1T9HA 2XHEA 1R0YA 4G1FA 4M55A 1R15A 4FUTA 4ZT7A 4UASA 1F48A 5ITSA 3C5EA 4RVCA 3T12A 5K4HA 1UOOA 1J4AA 4M1EA 1CRZA 1Z5VA 5HEKA 5A05A 2IVZA 3R76A 4M0PA 4YIKA 4TMTA 3SKXA 1V6AA 2FPIB 4OIFA 5LMZA 4QATA 4JZKA 1Y4ZA 5COBA 4URZR 4EM6A 5JSFA 1NNUA 5CP8A 1EWRA 1EX7A 3ROXA 1CZKA 2XNDD 5FB3A 1YS2X 1DC6A 1OV6A 5JLAA 4J0EA 3ECCA 4GOLD 3EIFA 1LTKA 3NYRA 4DC1A 2ZWAA 5AKZA 3JVDA 1YR3A 5CFLA 3IXQA 2OR3A 3INRA 4FGSA 2CXQA 4C43A 3AESA 1FNDA 3NDPA 2WYUA 3CH7A 4QXPA 1L4LA 3WNDA 2IWHA 1G8MA 1U7TA 2RGBA 3DOHA 4KWTA 4KSBA 5TMDA 3TFWA 4N5LA 3MJEA 5A4JA 2O59A 5EY5B 2PNJA 4GYKA 3NPAA 1P3Y1 3V34A 5KQSA 5JS1A 1PSZA 4WOKA 4YJGB 4PWZA 1RAEA 3UJ3X 1SUDA 3CGWA 3A06A 3H1FA 1M6YA 4CF6A 1CPYA 4DHWA 3AETB 1SB8A 3U13A 3D6JA 1M5RA 1C4XA 1PWEA 4ON9A 2SCUA 4WLVA 4ILEA 4IIEA 3TZQA 1T2UA 3VKWA 3ZTYA 5BWOA 1X1RA 2NU9B 2WYOA 1BHO1 2C9ZA 1IOVA 5C1PA 3PQ4A 1USWA 3I42A 4EVIA 1QMGA 1T9GS 2IEZA 3ENVA 4P5PA 5L3SB 1WZUA 3NBMA 2C7VA 3H2HA 4UU8A 5B3LA 2ZAYA 2H0RA 3RKRA 1OPXA 2J5BA 2FZWA 2H1FA 4EPXA 5G2OA 4JWTA 4LXHA 3ZK8A 4AZTA 4LKOA 3FVRA 2Q5QA 1G18A 4NCXA 2IYQA 2HDWA 1ZKDA 2VJMB 2X19A 1ZOOA 3NO4A 1N1EA 3P0HA 3MOSA 4JVLA 4YH1A 2FPWA 3RH0A 5HOQA 3FVWA 4GXNA 4CQMB 4XGNA 2F1OA 3JYQA 4LQDA 3RSCA 4GW3A 1SQGA 3QKRA 2DY0A 4KIJA 4JXXA 2WU0A 5FPQA 1U8YA 3VVBA 5IVPA 1NXXA 3I1YA 4B3XA 4GBED 2H31A 2JEOA 3X1WA 4BHTA 1Q7RA 2V3WA 2E87A 5IVKA 2HSEA 4DIFA 3E7XA 4RSRA 4LE1A 3O38A 4JT4A 5FR1A 3R7LA 4YAUA 3EASA 3K1ZA 4XQGA 3F2IA 4IOJA 1ZOIA 1XL0A 2VA8A 2L19A 4CEIA 1L7NA 4K2HA 4CCYB 1P18A 4LDZA 3T4PA 3K0HA 3G2IA 3C7TA 1QZXA 2QPAA 4D4KA 4DVJA 2ZR8A 3UGTA 2PIAA 3FPCA 3GO4A 5TF0A 1H3EA 1E69A 1LBQA 1P7WA 1QIIA 2NXNA 3NJRA 1C7QA 2EZ4A 3OZIA 4K9LA 4LGVA 5ALQA 3TKAA 1J06A 3DOJA 1EG7A 3N7TA 3P2OA 1CT9A 3GA7A 3RVMA 1YTUA 3CUEF 1BS1A 1QCCA 3UMCA 2H7CA 1XVTA 2D7CA 4K9QA 3DOUA 4PX3A 5F4BA 1ZL0A 4JP3A 3TB6A 1JQ5A 4RVSA 4DEXA 4DPLA 3E9DA 1A98A 1RM4A 2G1PA 4A0GA 3P0FA 4FMDB 3SC6A 5AVQA 4II3A 4NAVA 1Z4QA 5IJ0A 1EHIA 3GPLA 1Q7TA 5CW1A 5B58T 1L5LA 2B0JA 2BVNA 2NTNA 4P7FA 3I04M 4H3KB 1PTKA 1GLGA 3AR9A 3GA5A 4IS2A 3W7AA 3RQSA 5EZSA 5J4HA 1PR3A 2NSDA 4REMA 4BZXA 1KJIA 3KK0A 5LLTA 2O2ZA 2C4HA 2ATCA 2IYYA 4MTCA 2MMGA 4BTLA 4TN5A 1ZGJA 1KAOA 4YRAA 2QYOA 1WDMA 3TS1A 3MPOA 1H2ZA 4FNOA 1RTKA 1OX6A 2NVUB 1DMRA 3RK4A 3DL7A 4ZVMA 5F9MA 1CRQA 1KBOA 2ODNA 5CB0A 5EMHA 1DKMA 3RUFA 3H2IA 4LOLA 3KVVA 4YQEA 5MHTA 5IM4F 3IH5A 1OXXK 3KLOA 3MUFA 1V1RA 3WLEA 3ZDZB 4HDMA 2I67A 5AKLA 2K6GA 3NUGA 1N6LA 3MBIA 3L8ZA 2RG7A 2QMUA 3AX6A 4HQLA 5EA2A 2OYCA 4PRYA 1RRCA 1D07A 1MAVA 2D1QA 1UQRA 3DQZA 1DZIA 5LA6A 3TVDA 4CHGA 4UDNA 2ZJOA 4IVPA 1UOPA 4CLEA 1ZRSA 5EJIA 3IURA 4NBRA 3V97A 4C6TA 5CD1A 3RJMA 3MCTA 1UKZA 2AI2A 4FDTA 2F1KA 1JG3A 2ZKLA 4MVJA 2AFHB 2ZU6A 1O4WA 2HDHA 2FWRA 4BATA 5K0NA 3RSSA 1SBTA 4LOKA 1ULBA 1Z47A 1XZPA 1ZLXA 1OJ7A 3GJXC 3EXIB 1YL6A 4C20A 2IPXA 4QZVA 4KLAA 3Q10A 3OA2A 4TXNA 2DY1A 4BKOA 2EFDB 2ID9A 2WMDA 3FSJX 1SCBA 3OTHA 5DGXA 5LU9A 3ZGOA 4G8BA 5EC8A 1QIGA 2PXAA 5LXTB 5DPMA 4LJ4A 4R01A 3IAXA 4PLGA 4S0XA 5I7VA 1UPCA 2QUZA 2VQSA 1C0PA 4EI9A 2W8BB 4MRRA 4N40A 4C87A 2AZ4A 3ZXIA 4DV0B 1L7MA 2VJAA 4UEJA 2IFTA 4C4PA 4COOA 2HMAA 2XUGA 5AWFC 3RUPA 3Q7QA 5KYUA 2HBZA 2XCSB 5MN4A 2ID4A 1ZSNA 2G5GX 4F5WA 3EMDA 4A0HA 3GJ6A 2OZEA 5DEOA 1VG8A 3BYZA 3AG5A 2DJ5A 2XUQA 2HGSA 4DDTA 3RT7A 3P8ZA 5LUAA 4H4EA 1O95D 3QKRB 1Q0LA 3PFGA 4YYZA 1D6SA 3Q3EA 3UJ9A 3IAM1 1JKJA 2BC9A 1P0IA 1KMQA 1T8RA 2B2CA 2PO7A 4XUCA 4JBGA 5TT0A 2QQGA 4NFLA 3S68A 2GBPA 4CKZA 4WLEA 3DZJA 4U6NA 1NVDA 2IZ6A 2JGFA 3BF8A 3ITDA 1V1MB 5IWCA 3HVIA 4BEVA 4XYMA 5JJBA 3J81A 2XYQA 4HK4A 5BY2A 2YXLA 2BELA 2JG3A 1SM4A 3RNOA 3OKFA 3SKYA 5CB8A 1N5DA 2BFBB 4RDHA 4DR5B 1F4LA 1CEEA 3KQPA 4QD3A 1EUCA 1G5HA 3ZWVA 4BN5A 4HVTA 3V33A 4OGKA 3UHAA 2NZ8A 2IXGA 4X97A 2X14A 1I7DA 1Q15A 1L4BA 3OU6A 1IPFA 2QRPA 2IX3A 3UEOA 1QQAA 4L51A 3QMPA 4ABTA 3HNOA 1QO0A 2XMQA 5CM8B 3B36A 2XTMA 3S6JA 4YR9A 2P30A 1QHSA 1U7PA 4JJIA 2QZJA 5EGNA 2FMIA 3ZCTA 3KV1A 4AS1A 1TECE 2YL2A 1H2BA 5C7IO 4G8CA 2Z0MA 1YQDA 1UMCB 3L1VA 3IAUA 3IERA 4U39A 3RK0A 2P9BA 4K6HA 1ONSA 2R8BA 1U31A 1WCIA 2FK7A 1MB4A 2NYAA 2HIAA 4BWGA 6Q21A 1P1JA 4H1TA 5IJ0B 3L06A 4V2IA 3WBJA 1A8IA 4RK6A 1YUNA 3TCNA 2W00A 2RK6A 1DMSA 2OHHA 3G59A 4XIFA 4LXQA 4UE2A 2HWKA 5CA0A 3N87A 3KVNA 3E7PA 1YDFA 5HFJA 1SXJA 2H85A 5KX5A 1M67A 4E5PA 4OYLA 2Y9MB 4Y2UA 1HNZB 1NY6A 1Y7IA 4AY2A 4B4OA 1P0MA 1BYIA 5FTLA 2BFAA 3ZDDA 3VU8A 4HLCA 3PE3A 5H59A 2EKBA 1R3UA 1OGYA 1K08A 3QX7A 4PZYA 3H42B 2H8GA 4DUGD 5JAOA 1NNEA 4AKHA 3M70A 2YVUA 1MB2A 4HDMB 4DRZA 1INLA 3I9V6 5HM6A 1TEXA 4L3OA 1GGJA 3QVTA 1VL1A 3DDNA 2JHPA 4BLRA 4YV0A 4HFRA 1YDHA 2DCUA 2XMDA 1V39A 4Q1CA 2QHXA 1PP4A 4Y0NA 5DO9A 4KLNA 1JMVA 3FG9A 1XRQA 5FNVA 5LA6B 4EITA 3NIBA 2B61A 4JQSA 1YR8A 3CUTA 3MAAC 1E8NA 1H5QA 3UWKA 2NXEA 5DM60 4C6TB 4F1JA 2BR4A 2Q41A 3KYBA 2GZ2A 4J0CA 5JV5A 2FDXA 3P94A 3I32A 2RHBA 3MJSA 4BB9A 3PDIA 2Q5JA 2FAXA 1L7BA 2PX2A 4L95C 2AMVA 2HWXA 3PNLA 1FEZA 4L8LA 3WMGA 4BP8A 3D7RA 4B6SA 4I55A 4RDIA 2Y3IA 4KFUA 5BYJA 3I72A 1PFKA 2BGRA 1T1RA 2JJ1D 2GT1A 3T15A 3U6BA 5IBPA 1ZRMA 3FFWA 2RHOA 4W5NA 2VQ6A 4BVKA 3ZWMA 3ZYCA 3GC6A 1PJRA 4C2UA 4DBLE 5EE3A 1QGYA 2GN6A 1M6NA 3CURA 4JLDA 5L3VA 1W0KD 1AQNA 1LLCA 1D2AA 4IUDS 2IHJA 5DASA 4B6QA 5CGZA 3AG6A 4FU0A 1VSQA 4GPZA 3BFPA 1HC7A 4TZ6A 2V55B 3HUFA 2QUHA 2OC9A 2PKWA 3KOZA 4XA8A 1MX3A 1QCZA 1TC2A 2VDUE 5K0JA 2WG1A 2OXCA 3GNLA 2GERA 2DR2A 3TZEA 2YMMA 2O2HA 1CD5A 4UVEA 4V0OA 3Q9NA 2OXTA 1JKJB 3A70A 2QMEA 3ENQA 3OA0A 1VE6A 2DWQA 4N0MA 3E9CA 4KYTA 3L4SO 3CH5A 1H3FA 3E2IA 4FGKA 4C9BA 2RHLA 1U5BB 5E6SB 4DCNA 4JXZA 2ERYA 2WWFA 1L1RA 2G9RA 3PDCA 1JTFA 2LRHA 3KHSA 5F52A 3WYGA 3CN7A 1LWNA 2V0NA 2UXCB 1YVEI 4EKNB 2V4ZA 4Y2HA 4YAWA 3FYDA 3C16C 3CZAA 1M72A 5DHFA 3ZE2B 3DC7A 2YY5A 2NT4A 1GNTA 3GT0A 3GZJA 2W6JD 4OXRA 2C95A 5F51A 2QNBA 4OBBA 5TT1A 4GXQA 4UUAA 1W9HA 4S0ZA 2IZ5A 3QVGA 4URYR 3M9WA 4XD7A 1WMFA 2H2WA 2DX7A 4L9WA 3I2HA 2R6GA 4DDKA 4TMWA 2AQHA 2ICAA 5FFNA 4FS3A 1FLDA 1T36A 4XPZA 4EY3A 2BMFA 1AY0A 1JAHA 1RZUA 2ISCA 2ZUEA 2P9YA 1E64A 1J6UA 3P9XA 4PRKA 2K7ZA 1ODLA 4ND2A 1E8DA 4QBFA 3SSAA 3RO7A 1RCUA 4D8XA 3FVVA 1ZC4A 3SR4A 3H13A 3UAGA 4AL4A 4QYXA 3DFZA 2DP4E 4ZODA 621PA 2Q6OA 3AEXA 3KAPA 1K7XB 1JE1A 2IGBA 3BTUA 4R6XA 1W94A 1ULHA 2V7QD 3FCXA 1JEDA 2W48A 4ROTA 5DM1A 5K3BA 3VR3A 4BP1A 4PY2A 5BWMA 5ERGB 1SXJB 2EV9A 4IIYA 5KX5B 5CT4A 2JKVA 2ZIGA 3KZCA 2AYZA 4MVJH 4B3CA 3FSEA 1D1PA 1F9EA 2NZUG 2PZLA 3C1OA 3PGKA 2DSTA 4OI2A 5JEDA 2FKAA 2WKPA 2WUDA 3OKCA 4I8DA 4MUMA 3HPRA 3JWPA 4B7CA 1XMXA 1LZLA 3ZWOA 3WFZA 5IF9A 1QRRA 1JG6A 4QUAA 1SVWA 4LN1A 4CIAA 4U6SA 3V8NA 4ZMBA 4JJAA 5BQPA 2ATIA 2HTFA 4RLFA 1E1KA 1C7RA 1FB5A 1VKNA 2Q3HA 3JATA 1V25A 4Q1EA 2FQWA 3H87A 4E1VA 1H65A 2NO7A 2YASA 4TL9A 5KTKA 4EYQA 4DXDA 5D51S 3AEQB 4ZGWA 1JQDA 3UM9A 1XALA 4WOCA 1AHHA 4GMHA 2WLTA 1ZM4A 2XVXA 5AI5A 4YUZA 3Q9UA 4I9GA 4FOPA 3OECA 4RY2A 3R6WA 4I55B 3PRKE 2O2JA 2AEJA 1Z5UA 2EFHB 3TFOA 4TXHA 1M5UA 1VGQA 1XJCA 5I7SA 4BYMA 4KQHA 4RK1A 4IG4A 3HRKA 5AD1A 1RXWA 4ZQFA 1FTWA 2XZOA 4PEVA 1PJAA 3QH4A 4QQ8A 5DHTA 4DNOA 4M9ZA 1X1DA 2C5GA 5C80A 2VYND 1P4RA 4NU0A 1A9XA 2FW0A 2ZYAA 1R6UA 2WZDA 3T3IA 2JA2A 5DZSA 4OOFA 1Q6ZA 2CYCA 3SF8A 1N34B 5ECWA 1CUJA 3FYHA 3H0EA 3ONDA 2CT8A 2ZIEA 5TE9A 2A5DA 1W5FA 1X7DA 3L6UA 1Y4AE 4M9CA 1U0JA 3OP1A 4U1RA 4BNNA 4KRGA 4DKXA 1OV4A 1JWLA 3L79A 2GNOA 3BQMB 2W42A 1BCRA 1FVOA 3P9PA 1PT7A 4QDJA 2PH1A 3AKDA 1DS6A 4ZIRB 2O0JA 4ZU1X 1T8UA 4NJOA 3HCCA 1Q1EA 4R9VA 4XVHA 3ESZA 2AD1A 3FETA 1F2TA 1L5MA 4TMYA 4ZRMA 1L4GA 2DFKB 2JFGA 3BRWD 1EP9A 1E8MA 1KK3A 3LQ1A 1KQPA 2DSNA 2O5EA 1MLDA 3L2OB 2RH5A 1Z6XA 4GWKA 2E4XA 3W9BA 3F1LA 4TM7A 4JAVC 2FP4B 1NBME 3C7CB 3D6VA 3X1KA 2NSLA 1WPQA 3O4HA 3I39X 4W1RA 4C4SA 3B52X 5LYJF 4MQFA 5DIFA 2Y27A 3LC0A 3QVGB 3BMOB 1PV1A 2AC7A 2ETXA 3OQMA 3LC2O 5BO5A 4Z54A 3PX7A 3S8EA 2VBFA 1ZK2A 3DWGA 3JW8A 2O2IA 1GLVA 3I09A 3VHLB 1T5BA 3UCEA 1JAYA 1TJYA 4F8EA 2RGRA 5C52B 4Q66C 2JBAA 5ITZA 2A1UA 2Y4NA 4EJSB 2I78A 1O9GA 3WLQA 3BERA 1YQXA 3DPUA 4MWDA 2VF8A 1BE6A 3PA8A 4MR8B 2GN9A 5B37A 1IHPA 3VHQA 2QTBA 4KKVA 3VU3A 1JHDA 3DE3X 2WFLA 3T7RA 1M76A 1QFYA 2MWMA 4OLAA 1QVWA 5GZ1A 2VSXA 4UHDA 1AKVA 3GG2A 3KG2A 2GAJA 1W4AA 4EKGA 5IT0A 1NVVR 1R5JA 1MENA 4ITRC 2O0MA 3DWIA 3O1JC 2OORA 4H16A 1GGNA 1M1NA 1VJ5A 2HRRA 2RJ3A 4UVGA 5B1SA 3EZGA 3TQHA 2ZT8A 4JR1A 4LRYA 3LYUA 4LNAA 1II9A 1FUKA 2IH4A 4ZT2A 2B99A 5DNEA 3F2VA 3L41A 3VX4A 4AMGA 1UBMS 3IEMA 2PRYA 2BTOA 4N3NA 4PG6A 2ZYRA 3HKCA 3DFUA 1XTZA 2P9EA 3JATB 2OFOA 5CVVA 1AKRA 4DA0A 4E4TA 4ENPA 3LO5A 3H75A 5LZ8A 3MF4A 2FW8A 4NG4A 2HT6A 3T7EA 1HM5A 4EO9A 1PT5A 3ANYB 3HZZA 1VKRA 2DF8A 5TV2A 1EEHA 2DETA 4M1ZA 2QZSA 4B75A 3CRQA 2Z57A 3OM1A 1F8XA 2WTMA 3A7EA 1ISGA 3TQQA 1UBHS 3R09A 4EHIA 2FSPA 2ILVA 3V7FA 4EARA 3GEHA 3BMCA 1MQAA 1PJ2A 2F9MA 4DB4A 1RI4A 3LWNA 4B7XA 2XAAA 1A9ZA 1BWRA 2GD2A 3EPJA 2LGJA 4A3SA 3BMNB 1DBIA 3Q8MA 3WKAA 3BXOA 3SF8B 3B20A 1TK9A 4UEKA 1Y9DA 2VZ8A 3OLQA 3N2EA 3EQ8A 5ELMA 1U7XA 5ES4B 3TINA 2CV2A 1XMSA 2BMDA 2ZOSA 1XD9A 2HTEA 3QBVA 1ADCA 3ICWA 4HTFB 1QH9A 4P86A 3VHXB 4DCGA 2B1QA 2DKFA 2WILA 4J8PA 5JWHA 3TTVA 3T7TA 3CBQA 3HADA 3V1UA 3O8QA 2FMTA 4PFKA 2VC2B 1G3QA 2Z3VA 2QRUA 3PQEA 2G63A 4YJFA 3LFHA 2PS1A 3NALA 1A4RA 1YR1A 2GB4A 3KJFA 3L8MA 5ILQA 5E7JA 3KSZO 2PMWB 1K7EB 4Y9RA 2ZRKA 1FSGA 1CEYA 4A8JA 1XKQA 2VG8A 2ACVA 1W2WB 2DFPA 4UMFA 1O94D 3G88A 4WK2B 1KO5A 1L7DA 2XXAA 1ACJA 5JVDF 5AM0A 3R4VA 4LF4B 1T6YA 1W2HA 5L8VA 4N5MA 4B3HA 1LPAB 3BJRA 4B6GA 1D2HA 2Q49A 2GPSA 2ZPTX 4HFJA 3IOMA 3VC2A 2D54A 3A3KA 3DKVA 4YLGA 3UT5A 1OXTA 1XP8A 4EGQA 4ZDJA 2IXEA 5IFKA 4FE4A 1LK7A 3O83A 5EIOA 4X8HA 3N6VA 2H2AA 1EX9A 3PFHA 5CPFA 1ND6A 1G3MA 2Q4OA 5I7OA 3KB6A 3K4HA 2IYEA 1F14A 2BDUA 5ALJA 4UJ3A 2JRLA 3LUHA 3DPSA 2NQTA 4GE3A 1F3LA 3VBCA 2ZT6A 2D00A 1HQKA 2CMDA 2JCYA 1PKXA 2XMCA 2FWBA 3EZLA 3NYWA 4GZ5A 1RP1A 3E61A 4JQZA 2NZYA 2I62A 4J3NA 2VPZA 2P11A 3HCFA 5U1PA 3EGXA 1A27A 4AS3A 1PNTA 4RY9A 3U40A 4EHNA 4G0VA 4BZQA 3A6LA 3AUUA 3JWGA 2JBAB 5ITZB 1L8LA 4N01A 4LHYA 1T8WA 4ZAYA 1Z2DA 1EVYA 1N3LA 2B3DA 2H0AA 4MW5A 5SZIA 3W9YA 2PUDA 4Y9TA 1XZKA 2L42A 4O1MA 4ENSA 1OTXA 3DVQX 4HYQA 5FLEX 2WFLB 1KEKA 4IDOA 1MRNA 5F1PA 4US1R 5GWXA 2Q2OA 3UTCA 5C4MA 2NO6A 2JAWA 1KQOA 4KITB 1SKYB 3RRNA 5B12A 4RS4A 4AJLA 3AHDA 4H4CA 3N07A 2A0KA 3CMCO 5C1DA 4OX9B 3H8SA 2GCGA 4PLFA 3VISA 2JHCA 3OPNA 1M1NB 2PXHA 1A9TA 3GLGB 2J4FA 2V58A 3OVMA 5D3KA 1MC4A 4TLEA 3CNOA 3JYNA 1A5AB 5K3CA 1P4GA 2Q7DA 4ERXA 1V6CA 1ZMXA 1B8UA 4IIGA 3PUWA 3QJYA 5EKSA 3KU1A 4BN4A 4A8JC 3D4LA 3HKCB 2FPRA 4OMDA 3SLGA 5IUNC 3BE8A 5JSQA 1AO0A 4I81A 4AKIA 5IBRA 3SYNA 4KVZA 2QZ9A 2V5VA 3AOEA 4ZQEA 3CF4G 4J1NA 3V1KA 1OLUB 3G68A 5ALMA 5EZYF 3PV0A 1ZA1A 4R1TA 1Y8QB 5IABA 4G1EB 2QUBA 3DULA 3EGOA 4YCBA 3ST7A 4BQPA 5JZ9A 2O7SA 2Z2IA 2OCBA 1E4EB 3T4EA 2BBTA 4F5YA 4BFSA 2PJRA 5B57C 1ZOSA 1KYVA 2VJNA 2I7VA 1Z13A 1DC3A 5E0KB 3S2FA 2X0EA 2WZBA 2JJ1A 1I1NA 4LC1A 2E4AA 1PHRA 1CUCA 5IANA 4MWBA 1LF0A 1Z6QA 2HPZA 3V3KA 1U7DA 4D43A 1UBTS 3KQUA 1JFSA 4LJRA 3O82A 3GMIA 2G77B 3JS5A 3UAXA 3D6AA 2CWWA 1JR2A 1W0KA 2PGAA 2YWFA 1DRJA 3SS9X 1MGOA 2ANBA 4ND6A 2E1PA 2R6FA 3K9BA 3WYBA 1U0FA 4ACAA 4C0JA 1GUZA 3M6UA 3JWIA 2DOKA 3WMEA 1YVDA 4QPZA 1VMDA 4K5QA 1NA5A 1QF6A 2XPCA 5WRFA 4R81A 4AF6A 1EFPA 1UIMA 3WOVA 4EFMA 1ZFNA 4CXMA 5LMCA 4YR7A 5IC6A 2DKOA 1L7XA 4QVIA 1EWQA 3HJFA 1MT3A 4YUWA 2BGKA 1P74A 4RXMA 4CM4A 4IIBA 1N2EA 1Z0FA 2HMTA 1Q0QA 2AQKA 2FQXA 2FPPB 2C2OA 4JMLA 4NBKA 1TLTA 3H65A 4RY8A 1A0OA 3TIVA 4DCTA 3VZPA 5CYOA 1CZHA 1Z17A 1F9AA 1XEXA 2C94A 2D2EA 1OROA 2IZZA 3H11A 3GGCA 4IHJA 4Q24A 2H3EA 5EMKA 5JJ5A 5F3RA 1SOVA 1PDVA 1U7UA 1WULS 3ND6A 5AT1A 3DE5X 2KHZA 3P0IA 2WW8A 1MEOA 2H1IA 5JYBA 4FDMA 2BM0A 2HO5A 2GEFA 4IIVA 2YYAA 4EVQA 4O3MA 3HBAA 3E53A 1YS7A 3ADPA 4LFBB 1DOZA 1BE8A 2VAPA 4Z4EA 3THYB 1XLVA 3DAOA 3PCXA 1YBVA 2MTBA 1VI2A 4ECEA 4F3TA 1GEEA 1ZNZA 4AJJA 1YKSA 2Q3FA 3AOEC 2PWYA 3HRIA 4EDHA 2XQJA 3ZUGA 3MMZA 3KR0A 1P9NA 4DL9A 2JDIA 4MH0R 1E3QA 1H2FA 1O96A 1U6JA 3TRFA 2QL6A 4YJKA 3SIWA 2X6QA 5EP3A 2IP1A 2GK7A 4HWRA 4Q12A 2ZBGA 4DYVA 2EJVA 4F9FA 4AZSA 3GVXA 4KUHA 4LJ6A 1XTSA 3OD5A 3TPZA 5A71A 3EGXB 1E6UA 3IO5A 3UHFA 4JOCA 2QP4A 1SVIA 3KDAA 2FFBA 1I4WA 1PW5A 3RKSA 5CTJA 3G89A 1KDTA 4ZAFA 3VR5D 1HT3A 2AKYA 3DEJA 4G0PA 4KREA 4J75A 3SVTA 2GILA 4X1KA 4J0DA 3ZHSA 4QLBA 1MXFA 4JNCA 2J8ZA 1FLVA 1XD2A 1Y3HA 3AU8A 3KYJB 4H7FA 2QTFA 1W46A 2V7QA 3AUJB 5B1IA 4PX2A 2HCBA 4R0NA 1GZ4A 2YHAA 5MN5A 4IFEA 1WO8A 3RHTA 2R2GA 2PQ6A 1YGPA 3NAGA 1GAQA 4L1KA 2H16A 2XQKA 2HMYB 1GZVA 4F9EA 1WF6A 1MG5A 5IJAA 4J03A 3C3YA 1Q0RA 3PNSA 1AIPA 2VAMA 5LB4A 4FB5A 2YX1A 4DMLA 4PTYA 2JCXA 1YK0A 4F7DA 5A4IS 5K3EA 1F8YA 2H48A 3NRBA 2EF1A 5CJ2A 5FADA 4YRZA 1SPBS 1C41A 1PR2A 5BMVF 2QUIA 4BNMA 2UUBB 1ZXXA 4EUFA 1TYAE 2X0JA 1QHFA 2YQ5A 4DLAA 1LD3A 3OCYA 5F7XA 4DNQA 2FRXA 4CGYA 1YD7A 4CIXA 2VLBA 1WZ2A 5EN4A 1QR2A 1ZLYA 4G5RA 3S7ZA 1R0XA 1XLTC 2FOLA 2PU7A 4OHVA 2GVZC 1RWBA 2XOKD 4TMKA 2GRAA 3OT5A 4IIFA 5FBRB 3WK4A 3TZLA 5F1OA 1Z73A 4NAHA 3GWGA 4QRDA 1Y3AA 4MYDA 4QEZA 3VVCA 4G5XA 2P35A 4B31A 1L4UA 2G88A 4DM7A 3QLJA 1U81A 3OQJA 3P2YA 5EL0A 1ORDA 4V1CB 3SI7A 5JXJA 3PUVA 3GOHA 1ZH0A 5AKYA 3MGCA 3ORSA 5GP1A 4M6WA 1W75A 3I2YX 5DBIA 4PIPA 2DYKA 2VYNA 1YIAA 3GCDA 3H2KA 1Q12A 4LJ8A 3BFJA 1E66A 1Q91A 2Q99A 3CZQA 4G36A 4P0PB 3KFXA 1A69A 4OLJA 4QOJA 4WVLA 1ZAYA 1JI0A 1SUBA 2IYNA 3AC0A 2H11A 3BMQB 1P4SA 3OQVA 1C9MA 3HN7A 4X1OA 1EFPB 5BSUA 3VU1A 1XDDA 1QJ4A 3D0KA 3L82B 2JD1A 4NK5A 4D74A 1D03A 2GD1O 4J2TA 5CMLA 1N7IA 4I4TB 2BEJA 2VNKA 1QOQB 3PXGA 1E4OA 2DFDA 3NTLA 4I6EA 4PYIA 1CLEA 2HM7A 3EYWA 3WQQA 4D7AA 1WXHA 5KIAA 4KQGA 4DAEA 5MFPA 1FMCA 1X7YA 4G8JA 1Z2OX 4JT8A 4K8RB 1OX4B 4IHJB 1Y5NA 1XF1A 4DMCA 3RHZA 2GHQA 5J5AA 1JJFA 1GKYA 3L0IB 1II8A 2BISA 2D8MA 3ETGA 2CF5A 4IUYA 2QUKA 3BRWA 5JCOA 1DX4A 5IRCD 4JXKA 5EEGA 3MT0A 1X74A 2YOGA 1B14A 1JZSA 3H5WA 3IUJA 2B69A 2M9MA 4YXFA 3LU1A 2W6NA 2NLOA 5IP5A 1JB9A 3C6MA 4UUMA 2I65A 5EJ4A 2C4UA 4OK6A 4QBHA 5FTMA 3FCOA 1GZHB 1Z83A 1ZN9A 2FEXA 2Z83A 4O2AF 5HTOA 1QGDA 4AUMA 1Q77A 2GK3A 4MO2A 1HT0A 2PZAA 3D4BA 2JJQA 2BGGA 4M76B 2DHDA 4R8VA 3WWCA 3BQ9A 4JP2A 1NONA 4TYPA 1P8JA 4L5JA 1CUVA 4L3WA 2WM8A 2YMQA 3ZX5A 1DL5A 2NO4A 4UQLA 3B3QA 2BZ1A 3OX3A 2QTGA 4JBWA 4HDSB 5DGCA 2WJ6A 3QE4A 4OP2A 4RV5A 1ZONA 5SZHB 2GD6A 1NUPA 5G4KB 3P52A 4IP0A 4P4GA 3G17A 3HVUA 3Q11A 3M5DA 3RABA 3S2GA 4ZO6A 4ENRA 5JATA 1YDEA 1Z8NA 3PEYA 5LCXA 1UBEA 4YFVA 4E5DA 5IF3A 2QVBA 4DGSA 4XCQA 3ESQA 3PGVA 5GMOA 4DA4A 3AEKB 4KSCA 1AUXA 5HF8A 1CZOA 2AVNA 3WBFA 3RU7A 2HREA 3PIRA 4IRXA 4NNOA 1XXHA 3WGVA 4GGPA 1RAGA 1HYGA 3N59A 1EHYA 3NAQA 4L2IA 5KSYA 2V45A 4PC3A 1E2JA 3S44A 3TDNA 3FTFA 1RXEA 1R4NA 4M88A 3HGQA 3NHSA 4GOOD 4WWHA 5ALUA 2UZ0A 3K8QA 4IKOA 5DNDA 5IM4A 4O33A 3V48A 4YHBA 1H9CA 5K4AA 1ZI6A 2P6PA 1LRLA 1IBLB 3OP4A 5TARA 3P9QA 5JCOC 1P77A 4UQPA 4QEKA 3F46A 4MW7A 1JQ3A 5EUBA 4LF6B 3R7WA 2ZAIA 3G8CA 2GDJA 4LGMA 4TWJA 1E1CB 1LVUA 2YJ4A 4X94A 2DWPA 4KEAA 5C7OO 3SEQA 1SOAA 1T5LA 2QAGA 1PZEA 1M33A 1KI7A 2VDNB 2WFZA 3K9FC 4GOXA 3ZZUA 5LR6A 3KR9A 5F98A 1Y5IA 2X1LA 3OQIA 1JDBC 4EY8A 4WD3A 3ESRA 3MMNA 2QSYA 1SBYA 3QYAA 4ZU3A 5CEJA 3LRPA 4Q1DA 5LOVF 4Q4JA 4ALLA 9GPBA 1AHNA 3IVAA 3DTYA 4IICA 4LHZA 4M6WB 1U80A 2G7MC 3IIIA 2Y66A 2QTNA 4HI0E 1N8NA 5HIIA 3STWA 3ZNOA 4DV4B 1K0FA 4DIEA 2P7HA 3T1QA 1GKUB 1M0TA 1SCQA 5CDFA 3UUWA 2NUAA 4RV9A 3QEMA 3H7AA 4V3BA 4AO8A 1C80A 1T8TA 4OHWA 4RJ2A 5IAAA 3MHTA 3S27A 1FPMA 1AJEA 1W36C 1KSGA 3R8CA 3FY4A 1EH5A 4JJZA 5EI5A 3DHYA 1J1ZA 5KC8A 5HS4A 4G5OA 1CY2A 2P9QA 1SU8A 1LF5A 1N6KA 2PKCA 1AA9A 3GJ4A 2AR0A 1NHGA 4G56A 1G21A 1KY2A 2JGJA 1DKLA 2OD2A 3S1LA 2V6GA 4DVGA 4JLKA 2QSJA 2WJAA 3NB0A 1N3IA 5B55A 4Y6PA 1ORRA 1EQ2A 4BVHA 7MDHA 3DVSX 3PWZA 2DHEA 4RWEA 3ZVLA 1X7YB 3MT7A 3EF0A 4E2FA 1USGA 4D41A 6CHYA 4QO8A 1OLSA 1E2DA 1II8B 3EHEA 5FPPA 4QFDA 1O94A 2VZEA 1X38A 3ELBA 4MV8A 4BMSA 4Q1AA 1E7MA 3IHTA 4UU0A 4YB8A 5ALDA 4DCJA 3UJ7A 3EXG2 5EQFA 1R16A 3ECAA 3F3MA 1X7XA 2AWNA 4YLEA 2OCPA 4QKQA 2QTWB 5TF4A 3BB3A 2YDYA 3WLRA 1D2CA 2PSJA 1U2SA 2GS9A 4IGAA 3WNZA 1L9KA 3N8HA 5ETJA 1Q1AA 2WOJA 2GN8A 4KAFA 1Z9BA 1SCUB 1IK4A 2CJPA 3IBCA 5BQOA 2AN3A 2ZS9A 3DVAB 5F77A 1KOFA 3TRDA 2FSSA 2JARA 3QVLA 4FFOA 2WT9A 4LX8A 1HX7A 3P5BA 1OZHA 2C2GA 3D8NA 4NMMA 5CDGA 3HA5A 4IOMA 4OB8A 2PQ0A 3TR5A 4EI7A 1WAMA 3C3AA 5FQOA 5E2BA 3LP6A 4HUQB 3UPDA 3KYCB 3NTQA 4PZLA 1JQAA 2IHVA 2JI9A 5DP2A 1JIQA 4A6DA 1PKEA 1J33A 2ATEA 2H54A 4C4XA 3B85A 4QYTA 2MINA 1WX1A 1UWCA 4WERA 3VMFA 2C88A 3K2IA 1ULZA 1G20E 5I5GA 4Q02A 4MRAA 3KSBC 1JIJA 2WTAA 5ES3A 1QHXA 2IV3A 4YA6A 3AQ4A 1N1MA 2Q8QA 2B1JA 1E3LA 3NGLA 3R3WA 4P34A 1O5IA 1QG4A 3HABA 1E1YA 2B94A 2AF3C 3K2EA 4INAA 1YBMA 4L28A 4MNTA 3RW9A 3ESBA 5DX8A 1OXMA 1XXHB 1GU0A 4UTNA 2Y93A 2WICA 1F2UB 2YJ6A 3THWA 3QG1A 3BWEA 1R4NB 4MV5A 2C31A 4MW2A 5EWJA 1U0LA 4ZVKA 2Z9BA 4GT1A 3SFTA 3SZRA 1XN4A 2ZYWX 1W8DA 5C31A 5KTMA 4JYAB 3B13B 4NU8X 1YIOA 1MVNA 2J5XA 1XZGA 1LTQA 3ABQB 1ORVA 3R7WB 2FCRA 2PJDA 2P5TB 1XQWA 3ASUA 1PZFA 3PWSA 4UZSA 3LT0A 5ALZA 3UJDA 4ZYXA 1VSTA 3EQ7A 2B4QA 3JWHA 3WB0A 4OP3A 1BEZA 1IVSA 3L93A 1S3SA 2MCFA 2RHTA 2QAGB 3V7YA 1MORA 3COZA 3G13A 2O54A 1NKVA 2OBLA 4N9QA 3UA3A 3IV7A 4K9OA 4X7PA 4YRMA 3BD9A 1NJ6A 2IJGX 3G1WA 4AZVA 4JBYA 1BN6A 2A58A 2C78A 2ON6A 3ZHXA 5ADWA 3Q2OA 3ROTA 3T4XA 3TSZA 1TCVA 3G0HA 4TYYA 3O8LA 5B1EA 4F04A 4BXOA 2H4YA 3O75A 2VBIA 3HLTA 4WOPA 5L3QB 1ECPA 3BHJA 2GPAA 1KEEA 4M1QA 4LDRA 1WV0A 3KM0A 1O9BA 3KE8A 4JC5A 4LHWA 3W2IA 5JSHA 4C7OA 2MDTA 3ZCSA 1KJNA 1KORA 1WNFA 2ID7A 1P6UA 5NULA 2NUAB 5KMGA 3ZU4A 5F12A 5EWMA 2C84A 3BDIA 1WQ3A 4ZQBA 2CMHA 2HOQA 1PU2A 4BFXA 5T3UA 3GGPA 3GT4A 5K8CA 3U44B 4EUEA 1UBLS 1A95A 5KNBD 3FYUA 1TK3A 2RC5A 2OT3B 4CDRA 4E13A 1SRRA 3DMYA 1Q1GA 1JS1X 4RIFA 1O54A 3TUZC 1R9MA 3PRYA 3KBBA 4HZIA 4WRRA 5GAJA 2A9FA 4LAFA 3WMRA 4AECA 4OI0A 3DCJA 3IJRA 3GFRA 3L1JA 4P4LA 2UUAB 2YS6A 3KTAA 3RIMA 1SOMA 1WEKA 3NONA 4G5YA 3IQXA 4Y98A 2Q9CA 3M3PA 3OCWA 4BNVA 4YT2