5L4NA

Leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
253
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Chroman-4-One Derivatives Targeting Pteridine Reductase 1 and Showing Anti-Parasitic Activity.
pubmed doi rcsb
source organism Leishmania major
total genus 95
structure length 253
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l4nA00
2UDPA 2B4QA 2HJSA 3MWDB 1MC5A 6LDHA 2PZMA 2J3IA 1LRLA 4OXNA 1CEQA 3DBLA 1Y8QB 3ONDA 4IDBA 3FHLA 4XYMA 2WYUA 1NAIA 2GZ2A 5G0UA 3RVDA 1H6AA 5L95A 1ZEMA 1RYEA 4WEOA 2JD0A 2PKRA 1PL8A 1TA4A 4P4NA 4CM9D 4Q3NA 1UXGA 1AGNA 3H4VA 2CMDA 2QW8A 2X9GA 3PJEA 1H5QA 3O8QA 4YJGA 3WFIA 3OQ1A 4OM8A 1U1IA 3CXRA 4U6QA 2WM3A 1KYQA 2JD1A 1JVBA 2P5UA 5T64A 4YAIA 1KVUA 4YT8A 4UAGA 2JCVA 3ZWXA 4XB2A 4GKBA 1P3DA 4E32A 1YBAA 4J9VA 3CMCO 3WR5A 1QMGA 4D43A 3A4VA 5I8ZA 1I8TA 4BNKA 1A5ZA 1U3UA 1XHLA 3M1AA 2V6MA 4JIGA 4WKGA 5F5NA 3EC7A 4B4VA 4BO9A 2AQHA 3WGOA 4OIMA 2QG4A 3E48A 4O0LA 1UZLA 4BNGA 4EJ6A 1T2CA 4MP3A 1GD1O 2PGLA 2YZ7A 3Q3CA 2HKIA 4INAA 4XYBA 2PLAA 3WNQA 4BNWA 2NVUB 4YT4A 1XELA 3WWZA 2I6TA 1Y8RA 3VZQA 1K89A 4F6CA 2Q50A 2FRDA 3CUKA 3QY9A 1R4MB 2Q99A 1E77A 3ON5A 4CLOA 2UVDA 2J3KA 1I10A 3GGOA 3W8DA 1DIRA 9LDTA 1WMBA 1JKFA 2PZKA 4UREA 5KJCA 3DOCA 1A9YA 3W1VA 1SOVA 4OQZA 4ZN6A 3TDKA 2BLLA 3PFWO 3DOOA 1VJ0A 1SCUA 3UN1A 4OQYA 2X4GA 4FFOA 4RF3A 1GCOA 1LLDA 3VPGA 2Z95A 3GMDA 1NPYA 2ZTLA 4QFCA 2OUIA 4GX1A 3CZMA 3BHMA 1YGYA 4IMRA 4TRMA 4UULA 2CF6A 3OSUA 3BMOB 3QRWA 3PYXA 1YQDA 4MKXA 3VZPA 2IE0A 3WIDA 3ZWWA 1E7YA 2B5VA 1DEHA 4YDRA 2D5AA 5TS3A 5BQFA 1T2EA 1DIBA 5JDIA 4WLUA 5JPIA 1C1DA 3RC7A 4DC1A 4AJ4A 1KS9A 1YS4A 2NVWA 4HX5A 1HDOA 2IRWA 2PH3A 1BGVA 4G5HA 4CL8A 4FW8A 2X7HA 2Y1GA 1CETA 2P9EA 1H0KA 4R41A 2JKVA 1CDOA 4PLCA 5DULA 4EEXA 1UAGA 3H9JA 4JROA 1BHSA 2QRLA 5CDTA 3EDMA 1GZ3A 5EL0A 4A73A 3ANLA 1H6BA 3WNVA 1AUPA 2VTDA 4U8GA 3RIHA 3LT0A 4RZIA 4L73A 3JQFC 1X7DA 3PQFA 5GZ3A 3AU9A 3OEWA 3EAGA 4KDFA 2D59A 4MVJF 4M55A 2XAAA 1Y9AA 3ZU4A 3JD2A 3AJRA 2V6FA 4Q3CA 5L53A 4GBJA 5HRUA 3K8ZA 1ZJZA 4RLSA 4OO3A 5JFOA 1VRWA 4N54A 4BGEA 4IGFA 1NX6A 5BNFA 1YB5A 2ZYAA 3UICA 3O26A 5HWSA 4KDEA 2OGUA 2NV6A 4IGEA 3STHA 4ZA2A 2CVOA 3WDSA 1PX0A 1I33A 2TMGA 2EG9A 5ER6A 5TSDA 3B1KA 2Y0CA 1J6UA 1FK8A 1O6ZA 2VRCD 3GPDG 3K6JA 5EINA 4A03A 1B2LA 4QO8A 5DBFA 2IYOA 1A7AA 1PU2A 5L7YA 2VHWA 3A06A 1L7EA 4CLDA 2CVQA 1BXGB 4Y6SA 5KKCA 2DUWA 2WE7A 4QXMA 1DLJA 1QR6A 3MTJA 1E3SA 5G0VA 1UP6A 3NTRA 5F1PA 3WJAA 1MG0A 2Q1SA 3DQPA 1XG5A 3L4BC 4UEJA 4E13A 1HETA 4XDYA 3PQEA 4MVJM 1JWAB 1UUFA 4TSKA 1R16A 2GZ1A 2NQTA 4CR6A 1DJQA 3LK7A 1U3VA 1Z73A 3F3SA 1RPNA 3DHEA 2GR9A 2NQ8A 3DO5A 1KOLA 1T2FA 1LQUA 3SJUA 1Y5RA 1BSVA 4JJFA 1P0FA 3VZSA 1ULUA 2EHDA 3PGJA 4CODB 2YHUA 4GPD1 1DIAA 4YCAA 3WSVA 2EV9A 4DRYA 3LT1A 4L9RA 1ULSA 1SAYA 3ITDA 1WMAA 1YXMA 2AHRA 4JQCA 4ALKA 4JBGA 3OF2A 4BNJA 4XRGA 1IHXA 4FFNA 4EUFA 1PJLA 1SO8A 5ADHA 2CUKA 2ZATA 1GUZA 4AFNA 1Q7GA 3MJSA 1ORRA 5HS4A 4RCVA 2V7PA 5CEEA 2FMUA 2XF8A 1QRRA 4WLOA 2GN6A 1B15A 3E03A 3LZ6A 2VYVD 3E1KA 5TT0A 1N9GA 1YJ8A 2UAGA 1PZEA 3GNSA 3ZHYA 3O38A 4CV3A 1LBEA 1NAHA 2P9GA 2JAPA 3PYMA 4NBUA 2ZTMA 4EDFA 2C29D 4OXYA 1I32A 5H82A 1HWYA 4EYEA 2EGHA 1V3VA 1LSJA 3AI2A 4D3SA 2AXQA 4WEQA 3ETGA 3RJ9A 5DDIP 1GY8A 1NTOA 4E5YA 5KVSA 5TGDA 3FRJA 1IZ9A 4Z0PA 2O3SA 5JCXA 3ZWYA 2E49A 3OIDA 3GEDA 3HDJA 4EJ0A 2TMDA 3TZQA 4RVSA 4UUOA 1F14A 4Y6RA 1J0XO 1LU9A 2V6GA 4R1TA 4IIVA 2E37A 4LCJA 5AOVA 1C1XA 3KTDA 4NJMB 4PLYA 1EUZA 3S1LA 3VTZA 3KO8A 3AI3A 3NT5A 3WQQA 5C37A 3FR8A 4O59O 4BO4A 1NR1A 1DB3A 1BG6A 2EXXA 5L4LA 4AJEA 3RSHA 3GUCA 3ZV6A 3AY3A 4GMGA 1BW9A 2GRAA 3JD0A 4QSMA 5F1OA 1IL0A 1Z7BA 3D3WB 5HA5A 1P0CA 2GGSA 5BSHA 3AUAA 4A7PA 3ZCXA 3M1LA 3AOGA 1OZAA 4BOYA 1U5CA 2J3JA 5THKA 5CFZA 3OJFA 4OAQA 1YBVA 3EYWA 3FBTA 2EWMA 3PPIA 4KZPA 4EUHA 2IYPA 5KVQA 4B3HA 1E6EA 3E8XA 4ID9A 1CJCA 2AMFA 2CDAA 2RH4A 3PLRA 1VE9A 2EP5A 1TI7A 1ADCA 2O3TA 3K92A 3INRA 2VOJA 4YRDA 2OP0A 4J0FA 2V6BA 3IL2A 1MG5A 2VWPA 1RM4A 5K6AA 4C7KA 1ZSNA 3BMNA 1I3LA 3D7LA 4P8RA 4YA6A 4BNHA 1I36A 1ZW1A 4NIMA 1DAOA 4ZQFA 1PJ4A 2NU8A 3WB9A 5KWEA 5KTKA 2X23A 1N1EA 1UXJA 1U9JA 4I1IA 4NQZA 4BMNA 3KSZO 4JJGA 1T4DA 1IOLA 4JCOA 2DFVA 3BXXA 4RVUA 2C5EA 4NU5A 1NFQA 5CDGA 4GH5A 1EVIA 1VL8A 3PHLA 2BGMA 4QO7A 4II3A 1VKNA 4XQEA 1HXHA 1ZZEA 3UHAA 2NLOA 1EE2A 2OORA 2VHZA 2G5CA 4HXYA 2NACA 3SVTA 5ILOA 1R0LA 5G0SA 3D4PA 1O9BA 3KETA 1JQBA 2JHGA 1HDYA 3KYDA 8LDHA 2WTBA 3MWEB 4I5GA 2GD1O 2V65A 1KEWA 3D4OA 4PRKA 4U5QA 2JL1A 1FF9A 2YUTA 1WW8A 4FC7A 4CMKA 1E3LA 1Z6ZA 2B69A 3DBRA 3KVOA 2Y1EA 3E18A 1NNUA 5EIOA 2EKPA 1RM5A 3PP8A 4FFMA 1LDGA 3C7DB 3CE6A 3K30A 2R6JA 2RIRA 3JQCA 3WWYA 4D79A 2ZCVA 5DCYA 2VRBA 3LDHA 5ICSA 4XX0A 3DMYA 5F1KA 1DAPA 3ABIA 3QV1A 3C7CB 2FSSA 3B70A 1DO8A 2ZK7A 3DZIA 3H6KA 4LMPA 4BO2A 3QQPA 1M66A 3C24A 4OJNA 4ND4A 1T1RA 2QZZA 4YR9A 1PQWA 4JX8A 3VPSA 3OJLA 1LA2A 4MVJA 4YJFA 1DFHA 1EUCA 2O3RA 2X8LA 2OXIA 3KM0A 3W8EA 1W6UA 3ZNPA 1P45A 2XXBA 4NK4A 1QKIA 3BYZA 4I08A 3GVHA 4F6LA 1DIGA 4WCFB 5DOZA 1ADFA 3CKYA 4L4RA 3ZHZA 4RPKA 1I3KA 4JBHA 4PLGA 2DU8A 4RF5A 1UXKA 4CM1A 5A9TA 5GMOA 4KP7A 4MINA 1BVUA 3PWZA 4L0QA 1Y81A 4MKRA 2QRJA 4CQLB 4RPGA 2VUUA 1PJQA 2LDBA 5KOIA 2AW5A 2C20A 1T2AA 3LF2A 1M6HA 3FF4A 1ZO8A 2RBEA 1FDVA 2VQ3A 1X15A 3INGA 2W90A 3EVNA 3GHYA 3WLEA 4E5NA 5DT9A 3TQHA 5AXCA 2WD8A 3JQAB 5ENVA 3UUWA 4BNVA 5KIAA 1EBUA 1HYEA 1KVRA 5EESA 4E2WA 2YHIA 2D4AA 3JYQA 3PVZA 4M1QA 4TWRA 1QXSA 3DB2A 3DBHA 4GX2A 2JCYA 1VLLA 2G82A 3ANMA 1JU9A 1NR7A 2D0IA 1KEPA 3QVSA 4P4LA 5IXSA 3KZVA 3OFSA 3H8VA 2JCXA 5JDCA 1N1GA 2YDYA 1GR0A 4PG5A 3PGXA 2X1HA 3PIIA 4JGBA 3JSAA 1I2ZA 2VHVA 4IDDA 4BNMA 1P1RA 1C0LA 3KBOA 3PTZA 5I8WA 4J9UE 2Y99A 4PG4A 1N7HA 5A4DA 3HN2A 1XU7A 4OOFA 3ST7A 4BGIA 4FDAA 3KV3O 1LI4A 2C59A 1V3TA 5IFLA 3AK4A 3JQ8A 5HTOA 4M89A 3BMQA 4J4TA 2I66A 3GRKA 1B16A 1PJ3A 3IP3A 1U28A 2I9PA 5G0WA 4A10A 4FN4A 3SBOA 3VVBA 1HTBA 4XD2A 4B3IA 1VM6A 1PJ2A 1GUYA 4CLXA 4MVJE 5JC8A 2GN4A 1SB8A 4Z9FA 1CF2O 4KOAA 3HHPA 3I83A 2EJVA 1HDRA 1IB6A 1A7KA 4EBFA 3VPHA 3UCXA 1DC4A 1AHHA 4LSWA 5TQVA 3JQAD 1EVZA 3S55A 3GG9A 2DT5A 4J1QA 3LQFA 1QSGA 4MVJI 1VKOA 1E7RA 4N7RA 1OC4A 4FD3A 1JW9B 3DMTA 4RORA 4E3ZA 5IN4A 3G17A 3H9UA 4PLVA 4J7UA 1C14A 4L4XA 1XEAA 3QWHA 2ZYDA 5H81A 3QE3A 4YRBA 3U3XA 4HKTA 2VNSA 3IQDB 1LC0A 2YDXA 5CPFA 3GVIA 3GUYA 3I3OA 1M76A 3HADA 3CINA 5IN5A 4I5DA 2GASA 3VPXA 4YQZA 4XA8A 3L9WA 1AE1A 3HJAA 3VH2A 5B4TA 4WUVA 2BI8A 1V35A 1ENZA 3DONA 4PZDA 4YJHB 3A9WA 1GL3A 3KYCA 1YKFA 1K5HA 1W0CA 3DTYA 2E82A 5DCWA 2EJWA 5JCJA 4B8WA 2Y93A 3H9EO 1U2DA 3OP4A 3JYPA 1HSOA 1KVTA 1XKQA 1TT7A 1NXQA 1U8XX 3IOYA 4CMAA 5I7SA 4F46A 1HKUA 1ZVMA 4CMIA 1ONOA 5AYVA 3WGTA 2NUAA 2X5JO 4ND3A 3K5PA 3WMWA 1GADO 4BNUA 4UEKA 2ZTUA 1GU7A 4FB5A 1PZHA 4IQ0A 5G4KB 3V8BA 4WPGA 1JTVA 1VSUA 3IC5A 1GFSA 3ZN2A 4RPLA 5KVVA 1HL3A 4J1SA 3OA2A 2O23A 3FCOA 4PFJA 4CM4B 2BGLA 1WAMA 3DAPA 4YEDA 5ICMA 1J4AA 3GDFA 2HUNA 1JN0A 1ZUD1 1UDCA 3D5QA 1RWBA 4B7XA 1Q2XA 3PWKA 1I0ZA 2F00A 2DAPA 2Y68A 4PZCA 3L0DA 4IJWA 3IDSA 4R01A 4D3DA 2D8AA 4BKRA 3B1JA 1O0SA 3BTSA 4YAEA 4PG6A 4DQUA 5IDYA 1U4SA 1KY5A 4NK5A 5JDCC 2HAEA 3IKVA 1Z45A 5TRTA 3E6AA 4BGUA 3ENKA 2PZJA 3LSYA 4FJ1A 5DCUA 1XSEA 4JXKA 2FP4A 4CM9A 1LJ8A 3EVTA 4QUKA 4GWKA 1PGNA 1LDNA 4J49A 5CP8A 3GLQA 3AU8A 1VJTA 2DTDA 4IBOA 1KVSA 4TKMA 1PEDA 3NTQA 3S2GA 3DDNA 3KEOA 3N74A 4ZQEA 3RUCA 3ETEA 2RH8A 4BB5A 2A92A 2PA3A 3K2EA 3M2PA 4CQMB 4WOKA 3F5QA 3H3JA 4NPCA 3DAGA 4GLOA 2BMAA 5ILGA 3FD8A 4OXKA 1LSUA 4RVGA 3TRIA 5TF4A 4NBRA 3LVFO 4R1UA 1E3JA 1O5IA 3W6ZA 3H3FA 1ONNA 5CG2A 1GYQA 1E3EA 1B8VA 3PZBA 1Q0QA 2BHLA 1WDLA 3GF4A 3CH6A 3WYEA 1WXDA 2GN9A 2PWZA 3W8FA 3NJ8A 3ROQA 3OETA 3QVTA 5U9CA 1E6UA 1E92A 2ZB3A 3DMTC 1Y8QA 2C2YA 5A02A 4ZQBA 3JTMA 5DZSA 4BQRA 1GPJA 1X7GA 1BXZA 1H93A 2HO5A 2UYYA 2ZTVA 3HE3A 2X9VA 4YJGB 5L45A 1Y5MA 1LC3A 1P1KA 1SEVA 1X1TA 4ND1A 1ZSVA 5JS6A 2AQ8A 2O50A 1ZK1A 3MZ0A 1A72A 3C8MA 4XGKA 3RC9A 3WSWA 4AJNA 6ADHA 1MUUA 2X0IA 1ISFA 2PR2A 4IDCA 2GSDA 2Q4BA 1G0NA 4DPLA 4OKNA 1NPDA 3LYLA 1SNYA 2HQ1A 4A26A 4YAKA 1KERA 4WK6A 3Q2IA 3RASA 2Y1OA 4CQMD 1BWSA 2GZ3A 3BTUA 3U9LA 2VCYA 2IZ1A 1BDBA 4BV8A 3WGQA 3P5SA 3R1IA 3ZV5A 4ND2A 2NTJA 2UUPA 4IS3A 1L1FA 1LDEA 1NBOA 1LUAA 1I2CA 2VN8A 5KJ1A 4IXWA 5I9MA 5A05A 3VH4A 4WE3A 3F4LA 4CM5A 4ALJA 1HEUA 4W7IA 2DLDA 4ZICA 2YW9A 3UKOA 2W2LD 4KQWA 2G17A 4DMMA 4RO0A 1ONPA 3IUPA 4IS2A 5L9AA 3IUSA 3DZBA 3AY7A 1FDTA 4RDIA 2X22A 3P7MA 4J1TA 3RI3A 3HFGA 2GERA 3TN7A 4P38A 1M67A 2NU9A 4NBTA 3IIEA 4KUEA 3X2EA 3VTFA 4BS9A 1C0IA 3PJFA 3K31A 5L4NA 5EJ2A 1LTHR 1WLYA 3FTNA 2AA3A 2P2SA 3SLKA 4UEOA 5U1PA 1YO6A 3ADPA 2HU2A 3RBVA 2C0CA 4FC6A 5IF3A 4D7AA 2CDCA 3SJ7A 4KWIA 4YT2A 4UUNA 5AXDA 1K0UA 3BMOA 4YWJA 3TOZA 2X9NA 2A4KA 1C1DB 4GKVA 2PK3A 3B1FA 3QSGA 2ILTA 4KTVE 3R3SA 4RPJA 5JMPA 4E0BA 5HS6A 5CEFA 3AWDA 3DC2A 5IZ4A 1NWHA 4R54A 1UH5A 2C82A 2Y1FA 1XLTA 3EMKA 4GLLA 4DYDA 3TFQA 3V5NA 1Q7CA 2IEBA 2RCYA 3V1TC 3V2HA 1WZEA 2Y67A 3GDGA 4WECA 2UV8A 3BA1A 1PR3A 3FPLA 4TRJA 2BF7A 1E1KA 4XIYA 3JYLA 5TC4A 3E82A 4GAEA 3OICA 1PL7A 1SOWA 2C54A 4BHTA 1JAXA 2IEDA 2BI7A 3I4FA 1TXGA 4IDEA 3MJ4A 1HLPA 2PD6A 2VYND 3IMFA 2DBZA 2Q49A 2J5KA 3K96A 2YV1A 2X5OA 4WASA 1G6KA 1ZK0A 2W8ZA 1YONA 2GNAA 2DKNA 4Q3BA 2DC1A 3HDHA 3N58A 1AXEA 4HWKA 4LW8A 4DL9A 4HFMA 1AHIA 1Q0LA 1YOVA 2O2YA 4LN1A 4IDGA 3AW9A 1LRJA 2JAHA 3A28A 5C7OO 4DREA 4RDHA 5KJFA 3UVEA 5J23A 3KSDO 3NEPX 1YE3A 3ZWAA 4AJOA 3F47A 5BSEA 1D1SA 1F8FA 4UUPA 1MXHA 1RYDA 5EERA 1BXGA 2EF1A 2PKQP 4BNYA 1M75A 1U7TA 1LDYA 1UXIA 3BTOA 4XGNA 4KWHA 5A3JA 3DFZA 3MJTA 4J0EA 3ZHXA 1ISHA 3WXBA 2FZWA 3GHHA 3TL3A 1LSSA 3EHEA 4P4GA 1NASA 2DBVO 5C7LO 4H15A 1XDWA 1DC6A 3WGGA 4D44A 1MXFA 3GDOA 5CHEA 1I5RA 1WNTA 1EMDA 4O6VA 5L3ZA 4Z3KA 2I3GA 4BNXA 1MC4A 5FF9A 3TZCA 4ROSA 2VT3A 1SMKA 1HDZA 2OOSA 3GMSA 5JYDA 2CZCA 5IG2A 4L4SA 2POQX 2GYYA 3VZRA 4AJ2A 4OHUA 3SEFA 4LVUA 1ZCJA 3C1OA 5B37A 3GT0A 1JA9A 3MEQA 3T4XA 2Q3EA 3PHGA 3RFVA 2HSDA 4DLBA 3WG9A 1MLDA 2B35A 2ZB7A 1D7OA 4N5NA 4RQUA 1ARZA 1DOHA 1E6WA 3PYLA 1WDMA 1U7HA 4PVDA 4LVCA 4DXHA 1N9GB 3RFTA 5HBRA 3TSCA 4XWYA 3PZRA 3R0IA 3QHAA 3RC2A 5JDIC 1YL7A 3W4IA 1UR5A 5JLAA 2E48A 5CDSA 1IYZA 3L4SO 1A4IA 4YQYA 4ZGWA 3Q9NA 2PY6A 1DSSG 1UXHA 1YWGO 4R51A 1LRKA 1MP0A 4GSKA 5IZCA 4GSLA 2BKAA 4CL3A 2YYYA 2HMVA 3WX0A 4MP8A 4PCVA 4UVDA 1WPQA 4DQVA 3ZNQA 4XQGA 2OP1A 3W4KA 2EEZA 2G1UA 3ZWNA 2EKLA 4JP3A 5CDUA 5GZ1A 2I65A 1C1XB 4IINA 2XXJA 3ZDFA 5JYEA 2NU7A 2HK7A 3TPCA 3TZ6A 1TVEA 3B20A 3L9XA 1PS9A 3LT2A 4Y98A 4DBVO 3H9QA 1KY4A 1YJQA 3DFUA 3V1UA 5COQA 4EEZA 1GTMA 1PGQA 2ZKLA 3S2EA 4L74A 1N8KA 5TJHA 2A94A 4XB1A 3PI7A 5ITWA 2H1SA 5DBGA 3I23A 3AM3A 1MX3A 2W2KB 7MDHA 1YL6A 4LGVA 3DOJA 3INTA 4U0KA 1ZEJA 1EK5A 3ZU5A 1H6DA 3LC2O 1TB4A 4JP2A 4MOWA 1JVSA 1E3IA 4DLLA 4ZQGA 3GN2A 2C07A 3F1KA 3I4CA 1R15A 2AE1A 3DBVO 1GZ6A 4BO8A 1Y6JA 1Z7EA 4LRSB 4N18A 1I2BA 2Y0EA 2IZZA 2BGKA 4BNTA 4MP6A 4CM8A 5JAIA 2X0RA 5AQ1A 3GAFA 3K9QO 3PFFA 4D41A 1T2DA 2FOIA 3G3EA 1H9AA 2GPTA 3DZHA 4MVJH 3LC7O 1HYGA 2HK9A 1EK6A 1EVYA 4HFJA 2D3TA 4J2HA 1O8CA 4MVJP 1NWCA 3WGHA 4RZHA 5A04A 3BMNB 1CQIA 3QVOA 3JV7A 4FCCA 2B4RO 4YAGA 4GMFA 2ZIZA 2Z5LA 3AM5A 4E5MA 3HB5X 1GQQA 2GO1A 1L7DA 3ITKA 5COAA 1XA0A 3BTVA 4E2ZA 4BQPA 4KUHA 3PIDA 2JFGA 3ZWPA 1AXGA 3BHJA 2AE2A 1PTJA 2NWQA 2CF5A 3EW7A 1B3RA 1KIFA 1GYRA 3OA0A 1JLLA 4Z9YA 3QJ5A 1LEHA 3I9KA 1Q7BA 3TZKA 3QP9A 1AN9A 3KHUA 1JKIA 4OSOA 4ALLA 4GX0A 4MO2A 4Q39A 4K1LA 4XEHA 4BO5A 4FJ2A 2BFPA 3S2IA 2O3QA 3KYDB 1A9ZA 1CRWG 1ENOA 3QW2A 5L51A 2DBQA 3DTTA 1GPDG 1TT5A 2SCUA 4W4TA 3R3JA 5LC1A 5A06A 1O94A 3TNLA 4P22A 3DBRB 1FJHA 3TZHA 2CVZA 2G0TA 2CSUA 4E6PA 4XJTA 3OMLA 4U6SA 4PLWA 4FGSA 4CV0A 3RU7A 4DIOA 1NPTO 4HNGA 3RWBA 3DZFA 1ZNQO 1ISJA 3PWSA 5IZCC 3RUFA 1GAEO 4BNZA 3EK2A 3VKVA 1I01A 1I30A 2WD7A 4XR4A 4BB6A 4YT5A 4J4BA 3CSDA 1UP7A 1F17A 4DPMA 3HZZA 2QHXA 4WNIA 4ZRNA 1TLTA 4RF4A 3WJ7A 4AJPA 4BO7A 3JD1A 3GGGA 4XKJA 4DVJA 4YJFB 2I99A 3D3EA 1QYDA 3E9MA 1DJNA 4W9NA 1PZGA 2EKQA 1QORA 4FOSA 1EQUA 1ZMTA 4AJ1A 1D8AA 2VTEA 5THQA 2IDZA 3ZW8A 3QVWA 1A71A 4B7UA 2G76A 1ZJYA 1PL6A 3FSRA 5BNIA 3D64A 3RD5A 2OFPA 5F21A 4DGSA 4R5HA 4E33A 3JQGA 3TOXA 1JDJA 4K9DA 2J3HA 3GQVA 3WBBA 4NH4A 3CZRA 4JLWA 4RVDA 4DLAA 5IDQA 3DEYX 3F6YA 4BV9A 3GEMA 3EZYA 3AUUA 2P4QA 1YVEI 4HADA 1EBFA 1K3TA 3DBHB 5IDXA 1P33A 5K6AC 4HFNA 1Y1PA 1P9LA 2IZ0A 2O7SA 2YV3A 4TZTA 7ADHA 4C4OA 3EGOA 3GVPA 4MDHA 5A9SA 3JQ7A 4CUZA 1BVRA 1PJBA 3IAHA 4N5MA 1PJTA 4MVJD 4TZKA 3F4BA 2Z1NA 3C7AA 3PK0A 3V2UA 1K6IA 3UCEA 1T26A 2WEKA 2FY8A 5JE8A 5I7VA 3L07A 2VWGA 4ND5A 1MGOA 3CTMA 4Q3AA 1E3WB 5TNXA 1PGOA 3UH1A 4Y9DA 2XOXA 3OJEA 3VDQA 3AUTA 4EUEA 4IY1A 4OYRA 2DQ4A 4MIOA 3JQ8B 4XQ9A 5TJ9A 1RJWA 3BMQB 2AQKA 3I9NA 2WJPA 4A27A 4IPTA 1N7GA 3BHIA 3F9IA 4IM7A 5T6BA 3GPIA 1K2WA 3W4JA 4GI2A 1P1IA 1FDWA 5G2OA 2Q2WA 5IJZA 3OIFA 2I67A 3GGPA 4XYLA 2X0NA 5JO9A 1X0VA 5L4SA 4LMRA 4B4OA 4R69A 3ZWBA 4GX5A 2LDXA 4WCDA 1W4ZA 3F5SA 3ROMA 1GEGA 4E30A 1QV6A 4XYEA 2Y66A 2GLXA 3AI1A 2EGGA 1UDBA 1YRLA 4Q9NA 1SPXA 5B12A 1LLUA 3PHIA 2PV7A 1IUKA 1SZJG 2Y1DA 1VJ1A 1U4OA 2GF2A 4BL5A 5G0TA 3GZNA 4PLTA 3IJRA 3KYCB 1N92A 3VKUA 5IXYA 3PXXA 4DTIA 3K73O 1G0OA 2ET6A 2OBYA 4GGPA 2UUOA 3ZI0A 1DBVO 4IDFA 2PGDA 3CPSA 3H5NA 4W9NC 4LRTB 3HG7A 4FFRA 1D1TA 4NG5A 3WIEA 3GEGA 1XYGA 4CMIB 2A9FA 5EQFA 4E12A 2J6IA 3L6OO 4B4WA 4D0RA 4DQXA 2X5KO 1VC2A 9LDBA 5MGBA 2PZLA 5DBIA 4Y8VA 5I7EA 3BMCA 1P31A 3WQSB 1ID1A 4PRLA 4RQTA 5KJ6A 2O3JA 2WE8A 1NP3A 3GY0A 3Q2KA 3HN7A 4WNCA 1R4NB 5ITVA 4CJXA 3WYBA 3QWFA 4X54A 4ESOA 2AEJA 3O9ZA 4O1MA 4AJHA 4BNLA 4CLRA 3GRPA 3JD3A 2PD4A 4M54A 5JY1A 2Y0DA 3U5TA 3OJOA 3RQSA 1G1AA 3H5AA 4ZJUA 1MA0A 2HLPA 3NDJA 3GVCA 1Z82A 3PEFA 1MV8A 3IJPA 4BMSA 2YQ5A 3A1NA 4CM4A 2AEFA 3Q0EA 3RC1A 3U62A 4R3WA 5L7WA 1PJCA 3ONEA 1GCUA 2ZYGA 1R6DA 3DL2A 3P2YA 3VOSA 4A0SA 3KLMX 4PLFA 1ENYA 2C2XA 1Z75A 4AJLA 2FN7A 2HK8A 1UJMA 2OBNA 4F45A 4F3YA 3RJ5A 4RV9A 1N2SA 1ISGA 1T1SA 3CMMA 1C3VA 4UUMA 3HQ4O 1N5DA 3WLFA 4FFLA 1DHTA 4Q3DA 4PIVA 3Q9UA 3OQBA 5JO0A 1YQGA 2FR8A 2Q1UA 1PQUA 3OHSX 1WVGA 4HFRA 3ROPA 1VL6A 3GR6A 3VPFA 1CWUA 1KC1A 4OKIA 4J16A 2QRKA 1IE3A 3TJRA 2NTNA 3RBZA 3V2GA 4DWVA 4J7CA 3U49A 3WOHA 3NGLA 1MFZA 1YB4A 1C0KA 3Q6IA 5I9NA 4URFA 1OFGA 1R12A 1H6CA 1D4FA 3UOGA 4ILKA 4XGIA 3ZNOA 3GAZA 1V0JA 3DBLB 3KXDA 4IJKA 3H2SA 3U4HA 2GDZA 4HV4A 4IZHA 3LT4A 5H83A 2NTVA 3IP1A 2VHYA 4R3NA 1V6AA 1PSDA 2GCGA 3FNGA 4O63O 4WOJA 3JQFA 3IS3A 1NVGA 1DXYA 3ROKA 3JYOA 3NT2A 3EUWA 3ANNA 3OQ6A 3I9JA 3O8QB 1KEUA 4K6CA 5CDYA 2Y05A 1PGPA 1QYVA 1WP4A 3E9QA 2W2LA 3RUDA 1H9BA 3IKTA 2WWRA 3JYNA 3NDIA 2Q45A 1GV1A 1ZK3A 2BH9A 3GFBA 4NU6A 3M6IA 3BIOA 3RCBA 3DZJA 3WYCA 3VAZA 4BKQA 4GL4A 2FPIA 2DTEA 1KETA 1R0KA 3NUGA 5KJEA 2P4HX 4PLZA 1CERA 4E21A 3C3XA 4GQAA 4UVHA 4DIFA 4E31A 4OL9A 1UP4A 4QTZA 3X2FA 1WWKA 3FNFA 3KEQA 3SXPA 1E1LA 8ADHA 4ONEA 4TQGA 5LDGA 3DR3A 3MCVA 4YTEA 4RF2A 1WDKA 1PGJA 3U4CA 3G1UA 4W82A 3L4BA 3RUIA 3HFSA 1E7MA 4HNHA 1Y8RB 1E5LA 3S2FA 4CMEA 2JD2A 3AY6A 4D0SA 1DPGA 4HY3A 4XIJA 3K2BA 4CLOB 3ZHBA 2NVUA 1ZKMA 4CUJA 5CPBA 1LLQA 4QFDA 5B4VA 5LDHA 4R16A 2W98A 3PHHA 1BXKA 1B8UA 1X1EA 3WTBA 1P1HA 1R4MA 1QYCA 2RAFA 4R68A 2NSDA 3B6ZA 3PDUA 3OECA 4R1NA 1IULA 4MPDA 4NJOA 3ZV4A 4YPOA 2BFAA 2J5QA 2X86A 3WICA 1NQAO 3RU9A 4YYZA 1EDZA 3HB4X 2X0JA 2P91A 4PLHA 1J49A 4YVFA 4Z9XA 1YDWA 4IDAA 1F0YA 1B14A 3DZGA 4IUYA 4D42A 4CM3A 2NU6A 3I9OA 3JQEA 4RJTA 4TRRA 1DRWA 4ALMA 1BTOA 1XU9A 5JBIA 2BRUA 3JQ6A 1VL0A 2X58A 2AEMA 2C7VA 4GVXA 3WQRA 1LXCA 2O4UX 2VYNA 4GGOA 5DN9A 4AJKA 2E4AA 2VRCA 2QX7A 2O48X 4AL4A 4EGFA 1E1NA 2DVMA 4CMHA 4PN3A 3V1YA 3NT4A 1O95A 2JFHA 3MJCA 5TT1A 2FR1A 3M2TA 4CMCA 3ZNNA 1GUFA 1UZMA 3KOUA 2EW8A 4NZ9A 4XRRA 4E2XA 4WLVA 3C1AA 1J5PA 1LQTA 3CIFA 4CR7A 5C3MA 3ONFA 1DHRA 3H9GA 4J91A 4J1NA 1UAYA 3MOIA 1U3WA 3ENNA 4WLNA 3PJGA 3U0BA 3DAFA 3LLVA 3ETDA 4B79A 1JAYA 2PKQO 4ITUA 5DP2A 4UVEA 3GG2A 3DWFA 1A27A 2BFMA 2DBRA 2GN8A 3LC1O 5EN4A 5GY7A 1VPDA 3VDRA 3RFXA 2BELA 1XCBA 1LDMA 1FDUA 1OOEA 4CMBA 4PVCA 4W99A 3D5TA 4Q3EA 4TKLA 3GK3A 3FNHA 5EMHA 2JJYA 5CEJA 4L75A 2DFDA 5BT9A 1T25A 3AFNA 4Z0HO 4Z6KA 1E5QA 1NVMB 1QLJA 2CY0A 5TIIA 3NX4A 1V3UA 3JD4A 2HRZA 4L8VA 2VWHA 2HJRA 4S1VA 5JAMA 4RGBA 5JXWA 4EW6A 3SC6A 2DM6A 5FFFA 1MB4A 4ALIA 1PR9A 1S6YA 1NFFA 1EZ4A 2Q2QA 1BMDA 3S8MA 5F5LA 3UFXA 1GEEA 3FWZA 1EFLA 3RBXA 1YOVB 3LU1A 4CV1A 3ICPA 3JCZA 4L76A 2VNAA 4AICA 3PHJA 1LDBA 3AFMA 4J3FA 4MKZA 2VWQA 3JQDA 2VYVA 4BKOA 2O4CA 5I7FA 4J43A 1QV7A 2O7QA 5KKAA 3NKLA 3FN4A 1KEVA 5A3VA 1VSVA 3RUEA 4B3JA 4JJIA 4DIBA 5IDWA 3W6UA 1PS8A 1HE4A 4ZVVA 4D45A 1LX6A 3SX2A 1ADBA 3ASUA 2WDZA 4FFPA 2D2IA 1I24A 1GYPA 1XWFA 4R9SA 1NHGA 4NFHA 1ZK4A 1EVJA 3E9NA 1EEHA 3WBFA 3I1JA 1D3AA 4XZ3A 1XIVA 4DC0A 1DRUA 5T67A 2H9IA 4BIIA 1QP8A 3ASVA 3GOHA 1X13A 4CMEC 1KBZA 2Q1WA 3GNTA 1BRMA 2FR0A 4MIYA 3OH8A 2P5YA 4M86A 4E5KA 3F46A 2XPCA 3ZU2A 4CLHA 2CNBA 5C5IA 3BZUA 3L6DA 1OC2A 1T24A 4PGFA 4QQRA 3WGIA 5FI3A 2PTGA 1ENPA 1ML3A 3ICCA 4KTTE 2HCTA 4PZEA 3PRJA 3OBBA 1T4BA 1LSOA 3FI9A 4XYGA 4CM6A 1QYXA 4NDNE 4XQCA 3Q1LA 4WLFA 3ZW9A 3WMXA 3MJEA 1QG6A 4JN6B 4K26A 1X0XA 4I5EA 4ZU3A 3D0OA 3WTCA 3DXFA 4EITA 1NFRA 3JQ9A 4YJDA 2Q1TA 4BKUA 4DMLA 1B0AA 1GQYA 1ISMA 3LF1A 1CIVA 5A9RA 2VZ8A 1GV0A 2RHRA 1GQ2A 1R66A 4G2NA 4HUJA 1DRVA 4NI5A 3I9LA 4YBZA 3EY4A 1P1FA 2FZEA 2B36A 3PJDA 3QVXA 2OO5A 5KNLA 2HMUA 3GVXA 1PWZA 3D1LA 2PH5A 3NV9A 3QWBA 3OIGA 1E7QA 1XR3A 2HRBA 4NFYA 1LNQA 1XQ1A 1ZFNA 3UF0A 4BO6A 4DBZA 3MTGA 1PJSA 3FTPA 3E5RA 3VH1A 3GZ4A 2WSBA 3GN1A 5BSFA 1E7SA 4NJMA 2DTXA 4PG8A 3GC6A 2R2GA 4D46A 5BSGA 3GNQA 2O3UA 2OL4A 3HDYA 3CEAA 2DPHA 3HWRA 4KMSA 4FQ8A 4NMHA 5T5QA 4FOOA 3L6EA 3OEYA 1V9LA 4FBGA 1E0DA 4RLHA 5A5EA 1WZIA 1BW9B 1NYTA 2EIHA 2HMTA 2WYVA 5ENDA 1PIWA 2CD9A 3RROA 2VT2A 1I3NA 1R0SA 1IPEA 3H65A 4JNKA 4IJVA 4EZBA 2IXBA 3D3WA 4IQGA 4M49A 1E1MA 4XCVA 1YBMA 1DLIA 3AM4A 2W2KA 1U2GA 4S3MA 2C7GA 2DUUA 1Q0HA 3GH3A 3A14A 4XR9A 4ZD6A 3P2OA 4CM7A 2FHSA 1HYHA 3FNEA 1HRDA 4CMGA 2OMEA 4E2YA 1UDAA 5ER9A 3UW3A 4CUKA 4PLPA 2R00A 4CM8B 4QEDA 3F1LA 4ZRMA 4BGVA 2QZ9A 5GZ6A 3ZH2A 4TROA 1ADGA 1EQ2A 4TRNA 2B4TO 2FWMX 3PLNA 2B37A 3KLPX 3C1TA 3PDJA 5A5FA 5JW6A 4MJLA 4CR8A 4BO0A 3LLSA 4TVOA 3FBGA 1PS0A 1X7HA 4MIEA 1Y9EA 4YRAA 4FPXA 4OMUA 4QX6A 4BNFA 4NFSA 2I76A 4W7HA 4JBIA 4R4JA 3H2ZA 4Z0TA 5FEUA 1FXSA 2VHXA 3QWAA 1DC5A 1QYWA 1KC3A 4Z3DA 5EQDA 1YQXA 5TX7A 4HP8A 2WYWA 1SC6A 1U3TA 4M8SA 4IZIA 1OI7A 4LSMA 4LISA 1JWBB 2AG5A 4YAJA 1M2WA 2VUSA 3DHYA 3T4EA 1YL5A 3H7AA 5LCXA 1K6XA 3NGXA 4YB8A 3U4DA 5A1TA 1CQJA 2AQIA 5JNLA 1P74A 2P9CA 4EI2A 1BDMA 3KYBA 3O03A 3OJ0A 2ZCUA 4CMJA 3AOEA 3UAGA 2IODA 3KSUA 4J7XA 4KQXA 1F12A 5AXAA 2EP7A 3JQ9C 1XGKA 4A2CA 2FPPA 3E5MA 4CPDA 2PGJA 1TT5B 4GWGA 2W4QA 1ZXLA 5FYDA 3ZWOA 3KB6A 4NBWA 1QLHA 2Q46A 1P44A 3FWNA 5T57A 1HT0A 3TF5A 2YV2A 1S7CA 5DF1A 5AXBA 4N5LA 1EFKA 2Y1CA 2NADA 1ZSYA 2WD7B 3WFJA 3HDQA 1HZZA 3QA9A 3QWIA 4G65A 3I6IA 5MDHA 4IMPA 3C85A 3JQBA 4OSPA 2H5LA 3HUDA 3OM9A 4NHEA 4CV2A 3L77A 1E7WA 2VUTA 4AVYA 1EDOA 2PNFA 2ZQZA 3P19A 4B4UA 2J5RA 2QIOA 4BO1A 1DFIA 1O89A 1P77A 1PWXA 3DZKA 1V8BA 3H5RA 2VZ0A 1JKJA 2P68A 2NVBA 4WCFA 1OAAA 2PD3A 3WS7A 4R5MA 2IXAA 4U0JA 3ULKA 4BNNA 4M87A 3RKUA 4I9NA 4OH1A 4IQ8A 1HE2A 3NYWA 4CQLA 1W8DA 4J90A 5ES3A 5KCZA 1PQPA 4XDZA 2OHXA 5U4QA 5T8KA 1RKXA 1Z74A 2FPGA 3JQGB 2D5CA 5K0ZA 4LK3A 4ALNA 1SEPA 2YHIB 5EPOA 4JK3A 4NNJA 2VZ9A 5L40A 3RKRA 2R00C 1PZFA 1XQ6A 4ZQHA 1SB9A 3JQAA 1CYDA 3MOGA 3TFOA 2GUGA 3ZZNA 2BFOA 1ISIA 3DHNA 4EJMA 4O5OA 5FI5A 5G4LA 1ZBQA 4BO3A 3VC7A 4WJZA 1SBYA 1ZK2A 2A35A 1YB1A 4WGGA 5A9SB 2YFQA 4GVLA 3JQ7B 5C7IO 3D4NA 2NM0A 5JAQA 4Y6PA 1HSZA 1HDGO 4RVFA 2I3AA 2ZQYA 3EZLA 4II2A 2H6EA 3GA0A 3U09A 4LCEA 4I5FA 1B26A 5JAZA 1M6WA 4A5OA 4I9HA 4AJJA 2O2SA 3I9MA 3ZV3A 4QECA 3RUAA 3RUHA 5A03A 5COBA 1R37A 5BR7A 1H2HA 2C5AA 2QYTA 4UVGA 4J2OA 5BNTA 4J4HA 3AUSA 1OBFO 4G81A 1E3WA 2FSVA 4TVBA 5CG1A 5K9ZA 3ZWVA 4RPHA 1W73A 2ZB4A 4BMVA 3AOEC 2WMDA 4CLEA 4AJIA 1RM0A 1Q1NA 4MVJG 2E6UX 3U4IA 1F8GA 2HMSA 2Q4EA 2RHCA 4DYVA 5JC1A 2X6TA 1OMOA 5FWNA 2CFCA 4W6ZA 1C0PA 4H16A 1EE9A 1TEHA 4E5PA 1U5AA 3GFGA 4FSHA 4WLEA 1LLCA 3WGYA 3ZU3A 4H3VA 3WGZA 2B0JA 4FGWA 2DPGA 1HF3A 2HMWA 4YACA 3N7UA 3T7EA 4B8ZA 2ZJ1A 1FMCA 1NHWA 2QYSA 3FR7A 4I8XA 4ZHSA 4FS3A 4Y67A 2Z1MA 4FR5A 2JFFA 3RAJA 3NDRA 1YDEA 1DDOA 3HNPA 1IPFA 3JQBC 3GZNB 3ZGYA 3NRCA 4J6FA 4TMFA 1NQTA 2YY7A 3G79A 1HE5A 4YJHA 1DFGA 4FIZA 4BVAA 1I3MA 1ZH8A 2Q2VA 3O4RA 2CDBA 1HLDA 2HDHA 3KRTA 4DA9A 2OZPA 4I9UA 1ZXBA 4NBVA 4WCFC 3VVCA 4QT0A 5JY6A 1ZMOA 3BMCB 3HSKA 1H2BA 1HZJA 2AG8A 4RVHA 1HDXA 1MFPA 2D1YA 3TWOA 5CAEA 5B4UA 5G4KA 2JHFA 4YXFA 1GZ4A 3G49A 4CLRB 3NAQA 5F3RA 5I9LA 4BNIA 5T8KC 1K6JA 1IHYA 1R4NA 2EERA 1P1JA 4XJSA 1X14A 3G0OA 4IIUA 2H63A 4KUGA 3QIVA 3I6QA 1DIHA 3I52A 3ORFA 3SC4A 4DUPA 2I5PO 2QQ5A 3UCFA 1DC3A 5HM8A 1UZNA 4NR0A 3QLJA 1VI2A 1YH3A 1KVQA 3VH3A 3PQDA 4RL6A 5DNAA 3SLGA 5IAAA 2F1KA 4B7CA 1EUDA 4OOEA 4BKPA 4C7JA 4UVIA 4BUCA 3UGKA 3BAZA 4HBGA 2YQ4A 4U7WA 3Q11A 4IXTA 5JCJD 2VOEA 1NQ5A 5JMWA 4K6FA 4R9RA 1B3BA 1B7GO 1IY8A 2BD0A 5JSFA 3NTOA 2J8ZA 4PG7A 4E4YA 1F06A 3G1TA 1HDCA 4OGWA 5AVOA 2YJZA 5DP1A 3ADOA 4IJUA 1IZ0A 3R6DA 3I5MA 1GDHA 3VHRA 1H94A 2B83A 3NJ4A 4R1SA 1NVTA 2EW2A 4CQMA 2ZJ0A 5KVCA 4K28A 4DPKA 3KUXA 2B5WA 3ZWMA 2PFGA 5B1YA 1U8FO 5TLSA 1B8PA 1FDSA 4H7PA 5L7TA 3COSA 1A4UA 1HE3A 1NM5A 1RM3A 3UXYA 5DOVA 4FJ0A 1ZIDA 3T7CA 2ZB8A 3TL2A 1Y7TA 4AG3A 3MJVA 3FPCA 4D3FA 1NQOA 2YFHA 2NNLD 3ZWCA
chains in the Genus database with same CATH superfamily
2UDPA 2O5CA 2XUDA 3QF4B 4TT3A 2HHJA 3MTIA 5KWIA 2ZEJA 3B6IA 3P9YA 4FQ7A 4OXNA 4QDKA 4O4IF 5J4YA 4CEJA 5FEMA 2WUWE 3ILHA 2ZW9A 3O3NB 5H8WA 1RBZA 3MLEA 4A8PA 1K9SA 2ZBPA 3ONDA 4NENA 4QJ4A 1ZJ6A 2WYUA 4MVCA 1SUIA 1IY9A 2JGKA 3Q7PA 3BQ9A 5ENZA 4KB5A 3TLXA 2WU3A 4WEOA 2JD0A 1FU4A 4M8NE 4ARUA 2WJHA 5E4JA 4CKCA 1LZLA 5I01A 3A1SA 3IURA 3CUSA 5JADA 1UXGA 4QUBA 4ZVNA 5IMSA 2CMDA 3PJEA 3BD7A 3O8QA 3W8NA 5CVUA 1DAIA 3Q6MA 1P60A 4BLTA 5KDLA 4YDHB 4YAIA 1XB2A 5F51A 4JUFA 1YAHA 4WA8A 4NZYA 5FWDA 2ZRCA 4BFTA 2OGWA 3TLYA 4UAGA 2JCVA 2IVFA 3ZWXA 1ITZA 2ZJZA 4JXZA 2PR7A 3PRKE 3UHOA 1P3DA 3T5PA 3O9MA 3HGQA 2ZZKA 3OJXA 5DGTA 1B23P 3M9LA 3DXXA 1YC5A 3V7WA 1E79A 2EP8A 1YBAA 4BEJA 4J9VA 1Z4NA 3WR5A 2EJCA 1OFVA 4KG7A 3CZCA 3O7MA 2YWRA 1FP6A 4MIKA 1T3SA 1S3SA 1U3UA 1X7ZA 1EE1A 2QQGA 2L82A 2HREA 3B3GA 3H7IA 4FT4A 5IJ0B 2IPNA 3H5LA 4H4EA 1M2VB 1ZM2A 1UZLA 2Q5JA 3E48A 4LXXA 5K3AA 4EUKA 2QZSA 3ETNA 4MP3A 2YZ7A 2PGLA 4Y2XA 1TM4E 1EFPA 1ZBDA 3Q3CA 4KC0A 4BNWA 4DIEA 4BQNA 5A2QA 2I6TA 4UU1A 3VZQA 3ACBA 1GCAA 1OXSC 4QGGA 3CGWA 3GU3A 2YASA 4XB6B 1E77A 3D3KA 5CJPA 3KWFA 1UFOA 2FFQA 3AR9A 4PWZA 2ZU0C 1I10A 2DYKA 4KYVA 5KYVA 3W8DA 2OO3A 2GBCA 4B5LA 2CV0A 2J3LA 2V96A 5EUMA 3DVLA 4ER0A 1SOVA 3AVUA 4OQZA 1H1LB 1G98A 3DO8A 4U8HA 5JNSA 4OK5A 4GGMX 7GPBA 3N8KA 2MOKA 2PSDA 1VJ0A 1GM5A 1FW6A 4HAWA 1QGUB 3ZLJA 2VJOA 4OQYA 1VKJA 5HCNA 4FFOA 3SXUA 4B6FA 1TJ3A 1Z5PA 1TPYA 3B1YA 4NEQA 3UXEA 1XN1A 2C83A 4NULA 5EJAA 4D4LA 5TARA 3IE1A 3KKEA 2WQ7A 3UHPA 1NPYA 3M6XA 3AHFA 4FU0A 4QFCA 3A7EA 1XNGA 4GX1A 2V3CC 3CZMA 2XRFA 3B3JA 2HSJA 4IMRA 5D3KA 4AF6A 5B7GA 4UULA 2HGZA 2ZE7A 3QELB 2CF6A 2AI2A 2IYZA 2QRNA 1YQDA 4MKXA 3CUEF 2ZAYA 2RGBA 1C3LA 2P6OA 1GR1A 2CFSA 3DPUA 1GQRA 4BFUA 2Q2OA 4QFMA 2B5VA 1QX3A 3C3PA 4F56A 1WW3A 3KJQA 1W8IA 3CF4A 1CY1A 2MDTA 5ANRB 3AG6A 5JDIA 1GAWA 3O93A 2WD9A 3HY6A 5ESRA 4J16C 4WLUA 5JPIA 3V80A 3QKWA 4H0FA 2JW5A 3FLEA 3E2PA 4QOFA 1DTWA 1YS4A 4LFCB 1JIJA 1USVA 1J23A 4HX5A 3LQRA 1BKDR 4AUMA 2IRWA 4G5HA 1VLQA 3OAAD 4PX5A 5E38A 4CL8A 1V96A 5LBIA 2X8JB 4ZFNA 2ZI7A 1KXJA 2GJ8A 4ND8B 4GI7A 1CETA 2P9EA 1QK5A 4KQHA 4QG7A 2QG9A 4CEIA 1CDOA 2BGGA 1JJVA 4H27A 5ALWA 2BBWA 3AQIA 4HSEA 4JA0A 2GBLA 2R66A 2WDPA 4RZIA 3EQ2A 3EGEA 4LFAB 1YZFA 4HS4A 1XZDA 5DWVA 3L04A 3LX6A 4QUIA 3QKSA 4RQAA 1HL7A 2V6FA 4N82A 4Q3CA 4QPJC 4ZCMA 4BVHA 7AT1A 3A1TA 5L53A 3LQYA 5H0IA 3K8ZA 4AMZA 1QVWA 4BBAA 4OO3A 4JLAA 2MSWA 1Z0KA 4KR6A 4N54A 1RACA 3CA8A 1CBUA 1TFUA 1Q84A 3RIEA 3LOQA 3R24A 5BNFA 1U8CB 2ATEA 1EX1A 3O26A 1J97A 1H3NA 1VRVA 4OLHA 2OGUA 2NV6A 3WDSA 2YTZA 4G25A 1NXTA 5HFAA 2VZLA 2EG9A 3B1KA 5HF8A 1YIAA 2CXOA 3LQ4A 4A03A 3ABRB 1PEKE 1B2LA 3GJYA 1T35A 2XE7A 4QO8A 4UFOA 3WV4A 1EWVA 3HJHA 2VHWA 2O1WA 1L4GA 4JQSA 3TOCA 1FLDA 3H5IA 3H3XA 1C7EA 2CVQA 2JH8A 3G2JA 5SY9A 1FJ2A 3FNQA 4BMCA 1YRAA 1P0QA 3CV3A 4DA7A 5DNYB 2DUWA 5TQ2B 1N5JA 4ASUA 2ONJA 4QXMA 3SC3A 2EF0A 5AW0A 2N75A 4CYMA 2F67A 1E3SA 3D8HA 5CLHA 2BEWB 5F1PA 4TVSA 4E22A 5IAOA 4TSFD 4ZHQA 4R2MA 4UEJA 2AD1A 4JI3B 5DXAA 4EG3A 1HETA 4PC7A 3AH8A 5HK8A 1UUFA 4G0YA 4TSKA 5HIMA 1RXSA 1R16A 3DP9A 4C2UA 4EIWA 5JMTA 1YQ9A 1P5ZB 3Q6NA 4I55A 1D2MA 4CR6A 1NC1A 2C9YA 3PEEA 5D7BA 5EMMA 4HMPA 4C2TA 3MAAC 1U5BA 1UOEA 4LXYA 3PFCA 4AKGA 3ADBA 4GIBA 1LQUA 1EGAA 1E5VA 1XZQA 1Y5RA 1N5RA 1WKBA 4JJFA 3HCDA 3PDCA 4K05A 4F4IA 1OLUB 1V4BA 1KTIA 3KKLA 1ULUA 1Z4MA 1R5JA 4W5HA 4CF3A 3MS4A 3SHWA 1VZ3A 1DCMA 1ZWLA 3IPYA 1Y1TA 4FHEA 4K8RB 4YCAA 2FRDC 4HLUC 1UPAA 4HEJA 2PGNA 3OEEA 1WHSB 4L0MA 3IQGX 2AHRA 4PAOA 4M9SA 1RKUA 2O9JA 1JXOA 1RXWA 1AV6A 3ITEA 4BNJA 1IHXA 3P9QA 4FFNA 2D74A 3PENA 2JI4A 1SO8A 4O2AB 5CH3A 4K7JA 4PCLA 3SS7X 2JIMA 1FFEA 2ZATA 1IM5A 4IDQA 4MZDA 3Q3HA 3EXFB 2CDRA 4FFSA 1F8XA 2C1EA 4AFNA 5KYGA 1Q7GA 3MJSA 2VHQA 5E1BA 5IBRA 4TMTA 3IOCA 2PX8A 3OWOA 4N6GA 2V7PA 2XF8A 4M1WA 4MGHA 4ZYUA 2XVZA 4MLPA 4V0MA 1B15A 4HSGA 1ESDA 4QPPA 4WLOA 2VYVD 2G4CA 1B6SA 5A0TA 1XZJA 5TT0A 1A9PA 1A97A 1YJ8A 2UAGA 1PZEA 3OPYB 4H3SA 3SBDA 2NW6A 1GPMA 4HYQA 5LOVA 1L5YA 3O38A 2O8EA 3KKPA 5GV8A 3DCJA 1YI8A 2IT1A 2JAPA 4ECEA 2F43A 3PYMA 2O8FB 4MW5A 2ZTMA 3ZXYA 3A6EA 4W9RA 5KYNA 2CUNA 1VRCA 5H82A 3S0JA 4ENVA 1LSJA 1Q14A 3ID6C 1MOSA 1PQYA 4HB2A 4HAUA 5TPZA 4WEQA 4NZZA 2H2GA 2EFGA 4UZFA 4PXAA 4DDMA 1RYHA 5DDIP 3RJ9A 1GY8A 4LZPA 2NZ2A 5TGDA 3EEIA 2O3SA 1G4HA 3S5JA 2E49A 2VSFA 4WY5A 2H7YA 1C1YA 2J09A 3HDJA 9ATCA 2OFXA 3OMXA 2TMDA 5I9IA 4LJ7A 4RVSA 4UUOA 1F14A 1YR6A 2NV0A 2V6GA 2ZR0A 3ANXA 2DR0A 2R65A 4IIVA 4KBYA 2CLKB 3REQB 5AOVA 3JWPA 3Q0IA 1V8OA 2JGJA 4PLYA 2E5WA 4QREA 1J25A 3S1LA 2GN2A 2PTHA 3HJRA 4LDJA 5DK4A 3GGCA 4BLRA 3HLTA 4D8WA 2WW8A 2WYHA 3AI3A 3K5HA 4EY8A 4AG6A 4O59O 1HC7A 1N2BA 1U81A 3D0QA 1M83A 4O4IA 1XWWA 3AXSA 3E35A 2QYOA 1JTEA 4PZAA 3ERCA 2HYDA 3RSHA 3WRVA 1BJKA 3CZ9A 3GUCA 3PG5A 2WU0A 1UMKA 1E20A 2ATVA 3ENQA 3P2KA 4MK4A 3A2KA 2RBGA 2ONZA 3AY3A 4GMGA 1LW6E 4RMIA 2GRAA 4XQ0A 2YXDA 1IL0A 3D3WB 3I8XA 5DX1A 2GGSA 1W49A 3KAKA 4UQOA 3V4ZA 5JD5A 2QUAA 1NMQA 3AOGA 1OZAA 2JGRA 3O1IC 4MQLA 5BR1A 4BV2A 1U2PA 3OJFA 2YN2A 4CIXA 1DJMA 4OFXA 1XT6A 1RHRA 1YBVA 1RQ7A 3FYUC 4MJ3A 4FDTA 2V54A 2ZP1A 2EWMA 2R7NA 4KZPA 4S2UA 3LPDA 2C7PA 2AS0A 4D82A 1D2AA 4A16A 4ID9A 2AMFA 1NV9A 2CDAA 3GT7A 3MA0A 4NMXB 5AK0A 5KHOC 4YQFA 3C2QA 2O1SA 5KDDA 1ZUWA 3BIXA 3W2FA 5IHPA 3TW8B 1MD9A 5IXJA 3INRA 4WDQA 3ZLUA 1SCNE 1TJNA 2D1FA 4XI9A 5CBKA 2EARA 3GDHA 2OP0A 5JQWA 1R0YA 4G5QA 2V5AA 4KSBA 4AS3A 2QN3A 3L8YA 4J75A 3DOUA 4C7KA 1T1IA 1GGJA 3D7NA 3DMDA 2BCGY 1NDUA 5FBQB 4PGAA 3I04M 1GLGA 4MMZB 1R0ZA 4HEHA 2FZ5A 2C2MA 4O4JF 5D5HA 2BF4A 2X23A 4MEAA 1UXJA 4I1IA 3ROEA 3FIJA 2AFHE 1UBTS 3KSZO 4IF4A 3L7IA 4FKZA 2A9KA 1T4DA 4JCOA 2ADMA 2J41A 2QRMA 4RVUA 3WADA 3U4QA 3ZVRA 3R5HA 5KBYA 3R5XA 4LTMA 5K0SA 3FMOB 1IY2A 3PHLA 4LHXA 2BGMA 1A9XB 5AWFC 4FDLA 1J06A 4II3A 2TRSB 2VJMB 1YV9A 1VKNA 4AY5A 4NNPA 4TYNA 4JR2A 1XMVA 4XQEA 3LHIA 3UHAA 3BDIA 1TVKB 2NLOA 1E32A 4EPTA 4X1IA 1QOZA 2OORA 3HVKA 1XFAA 2NACA 2P3SA 1KK0A 1R0LA 2YZMA 3SVTA 5ILOA 1GTRA 5BSWA 3KETA 3UJBA 1XMPA 5FUQA 4M0MA 2C42A 4B3RB 2JGMA 4I5GA 1EM8A 4PRKA 2VJBA 3D4OA 3FDZB 2Q3JA 3UXHA 5F2OA 4CMKA 4DKJA 4XUCA 4DHWA 1Z6ZA 3AGQA 4R2KA 4LOKA 3RVOA 3EXHA 3SF8B 4I1PA 3KVOA 4YRRA 3FPAA 3OE7A 4YS6A 2Y1EA 5EQJB 5ARDA 2Q5IA 1DUSA 1GGHA 2EKPA 4FFMA 3R5FA 3ZIDA 1BS9A 1TJPB 1VA5A 2ID4A 2WTAA 2ZSUA 4EP1A 3C7DB 3K30A 1K7FB 1ZR2A 3JQCA 4MWSA 5CIYA 5B3LA 1L5QA 1NGSA 3HZRA 1W5SA 1U63A 2X2EA 2ERXA 2VRBA 4M1KA 3H1EA 5BORA 2AH5A 1M5TA 2IYNA 2XYHA 3RS7A 5GJVC 2H07A 3ABIA 4E03A 5FNZA 5JZOA 1DAKA 5EIWA 4DW8A 1TUBB 3B70A 4DJJA 1LW7A 4J76A 1BHQ1 3EPRA 4LMPA 4Y9UA 4GOOD 4F2WA 5BUSA 1E3TA 4QT4A 4JEMA 4ND4A 1UK8A 4RTMA 1DINA 4YCNA 4JX8A 1NY5A 2JRLA 5C1PA 4JBLA 1WXFA 4GZMA 1WBDA 2XA9A 4ZTBA 3IFSA 1OWLA 1EUCA 2I1WA 2QP3A 2O3RA 5I7HA 4QU8A 5E2BA 3PC6A 5ISMA 1P45A 3NV7A 4NK4A 2VDNB 3V9AA 1XEXA 5CFMA 3GT3A 5DOZA 1JKJB 4W1PA 1YE8A 4BJ6A 1NZDA 3L0IB 4II7A 4L4RA 1LFAA 1N2CA 1I3KA 5D6NA 4CM1A 1THMA 2AC2A 2HGSA 4RF5A 5A9TA 1JU4A 4B4KA 3ZDCA 4MINA 1BVUA 4RKQA 3TIGA 1Y81A 1PVVA 4EGAA 3ISJA 2VUUA 1YF3A 2ZUTA 3HR8A 4DF3A 2XHZA 4DEVA 3TKAA 3L40A 1EP3B 3IOMA 5CB8A 1EXMA 3FF4A 4WN9A 1OIXA 4LE2A 4CN9A 4RKWA 1UDWA 2VQ3A 2WIGA 2IL1A 2JANA 2W90A 3INGA 5JRZA 1JQKA 1OV4A 3G7SA 3V46A 3TQIA 1J39A 3A4TA 2WD8A 4FMCF 2NSLA 4PPYA 5AKLA 4OJYA 4DA8A 3HO6A 4F5WA 2VNJA 1XO1A 4DDWA 1QXSA 2CUZA 1RU3A 4XCXA 3B51X 1W9HA 4P83A 4PSKA 3THYB 1WXHA 1NR7A 2D0IA 1WG8A 4IXNA 5IXSA 1V1RA 5FBWB 3W5CA 1V16B 1C7JA 3CN7A 5AM3A 4PNEA 4A8JB 1X8LA 4PG5A 6AT1A 5P21A 5LQMA 1YB2A 4B47A 4G5XA 4FDMA 4DR7B 2CLMB 3OU7A 3LCRA 4I4TF 3D3QA 1ZHOA 2VHVA 2A9QA 4IDDA 1EWYA 1C0LA 2GD6A 4H7DA 1YC2A 4D9HA 3MG9A 4ZT3A 5CD1A 1EFVA 2EBHX 2OEPA 3AF5A 1T6NA 4PG4A 4QXOA 5B2EA 2C7BA 1S02A 3HKEA 3OOEA 4Z1OA 3GLIE 3SE7A 2HNBA 2OPBA 2JDIA 4OOFA 4BGIA 2NYRA 2JJ2D 4MQEA 1LI4A 3FAZA 5ALSA 1V3TA 3OX2A 5EJMA 1A5TA 3BX1A 4TN5A 1MAAA 2ZJAA 2I66A 4B3TB 1U28A 1L5LA 2I9PA 2IZOA 3E7WA 3UJ3X 4FN4A 3WYDA 3OX4A 4A10A 4BN4A 2AR9A 3V55A 3CRQA 2C2HA 4FZRA 4MVJE 5JC8A 5LQDA 2QM3A 4D96A 3D81A 4B3BA 1JQ3A 3HHPA 2M98A 3HC7A 3A31A 3I83A 3VGPA 1HDRA 1IB6A 5GM2A 3VPHA 1G18A 4OQXA 3UCXA 4JJ7A 4KMMA 2OTCA 3DHWC 1EVZA 1SH7A 3S55A 2DT5A 4J1QA 3TRHA 3UKJA 4DMHA 3V8RA 1QSGA 1WZUA 3LRXA 4OYHA 2B8EA 2O2GA 5GV7A 2AFIE 1RHKA 4N7RA 4C29A 3ROXA 1OC4A 3LAWA 4FD3A 3C45A 4FZ3A 4X1YB 4WIAA 4WVLA 2QPAA 4RORA 4D8XA 4E3ZA 5IN4A 3R75A 3H9UA 3EARA 2XKJE 1Z6YA 3PL5A 3R7DA 1C14A 4WJLA 4KK4A 4L4XA 4RTQA 1U3FA 4UD6A 1XEAA 3L02A 3PFIA 5KOHB 4LECA 4YRBA 3U3XA 4HKTA 2QV0A 2ZRFA 1LC0A 5EKSA 2FU5C 3GVIA 2Z58A 3I3OA 3R0VA 1M76A 4RZ3A 3ZIAA 3AC0A 1U7OA 4ESHA 4YY3B 1TK2A 2B1IA 2GASA 3GH1A 4MUIA 4DCSA 5DNUA 4MJXA 3L9WA 4ZOLF 5DN6D 2PZAA 3STWA 1UK7A 3VH2A 5B4TA 1P4JA 3DLAA 2BI8A 1WSAA 2H65A 1V35A 2G36A 2C58A 4OX9Y 2B25A 2MMCA 3AR3A 4AUNA 4DADA 3V00A 4B35A 1T13A 5JG7A 2Q5LA 4KVZA 2VP5A 3MXTA 4X6UA 3H9EO 1XKQA 3W9YA 3GIDA 3PDIA 5DIFA 1E2NA 1U8XX 1NW8A 3IOYA 3H84A 4F46A 4WZAE 2GAJA 1H2ZA 1G3IA 1ONOA 5AYVA 1GT6A 3O0TA 3N86A 1KZ9A 3OPQA 5DASA 2X5JO 4ND3A 3MW8A 3WMWA 4F5EA 4O29A 2ZSHA 4UEKA 1J0EA 1GU7A 4YMLA 1DQSA 4KV9A 4WNAA 3AYXB 4IQ0A 4D57A 3PQ3A 3EEQA 2JGDB 5JJCA 4M38A 3VR6H 2VPTA 2Z0MA 4WPGA 1JTVA 1KF0A 1CKEA 1XTTA 4UZSA 3IC5A 5FORA 1NVVR 2PMBA 3RTEA 4KN5A 5KVVA 2MMGA 2IHTA 2KMLA 2O23A 3AF0A 3OA2A 4G1VA 4PFJA 4XD7D 2J9ZB 3GL9A 4CM4B 2I4NA 4M1MA 1Z5NA 2JI7A 3MTAA 4JP1A 2BGLA 3GXOA 4QBGB 5CT5A 2L42A 2WBLC 3KJNA 3PFKA 4N0DA 1R0WA 3B6MA 1WMSA 1YQEA 2VAXA 3N2IA 1LNZA 4FOPA 3HJTA 1UDCA 4LRWA 1A9SA 1ELOA 1RWBA 4ERXA 3PWKA 4DSUA 1SKYE 2AUNA 1X2EA 3P0FA 4UXHA 1Z5VA 2Y68A 2F59A 1KYIA 4LPSA 2D8AA 2HCJB 3B1JA 5FBZA 1J5XA 3VRHA 1DWQA 2EFDB 3BTSA 1NNI1 2SICE 1YRYE 2RGAA 1UZAA 2W6NA 2OM2A 3RS5A 4X45A 2F1RA 4UM5A 3TK1A 4O4JA 3E6AA 3FVWA 5DCUA 1XZNA 1PQ4A 3LSYA 1XSEA 4NXMB 4QUKA 2Z4TA 1QIDA 2QW1A 1OWPA 1WUKS 2X1VA 1GHTA 3O95A 2DWPA 2AJTA 3AU8A 5E2IA 2DTDA 3H87A 5KCMA 5EIEA 3TPZA 3AI7A 2A33A 1PEDA 5I7OA 5BPFA 1BFDA 2CLCX 1MB2A 2FSUA 2H7CA 2QX9A 3KEOA 3N74A 5FBKA 2DH5A 4D3YA 3RUCA 1QH0A 3ETEA 3JQQA 2RH8A 3TNDA 4BB5A 1T4CA 3NTXA 1XZEA 3S44A 4DKXA 2PPVA 1KAOA 2XE8A 4WXYB 5EE0A 2WPNA 3EWSA 3G8YA 1CZHA 3F5QA 3K70D 3CKKA 1B93A 1MKYA 2CLFB 3M6AA 3UMRA 5A71A 3LX5A 3KPYA 1P2FA 4CKXA 2ES4A 4UQPA 1FNMA 3TRIA 1NVAA 1RHMA 1SR8A 4F71A 2G7MC 3BWEA 2J0UB 1G66A 2P41A 5I8PA 1L4LA 4R1UA 1UIRA 3A0RB 1G8SA 1XPJA 3OLWA 3RTBA 1WKVA 2WJAA 4AT1A 3H3FA 4RZSA 5CD9A 2AWNA 3EDYA 4PPNA 3UWKA 3DZCA 3O91A 2O8CB 1OGJA 4PO8A 3VMFA 2BHLA 3GF4A 1ZD5A 1RJEA 4RUKA 1MORA 4A6EA 4BCBA 1QF6A 2CXNA 2ORWA 3WWDA 3WYEA 2OHIA 1KJWA 2OC9A 3D6NB 4DR3B 3U7IA 1ZNWA 1SY7A 2YC4C 5KTTA 2OQRA 5K2OA 2J7KA 2PLFA 1M8GA 2I71A 4AQDA 1VXRA 4CF5A 2Q7DA 4YP5A 1NUPA 4ZQBA 5EHZA 1P6QA 1WXEA 4PBSA 3ZE6A 2QTBA 1P2GA 1V5IA 5HZGA 2ZTVA 2JK0A 1AUXA 4XIGS 4BBJA 1LC3A 1T0PA 5AVKA 1X1TA 4YXWA 4D9NA 2F9MA 2Q3DA 3W9UA 2DSTA 4W5OA 1RE1A 1Z6GA 4U2DA 2V7QD 3RVRA 3FHOA 2QDXA 5F76A 3GZTB 4BV3A 1FLNA 2GKGA 3ND8A 6ADHA 4UBIA 5TXGA 2BSQA 2PR2A 3TDNA 4J94A 1G8HA 1M54A 2Q4BA 2VJDA 2VUHB 2ETXA 3HI6A 2HQ1A 2LKCA 3NHZA 3IVMA 2Y1OA 4CQMD 1BWSA 1HEYA 2GZ3A 3QHPA 1QG2A 4JELA 2F2TA 3BTUA 4KEAA 2YUIA 4DJFC 1HM5A 1XK6A 4C87A 3RKSA 3P5SA 3R1IA 1SULA 2ZAIA 4L50A 4OV6B 5H68A 3L7LA 2IXGA 2UUPA 1TKAA 2AF4C 2B2NA 2Y1XA 3CISA 2FOXA 5H70A 1L1FA 4CKBB 1PG5A 3OZGA 4PU0A 4QDXA 2R6HA 2IUUA 3T7RA 3HUTA 2JASA 3MHPA 3EAQA 4C4RA 4BATA 3Q7IA 2H4HA 4RJ2A 1KQ3A 2AV6A 2PKWA 5E1MA 4B3GA 5BOSA 4FGJA 1BGWA 1XZAA 1Z0JA 2DH6A 4ZICA 2YW9A 4QU5A 3UKOA 4J7AA 5B3JC 2IHYA 2G17A 4KWCA 3L8DA 2E18A 2FEAA 3ZI7A 2CV1A 1L4EA 1M0EA 3Q72A 4LBZA 3EPJA 5JFTA 2IZ7A 1SCUB 3F67A 3HACA 4RFSA 1U1EA 3V9PA 2YJNA 1W85A 2LR0A 4D4MA 2PCLA 2R68A 3HFGA 3OLZA 2XTNA 2QTCA 3QOXA 3R20A 4Q02A 5LBTA 3UV3A 3U7QA 4R2WA 3X2EA 3QTLA 1E2MA 3PJFA 5H02A 3QY0A 2PUFA 2B92A 1G2PA 1LPBB 2HMAA 1F20A 1LTHR 3GEEA 1A04A 2UYQA 3X43A 4EQ6B 1USUA 1G16A 3J7AC 1Q16A 2PZEA 4KQFA 1HT1E 1Y3CE 4HNAB 3RBVA 1K5DA 4I4TA 1ESCA 2B7LA 3COJA 3NIGB 4YCSA 1F3OA 2CDCA 2PLWA 2ZYTX 1L4BA 2IYTA 3Q2OA 4KWIA 4Q66C 5AXDA 3SJ7A 3TOZA 2QR3A 1QBGA 2QTRA 2EFJA 2QRVA 4HH0A 4C20A 3OJCA 4TPKA 1XZMA 2A4KA 1C1DB 2QTMA 2PUCA 2ZZNA 1YJCA 2IYSA 4CCYA 2D2VA 2PK3A 3PT5A 3QSGA 4JYPA 4RPJA 5JMPA 4ARZB 4E0BA 5HS6A 5CEFA 1GVNB 3EODA 3FYTA 5KWVA 1G7CA 4R54A 3T0FA 1S8NA 1YJXA 2PS3A 1FRQA 5CR9A 4DEYA 4DRXA 4ETNA 3K0EA 3W7BA 3Q3JB 2XB2A 1XVAA 1DBRA 4MV9A 5HW0A 3V1TC 1C8VB 1SHZA 2OK8A 1L5HB 3L0CA 2UV8A 2C9DA 1GZHB 5M3BA 3NFYA 1PR3A 1TYAE 1AKEA 1RKQA 2WAMA 1C8LA 4Q48A 1PRYA 2BF7A 1PSWA 3GQBA 4XIYA 1YKGA 1FYEA 3E82A 3N05A 1TVMA 1VP9A 1PL7A 3QPDA 4GXRA 3U19A 1GSHA 5KNCH 1JMYA 2BI7A 1KK2A 2FF7A 5DNWA 1TXGA 1IHUA 2I2XB 2JKYA 1T0JB 1GU0A 3G2QA 2PD6A 4ZPJA 4Z2YA 2C4VA 1KFJB 1KY3A 3HP4A 3NHMA 3DV0B 3K96A 4KE6A 1CEEA 3NHYA 1W35A 3ANYB 4TS4A 4Q3BA 3R3VA 4MH0R 1EWQA 3OD5A 4DL9A 1AHIA 3N2GB 2QRPA 5C4MA 1IIRA 1KI2A 1Y7LA 2JAHA 1L5RA 4QPDA 2JFPA 2B3TA 3PC8A 2VA8A 3OZDA 4AKSA 3R7FA 4RDHA 1M1YA 2LTAA 1LPOA 2M1XA 2ZUWA 4QYTA 3KSDO 1WQ3A 3NEPX 4ZOLA 4C08A 1YE3A 3WLOA 1W2WB 3ZWAA 2F8MA 3D9QX 4AJOA 1NXOA 2O5EA 2HADA 2VBFA 1S1CA 3NHFA 2XMGA 3AR4A 2CVHA 3RSCA 2XAUA 3P9XA 2G77B 4Y0AA 1BXGA 1E96A 1JJ7A 1NJFA 2EF1A 2JFZA 2ZT8A 1M8JA 4G1FA 4UDOA 4BNYA 1DZIA 1U7TA 1LDYA 1UXIA 3JZFA 3OSZA 4KWHA 1SVWA 4ZQIA 4RH1A 3TPFA 1HT3A 2C2WA 1O6BA 3ZHXA 4P93A 3KXPA 3I3SR 4IUCS 3WXBA 3IMKA 4DC9A 1AMOA 5ED4A 3E2MA 1IM2A 1LSSA 1QM5A 3EHEA 3ZYCA 4E7PA 4RH0A 3NBXX 1NASA 5GOZA 1XPRA 5CM2Z 4BVEA 4H15A 1E1QA 2PV0A 4HNQA 3REGA 3FLBA 1NUHA 4O6VA 3FH0A 1VB3A 4MQ4A 3KJXA 3HVUA 1X2BA 3DE1X 3X3HA 4O02B 2IOQA 1PF7E 3B7WA 3GMSA 3SYNA 3TEFA 5JYDA 5IG2A 2Z56A 3GA7A 4YAFA 3UPDA 1JFVA 1Z6PA 4KFUA 5F78A 3WGMA 2QMUA 4OHUA 4LVUA 5CYPA 5H9VA 1S2OA 1WCYA 1VMDA 5EWLB 3MEQA 4Q9AA 3GD5A 2ZRNA 1CHNA 4ZYLA 3RFVA 1GGMA 3D6MA 1CJBA 4UBOA 1OB5A 2W9XA 3HY3A 1MO5A 2HSDA 1U8YA 1RAHA 2WKWA 2ZB7A 2B35A 3BCHA 2C9ZA 3D43A 4TWJA 3QMWA 5AW8A 4UTNA 1ARZA 4HZUA 1SUSA 4NICA 5HK9A 1JHMA 5CFNA 2W93A 4ZVTA 4J0CA 4DXHA 2VAPA 3MELA 1JQAA 2JAUA 2ZM6B 2ACKA 1XALA 2CL5A 4GM4A 5L3RA 4RBNA 4G63A 4N39A 2WJWA 2V7GA 4PHCA 5JDIC 2E4XA 2VH2A 5DE3A 1KE2A 4GL2A 1UWVA 2OC4A 3KKKA 5JLAA 4NU0A 3EIUA 3MB5A 4TZ6A 3TW6A 2ASVA 4O8ZA 3AQ4A 2NXCA 2O0MA 4ZGWA 4PQEA 4BN5A 2BYTA 1A69A 1JG3A 1YZVA 3AEKA 4Y2HA 5CCDA 5DEIA 4ARSA 5AVRA 3K9CA 1ORVA 1UXHA 2EKDA 3RLIA 1MZPA 1LRKA 1MP0A 4GSKA 6YASA 1OWNA 3IUQA 1VHTA 4MP8A 4PCVA 4DQVA 1UT5A 3CT4A 2OVBA 3F0TA 4XQGA 2GBLC 4JP3A 1VJRA 2MHCA 3SSNA 1RWQA 4ENRA 1A9QA 4RANA 5K3EA 3M1IA 2XNKA 4OSEA 2QAGC 5JANA 4F2DA 1RCFA 4PX2A 3EPHA 2FPXA 4MRVA 1AB5A 2VT6A 2P6MA 1AQYA 4FFVA 3GBPA 3M3PA 4ZEWA 5DV9A 5FLEX 4DBVO 3TVDA 3HNRA 3TTYA 4TV9B 2IH2A 3KB2A 4Y2JA 1UPFA 2JA1A 3DFUA 5DYGA 5FJIA 2VIIA 4NSNA 4EEZA 3RV4A 3G0DA 3S2EA 2JGFA 2B1JA 4XB1A 3PI7A 5ITWA 3KSRA 3V7UA 3DB1A 3F6EX 4UNIA 3ZBTA 3KJEA 4K8OA 4KFSA 5H3CA 1U9ZA 5C1DA 2W22A 3EEYA 5BV8A 1MTOA 2W2KB 7MDHA 2XZTA 5EE1A 3UH0A 4CGZA 4U0KA 3PKZA 3OY2A 1EK5A 1QU2A 4W1QA 1BCRB 4X91A 4ZAYA 4JP2A 1JVSA 1I4TD 1CNEA 4BC0A 1I1HA 3CLUC 4EUSA 4CBVA 2B4AA 4HCJA 1MO3A 4DUZB 1R15A 3DBVO 1QE3A 2A5YB 4E5KA 5BN3A 4BO8A 4C06A 4Q4CA 1I2BA 1WW2A 5FPPA 3SGLA 2YXNA 4C0WA 3C48A 3FTCA 5D3QA 3WMEA 4IW3B 2O2ZA 2FOIA 3CRNA 1AO0A 3TQFA 4D6XA 2VDQB 1ZAYA 2P9QA 1CIPA 1UJ5A 1EK6A 2I62A 5CCXA 4HFJA 3R7SA 2D3TA 4YO8A 5GIOE 4ERNA 3D02A 3SZMA 1B1CA 4RZHA 2GK4A 2Z3WA 3BMNB 3QVOA 1VJCA 2QVLA 4FW9A 3WGHA 1FJGB 2B4RO 3B52X 2CNDA 4N0EA 2B4KA 1AV7A 1YHZA 2J7PA 1I7SB 1PDVA 2Z5LA 2K87A 5ALYA 5BYKA 4E5MA 2Y2VA 4F7WA 1L7DA 3LDFA 3H13A 3BTVA 4E2ZA 3RUPA 1VL5A 4LXUA 4NBLA 5CT8A 3UEOA 4EG7A 1TRKA 3KK0A 3KJHA 2IOYA 2NWQA 1KZHA 3TLKA 3TGWA 1KIFA 1UPCA 3JVVA 4CT4B 4DR4B 3OA0A 1VGRA 4TL7A 3UYLA 3E0XA 1V11A 1Y3HA 3RSZA 1ECPA 1LEHA 3I9KA 1V45E 2H7XA 3TZKA 1ZD2P 1AN9A 1WD5A 1FYDA 3OOJA 4EVIA 1SK9A 2PBZA 4ATNA 5LP1A 4UD2A 4OSOA 1X39A 5EC8A 5GONF 1Y6ZA 4BAUA 4XVQA 3G0GA 3LPMA 4GX0A 1EINA 1UEJA 5TMBA 4NYJR 4XXHA 3S2IA 2W2XA 2R1VB 5DTIA 1GNLA 5HMMA 1A8UA 1FRVA 1GPDG 4QPCA 3AR7A 2PLRA 4KNYA 4IG4A 1SG6A 1VZ2A 2NT3A 2Q8QA 3R3JA 2FF5A 4W4TA 4A8HA 5LC1A 2DLNA 3DBRB 4Y1EA 3TZHA 2G72A 4HRXA 5A6SA 4C4SA 1U80A 2CSUA 3L1IA 3A9CA 1PYGA 4XAQA 1Y8CA 4IYJA 4LHYA 4B3CA 3K09A 5CBPB 2A67A 4FGSA 4DIOA 5E6UA 3ZDRA 2A1UA 4B48A 3U1BA 3RUFA 2VCEA 1GFZA 5TEWA 3KZOA 3R3ZA 2XCSB 5BXYA 1FRFS 1AKVA 3I9FA 5L3SA 1E6MA 1I01A 1L3IA 4OHXA 3QPCA 4LNUA 1OY1A 2DECA 3C5CA 1T1JA 3EF3A 5AK5A 3EMBA 4GF5A 2XKKA 4N01A 1ZNXA 5AKKA 1NC3A 1T5BA 1RC8A 4YT5A 4AQ7A 1QK3A 4J4BA 1G5QA 2JJ8A 5AJTA 1V7QA 4QGAA 3CSDA 1UP7A 2H29A 2ZJ8A 3R7AA 3WLMA 4DPMA 1NRIA 2QHXA 4Q34A 2Y92A 4L22A 3BFJA 4EHHA 2XZDA 4X7RA 2VXYA 4LJ6A 4DVJA 1Z8NA 3RYTC 5KU1A 4L51A 1QYDA 2WSLA 3E9MA 1DJNA 4W5RA 4HLNA 2ZAMA 3L7DA 3QENA 1S01A 3NEAA 4TLBA 4FXOA 5FO1A 4IKPA 4RMNA 3U44B 4MWGA 3C3BA 4AZ3B 2FMHA 1TZBA 3V7YA 3VU9A 1P2SA 3ZW8A 2V03A 1FLAA 3O4JA 2QX8A 4GOKA 4LBYA 4MITA 4YCBA 1A76A 1EP9A 5SYMA 2P8SA 4Y3UA 3C8ZA 3GLGA 4QELA 2FPGB 3ETCA 4XEUA 2W4MA 3FDJA 4Y9SA 2G76A 5BNIA 3SQDA 2ID9A 4FYXA 1GNSA 1NQVA 3RD5A 1HBJA 3AHEA 3U26A 1MW8X 1JHAA 3F6RA 3LNTA 1NUUA 2W4IA 2WKQA 5F21A 3VNQA 4DGSA 1SG9A 4UATA 3ZLTA 3JQGA 1UJNA 2R7AA 1JDJA 2J3HA 3GQVA 4JOBA 1NF3A 1ZGZA 2PBLA 3CZRA 3N8NA 3S68A 1N8SA 1OW3B 1VXOA 1ZN7A 2I2DA 4JGGA 1GTVA 5CFRA 5IDQA 1UBUS 4YLGA 1UWCA 3C3WA 3AUUA 2XCOA 1KZ6A 2HIMA 4HADA 4DCTA 1HX7A 1EBFA 2J85A 2Z6VA 3DBHB 1D5CA 4XW2A 2WWXA 5L6LB 2OCAA 5TF0A 1YRWA 5I6DA 2JLXA 3CE9A 4TZ0A 2IZ0A 4HDCA 2O7SA 3V7NA 2CFIA 3HO1A 4G8CA 3U37A 3ZUGA 1G20E 4C4OA 4F84A 4LF6B 1JLMA 2PS1A 2HRCA 1KO5A 2KBEA 1E9SA 1ZM3A 4M1OA 3T5CA 2PUHA 2EJUA 4YAUA 4QGHA 3C6KA 3NAMA 3Q5DA 3SX0A 3MUFA 1UBRS 2KPOA 4MVJD 4DIKA 2I2AA 4TZKA 3F4BA 3DDCA 2VPIA 2W00A 4GE3A 3RK4A 3V2UA 3TMYA 1U0RA 4WKOA 4BMZA 3B3FA 1N5MA 1SN7A 4XLZA 5I7VA 3NEJA 1U2ZA 4JMPA 2G5PA 4U6NA 4MAMA 4OI2A 2QJFA 5FTNA 4DLRA 2J08A 4PTZA 1PR4A 2FLWA 1PTJC 3HVJA 4Y9DA 2WKRA 3OJEA 3UTDA 3AUTA 3CJQA 2OXTA 4EUEA 1AY0A 4DMGA 3A2NA 2OORC 3FWHA 4MIOA 3WVNA 3DT6A 3UMYA 1V6SA 4HUQA 1TQDA 1UC8A 1XJWA 3MWYW 1Z47A 5T6BA 3ICVA 2ZYWX 3GPIA 1GRNA 1OT5A 5KNBA 1SXJE 4IRXA 2GB4A 2RHOA 5BQPA 5IJZA 2K4MA 4B81A 1RMTA 3N3BC 3QU9A 3ZVMA 1CT9A 1M7GA 2C04A 4XYLA 4RH3A 4Z1MA 2FG7C 3U7HB 3ORYA 1O94C 1X0VA 2GYVA 3UV7A 3V48A 1YU6A 3LWBA 1FNDA 1ZONA 1Z38A 1O5OA 3G9XA 1NW5A 3PQCA 2WTMA 4GX5A 4NS1A 2PH7A 4KOEC 1T34A 3X1YA 3F5SA 1E4YA 4K9LA 4EHBA 5D84A 3PKJA 3OO1A 3AI1A 1N2JA 2EGGA 2NNWB 4FYKA 4PIPA 4Q9NA 3QITA 2VJLA 3AR6A 3HU2A 5B12A 4LZAA 1SZJG 1U8ZA 1ZM7A 2WR8A 2ZUSA 4M88A 3W3ZB 4FM9A 1PZNA 2GF2A 3Q15C 2N3ZA 4LJ9A 2JIBA 5LLSA 3G6KA 3GZNA 4L5JA 4GSYA 3QYPA 5HRAA 1N92A 1XAHA 3VKUA 4EEKA 4W5TA 5IXYA 1SXJC 3W3AA 3PXXA 4LRXA 2BPOA 5D7NA 5A3SA 3VYSB 2ET6A 1PJRA 2OBYA 1PUJA 1ZJJA 2UUOA 2PYZA 4GGPA 5DLPA 3TW4A 1DBVO 1K97A 4IDFA 2AZDA 2FUEA 4BECA 4K03A 4W9NC 4LRTB 5K2MA 5BN5B 1R9JA 4JKYA 4NG5A 5FV7A 5HUJA 2HLNA 3ORRA 2Q28A 4CMIB 3JARB 3ZTYA 3BE8A 5IWCA 2NAFA 3L6OO 4UTRA 5HNKA 5JNUA 2G4LA 5K0EA 1CSEE 4OB6A 3EGDB 4D9BA 1Y6FA 4P9NA 1W0KA 4WXMA 5B1DA 2B30A 2W8BB 4ZCIA 1ID1A 1W96A 1NT2A 4PRLA 1R00A 4RQTA 1AS2A 4LJSA 1GPUA 1EQAA 2WE8A 3GY0A 3B1XA 4N7JA 5C1IA 4EFLA 1U2QA 5ITVA 2C5GA 4LWZA 4ZVRA 4AIRA 4XJVA 1GPKA 3CLHA 2G9RA 4BNLA 1MNQA 3P9CA 3OT1B 1Q74A 4URHA 1CJKC 3JD3A 2PD4A 1PO7A 2QSZA 2Y0DA 1II8B 1G60A 1T9DA 3IIIA 1O9GA 3FKJA 2PUGA 3EVGA 2XMDA 3M4JA 3NDJA 5CK4A 3GVCA 4LY9A 2XOKA 4ZVLA 4RIGA 4UHEA 5L8VA 1SUCA 1PUX