5L4NA

Leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
253
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Chroman-4-One Derivatives Targeting Pteridine Reductase 1 and Showing Anti-Parasitic Activity.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 95
structure length 253
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l4nA00
4BKOA 3FRJA 3JYQA 4URFA 4B3HA 4RF5A 1W0CA 3G3EA 3ZWAA 5L40A 3DONA 5C7IO 4AJOA 3C1OA 2G17A 1N1EA 5DP1A 1PL6A 1QYCA 1ZW1A 3PWKA 3HFSA 1QYXA 1YOVA 3I1JA 3PDUA 1ADBA 4MP3A 2X0JA 4CLOB 2AEJA 3WX0A 1PGNA 1JTVA 5KCZA 2GNAA 3VZRA 2A35A 4M89A 1QV6A 1WMBA 3A06A 3GA0A 3QA9A 3CMCO 3F5SA 3AUTA 3DOOA 3DBLB 2JCYA 3UVEA 1M2WA 5GMOA 1I3LA 2FMUA 2OOSA 3D0OA 1HTBA 4AJEA 3ROKA 1LXCA 2O48X 1EUCA 2G82A 4U6QA 4RGBA 5HBRA 1R12A 3VH2A 3VTZA 3QVWA 1SC6A 4J49A 1Z74A 1ZSYA 4QQRA 4R3WA 2X6TA 4YAJA 4FQ8A 4ZQGA 1ISHA 1A72A 1Y9EA 1CF2O 2NQ8A 1U3VA 2AG8A 4ITUA 4PLWA 2WMDA 4IQGA 2B36A 3ZZNA 3V5NA 1Y8QA 1E3EA 5A04A 3JSAA 4XA8A 5TRTA 3VAZA 5IXSA 1HYHA 3GH3A 4GMGA 1EQUA 1UAGA 3CUKA 1GTMA 3DAPA 4E2ZA 4R1SA 4K9DA 4WUVA 1XG5A 2QG4A 4Y6SA 4BO5A 3QJ5A 3L4BC 4PG7A 4NI5A 1HDYA 3AM3A 4D3FA 1B3BA 5DBFA 4K6CA 5BNTA 4EJ6A 1U9JA 2Q1TA 3H4VA 1V3TA 1LU9A 5B4VA 2GZ3A 2POQX 3Q0EA 3IOYA 5CDGA 4BNJA 5L4NA 4Q3AA 2IODA 1RWBA 3RC7A 1X7HA 5I8ZA 2HKIA 3FPLA 4U7WA 4YT4A 2WYWA 1T2CA 3DC2A 4X54A 2R6JA 2YHIB 2VNSA 3MTGA 5JO9A 4CMKA 2EV9A 3GPDG 5B4TA 2Y67A 4OOFA 3K96A 2X4GA 4BNHA 4NIMA 4ALKA 4Q39A 3EY4A 3MJTA 4BVAA 1ISMA 4WLOA 4YWJA 2YYYA 1SB8A 2LDXA 3RFVA 2GD1O 5ER9A 2O3SA 3OHSX 1PJQA 4FD3A 3JQ7B 4CODB 1VL0A 5COBA 4BNKA 5JDIA 3LC1O 4PLHA 5I9NA 5A9RA 5T8KC 3VPGA 3WFIA 4AJLA 2CSUA 4YJHB 5T6BA 4MO2A 1GZ3A 5A4DA 1ZK2A 5MGBA 4AJHA 4KOAA 1YB4A 2B4RO 1F8GA 3SJUA 3CH6A 4AJJA 3LYLA 3BXXA 4HFRA 1I2ZA 3GEDA 1ZBQA 1MGOA 4WLUA 3OEYA 2BGMA 2W2KA 3BHMA 2Y1FA 1PJ4A 5G4KB 3ZU2A 5B4UA 3V2UA 4UVHA 2O50A 1XLTA 5T5QA 1LSJA 5JYDA 3WMXA 1Y8RA 3DOCA 4I8XA 1KY4A 1YH3A 2YV1A 3DBHA 3QWBA 3I9OA 1B8PA 1H6BA 2OBNA 4OXNA 1OBFO 3CEAA 2DTDA 1BXKA 3GDOA 3GVIA 4TMFA 2P5YA 3ANNA 4BNXA 1BMDA 4WOKA 4OKNA 2E37A 3HG7A 2B4TO 1JKJA 4CUJA 1XYGA 4DXHA 5KWEA 5TT1A 3BMOB 3H3FA 2ZB4A 1KVQA 4R5HA 2NU8A 2IZ1A 6ADHA 3R0IA 1AXGA 5JAIA 2TMGA 1GQQA 3RROA 9LDTA 2ZYGA 3C7DB 4O59O 3MWEB 2PZMA 4IDFA 4PFJA 5KVSA 3N7UA 4AJ2A 4W9NA 1E7YA 3PJEA 3C85A 4E5YA 1NQOA 3D3WB 5TNXA 5ILOA 1KBZA 4CMEC 1QLHA 1ZSVA 2PGDA 3VH4A 1AXEA 1QYDA 1BHSA 2I5PO 2EGGA 4BNLA 4E5KA 1K6XA 4O1MA 4PLFA 4D79A 1ZXLA 1PGPA 4Q9NA 1KERA 4MVJM 3WQSB 1W8DA 5I8WA 2E82A 2GCGA 3VHRA 1KVSA 4BO1A 3U4HA 4I5FA 1K0UA 1HLDA 5DCUA 4RJTA 4XKJA 4BIIA 5DP2A 1EK5A 1M6WA 2OGUA 3HE3A 1GQYA 1KC3A 1QORA 3GAZA 3GVHA 4TQGA 1ENPA 2X86A 3CTMA 3ZW9A 1SEVA 1Y7TA 4J1SA 4J1NA 2EP5A 1BTOA 1MG5A 2PZJA 4IS3A 5DT9A 2DKNA 1GY8A 4D42A 3IP1A 3UFXA 1E6WA 3ONDA 4D0RA 3QHAA 3FR8A 4HFMA 4R01A 1R16A 4M54A 7MDHA 2FHSA 4M87A 4Q3NA 2J8ZA 5U4QA 1NVGA 1YL7A 1J4AA 3H3JA 1A7KA 3BMNB 2VWGA 1HSOA 4GVXA 3ZNOA 2CMDA 4K1LA 3F6YA 3HADA 1A9ZA 1Q7BA 1BVUA 3A28A 4CUKA 4XD2A 2YJZA 4RDHA 3I9KA 3DMYA 4YBZA 1ZSNA 2DPGA 4TSKA 2ZTMA 4TKMA 3ZNQA 1S7CA 4GX2A 1JLLA 2VCYA 3LSYA 3OETA 4OHUA 3Q1LA 3H6KA 3LC7O 4E5NA 4D44A 5KVQA 3O03A 3D7LA 4B4OA 2AQ8A 5CG1A 1P31A 5AQ1A 3ZU4A 2EF1A 2YDXA 3R3JA 1U3WA 4JIGA 2VN8A 4CV0A 4CV3A 4XYEA 3IDSA 5DZSA 2VWPA 3WS7A 1X7DA 3AY3A 2Y99A 3JD3A 5THQA 4MP6A 2Q3EA 2DVMA 5TJ9A 1YOVB 1I8TA 4B8WA 2RCYA 2P9GA 3L9XA 3EC7A 1N7HA 1RM5A 1LDEA 1BVRA 4KTTE 1YRLA 1HDOA 4ZGWA 3QW2A 2AQKA 1JKIA 2UUPA 4M1QA 3AW9A 2C2XA 3OP4A 2YQ4A 2QRJA 4EUEA 4I1IA 5IDYA 1HF3A 1XELA 1LDBA 2DBZA 3KOUA 1XU7A 2YV3A 1KVRA 1P74A 1CEQA 4A27A 4E5PA 4BNWA 3PPIA 1B8UA 1DDOA 4KP7A 4AJKA 4HFNA 2ET6A 9LDBA 4QFDA 1AGNA 3F9IA 2C07A 1HL3A 3GAFA 1WPQA 3D5TA 4M49A 3RD5A 2G0TA 3IL2A 1NHWA 2PZLA 2DC1A 4JP2A 4BO0A 1LRJA 2QYTA 5EL0A 4RPLA 4BNGA 1FF9A 2EGHA 1XEAA 4HXYA 5EERA 3QWFA 3DBVO 4DQXA 1R4MA 1NYTA 4CM9D 4WECA 1YE3A 1M76A 2BFOA 3AY7A 4YCAA 4L76A 3DFUA 4UEOA 1T25A 1LLDA 3IKVA 1UXHA 3I6IA 1F0YA 3HDYA 1Y5RA 4DLBA 3NGLA 4H15A 3WQQA 3EUWA 3RC2A 3UAGA 2H1SA 4E2YA 3U3XA 2ZYAA 2E48A 4CR6A 2JAHA 2PTGA 1VJ1A 3QWAA 1P1RA 3F46A 4M55A 4AFNA 2Y05A 4NFHA 2X23A 4B4UA 3H5RA 5ILGA 2GZ1A 4JCOA 2BI8A 3D1LA 5EESA 2OP1A 3EK2A 4RVUA 1E7RA 2FR0A 2NTNA 3SLKA 3E9MA 3WBBA 3EDMA 3JTMA 3AUSA 3TSCA 4UVDA 1NPTO 1QG6A 3GVCA 4OO3A 4P8RA 1C14A 1LA2A 3EZLA 5F1KA 2RHRA 2QZZA 2FR1A 2A94A 2EP7A 4E4YA 2CUKA 4B3IA 5L3ZA 2DBRA 2VZ0A 1PS9A 4WASA 1E3LA 1LLCA 5I9MA 3VDRA 3E5MA 1HKUA 3AFMA 3K2EA 4QO7A 2D2IA 4FGWA 2Y0DA 2PKRA 4BO2A 2DTXA 1DHTA 3ZWBA 3I83A 4CLEA 1SEPA 5KKCA 2IYPA 4IM7A 1YBAA 2A4KA 1Z75A 3MJVA 3G79A 3DHNA 5JE8A 2HCTA 2G1UA 4CL8A 2J6IA 2HRZA 3ADOA 3DMTA 3PEFA 1GPJA 2WE7A 4Z3KA 3S2FA 5KIAA 2O3UA 2XF8A 3O9ZA 4GKBA 3RJ5A 4XR4A 5BNFA 1Y9AA 1IHYA 2EJVA 3NKLA 2RHCA 4CLRB 4BKQA 1YL5A 4L74A 3AFNA 2JFFA 1C1XA 2AXQA 2VWHA 2J5KA 4GQAA 3DBHB 4WNCA 4DRYA 5L7WA 1DHRA 4CV2A 1RYEA 3PYMA 4Q3DA 3KXDA 4P4LA 3IUPA 4EYEA 4G65A 2H9IA 4M86A 2Y68A 4WE3A 4EITA 2JD2A 3PFWO 4PZCA 2JHGA 1EK6A 2O4UX 2NTVA 1Q2XA 2D5CA 4IGEA 5GZ1A 1VKOA 4QXMA 2OZPA 4XZ3A 1MP0A 1ISIA 1E6UA 3KYCB 4IINA 4IS2A 5FWNA 1NVMB 2VRCA 5AYVA 4XRGA 1XIVA 3FCOA 3GUYA 2ZB8A 3WG9A 2GASA 1W73A 4PLYA 7ADHA 3L4SO 1LDGA 3O26A 4LVCA 4S1VA 2Y93A 2I76A 2QRLA 4Y6PA 2GSDA 4Z9XA 1X1TA 5G0VA 2VRCD 4GH5A 4XRRA 1F12A 4JBGA 4C4OA 3WGOA 5B12A 1HEUA 4J1TA 3H9QA 3MJSA 5JXWA 4NQZA 2VOJA 1K5HA 3RSHA 3DBRA 1T1SA 1YS4A 5ER6A 1GYPA 3RFTA 4OH1A 4ZICA 1OZAA 3KYBA 3WOHA 1D4FA 3WNQA 3ORFA 4RDIA 4MVJA 4BKRA 3GR6A 3AUUA 1SB9A 1ID1A 2X8LA 2JAPA 3CINA 1GAEO 1UAYA 3I3OA 4MVJD 3RUAA 2QRKA 1HE4A 4BNYA 1IE3A 5A9SA 3PZBA 4U8GA 3WJAA 3LK7A 1SO8A 4W82A 3UCFA 3NDJA 5JMPA 3E9NA 1A71A 2DPHA 3P19A 3A9WA 1LSSA 5L9AA 2D3TA 2XAAA 3X2EA 3U4DA 4L4XA 1KEPA 4F3YA 4IUYA 3PWZA 5I7SA 4J0EA 3RVDA 4XB2A 1WAMA 2PD4A 3M1AA 3ZI0A 3W1VA 2YQ5A 1VSVA 4N54A 1JAYA 3MOGA 1NFQA 3GOHA 4E30A 2Z1NA 5I7EA 5CDSA 5DN9A 3QSGA 2B0JA 2PKQO 5L95A 4O0LA 4A73A 1O9BA 3L0DA 3ZU5A 2PK3A 1E3WA 4ZN6A 3D5QA 3C7AA 1JQBA 3RI3A 1ZKMA 1NX6A 3KSDO 1BRMA 4WLFA 1GU7A 3KBOA 2OP0A 4XWYA 4IDGA 5L4LA 3TQHA 1N9GA 2WD7B 4NJMA 3CIFA 5A5FA 2F00A 3ZN2A 4BB5A 3PJFA 2PD6A 3S1LA 4B79A 1XQ6A 4CMAA 1NP3A 3V1TC 3WGYA 1WZIA 2C7VA 4HV4A 3L6DA 2GDZA 5F5NA 4ZQBA 2XXJA 2WTBA 1LTHR 3I9LA 4HADA 5DOVA 2IRWA 3W4IA 3H9JA 3LLSA 2NQTA 4LK3A 2YY7A 1EVYA 3P2OA 5F3RA 3RC9A 1VJ0A 5THKA 3TL2A 4BV9A 2EW2A 1PJSA 3PVZA 3KO8A 1QKIA 1PR9A 3BHJA 4NK5A 5JAZA 4M8SA 3LF2A 4BNUA 3FNHA 1R4MB 4RO0A 5G0WA 2NADA 2BLLA 4FN4A 2R00A 3GN2A 3HN2A 5TSDA 1F17A 4RORA 3O38A 4UEKA 4FPXA 3UXYA 4K28A 5CAEA 5IXYA 2GRAA 4KQXA 1GR0A 2AEMA 3F1KA 4BO8A 1UZNA 1GV1A 3UCEA 1NTOA 4IDCA 4YT8A 4NU6A 1R4NA 3JQBA 3ONFA 1AN9A 2D4AA 2ZCVA 3GVPA 3PGJA 3UUWA 4BO6A 3SVTA 3VPXA 1U3TA 1PGOA 3S55A 4HUJA 3JQCA 3I5MA 2QX7A 2YFQA 3TL3A 3H9UA 1JDJA 4FFOA 4KDEA 3AM4A 1B8VA 3DZJA 3PGXA 1I3MA 4PLCA 4TZKA 2Q2WA 4D7AA 1T26A 1HE3A 2H6EA 3MOIA 1Y1PA 4TZTA 3WB9A 1HT0A 2C5AA 3VZSA 3RBZA 4PLVA 1UP4A 4IGFA 2ZATA 4N5LA 4YJGA 4NR0A 5CPBA 5GY7A 2I9PA 1PGJA 2PH3A 4UVEA 4RCVA 2NU9A 3JQFC 1HE5A 3RUDA 2Y1EA 1R0LA 3OIFA 3JQ6A 1LEHA 3ENNA 1ZH8A 4L0QA 2OBYA 5DCWA 1BSVA 5ADHA 4YDRA 2FZWA 2AW5A 3V2GA 4E3ZA 1KVTA 2V6FA 2Y0EA 2ZTUA 2GPTA 1ZK0A 5JDCC 3VDQA 2OO5A 4LMPA 4AJIA 3ASUA 4GX5A 3RJ9A 3HDQA 4R51A 4EEZA 2NVWA 2B5VA 1ZVMA 2WD8A 4IDBA 4OYRA 4W7HA 1BXGA 2O2SA 4KQWA 4D3SA 1LUAA 4NG5A 2IYOA 1YB1A 1VI2A 2ZB7A 3I4FA 1QYVA 4XYMA 3JD0A 4GLLA 4D46A 3GLQA 3TOZA 5U1PA 4CQMB 2CF6A 3I9JA 1OOEA 4IJWA 1ADCA 1EDZA 1GV0A 4JXKA 2NVBA 4KZPA 4XIYA 1CQIA 4W99A 1BGVA 1C1XB 3GDGA 3WTBA 3UGKA 3FHLA 4HX5A 1V3UA 4JNKA 4DREA 4Z0TA 1HDGO 5JAQA 2B69A 1W4ZA 2ZTVA 4I9HA 4C7KA 5BSHA 3GK3A 4IQ0A 3PLRA 4GBJA 3EMKA 1ZFNA 2HMTA 1HSZA 5B37A 5HTOA 3GG9A 4FFPA 1GCUA 4E6PA 2DUWA 4G2NA 3KTDA 2CDCA 4LCEA 1VL6A 2OORA 1NFFA 2P9EA 3PHLA 4NH4A 4CM6A 5JYEA 5JPIA 2FPPA 2HDHA 4E32A 3ITDA 1P3DA 1PTJA 2FPIA 4CQLB 4R69A 1ZK3A 1D7OA 3LT0A 3PWSA 4NBRA 3OQ6A 3ROPA 1NNUA 2PA3A 4E5MA 5CEJA 1WDKA 4GSKA 5COAA 1FDTA 1LRLA 3DAFA 3A1NA 4DUPA 2P2SA 2IDZA 1R37A 1X0XA 3AU9A 2NVUB 3UOGA 4UEJA 3ONEA 3KSZO 4U0KA 3DBRB 4LISA 3VVBA 4TWRA 3S2IA 5CEEA 4CMCA 4O5OA 1I32A 3GHHA 4AJPA 4PLPA 2O7QA 4DLAA 3OQ1A 3F4LA 2J3KA 1ISJA 4LGVA 5CHEA 5EN4A 4BHTA 1E7WA 1E0DA 5L53A 3GQVA 2V7PA 4B4VA 1ARZA 3OMLA 1T1RA 1U8XX 2RH4A 5A06A 2X9NA 3K6JA 1T2FA 3WYEA 1U28A 2O23A 1EMDA 2D5AA 1TA4A 2Y1OA 4WNIA 2VHWA 1H93A 4GWGA 5DDIP 1PEDA 2NTJA 3UH1A 3WGHA 3MJ4A 2FP4A 3P5SA 5IAAA 1O94A 5K9ZA 3I9MA 4MP8A 1NM5A 4OM8A 4YYZA 4WJZA 1YBMA 1LC3A 5K0ZA 3JYOA 1IB6A 1S6YA 2GO1A 2LDBA 4II3A 5L7TA 2IZ0A 2O2YA 2Q1WA 3RASA 1Y6JA 4JQCA 1BW9B 1Y5MA 2OL4A 3FPCA 3UCXA 5LDGA 1PS8A 3W4JA 3K31A 1U5AA 3GT0A 1HXHA 1M67A 5JC1A 4YVFA 5IZCA 2FR8A 1OI7A 2AA3A 4G5HA 1UXIA 4WCFC 1K2WA 4B7CA 1DC5A 3E03A 5DNAA 3QWIA 4LSWA 4U6SA 1ISGA 3HDHA 3K8ZA 4A26A 3EVTA 1YQXA 4BL5A 1N9GB 2GUGA 4CM4B 2VT2A 2YZ7A 3GNQA 3CPSA 4UAGA 5MDHA 5IDQA 5CG2A 4OQZA 1C0PA 2OHXA 2YHUA 4FJ2A 4QT0A 1KETA 3GEGA 4PZDA 5DF1A 5KVVA 4MVJH 2CD9A 2AQHA 1QLJA 4DL9A 4Q3EA 4IMPA 1KC1A 4BMVA 2FSVA 4YT5A 5FYDA 3UICA 3AUAA 3QVXA 4ND2A 1DBVO 1GYRA 5JY1A 1BXZA 2YW9A 4FBGA 1EVZA 3B1JA 4FR5A 3SX2A 2B35A 2W4QA 4BNTA 2J3HA 4JLWA 1P1FA 3JQ8B 3RCBA 1YGYA 3KYDA 1YO6A 1J6UA 3JQAA 2AQIA 1ONNA 1KYQA 3GZNA 4EEXA 1VM6A 2I66A 4A03A 1IL0A 3QVSA 3E8XA 4P4GA 4WCFB 1YDWA 2GN8A 3WYCA 3K9QO 3H65A 5LCXA 3SC4A 1R4NB 2E6UX 3JQAD 3GNSA 3ANMA 4BQPA 4WCDA 3HWRA 4ZA2A 3ENKA 1H9AA 4FOOA 1TVEA 3H2ZA 5F1OA 3NX4A 3BIOA 1I01A 2GGSA 5A5EA 1MB4A 1P33A 4D41A 2VYVA 4R68A 1AUPA 4DA9A 1N2SA 2UAGA 4DC1A 3C1AA 1JA9A 2HMUA 3PQDA 3DZIA 3JQDA 1PJCA 3ETGA 4YJGB 2VUSA 1UXKA 1B14A 4IXWA 2JHFA 3JV7A 1EDOA 3UKOA 3C24A 1P77A 2VYVD 3UN1A 3JD1A 4B7UA 3MJEA 3ZWPA 2R2GA 3PHGA 5FF9A 2TMDA 5GZ3A 5CDUA 5K6AA 3DB2A 1LSUA 2DBQA 2JD0A 3GGOA 2G76A 4YRBA 1CYDA 1VPDA 4PCVA 1WP4A 1X14A 3JD2A 3CZRA 4J1QA 4XQEA 1QMGA 4KWIA 4E31A 3WGIA 5KJFA 3WBFA 4BO4A 2HSDA 1A27A 1J0XO 1YDEA 4WOJA 4TVBA 5A03A 4XQGA 1FDSA 3ABIA 1C1DA 3CMMA 2O3JA 1U3UA 4NMHA 1RM0A 2C2YA 3Q3CA 5EINA 3UF0A 3INTA 3IUSA 4A5OA 1BXGB 2G5CA 3GHYA 3ZNNA 1L7DA 4ZQEA 2Q50A 2XPCA 1TLTA 1I3NA 2PKQP 1Z73A 1P1IA 3LT4A 4CM1A 4AJ1A 2HRBA 3ZWNA 3IMFA 3N58A 1P0FA 4IY1A 2QQ5A 3NDIA 3AOEA 1Z6ZA 2VRBA 3GRPA 4RZIA 3RUIA 1C3VA 1ZJYA 1BDBA 3GEMA 2X0IA 4Y8VA 5A3VA 1YBVA 4RQUA 1KEWA 2DBVO 4DPMA 4Y98A 1R0KA 4LSMA 3PYLA 3JYNA 3OIGA 1WWKA 4FGSA 3FWZA 4BMSA 8LDHA 4AICA 3NUGA 3WMWA 4UULA 3BMCA 5AXCA 4CM9A 4RPJA 1DAOA 5BSGA 1NFRA 1DIBA 2D8AA 1V8BA 4R4JA 4J7UA 2FY8A 3GC6A 1JWBB 5G0TA 4UUPA 1I10A 2X5KO 4L75A 4J90A 1Y8QB 3KLMX 2BFMA 3VOSA 1I30A 4NBVA 1MA0A 4DVJA 3BTVA 4J3FA 4J16A 4MDHA 5JDIC 1AHHA 2Z5LA 3K73O 3PDJA 4RPKA 4CMBA 3ASVA 3FTPA 1H6CA 4GSLA 1YONA 2P68A 4XQ9A 1LQUA 1YJ8A 1PX0A 3HB4X 3DZBA 2HO5A 2CY0A 3BMQA 3PJGA 3TJRA 1EUDA 1NXQA 5CPFA 3WQRA 1YVEI 4WEQA 4CJXA 2HK9A 1TT5A 2VUTA 4I08A 1H2HA 1N5DA 3OM9A 3OIDA 4JJGA 2O3QA 3L6OO 3HUDA 1DFHA 2NACA 2C5EA 4QUKA 4WPGA 4CMIA 4MIOA 4E13A 4YAGA 3N74A 4XYLA 1YKFA 2JFHA 5FEUA 4E21A 3QE3A 2WWRA 3AY6A 1YQGA 5LC1A 3E48A 2ZYDA 3NDRA 1X1EA 3TWOA 5JCXA 4GGPA 2I65A 3U4CA 4UUNA 2EWMA 2W8ZA 1ADGA 1GZ6A 3WICA 4FIZA 2ZB3A 4IDEA 1UP6A 2BKAA 3EHEA 2A92A 3C7CB 4DPKA 1Z45A 5GZ6A 3O8QA 5C3MA 3PQEA 4HWKA 1FJHA 4E0BA 1EBFA 1I33A 1GCOA 4J6FA 2WJPA 4MKZA 1L1FA 1I3KA 5A9TA 3RKUA 4W9NC 1X15A 4PG5A 3NTOA 4RVDA 4LN1A 1NR1A 4NZ9A 2X1HA 1UZLA 4U5QA 4ALNA 5I9LA 1HZJA 2PY6A 4CL3A 1GEEA 1MV8A 2NV6A 1K89A 5AXBA 1GFSA 3IS3A 3F3SA 4GL4A 3NGXA 3B1KA 4ZD6A 1OC2A 1A4IA 3DWFA 1YQDA 2W2KB 3M6IA 1PZGA 1NBOA 4RL6A 1UDAA 1H6AA 4IIUA 4TRRA 5IN5A 4TVOA 2EW8A 3T7CA 1O0SA 1Y8RB 2HJSA 3KZVA 5TF4A 3ADPA 4PGFA 4KDFA 1U8FO 2UV8A 2RAFA 4XDZA 1P44A 1GL3A 4IJUA 2VYND 4FOSA 1MC5A 3RU7A 3NRCA 2QYSA 2P5UA 2ZTLA 1WDMA 4LMRA 3PJDA 4NJOA 4Z3DA 3AWDA 1GQ2A 5AOVA 4JN6B 3DBLA 1NQ5A 1RM3A 3BTSA 4HP8A 3IP3A 3LT2A 3W8DA 4D45A 3PYXA 3U09A 1AHIA 5DBIA 1H9BA 1A7AA 4BKPA 4KTVE 2Q1UA 4LRTB 3QQPA 2HMSA 3ZWXA 3ZWWA 4F45A 4N7RA 5CFZA 1MXFA 4Z9FA 5EJ2A 3SC6A 3ZWOA 2ZK7A 3F5QA 3RAJA 5DBGA 5HS4A 4KWHA 4PIVA 4WEOA 2JCXA 1HWYA 3GVXA 1ZO8A 3IAHA 1CIVA 2EHDA 3JQEA 4DIFA 2EJWA 3HHPA 1DIHA 2CFCA 5EQFA 4CM8A 5ICMA 3JQ9A 4L4SA 3G1UA 4F46A 4WLVA 1H6DA 1P45A 3RKRA 3GZNB 4A10A 4YAKA 1ZIDA 4GI2A 1ENZA 2NSDA 3I9NA 2O4CA 3ICPA 2UVDA 2AG5A 2WYVA 4GAEA 4RVFA 5HA5A 1YXMA 4YJFA 4UREA 3PI7A 5I7FA 5IFLA 1LJ8A 4H16A 4NDNE 5FFFA 1I5RA 3H2SA 4R9RA 4CV1A 5BSEA 1DXYA 1CJCA 1LNQA 3DZHA 1DRUA 5EMHA 4QX6A 3E9QA 4IQ8A 5AVOA 3PZRA 2O7SA 3ZU3A 1EFLA 4W4TA 1E3JA 3GUCA 1JW9B 1XHLA 2B83A 4ZU3A 3TF5A 2FZEA 2PWZA 4PG6A 2BMAA 2V6GA 1BWSA 1E1MA 5I7VA 1ZK1A 1ISFA 1PJLA 2J3IA 3HZZA 2ZJ1A 3LT1A 3Q11A 3H5NA 3MZ0A 2QW8A 1U2GA 1ZXBA 2P91A 4AJ4A 4I9UA 4RPGA 4BS9A 3CXRA 2BFPA 1KY5A 2Q2VA 3UW3A 4NNJA 4YA6A 3SJ7A 5U9CA 5KJEA 4J2OA 4TRMA 3PFFA 3T7EA 3CZMA 1GYQA 1ULSA 3WNVA 4CMJA 5KJ1A 1OAAA 1HZZA 1WNTA 4RZHA 2DUUA 4R16A 4W6ZA 3OJ0A 1ZMOA 4QO8A 2IEBA 5TIIA 3OECA 2JD1A 3AJRA 3LF1A 4C7JA 5JY6A 3JQ7A 2BHLA 2FRDA 3EW7A 1B0AA 3K5PA 1IYZA 4WLEA 5JS6A 1HDZA 1V35A 3R1IA 5DCYA 2NWQA 2Q49A 3ZWVA 3JQGA 5JFOA 2X0NA 4Z0PA 1F8FA 3P7MA 4YR9A 4BB6A 2VZ8A 3I6QA 4BO3A 1K6IA 1PS0A 2CVQA 3H9GA 5EQDA 2O3TA 1U1IA 5G4KA 4NHEA 4EW6A 5IDXA 4XGNA 2WEKA 1W6UA 1GUZA 3B20A 1CERA 4RVSA 4BNFA 3W6ZA 2GLXA 1I2BA 4YQYA 1YJQA 3K30A 2VTEA 1D8AA 3ZNPA 1DC6A 1X13A 1GPDG 1IZ0A 3TZHA 4PVDA 2X5JO 5CP8A 3K92A 3SEFA 4N18A 4J43A 5KOIA 1KS9A 4RPHA 4JBIA 4Q3CA 5HRUA 3ZH2A 4IIVA 1NAHA 4DBZA 2HAEA 4J9UE 2C0CA 5T67A 5L4SA 4ESOA 5C7LO 2JL1A 5JSFA 3WGZA 1RJWA 1CWUA 4CLHA 4MINA 4YAIA 1M6HA 2D1YA 4Y9DA 3H9EO 2VWQA 3OA0A 4IZIA 1VLLA 3FNGA 5JMWA 3DMTC 1SMKA 4BO7A 1P9LA 1HETA 2Y1GA 3LC2O 3Q9UA 1YB5A 4WGGA 4MVJI 3PRJA 4BMNA 3SLGA 1QR6A 4CPDA 1UXGA 3GRKA 4A7PA 1ZUD1 3QVOA 3TFOA 4FFRA 3H8VA 3G0OA 1O89A 2I67A 4GPD1 4TROA 5TJHA 4MOWA 1A4UA 4IDDA 1R0SA 4BGIA 1EVJA 4GVLA 1F14A 4NBTA 5ITVA 3E1KA 2DAPA 3Q2KA 1LRKA 3VC7A 2WE8A 3VH1A 4J91A 4CMIB 4IBOA 3B1FA 3UHAA 1DC3A 2B37A 3ICCA 4D3DA 4DYVA 3LLVA 3PK0A 3L9WA 3PLNA 2XOXA 3GN1A 1OMOA 4WK6A 2IXBA 4Z0HO 3MJCA 1DSSG 3X2FA 2H5LA 3D4NA 3JYLA 1X7GA 3VPHA 3A14A 3PHHA 2GN4A 3KVOA 3JD4A 4FFLA 1EBUA 4OSPA 1PQPA 4K26A 3LZ6A 2CVOA 1IHXA 1Q1NA 1IOLA 3BMNA 1B15A 1DLJA 2NU7A 4N5MA 3WFJA 1LLQA 1I36A 3OEWA 4GX1A 5C7OO 4Z9YA 3KM0A 3EZYA 4A0SA 3OBBA 1SBYA 2C20A 3TRIA 3V8BA 4FSHA 4P22A 1UR5A 3TOXA 2OXIA 2W2LA 4CMEA 1M75A 3GMDA 1J5PA 3MWDB 1K6JA 1VRWA 2C29D 5BT9A 4ALJA 4EUFA 2F1KA 3D3EA 3DXFA 3DZKA 5IN4A 1UJMA 3DHYA 4ZRMA 4PN3A 3EAGA 4J7CA 3I23A 3KEQA 4G81A 1G6KA 4XIJA 1E1KA 4BNVA 3G17A 1DIGA 2W2LD 2YFHA 3LQFA 4UUMA 3TZQA 2NM0A 4XX0A 1DOHA 1HRDA 4EJ0A 2Y1CA 5JW6A 2E4AA 1P1HA 5HWSA 4IZHA 3NT4A 2Z95A 3W4KA 1ONOA 2V65A 1DRWA 3BAZA 4MJLA 3TN7A 4EUHA 4XYBA 1E1LA 3DL2A 4O6VA 4XGIA 4CLXA 3AM5A 2YUTA 3HNPA 1IPEA 1OFGA 1LX6A 3CE6A 1MXHA 1IZ9A 4RF3A 2P4QA 4LRSB 3TPCA 3T4EA 3C3XA 4JJIA 2HK8A 3RBVA 3V1YA 1T4BA 1H94A 3GNTA 4HKTA 4XJSA 1O95A 1NASA 4CM3A 3BTOA 3OJFA 5TGDA 3QP9A 1MUUA 3PQFA 1EFKA 1DJQA 1TB4A 1OC4A 3VH3A 4H3VA 5H83A 5BNIA 4LCJA 1ULUA 2EG9A 3NJ8A 1JN0A 4YRAA 4DGSA 1U4OA 5ENDA 4E2WA 2I6TA 4TKLA 3JCZA 4CM5A 4MKXA 5A02A 4CM8B 4HNGA 3HSKA 3U62A 2V6MA 5H82A 1NWHA 2HMWA 3AK4A 3U0BA 3GDFA 3ETEA 1N7GA 3FD8A 3OJLA 4ZQFA 1CQJA 2CZCA 1E77A 3QWHA 4R9SA 3KRTA 4ZRNA 5AXDA 3VKVA 2AE1A 1QP8A 3KEOA 2EEZA 2VHZA 4HFJA 4YJFB 3GGGA 3GY0A 1EZ4A 3FF4A 2BGLA 3NAQA 2A9FA 4OKIA 4CMHA 3R6DA 1UZMA 2HU2A 3EYWA 3M2PA 4YTEA 1B26A 1N1GA 2PH5A 3KUXA 2DT5A 3TZCA 1NHGA 5L7YA 3VZPA 1PQUA 3H5AA 1HYEA 2RH8A 2NNLD 1D1TA 3AI1A 1U2DA 2JFGA 4BNZA 4B8ZA 2XXBA 1DPGA 2YDYA 1V0JA 1VKNA 4WLNA 3U9LA 5CDTA 3OQBA 3NYWA 5A9SB 1D3AA 1PIWA 1ML3A 3GPIA 3EVNA 3RUEA 4DBVO 3PHIA 2EKLA 1J49A 3ZHYA 1F06A 1DIAA 1Q0QA 1ZCJA 3INRA 3ZV6A 1N8KA 2EXXA 4BOYA 4OMUA 4XB1A 1WVGA 1PZFA 2WM3A 3GGPA 3ZWMA 1Z7EA 4DWVA 4EBFA 4R1NA 5IF3A 1B3RA 2VT3A 5B1YA 2R00C 1PU2A 4PRKA 4MVJE 3T4XA 2ZIZA 4FFMA 3GF4A 2I3AA 2FOIA 2PZKA 1E3WB 2P4HX 3QY9A 4MVJP 2DTEA 2X58A 2AMFA 1XGKA 2GN6A 3JQBC 3F4BA 2CDAA 1NQAO 3JQGB 1GUFA 5IZ4A 3F47A 4IDAA 4NJMB 1TEHA 1SCUA 3OA2A 2P9CA 1H2BA 5IG2A 3WYBA 5TLSA 3DZGA 1FMCA 4FB5A 4I5EA 4GKVA 4J4HA 4JBHA 4BQRA 4CLRA 1ADFA 1LDNA 4ILKA 4IMRA 2IE0A 5TT0A 4EZBA 1LQTA 2PGJA 4NBUA 3RUCA 1PJBA 1MLDA 3AI3A 5IDWA 2WDZA 1U4SA 2Q4EA 4ZQHA 4RVHA 1GADO 1PL8A 3DDNA 4BNNA 2UUOA 1PJ2A 2RIRA 2DU8A 4JK3A 1MG0A 2UYYA 3JYPA 2NU6A 1U5CA 3VZQA 5F21A 4GMFA 1T24A 1FDUA 1PGQA 3MEQA 3Q9NA 1PJ3A 1PSDA 4TRNA 2QIOA 1RPNA 1VJTA 1G1AA 1P0CA 3PIIA 1KEUA 4LVUA 3ZGYA 3EGOA 3KYCA 3DEYX 1JKFA 2SCUA 1NPDA 4XCVA 1SAYA 4ALIA 1BG6A 4Y6RA 3ZV3A 3FTNA 2NUAA 2IZZA 1Q7CA 4XQCA 3HQ4O 2HMVA 2X9VA 4R5MA 1B2LA 3NV9A 4LW8A 3U49A 4OL9A 2BH9A 3PTZA 3CKYA 1I2CA 1TT7A 4CM7A 1EE9A 3ZWYA 1E3IA 4L4RA 4MVJF 3ZV5A 1HLPA 5CEFA 5L51A 3FBGA 2DFDA 1C0LA 4J9VA 3WIEA 4FDAA 3IKTA 1U7HA 2X9GA 3DR3A 4ZHSA 1TXGA 1XR3A 4YPOA 1DIRA 3DOJA 4YB8A 3IQDB 3WTCA 1ORRA 2BGKA 3QV1A 4DLLA 4EGFA 1YL6A 1NR7A 3WLEA 4BGUA 1L7EA 5JO0A 3HB5X 3U4IA 4ID9A 3QIVA 3BA1A 1E7MA 8ADHA 3BTUA 3GZ4A 2B5WA 3WGTA 1YWGO 1E3SA 3AU8A 4P38A 3W8EA 1SNYA 3RFXA 4UVIA 5A1TA 3ZHXA 1U7TA 4JJFA 2X0RA 3L07A 3PP8A 4RLHA 4MKRA 1GD1O 4ALLA 2FSSA 3ZCXA 4R54A 1N92A 1NQTA 3AI2A 3V1UA 2PV7A 1R6DA 3P2YA 2C7GA 2OFPA 4PLZA 1VE9A 4XGKA 1CETA 3ON5A 3KV3O 3DTYA 3B6ZA 4YAEA 3NTQA 2IXAA 2BFAA 1WDLA 2AEFA 2W98A 4BNIA 4JP3A 3FI9A 4NK4A 2ILTA 3OFSA 1GUYA 4OSOA 5BQFA 4CMGA 3D4PA 1G0NA 3RIHA 1B16A 4RQTA 4KUGA 1PWZA 4DMMA 2CF5A 3FN4A 1EUZA 2DM6A 4GLOA 2D59A 1I24A 4HBGA 2JJYA 3FWNA 4Z6KA 1VC2A 3WGQA 1LC0A 1T4DA 3LU1A 1JAXA 5AXAA 3VPSA 1ZEMA 4FFNA 3QRWA 4AVYA 3NEPX 2WD7A 3C1TA 3RC1A 1ZZEA 4PRLA 4JX8A 1QYWA 2Q1SA 3WIDA 4BGEA 2E49A 4FJ1A 1Z7BA 5ITWA 1IULA 1MX3A 2YV2A 4A2CA 4NBWA 3DQPA 3MTJA 3WDSA 1RM4A 1DEHA 2DLDA 4OAQA 4JROA 3ZV4A 3U5TA 1SPXA 3V2HA 5C37A 1R15A 1DO8A 3WGGA 5T64A 2PNFA 3PXXA 4JGBA 4O63O 5ICSA 4L9RA 5ENVA 5KTKA 1H0KA 1Z82A 5JC8A 2EKQA 2VHXA 4RF2A 4XEHA 4D0SA 2J3JA 3IC5A 5G4LA 5BSFA 1MFPA 1UXJA 5TS3A 3DTTA 1PWXA 1ZNQO 3Q2IA 4AG3A 1XSEA 1A9YA 2DFVA 4PLGA 3Q6IA 1T2AA 4L8VA 2QZ9A 2HLPA 2GYYA 3OICA 2H63A 4YEDA 1ENOA 1O5IA 3G1TA 4NFSA 4IJKA 3ZDFA 3LVFO 5IZCC 1E92A 5TC4A 3OJEA 4HY3A 4DMLA 1XQ1A 1T2DA 5CDYA 3ZWCA 4AL4A 3FR7A 1DC4A 1KEVA 2WSBA 4CR8A 4ND5A 3SBOA 1WZEA 5TQVA 4DIBA 2GZ2A 4B3JA 1DB3A 3RQSA 2CNBA 2RBEA 1WW8A 4E2XA 4PG8A 4I5GA 2I3GA 4CR7A 1UDCA 2X22A 3WSVA 4FJ0A 3L77A 1QSGA 1LBEA 3KB6A 4FC7A 1JVBA 4I5DA 1V6AA 1XA0A 4GWKA 1E6EA 2B4QA 4K6FA 2HQ1A 4R3NA 3L6EA 1P1JA 4BNMA 2D0IA 1O8CA 3WJ7A 4J4BA 5FI3A 5BR7A 1Q7GA 1EE2A 5J23A 1GZ4A 5JLAA 1UDBA 4R41A 2X7HA 1B7GO 1DFIA 3RBXA 5F1PA 2DQ4A 1PZHA 1UH5A 5F5LA 3DZFA 5HS6A 2VYNA 3ROQA 3KSUA 1EQ2A 1HYGA 1NPYA 4ND1A 1SOWA 1LSOA 5ES3A 3H7AA 5T57A 4KMSA 1E1NA 1Q0LA 2ZCUA 1ZK4A 3VTFA 3INGA 1DLIA 3CSDA 4FW8A 2W90A 4F6LA 4CLOA 4IPTA 5C5IA 4OOEA 4RVGA 2FWMX 4MIEA 5KJ6A 3NTRA 1EVIA 2C54A 1JVSA 1EEHA 1LLUA 2GN9A 3PIDA 4PG4A 1DRVA 4CQMA 2V6BA 4KUEA 2BELA 4OXYA 1PZEA 5L45A 3STHA 1HDXA 5DULA 1ONPA 2AHRA 4NPCA 2EKPA 4OIMA 3S2GA 1PR3A 4KUHA 5G0SA 4CQMD 1PJTA 1ZMTA 2VUUA 4IXTA 2VNAA 3OJOA 4U0JA 1HE2A 1HDCA 3W6UA 2FPGA 1H5QA 2QHXA 3JQFA 4D43A 5K6AC 3AOGA 1C0KA 4XYGA 3FNEA 2JKVA 2BD0A 3KYDB 2Y66A 3K2BA 3OF2A 5KJCA 4QECA 1WLYA 3E18A 3JQAB 4E33A 4FS3A 4P4NA 3TDKA 3E6AA 1VSUA 4ND3A 2O3RA 3DO5A 1WMAA 3F1LA 1D1SA 1C0IA 1K3TA 1E5LA 4J4TA 3ROMA 2Y0CA 4DIOA 2HJRA 2JCVA 2PR2A 3FBTA 4CQLA 4DPLA 1BDMA 4EDFA 5JDCA 4NFYA 4TRJA 1UP7A 2Q46A 2VQ3A 4Q3BA 4ROSA 1NWCA 5EIOA 4YRDA 3WSWA 4OGWA 1T2EA 3GFGA 6LDHA 1CRWG 3M1LA 2Q4BA 3IIEA 3AOEC 2NVUA 2Z1MA 4RV9A 1WXDA 2UDPA 4OXKA 1NAIA 1DJNA 1IPFA 4FCCA 3I52A 1FDVA 2VHYA 3NT2A 1ZJZA 4OQYA 3M2TA 1A5ZA 4QSMA 3ST7A 2Q99A 1DFGA 1PQWA 2IEDA 2VHVA 4HNHA 5DOZA 2PD3A 1AE1A 4OJNA 3WWZA 1I0ZA 2YHIA 1SZJG 3BYZA 4MIYA 4B7XA 3HJAA 5KNLA 3HN7A 4II2A 4RF4A 5JCJA 1FK8A 3G49A 1IY8A 1O6ZA 1FXSA 4MVJG 1E7SA 3DFZA 3FSRA 2J5QA 3I4CA 2EERA 1P1KA 5G0UA 1LDYA 3IJPA 1KIFA 1Q0HA 3ITKA 4L73A 1C1DB 1E7QA 4DQVA 5JCJD 5FI5A 3RUFA 3WR5A 4DC0A 4W7IA 4YJHA 4DTIA 3L4BA 5KKAA 4E12A 4QFCA 1QXSA 1BW9A 3D4OA 2OMEA 4PZEA 3VKUA 4B4WA 3OSUA 1R66A 1XKQA 4DQUA 1XCBA 5IJZA 2BRUA 4J0FA 5A05A 3R3SA 4N5NA 1ENYA 1M66A 2J5RA 2PLAA 2GERA 1LI4A 1V9LA 3KETA 2ZQYA 1ZEJA 3WXBA 4BV8A 3HDJA 3WLFA 1XDWA 4BKUA 1PL7A 3ULKA 2Q45A 3E5RA 4ALMA 4YJDA 3BMCB 1JWAB 4J2HA 3TNLA 3W8FA 3GMSA 4CM4A 3D64A 3DAGA 2PGLA 3NJ4A 4DYDA 1XWFA 3BHIA 2HUNA 1MC4A 2C82A 3DHEA 2X5OA 4EJMA 3LDHA 3BMOA 1GEGA 4UUOA 4EI2A 2VZ9A 4CUZA 1RYDA 4RLSA 1KOLA 3OH8A 1QV7A 3O4RA 4BUCA 5JNLA 3S2EA 4INAA 4YACA 3FNFA 2C59A 4R1TA 3QVTA 5COQA 4BGVA 4NU5A 4ONEA 2OUIA 3BZUA 4R1UA 1KVUA 4GX0A 3D3WA 5T8KA 2Y1DA 5KVCA 3GFBA 1Y81A 2I99A 4XDYA 3GG2A 5LDHA 2WYUA 4ZVVA 3ZW8A 2VOEA 4PLTA 2VTDA 1RKXA 2AE2A 2BF7A 3BMQB 3COSA 3JQ8A 2NLOA 4H7PA 2ZJ0A 3RWBA 3ZHZA 1TT5B 1VL8A 2ZQZA 1TI7A 1GDHA 4FC6A 5JBIA 3TZKA 2GR9A 5A3JA 4XR9A 1X0VA 4WCFA 4YT2A 3MCVA 3SXPA 4Y67A 5G2OA 3A4VA 4F6CA 4AJNA 2CDBA 4CLDA 3NT5A 1E5QA 4YQZA 3RUHA 3RU9A 1QRRA 1JU9A 2FN7A 3VPFA 2Q2QA 3ANLA 3B70A 2GF2A 2PFGA 3ETDA 3TFQA 3IJRA 1UUFA 3KHUA 3S8MA 5EPOA 1HDRA 1XU9A 1IUKA 2ZKLA 1SOVA 1G0OA 4QEDA 3HFGA 4ZJUA 3O8QB 2HK7A 4I9NA 4ND4A 1DAPA 1V3VA 4XJTA 3WWYA 2CVZA 4PVCA 3C8MA 4J7XA 4IJVA 4YXFA 3KLPX 1FDWA 3TZ6A 4WKGA 3VVCA 3QLJA 3ZHBA 4S3MA 5H81A 2EIHA 3E82A 2BI7A 4GGOA 5TX7A 4BO9A 5HM8A 5JAMA 4UVGA 1CDOA 3PHJA 4MPDA 1NVTA 3JQ9C 1LDMA 4QTZA 1MFZA
chains in the Genus database with same CATH superfamily
4IG4A 3CO5A 4BZPA 4LF6B 5G1PA 3DE3X 4AZ3A 3E35A 1TF2A 4B3HA 3D6TB 4LDZA 1W0CA 1Z4QA 3RFFA 2QOEA 3ZWAA 4AZTA 3FOAA 5HBGA 3C1OA 3OCYA 1RJEA 2XGMA 6REQB 1E3MA 2ZPUA 2V55B 5AKHA 3PWKA 1Z6QA 3I1JA 3WLOA 1D2RA 2NYVA 2JLBA 3T7DA 2FOLA 1NNSA 1ADBA 1FQJA 1J99A 1WOYA 1ZUNA 2ECKA 3C3EA 2R8EA 3T1VA 3WX0A 4CLOB 1PGNA 4EB8A 2D7JA 1YZFA 2ZT8A 2JGKA 2PGXA 4ZI7A 3OCWA 3W3AA 2V7XA 3A06A 3GA0A 3QA9A 3F5SA 1ABFA 3AUTA 4M7OA 5CK4A 2RAVA 1AMOA 4AQDA 5DM0A 2XUAA 4MUHA 4Q7MB 4QYXA 1LI5A 1HOTA 2FMUA 2BF4A 2V0GA 2WKWA 4QGBA 5AVRA 5J1SB 4LWQA 2IXEA 4A23A 2PUCA 1E9CA 3DDOA 5HKLA 1DBWA 2G40A 1MMFB 3PUJA 4I36A 1NVVR 5JR3A 2C42A 4MWCA 1F5NA 1SC6A 3ILVA 1TVKB 2OMKA 1ZSYA 3H05A 1DCKA 4M8NE 2G9NA 4LYGA 5FWYB 3W79A 4ZQGA 3WNCA 3G8BA 5NLLA 4D8UA 1MV5A 1RI1A 1UBFA 2AG8A 5K0BA 3IPRA 4HT3B 1AQYA 3FZNA 4LECA 3P26A 2IU0A 1E3EA 3MJRA 3P2EA 5DTEA 5A04A 4DUGA 3LXRA 1LLFA 2WUEA 4L2IB 3UJDA 1GGVA 5JD5A 1NYQA 3WKAA 5BQXA 3GH3A 4ENQA 1W2GA 4P3KA 4OMCA 3VDMA 1YRQA 1TM3E 4R1SA 3QITA 4Y9UA 2DGDA 4RANA 2YRFA 3TRKA 2P2YA 4BDTA 1IMJA 4TWJA 2EFJA 5A71A 3MM4A 3T3MB 2P67A 4F86A 1K88A 1JPUA 4HB2A 1B3BA 1G5FA 1PT8A 2C61A 4R7ZA 3P9IA 4JKIA 5ETJA 1FLAA 2C03A 1JDBC 2H57A 5BNTA 1J0CA 2Q1TA 1HNNA 1V3TA 3GZTB 3G2NA 1MB0A 1R6BX 2POQX 1XZHA 5HG0A 3LP5A 3O0DA 2F48A 1H3FA 5M34A 4O4IA 1CUGA 3DULA 3RR2A 1U81A 4D9EA 5I8ZA 1Y1KE 3CCBA 3BDVA 2EFHB 2HKIA 4HRAA 2ZS7A 4LF4B 4U7WA 2QT1A 3JZFA 5FNVF 4AECA 2WJ4A 4X54A 1I4LD 5DHPA 4E5DA 1S4MA 5JO9A 1XZKA 4MCAA 4AYXA 1WXFA 2RD2A 5B4TA 4L5CA 3T41A 4WKCA 3DMDA 4YRZA 1UZAA 2DB3A 5KZMB 5ESRA 4KV7A 1H2ZA 2DCUA 4GO1A 4KXNA 2EKZA 3V34A 5M29A 2NIPA 2P78A 3ESCA 3LUDA 2H1HA 2IEGA 1IM5A 1YZGA 3TBFA 1KZ1A 3FTEA 4F1KA 1NIJA 3WK6A 4BDSA 1JTEA 1SB8A 3I6YA 1FDOA 5ER9A 3UHPA 1JBKA 3G6KA 4CODB 1GRRA 5COBA 3RVBA 3LP6A 3FOWA 1GAXA 5AVJA 2CMHA 4PLHA 5GM1A 4AMGA 4BU0A 1G7TA 3KAQA 1KI6A 1L5HB 2J0VA 1G5QA 3PFNA 4TV9A 3VPGA 4A82A 2OAGA 5KKNB 3CIOA 4GLJA 1L5KA 1BAPA 1CS4C 1R8QA 3GLHB 3BXHA 1NUQA 3KOYA 5JZOA 4YRRA 3EPKA 4LY3A 5CURA 3RIGA 1N0UA 4KOAA 3SJUA 3CH6A 5KYUA 1UM9B 4QAQA 4WESB 3WLRA 3E7WA 2AZDA 2LBPA 3OEYA 1ZM9A 2Y1FA 1XCLA 4OLBA 1T6ZA 1JT9A 3OD5A 3FMVA 4UVHA 2O50A 1XLTA 4Y7CA 1LSJA 5T5QA 4ETNA 5B6IA 2G1PA 3CR7A 1AHPA 2ZJ6A 1E2NA 3D3KA 2BFFB 3QWBA 3HY6A 1PFWA 4YECA 3CEAA 1FNNA 1IONA 1JG1A 2FXIA 1IN8A 3BQ9A 2F8LA 3EPPA 1OBCA 3AEKB 3L6BA 1M5RA 2V9PA 3EEYA 5I9TA 4XM1A 1E6MA 4DS3A 2PUEA 1RLTA 1ZD4A 3AP3A 3BULA 1GKYA 4KXVA 1UK7A 1TUEA 2FPOA 1XYGA 5FP0A 1DAFA 4AMBA 2PANA 5TT1A 3L0YA 4Y9TA 1DBQA 2FTKE 3ZDEA 1KVQA 3ZGXA 2NU8A 6ADHA 1TZCA 2HGSA 2KQUA 2QN8A 3VSEA 1CEEA 1OGIA 3W9BA 4X63A 1CULC 3DP7A 3RRBA 3N7UA 4AJ2A 3SWWA 1PEKE 2XBLA 3A6ZA 2X0DA 1JUDA 1E7YA 4QBHA 3C85A 1JB1A 1BGWA 1T34A 3I8OA 1P6XA 3D3WB 1O87A 5ILOA 1S02A 1UBGA 1QLHA 4JJEA 4RIGA 4AWBA 3H7IA 5FOTA 1QYDA 2NO9A 2B3TA 4QHTA 2I5PO 4INZA 1ZNYA 4WN9A 4X6YA 4O1MA 1Z2PX 3IDZA 4J0KA 2NO7A 1PGPA 4WADA 4MVJM 2QRHA 1QOZA 2GCGA 3O1JC 1KVSA 1YK0A 2IHNA 2D2EA 2H1LA 1YZ3A 4I5FA 3JWPA 1QIIA 2CXHA 1M1NA 3L79A 4ZGGA 1DAMA 3K5WA 2ZBEA 4BIIA 4MKIA 2HMYB 3BGOS 1NSTA 5F4BA 4PEVA 5JD3A 4FT2A 1GQYA 1QORA 1JG2A 3GVHA 4XWOA 1DKQA 5EZ6B 1VJ5A 2C88A 2HN9A 5E8JA 2O8BA 5DTJA 3IXLA 4QGAA 1G38A 1U6JA 2H3EA 3CPEA 2X0EA 1PYDA 3L8MA 4EGSA 4DQDA 5BW5A 1OB5A 4D42A 3H0KA 3MMZA 4KXFB 1ZU5A 2P9TA 4F3CA 1E6WA 3B1XA 4ICIA 3A27A 1HUQA 4D0RA 5HKBA 1Z2AA 2IIPA 3E7FA 2CE7A 4JLBA 4M87A 5U4QA 4EL0A 1OROA 1FRVA 1Q14A 3LBNA 4F21A 3ZJTA 3G0GA 3ZNOA 3UWOA 1O95C 4QUAA 3IOEA 3UJAA 5E38A 2CMDA 1WVMA 1T0UA 2D5LA 2MSKA 3OIYA 4DT1B 1KJJA 1M6YA 3F6YA 1JNXX 1A9ZA 1Q7BA 4DOMA 4CUKA 4XD2A 4RDHA 4D44A 2YVAA 3DMYA 3HO6A 4K9NA 4TSKA 2D5IA 2JI9A 2W83A 1GG5A 3ZNQA 3CUUA 4L4YA 4M3NA 1SVWA 4QUHA 1G7RA 4U2BA 4X85A 4DDKA 5KQGA 3CX6A 1HMPA 5KWVA 4GS5A 1K7YA 1TUBB 4TSFD 3FUCA 3OG9A 3R9KA 4E6EA 1SKQA 2G4VA 1FTWA 4KQKA 4IFEA 2AQ8A 5CG1A 1HC7A 4QPDA 5AQ1A 3R3JA 3TLGA 1A5SB 2QE7A 1PG5A 3BWYA 1YCHA 4XYEA 3C4VA 4B1FA 5JH7A 1K1EA 2ZU0C 4MQUA 3PQ5A 3U31A 3V7YA 1KI1A 2ODPA 3A6GA 4G01B 5BSWA 2PIAA 4ZP1A 3TQCA 4EFMA 2WYHA 1I8TA 3MLBA 1IOWA 3NBKA 4ZCMA 1B76A 2WHQA 3F7NA 5TEWA 1J8VA 3EC7A 2EZ8A 3CVYA 3K1YA 1K68A 3LQ1A 5J2UA 4DA4A 1SUFA 2QVLA 1GPKA 1FW6A 4DJEC 2AQKA 5H4HA 1U2DC 2JEOA 2V6JA 3EVZA 3EFOA 3M4JA 4K3UA 2PRJA 3I1FA 2GEVA 4WINA 1VLJA 1UPFA 4ZZ1A 3ZJYA 4EUEA 1QGED 4L02A 2RK3A 2DBZA 3I01M 2X8AA 2J31A 5KYNA 2D1SA 2WP0A 1UBEA 5E9QA 2H85A 1CEQA 4M9ZA 3KYIB 1X38A 9LDBA 4QFDA 2PLNA 4JBLA 4Q1DA 4MZXA 1L5MA 2C07A 1HL3A 1EXDA 3UJNA 2O20A 4M49A 4M0FA 5KTYA 3FMOB 4RWZA 4ZU6X 5C1IA 5FTLA 1XZIA 4FN5A 4HDRB 4P36A 3SFVA 5EUBA 2YCBA 2IY8A 4Y2RA 1D03A 4JU9A 3SIWA 1WZ2A 2NVOA 1XEAA 3EXHC 3CKKA 3TQIA 3JX9A 1ZNWA 1E0SA 5BQOA 1FMJA 4D02A 5AVUA 4NFLA 1R4MA 3ADBA 2VTVA 2XQVA 2M2IA 3MMXA 4S0XA 3I2GA 3S81A 4ZJYA 5IBPA 5AUPB 2AN1A 5LZ2A 4YCAA 3D0RA 4L76A 4DV0B 3MAGA 1C7RA 4PAWA 3CLVA 4JDUA 2CYAA 3IKVA 2YUIA 2P6PA 4JBXA 4NICA 5TY0A 1KU6A 3HDYA 3IE2A 5K51A 3W2IA 4P6VF 5IULC 2HRDA 4KPEC 3ELDA 4AY4A 4DMLA 4XUEA 5ALZA 3UAGA 1DBSA 3RS9A 3DMHA 3ILXA 2N9UA 4D9JA 2BMFA 3IO5A 3SLRA 2A7QA 2E48A 3UAYA 4ZIRB 1YF3A 2PTGA 1VJ1A 1VP3A 3NASA 5IPFA 1U8AA 1OH7A 4U00A 3HLTA 4I1YA 3TQRA 4LOKA 2F9FA 3VYRB 1TCVA 2A9PA 2RGNA 4YV1A 4JCOA 5EESA 1V5FA 2OP1A 3A4TA 1E7RA 3DEHA 4UXIA 2H4HA 1AKYA 4F8JA 2G71A 1NW7A 3JTMA 3FTDA 3D31A 3Q8LA 2IQIA 4UVDA 2JJ2A 1NPTO 3UNXA 1FJ2A 3W3AH 2V3VA 2PZGA 3N8DA 4JGGA 4YMIA 1YQEA 3HCDA 1C14A 1NMZA 3NTUA 5F1KA 2RHRA 4KLNA 3S1SA 2FR1A 4LE0A 2EP7A 3FRIA 3JAKA 4ENWA 3UB3A 3B53X 4G25A 1EDDA 3BH0A 2E4UA 4H6XA 1PS9A 3NRBA 5DGDA 1YJCA 3OLVA 4FKMA 4IIYA 3TO5A 3E5MA 1HKUA 5IANA 1TJ4A 1YA4A 1XLUA 4QUEA 4JQOA 4IV8A 4WFKA 4Y9RA 1O2DA 5G1NA 1LPNA 2X7XA 3R9XB 4U7DA 2Y0DA 3S29A 3SICE 5IW8A 1P0IA 3DWGA 3I83A 5KKCA 1DQSA 4LWZA 1N34B 1Z75A 2XBMA 3QE9Y 3DHNA 3HDTA 2BEVB 5BSRA 4CL8A 3EE6A 1DV1A 1QUEA 2HRZA 3ADOA 4K0RA 1MKYA 3HMQA 4KKVA 3FIJA 3SK0A 1GPJA 3ZI7A 5JVDA 1KNXA 1P9RA 4O2AF 3S2FA 5KIAA 4RULA 1GHTA 1XMXA 3IKJA 1GVNB 1X8LA 1YA8A 4QTYA 1KXZA 2XF8A 4JP5A 4CYMA 2UVPA 1SCQA 2HT6A 5C7YA 2B7BA 5IJWA 4IIGA 5YASA 3DO6A 4ARBA 3CUYA 1KSFX 1OGJA 1YL5A 5T7BA 4L74A 1HEIA 3R7BA 4CIAA 2AI3A 5GONB 1BA2A 3AFNA 2AXQA 2VWHA 2M1XA 3JVDA 2E87A 4HR7A 5DRTA 1UK6A 3CRW1 3LZDA 1XZPA 1E2IA 1DHRA 4JS0A 4U63A 4WNCA 3PYMA 3ZXSA 1L4MA 1REQB 3ZIDA 2HA5A 5BRNA 1A1SA 3IUPA 3QELA 4C4TA 4G65A 5E4JA 5K0NA 5TPZD 1ZISA 3GJXC 4XWKA 4Z99A 3K0KA 2FG6C 5CBPA 1SVLA 2E55A 4ZCPA 1R27A 2C5FA 4YROA 1EX1A 1IHDA 1Q2XA 2D5CA 5GZ1A 1HDIA 1VKOA 3AVUA 3IT1A 3UT5A 1K06A 3H5VA 1U9IC 3KYCB 4FLEA 4IHJF 3AIKA 4LRYA 2NW6A 1NVMB 4NENB 2G77B 5FAKA 3E7XA 3WKEA 1XIVA 1JFFA 2ZE5A 3M6AA 4PR0A 4ER7A 3ZDDA 1GQOA 3DTVB 1ZGAA 2ZB8A 2GASA 4KO1S 4DR6B 4FB4A 4LVCA 1TUIA 3EGVA 2WTMA 5LP6F 1KO1A 2I76A 4Z9XA 5BP7A 1P3JA 4HGRA 4RJLA 4ZKDA 2PJZA 5G0VA 2FXVA 2AWNA 1W49A 1PJZA 1SR8A 4DLTA 5AJTA 3IELA 4IW3B 4A1OA 1W19A 5JWRA 4K7JA 3DVAB 1HFEL 1HEUA 1PUXA 1K5PA 3LLUA 3MCAA 4J1TA 4M9RA 4MWEA 4UDYX 4YI3A 3H9QA 3M83A 6PFKA 4G0WA 1XROA 2Z3VA 3KCQA 1PW5A 3LY5A 2YWXA 4NQZA 3C8HA 2WFLA 5EPEA 1SBIA 1U7XA 3CU5A 4F3NA 1KI4A 4DIMA 3IRUA 1J2UA 1ABEA 2YWRA 1OZAA 2HF7A 3EEFA 3L3BA 3ACBA 1L5WA 1CR0A 3PVCA 1LBSA 2RBGA 4HEJA 1Y48E 1THZA 1KAGA 1UPAA 2XZPA 3GLKA 3HYRA 4FGUA 4JITA 5EIBC 3WL8A 4PCAA 2VIIA 5CVTA 1US8A 2PGOA 4NCAA 4AI6A 3U3OA 1QV9A 1FS4A 3MT9A 2WU3A 3CINA 4YUAA 1NKSA 1QH1B 5DHTA 4BGDA 1OWNA 1JH9A 1BVHA 3K8QA 1F51E 2BFEA 3I3OA 4IV0A 4OSEA 2HUPA 3PDHA 1YFKA 1MTOA 1BVYF 1SXHA 2XNSA 4QJ4A 5A9SA 1PJAA 4P7GA 2OHJA 5ECDA 1M1UA 1ID8A 3G88A 3HJCA 3LK7A 3R5KA 4FR0A 1VL2A 1TMKA 1TLFA 4MV1A 3CURA 1EJ6A 2DPHA 3HA2A 5L9AA 1J25A 4CHGA 1LK0A 1W6RA 3PUWA 4OU5A 3OZXA 1V9SA 1D0VA 3L8EA 2ZM5A 3AKEA 3BK7A 1DEKA 3MTDA 3RVDA 4XB2A 3ITEA 4BO6A 2DQSA 3LE8A 3M1AA 4ZYTA 1NXWA 3W1VA 1IH8A 2YQ5A 1TM2A 3E5NA 1VSVA 3URKA 2DH5A 1VE5A 1YIAA 1NFQA 1T4MA 4N54A 4WZBB 5LA6F 5C1OA 4TTSA 4C4ZA 4M8IA 5I7EA 2RGGA 5CDSA 2HQRA 2R2AA 2XE7A 1GTSA 4NYIQ 4LF7B 2H52A 2FF7A 2PKQO 1EA7A 3AKDA 3FPEA 3L8HA 3PFBA 3VZCA 4CXMA 3N6VA 5SZHB 1XOIA 1RLOA 1O9BA 4R0VA 3L0DA 1QB7A 1OF1A 2P1DA 4EW1A 2IGTA 2JRLA 1TYCA 3V1MA 3GFQA 3SMVA 2XVZA 3KKMA 4MV4A 4U2GA 2ZRQA 4GSYA 2HV8A 3DF7A 3HP1A 4Z0NA 2MHCA 1QC5A 4F5EA 5L4LA 4YRQA 5AKGA 1J23A 3MK31 1W1UA 1E3DA 3G2QA 4NJMA 4PAOA 2QYOA 3ZN2A 2I62A 5ED4A 4P83A 2ZIGA 3RIEA 1GRNA 1DTWA 4KJZA 3S1LA 3UC9A 4B79A 1CUZA 4BP3A 4JI7B 1NP3A 1KFKB 5FWXA 5T41A 3TUIC 2V7QA 1P2TA 4DIEA 3B3JA 4G5GA 5IP5A 4HV4A 1TQ2A 3UBTA 2VYFA 4Y6OA 4EGQA 3QNMA 4ZQBA 4XPIA 3I9LA 4HADA 3U3MA 4PRYA 3W4IA 2IRWA 2KPOA 4L16A 4RGQA 4YP5A 5AVZA 3U44B 4LKOA 3NGMA 3H9JA 1CY0A 4LK3A 1T1EA 1J9EA 3RC9A 3M89A 1VJ0A 5THKA 1RT9A 4LC9A 5AW1A 2EW2A 3PVZA 2XITA 1OX5A 4ER3A 2VAVA 3FGOA 5C8YA 5FOQA 2Y4OA 5G0WA 4P08A 4FN4A 1P62B 2NGRA 3GJSA 1O58A 3VC3A 2C7PA 3BEOA 3G2MA 3IIMA 5TSDA 3UXYA 3HA5A 1AK1A 3O38A 3VPCA 4DBLC 3ZE9A 2OK7A 5CAEA 2B4YA 2GRAA 1EJ0A 2IA5A 1GR0A 4BO8A 1ZXXA 1PO7A 4CIXA 2DWQA 2EBWA 4QRHA 3JQBA 4LEIA 5CD1A 3PGJA 4PQGA 4TMZA 3DGEC 3T3DA 3VPXA 4DJDC 3GRRA 1AH2A 1GL9B 3JQCA 1XCOA 1XA4A 3TLKA 1G8JA 3TL3A 3H9UA 3QXGA 2QXTA 4FFOA 1G21B 1GO2A 2YXEA 4BQNA 1U1GA 1QPBA 3SHQA 5ITZA 3T0IA 4OBEA 1I3MA 2FWNA 4TZKA 5DX8A 3RVLA 2XKBA 4D7AA 4ZHQB 1HE3A 2QGNA 4QPCA 2FOXA 2C5AA 2G0AA 1YI8A 5LLTA 2BONA 5FBRB 4EECA 2OO7A 1N2GA 1M7HA 2ZATA 2I1WA 2QL9A 4N5LA 1NMEA 2CXNA 2GEUA 5KOHB 1WSBA 4BX0A 1PGJA 3O7MA 4O4LA 2PH3A 3BZWA 4CF5A 4UVEA 1N32B 4RCVA 2RH9B 3E7PA 1HE5A 2ISCA 3GGJA 4EHJA 3D2LA 1EM6A 1OH5A 1ZWKA 1CUUA 3FZEA 3JQ6A 3OIFA 4PFKA 1UAAA 5F1YA 3REOA 3DV9A 3J7AC 1ODIA 1P7PA 3G5MA 4RNDB 2FZWA 2Y3IA 2AW5A 3F7MA 4RY0A 1DG1G 1DTSA 4LYFA 5A3SA 4D4JA 3SX4A 2BHRA 2QTCA 2V6IA 3BH7A 3KXKA 4GF5A 4MQMA 1SK8A 4RAOA 4F2DA 2V6FA 1VA5A 4YO8A 5IK2A 3WDLA 3MGGA 5JDCC 2CL7X 3VDQA 4AJIA 4GDMA 4QJ5A 4WZAB 4ZMSA 3RJ9A 4LWPA 1JAIA 4E08A 4HAWA 4Y1RA 5EZYF 2ZQ5A 4IDBA 4OYRA 2O2SA 2Q2OA 3KOMA 4BRWA 1JQAA 3IVCA 1DWQA 2ANBA 1TECE 4KH0A 4MW9A 1IWPB 1JAZA 1VXRA 1G7SA 1QYVA 3I4FA 2IWRA 5C51B 2YJTD 1GIAA 4D46A 5HNKA 1R4ZA 1W0KA 4CQMB 4B9EA 5EFOA 3UQZA 5LQRA 1ADCA 3C5VA 2NSYA 5B3AA 3W5DA 1NRIA 2BJHA 1TL7C 2NVBA 2WOOA 4KZPA 1JJIA 2VHUA 3BOSA 4O4HA 4J0JA 4XIYA 1BCRB 3BCUA 3DE7X 5JV5A 4ECAA 4KVAA 1L1QA 4DREA 5JAQA 1GLGA 1V48A 2JGDA 2R0QC 2B69A 3OT1A 1QZ3A 2XB9A 3CNQS 2I8CA 2Z8XA 3D8HA 3LGSA 2X4IA 3N2NA 4IQ0A 5LVAA 3S28A 2JARA 3C6KA 4QBFA 5I7OA 2Z0MA 3EMKA 1RR6A 4LXXA 4MX8A 2FPGB 4TXMA 1ZFNA 2WT8A 2ALJA 3TIVA 4DIUA 1G55A 3ETCA 1GLVA 3O91A 3T1OA 4EG0A 3R3WA 3S68A 4BP9A 1WKVA 1FYFA 1KO5A 1WCWA 4LCEA 4D98A 2BFDB 1TM1E 3Q8KA 4B2PA 1HURA 4N9WA 2HRCA 1KPIA 2FPPA 1KDRA 4FFBB 3S2UA 2QN6A 2XMSA 3EA4A 2HDHA 2JNWA 4PHFA 4ARZA 4NZZA 4QYIA 2PR7A 1W36B 3RVNA 3HH8A 1KEEA 3NDBB 5F9MA 4LZJA 1B8OA 1D7OA 2OB1A 4JUAA 3LT0A 4LE1A 4OQDA 4OJMX 5JG7A 3WYAA 4X00A 1IBSA 3OQ6A 3QFRA 2ERCA 4PSVA 3CLSC 3ZD7A 2GYWA 1RYMA 3LXMA 2ZRKA 2UYQA 4A8HA 4DNFA 5CEJA 2HIHA 4GSKA 2FLVA 1I5EA 5CR9A 4D3ZA 1E3QA 3A1NA 1YIDA 3LP8A 4RACA 2P2SA 4DUPA 1R37A 3K4HA 2AI2A 4X3PA 4L08A 4DR3B 4OFBA 1IN5A 5F2EA 3VSBA 4LFAB 3KSZO 1PP4A 1GKLA 1X94A 1ZOPA 3T9EA 4H7JA 2JBAB 3DBRB 2GD6A 2HWXA 3AQIA 2QSUA 3S2IA 4EOGA 4TV8F 1I32A 2KI5A 3NXKA 4US1R 3MN1A 4K6OA 3VJRA 4YV2A 3V8NA 4PLPA 3NHWA 1M0SA 4ZVOA 1C2TA 1A8SA 2FJPA 2GO7A 5CHEA 4D57A 4BHTA 2GM5A 3C4QA 4IDNA 1U8UA 3R5FA 5L53A 3L7MA 2QN7A 4RD0A 1U7DA 3GMIA 1T1RA 4ZV4A 821PA 2Z2KA 2X9NA 1L4FA 3SR3A 1E9DA 2VAXA 3DUFA 4MYDA 1T2FA 3WYEA 2Q21A 1EMDA 3K0AA 2DKFA 1E60A 3KIPA 3Q88A 1Z16A 4WOBA 3IAS6 3HVRA 2QNRA 3Q3HA 1NMYA 1JDZA 2XEDA 2YNMC 2ZSIA 4E46A 4PX3A 1T3HA 1XXHA 5IT0A 5JS1A 2AOUA 3MJ4A 2XDQB 4P58A 4IP0A 3P5SA 3T1TA 3WIUA 5K9ZA 5FOWA 3X1ZA 3G2OA 4V0OA 1PV2A 2B5OA 1NP7A 4UEWA 4Z86A 5KMGA 2Z30A 4OM8A 4RW0A 4C6RA 5I9SA 4F5ZA 3ESRA 4WJZA 1LC3A 2VXBA 3QF4B 1C9YA 1IB6A 1S6YA 2RGAA 3M5DA 4II3A 4US0R 5A5VA 5L7TA 2PEZA 1KOGA 3FYHA 2Q1WA 4PNHA 5K6RA 3LUCA 4IVRA 1I4EB 1Y5MA 2OFOA 3PC3A 5DEOA 4CKBB 1O94D 1ACLA 1WUJS 3KZXA 4FEAA 5LDGA 2ZDQA 5IKMA 3ZGVA 3ZHRA 3K31A 2CWDA 3EJ6A 3LA8A 5CMLA 3PTAA 1G2PA 1HYBA 1M67A 1KSJA 5BRAA 5BMVB 5JC1A 1V1RB 2HWKA 1A76A 1ZMXA 1A8PA 2ETVA 2PVCA 1OI7A 2QQ0A 3I5AA 4HYQA 4WCFC 4JA0A 4WXHA 1RMYA 1K2WA 3KXLA 1E20A 4B7CA 1DC5A 5DNAA 3WNBA 4YP7A 3WHIA 1XP8A 1WHSA 4EKGA 4Y6QA 1ISGA 2Q9AA 3HDHA 1TYZA 3JQQA 3CLUC 1RVV1 3ZLVA 5DBEX 1Q0SA 5EZQA 3V8RA 4BL5A 1N9GB 2GUGA 3M6LA 4JLUA 3W78A 1TKAA 3PDIA 5LL6P 1GITA 3CF4G 2ES4A 3U26A 2FEWB 3OEED 3GCXA 3V00A 2R44A 5LB4A 3CPSA 1Z2OX 1KSGA 1KI8A 3QVGA 1B4DA 1LJLA 3NH9A 2WPDD 2OQRA 4I0WB 3SCZA 1T9CA 5SY9A 2YHUA 2OHXA 4G86A 4QT0A 2VEOA 3GEGA 5DF1A 1FRNA 3MVEA 4FLFA 5EIFA 5KVVA 2CD9A 2JAXA 3R0ZA 3MELA 3PC7A 2XVAA 1QLJA 2OGZA 5GJBA 5HIMA 1UWCA 2LR0A 4A8JC 2OYCA 4I2NA 4F2HA 5C5EA 3AUAA 3QVXA 4ND2A 1XAJA 4G4JA 3VR4A 2J5XA 3H5WA 1JALA 2JLQA 2R68A 2CNNA 4FXOA 4JLWA 1D6JA 1DKNA 2R85A 3KSMA 3RCBA 1AKTA 1YO6A 3HSSA 3FVRA 1X7XB 3QQ5A 1E8NA 1HMYA 3H8SA 3OFVA 2AQIA 2ODQA 1KYQA 1Z6PA 2BH2A 2ST1A 2BGNA 3DM5A 3V4ZA 3DSRA 4FMCF 3TJMA 4DJAA 1KI7A 4P4GA 2GN8A 1MQSA 5AKKA 4XEUA 2KYRA 3EA5A 4AS1A 1QH8A 4JVLA 2JLCA 4JP8A 2B30A 1AB6A 1JIJA 1HORA 2PSEA 2JA2A 4ZYZA 3JQAD 3ANMA 3AYXB 1XRPA 3C3DA 3IT2A 4LSZA 4Q34A 4BQPA 3HWRA 3FTQA 4X95A 1RXIA 1X1CA 2Z09A 1KDOA 2E89A 1RWXA 4P32A 1TVEA 2AUNA 4EY7A 3OLQA 2X40A 1GQSA 1ODJA 5JMTA 4AQYB 5A5EA 3IR7A 1NYRA 1Z37A 1Z4NA 1P33A 5FQOA 3TVDA 3CN9A 4LTNA 4GPAA 2OPHA 4B3XA 3K7EA 1AUPA 1NR5A 5KOYA 4JL8A 2AMJA 1MO4A 4Z54A 3LH5A 1IOVA 5TQJA 4EB0A 5IWCA 2ZYRA 2PG3A 2VJPA 4AYTA 1JMVA 2ORYA 1FUYB 4EF6A 5BXQC 2QXYA 3ETGA 3L1KA 2J3DA 4YJGB 2QJOA 3FPAA 4BFLA 3ISTA 3JV7A 4NH0A 5ED0A 4B34A 3L7AA 3QKRB 3UKOA 4Q00A 3T1NA 1G291 3LPDA 4RYLA 2IYTA 4LJAA 4V0LA 3PD7A 1DG9A 1RPTA 4QYMA 4N48A 3N2KB 1ZI8A 2G83A 2EYUA 3DB2A 4QULA 5LN1A 2VQFB 1L1RA 1LSUA 5EXXA 3GGOA 5JAPA 5SZIA 4YP6A 4YRBA 5BNZA 4DUYB 1JMYA 4AZ3B 3AEYA 1JR3D 1WP4A 2OORC 4ZODA 3JD2A 4XWAA 3K16A 4LE2A 1X1SA 1DC8A 4R31A 1QFYA 2XGSA 3MBIA 4E31A 1W8IA 2NNWB 3OZUA 4K05A 4XDHA 1H69A 1H0SA 2GRJA 3CVJA 2XMGA 4QT4A 2OHFA 2FRXA 5IJXA 4HLDA 4IDHA 5HKOA 1UCFA 4MHOA 1BE1A 3LY9A 1T6NA 4NHOA 2HA3A 3EBLA 3CRZA 2A0KA 3UF0A 4TT3D 1BXGB 3TDNA 1RLMA 3ZNNA 5E3JA 1L7DA 3G82C 1P3Y1 2G9RA 3K2QA 3QFSA 5CFOA 2B98A 3HYTA 2GZDA 1LS6A 3U17A 3TH5A 1KHHA 1P1IA 4Q05A 1K3UB 1KAEA 2HRBA 4QGGA 1CT9A 4IY1A 2FPSA 3LK6A 2JH9A 4X1OA 2EATA 3I9V1 2FUKA 3W0LB 1YD7A 2CNWA 2GZAA 3AOEA 1GGFA 1NE7A 4EGCB 2A8YA 1EZZA 1WM1A 1HFJA 1ZJYA 1CPYA 3DKIA 2X0IA 1JEYB 4ZYXA 5A62A 1AVTA 1YBVA 3HJBA 4UZFA 2QM0A 1EFRD 1EWKA 3M81A 4JENA 1GPNA 1YDMA 1I13A 3C6MA 1L5RA 1OQAA 5KNBD 3WGJA 2OHVA 3AUFA 1BD3A 3NUGA 2HIGA 4UULA 1KMMA 1VL5A 1Q7RA 2ZSEA 4HGPA 3EC2A 4RPJA 2JHPA 5DIZA 3ET4A 2JLUA 2FUNB 2CXXA 3PGLA 4KB5A 1A9RA 4R4JA 4OU4A 1KR5A 1ICEA 1RSZA 3MLEA 1GU1A 1JWBB 2O8CB 3K0BA 2BP7A 1JLKA 3IIJA 4BE7B 1NXSA 1RHUA 1YU9A 3NWBA 3GBPA 5KC9A 1I30A 2XUKA 5EHIA 3VKHA 1UBHS 3IUMA 1I7QB 1CR1A 1U3GA 1MA0A 3N2EA 4PC1A 4XUGB 3GRAA 3VNAA 3BTVA 2K7FA 4J16A 2NSJA 2MSEB 2PT7A 3ZUGA 3WGVA 3HU2A 5J4LA 3TGPA 2PBFA 4HDOB 4NOKA 3A1SA 3PX3A 2PSHA 2EX1A 5CCXA 3EAQA 4AD8A 1WBBA 1YONA 3HGMA 4XQ9A 1KJIA 2YIDA 3DZBA 3NOXA 4M22A 3DL0A 4HGOA 1CUXA 2HO5A 4PQRA 3BMQA 3FY4A 2ONYA 3OZTA 1EUDA 1NXQA 4X3CA 5CPFA 3TMYA 1XRRA 4HNVA 2GHIA 4H0CA 3PQ8A 3B51X 1A2BA 1N5DA 3OM9A 4MS3B 1OYYA 2O05A 4JJGA 4O4IB 5IYZA 4EVSA 3L6OO 1DFHA 3C39A 5H59A 2XUDA 4KBGA 4P0TA 4PM4A 4QUKA 2I3BA 2VXCA 4FWBA 5FPHA 4CMIA 1YKFA 5B1DA 2MT9A 4P4TA 1L4EA 4BN4A 4HRXA 4V0ME 1GGJA 3SKXA 3AY6A 1NNEA 1GPYA 4F97A 4B6RA 1U0LA 3GYBA 1TU3A 3NDRA 4FLMA 2GXUA 1X1EA 4NNOA 4I1PA 4QUBA 3O4IA 1X9HA 1XAIA 2C3PA 1AUVA 4KK4A 3SY8A 3ICOA 1ADGA 4LQCA 2L82A 1T5IA 1L7OA 2GK7A 3HZOA 4LJSA 4FIZA 3U60B 1E96A 1RQGA 1UP6A 4IDEA 2XWPA 3VU0A 3EHEA 2CHQA 3ZU6A 3SBDA 1O0CA 4IYRA 2HA2A 5GZ6A 2QY6A 1A9PA 5TMEA 4AY2A 3MG9A 4RLFA 1FJHA 3IEUA 1GCOA 4NMMA 5F3DA 1L1FA 5A9TA 1XDBA 5PNTA 2UU9B 4AUNA 4QJ3A 2EARA 3EZ9A 3LDFA 3L1VA 3NTOA 4LN1A 2HWUA 4L5IA 3LD9A 4RETA 2X8JB 4N39A 1NR1A 3WA6A 2GX6A 2X1HA 4WK2B 3VRHA 2D2VA 2CHEA 2ATEA 4CKCA 5BUQA 3AF3A 3Q0TA 3QEBZ 3I0ZA 4YPVA 5AXBA 4CF6A 1NUHA 4UNIA 5KYUB 2IUFA 1IIBA 1F9AA 1DBIA 2BSAA 3B1KA 4DV7B 1H8HA 2GPJA 2IGBA 1SOAA 3ENVA 3IP9A 4JEHA 3EVFA 3LIIA 1NBOA 1UBOS 3OZCA 3RS4A 5JSZA 3AKYA 4W5OA 2EW8A 1FFDA 3LQYA 2HJSA 4CG2A 1WXXA 5TF4A 1NBMA 2XE8A 2O2ZA 3H75A 5FADA 5IBQA 3G2LA 2O59A 1MA3A 1V71A 1KMCA 4MVWA 3UMCA 1U8FO 2TMKA 2VP4A 1XTRA 1X42A 4IJUA 1JZQA 2JFVA 3D6AA 4K9QA 1E4VA 1WZUA 1H8EA 1QO0D 4XCQA 5E6UB 2OKGA 5J5AA 3RU7A 4AWXA 2QYSA 2ZTLA 1WDMA 4Y6GB 4E2FA 2QM3A 4QLOA 5ALWA 4NJOA 4EFNA 4GE0A 1U9CA 2AOXA 1MB9A 4G5SA 1GQ2A 5AOVA 3BRWD 4JN6B 3DBLA 3DLHA 2NU8B 1E58A 3BTSA 4HP8A 4NCJA 4DCOA 4D45A 2NAPA 1TD1A 1AHIA 1PSZA 1AHNA 2YXPX 2AG1A 4H3KB 4ISCA 1BDJA 4BKPA 3IAM1 4DDHA 4HS4A 4RTKA 4LRTB 1BQEA 2HMSA 4V02A 2H1WA 3U13A 2JS7A 3ZWWA 1NY5A 3C6ZA 5AD1A 4N7RA 1ZIPA 4M76B 1NJGA 5EJ2A 3V4VB 3F5QA 3GX1A 5DBGA 3RAJA 3CX3A 2DWUA 5CM2Z 1HWYA 3HCNA 4FUTA 4WN9B 2OGWA 1E2QA 5BSMA 2XSZA 1SVIA 4OA8A 2EJWA 2A58A 2CXRA 1UKZA 1ZGGA 3HHPA 4UFOA 1W34A 2BYTA 2FWRA 2J4FA 3PHBE 1H4SA 2OV6A 2M9MA 3Q7SA 1JXQA 1DKRA 1FFWA 1H6DA 1LKZA 1P45A 4WLVA 5H1YA 5HJ7A 1KDZA 1SPBS 2R48A 2X9QA 3AJDA 3IB3A 4KKXB 4RTPA 2AFIA 1XTSA 2UVDA 5A2GA 1WUTA 1K63A 1SG0A 3ZBQA 3S8YA 2O8BB 2Y9MB 2A9RA 1J20A 1MJNA 1UMDB 3QPWA 4R2XA 5B3JC 1QK5A 1ZOIA 1QGYA 4QEKA 1DXYA 4OYLA 3Q5DA 1J2YA 4C1BA 3PGVA 1DRUA 4DKXA 2ZUVA 5CCEA 3DB1A 1L5LA 4UQPA 3VNSA 5K1ZA 3N5CA 1RWWA 3WNDA 4V38A 1NVKA 3ZU3A 2LGJA 5DYYA 2Q5OA 2ZUDA 4P2GA 4PBRA 4MI3A 4OHWA 4ZU3A 3ICVA 2JLZA 1IPHA 3AVQA 4GBED 1DO2A 4HQNA 4MHSA 4ID3A 1ZK1A 1ISFA 1BRTA 5F7XA 1PJLA 2J3IA 3HZZA 2ZJ1A 2PS9A 3Q11A 5EE5B 3H5NA 3ZDYB 4B4DA 3KU1A 2QW8A 3E3LA 5IMBA 1C30A 2IVZA 1TFUA 2P91A 5MF6A 2O9JA 4GMKA 3HV2A 2R8PA 3RV4A 4B44A 4BS9A 3WDKA 1Y3DE 4PZ0A 1N57A 2CSXA 1Y34E 2DJIA 3EWAA 3KOOA 3R7DA 4LOIA 1LNZA 4FMPA 3R44A 5BURA 5U9CA 4TRMA 1FZTA 2Q6LA 1U3FA 2YZGA 1EFPB 1I7PA 1YS7A 2R66A 2YXDA 3G59A 4HUQA 3TLGB 4NCHA 4AKIA 1L7RA 3FLAA 5B3LA 5BW6B 2JI6A 3VOAA 4R16A 2WV9A 9MHTA 4W6ZA 3NIWA 5T4HA 3VR4H 3QMPA 2OESA 1SUAA 4YAFA 5LIPA 3LF1A 4KN9S 8ATCA 5TIIA 3BS4A 3EIUA 3JQ7A 2BSQA 4M8LA 1C5KA 1IYZA 2ZRJA 4O2LA 4WLEA 5ALDA 3GCDA 1HDZA 1YZLA 3ELWA 5DCYA 2BBOA 5J2UB 3JQGA 2IITA 4EGJA 4JR0A 5TB5A 2H11A 3OEHA 4RE6A 1L5VA 4WVFA 4I1SA 3OOSA 1RJ9B 3LWBA 3KLOA 4HTAA 5ERXA 5LLSA 4NKRA 1XJQA 3HKBB 5I3CA 1QX3A 1CVIA 2XF2A 1QHEA 4XGNA 5CX4A 1JQ3A 1GUZA 3UHOA 3WRYC 5P8WA 2WLTA 4AP5A 2FSUA 4ZO9A 4ED9A 2BISA 1DCMA 3Q9SA 1FPQA 1I2BA 2CFRA 2XADA 3ZNPA 1S1MA 1S96A 2GM4A 2GKGA 4YJ2A 1IZ0A 1M1YA 2DWCA 1PR4A 3ZZ1A 3KDPA 4WMLA 5HZHA 2H4FA 4WZBE 5GJVC 4J43A 4RDXA 5CX1B 1K8QA 2GK6A 4QKQA 2PUBA 3Q85A 2PRYA 1WXHA 4JBIA 4UARA 3KZCA 3JARA 3I01A 1MJGM 3JRXA 5CA0A 3S0JA 3CWCA 3OZDA 5AJXA 2OWDA 3NWOA 1XYYA 2X5NA 4AUMA 5K0JA 1SK9A 1AOXA 2G67A 1UBJS 2HAEA 2RGXA 4J9UE 1JI0A 5EEHA 5FV4A 3SZGA 3JATB 1WDWB 4XB6B 3OWOA 2UZ1A 3TPFA 3UJ9A 1RJWA 1CWUA 4KPFC 3WGZA 4YAIA 4BLWA 3A4LA 3VR0A 3GDHA 1JJVA 3U7FB 3SHFA 2PBZA 4BY9E 2B25A 3D8BA 2OCXA 2VWQA 1IRXA 3H9EO 4PSDA 4Q03A 4CF7A 3U5ZB 2NG1A 1VLLA 4BJ5A 4HDMA 3STTA 4M99A 2AN3A 4L5BA 2ZWVA 1QIMA 4LNUB 1N7IA 1ZUD1 3QVOA 1AK2A 1NW8A 1Z17A 2J9RA 2QMHA 3E3NA 3G0OA 3DDCA 2EJTA 4TROA 3A3KA 5TJHA 3AF1A 1Q6YA 3EMBA 4IDDA 1AD2A 1E9RA 4UTRA 2H51A 1EVJA 2QQGA 1GT6A 3Q8WA 1F14A 2XMZA 4G0ZA 4GVLA 4U2EA 1MABB 1NUUA 2OAEA 4OVKA 5C5DA 4BMPB 2ZSFA 3MXOA 5DGXA 3VH1A 3RS8A</