5L4NA

Leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
253
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Chroman-4-One Derivatives Targeting Pteridine Reductase 1 and Showing Anti-Parasitic Activity.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 95
structure length 253
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l4nA00
1HE5A 4DUPA 3ZI0A 4AJHA 2GN8A 2PH5A 3BHIA 4FS3A 3Q9NA 5BSFA 2I9PA 4DQXA 1L7DA 1O95A 4J7UA 2IRWA 4RO0A 1LDGA 3WIDA 2GZ3A 3SJ7A 3MJEA 1RKXA 4BMVA 4Q9NA 4OQYA 1LRKA 5JMWA 2G5CA 2X5OA 4KQWA 1LX6A 3ENKA 1DXYA 2D8AA 3DOJA 4FFOA 3EC7A 4GVLA 4J4HA 2HRBA 2R00C 3ADOA 4MIOA 1UAYA 3V8BA 2V6GA 5A3JA 3PWKA 3NGXA 2HAEA 3ZNNA 5K6AC 1BVRA 3P19A 2ET6A 3VTZA 3W4JA 3GN2A 1P1HA 1U3UA 1DSSG 4OAQA 1T26A 4XYMA 1P77A 4XR4A 5TT1A 1E3IA 1PWZA 3AY3A 1B7GO 2VRCD 1DO8A 3VKUA 2Y0CA 4MO2A 1A4IA 1ISIA 1Z7EA 5KVQA 3GY0A 1X0VA 4NJMB 5KNLA 2GRAA 5JY1A 4WUVA 1RJWA 4YBZA 4O1MA 2GLXA 4FFNA 4P8RA 5JS6A 2CDBA 2W8ZA 2YQ5A 5GY7A 3UFXA 3ZV5A 1RYDA 4Z3KA 4L9RA 2ZQZA 3LLSA 3PDJA 2ZYDA 3TZHA 3I6IA 3M2PA 2Y1FA 2JAHA 3QY9A 3DBRB 4NJOA 3WGOA 2R6JA 3INTA 1D1TA 3S2FA 4LGVA 1Z73A 1WNTA 2DVMA 1KVQA 2YHIB 5U1PA 5TLSA 3JSAA 3OICA 1ZFNA 4AG3A 2JD1A 3PZBA 2VZ9A 4ALKA 3PXXA 4DC0A 4HNGA 1PTJA 3DTYA 4PLFA 4RV9A 3VHRA 4R9SA 3AI3A 4PIVA 2HSDA 2GASA 8ADHA 1E1LA 5JFOA 4OXYA 2DFDA 1DAPA 5B4TA 1M2WA 2NU8A 5JLAA 1DHTA 3PHGA 4RLHA 4YT8A 2AQHA 3F9IA 4IMPA 2C0CA 4BNVA 1U3VA 1VM6A 1P1FA 1E3SA 5C7OO 4CM9D 3JQ7B 4RVDA 1LSUA 1HSOA 4LCEA 1E3WB 4CMHA 4PG4A 4WKGA 5DBGA 3H2ZA 1EDOA 4BS9A 2BI7A 3GNQA 4Y8VA 2VUTA 4D79A 2R2GA 1VJ0A 3DOCA 3E5MA 2DLDA 4E0BA 1I8TA 1UH5A 3NTOA 4IZHA 4D46A 3PRJA 4YDRA 3H2SA 3U4HA 1UZNA 4DQUA 4ZU3A 4N7RA 1DC5A 1O8CA 4YJGA 2NVUA 4RF5A 3TL2A 4CV1A 4DBZA 1E7WA 2FY8A 4BIIA 1ZXLA 1QYVA 4IGEA 2X5KO 4MDHA 1NM5A 2I5PO 1SPXA 2AW5A 1JKFA 3JQ9C 1LRLA 1U4OA 3C1TA 5G0UA 2NTNA 4ZN6A 2XOXA 1V0JA 3E03A 4OQZA 4ZQHA 3F5QA 1ADGA 4UVDA 1PZEA 3ZWYA 5C37A 1OAAA 1BW9A 3JV7A 3LU1A 5L7TA 1MFZA 1JLLA 3VKVA 1X7HA 5AXBA 2YDXA 1DIGA 1YB5A 2C5AA 4PFJA 3MJVA 1E6UA 2X0NA 5ILGA 4E2ZA 5IDQA 5LDHA 4PLHA 4GLOA 1D8AA 4IQ0A 2I76A 5DP2A 1XYGA 4OMUA 4GKBA 1I3LA 5JYEA 1KVSA 4ALNA 3FF4A 3GOHA 1QP8A 4JXKA 2BMAA 4RF2A 5HTOA 1B2LA 4W7HA 1QYCA 1GZ4A 3RKRA 5DT9A 3VDRA 5JNLA 4LISA 3I5MA 1EDZA 5TX7A 3D5QA 4IIVA 4F6LA 3WNQA 1OFGA 3FNFA 1X7GA 1BXGA 4CMCA 1K6IA 3JQGB 3K30A 3RROA 4BKRA 2OBYA 3OJFA 4J49A 1TVEA 2VCYA 2X9GA 3AOEC 3N58A 5IXSA 3JYQA 4JLWA 4KTVE 4WPGA 4CMBA 4M1QA 1PS0A 1PL7A 3LT1A 9LDBA 3FN4A 1Q7BA 1HDGO 4MINA 5F1OA 4D42A 1DAOA 1NBOA 5MDHA 2O50A 4MIYA 2NADA 4FB5A 3RUEA 2Z5LA 1P3DA 1C0IA 1ZJYA 2D59A 2WM3A 3KXDA 1ZSYA 8LDHA 2FP4A 4BO2A 3CXRA 3P2OA 1DB3A 4II2A 5ENVA 1IZ0A 1NP3A 3RC7A 3HZZA 1EE2A 3DC2A 3I9KA 1C1XA 3WGQA 2DQ4A 3OJOA 5ICMA 4CQLA 1ISJA 1S6YA 1UXGA 5T8KC 1O9BA 2GNAA 4H16A 1ZO8A 4NBRA 5LCXA 2XAAA 3ZWBA 3EAGA 1L1FA 4EEXA 4RVHA 1SOWA 3ITDA 3QW2A 4L76A 2DTDA 5JAZA 2RH8A 3NX4A 1SAYA 3L9WA 1ISGA 4UVGA 3DMYA 2FPPA 2WYUA 3MJ4A 2YW9A 2GN6A 1RM0A 3GVPA 4GKVA 1NWCA 3C7AA 5L9AA 3JQAB 1V6AA 1KC1A 1NX6A 2OP1A 2AEMA 6LDHA 2G0TA 2ZTLA 3T4XA 2EP7A 4EZBA 3GG9A 1P1JA 1YDEA 1D7OA 3IUPA 3B70A 1JWBB 3GR6A 1YBAA 1TEHA 4RVSA 4H15A 5C3MA 5L53A 1HYHA 3WXBA 1UXKA 5EERA 4ZQGA 1PQWA 3UGKA 3RU9A 1EUDA 1IE3A 3TOZA 3WGYA 5LDGA 3CPSA 4BMNA 3KYBA 2FN7A 3GRPA 4UAGA 4UVHA 3EUWA 1DIAA 3RJ9A 4DGSA 4CODB 1M75A 1CWUA 1RM5A 4E4YA 2O48X 3FNGA 4IMRA 3GZNB 5IDWA 3PFFA 1DC6A 3ZNOA 1QMGA 3ETGA 3DBLA 4NPCA 3ETEA 1ZK3A 2RAFA 4MKRA 4BGUA 2BF7A 4KQXA 1LNQA 4OH1A 3F4BA 2HMVA 2RH4A 1G0NA 2JCXA 3E9QA 5F1KA 4YR9A 3VZRA 3WYCA 1U1IA 5F1PA 1BVUA 4AJIA 5BSHA 4UUOA 1VL0A 3R3JA 2D5CA 3JCZA 1J49A 5ADHA 1AHHA 5KJCA 5T57A 1T25A 1H6CA 5CDUA 5EMHA 5T67A 1LC0A 3I9OA 1J5PA 3BMQA 3BMCA 2EJVA 1GAEO 3DWFA 2D1YA 2FHSA 2JD2A 1YOVB 2I3AA 2RHRA 3NJ8A 4FGSA 2O3RA 1IPEA 3ZU3A 1DBVO 3B1KA 1EVJA 5COAA 3MEQA 3WLFA 4R1SA 2BFAA 2IODA 2J3KA 3VPGA 1F8GA 1YS4A 1XWFA 3ROKA 4XX0A 3K31A 4YCAA 2VHWA 2WSBA 3PHLA 4BNJA 5JC1A 3PLNA 1MX3A 1U28A 1NFQA 1IPFA 1J0XO 1LQUA 1W6UA 1NR1A 3BA1A 1HDOA 4IY1A 3X2EA 3Q0EA 3IOYA 3ZWAA 2J8ZA 4J16A 4MVJG 5CPFA 3F47A 1HLDA 1E7SA 1Y8QA 2QRLA 4ZICA 1EVIA 1W73A 4YPOA 2YJZA 4KWIA 4PRKA 2VTEA 3RWBA 4ZHSA 4O6VA 3NRCA 1M66A 1Z7BA 3SLKA 3JQAD 1QG6A 3PQEA 1Z45A 4MVJI 4R1TA 2DUUA 3DBHB 3QVTA 1RM4A 3RKUA 5IXYA 1PR3A 2ZCVA 1PZFA 4BO5A 3E1KA 1DLJA 3KV3O 2BGMA 4YT5A 3PJFA 3WICA 4B3IA 2RHCA 3W6UA 1DIHA 3H3JA 3U62A 4QSMA 1E5QA 3E9NA 4HWKA 4JBGA 2WJPA 3H4VA 1PJSA 1SNYA 5HRUA 1BWSA 3EY4A 5A05A 4A10A 4CL3A 1V3UA 4NK4A 1EVYA 2NWQA 3JYNA 4KP7A 4GX0A 2EGHA 2WD8A 4O5OA 4EYEA 5KVCA 3OHSX 2Y1EA 4MKXA 4Y6SA 3UW3A 4C7JA 5KVVA 4PLTA 1DIBA 1C14A 1T24A 1C1DA 5JCJA 4M86A 2VUUA 2FSVA 2Y93A 2Q1SA 3U5TA 1CJCA 4Q3BA 1XSEA 3DONA 2OGUA 4DXHA 2J3HA 4QUKA 3VH2A 1VE9A 3VPSA 3L4SO 1ISFA 1VI2A 2NQ8A 4YT4A 5JBIA 4B7UA 3H5RA 1A9ZA 3QV1A 1R0KA 2YFQA 5KOIA 4CMEC 1U2DA 4DMMA 1PSDA 4W4TA 3S2EA 4RVGA 3QVSA 1GCOA 4F46A 4EBFA 2PGJA 3DZHA 1KVUA 1LDBA 1L7EA 2JL1A 3DZIA 3I52A 3H9UA 1A5ZA 2DBQA 1MV8A 2VYNA 5JO9A 2VYVD 3TF5A 4C4OA 1T4BA 2JJYA 4ALIA 4DQVA 5A03A 4AJEA 2NVWA 5G0WA 3AK4A 1HKUA 1E7RA 3G3EA 4GWKA 4O63O 4U6SA 3ORFA 3O8QA 4BKPA 1SOVA 5A3VA 2VRCA 1H6BA 1HF3A 5HBRA 1X7DA 4KDEA 3V2HA 4TWRA 3VVBA 4LVUA 3CH6A 4Z6KA 4FFRA 3QWBA 3WFJA 2WYWA 5TIIA 4WE3A 3O38A 3CUKA 1FF9A 1O0SA 2GZ2A 1V3VA 3DAGA 1B14A 2JFGA 4R16A 1LXCA 3PWSA 4KZPA 2GSDA 4IJKA 3NKLA 3WYBA 4NZ9A 1GFSA 1U4SA 4ILKA 5IZCC 3HQ4O 2X8LA 3OEYA 4ZVVA 3ST7A 1MC5A 4P38A 4PLVA 3C3XA 1WAMA 4FCCA 3KEQA 1NQTA 1M6HA 4XB2A 3VH1A 3Q9UA 1HDYA 2DPGA 3L9XA 1QV7A 1ZXBA 2F00A 3GG2A 1E7MA 4IDDA 1F06A 1YRLA 4IPTA 1CRWG 1OI7A 3LYLA 4JBIA 1NWHA 4R3NA 3O4RA 2AQKA 4PG5A 2UUPA 2YDYA 2HKIA 3AU8A 3G79A 2O3JA 4TRMA 4UVEA 4FFMA 2C54A 4Q3CA 4S1VA 4OSOA 4DPKA 1VSUA 3ZWWA 4XQGA 3DFZA 4YB8A 4YQZA 1B15A 2YV2A 4BNFA 2EERA 2Q46A 4M55A 1N7HA 4KMSA 2OZPA 3ONFA 4BNTA 4RPKA 3BIOA 1GL3A 1KEUA 5F3RA 3WIEA 4D0SA 1V9LA 2JHGA 3NTRA 1KYQA 3RUIA 4ZA2A 4L4SA 2W98A 2AEJA 1PZHA 3ZV3A 4R69A 5L4NA 4MVJH 4NFYA 1PS9A 1ENOA 1B3BA 5KVSA 5I7VA 2FRDA 2A94A 4XJTA 2C82A 3OQ1A 3CKYA 3ULKA 2OO5A 4BV8A 1PL6A 3SJUA 4CMGA 3UXYA 2B69A 5FWNA 4NFHA 3K2BA 2GN4A 5BSGA 3PWZA 1F0YA 3T4EA 1UXJA 4G2NA 5F5NA 4CMJA 1AN9A 1PJ2A 2D3TA 1MUUA 2RCYA 2IYOA 1K0UA 5DCUA 1QYWA 2HK7A 3BMOB 4JN6B 4J90A 1ZMTA 4BO8A 3AM4A 1IY8A 4BNWA 5ILOA 3GAFA 3AI2A 2TMDA 3C24A 1NFFA 3INRA 4J2OA 2B0JA 4KUEA 2JAPA 5KWEA 1P45A 3F6YA 4X54A 1O6ZA 3AUTA 1AXEA 1QYXA 3DZBA 4HADA 1IOLA 2A35A 3D5TA 2V7PA 3KLMX 3PHJA 5A4DA 3E8XA 3AI1A 4WOKA 5EN4A 3D4NA 4WEQA 4ALMA 2PD4A 4EJMA 4XEHA 4Y67A 3GHYA 3KUXA 5F5LA 1K5HA 1N9GB 2Q4BA 5T5QA 4DA9A 3NTQA 4BL5A 3WB9A 5I8ZA 1YO6A 3JQCA 4HFJA 1HE3A 4GLLA 4PZCA 2Q49A 2A9FA 3OQBA 4FW8A 3O03A 4NI5A 1D1SA 2AQIA 2LDXA 2D5AA 2G1UA 4YRDA 1NAHA 3DDNA 4QO8A 5I8WA 1NXQA 1BXKA 1FDUA 3PZRA 4RPHA 3GPIA 4DYVA 2D0IA 5KKCA 4HFNA 1DLIA 4BNIA 1KVRA 3H9QA 4CM8B 2EHDA 1UXHA 5G4KB 2QX7A 4HNHA 2GF2A 3DZGA 4YACA 4GSKA 4MP8A 1P1KA 5FYDA 1DC3A 3GMSA 3GUYA 4ID9A 1NYTA 3WFIA 4MVJM 3JD4A 1WPQA 5A9SA 2QIOA 2Y0EA 3HUDA 3EZLA 1BXZA 1LLDA 4KUHA 2GO1A 4XZ3A 3HG7A 4D7AA 3ZHZA 4HX5A 4YVFA 1ZUD1 4EJ0A 3JD3A 3ANLA 3D4PA 4RL6A 3EZYA 4RQTA 3LC7O 1WDLA 1YL7A 4YYZA 2HJSA 3F3SA 5L4LA 3BTUA 1PIWA 5IDYA 1TT5A 2E6UX 4CMIB 3V5NA 2YV1A 3JQ6A 3FBTA 5A5EA 3AOEA 5ITVA 1GQQA 1JQBA 3QVXA 2PTGA 1C0LA 3RCBA 2DPHA 5U4QA 3TFQA 1SCUA 4YJHA 4E5MA 4XDYA 1LC3A 1XCBA 2X23A 4L74A 1GPJA 4IJWA 3KYDA 5AVOA 1H6AA 4BMSA 4IS3A 3GGPA 3DBVO 1E92A 4PVDA 3UOGA 3AU9A 4KTTE 5JAMA 4MOWA 4J4BA 2D2IA 1A72A 2IXAA 3QLJA 2Y1CA 1VKOA 2H63A 1Q2XA 1IHYA 2BH9A 4IQGA 2AMFA 3AUSA 3MJCA 2OL4A 2CF6A 4E5PA 1PR9A 5ES3A 1QKIA 3S55A 3H9EO 4E3ZA 3SBOA 4URFA 3BXXA 1AE1A 6ADHA 4IXTA 3GFGA 2JCVA 4LK3A 1NPYA 5T8KA 3QRWA 4J2HA 1NHGA 4E31A 2QZZA 1YQGA 2JCYA 4B79A 3SVTA 2QG4A 3JQGA 3PIIA 3V1TC 1U8XX 1JDJA 1JU9A 4IBOA 4AVYA 4ND4A 1GY8A 4QO7A 1QYDA 2PWZA 2UUOA 4N5MA 3Q2IA 3MJTA 4OL9A 3FRJA 3PVZA 5JDIC 3WTBA 5IJZA 2VWHA 3JQFA 4FJ2A 2UYYA 1UAGA 2I66A 4OGWA 5TQVA 4FFLA 3T7EA 3EYWA 4WECA 2X7HA 2J3IA 3ZV6A 4YJFA 3JD0A 4BKUA 3VTFA 4AJNA 1N2SA 4GX5A 5HS6A 1WLYA 2GN9A 5K9ZA 1P1RA 5GZ3A 3ZU4A 5CP8A 4XGIA 1GTMA 1J6UA 2EIHA 4JQCA 2EWMA 1LDMA 2C5EA 1X1TA 1Y9EA 4J1QA 2NQTA 1ULSA 3WSVA 1I3NA 3NDJA 3IJRA 3JQ8A 4NNJA 3IP1A 2FPGA 4BOYA 2CF5A 4Z9FA 1GQYA 1IHXA 4CM6A 4DMLA 5MGBA 3LLVA 2O2YA 3QJ5A 4CM4B 5KIAA 1JVSA 3MOGA 5HA5A 4YQYA 2HMUA 5FFFA 4BNMA 3JQAA 1XIVA 2CSUA 3KYCB 1KS9A 4W82A 1OMOA 3RAJA 4E30A 3ZH2A 2ZK7A 1VL8A 5T64A 5JC8A 5DBFA 3E9MA 3I9MA 1WXDA 1WZEA 2BELA 4I08A 1E1MA 1A7KA 1MG5A 4ESOA 1I2CA 3COSA 7MDHA 2O7SA 3FWZA 3H9JA 3IKVA 2E37A 5DBIA 1WVGA 1SBYA 4EW6A 5DZSA 2ZB3A 3RIHA 2YFHA 2ZTVA 4RPLA 2BGLA 2ZATA 4P22A 4IDFA 1OC4A 1Q0LA 1DRWA 1E6EA 2JD0A 3RUFA 2X5JO 4IDAA 4AJJA 1UDBA 3ZW8A 5ENDA 3GZNA 4J0EA 4ZD6A 1PJ4A 4QEDA 1GR0A 5CDSA 1OOEA 3NT2A 3ZWXA 3Q11A 1NPDA 4YAJA 3FPCA 4K1LA 2AXQA 3HDJA 2VWPA 4TSKA 4PG8A 4LW8A 1ADBA 2PK3A 2PY6A 2OHXA 4XGKA 1EK6A 1HYEA 3RJ5A 2CFCA 3GF4A 3C85A 4E13A 1YGYA 4IDCA 2J5QA 1HYGA 1TXGA 3GT0A 3QQPA 4R1NA 3U49A 4WGGA 2PKQO 4BNGA 2NLOA 3PJDA 3BYZA 3UKOA 1YXMA 2P68A 3SEFA 3DFUA 2Z95A 3B1JA 2PKRA 3HB4X 1NHWA 1K89A 3QHAA 3JYLA 4YTEA 5IG2A 4OO3A 3R6DA 2GD1O 3GVXA 4NU6A 4B4OA 1LRJA 1PL8A 2YV3A 3ON5A 4W7IA 3FCOA 3GFBA 4YAEA 2WE8A 3KOUA 3ZWCA 2AA3A 3WBFA 3UCEA 4EUEA 3RFTA 5L51A 1Y9AA 1EBUA 4ND1A 3OJ0A 4J1NA 3F5SA 1NVTA 5B4VA 3A06A 3OA0A 1GUFA 5G0VA 3V1UA 3BMNA 4BV9A 3HN7A 2QRJA 4Q39A 1T2DA 3S2IA 3ZWOA 2CMDA 4NFSA 4WLVA 4A03A 4KOAA 1XQ1A 1Z74A 1GD1O 4JJGA 3OA2A 3D3EA 4MVJA 4KDFA 3GDFA 1E3JA 5B4UA 4J7XA 5JYDA 1ZW1A 1PJCA 2O3UA 3AFNA 4WLEA 1GZ6A 3ONDA 4IDGA 1DEHA 3ITKA 3JYOA 4XD2A 5DDIP 3V2GA 4CMEA 5G2OA 4GMFA 4EJ6A 2H1SA 3ICCA 4PLWA 3NT4A 4DIBA 4GGPA 4WNIA 2IZZA 3DB2A 1W8DA 3TZ6A 4ITUA 5TJ9A 5BNTA 3A4VA 1TB4A 2GUGA 4XIYA 3FBGA 1H9BA 1XU9A 3MWDB 2PLAA 4XKJA 3WQSB 5IZ4A 1IL0A 3KSDO 2B4RO 2EXXA 3NDRA 1YJQA 4CM3A 1HZZA 1PQUA 3U4IA 4A0SA 4DTIA 3UAGA 1OZAA 2O7QA 2GERA 2ZIZA 4LN1A 4RDHA 1B16A 3IKTA 2DBRA 2Q2WA 4BB6A 1JVBA 1R6DA 2DBVO 3JYPA 1QORA 2ZYGA 1LSSA 2P9GA 3WMXA 1MC4A 2PR2A 4ZRMA 4TRNA 3JQEA 3LT2A 4JBHA 4K6CA 4I5DA 4IJUA 5EINA 3JD2A 4U5QA 1MG0A 2P9EA 1P74A 1JKJA 4Q3DA 4M89A 1E6WA 3TZQA 2C29D 2FR8A 2VNSA 4XWYA 3ZU5A 4HFMA 3F4LA 4TKLA 2EGGA 3QE3A 2W4QA 3DO5A 5IZCA 4RGBA 1ADCA 4U8GA 1PGJA 4YT2A 2FOIA 2VHZA 4UEJA 4K6FA 2XXBA 1G6KA 4FDAA 4IDEA 1GYRA 1VRWA 2G82A 4YJGB 1CQJA 3DZKA 4Y9DA 3QP9A 4ND3A 1K6JA 1KBZA 1BGVA 4CMKA 1LQTA 1D3AA 3SLGA 3TJRA 1MA0A 2BLLA 2HUNA 3QVWA 3DAPA 2HLPA 3WGHA 3RUHA 5IFLA 1Q7CA 1SEVA 1HTBA 4CLOB 1BTOA 1ISHA 1A4UA 2W2KA 2J6IA 4QFDA 4FPXA 4Z9YA 1VLLA 3GLQA 4CJXA 4CM5A 1QRRA 4UREA 1AHIA 2FMUA 3LF2A 3S2GA 1BW9B 1OC2A 4NG5A 3CZMA 3E5RA 3DAFA 2C2YA 5AXCA 1TI7A 4HBGA 4MKZA 2WD7B 3PP8A 1Y7TA 5AQ1A 1DJNA 1N1EA 3VDQA 1ZIDA 3NAQA 3AWDA 4L75A 2BHLA 1ZK0A 4QT0A 3H9GA 1LSOA 1I2BA 4E12A 4YA6A 2ZB7A 2Q1WA 2NTVA 3E82A 4RZIA 2W2LA 5AXDA 2E4AA 3BHJA 1ZK1A 4IUYA 1ZMOA 3U09A 1VJTA 2DC1A 2VHXA 4GH5A 1PX0A 3ZN2A 3GPDG 3FPLA 2H5LA 1YL6A 1O5IA 1IZ9A 5G4LA 1H9AA 4Z9XA 3FR7A 1BXGB 4XYGA 4Y6PA 4DLAA 4MVJE 3I3OA 3MJSA 4OSPA 1GQ2A 1KY4A 2O3SA 3WSWA 3QWHA 5A04A 3K9QO 4NMHA 3NT5A 3FI9A 4ZQFA 4YWJA 4PG6A 4ZGWA 3GDGA 1R0SA 4A5OA 4BUCA 4BO6A 1RPNA 3GA0A 4NK5A 4WOJA 5CEJA 3CIFA 3RU7A 1JN0A 2CDCA 1E5LA 3GDOA 5HWSA 4YXFA 2VUSA 4BO1A 2Y68A 3E18A 3WWZA 1R4NA 4YRAA 4GL4A 3SXPA 3IMFA 3OH8A 1HEUA 4CLDA 4AJ2A 4EUFA 2ZJ1A 1NNUA 1C1XB 2DAPA 3EDMA 4E5YA 1W0CA 2EW2A 1SEPA 1ZNQO 4J9VA 5DN9A 3DR3A 1T2EA 4CV3A 4CQLB 3ROPA 3K92A 4I8XA 4NBWA 4U6QA 4UEOA 4LRSB 3ZGYA 3RASA 3I4CA 1DRVA 1PGOA 4RJTA 3AY6A 3MZ0A 4PZEA 2OFPA 4PVCA 2XPCA 5CHEA 3L4BA 4XB1A 1X14A 4A7PA 2AE2A 3C1AA 2PD3A 2VN8A 1O94A 2C2XA 3ROQA 4NBTA 3M6IA 1RM3A 4R9RA 4E33A 2Q1UA 1ENPA 1EK5A 1NFRA 4BNYA 2TMGA 2AQ8A 3ETDA 4MIEA 3WGIA 4XJSA 4WCFB 4P4NA 3KM0A 2ZYAA 4JJIA 2Y99A 4O59O 3RFXA 2HK8A 2O3TA 3OETA 4RF3A 5KJEA 4EEZA 2WMDA 2J5RA 1N9GA 4IGFA 1IB6A 1DFHA 3SC4A 2H9IA 1XQ6A 3C7CB 3I23A 4E2XA 4TZKA 3EK2A 2V6BA 2CUKA 2NVBA 2VT3A 4UUMA 4CLHA 4TROA 1HRDA 3BZUA 4CUZA 3OJEA 4XYLA 3GUCA 1QSGA 1U2GA 3ZV4A 3NGLA 3FNEA 4YJDA 4BQRA 4NH4A 1I5RA 4LSWA 4TRJA 5FI3A 1KOLA 1WZIA 4GBJA 4NBVA 2C7GA 4BNHA 4M54A 5ER6A 2EF1A 5IDXA 4JROA 3DEYX 1PJLA 3DBLB 1GADO 4UVIA 5JE8A 1JTVA 5TJHA 2P5UA 3UHAA 3TSCA 3VAZA 4E5KA 4WCFC 1U3WA 4PGFA 4CM1A 1SB9A 1H2HA 5FI5A 5G4KA 3RBZA 4RPGA 3WS7A 1GYQA 4A73A 4B4VA 2X9VA 4NIMA 5LC1A 3KBOA 3LC1O 3O26A 1PS8A 4CV0A 1P0FA 3WG9A 4QFCA 2LDBA 4XGNA 1VSVA 3WBBA 1QV6A 2R00A 3S8MA 2VWQA 1WMAA 4GPD1 3I9LA 4IINA 1ZBQA 5EJ2A 1NAIA 4CPDA 5FEUA 4DLLA 5K6AA 3BMQB 3OIFA 1P9LA 1HE2A 3JTMA 5KJ1A 3FD8A 4A2CA 3PJEA 2QYTA 1VPDA 1GZ3A 1LA2A 1I2ZA 4C7KA 4CQMB 4ZQBA 1T2FA 5EIOA 2Z1NA 4CM9A 2IYPA 2AG8A 3GGGA 3ZHXA 2J3JA 3ANNA 3ZHBA 1YE3A 4MVJP 4CMIA 3RUCA 2FWMX 4N5NA 3HADA 1I0ZA 2DTXA 5TRTA 3PI7A 3RD5A 3AJRA 1H2BA 2FR1A 3GVHA 5JDIA 2E49A 3NJ4A 1GUZA 3EHEA 2NUAA 2C07A 2QYSA 2VQ3A 1CERA 3ENNA 1QR6A 2WTBA 5I9MA 3I9NA 1Y8QB 3FTNA 3AW9A 3D4OA 2NV6A 2QRKA 1BG6A 3GVCA 4R4JA 4ROSA 4WLUA 3PK0A 3KB6A 4CLRB 3C7DB 5BT9A 2UV8A 4BKQA 3OQ6A 5TGDA 4H7PA 4CV2A 2B5VA 4OIMA 1E77A 5H82A 4BNZA 9LDTA 4PN3A 4JNKA 1XEAA 5KJ6A 1A27A 4CR6A 3M2TA 2PZMA 2PZLA 3L0DA 1DFIA 1CDOA 4NU5A 2NU9A 2HK9A 5A02A 1I24A 3VVCA 3RI3A 4L0QA 2FPIA 5L45A 4R54A 3HB5X 1N1GA 2X0IA 1F8FA 4D41A 2RBEA 4PCVA 5JAIA 4NJMA 2V65A 1ARZA 3D3WB 5DOVA 3OEWA 2PFGA 4KUGA 1C1DB 1ZKMA 1R66A 3FR8A 4ZJUA 3RFVA 2V6MA 1Z75A 3K5PA 4GQAA 4DIOA 4OOEA 5GMOA 1A71A 4EITA 3PEFA 1B26A 4WCDA 3ABIA 3DBRA 2V6FA 1PJ3A 4Z0HO 5IAAA 2YHIA 4HV4A 1PWXA 3HSKA 2JKVA 3UF0A 3BAZA 3F46A 3PDUA 4FJ0A 1HT0A 3HFGA 1A9YA 1JWAB 4Y6RA 5CG2A 4L4RA 2YHUA 3MCVA 2B36A 2I67A 3OFSA 1EFLA 1PGQA 3JQ9A 5EESA 2OBNA 2VTDA 4EDFA 3TNLA 3KZVA 5GZ1A 2HDHA 3L07A 3IS3A 4CQMD 1CYDA 4IIUA 3PQFA 5I7FA 1X13A 3AOGA 4A26A 3O8QB 1YBMA 3JQ7A 3Q1LA 2HMWA 3KYCA 1Q0HA 1E1KA 1E3WA 2POQX 1I3MA 3RC9A 1C3VA 1PJTA 2QHXA 5TF4A 1W4ZA 3WJ7A 1JA9A 1ENZA 3KO8A 1IYZA 1U7TA 3I4FA 2VZ8A 1G0OA 4II3A 1PJQA 2JFFA 3JQDA 4G81A 2IEDA 4OM8A 4AJPA 4DPLA 2OUIA 4BQPA 2E48A 1P31A 3NYWA 3P5SA 2Q99A 1R12A 3WMWA 5DP1A 3Q2KA 1XDWA 2FR0A 3CMCO 1PGNA 4FFPA 5JDCC 1M76A 2CZCA 1P44A 4G65A 4D3SA 1LJ8A 4DC1A 1XHLA 5A5FA 4BKOA 3MOIA 4CR7A 3G0OA 3WWYA 5TSDA 1XA0A 5CDGA 4R51A 4JX8A 3AUAA 4I5FA 3WX0A 4FC6A 3W4KA 2NM0A 4TVOA 4BNNA 4K26A 3ZWNA 3U9LA 4J4TA 1HDRA 4BGIA 2PH3A 1DHRA 5HS4A 1I33A 3OIDA 5CEFA 1V3TA 3Q3CA 3PYLA 3WQQA 4RF4A 1LEHA 2EKPA 2AE1A 3OF2A 3H5AA 4HY3A 4OYRA 4CM8A 2P91A 1GV0A 1H5QA 1EQUA 3GRKA 3QVOA 1HETA 1V8BA 1AUPA 1LDEA 4U0JA 3E48A 4XYBA 3RUDA 2DKNA 4QECA 4TZTA 5ER9A 3GVIA 2ZTMA 2A92A 4E21A 3VC7A 1C0KA 2VHYA 3ICPA 3ZHYA 5JMPA 4R1UA 3GEGA 1ONNA 4O0LA 3TDKA 2Y1DA 4FBGA 2B37A 1EZ4A 1ML3A 5ITWA 1BHSA 2QZ9A 3GHHA 3H8VA 1Z6ZA 1F12A 4QQRA 4DPMA 1MLDA 1H0KA 4IDBA 3B6ZA 4CL8A 4YEDA 3RSHA 2B4QA 4DRYA 1YQXA 1GEEA 5JXWA 4J3FA 3UICA 3R0IA 1FDWA 3VZPA 2VYND 3NEPX 3NDIA 4PG7A 3WYEA 3A14A 3M1AA 1NR7A 4J0FA 1ZH8A 2BFMA 4FN4A 3TOXA 2QQ5A 5I7SA 4ZRNA 3NUGA 3W6ZA 1DIRA 2PD6A 1FDVA 3A9WA 4J1SA 4Z0PA 4AICA 1JAYA 1XKQA 4HUJA 5L3ZA 2YY7A 3HE3A 3D64A 2VT2A 3TL3A 1D4FA 3BTOA 3F1KA 4F45A 5DOZA 4RVUA 1K2WA 4HKTA 5TT0A 4B8WA 5B1YA 4J91A 3DMTC 4FOSA 1LLUA 1MXHA 1R15A 3TZKA 1UXIA 1X15A 5U9CA 3FNHA 1QXSA 4TVBA 3N74A 1YBVA 4TKMA 4PLCA 3GZ4A 4B4WA 4CR8A 1X0XA 2XXJA 4MVJF 1T1RA 3GGOA 3RUAA 5I7EA 5L7YA 3L6EA 1O89A 1LDYA 3F1LA 3GEDA 4Q3EA 4AJLA 4B7XA 3QIVA 3STHA 4DBVO 2VZ0A 3KSUA 1CEQA 1CIVA 1GYPA 2UVDA 2NACA 1NASA 1E0DA 3D0OA 3HDYA 4JK3A 4JP3A 3SC6A 1B0AA 1YVEI 1U7HA 4XR9A 3UCXA 2I6TA 2Z1MA 3QA9A 4QTZA 4BHTA 3U3XA 3DZFA 4GMGA 4S3MA 1HDZA 3ZNQA 5DF1A 3H65A 3OBBA 5G0SA 4D0RA 2WE7A 4BNLA 2O23A 3ASUA 3IJPA 5EPOA 2EEZA 3PHIA 4GWGA 4N5LA 2P2SA 4IJVA 1HDXA 2DT5A 4CUJA 1RWBA 1R16A 3OM9A 4LVCA 5H83A 1Y81A 1MXFA 2P4HX 3KRTA 4IS2A 1ENYA 1FJHA 2IZ1A 3I1JA 1YB1A 4I5EA 3RC2A 3PLRA 3V2UA 3VH3A 1MB4A 2BKAA 3D7LA 2HO5A 5A9SB 4BO7A 1R4MB 4GAEA 1Y8RB 4GI2A 2XF8A 2IDZA 3E6AA 2HJRA 1OBFO 1ZVMA 3LZ6A 1CETA 3ASVA 1NQOA 3FTPA 5JO0A 2JFHA 1KEWA 3GMDA 2WWRA 4PLZA 3ZWVA 1NVMB 2VWGA 1YKFA 5KKAA 4E32A 1TA4A 4CLXA 1TT5B 1Y5MA 1ONOA 2ILTA 1DFGA 1B8PA 1DRUA 4CLOA 3DZJA 3PJGA 2VYVA 3B1FA 3JQBC 3PGJA 5JAQA 5C5IA 3D1LA 5C7LO 3DHYA 5FF9A 1KETA 1YOVA 1Q7GA 3DHNA 1ONPA 2WD7A 4YJHB 5DNAA 5L7WA 4H3VA 4B7CA 2O4CA 4D3DA 1UZLA 4OKNA 3CMMA 3WGZA 1I3KA 1UDAA 2P5YA 3KYDB 1WW8A 2Y67A 5BNIA 3I83A 2X4GA 4YAIA 2B35A 3U4DA 1LTHR 1K3TA 5BSEA 4YAGA 1NTOA 4RPJA 1UR5A 4I9NA 5AXAA 5A1TA 5L95A 2AEFA 2FZWA 3GAZA 4WASA 2B5WA 4J43A 1KY5A 1MP0A 3C8MA 5GZ6A 3TRIA 1GUYA 5BQFA 1LDNA 2Y1OA 4W9NC 4DREA 5B12A 1UUFA 2HMSA 3ZU2A 3R1IA 1BMDA 2GGSA 3HJAA 3INGA 1PZGA 3DBHA 1P1IA 1LI4A 1SO8A 4FGWA 4OHUA 5T6BA 4L4XA 3TQHA 5TC4A 4BO9A 1F14A 3LC2O 1I30A 5BNFA 2GCGA 1ZJZA 3CEAA 4NBUA 2DU8A 1KC3A 1HLPA 4PLGA 2IE0A 4R5HA 1ISMA 2CNBA 1AXGA 3ZWPA 2OORA 2ZQYA 3R3SA 4YJFB 3GNSA 2YQ4A 3IP3A 4AJKA 5HM8A 2OMEA 4R3WA 2X6TA 2HCTA 3LSYA 3UVEA 1SZJG 3CSDA 4LSMA 3W8FA 1PGPA 1NQ5A 1EEHA 1ZK4A 2Q45A 4XA8A 3UCFA 3WOHA 1PQPA 2PGDA 3EW7A 3LT4A 4PZDA 4R68A 5H81A 3WQRA 2Q50A 3ADPA 4BGVA 4D45A 5I9LA 3NV9A 1MGOA 5G0TA 2GR9A 2B83A 5IN5A 3RBXA 1XR3A 4PRLA 1ZEMA 3JQ8B 4R01A 4XYEA 1U3TA 4FD3A 3DQPA 4P4GA 1DOHA 3G49A 3PGXA 1YWGO 5DCYA 4WLNA 2WYVA 3AM5A 1WP4A 2C7VA 3JQFC 1N8KA 4FR5A 1PJBA 4I9HA 5AOVA 1FMCA 3A28A 1BDMA 2Q2VA 1PU2A 2I99A 4RLSA 4BO4A 3PYXA 5CEEA 4WCFA 3GC6A 5EL0A 5JSFA 2CVQA 4DL9A 2YZ7A 1XU7A 1U8FO 4JP2A 3VPFA 2FZEA 4YRBA 4E6PA 4K28A 2D4AA 3P2YA 1XELA 1EQ2A 1WDKA 5AYVA 3X2FA 1ZSNA 5DCWA 3PQDA 4XIJA 1QLHA 3BTVA 4NDNE 4Q3AA 2NSDA 4W6ZA 4CMAA 1GV1A 4I1IA 5DULA 4ONEA 3TN7A 3GH3A 2NVUB 3HFSA 1A7AA 3EGOA 3I9JA 2X0RA 1T4DA 3QWFA 5K0ZA 4LRTB 4R41A 1NPTO 3U0BA 2ZJ0A 3OSUA 4AJ1A 3BTSA 4BNKA 5A06A 5CDYA 1EE9A 4TMFA 4GVXA 2I3GA 1E3EA 3QWIA 5CDTA 4IXWA 3KHUA 4U0KA 4BVAA 1E7YA 1LLCA 2NU6A 4BO0A 3DOOA 3L6DA 3HNPA 4J1TA 2ZTUA 2EKQA 2J5KA 4G5HA 3HN2A 4XRGA 5J23A 3OIGA 5IF3A 2QW8A 3PTZA 2OXIA 1LU9A 3TPCA 1ADFA 4DIFA 4U7WA 4XQCA 1YQDA 3PIDA 2B4TO 4B3JA 4MP6A 1Q1NA 2HQ1A 3KTDA 2F1KA 3SX2A 1UP6A 5JCXA 1F17A 4RZHA 2JHFA 2Y05A 4KWHA 4TRRA 1ZSVA 3L77A 4W99A 3ROMA 3VPXA 4J7CA 4GGOA 2DFVA 4OXKA 3HHPA 4CQMA 3PYMA 2CY0A 4Q3NA 2HU2A 2Q1TA 4GSLA 3RC1A 3W8DA 3WR5A 4JJFA 5I9NA 4WJZA 1YONA 3KLPX 1UP4A 3A1NA 4MPDA 1BDBA 3G17A 3BMNB 3TFOA 3IQDB 1XG5A 3WTCA 5CAEA 4ZQEA 1YDWA 4XQEA 3EVNA 1KEVA 3RVDA 2CVZA 4JCOA 4ND2A 4CLRA 2C20A 3VH4A 4WLFA 4AFNA 3IIEA 4RQUA 1Y5RA 1XGKA 4BO3A 1EVZA 4XQ9A 1HXHA 2CD9A 2YUTA 3IDSA 3LK7A 2H6EA 3GQVA 1WMBA 3BMOA 2BGKA 1GPDG 1WDMA 4ALJA 3IC5A 1YL5A 3MTJA 4N18A 4FQ8A 1ZEJA 3IL2A 2IEBA 5COQA 5ICSA 2E82A 2W90A 3QWAA 4NHEA 2ZB4A 1T2CA 4ND5A 5F21A 1HWYA 2I65A 4PLPA 3WLEA 3LDHA 3GK3A 4BGEA 2VRBA 4I5GA 3D3WA 2PZJA 2Y1GA 1LUAA 4B4UA 2X86A 5KTKA 4INAA 1SC6A 3HWRA 5EQFA 2Y0DA 4MP3A 4D3FA 1FK8A 1GCUA 2GPTA 1IUKA 1DJQA 3G1TA 1FDSA 3IAHA 4K9DA 3W4IA 2OOSA 1SMKA 1HSZA 5L40A 5IN4A 5TNXA 1J4AA 1G1AA 1DDOA 1NVGA 1Y1PA 4E2WA 1UJMA 3PPIA 3RQSA 2RIRA 5JDCA 1KVTA 2BD0A 3N7UA 1I36A 1GDHA 1HE4A 3CINA 4Y98A 1S7CA 2NNLD 3ZZNA 1SB8A 4Z0TA 2EJWA 3KVOA 1VL6A 3B20A 3CTMA 1N92A 1DPGA 1I10A 3OP4A 1JW9B 4DYDA 3S1LA 2ZCUA 1GEGA 1T1SA 1LLQA 4HFRA 3K6JA 3UH1A 4HP8A 3DL2A 3AUUA 5KJFA 3K2EA 3LVFO 3ANMA 4NR0A 4QX6A 4IM7A 2PGLA 1H6DA 4RDIA 4DLBA 5A9TA 4YAKA 3WGTA 5CG1A 1LSJA 4RVFA 4EI2A 4B8ZA 4IQ8A 1HDCA 2G17A 3O9ZA 2P4QA 1U5AA 2DTEA 4MVJD 1I32A 3LF1A 3DXFA 3GNTA 3ZCXA 2NU7A 2W2KB 4LMPA 4WLOA 3G1UA 5THKA 3VOSA 3VZQA 2O2SA 2PNFA 3BMCB 4E2YA 3TWOA 3OECA 1IULA 3AM3A 4F3YA 1KERA 1MFPA 1Q0QA 3UUWA 1VJ1A 1ORRA 2UDPA 3L6OO 2AG5A 1X1EA 4HXYA 3T7CA 2O4UX 1P33A 2X0JA 3RBVA 1EUZA 4M49A 4BNUA 4J9UE 5JY6A 1N5DA 3DHEA 3PHHA 3ZW9A 3MTGA 4P4LA 2X58A 1I01A 3TZCA 1CF2O 2GYYA 4OXNA 4OJNA 4GX1A 4NQZA 4E5NA 3HDQA 4CUKA 4D43A 4DWVA 1B8UA 1JKIA 1BSVA 4RORA 3WJAA 4FIZA 4UULA 4WNCA 1XLTA 1FXSA 1PEDA 3FHLA 2DBZA 2ZB8A 4JIGA 1B3RA 1EBFA 3IUSA 4MJLA 1ZK2A 1ULUA 3FSRA 2VOJA 3JD1A 4AJOA 1UZMA 1EUCA 1YH3A 2BFPA 4ALLA 4EUHA 3ONEA 2VHVA 3P7MA 1KIFA 4OOFA 2IZ0A 3AY7A 3DMTA 1Y6JA 1GU7A 3LT0A 2X22A 4FSHA 2EP5A 3VPHA 4D44A 3EVTA 5COBA 4I9UA 2IXBA 1R4NB 2WEKA 4JGBA 4XDZA 5THQA 1P0CA 3CZRA 3OJLA 3EMKA 4A27A 1R37A 3ZDFA 2HMTA 1K6XA 3K8ZA 1BRMA 4LCJA 5L4SA 4FOOA 2ZKLA 4WEOA 3AFMA 4WK6A 3C1OA 1HZJA 5B37A 4FC7A 3BHMA 5JPIA 1UP7A 2PA3A 3K73O 1VC2A 2PZKA 2Q3EA 1H93A 2AHRA 3DTTA 5TS3A 1ID1A 2BRUA 2VNAA 5JW6A 5CPBA 3I6QA 4CLEA 3CE6A 3U4CA 4UUPA 1QLJA 3H5NA 1C0PA 4B3HA 2GZ1A 2OP0A 2BI8A 4EGFA 1YJ8A 3GEMA 2HRZA 4LMRA 2G76A 1N7GA 5CFZA 4BB5A 2PKQP 3Q6IA 2P9CA 2X9NA 4CM4A 2BFOA 1H94A 2EG9A 2A4KA 1YB4A 3PFWO 4M87A 4R5MA 3WNVA 3KETA 2CDAA 3OMLA 1M6WA 2WDZA 4DVJA 1VKNA 4F6CA 2VOEA 1T2AA 4IZIA 2C59A 5C7IO 3WGGA 3MWEB 5BR7A 2EW8A 3H7AA 4M8SA 1E3LA 2DM6A 3L4BC 2W2LD 5A9RA 3HDHA 4UUNA 2FSSA 3W1VA 1FDTA 1U5CA 1ZZEA 2UAGA 3M1LA 4TQGA 1AGNA 1JAXA 2GDZA 4BNXA 3LQFA 1RYEA 2CVOA 4PLYA 1ZCJA 2Q2QA 7ADHA 3JQBA 1Z82A 2EKLA 1R0LA 4N54A 1DC4A 2PV7A 1TT7A 4J6FA 1UDCA 3KEOA 1HL3A 3QSGA 3KSZO 4AJ4A 4CM7A 3H3FA 4XCVA 1EMDA 1U9JA 1EFKA 4QXMA 1TLTA 4FJ1A 4Z3DA 3WDSA 4GX2A 3ZWMA 3UN1A 2X1HA 1E1NA 1NQAO 4AL4A 3K96A 2YYYA 3H6KA 1R4MA 1V35A 4L8VA 1Y8RA 2DUWA 3ZNPA 1WWKA 3VZSA 5KCZA 4L73A 3FWNA 2Y66A 3GN1A 1E7QA 2EV9A 5EQDA 4RCVA 1M67A 2Q4EA 4UEKA 3W8EA 1KEPA 1B8VA 4XRRA 2O3QA 4OKIA 3V1YA 1CQIA 2NTJA 2SCUA 4W9NA 5JCJD 1LBEA
chains in the Genus database with same CATH superfamily
3AEQA 4G5FA 1QVAA 1R74A 4TTQA 1MA3A 2JZNA 3H6GA 5EC8A 4BEBA 1JR3E 5BSFA 2I9PA 4LF6B 1T4GA 1O95A 2TMKA 3KFVA 1R0RE 3DQQA 3KWFA 1JHZA 2ZSBA 3NBZC 4W1PA 3SMQA 3ZTTA 1X1SA 4YR7A 2ODBA 2OSVA 1OB5A 4EG0A 4CEIB 3N86A 1V11A 1R8JA 1USUA 1T9DA 1JG2A 1ZJJA 2WWHA 4OK5A 4FZVA 3P9ZA 4JP1A 1PV2A 1CUZA 1MJGM 1P2BA 3ENKA 3ZLUA 5F98A 1HLFA 4S24A 4E88A 4J4HA 4GVLA 4RTPA 1PBTA 1XOIA 2VDKB 2HFKA 2XVZA 3CNHA 4H7FA 4NARA 3GDWA 1XEXA 2ADMA 2BEJA 4G1UC 1ZUIA 1MTZA 2WW8A 3EWIA 5DT2A 2QTCA 3VU3A 2CNLA 5B5SA 4DABA 3T5CA 4F2DA 1WU7A 4X65B 2V0NA 3DJYA 4OF4A 2WHRA 4OAQA 3HU5A 4N6GA 3C8HA 4XYMA 5LOVF 1OLUB 1P77A 1W85A 3BPSA 2L42A 2NU9B 1E3IA 3PFNA 4MTLA 4YLEA 3E0QA 3AY3A 1JXMA 3G2QA 3OZWA 2A6PA 4HTAA 1A4IA 1SUWA 2YZKA 4QTYA 5F78A 4OCZA 4MI3A 4BLRA 1AKMA 3HXQA 2GZDA 1X0VA 4OXIA 4MB6A 2F59A 3SBEA 2PH1A 4ZYLA 4OHXA 2CDBA 4Q4AA 4Z2AA 2W8ZA 4CDMA 3IEMA 2EDAA 1QGZA 3QF4A 1RYDA 3DH0A 3BE4A 5ES4B 2PGIA 3ORQA 2VK8A 2ZYDA 5B3LA 2W70A 1UBCA 2FRDC 1HMYA 1ZS9A 2AHOA 1Z39A 3EXEA 2Y1FA 3QY9A 4NJOA 4CEIA 2JFNA 3VZCA 4AP9A 1C7JA 1D1TA 2A0FA 2G9RA 2O05A 4RJJA 4ATNA 2CFIA 1WNTA 1ADYA 2DVMA 1PJAA 3OPMA 1Z0KA 1VRCA 3JSAA 6YASA 2Q62A 3OICA 3LYAA 1KQGA 2OECA 3K0HA 4P54A 4OH7A 3W04A 4OQNA 1G3UA 3K0AA 3HDVA 4V0MA 1K4MA 4AG3A 4DC0A 3RW9A 1J9EA 4FONA 4QBGB 1U9ZA 2AG1A 1OX4B 1QGUB 4JJEA 2BTEA 3R76A 3VHRA 1DJLA 5KINB 5LR6A 3W5DA 5AICA 1XAGA 3WRYA 4H2DA 2QD2A 1AY0A 4HG2A 2HCRA 2Y2VA 3AIOA 3X3HA 1DAPA 2ZYTX 4UU8A 1CUCA 1M2WA 1YIOA 1FJGB 1K9SA 1ORHA 3PHGA 4YT8A 2WZDA 2R84A 3F9IA 1R9NA 3V2IA 5B6JA 1SG9A 2C0CA 1ZD2P 2DR3A 4BNVA 1TEXA 1U3VA 3NBYC 3A2NA 2GZMA 1E3SA 4M9CA 4ER3A 3PDWA 1P7VA 3JQ7B 3HSSA 2WLSA 4FW9A 4G5XA 1HSOA 2ZIEA 4LCEA 2HUPA 4DFDA 1B2RA 2X1VA 4IUCS 3VV2A 4IIJF 5HKAA 2AJLI 3A7EA 4WW0A 4DG8A 3H2ZA 4NEHB 1X2EA 3VU9B 1NVBA 3VUEA 3ZS8A 4C3UA 4BS9A 5AVZA 5FA6A 3OD5A 1U7UA 3H87A 4RD4A 1QH8B 3IA7A 4B80A 1KYTA 3RJMA 3U7HB 4Q1FA 1YE5A 3W5AA 4K03A 4FYMA 3E5MA 4Q12A 3PJRA 1G42A 1QE0A 2EFJA 1I8TA 4IZHA 3UJ9A 1GQOA 4D46A 1Y37A 2HU7A 5B1SA 1F20A 3U4HA 4N7RA 4YJGA 4HWSA 3PA8A 2NVUA 5FBWB 3OC0A 1TUGA 5BN1A 4RFVA 4BIIA 1T3SA 3IO5A 1QYVA 5KZMB 3X1DA 1IQPA 2FWBA 3CLRD 1NM5A 2I5PO 3OG9A 4IGEA 5FQNA 1XMJA 3IMKA 5C4GB 1XTJA 3JAKB 3PEWA 2QUHA 4NQRA 2XNSA 1Y3FE 3C1TA 4EG4A 4CN8A 1CUVA 4ZN6A 2XOXA 3E03A 3F5QA 4D8TA 2BP7B 1JJFA 1WXGA 1TFUA 4MS1A 2A33A 2OHJA 4MYTA 4KPUA 1XUOA 4PSAA 1SCKA 3EXG2 1ADGA 4IF4A 4LYJA 4UVDA 1G3RA 3D4LA 4ZCQA 4XWKA 5IXJA 5A5VA 3RREA 3EAFA 4KXWA 5AI8A 4BTVA 5AXBA 1DIGA 1YB5A 1ZM4A 2C5AA 4KN9S 4OLAA 1CP2A 2AF4C 5LIPA 1G8PA 3NHMA 4RM2A 1NOIA 2X3UA 1GGMA 1VL5A 2R60A 4FYPA 1ECPA 1YFKA 1D8AA 1E1CA 2FEKA 4GLOA 2ZPUA 4GPEA 2YUIA 4QTTB 4GXQA 4J3JA 2IZ5A 5JYEA 1I3LA 1VBNA 2IYEA 3KZ1E 1QIIA 2QEQA 2PWYA 3CH5A 2IUFA 1RIFA 3GOHA 1BE1A 3TCNA 5AM4A 4EJSA 4D9BA 2DWPA 4Q7KA 4QYXA 4EB3A 1U80A 4EFMA 1QYCA 3RKRA 5A4KA 5JNLA 4ZOAA 4LISA 5IEBA 5TX7A 5H8WA 1TU3A 2OD2A 5K6TA 4PGHA 3FNFA 3ZCSA 2I3DA 5CFRA 1Z5UA 1QTQA 1X7GA 5JNVA 3EF0A 4RGYA 4BVHA 3IIJA 1QR2A 4QASA 3JQGB 1CLEA 1O58A 4R7ZA 4FLEA 4J49A 4YV0A 1SU8A 4ZQIA 2X9GA 2IS4A 1E1QD 2AR9A 3EQ7A 1N6IA 4KTVE 5K0NA 2G0NA 4DDHA 1PS0A 1PL7A 3LT1A 2XWPA 2WAMA 1JVNA 4N3BA 1HDGO 2PVPA 1DRKA 3MMPA 4TLEA 1M2VB 1LBIA 1QZTA 2FFAA 3FETA 3HC7A 5J3JA 2JLWA 3B3GA 3FZGA 4I1SA 1IY9A 2O8BB 3V1KA 8LDHA 1WMEA 5JMOA 3OX3A 1C9YA 4RPIA 1Q74A 4XFDA 3SF8A 5KYYA 5LP1A 5HQ3B 1IZ0A 1U8AA 2XCUA 3RC7A 2F4VB 5H68A 1EE2A 1CVIA 2LGJA 1ZNXA 3ID6C 2DQ4A 2HRQA 4JA2A 5ICMA 5AUPB 1Z07A 4MV3A 3RABA 4A0GA 5FX2A 1S6YA 1DJMA 5T8KC 2GNAA 1KZ1A 1XDUA 4KR3A 4NBRA 3ZWKA 2Z5FA 2FLVA 3BZWA 4RU1A 3UT6A 5LCXA 2P7HA 2CXRA 3S0JA 1G2IA 4MI9A 2VBCA 1KAGA 5JVDB 5YASA 1SOWA 1Y33E 2B2NA 4L8GA 4L76A 5F35A 4C0LA 4AQDA 4BP3A 1AZLA 1SAYA 3VYTB 3V4LA 2QRNA 4DV6B 2HJVA 5JD5A 2GN6A 3TJMA 4MRPA 4GKVA 1KA9H 3STYA 5L9AA 2PKCA 2HRCA 1KC1A 3HM2A 3RO7A 4WI1A 3P9KA 5DM60 1OTXA 2AUTA 1MF7A 3Q98A 4WNAA 3AONB 3SG0A 2XB8A 2FYTA 3T4XA 3EC1A 3LHKA 3G23A 2G1JA 5G41A 3ADCA 3ZI4A 1M0TA 2A1UB 2OHHA 2FH5B 3TSOA 1D5WA 3ZQUA 4C9BA 3O8RA 5C3MA 4D92A 3P27A 1W30A 2VF8A 4ZQGA 2VDNB 2WMOB 3UGKA 1D8TA 1J20A 1CUYA 1J8YF 1R6VA 1VGVA 2ECFA 3ME5A 5IAKA 5CBPA 3LFUA 5JYCA 2H08A 3P9NA 4URHA 1DI0A 1L9KA 1Y8AA 3LCVB 2YFYA 3B2EA 1X6VA 2O0HA 5LDGA 4JXJA 1CUWA 5A7HA 1IHOA 2ZWMA 3PB3A 3GRPA 2IY9A 5EHIA 3PNMA 2FCAA 2JGDB 2IE8A 3QYPA 5B58C 1XRQA 2O48X 4IMRA 1N5JA 1H0RA 2QSYA 3FDZA 2FW6A 4JVMA 4O1HA 4B45A 3ZNOA 2X76A 5B64A 1E2FA 1NLUA 3WIVA 4MKRA 4M1KA 2BF7A 2BFDA 3F4BA 1BE0A 5E2IA 4LC1A 2JCXA 1Z8FA 3E9QA 3LUDA 3UY4A 5H59A 1OH7A 1QS0B 3UTCA 3WYCA 3NXKA 2XCIA 2XUOA 3QMPA 1GRQA 3OM0A 5FHRA 2JEZA 3R3JA 3ZOZA 3D59A 3WK9A 2XT9A 5ADHA 1WOYA 4D0LB 1AHHA 1DJOA 2B98A 5T57A 1N3BA 4UU0A 1GGNA 3FNBA 3NDBB 1E5VA 1KMMA 1PLKA 3OZDA 3C8UA 1UPCA 5JCPA 1PYGA 1XTBA 1EGAA 2WU1A 1YU9A 2HJWA 3H16A 4FQ7A 4RC9A 5T67A 5AM2A 1P3Y1 1JG3A 2P27A 3I9OA 3K0CC 1ZRHA 3BD9A 4RHXA 5C1DA 1K8QA 2F43B 2FHPA 1UBEA 4ZKEA 4Y2HA 3X43A 4YIHA 2BSAA 2D1YA 2HPHA 3CBQA 2RGRA 1A9SA 2GPSA 2VP5A 2I3AA 3NJ8A 4FGSA 5IS2A 3RAEC 2O3RA 1IPEA 3F5MA 1RKBA 2JJ8A 2VQDA 3BF8A 3K4PA 3LK6A 2WU0A 3WLFA 1A2BA 3SEQA 3FZQA 5AKLA 2ATCA 1F8GA 2P6NA 1YS4A 4JLPA 1XFDA 3O3MB 3LXRA 3PDIA 3ROKA 5JNTA 5KTMA 2VXYA 1Z6YA 4MJ3A 4YCAA 4OHPA 5BXQC 4H7HA 5F23A 2OAP1 1ZRMA 5CB4B 3NHJA 4MUJA 1DL5A 2G70A 1YAHA 1XMIA 1EB8A 1M83A 3BA1A 4MAMA 4D1YA 4DV1B 2BCEA 3OURA 3IOYA 3PUVA 3ZWAA 4MVJG 5CPFA 3VNRA 3AEXA 1HLDA 1E7SA 2MYPA 2MMCA 3NCTA 5CFQA 3HL0A 5JAHA 4GR4A 4DLXA 1WJGA 3ABOB 3I73A 4KWIA 1OXVA 5SZKB 1X2BA 3SLKA 4KU4A 4XWWA 1G3IA 4YC7A 2X6RA 3PQEA 4QM6A 4U63A 1Z45A 2WTEA 3WWCA 1Y3IA 2DUUA 4LQ4A 5EXTA 1RM4A 3M6VA 4KL8S 4TTJA 5K8VA 1PZFA 3R0JA 3E1KA 2IU3A 1DLJA 2C96A 3H84A 3K5WA 4HQKA 3PJFA 3WICA 4B3IA 3IBFA 2I62A 2RGEA 4M21A 2C92A 3H3JA 2PPLA 4CF5A 3D8BA 1NJ6A 1LPNA 2KI5A 3E9NA 3L7JA 2DYKA 1ZDMA 2WJPA 3OOJA 4O25A 4U8HA 3QKRA 3U3MA 2IOFK 2D8MA 5A05A 1T9ZA 5IBPA 4M60A 5HRUA 1KDOA 1PFQA 3K6KA 4LOJA 2W8BB 4O5OA 2Z98A 3I04A 4CRWB 4Q3OA 2ZBPA 3CR7A 4QBHA 3LBAA 5KVVA 2ZJ2A 3LG2A 1ZPDA 2EZUA 1C14A 2I4RA 4GOMD 5JCJA 5J40A 1QYRA 2HQRA 1PG5A 2VUUA 1QWSA 2FSVA 3GCWA 1CJCA 3LM8A 1RWQA 2W0MA 1LY1A 1OXTA 4EKGA 2RHDA 4Z9AA 3VPSA 1T6YA 1VE9A 2HTFA 1V7QA 3KJNA 4YT4A 5JBIA 4B7UA 1RHUA 2RBGA 5FTKA 4ANFA 1EFHA 3UAOA 5KOIA 4OGKA 3L8CA 4DMMA 2YWDA 2JFUA 4JLVA 1IBKB 4F46A 3GPCA 2WJIA 5HCIA 4I7EA 3NHBA 4C06A 1AS3A 1XQVA 1Y3AA 3DZHA 4TL9A 1DZIA 1KVUA 1L7EA 3NP9A 3RS5A 3H9UA 2DBQA 4ZDKA 2V5UA 2QUKA 3BRCA 5AMXA 3DNFA 3K09C 4ZVMA 4IO0A 1DEAA 1Y5NA 3HH8A 3DLAA 2Q6IA 4DQVA 3ZHQA 2VDWA 1IC6A 5DSXA 2NVWA 2VJBA 1EXDA 5EA2A 3AK4A 2J3DA 1Y8CA 3ORFA 2DX7A 1Z3IX 3OPQA 5A3VA 1ZCFA 2ORVA 4POOA 3PS9A 1MOSA 2ERXA 1H6BA 4M0MA 1TK9A 3PDHA 3A26A 3KZKA 1X7DA 5B36A 1Y89A 3V2HA 3MHPA 3R3VA 4QUHA 4WN9B 4C0XA 3ZDBA 1X9GA 2ZM6B 2W0SA 1Z4PX 2AN9A 2QJFA 3KJIA 4ETIA 3B6EA 4Z6KA 1O57A 2EJBA 3QWBA 1VSTA 3T5BA 3WFJA 4F2GA 2WYWA 4MV4A 1V95A 4WE3A 2FPKA 4GIBA 4OUDA 3P9SA 2IGTA 3B1WA 4EO9A 4HZUA 4V3CA 4IIFA 4FHCA 4R16A 1D04A 4M76B 4ABYA 2FR8C 3IXQA 1EFDN 4KZPA 2HCFA 1COZA 3DFKA 3VR6H 5IM4A 3DVAB 1JEJA 1NDQA 3DEZA 3I28A 3NKLA 2XUQA 4HUQA 2IIPA 1GFSA 2DWQA 2J9YB 3C5EA 3ZKWA 3GZTB 4B09A 1E8NA 2X8LA 3B60A 1F3LA 1FUUA 4ZVVA 1QFSA 5CLGA 1WSAA 3VR0A 1MO5A 2NGRA 2XODA 4Y2QA 3QGMA 3KEQA 1ZJWA 2HSEA 3CNBA 1NQTA 4NOMA 4UE3S 1DCFA 3ROEA 1M6HA 1XMXA 3KS9A 4CF4A 3G8AA 1EWYA 1T4CB 3EDRA 1XVLA 4H7KA 4L02A 4X1OA 5BSWA 1TCBA 1AV6A 4QAJA 4IDDA 2C4MA 1YRLA 1L0BA 5K3CA 4ZK6A 5HW0A 1R6TA 3ZY5A 1EFRD 4JBIA 3EUAA 4PTYA 2IC5A 3R77A 4TLDA 1BROA 2HZBA 2G4VA 2YDYA 2YRWA 5J5VA 3LX8A 3HCWA 1M7HA 3K35A 4W1QA 1NVUQ 1J0EA 2YJ3A 5K6RA 1TO2E 4FFMA 3OMWA 2Q3HA 4S1OA 4S1VA 3EGDB 4DPKA 4FR0A 2DLNA 3PQ8A 1VFPA 4LJRA 5BW5A 1D2NA 2YWJA 3M4XA 4YQEA 5SYNA 3FTFA 5IJ9A 2C4WA 3NHYA 3ONFA 4J1TC 3DE0X 3BIOA 2HSWA 4MQLA 3WIEA 4QA9A 4QXRA 1V9LA 5E4TA 4BN4A 2XRZA 2JHGA 5C31A 2V0GA 4KOEC 4WOPA 4MCAA 4L4SA 4NY1A 5JSKA 4B7AA 1PZHA 2EOAA 3VKHA 5L4NA 3G6WA 1ENOA 1B3BA 1LKZA 3ABSB 1QBGA 1XCPA 1CUHA 3BJEA 4CG0A 1PT8A 2C7RA 3KEGA 1QKKA 4XJTA 5GVRA 2XB9A 3ULKA 1SHTX 4X45A 3U3OA 3DCNA 4CMGA 1C8LA 2B69A 2JGJA 4P0TA 5FWNA 2GN4A 1RHQA 3MRXA 2E4XA 4MKIA 4CMJA 1LJUA 2BEUB 4F3RA 4DLVA 4GE3A 4OA8A 1RR6A 5DWVA 1OV4A 2IYOA 4B43A 2QVZX 2C00A 4V0RA 3K94A 5DCUA 1KE2A 3LWZA 2G04A 2ZYRA 1KIAA 1OLUA 5CBKA 4J90A 4YGXB 3CVJA 5IUKC 3GEIA 5T4FA 4BO8A 3HVRA 1VPWA 1IY8A 4HR7A 4CYMA 5LKRA 3KDPA 4IQ4A 2LP4Y 2HPVA 4MUGA 2TMDA 2FEOA 2VP6A 4U2DA 3VDNB 1IMOA 3DT6A 2DH6A 2G07A 4Q19A 1NFFA 1I4WA 3RJTA 3ZE2B 4A15A 5GJCA 2F6RA 1T6BY 3RWOA 3D6JA 2C3PA 1P45A 1R8XA 1XO1A 1O6ZA 3AUTA 2VC2B 3F6YA 1FYXA 1AXEA 3A1SA 3CJRA 2Z2KA 3DT8A 3G5LA 3N8NA 3U7QA 4BFLA 3VYRB 3F74A 3F6EX 4HADA 1IOLA 1SU7A 3L02A 3KLMX 2GJAA 5A4DA 3E8XA 1GA6A 4ZZIA 1SC4A 3GL9A 3H19A 1WW3A 1Y3HA 5DGXA 1JEAA 2RHTA 4YP7A 3N2YA 5J2UF 2O5RA 1UM8A 1XEWX 2OQRA 3WKEA 4EJMA 1EP9A 2VZLA 1RJ9A 3AFGA 1T36B 1BDJA 3K6SA 1S2GA 3HV2A 3REFA 2JFBA 5EP1A 3AMVA 2QZPA 1U0RA 5AK6A 3I0MA 1GJRA 3HBFA 1IBSA 1OAKA 1SUPA 2GLTA 3JALB 4GT1A 4HFJA 1DAFA 1QUEA 4WXHA 4B6OA 4CN9A 4CU2A 1TMYA 2ZSUA 2C0PA 1OX4A 2WU8A 3OQBA 3D4IA 5DBOA 3TAUA 3X2SA 4ZOQI 3CNEA 1D1SA 2AQIA 2LDXA 2D5AA 4RDCA 1G9TA 3DDNA 4KB5A 1CF9A 2CK3A 3KFXA 1J7JA 3AWIA 2R68A 3G1WA 5AKHA 2HU8A 4FOTA 3E05A 2ATXA 1QK4A 4P86A 1J33A 5EUQB 4J03A 3VR5D 3OOHA 1IJEA 3QE4A 3BRSA 3CF2A 4HDNA 1N8NA 4ECAA 2IT1A 3NGMA 1DNPA 2BV3A 3KTAB 3HM9A 3DMRA 3G8DA 3KT8A 4RA9A 3V32A 3UWMA 2NXCA 1KVRA 4HRXA 4WA7A 5I9SA 1UXHA 1W93A 2R3SA 4Q02A 5JZSA 4LWQA 1GTVA 4HNHA 4JOQA 2GF2A 1QH8A 4D80A 1RYNA 1GPBA 1U98A 4MP8A 2AOWA 3JVUA 4Q7MB 1P1KA 3UWSA 3WP0A 2DCMA 3GMSA 5ALNA 1U04A 5C2JB 1PWHA 3ZCRA 1D4OA 2BBTA 3QEMA 4MVJM 3E5HA 1G5HA 1NC1A 3SZGA 4FINA 1MTOA 1YRBA 3FMFA 1YVDA 3V6MA 2HHLA 2KPOA 1I7LA 1YDHA 2QIOA 2Y0EA 3GYGA 4QGAA 1A9QA 5JNWA 5LQUA 3V7UA 2CEAA 1EGQA 2EBFX 4H0CA 1C80A 1ZOOA 1NMEA 1JFRA 3DDOA 3I01M 3HG7A 3T34A 3ZHZA 1YZYA 5A7FA 2H7VA 1U2EA 4HB3A 1SIBE 5JLJA 1KZYC 2D2EA 4MR7B 4A1FA 2C57A 3A05A 3U4QB 3JW8A 3QTTA 3OQMA 1YZVA 2PQ0A 4FYWA 2R6R1 5D8DA 4IEFB 1QTIA 1PIWA 1R27A 2CEKA 3I2IA 4R6WA 2E6UX 3R09A 4WX2B 4M1WA 3N70A 4TT3A 2JIBA 1R0ZA 2QNIA 3FCXA 3FE2A 1OZFA 5A5EA 5ITVA 2GBLC 1K5GA 3VPBA 5FUWA 2LVBA 3PL5A 4CKBB 3M70A 1T9HA 5WRFA 2IDKA 3OBIA 1U0NA 1MX5A 4S04A 2ORIA 3AHFA 1TVMA 4MYUA 4H1VA 3I34X 4FWBA 2XNKA 1LPBB 4M83A 1UL1X 2X23A 4G89A 4L74A 4DLTA 4IJ5A 1PSZA 1KR5A 3OT1A 1M2JA 4BMSA 2DWOA 4I1RA 2BI4A 5C5CA 1JR4A 1FTSA 4PVDA 3UOGA 2DKOA 4KTTE 5FOTA 4AF7A 2IXAA 2FAXA 3QFHA 2H63A 3BIXA 3ILHA 5FBKA 5E0OA 3D2AA 2VK2A 4TLAA 4EGAA 4E46A 4YDHB 5HJ2A 5LYYA 3H9EO 3HUFA 1OKKD 1QPGA 2RHBA 4M9UA 5BV0A 3SVLA 1AQJA 1W5TA 1V48A 3GFGA 3SSMA 5K01A 5C1IA 2XYGA 1Q1EA 2XNDA 3QRWA 4G85A 1K6MA 2P30A 4J2HA 5K1ZA 4XUEA 4OQFA 2JCYA 4C76A 5K8JB 3JQGA 3FKQA 3OWHA 1U8XX 1JU9A 5BW6B 3RANA 1MNQA 3FWPA 3DMNA 1V8FA 2EZ9A 1QYDA 4KBGA 2UUOA 1Z37A 2VJDA 3KKNA 3MJTA 3EAQA 3OFNA 3UC9A 1C7FA 3SZLA 1NY5A 2Q8PA 1QCDA 2DHQA 3RIMA 4HO1X 5IJZA 4D9CA 2AD5A 2BFFB 3GXOA 1M2VA 3DP7A 4YCLA 3H1PA 4HOYA 5CB4F 1B6TA 3MMSA 1E79D 1KJNA 1TZMA 3QXXA 5A3QA 2WINI 5DI3B 3U4MA 3N0XA 3ZH9B 1P2VA 3EYWA 4R83A 1C9MA 1RWKA 1EFVA 4YJFA 4ZJYA 5ESXA 1M34E 2R1VB 1GZDA 4RA6A 3VTFA 1FDIA 3CLRC 3Q0IA 5HS6A 1GN8A 1WLYA 4HAYA 5JWOA 2PUFA 1K08A 5BN4A 1P1RA 1G7CA 5KYUA 5IUJC 4DA7A 1UEJA 1T9BA 2WJJA 3CF4G 3E7DA 5LZ2A 4QU8A 4N49A 3WL8A 3WNZA 1L6RA 3UK1A 2GI4A 3D9QX 2MSNA 5EIBD 4KQIA 1YSCA 1ZQ1A 4HGYA 1X87A 1UWKA 3LLCA 2RHMA 1TAQA 4X8LA 1I3NA 4N3AA 8GPBA 4TQAA 5FWXB 4C88A 5CK4A 4NMXB 3NDJA 3IJRA 4BOYA 1UOPA 3IP1A 1Y1SA 2CFOA 5IF9A 1DC7A 2PMWB 2R85A 3HBJA 4LE2A 4PF1A 1OIXA 1H65A 1G6OA 5HG0A 5I7RA 4YMUA 5AQEA 2QE7D 3AZOA 4G4SO 1BQ3A 4G1BA 2P6OA 2WSLA 4LE1A 4OGGA 4CM4B 2ZQ5A 2V7XA 5HA5A 4EG3A 5KIAA 4KNYA 2ORED 3GLVA 1NJSA 3KYCB 3RTAA 1KS9A 1OMOA 4NSNA 4EW3A 2RAVA 3EIUA 4HGRA 3GLFA 3UGJA 5LM3A 4O2BA 3NC4A 4DLNA 3S1AB 1WZEA 1O5TA 2PVSA 5C8XA 2H06A 4G0MA 4RK7A 4UUBA 2P77A 2DUNA 1MG5A 2AK3A 2XQGA 1WL8A 2YNMA 1P5RA 1TCAA 3O7MA 4FDTA 3FCYA 1NW8A 3FWZA 3H9JA 1K7SN 1O7JA 2E37A 4M53A 2ZI6A 3GROA 5DBIA 1SBYA 2XEXA 1Q7RA 2B34A 2XZOA 3NMUF 2G1KA 5DBEX 2OC9A 2ZB3A 2J0UA 2ZTVA 4RPLA 4KQCA 3EZXA 5AO9A 5ECWA 2PRIA 2HA0A 4D0NA 3M81A 4E30A 2OCDA 4H1TA 2JGDA 1E6EA 4XDHA 3VDXA 4ZPJA 2J9ZB 3U48A 3ZW8A 5LYJB 2DSTA 5IJAA 3E23A 4J0EA 3THOA 8OHMA 4QEDA 3V6LA 3V7FA 5CDSA 3ZWXA 3NT2A 3MAJA 1YVRA 4PC1A 1RPJA 4TLBA 5ELMA 4M0DA 3SKXA 3VR6A 3O8OA 3W77A 4NZYA 4YAJA 1JYSA 3FPCA 1GO2A 4IXNA 4QODA 2VWPA 4R3UC 4PG8A 4LW8A 1HR0B 5AIAA 2PK3A 5EJ9A 4XGKA 5GAJA 1FCJA 3I45A 4COOA 5EQTA 1Q1QA 2PBFA 3RJ5A 3GF4A 3C85A 4U3JB 2WM8A 3LE8A 4U7HA 4TMVA 5JATA 1O4VA 1P5JA 1WQ4A 2GJSA 2F1OA 4X1IA 3U49A 3IDZA 7REQB 4BNGA 2XADA 1AV7A 1KWGA 4ZVOA 3FZNA 4ZYXA 1YXMA 1WBDA 2YJ6A 1W19A 3QVJA 3B1JA 1L4MA 3E8SA 3L46A 3T99A 3QE0A 1NHWA 4GKAA 4EFNA 5BV7A 4AQ7A 3SY8A 3QHAA 3IVAA 3CTPA 1RRFA 2FRVA 2HM7A 2VSYA 1KY2A 5B6IA 2YRFA 1R5JA 5M34A 5EKDA 5KTSA 4FK8A 3LO5A 4G4IA 1LRJA 2QXTA 3L5OA 4W7IA 3FCOA 4PZPA 3NKVA 3GJTA 4QC2A 5H5JA 3RTCA 1PX2A 1J0DA 1U3CA 2ANCA 4D56A 3ADBA 3HEAA 3ZWCA 4IIDA 3HYRA 2XZPA 3AP1A 3RFTA 2XEDA 4IHKA 4MCJA 2WHEA 4URWR 1OYOA 2W2PA 1QYIA 4J76A 4XTCS 2JH3A 5B4VA 1XZMA 2LIPA 2M6RA 2BDTA 3VYVA 5G0VA 3LQ4A 5FNVF 3UATA 1Q11A 1FNCA 4BEJA 1T2DA 3LPMA 3TD2A 3HA5A 3NBMA 3L0ZA 1ZGHA 4KG7A 3VHXB 3IP9A 2PUAA 1XQ1A 3O90A 2IDMA 4IRXA 3NPAA 4JJGA 2JGFA 2QJTA 3OA2A 3D3EA 4IFBA 1AZSC 1P19A 4KQ1A 5BN3B 1DXQA 2P4EA 2O07A 4I81A 5H80A 4EM6A 2VYFA 1NUHA 5B4UA 5E9QA 3SOPA 4HUTA 3CH4B 4PYLA 2XI4A 3IDAA 2O3UA 3AFNA 4N39A 3C15C 4EPXA 2ZDHA 4GP6A 4TTIA 5EPEA 1UPAA 5C7YA 5DRYA 4R8RA 4XD2A 3ER6A 4CMEA 5DYWA 4NENB 5G2OA 1PCXA 1X92A 2KX7A 4QZVA 3ICCA 4PLWA 4ZKDA 1S1MA 3ESZA 4DIBA 2W6JA 2RK6A 2UYCA 2MTBA 2GO7A 4ITUA 1F0NA 2OTCA 1QVRA 2LWIA 1NRJB 1TB4A 2PX5A 3BF7A 3GT3A 3I8OA 1TX4B 1VCMA 3FBGA 4XIYA 4RMNA 4F3KA 5DNWA 4IAOA 4ZI2A 3WQSB 1EBBA 1TLLA 2D1QA 5DE3A 3GPBA 3KSDO 4EEKA 1PV1A 3BH0A 3AVVA 2EXXA 4QULA 1V37A 2FMXA 2CLLB 3K4QA 4JJKA 4A0SA 1Z8HA 1GSAA 2A5LA 3COPA 4U7GA 1WZ2A 1E2QA 5HKLA 3T9AA 3IKTA 2OHGA 3QKSB 4REOA 1JVBA 3SK0A 4JOSA 5I5GA 1T6ZA 1H23A 1E3QA 1LSSA 4ZGGA 5IBCA 2P9GA 1AQNA 3ILYA 3WC4A 1NQUA 2JIQA 4PPGA 4JBHA 2QD1A 3E2PA 4K6CA 4QBKA 4UJ5A 1IVYA 1GKLA 3HXLA 4M38A 3B12A 4MI1A 1LPPA 3ZE7A 3JD2A 3O8CA 3GLFE 2RGWA 3CT6A 4FMCB 3JRXA 1T8SA 5I4CA 1G8SA 1E66A 3ZD6A 4Y2SA 1U2ZA 4D0GA 3AIMA 2EHJA 4H7DA 4W9RA 1I2DA 1KFJB 3EGEA 2JGRA 4IDNA 4FNGA 1REQB 2ZTSA 5AVRA 2XGMA 1X94A 3Q87B 2IBSA 4HEA6 4ZO7A 4DAOA 3GLIA 2AN5A 3DO5A 3LVQE 1HOTA 1NW7A 1CY4A 4Z1MA 5B55A 4RGBA 4UNRA 1UBLS 4IOLA 1GXSA 1RYHA 2QRVA 2WVGA 3DJFA 3K9HA 4I46A 3H97A 2HLDD 2FI1A 2HBZA 4HQOA 2F3QA 2Y92A 4IX1A 3NIBA 1KYZA 1PGJA 2NN3C 4KGDA 2BFEA 3K0FA 2XCQA 5EWMB 1SVOA 2RD2A 4QUDA 5DM4A 5K2MA 2B2XA 3CX7A 3CKMA 1SD1A 3DZKA 1U9IC 5G1NA 3D4BA 4ND3A 1K6JA 2PIAA 4HH1A 2WWFA 5BNWA 4EY6A 1FMLA 2GM9A 4WN9A 1EDDA 4XQ0A 1JFFA 1YQWA 1H5UA 1LQTA 3FHJA 4KV9A 3IP6A 3SLGA 2HWXA 1P4RA 3PC2A 1M10A 4MQEB 1YDFA 3TSZA 3ZLVA 3KSRA 4EABA 3ETLA 4US0R 3FSJX 1MDBA 5EVJA 4OUKX 4FU0A 1TM4E 4CLOB 3MLBA 1ISHA 1A4UA 4QFDA 2W2VA 4FPXA 4Z9YA 1VLLA 1XP8A 2WU3A 3S2SA 2VYCA 4MUBA 3B1XA 2HD4A 3L2OB 4N9WA 4UREA 1X8JA 3ISVA 4IOKA 5EKTA 3S2GA 3ZUGA 4CKZA 5JAUA 5KC9A 5A4JA 1HK7A 2C2YA 3H2KA 4Q4JB 3CNLA 4FUQA 4MKZA 5AXCA 2C2HA 3PP8A 4MLZA 3UA4A 4QAQA 4RAQA 2W43A 1C81A 4L75A 3VDMA 4EG8A 1UJ2A 3DAHA 1T2NA 3CONA 3UMGA 3D0QA 1G20E 1DMSA 5KYWB 3H9GA 4CI9A 3MWLA 3DUWA 1I2BA 2AYXA 2XZDA 1C3XA 1X7XB 4FMDF 4EPTA 1U11A 5HJEA 3UAZA 3Q40A 4YA6A 2ZB7A 1TTPB 1MRZA 2RC5A 3E82A 4RD0A 3SMVA 3IE2A 3OWOA 3BHJA 3DW1X 1ZMOA 2H2FA 2OV3A 4ZVRA 3D31A 4EY4A 4GQBA 1VJTA 4PFQA 5K51A 3VQTA 1YU6A 4GH5A 2XQKA 5G4LA 1O5IA 3FOWA 4JC4A 3G7NA 2YRXA 5EWLB 4Z9XA 4BFVA 2XQJA 3QEBZ 4N76A 3EGDA 5GOTA 2G06A 4AQYB 4RKYA 2X0EA 4OGFA 2CFTA 4WZAA 1RHRA 3ND6A 2HT6A 2XGSA 3EOAI 5JNUA 1TJNA 3NT5A 5LZ8A 3HJUA 3LMKA 1DAGA 2LXNA 2P1ZA 5LA6A 1YBHA 2IKQA 3K70D 4C5BA 4WFJA 2QMEA 3GDGA 3DS8A 1R0SA 3STXA 2FFBA 5C8DA 2P5TB 5D3KA 1GPYA 3HABA 5CEJA 1U1EA 1XDSA 2YXLA 3B3QA 2B7CA 3CIFA 3H5LA 3KIPA 1W88B 1U7XA 4H31A 3RU7A 1HNWB 1JNXX 2VUSA 2QN2A 3ED1A 3CO5A 1YD7A 1A95A 2GPNA 1JIJA 1JBQA 1ZHFA 4V38A 5DYIA 4URXR 4IMIB 4LTDA 2WSSA 4A2QA 4CG1A 4WL0A 3OH8A 4D3ZA 5M04A 2XBLA 2ZSAA 4WZBE 4EUFA 1Y0BA 1C1XB 3IBGA 3GRYA 2DAPA 1M1XB 3EDMA 1W0CA 2EW2A 1E9SA 3ET5A 4NYJQ 5DN9A 4ZQCB 1T2EA 4CV3A 3EOZA 1OXXK 5AM1A 1Q1GA 1ULTA 5J2TA 1DAKA 5E7IA 1AKQA 2ZETA 1W7AA 1KI6B 1PGOA 2ZYWX 3HNOA 5AVXA 3MZ0A 4MRMA 5FOSA 1PR0A 2BFCA 2OFPA 4PVCA 4F9TA 1HLGA 3JASA 3BIFA 3L4BA 4XB1A 5CK5A 1W47A 1WF3A 2AE2A 3IQZA 4EJ2A 1N77A 2D6FA 2XVXA 4JNCA 1O94A 1RRVA 2C2XA 1BFDA 2W6QA 1JZSA 4KQJA 1NX9A 3BL6A 3BGOS 1RM3A 2D4HA 3BJMA 4HAWA 4E33A 4X61A 1EK5A 2G83A 4I2VA 5CXUA 2AQ8A 2YY6A 1BJKA 4MIEA 5HF5A 2R8RA 1AJEA 5KX5A 5DASA 1BOOA 3HZHA 2FWAA 5AHOA 1QHNA 4P4NA 1DU4A 4F1WA 2Y99A 2Y77A 4EB0A 3GLGA 2O3TA 2RB5A 3VU0A 4RF3A 1OKKA 5KJEA 1FNNA 3LSTA 1KFBB 3VR3A 4ACBA 5A4MS 1RAEA 1C4OA 4EL5A 2XCRB 4IGFA 4BLVA 4UHJA 3SC4A 1TK2A 5FPKA 1I1QB 2RHLA 1KGSA 2ZE6A 3I23A 3Q9LA 4XVCA 2A5FA 1G7RA 3W2HA 2R6GA 1QH1B 2F1RA 2VT3A 2NZJA 2RKBA 1E5TA 2PX4A 2W6MA 4XYLA 1YTUA 2HFJA 3AR5A 3D02A 1QSGA 2PH7A 3HJCA 3ZV4A 3NGLA 5JU6A 1UPTA 2BEVB 2QJWA 3FNEA 2JAOA 2B8TA 5DIZA 1KK3A 2E85A 4YRGA 1KOLA 2R1TA 1NXXA 4GBJA 2B30A 2WTAA 4NV1A 5ER6A 3TNYA 3U3ZA 3RKSA 5JANA 4XW2A 4B3BA 3PV0A 2NX2A 5JE8A 1G19A 1V1MB 1JTVA 3AIIA 3SDBA 1UF9A 4MQFA 1YIDA 5TJHA 8AT1A 2NO6A 3RFUA 2I1LA 4ERNA 1SB9A 5P21A 1RC1A 2H8GA 5FI5A 1U5BA 2ECOA 5FJIA 3WS7A 4EA9A 2X9VA 3BQ9A 2PUTA 4NIMA 3OZTA 4MKGA 3IB6A 2Z0MA 1XWWA 3KBOA 5CNKA 1Z6AA 4ENPA 3S29A 3EXAA 4B34A 4MXDA 4OFBA 3EWSA 4IWXA 1Z18A 3C8ZA 4YASA 1XTQA 3PNVA 2QG9A 4NU0A 4Q15A 3BHNA 2ISSD 2W4IA 3S8MA 2JIZA 3UNXA 3WL3A 5BVHA 5HZMA 3GFSA 1E2HA 4LJ8A 3CRRA 1Z0DA 4DLLA 4N01A 3PSHA 2BHTA 4UMVA 1CZNA 1U90A 2A4MA 2QAJA 1P9LA 1W0KD 2Z57A 1OQAA 5KJ1A 4A2CA 3PJEA 4UTOA 4CCYB 1GZ3A 4MR7A 2YC2C 2P40A 5TQJA 1J21A 5BSVA 4CQMB 3IFSA 3ROXA 4AI6A 1ECJA 2QSZA 1U2PA 2CL6X 3L5KA 4CM9A 1CEEA 2AG8A 2QORA 5LYJF 4DCVA 1KH3A 1Q3KA 4LHWA 3D7RA 4XD7D 3RUCA 1MJHA 3Q72A 4UHKA 3ZG6A 4N5NA 1KBOA 1KEKA 2X8WA 3NATA 3O75A 4E03A 2FR1A 2VNKA 1PLLA 3PT5A 1J22A 4L6CA 2ZSIA 3EZFA 4ZVSA 2VQ3A 1ORIA 1CERA 1PR1A 2G9VA 4A1OA 4EH1A 3AJEA 3W6OA 3I9NA 1YASA 2G80A 3AW9A 3FMGA 2ZYUX 3LO8A 2QM0A 4HWGA 3U7JA 3LH5A 4ROSA 3GVCA 1MAWA 4Z4HA 2XTNA 3KB6A 3VJLA 3GJ7A 2JRLA 4Z7NB 2UV8A 4H9GA 5D3QA 4OIMA 1E77A 1QTNA 1YDGA 3EDYA 3L1JA 3Q0TA 5EPUA 5KJ6A 3N75A 4O4IA 4PX9A 2XQIA 2YINC 4G4SP 2PZLA 1SKAA 3LPCA 2IV3A 4BMXA 3EWNA 4C6TA 3F4KA 3RPEA 4ZI3A 2V7QD 1J5XA 3SCZA 1BJRE 2DJ5A 2VPWA 3A1FA 3H4MA 4JD5A 5E95A 4BP1A 3LNTA 1SG6A 1M5UA 4ILEA 4L8YA 4AMZA 121PA 1WCIB 4YRLA 2X0IA 1F8FA 3FJ1A 5DNEA 5HK8A 3T1NA 4D41A 1JPVA 1PF7E 5IEJA 1DG9A 2I2XB 4QLBA 1G59A 3ESDA 3FOCA 3D3WB 4ND8B 2D06A 4YPFA 2RG1A 4C4ZA 4KUGA 1ZKMA 4J16C 3SHTA 3ZGZA 3H1EA 3U3DA 1Z28A 5JZMA 2B4YA 4OOEA 1IEWA 5EIHA 2UYGA 1KZ4A 3DBOB 5F52A 2R1VA 1EEXB 2GBFA 2J45A 3PEFA 3ABIA 1UZAA 4JGIA 3SYMA 1S9DA 5GONA 1NXOA 3IQHX 2REOA 4P4SA 4L9AA 4HV4A 4HDQB 5LVAA 5EMMA 4LYHA 3AG6A 3JARA 2JKVA 5FR1A 4YMTA 3F46A 3O82A 3WNCA 3L8ZA 2ZBDA 1HT0A 2HX1A 1A9YA 3HO6A 4JENA 2DEUA 4IGIA 1B73A 3GJXC 4L4RA 4O4JB 3RVBA 3SICE 3ZE0B 2ZUVA 3MCVA 2QJRA 5FWXA 4AUEA 3IPCA 3OFSA 4KSYA 4P1ZA 4C29A 1Y5LA 2GN1A 3ZK7A 3BH7A 1N8SA 5K3FA 5LXTA 2D13A 2JCBA 5EESA 1XKTA</