2WWGA

Plasmodium falciparum thymidylate kinase in complex with dgmp and adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
TDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDILATE KINASE, PUTATIVE
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwgA00
3BFKA 1II0A 1VHTA 3A37A 2BBTA 3NVAA 2ORWA 3K0FB 4NYJQ 1AZSC 4JLMA 4LJYA 3LX8A 3LVQE 4KJZA 1DAFA 4MITA 1ZM4A 1SXJD 2AK3A 3SYKA 2CHGA 1U9IC 3LO5A 2CVHA 1Z07A 2A7QA 2CBZA 1A82A 3LA6A 3EWSA 4IVQA 4BLOA 2JDIA 4DLZA 3L82B 4PX9A 4IXMA 5KDLA 1TNDA 2QE7D 3OF5A 4WZAE 2N46A 2ECKA 1KGDA 4M0LA 1N3BA 1KY3A 4RCYA 4QBFA 4HLUC 4OI4A 1G21E 3L0SA 5FUXA 1EFRD 5JJLA 1P2UA 1P9NA 1UBCA 2ZUDA 3R7WA 2BWJA 1A1VA 3MAAC 1KZGB 1UEIA 1W0KD 1E4VA 4FWIB 2JLSA 3N70A 4Q5IA 1D9XA 1NIPA 4CZ2A 4J0QA 3CNNA 4OI2A 2QL6A 3NIBA 3AF0A 2CLSA 2VO1A 1EFUA 1TF2A 3BJIC 4KBFA 4Q1EA 5BN3A 1WRBA 2WAXA 2P5TB 4KVAA 3C4JA 1OXUA 4E5UA 1US8A 2NIPA 5FUVA 1UFQA 4CEIA 4TYPA 4MQBA 1QBKC 3PR1A 4PPGA 4URXR 1CU1A 2H7VA 3G0HA 2W2VA 5HTKA 3GLIB 2HYDA 2W00A 1X1RA 2ZROA 2A5FA 4LCBA 2J5XA 2OILA 3KDSE 1UBEA 3WXMA 4E03A 2QA5A 3KTAA 2O0HA 3H1TA 5KYKA 3CUEF 3U3JA 3ZS8A 5JI2E 3WMEA 1UDXA 2WVJA 2V3CC 2NZ8A 1FFHA 3QI2A 4XWAA 3CH5A 4EFNA 2CHVA 4G1UC 2QQEA 4AC9A 2ERYA 3SYNA 1NI3A 5JWRA 3QOFA 2CJWA 2Z0MA 5DISB 3GJ5A 4QGAA 4RFVA 3BB1A 4HAXA 4KO8A 4L9SA 3RC3A 1EX6A 1KI1A 4EPVA 4LYAA 5E7MA 1Z5ZA 5ANRB 4BFSA 1J2JA 5EXXA 3FE2A 1AM4D 1KSJA 4DSUA 2QAGC 3ADDA 1E2KA 2PZFA 2WPDD 1BMFD 2F7SA 4P33A 3K8YA 1XCPA 1SGWA 4GBMA 1LF0A 1YZUA 3T1OA 1TX4B 4CEJB 1JALA 1HE8B 1TF7A 1KO5A 2AXPA 1OW3B 3Q8XB 3HJNA 5DO9A 1G3MA 4DLTA 3KQLA 1FUUA 4EPTA 4DSOA 5E3HA 2F6RA 2FOLA 4QG7A 5B58C 3JZAA 3Q5EA 3KJEA 4M1SA 4TQAA 3ND9A 4HUQB 4F93B 4LJ7A 1Z0KA 2C03A 3VR5A 5DI9A 3E5HA 1T0HB 1ESNA 1IXZA 1Z0AA 3DKVA 4QXAA 4NP6A 1GAJA 1VYUA 2GVZC 3SBDA 1UBFA 4LGMA 2AL7A 4R98A 4Z54A 1E3MA 5EP1A 2VRWA 4M21A 4AURA 2A5DA 3H86A 3WMGA 1G7RA 3B8HA 1NKTA 4JLDA 4WVFA 3T1VA 2IX3A 3VR3A 1ZD1A 3PV0A 4LC0A 1WE2A 4B2IA 2H92A 1QHIA 1Z83A 1EXMA 3DHWC 4B3FX 3IHLA 5EP4A 2VP4A 4EKDA 3DKPA 1GKUB 1YKSA 4V0MA 2O8EA 2WTUA 1DS6A 421PA 4FMCB 2ATVA 3LQRA 2DR3A 2HT6A 5TV2A 5KPDA 1M7HA 4XJXA 2B92A 1I2DA 3QXCA 4JLAA 1QHYA 3IIKA 4LHXA 3VR1A 1MO5A 4V0KA 2QAJA 3FHCB 4TQUS 1FNNA 1KJZA 1N5KA 2GF9A 3PJRA 1FQKA 2QP3A 4JLKA 3VX3A 3KKNA 1L2TA 4IDPA 3N2EA 1PVOA 3ZIAD 5B57C 2QM8A 2VSOA 5C46F 1ELOA 3VQTA 4URZR 3SFZA 3FMFA 2GXSA 1BS1A 5L3VA 3GFOA 2R6DA 3LLMA 1MO3A 2J0UA 2ATXA 5DI3A 5IK2A 5SZKB 4Q47A 3FKQA 5J40A 3M1IA 2XNDD 3EZ9A 1W4CA 3R7WB 2J0QA 1DADA 4A6PA 3RSLA 4OI0A 4Q1DA 4LHVA 3AP2A 1GTVA 2Z4RA 3AV0B 1LS6A 1MH1A 3AF1A 5LDDC 1A4RA 5JJKA 4RD6A 1R0YA 2ZJAA 2FE4A 1E98A 5FPSA 2JLZA 3AVQA 1G8YA 2YOGA 4B75A 1EGAA 2GZDA 3GFTA 3I1FA 5DSZA 5K8TA 1LF5A 2J46A 4Q19A 3DMNA 4ZI3A 3D7MA 5HPYB 5FTLA 4M1OA 3H0KA 3AF4A 4PPQA 2GZAA 3I72A 4GP7A 2F3TA 2Q9AA 3CNOA 2VEDA 4OHWA 4MGIR 4D25A 3SHWA 3HYRA 2IT1A 1OF1A 3RNLA 3GPLA 5H8WA 3KQNA 4C7OA 5EE0A 1NBME 3OESA 2QAGB 2ZR9A 2ZI5A 1CIPA 2GEVA 1G1MA 2I1QA 1HEIA 1XP8A 3QBTA 3EA5A 1BKDR 2QN6A 1U0JA 4II7A 3KTAB 1DBSA 3ZVMA 4OK3A 5EXSA 1IM2A 1A2KC 3LBNA 2OUKA 1EFHA 2ZI6A 3K1JA 3QPWA 3L8ZA 4M9ZA 1OFIA 1P62B 4RD3A 1FW6A 2IWRA 1Z6XA 1JPNA 2WWIA 4V02A 2J7KA 1XD9A 3TUZC 3FPAA 3C8UA 4FI3C 3EW9A 4OHXA 1Q3HA 2GJ9A 3ZVLA 3K53A 2ZETA 2JLQA 2HLDD 1NVVQ 2WKPA 4GOKA 3LFUA 1VDZA 4WIAA 1G7CA 1U98A 4GMDA 1JR3D 2HV8A 4BFVA 4B33A 2IYRA 4F4JA 3U4QB 4ERNA 2BVNA 2IWHA 2VHCA 1Y63A 3QKRA 5FPYA 4C2UA 4BZPA 2BMDA 1GWNA 5JFGA 5G53C 4P4TA 1NSTA 1Z0JA 2G0NA 1OHHA 3SHFA 1E2DA 3EWAA 2PLFA 521PA 2CK3A 3CH4B 2FH5B 4TWZA 2AWNA 3S1AA 5KNBA 2BM0A 1AQYA 2XEXA 3P27A 4TLDA 4BZXA 1QHGA 3GLGE 1H8HA 3MJHA 2QPAA 2OLKA 4HLQB 5JS7A 3U7HB 5K8LA 2J59A 1G5TA 1P5ZB 4AG6A 1U8ZA 3B85A 1B0UA 4O0MA 1A2BA 3QXSA 3OAAA 1E79A 4FWTA 3EPKA 3CR8A 4Z1MA 5L3QB 4PC6A 1NN3A 1AS0A 3RRNA 4I4LA 4UJ5A 2WWXA 1LB1B 4P4SA 1KI4A 1M7BA 1XF9A 2RH5A 4L16A 2QMEA 1W49A 4ARZB 2YOFA 1Y3AA 1RRCA 1G6HA 1XEWY 4AIIA 1H65A 1DAGA 1RVDA 4RFSB 2C5LA 2BEJA 3O8RA 2O8EB 1VG9B 3IPYA 3OEHA 4V0OA 4LJ4A 3QIAA 1KHTA 1XCGB 1YZKA 2FGJA 3QKTA 2AX4A 4RD4A 4EFLA 4BPBA 2G83A 4PC7A 1W0JA 1VYTA 4QBHA 2PMKA 3FVQA 5DH9A 1JXOA 3KXIA 1E0AA 4CGZA 5L3RA 4DCNA 2C8VA 3GCGA 2MMCA 1KDRA 3CNLA 1E1QA 1XMIA 2DWOA 3AKEA 4Q1FA 4R2HA 4A92A 1PUIA 3CRRA 1OV4A 3SNHA 3SBEA 5CIQA 1ZBDA 5C1BA 4DRZA 5EUQB 3IKJA 3Q5DA 2FZ4A 1GL6A 1G8GA 3LVRE 2DFNA 3ZD6A 1ANKA 3LNCA 4HDQB 2VHJA 2NQ2C 4FMDF 3IIJA 5DIFA 1G64A 4PQFA 1E94E 4W5JA 3NC0C 3RSOA 4ZIRA 4L4UA 4C0AC 4IOLA 3CF0A 3P4XA 1KNXA 1YRBA 1ZC3A 2QMUA 5JRZA 4FCWA 3A58B 3QVVA 4DIDA 5CJ2A 2WKRA 3AGQA 4QNRA 4PR0A 4G3XA 4QHSA 5JZVA 2IHYA 2ODBA 2ONKA 3PQCA 3TSOA 4YXWA 1OKKD 4URUR 1XXHE 2ZRNA 4RZXA 1TEVA 4BRUA 2VP5A 3CPJB 4DKXA 5GJVC 4FN5A 5AJZA 2OM2A 4ZCLA 1W36C 2V6JA 3EIEA 4U5XA 1JPJA 3TVDA 1Q1ZA 1BIFA 2OFOA 2PT5A 1E2NA 1R5OA 3CZQA 4DC9A 1FQJA 2QORA 3D3QA 1ZRHA 2EFHB 2QQ0A 1ZNWA 3R20A 1NVXQ 3RS4A 5DHFA 5KDOA 5FBWB 3NXSA 4XWKA 3U6BA 4B44A 2BMFA 5AWFC 4ITRC 4A8JC 4GDFA 2CDNA 5FOVA 4KLNA 1E2GA 3CKLA 3EZ6A 1NL3A 4RCZA 4LJ8A 2PT7A 4N1AA 4PFSA 2QGZA 2PCJA 3W6NA 2CMKA 1RKBA 2F43A 2JDID 3MWKA 4WW0A 4A6XA 3GLHE 3UATA 1WBBA 1SXJE 2R2AA 5JECA 5KDDA 4Z8YA 2HT1A 2VTKA 1NIJA 4W5WA 3TE6A 5H68A 3KQUA 1OH7A 3K9LA 5FTMA 3K0AA 4TSFD 5E4FA 4RKFA 2A3RA 2NGRA 1DVRA 2QPTA 4LHWA 4LBVA 5D3QA 2RGNA 1YR7A 2QRNA 5AUOB 3BGWA 2GCOA 4UXHA 1DARA 4HB2A 3OFNA 3UWKA 2A9KA 2I1VB 3LY5A 3B1YA 3BAFA 4GT1A 3X2SA 3GLFE 3KJHA 5LD2C 1UPTA 3B9QA 3VKWA 3B2EA 3EZFA 3H2YA 5JRJA 5D3MB 3V4RA 4DLRA 4KSCA 5AK0A 3QKUA 4AKHA 2OESA 4TL9A 1AIPA 4NCIA 5FH9A 2D7CA 1DO0A 1Z0DA 2BOVA 2C77A 1E9EA 5F9HA 4QL3A 3RC8A 1Z6YA 1N6OA 3AVPA 1XZQA 4PSAA 2J1LA 3L0IB 4Q21A 2IYWA 3IO5A 5JJIA 5FPKA 3KKPA 4LV5B 4Q4JA 3TH5A 4A4DA 1TAGA 1YHNA 3QEJA 3K0EA 3SJZA 1NVWQ 5KUTA 2ZSBA 1VG0B 1DAKA 4F38A 4NBSA 1PZNA 3SOPA 2QBYB 1T4GA 3HWSA 2RGXA 1Q1EA 1GNRA 2CCKA 5BW8A 3LH5A 3IIMA 1NBMD 2ZIAA 5BN5A 1S0UA 5P21A 1S4QA 3V4FA 3KFVA 1SKYE 1SQ5A 1R5BA 2H18A 4JVSB 2RGDA 4FXPA 3LLUA 1AGPA 2RHMA 1LFDB 4C0QC 3PG5A 2OFWA 4LI0A 1GITA 2ZJYA 2A30A 1OFUX 2BCJQ 3GD7A 4JS0A 5CLLA 2NPIA 3ETLA 1KI9A 4DCSA 4DT1A 1RRGA 2QSYA 5J4VA 1E2IA 1G16A 1XB2A 2FMXA 3K0FA 1KO4A 3A6PC 2GBLA 4UNNA 1W2HA 3QVUA 3B9PA 3MLEA 1CJVC 1RZ3A 1E2JA 3I5YA 1BOFA 1W36B 4HB0A 2WIBA 3KFXA 2X8AA 3K9GA 1ZM9A 2GILA 4ZIRB 4ON9A 3SJAA 3CW2A 3TKLA 2R65A 2V7QD 2QTVB 4MRPA 4BLPA 3A1VA 3CRW1 5DE3A 5FOSA 4A0GA 4NDZA 1YZTA 3BE4A 2ZRFA 4MKIA 2O8FB 4XSGA 1P60A 4B3BA 4RZUA 2ZRJA 5AUPB 2ZREA 4DCUA 3WYFA 5E95A 2ZXUA 3PEVA 2JCSA 4DB4A 3X1WA 4W7SA 4OQNA 4ZO4A 5CYOA 5AR1A 3T1TA 5CYPA 2AD5A 3GJ0A 3PUWA 4NZYA 5G3ZA 4ESHA 3RRZA 3B6EA 3PEWA 2WWFA 3QSYA 5J5CA 3AVOA 1FTSA 3AKYA 5TVKA 1TMKA 3U6KA 1R5NA 3VHLB 3GLIA 3EX7C 1XEFA 1BH2A 2WWWA 3MWLA 1UF9A 3KQHA 2HCJB 4IDNA 1VYVA 2WBLC 4G5OA 3MG9A 4GZLA 1Q22A 4M1YA 1NLFA 4CEHA 3LW7A 3OHMA 2B7BA 4IHQA 2F3RA 5IK2D 2BM1A 3BH0A 3HU2A 1MT0A 2XZOA 3OEEA 3WHKA 4UXJA 1RJ9A 4KBGA 4UNPA 3A4LA 2DY1A 4HI0E 1ZM7A 1XX6A 3C16C 5IDVA 1Z28A 3KKQA 2VQSA 4O25A 2F9MA 4RD1A 1CJKC 4PC3A 2GNOA 2JJ2A 2YNMA 1ESMA 2PMDA 2VP6A 3A1TA 1QHNA 1C9KA 3ZZ0A 2OEPA 4GZMA 4TT3A 3KL4A 2GDJA 1TEXA 4QKQA 4JIMA 4DSNA 2PCLA 5DGXA 3T35A 4CEJA 2BMJA 1KO7A 1ZD8A 1NMZA 4WZBE 2XZPA 1WQ1R 2J45A 3SU8A 2LWIA 3NWJA 4JKIA 2IUTA 3ONWA 5J4HA 4JLPA 4MRVA 1GL9B 4JT4A 1E1RA 3QBVA 2J3EA 1E99A 4IVPA 3ND8A 2JAQA 3R8CA 2QM7A 3ZLJA 4B3DA 2A78A 3B7GA 4TZ6A 3TJZA 2FV8A 3QPVA 1U8AA 1HUQA 2EQBA 2D62A 3UXMA 5SZIA 1U9IA 5EZ5A 121PA 4KODA 1GFIA 5EJEA 4Q7MB 2WAYA 1N25A 3T1QA 1JR3E 4MGYR 5GJCA 1GILA 2C9YA 3W6OA 2JLRA 3DMDA 1OB2A 4HLUA 2DFKB 5FTKA 4L15A 4PO9A 3UIEA 3RWOA 1UKEA 1PLLA 1YZNA 5BWMA 821PA 1XJ0A 1OHHD 4LBWA 1PV4A 3GMTA 3THXB 3MJRA 4OQLA 3N2IA 2CK3D 4B48A 1GNQA 1O87A 3CR7A 3P4YA 4CRWB 4FW9A 5JWHA 2D2FA 1XPRA 4YMSA 4EPYA 4JZKA 1H8HD 3CPEA 4JL8A 3LV8A 2IS4A 4DLWA 1QF9A 1EWRA 3CZPA 3NG1A 3VNUA 3ZDQA 1GP2A 4HLCA 1Z22A 1F2UB 3ZH9B 4GNKA 5JBQA 2H57A 3QXXA 1E79D 3GJ6A 1TL7C 4MGZR 1Q3TA 3FFAA 4Z1MD 3PEUA 2RHDA 4OQFA 1SVOA 4ZV4A 2R6CA 3VNVA 1E2FA 2XTZA 5EE5B 2WV9A 4K81B 2ZR7A 1E0KA 2D4HA 1AK2A 1Q21A 2GHIA 5A4JA 1F48A 3K9NA 1W2GA 5DNYB 5GVSA 2EWWA 2GF0A 1RYHA 1AGRA 4KHZA 3IEUA 1VCOA 3OEHD 3T15A 1N0VC 1Q12A 1P9WA 4QBGB 3QXHA 1W0JD 2PEYA 2ZJ2A 1VG1A 4GOXA 2CCGA 4HYYA 3K09C 2WMNB 4XIGS 5FBLB 2O8BA 2RMKA 2XJ9A 2FNAA 2YWEA 2ZSFA 3NTUA 3X1YA 2QAGA 4BE7B 4BRWA 3K0CC 3FKSA 1N0UA 2P6NA 5EXTA 1E1QD 4PANA 4JJZA 2ZE6A 2ZPTX 3T06B 3KJGA 3B78A 4M1MA 3U60B 4Q4HB 4CEHB 1CR2A 1MRSA 2Q9BA 4OK6A 2BV3A 1EK0A 1JJ7A 1G20E 1RW4A 2PZEA 3D31A 1XEWX 2NOAA 5C18A 2JLXA 1NP6A 1ZM2A 2CLDX 2ZVPX 1EWQA 3HPRA 3WMFA 2IS6A 1GRNA 1Q57A 1RJ9B 3W3ZB 4Z51A 1UJ2A 2EYQA 1PJRA 2QY9A 1Q20A 2BMEA 3BH7A 4OHVA 1YJ5A 2XTNA 4LYJA 4PSKA 2G77B 3WRYC 4HB4A 4C0HA 3IGFA 3LW8A 2IXFA 3NHBA 4IOMA 1DAEA 3U4QA 3MSXA 1OXTA 2G88A 3X1DA 1T8TA 2MSDB 2VF8A 3NDPA 3VU9A 1HT1E 2QGNA 2G3YA 4US1R 4LRWA 2VA8A 3UG7A 1MABA 3OZXA 4JL6A 4OQXA 5HKKA 4NYMQ 1FOEB 1AN0A 3U7FB 2ZE8A 2KI5A 4FIDA 2DFTA 2DBYA 2ZE5A 3RS7A 5JWOA 3BORA 2ZUCA 5C4MA 4LDJA 4C2TA 1FPMA 5FFMA 3LBHA 2JIZA 1D5CA 4G01B 4M2LA 4TTPA 1OFTA 2IXGA 2EW1A 1U99A 3EPHA 3DDCA 1G3UA 1YRAA 4LJ5A 2OG2A 2ZI7A 4Q1CA 2X19A 5F98A 1FX0B 1KOFA 1JAIA 2ANBA 5L3QA 3DEFA 3QJYA 1OPXA 1IJFA 3X1ZA 3EPLA 2HF8A 4ARZA 1O3YA 4LUCA 1BYUA 4UXIA 4RFSA 3CF2A 1DG1G 4W5HA 4IOKA 2K5UA 1U0LA 3U3OA 4M1WA 2QMHA 1G5RA 2BKUA 3TSZA 1KI3A 1ZU5A 4YDSA 1EESA 1Z0IA 1E96A 3M4YA 2ZJZA 3L8YA 1E2EA 3BB3A 1DAIA 1NN1A 3OIYA 621PA 5AJVB 3UG6A 1E0SA 2WWYA 2J9RA 4TLEA 1ZIOA 1IN5A 1N0WA 4B32A 1GG2A 2ZUBA 2GXUA 2IEYA 1C4OA 1KMQA 1ONBA 1KO1A 2ZRAA 2XZLA 1KAOA 5J4KA 2C95A 4UQOA 2YJTD 5EP2A 3V9PA 1HE1C 2OSBA 5CM8B 1Z29A 4NKRA 4US0R 2KSQA 4RZ3A 3WBKA 2YC2C 1ZUIA 1U90A 3K70C 3SJBA 2IYVA 1D9ZA 1G41A 3Q7QA 2DWPA 4QM6A 4DB2A 4JLJA 1J7KA 4LV8B 4HAYA 1OSNA 2CE2X 3BC1A 3EC2A 1RE0A 4LHZA 4DUGD 1R4AA 4TMWA 2JLVA 2H1LA 3F8TA 2X1VA 3NEJA 4LPKA 2HCBA 4Q18A 5BQ5A 4PHTA 4AYTA 4G5SA 2XSZA 3TRFA 2O8BB 4ZKEA 2GCNA 5EUMA 3QPUA 4PQRA 4A36A 4H9GA 1XCMA 4KYIB 4F92B 1XJCA 3GJ3A 1CJUC 2XOKD 1E2PA 2YV5A 1I4TD 4NU0A 1E2QA 3RS2A 3GEIA 1L7VC 2QUZA 5G40A 2PJRA 4QFMA 3QEOA 5JSZB 2BBWA 2FPLA 3C41J 2NMVA 1H8ED 2WJVA 4IJMA 3RS5A 6Q21A 2ODWA 4ASUD 4LOAA 1YU9A 2EYUA 3QUSA 1IN4A 2RCNA 2IHBA 1JECA 1KKLA 4X8HA 1OIVA 4DCTA 4FMCF 2FEOA 3T5GA 1YVDA 2FX3A 4LSGA 4JYCA 2CL0X 2ZQ5A 3BS4A 4XD7A 2C98A 4QGHA 4YMVA 3VR6A 4MKHA 4DXAA 1E32A 1SVKA 3W34A 1IJEA 3Q85A 3QE0A 3VU9B 1XJQA 2IL1A 1S2MA 3BIFA 5FL7A 4IFBA 2YVUA 2O8CB 1YR6A 2WSMA 4X8MA 2Q3FA 1MABB 4EUNA 2AKYA 4HB3A 1IY2A 4IKEA 3VMFA 4POAA 1D8TA 4NH0A 2GK6A 3JZMA 2A5GA 2GEDA 2ZU6A 3OE7D 2Q0HA 4LK2A 5HR5A 2JLWA 2FF7A 4HZUB 5A5GA 1G3IA 1IHUA 5TDHA 4W9MC 3CBQA 3A4NA 1Z2CA 1KDOA 4V0NA 2D7DA 2CCJA 5D3MA 2ZRLA 2DCUA 1DTSA 4V0ME 3NBFA 2OBMA 1FMJA 1YZGA 1OT3A 1Z6GA 2R8RA 2X2EA 3WYAA 5HE9A 1R0WA 3RRYA 4R2IA 1F60A 4LYFA 1X8LA 3GJ4A 2QP9X 3SJCA 4I1SA 1CS4C 2MSEB 1R6BX 3PITA 5FTNA 3CRMA 1FNMA 1M8PA 4G0NA 5G3YA 1MV5A 1S3SA 3DL0A 3ZZTA 2FWRA 1IY1A 4TMVA 3U7EB 2ZJBA 1TPZA 2UKDA 1CXZA 1OFHA 4B73A 2IA5A 2QE7A 5TMPA 3I5XA 1J8MF 2QBYA 3H84A 1OIXA 1E2LA 2FSFA 5FR2A 2QRZA 1EFRA 1N6HA 4GI7A 3C7KA 1G7TA 1KMHB 1SVWA 2JJ2D 5FUWA 1W0KA 2LCFA 2FN4A 4HZIA 4JBYA 1HA3A 4OI1A 1Z06A 4TT3D 4C0KA 1SXJC 3K70B 4S2EA 1N6PA 4A0FA 4FINA 3DOFA 2JLUA 1WB9A 5TARA 3GLGB 1FTNA 1KNQA 1SHZA 4Q03A 2C9OA 2BCGY 4QRHA 1LY1A 2FPKA 3EPJA 3L2OB 2ZRHA 1YZQA 4B6FA 4L9WA 3U61B 2CHQA 4BFYA 5KO2A 4GOJA 2GRJA 2AFHE 2GJ8A 3IBGA 1GRQA 5GJWC 4YMWA 1G8PA 4PO1A 3ZJYA 3REFA 1KJYA 2YOHA 4G5RA 2ZAMA 4LHYA 4TTRA 4B76A 3L0PA 3VAAA 2P5SA 2C96A 3ICEA 3KQKA 4A8JA 4I1VA 1DEKA 3CX6A 1E4YA 1XTIA 2O8FA 1IXSB 4Q7LA 4C0BA 4A15A 2EU8A 1F2TA 1CRQA 2LKCA 2ZI9A 3TW8B 2QSZA 4Q9HA 4WXPA 2R44A 2Q3HA 3WRXC 1GKYA 1Z6TA 2OBNA 3PIRA 4Q9LA 2DHRA 1T3HA 1WP9A 1NY5A 3OIUA 2YHSA 4TYNA 3HP1A 4JVLA 4Q1AA 4HAZA 2B7CA 4B35A 2RKOA 1LTQA 3THWA 5BXQC 5KPJA 1BO6A 1FZQA 3SR0A 3KKMA 1M6NA 4Q01A 3Q72A 2Z83A 4XVRA 2P6RA 1BMFA 2P6UA 3NBZC 2B8TA 1W4BA 4NMMA 2Q21A 4LZZA 1QRAA 3W8NA 3IQXA 4AYWA 5JLJA 3V00A 4D4JA 3O8CA 2PZGA 1ZAKA 1R10A 2W83A 2WHXA 1M34E 3AF3A 3R9WA 1II9A 2R6GA 3EXAA 3KUCA 4KU4A 3TBKA 3EZ2A 1GM5A 2UZ3A 2VSFA 3AVUA 5IHPA 2A5YB 3ZQ6A 5G41A 3CWZA 1HQYE 3THOA 3HPQA 3TQCA 4URVR 4YMTA 2XXAB 3T5DA 1COWA 1P7CA 1XXHB 3SEAA 2WKQA 4C4PA 2REXB 2IUUA 4BFZA 2OFXA 4OKSA 4B43A 1N6KA 4XTCS 2ZSEA 1ZD9A 3QENA 2VSXA 2ZRBA 1S1CA 3MRSA 2OAQ1 4BLQA 5JS8A 2IYUA 1Z3IX 3RANA 4LPSA 3TQFA 1E9BA 1NG1A 1CRPA 1P6XA 2AKAB 2ZJOA 1E2HA 5KSOA 2EFGA 2QP4A 2Z43A 1IN6A 4F4IA 3Q7PA 3U5ZB 2F1JA 3OIWA 2P65A 1TUIA 3GLHB 3ADCA 1SXJB 1ZYUA 2BEKA 4O2LA 1G17A 4R9UC 3WNCA 5H70A 4Q4AA 1ZJ6A 5CM9C 1R0XA 4JJKA 2WZQA 2ZE7A 3ZIAA 3P32A 1XD2B 4Q7JB 4UNRA 1UAAA 1ZNZA 2Y8EA 4U00A 3I73A 1NRJB 3A4MA 3Q3JB 1ZMXA 1SVLA 3A1SA 2PLRA 2ZRGA 3BFXA 2V4ZA 1LVGA 4MUBA 4QC2A 1KIMA 1E9RA 2OCBA 4IRUB 3O47A 4IEEA 4BFTA 2WOOA 4O3MA 5FOXA 3E70C 4MYTA 2GK7A 1K5GA 4E07A 4WOPA 2RB4A 1QHHB 3SFVA 1QZXA 3DVLA 2IF2A 4D80A 1PUJA 4Q9JA 3AEZA 4QJ4A 2JA1A 4L5BA 5FOWA 1BYIA 1XWIA 1G6OA 2R6FA 3B1XA 4PZZA 2V8OA 4CT5A 3UPUA 4G5QA 2HJGA 3A1WA 2AD1A 1X6VA 2ERXA 4KFTA 1K5DA 2EWVA 2OCAA 2ZI4A 3EIQA 2FSIA 2JJ1A 5HKKD 1DG3A 3THXA 5DN6A 4C0SA 1L4UA 1SKQA 4TTQA 4LYHA 3UANA 3TNFA 2PJZA 4X8LA 4DLXA 1QG2A 2JIZD 5JEEA 3UMSA 2W6JA 5DYIA 1G5PA 1OH5A 4OJKA 2OXRA 1TQDA 1KI6B 4DLYA 5CITA 3ADBA 2P0EA 1F2UA 2W58A 3MCAA 3P20A 1SVIA 4CYMA 1KDPA 4A8JB 2C04A 1GSIA 2ORVA 3B1VA 4M1TA 1D2MA 5B30A 1JB1A 4IFEA 5CDFE 2VHQA 1F2TB 1DAHA 1M1YE 1Q1QA 4X8OA 3SE0A 3W8RA 2WMOB 3TUJC 4PC2A 4V0LA 4DLSA 4RVCA 1OH8A 4QGFA 1SKYB 3I4LA 2NZJA 2W0SA 3ZZUA 3NC1C 2ZJ5A 4ACBA 1N5IA 4B74A 1AS2A 3JVUA 3THWB 1MO4A 4BLSA 1KK2A 2V6IA 1RC8A 3RRMA 2YZ2A 3DZ8A 4B34A 1CEEA 2AK2A 1SVMA 5BN4A 3CRVA 4NPHA 3FDIA 1ZUNB 1WA5A 3AGPA 3EIHA 4I1UA 1ODFA 3B1WA 3IQWA 2V9PA 3EARA 2GAAA 5CJPA 4D82A 4B47A 5KHOC 3PENA 1A5TA 4DCVA 3LX5A 3CO5A 4C0LA 1DE0A 2GTPA 5CK5A 4LC1A 4Q4HA 5LD2B 4TL6A 4IEIA 4JSYA 4ACAA 3R9XA 1EX7A 4G5GA 3FYHA 3TMKA 4MKFA 1LNZA 5KSZA 4UKDA 1CLUA 4ZDWA 2PX3A 1G3RA 2WWGA 4QJ3A 3SC3A 2HUPA 4UNQA 4NTZA 1GRRA 4EFMA 2BKEA 2NO6A 1Z08A 4LWZA 5FTJA 2XTMA 3DPUA 4IDOA 2J0SA 3AVVA 1LV7A 1D2EA 2F9LA 4GMXA 4EAQA 2W6IA 1DELA 3BK7A 4I99A 1ZIPA 2EFEB 4JLVA 4M9QA 4WBSA 1JQJC 3F3YA 1IBRA 2MSCB 1T5LA 4UJ3A 3I92A 2IF0A 1JEDA 1MKYA 2IYLD 1M7GA 4LJAA 3SI7A 3AVXA 1E9DA 3SZRA 5L3SB 2FDCA 1CR1A 2I3BA 4TQ9A 3ASYA 3CWQA 2AR7A 2H5EA 2CEAA 4D0LB 4PPFA 1R2QA 3RLFA 1NJGA 1Z2AA 4Q4AB 2A2ZA 4NL4H 3LAWA 4C3ZA 1GOTA 1JQLB 1P2VA 1XBTA 4D81A 3U44B 2PX0A 1KI2A 1KZ7B 5J4YA 3VKGA 1N5LA 1CBUA 3B5JA 4LX0A 4ZDJA 1FX0A 1XEXA 3EG5A 4B6EA 4D4LA 2TMKA 2FZLA 2WJGA 4CDGA 4AY2A 4XD7D 2YC4C 1OXVA 3O8BA 5CLQA 3ZVRA 2QU8A 4PAMA 2GJAA 1VMAA 4BFXA 2G0TA 3QQ5A 4RSGA 3IHWA 4A1FA 3BD9A 4V03A 1J99A 5FL7D 1JJVA 2RAPA 3I8SA 2ONJA 1KAGA 2GZHA 5TB5A 4E22A 5C4GB 4DEXA 4CVNA 1PLJA 4M9SA 5J4LA 1AJEA 2D3WA 4LJ6A 2PBRA 1ZINA 3L43A 4N0DA 4RZ2A 2XNSA 4TL8A 4C9BA 1UDWA 1E2MA 4D0NA 3GJXC 4IW3B 3PEYA 1L8QA 4NCHA 1OKKA 3FGNA 3ZGXA 1JXMA 2C78A 4DLUA 4D0GA 3RABA 1S1MA 4KFSA 3FMOB 4XOIA 1LS1A 1KSFX 1GDDA 4OHZA 3RS0A 2XAUA 4Q9KA 1SULA 4QGGA 2QG6A 2HXYA 1ZVQA 3OAAD 1JBKA 4MDFA 1AS3A 1K6MA 3HR7A 3KZ1E 3K09A 4PTLA 1X8JA 2G6BA 1VECA 2YYZA 3AF2A 5AUNB 2P2LA 3K0CA 3GLIE 2VP0A 2Q9CA 4YLGA 4DLVA 3TW4A 2OV2A 1W7AA 1Z47A 4Q1BA 4PHHA 2FJUA 2JGNA 3LRPA 3RS3A 4U7DA 2XB2A 2QNRA 3J81k 3VR2A 4TYYA 2HJVA 2KBFA 2F1IA 3CF6R 1ZNXA 5FI1B 5UKDA 2C2HA 2YINC 2G9NA 3BB4A 1NMXA 2R9VA 2YWHA 2ZU0C 3AVYA 5E7JA 3ZQJA 4TSFA 2OCPA 1CULC 3AQ4A 3DM9B 4NYIR 1RRPA 3I3SR 1Z0FA 2KJQA 2QZ4A 2V1XA 2OO7A 3FMPB 2GETA 1KI7A 5CB8A 3GEEA 1XTKA 4A2WA 3KX2A 4CT4B 1X1SA 1KJWA 1XDBA 2N42A 2V55B 1G4AE 2WJYA 2XB4A 5JSZA 1M74A 2C9CA 2GEUA 3D8BA 4EPRA 3RVBA 1G18A 4P3YA 2G1JA 2OT3B 3CPHA 3A1UA 4YONB 4NYJR 3AVWA 4FCVA 4MYCA 1G3QA 1P9RA 1TQ2A 3N5CA 3O8DA 4C0JA 4TN1A 1W36D 1DPFA 1JAHA 2WICA 2CNWA 5JCPA 1Z63A 3TUIC 1GKIA 3NH6A 4B3CA 1ZCAA 5FBVB 4NCJA 5E7IA 4NONA 4QM7A 2ZYTX 4N3NA 3GJ8A 1OYWA 3BWDD 2XGJA 2ZYWX 5GJBA 1G7SA 2O8CA 4NE2A 4F91B 4IDHA 3LDAA 4YXWD 4B3XA 3W5JA 1NY6A 1OIWA 3WHLA 3MD0A 4OBEA 1QHSA 5B2ZA 1NBMA 1II8B 3KKOA 2YWFA 3AKCA 2BBSA 2G1KA 4HZUA 3G5UA 1HTWA 2ODEA 1D6JA 3G82C 4TLAA 5FR1A 4LJ9A 1XMJA 3GJ7A 4QOSA 3RHFA 2IK8A 1UM8A 1TTTA 2BC9A 5LPNA 1OYYA 2IYQA 1L4YA 2NO7A 1XRJA 2RGGA 2RGCA 4KFUA 3UK6A 1TADA 2DPXA 1ZP6A 4KVGA 4ILEA 1T5IA 1JR6A 3AM1A 2IC5A 1XFAA 2QI9C 4Q9IA 4D26A 1XEXB 4I81A 2WJIA 4KFRA 2ODNA 2WSSA 4M9XA 3TLXA 3C5HA 3QG1A 4PHFA 2O0JA 3EZ7A 2SHKA 1ZCBA 1FP7A 1V5WA 2FSHA 2O8DA 1P72A 4GRAA 4Q66C 2E9SA 3GEHA 3NDBB 1FP6A 2V7QA 5HCIA 4KXFB 1COWD 1U2RA 2D2EA 3T34A 2NTYC 3RAPR 1S9DA 1MRNA 1KMHA 5B64A 3BBPA 4BLRA 2X2FA 5EZ6B 1S9HA 3PUYA 2JEOA 3OFND 1IN7A 3FOZA 3MFYA 4LBZA 2FFBA 3U2QA 2J41A 1GL7A 3ZD7A 1YE8A 4D4KA 5SZJA 3X1XA 4RD2A 2QENA 4AG5A 3PXGA 4ZDKA 4HDOB 4TMXA 4HDCA 3B1ZA 3GLGA 2QMOA 1MOZA 1VIYA 2EFCB 2ZRMA 5KSYA 1KDTA 3Q9LA 2NG1A 4Y0VA 2CL7X 2QTFA 4NYMR 4O2RA 1E9SA 3VR4A 1NJFA 3MUFA 1UADA 1V43A 2FG5A 2H17A 2VHTA 3ECCA 4F7WA 2ZM5A 3AVTA 2CE7A 3A8TA 4KI0A 2OLJA 4K46A 4QBIA 3W9YA 3PFIA 1E9FA 2VIIA 2O5VA 1NN0A 3C14C 4KAXA 1CR4A 3SQXA 4OK5A 2GA8A 1AA9A 2J7PA 3F0TA 4AI6A 1I4DD 1GZSA 1WF3A 4XWOA 5AUQA 4JBWA 1TUEA 2JATA 3B60A 4E09A 1YQTA 1W48A 2RGBA 1GIAA 1I4LD 1N6RA 3SYLA 3CONA 4Q4LA 1KKMA 4BEJA 3DM5A 3KJIA 1CP2A 2ZRCA 4JL5A 5KU1A 2ZI3A 3NKVA 1G9XA 4WXRA 4Q02A 5J47A 4A82A 1WMSA 2ZYVX 2REBA 1G8FA 1MR3F 2CXXA 4XH9B 1WDTA 1NLYA 4BLTA 2JJ1D 2ORIA 2IYXA 4A9AA 4HSEA 4AKIA 3MWYW 3SQWA 2IS2A 5DN6D 5AJYA 1US8B 2J0VA 2VLIA 3SS8A 4HEJA 4CEIB 1XMSA 4QJ5A 3W90A 1A7JA 1W44A 3QF4A 1NNEA 2GXAA 2HYIC 1T6NA 1S3GA 2OCYC 1J90A 4PAQA 1CJMA 5JEDA 2E1RA 3U7GA 5LB4A 4M1KA 5LB2A 4N0EA 3LWNA 4OL0A 3VFDA 2W6JD 1KI8A 1P3JA 1N2CE 4PZLA 3DOEA 4FMBB 2Z6VA 4L8GA 1W47A 4CIDA 4EJSA 2B6HA 1IXRC 2ZVQX 1S96A 1KSGA 5M04A 1CJTC 3T12A 3TIFA 3HR8A 2XXAA 4KSBA 2VHUA 3ZS9A 3GQBA 3BFVA 1KTVA 2FU5C 1R8SA 1T8UA 1NLZA 1XXHA 2CJWB 4BECA 5JMTA 4RD0A 2B21A 1DO2A 4HAUA 3WP0A 4QHTA 5CK4A 5JCZA 2JJ8A 1XD8A 1VKJA 3QY0A 4JLBA 2YKGA 2VF7A 4EJSC 5DHAA 2D06A 3C15C 1WBDA 2L0XA 4MUAA 1UKVY 2IS1A 4TYWA 4TZ0A 2NO0A 3AH8A 1N5JA 4FMDB 4HAVA 1HYQA 5DYGA 2FA9A 2XITA 1W46A 3PUZA 4H1VA 4TMZA 4ZCMA 5FPHA 1T9HA 3H4MA 1NSFA 4PSVA 8OHMA 2ZSDA 4Q7KA 1P2TA 2IYTA 4TLCA 3E2IA 2IYZA 5KNCA 1QVRA 3ZYCA 3GLHA 3IBYA 3T61A 1W4AA 2EFDB 1HY3A 1SXJA 3EAQA 5TY0A 4OJQA 3THYA 5FOUA 4IXNA 721PA 2CL6X 2O8DB 1KK1A 1JI0A 1OXSC 3UMFA 1XD2A 1FL9A 1SHKA 3FWYA 2OXCA 4ZPXA 1T91A 2PL3A 2IEZA 1TU4A 3OEED 4PAOA 4BFWA 4B2LA 4ZDIA 5F9FA 4C30A 4WZ6A 3BXZA 5C2JB 1NKSA 1ZW6A 4JBXA 5F2EA 1NVVR 1RRFA 1UBGA 4DZZA 3FTQA 3AP3A 4AWXA 2BBOA 1R8QA 1QHHA 1VG8A 3P1JA 4JVMA 3ICQB 4MYUA 4TMKA 3BERA 3TR5A 2HXSA 1EFCA 1W4RA 2IBMA 3GLFA 2W6ID 1T3SA 4PXAA 4URYR 5EP3A 4Q48A 4BQSA 4M4SA 4YMUA 4HLDA 4DVGA 4JSTA 2QT0A 2QEQA 3WP1B 3UKDA 4A2PA 1ZU4A 2GAOA 4S35A 5SZHB 2ZS8A 1VCIA 4R71A 3PUXA 1OJLA 1P4SA 2XJ4A 2FPMA 1VPLA 1DOAA 1QHXA 2VP9A 1Z6AA 3NBXX 2VYFA 3M6AA 4H1UA 4MH0R 4D4MA 1KYIA 5LBIA 4LY6A 4MDEA 2KWIA 2R6AA 1E1RD 4A0RA 1AQUA 3FFBA 2FFAA 1AKEA 1R0ZA 3B82A 2RGAA 5K8UA 1NVUQ 3BOSA 3B13B 3DO6A 3PUVA 5K8IA 1KI6A 2B8WA 2W2XA 2F55A 4B3GA 2ZS9A 2DYKA 4DEYA 2J0UB 1G19A 5DI3B 3EA0A 3K9HA 5HCNA 3WNDA 3QG5A 4AD8A 5AJXA 2BDTA 2LKDA 2J87A 3U3RA 2WWHA 1HURA 1Q1BA 2C99A 2GJSA 1P2SA 2AHOA 3MWJA 5KNDA 1HT2E 2GCPA 5HE8A 4YQFA 3CX7A 4PO8A 3E1SA 2AFIE 2ZITA 4BZQA 1NG9A 2MMGA 2CLCX 4EIWA 1IOZA 1CKEA 2BJVA 2ZRPA 3FHTA 4I1OA 5CIWA 1T3LA 2WPDA 3D6TB 4D6PA 3WYGA 1XNJA 5KSPA 3U3KA 3AUYA 1F6BA 3KUDA 3QF4B 5KTYA 4RJLA 4TL7A 4MGKR 2ASEA 1Q44A 3QNUA 5FUYA 3R9IA 4DDTA 4C7OB 4NCNA 2QPOA 1NMYA 1G291 3VHXA 4R7ZA 2VL7A 1PLKA 4ESVA 1UKZA 3NBYC 4EJSB 1X3SA 2ZANA 4CF7A 3TAHA 2DFLA 2VH5R 5GADl 1WXQA 2WJHA 1C1YA 4IOJA 2Q3MA 3TK1A 3W6PA 3AUXA 2D74A 2ZEJA 4GFDA 4OYHA 2HEIA 2REOA 4MRRA 1UEJA 2JASA 4JLOA 2OHFA 5HZKA 4CW7A 3AB3A 5CDFA 1JNYA 3L0OA 2GWHA 5H1YA 1T0JB 4BWYA 1JEEA 1CTQA 3UWOA 4RKEA 4GP6A 5JHHB 4Z8XA 1OLOA 1CF4A 3RYTC 1OH6A 4JVNA 1VCMA 2OAP1 3KXKA 3HDTA 2IW3A 1OXXK 1Z8FA 2V54A 4PQYA 2ZRKA 2YWGA 2ZRIA 1XPUA 2EVWX 3FHOA 3AP1A 5TXGA 3A36A 3QKRB 4D2IA 5EE9A 3I62A 3NEYA 4QHYA 2F1HA 2AWOA 2RGEA 5IRCD 5BYKA 1W5TA 4JMPA 4GSYA 1UKYA 3W3AA 1ETUA 5L3SA 2H8KA 2OBLA 4HUTA 2KBEA 5CB6A 3FKSD 2AN9A 5BYJA 3F5FA 4PC1A 1KK3A 3MMPA 2UVQA 2JLYA 2GKSA 3S1AB 2XX3A 1U8YA 1K8RA 5KOYA 1B23P 1RPZA 3THYB 2A5JA 5AJWA 1NF3A 221PA 2E87A 3IO3A 1KSHA 4EQ6A 4P0TA 3RDPA 1HQCA 1IY0A 4BASA 3U44A 1VIAA 4YDHB 1IQPA 4P31A 2H16A 3WNBA 1E0JA 3KXLA 4M22A 4ABYA 3VX4A 4MRSA 3VKHA 4DDUA 4US2R 1XU4A 2KB0A 1GVNB 2RGNC 4MKGA 2CNWD 2HF9A 2OE2A 2XNDA 4GPTA 4EPXA 2X77A 2W2TA 4KYUA 1NN5A 2CVFA 2QTHA 4P4SB 5F3WB 3TVTA 3ASZA 3WBJA 3TAUA 4URWR 2FFQA 3GLFB 4Q00A 4TYQA 5FBRB 1XTRA 3GFPA 3SN6A 2GJKA 3TSWA 2PEZA 1SZPA 3HU1A 4MYHA 1U0HC 4KITB 1CR0A 1U81A 4DUGA 2UZIR 5DLQC 3PCRB 3QKSA 1J70A 5IF9A 4HAWA 4QNMA 1KY2A 3IUYA 5JHGB 4K8OA 3LD9A 3LXRA 4PPNA 2Q6TA 1F5NA 4UNSA 3VTKA 1F3OA 1J8YF 4DHEA 3P26A 1VTKA 3OIVA 1KK0A 2P67A 4GL2A 2ZTSA 2XOKA 4BFUA 5GVRA 3NHAA 1I2MA 2FGKA 2Z4SA 4YC7A 4KCGA 4LBYA 2DWQA 4DIEA 1G4UR 3QF7A 4JLNA 1H8EA 4ZKDA 2WSSD 4ASUA 3R8FA 3BRWD 4RY2A 4NHOA 3RWMB 1E69A 5EQTA 1HH4A 4P32A 4XVQA 2HLDA 2KE5A 4DWJA 1S8FA 4XTRA 4OQMA 3IPXA 4PHGA 2F1RA 4AKGA 1JR3A 3W5IA 1D2NA 4EDHA 4DSTA 2I4IA 5FBQB 3CB4A 3I61A 1Q0UA 2O52A 1XPOA 3PVSA 4NCKA 4DJTA 2WM9B 1EG7A 4KV9A 3REGA 4Y0AA 1IONA 5A0FA 3LQQA 3U3MA 2PH1A 4OHYA 5FPTA 1VHLA 2GBLC 3UMRA 1IAQA 4A0HA 3CX8A 3K70D 2Z5FA 1QDEA 1YZLA 2P3SA 3KB1A 1AZTA 1TF5A 3OE7A 4IVRA 3ADKA 5JI3E 5FL3A 2OZEA 1YR9A 1KO8A 1N6NA 1AKYA 2FEMA 3JVVA 4BUJA 1TQ4A 1YR8A 1RFLA 1IN8A 1RYFA 3KB2A 3TGPA 4TLBA 1OE0A 1RIFA 1GNPA 4ZI2A 2QT1A 1E6CA 2AXNA 2BJWA 2IXEA 1EFTA 1XTQA 1WCV1 3BH6A 2R62A 2VBCA 1HV8A 2V1UA 1P73A 2ZSAA 4U02A 5L8VA 2F43B 4A2QA 2N1BA 2J7PD 3GP8A 1TQ6A 3MGCA 4DBLC 2WIAA 1XZPA 3EASA 2NO9A 1FMLA 4AK9A 4B2PA 5IT5A 4AKEA 1LW7A 2FSGA 3AKDA 4MRNA 3IDQA 3K0AB 4XSHA 1G8HA 1W5SA 3HYTA 1SVSA 1M2OB 2XSZD 1U94A 4TMTA 2HDNB 3IILA 3SDZA 2DB3A 2W0MA 1II8A 2GCOB 1ZUHA 4XVUA 2GVDC 3FMIA 2NO1A 2GXQA 1N6IA 2ZS7A 4MA4A 1ZM3A 4EQ6B 1X8KA 3NH9A 2VPPA 4WA7A 1VCNA 1QG4A 2BHRA 3I32A 1XMVA 5EE3A 1DAMA 2ZRDA 1TU3A 2WOJA 1MO6A 4FD2A 1XTSA 1XTJA 2FFHA 3WY9A 3FB4A 2IYSA 3CRQA 5FOTA 2ZJ8A 2ANCA 3TR0A 5FI0B 3QXJA 1E9CA 1QVAA 1ZNYA 4F4CA 2WJJA 4HUQA 3CM0A 4JYBA 4DDVA 4EPWA 2IYYA 1R7RA 3CLVA 4Q4JB 3ZVNA 2QROA 2ZR0A 1N6LA 4PZYA 5EXPA 4AYXA 3DZDA 5ELXA 4KLZA 2NPFA 4HATA 4WAUA 2GESA 4M53A 1P61B 4LV6A 3CIOA 2ZYUX 3C5CA 4FCTA 3LXXA 1X86B 3QKSB 2O0KA 4JT2A 4DDWA 4ZCIA 4BGDA 3K0SA 1FUKA 1E9AA 3HU3A 4NYIQ 4JKYA 1GUAA 4B71A 3M0EA 2VP2A 5EE1A 4M8NE 1P75A 2IUSA 1ZC4A 3IEVA 5HZHA 2BIFA 4P4UA 3I8XA 4BEBA 3LBIA 4IDQA 3EC1A 1OB5A 1W1WA 2ZAOA 4DT1B
chains in the Genus database with same CATH superfamily
1NMSA 1UWKA 3B6KA 2ORWA 1JG7A 1D0IA 2FLVA 3K0FB 3VJMA 1I32A 1GPYA 2XRZA 3P2OA 4YFVA 3B3AA 4LJYA 3LVQE 3SYKA 3V8BA 1DAFA 4MITA 2BONA 1SXJD 1PHPA 2JGDB 2R3SA 1MHTA 1EU1A 1XP5A 3FGZA 2C42A 1ATIA 3LO5A 2BAGA 2A0WA 3JQAD 1Z7GA 1ZPDA 2CBZA 1Y1RA 1A82A 4BLOA 2ZKIA 4C5CA 1FMCA 4PX9A 2XKKA 2YRXA 2ONZA 3P5SA 3OF5A 4KZPA 4RHYA 3TLXA 4ZGBA 5MGNA 4TTTS 3HLKA 1F06A 1N3BA 5A6SA 4RCYA 5JFOA 4A0QA 2GO1A 1M75A 5TE9A 1U2TA 3RFXA 5JJLA 1L4GA 3IDZA 4J0FA 2ZUDA 4RHCA 3R7WA 3QEKA 1MNQA 5IN4A 3HBAA 1ORHA 4JOCA 4OX9B 4MWSA 1DXQA 4U9HS 5D00A 4AM8A 3B6JA 3HABA 3WGYA 4G0OA 3Q3VA 5HF8A 2DTEA 4Q5IA 1D9XA 1ZVKA 4ZMSA 2WYHA 1H05A 4RH3A 8ABPA 5MFPA 1JWAB 4OI2A 2X6TA 1E1CA 2QL6A 2ZXFA 2AUMA 4AJ2A 1RXIA 3NWOA 4Z4EA 3VDQA 3NDRA 2FR8A 2MYTA 3BJIC 3NHFA 1CETA 3AQIA 2J31A 4D8WA 2P5TB 1N75A 1G5FA 2A58A 2VDOB 1OXUA 2ARKA 4E5UA 1CJSA 5BV2P 4CEIA 4TYPA 1W76A 1EK2A 1IHXA 1L5OA 2J3QA 2OY0A 3O8LA 4MQBA 4CCYA 4URXR 5LIPA 2F8MA 1K66A 3MS4A 3KS9A 3D3KA 3G0HA 2W2VA 4E21A 1LPNA 1B6RA 1LSOA 3JYNA 4AN0A 4Z7NB 2HYDA 1TJ4A 2YIVX 2Y77A 4M54A 2XCLA 4LWQA 3KDSE 2EAUA 2C7QA 2B3TA 3KTAA 4IG9A 1T4CA 3CUEF 1U7PA 1NNUA 5KQGA 3BEOA 4JFAA 1WOMA 3WMEA 1UDRA 1U1IA 3GLKA 5CNJA 1ZY2A 2JBAB 2NZ8A 3S40A 1N4DA 1PJCA 3CZAA 3VYSB 5KQSA 4EFNA 1T5OA 4HN2A 1J0AA 4J4HA 1YS6A 2I6XA 3BXHA 2XODA 4LOLA 2CJWA 2AN4A 3DD1A 4F6CA 3GP3A 4O2AF 5KNDD 1L4KA 2R6ZA 2XE4A 3K2QA 3MJTA 3RC3A 1KI1A 5K3OA 3QLVA 4J3NA 1ECFA 1IHOA 3GDGA 3WAKA 4BFSA 4DSUA 1AM4D 1KSJA 4ETMA 3ADDA 3PJDA 1Y81A 3JZIA 5I4KA 3EG9B 4CDRA 4CKYA 1XLWA 1Y5NA 3BJZA 3O1HB 1QS0B 3Q4GA 1I5OA 1Q92A 3BZBA 2PZFA 4MVJD 1AHNA 1XI2A 2QV0A 3O21A 2PQ0A 3V4LA 1NW4A 2B4KA 1SGWA 3E58A 1LF0A 4EM6A 2PV7A 2PU7A 1TX4B 4CEJB 1Z12A 3UT6A 3CKKA 1KO5A 2Z2XA 1OW3B 4FZVA 3HJNA 4DLTA 1G3MA 4H1WA 3KQLA 2QN7A 3F6PA 5J3JA 2FOLA 5B58C 4QQKA 5C8YB 3PFWO 1OBVA 4HUQB 4TVSA 2HO5A 3WK4A 4BX9A 1UWCA 4RENA 4QE3A 3VR5A 3AHCA 1YQQA 3RGGA 1WSWA 1MT3A 2I22A 2AUTA 4HQ0A 1HDIA 4P3XA 5THXA 3Q7IA 4QXAA 1QKIA 4KVFA 3K73O 4P98A 5ITVA 1U3TA 2Z3ZA 5C1OA 3WGIA 5A6VA 4LZNA 1BW9B 4NJEA 4LGMA 3MGBA 1VI6A 3GIDA 2CV1A 3PDWA 4BX2A 4M21A 2X9GA 3WMGA 3H1EA 4BMPB 1G7RA 1JU9A 2YY6A 4EECA 1NKTA 2C7VA 4WVFA 4DJEC 4RJTA 3VR3A 2IX3A 4YRKA 3PV0A 3I64A 5E3IA 4N03A 2VNHA 2VQ6A 1Z83A 1YZVA 3ETHA 4UMDA 4Y6PA 1R1DA 4BZWA 5HVNA 3CQ9A 4V0MA 2O8EA 2WTUA 1DS6A 3AR4A 4CPDA 1A9QA 1GA4A 5LU8A 2KPOA 3FR8A 1ZXXA 5TV2A 4JLAA 1CZKA 2WV7A 5PNTA 3DQPA 3ESYA 2PZLA 1Q19A 1BDJA 1U7DA 3A1EA 3FHCB 1M0WA 4WKPA 4X1KA 1JLMA 4BNJA 2GF9A 3PJRA 4JLKA 3G5LA 3Q3CA 3SVTA 1ENOA 3OJFA 5B57C 2C5HA 2VSOA 1V8DA 3QNWA 2HWWA 4Y9RA 5C46F 5C8ZA 3DQZA 2V7PA 1NXPA 5EKDA 2UVDA 3FMFA 5G2OA 2GXSA 3IAHA 4MS1A 4EY3A 2QZJA 4K9PA 3RJTA 2R6DA 3OKCA 1W34A 1MO3A 2ATXA 2RHBA 1OA0A 1L7DA 2V3WA 2OMEA 3BGDA 4G4JA 4I3GA 4YTEA 2NNLD 3T9CA 3M1IA 1T26A 1J22A 2OK7A 3LIPA 2EEPA 4R2KA 5EXDA 4R69A 1EFVB 1HETA 4A6PA 4GOMD 3UOGA 3Q7RA 4FILA 5TMEA 2P40A 4CMEA 5DBOA 3CLRC 2GPBA 4QEZA 1TIPA 5CFPA 3D6MA 2H4ZA 5CEFA 1P2GA 5CCDA 3PVZA 2I0FA 4BHTA 2FN7A 1Z5PA 2HK7A 2FE4A 3IA2A 3D9QX 5FPSA 3TE7A 2QJOA 3K35A 4A16A 4B75A 1LC3A 1P7VA 4L73A 4Z9BA 4Z3OA 1VJ5A 2R7KA 4BBAA 1LF5A 4Q19A 4L3VA 4MWTA 3KJQA 4ZI3A 3D7MA 3ZQUA 2E55A 4RJJA 4L2IA 3S0JA 2FPGA 3AF4A 4PONA 4XQGA 3ORHA 5F76A 2GZAA 2XBMA 3MJSA 3CNOA 4NLLA 4D25A 5EIWA 1DKNA 3ER6A 3OOYA 1QP7A 2AFHA 2DQYA 3MM4A 1OF1A 1XSEA 4JODA 1KYWA 5H8WA 1F8UA 2VPXA 1NBME 4U2FA 4WJZA 4I8IA 4GLJA 5AM5A 3DOHA 5GTDA 3CGWA 2EGHA 4RAOA 4AS2A 3QBTA 2HQSA 3EA5A 1L7QA 4TZKA 2QN6A 4G2TA 1R8XA 2PUEA 4GZ3A 3OURA 1DBSA 2VUTA 3LBNA 1EFHA 1CZLA 3HFRA 2ZI6A 1TD1A 1IIBA 4L9RA 3L8ZA 4N01A 4Y2PA 1P62B 3COWA 5ALFA 5G0VA 2IWRA 4B6QA 1IIRA 1G66A 2AGVA 2J7KA 1X1BA 1XD9A 3P2MA 3KWFA 3W5UA 4FI3C 1IZZA 2VF4X 5TGZA 5HF5A 4PLGA 3KKKA 2C2GA 4QUJA 5DNWA 3KC2A 2JLQA 2HLDD 3T1HB 4EYEA 3LFUA 2PFKA 1QVWA 1PWZA 5TEVA 3KKLA 3T7TA 2X8JA 1F4VA 3EMDA 2RH8A 4LHEA 5LYJA 4DRXB 1AMNA 1IOWA 4ERNA 5A3SA 3UC5A 2IWHA 4HMOA 2R8YA 1Y63A 2VHCA 3IJPA 3NONA 3QKRA 2G9QA 2Q1YA 4M38A 5FPYA 5BVHB 1Y37A 4TXJA 1WHTA 3AMVA 1HZZA 5CFQA 2HN9A 4E5SA 5GONB 1V39A 2Q4DA 4EHHA 4ESEA 3BMNB 2G7ZA 1KRHA 1WX1A 4KDRA 4F84A 4ZVQA 4E7PA 3WNZA 1AV7A 3EWAA 4LXXA 2GAFA 2EKPA 2WD8A 3AJRA 4Z4FA 5LP6F 5J2TA 2HWXA 4MUMA 3S1AA 2AWNA 2B34A 2PDAA 1Y5MA 1ZISA 2I2BA 4YRCA 2BM0A 4F2GA 1C81A 2QD2A 1NV8A 2XEXA 2BP7A 3P27A 1CD5A 4BZXA 1BGWA 1FPQA 5H5JA 5JS7A 3I9V1 1L8LA 2P1ZA 1G5TA 3PXAA 4JQCA 5DB4A 4AG6A 1MO2A 3RYFB 1IBSA 1I30A 2HNBA 2JH9A 4QDOA 4QDUA 2H59A 2XE7A 1E79A 3O9MA 3OAAA 4WMLA 1C3VA 1YC5A 1Y3DE 2FF5A 2KLBA 3KYCA 3PQ4A 2VT2A 4ISCA 3U13A 3UJBA 1AO0A 5BMVB 2V0NA 4Z1MA 4UC0A 3Q2OA 1PD0A 1SXIA 4YGYA 3Q0EA 1XJWA 4FOTA 4HAOA 4L6AA 1M7BA 4W6ZA 1PSWA 1SCKA 2VPIA 4KXWA 1M33A 1K8XB 4J7XA 4O1MA 5JAQA 4ARZB 1B16A 1Y3AA 3LQ2A 4II2A 5H9WA 2A9JA 1BDHA 1G6HA 3ZBPA 4AIIA 4E7OA 1OI4A 4RJIA 5DM2A 1K7CA 2NZ2A 3JATA 1N2SA 4L0MA 1U2GA 2WZCA 2SKCA 3T5BA 2BEJA 1HM5A 2JGJA 1C7JA 3TVYA 1Z6QA 3A25A 1LV8A 3HDQA 2GKGA 2XZLA 1IMJA 1XCGB 3QKTA 4W4TA 3VUEA 4PC7A 3NV9A 2D2IA 4YEDA 5IG2A 1YWGO 1MX9A 3DBLB 5CNIA 1DQNA 3FVQA 4O1HA 4Q6WA 4F8EA 1E0AA 5BO5A 1WXIA 4KMRA 4OP3A 4X7PA 3GCGA 1GTJ1 1IG3A 3N7TA 5L3RA 3RWBA 1PI3A 2GJ4A 2MMCA 3UUFA 1KDRA 5TQ0B 3E9RA 3L1IA 4UTRA 3AKEA 3STYA 3TIIA 2EERA 4B45A 2XUOA 3A4TA 2ORYA 5FORA 1L5WA 1XQ6A 1PUIA 2R4UA 4Y6OA 5ETJA 4HDKA 2QMZA 1I2BA 3HVKA 4ABTA 4L85A 2OCDA 4PFKA 2CSXA 1L4LA 3IKJA 3Q5DA 3GPBA 1C50A 2FZ4A 1G8GA 4QPNA 2OFFA 1BXRB 1MAWA 5BVGA 1Z4MA 3G2JA 4HDQB 2B9VA 2J5BA 4FC7A 1RXCA 4FMDF 5JPDA 2J3LA 4TUYF 4V1CA 3W5BA 3HJGA 5K8VA 3NHYA 3BMCA 3DZCA 3RSOA 4LXGA 3LLSA 4B6JA 3DZIA 2X4LA 4IOLA 2OVBA 2ZTUA 1V26A 3RBXA 2IQIA 3GGJA 1ZC3A 2I6UA 2QMUA 2VPYA 4M3NA 4XX1A 1HNWB 1AZWA 1YVPA 2GPAA 1BGVA 5D85A 3ZNOA 2PUBA 2LCIA 4XM1A 3AGQA 1KEZA 3UT5B 1YJBA 1CE8A 1HYHA 2IHYA 2ODBA 2X86A 2ONKA 3R3UA 5AOVA 1LBQA 3S2SA 4D4GA 5IAOA 3K16A 4URUR 2ACEA 4LK3A 4RZXA 4BRUA 4MAFA 2VP5A 3H2SA 2EG9A 1VA4A 5GJVC 3AXTA 1XL1A 2V6JA 3EIEA 4EDFA 2WMDA 5EINA 1T2UA 1E2NA 1R5OA 1HNNA 3NCTA 4DKJA 3R0QA 2DUJA 5BSVA 4NU6A 1IQRA 1QDUA 4P3PA 3R7DA 2B4TO 3O2SB 1RCTE 2P77A 1CJBA 2QTAA 2IW1A 1UWVA 3OUUA 3BXEA 5D6NA 5DHFA 5FBWB 4BPRA 2E4ZA 2BMFA 1HT3A 2P9QA 4XWKA 4CFYA 4GDFA 2CDNA 2FWAA 2NQTA 3I39X 4L4YA 3RUDA 1WMEA 5JQWA 4F11A 4OAQA 1NL3A 5A1JA 3KSAC 1CVIA 5AXCA 4CMGA 1T0IA 4EUSA 5BR4A 3RCBA 4MICA 3TB4A 4F71A 4OLAA 3UUEA 1RKBA 4C3VA 4HFMA 3BIOA 2BI4A 1IULA 2JDID 2XWSA 4B7UA 3F7MA 1RMTA 3KHKA 2HT1A 4ARVA 4QD3A 1NIJA 3LCCA 2CZGA 4MR7B 3DA8A 3PXBA 5FTMA 4D45A 4TSFD 1LSJA 2FW1A 1T1GA 1IWPB 5DTMA 2NU8A 1DVRA 1E0DA 4WLEA 4LDRA 1IHYA 1YR7A 2QRNA 5AUOB 4ZN6A 1OQAA 1HE5A 3B2QA 4INAA 3FN4A 4IDBA 1G2QA 2R7AA 4UXHA 2V7EA 1HDCA 1YCFA 2I4LA 5ES3A 1XHLA 2I1VB 4DMHA 1XA0A 4NABA 3PHBE 1RXUA 1WW3A 3CJTA 4S1NA 3UMMA 5LD2C 1EUCA 2FY8A 2XUKA 3B9QA 4DNXA 3H2YA 4EG3A 2XA1A 5D3MB 3ANMA 3CNBA 3FPHA 5AK0A 3V4RA 4AKHA 1E7WA 5A9SA 4TL9A 1AIPA 3R40A 4NCIA 5FH9A 2UVPA 1DO0A 5FOQA 3QE9Y 4HQOA 2BOVA 3LL7A 4PO3X 4M37A 4CV2A 5F9HA 1VPEA 3NYWA 4A26A 1F12A 2HCRA 2AKEA 2XYRA 4WVLA 5FFNA 5FB3A 2I2CA 3L0IB 2IYWA 1EP1B 2HLHA 3IO5A 3KKPA 4LV5B 1F2VA 3NVMB 4FX2A 4Q4JA 2NXNA 5DGCA 1YHNA 1C30B 3KZCA 5AKEA 2FQQA 3K9FC 2NYUA 4X0EA 2ACWA 2HHLA 3VYVA 5KUTA 5IUKC 4MWGA 5IKXA 2ATEA 3A31A 3EYAA 4LYGA 5I7UA 3MWGA 2VF2A 1RJDA 2LBPA 3L9XA 1DAKA 4AY3A 3HWSA 1XJ5A 2X0IA 1Q1EA 2CCKA 1PEYA 3LUAA 5FWAA 3ZWBA 3EISA 3DT8A 1JKIA 2R751 1NBMD 1SM4A 3QOWA 3I76A 3L0ZA 3MWFA 4DCJA 5HRUA 2NU9A 3N8DA 1M8KA 2I4RA 2O1EA 2N1MA 1GQ2A 2QYHA 1IDOA 2Y1CA 4NZNA 1WJGA 4WCFB 3SYRA 1SKYE 1AKTA 1R5BA 5I48A 4F3NA 4K9RA 4QREA 1AGPA 2Q2NA 1CUSA 1G6KA 3TXXA 1EWYA 3RSFA 4O63O 2NZYA 2OFWA 2YHAA 4DV4B 2BCJQ 4JB8A 2HY7A 2NPIA 3KXDA 4MI3A 1M0EA 3PD7A 3RUHA 2MIIA 4ID3A 2HQBA 2Q9UA 1RRGA 2QSYA 2RIRA 4XLLA 5J4VA 3U56A 3ZJVA 2GH1A 3CZ9A 2D0IA 5LYJF 3MERA 2VQEB 4CMCA 2GBLA 4HH3C 4HX9A 4BX3A 1JEQA 3DBIA 3QVUA 1A72A 3UFXA 2X7HA 1CJVC 1RZ3A 2Y71A 1T8RA 1YACA 3FBGA 3V4SA 1IRIA 5EZSA 3I2GA 5F3RA 1C0LA 2AXQA 3Q8WA 4FR2A 3FA2A 1DWUA 2QRJA 5HMLA 3L02A 1ATZA 4RL6A 2PUTA 3CRW1 4BGEA 1GKLA 3OY2A 5J2TF 1ZX1A 5AW4A 3HHEA 1HE2A 1MEEA 1V8BA 3R3ZA 2ZRFA 5SV2A 4MI1A 1X7XA 3FJ1A 3F7TA 3P52A 3D43A 1P60A 3GRZA 4GE3A 1VJGA 4MV3A 4WCVA 5LLSA 3H8SA 3LP6A 2R48A 1V35A 1BH6A 3B89A 3G8DA 4GPD1 5AUPB 2ST1A 3JSXA 3R3YA 3WYFA 1S2OA 5E95A 5KVQA 3CJRA 1P17A 5AW5A 3FVWA 3AY3A 3C6ZA 2X0DA 2YJ3A 2K6GA 3BL8A 3EULA 3F5SA 2CJPA 3JSAA 3NDIA 3NRJA 4OGLA 3FYSA 4LFAB 3V8MA 3NI2A 1G9SA 2QRVB 5AVYA 2YHIA 3SSAA 2OYCA 3AIMA 3PUWA 4NZYA 4U7JA 3RVRA 1XCOA 3RRZA 3G85A 1BFKA 1NF9A 3M4XA 3ZZNA 1B8VA 2V9ZA 2VDUE 4NAVA 3KQQA 3IXLA 1W85B 1Y89A 4AY5A 1TMKA 3G1WA 3PLRA 1WOYA 1R5NA 2AS0A 2OCXA 1J0XO 4NIMA 3BSSA 2VWGA 3PXCX 4ZZ2A 1ZWLA 2C8LA 1PJ3A 2IEIA 4M1YA 4G5OA 2QLFA 3MG9A 3T41A 4AZTA 4BQEA 1KIAA 2XT0A 3C3YA 1KJIA 3GB9A 3VTAA 1PJLA 1PR0A 3GAFA 3ZYZA 4EBFA 1YULA 2F3RA 5IK2D 1SXPA 1GTMA 5TR9A 1UODA 3JQGB 5EFZA 3EEYA 3VV2A 3WHKA 3LOPA 4RCVA 4BMCA 2X4DA 1E8NA 1QJCA 2P9FA 5A7GA 4NNPA 2PSHA 5IDVA 4KPEC 3KKQA 3DOIA 3GFQA 4I4TB 2VQSA 5JD3A 4D9EA 4CI9A 2YX1A 5CVTA 2YVQA 3S70A 2JJ2A 5AW7A 1PK9A 4XQ0A 2I3GA 5LQAA 2CVZA 2C4MA 1FRVA 2WU0A 2Z2JA 4G5HA 1RYEA 2HJRA 2QLMA 1DX4A 4NZ9A 2KHZA 3KVRA 3T9FA 4BVAA 2N75A 5FLKA 4QKQA 2B8EA 4UTOA 3DC7A 1SU8A 1J4AA 2VT6A 3G0IA 3II6X 3TLKA 1XU7A 2ASVA 2BMJA 1BVUA 1KO7A 3MQFA 2XZPA 3SU8A 3KYDB 3WWEA 3NNDA 1WB4A 3GARA 1LC0A 4BO6A 1YHYA 1Q5PA 1TUBB 4FS8A 2Z04A 1EYZA 1OYOA 1ZFNA 1L5HA 1VB5A 5M3BA 1XAGA 3O0DA 3WLTA 1H2XA 3MMSA 3PEFA 3RR2A 3JQ8A 3PSAA 4IFTA 5DP1A 3RUEA 1A3CA 4CGYA 2AQIA 1J9GA 1OBFO 3OCCA 3TJZA 3HZRA 3QPVA 3IAUA 5IJAA 1DRVA 3ANTA 1HUQA 3OIDA 1BWRA 1VSVA 2FPPB 1LQ2A 2EQBA 4BNVA 3E05A 3HCEA 1T1SA 4IWNA 5J5AA 1PK7A 5SZIA 1NFRA 3T4XA 5EZ5A 121PA 5JH7A 1QP0A 3RVLA 4DV2B 4Q7MB 4RIHA 2AC2A 2WAYA 3IIIA 3Q3EA 1RWNA 3N53A 5DM70 1X7WA 4BQOA 1AA6A 1JR3E 2NX2A 4IRMA 1GILA 1Y42X 2H1RA 2JLRA 3DMDA 1DIAA 2ZIWB 3JWJA 1GPH1 1VXRA 2UUOA 1EVJA 1D4OA 1Q91A 2CDCA 2VJCA 3E18A 4J0GA 4L15A 3S5JA 2JBHA 1UKEA 2Q4TA 2WJPA 3KHTA 1SCQA 4K7JA 3R75A 4DNQA 2I91A 3IUSA 4JXJA 4DIMA 4ZOLA 4D3ZA 5LWHA 1QSGA 2JI7A 1OROA 1TYAE 1WZCA 1WZ2A 1G5QA 4FW9A 5JWHA 1BZYA 3ZCVA 2QTZA 5DGIA 2Q6LA 3UC9A 3W9UA 4R6WA 4EPYA 2UYOA 1E3DA 5CUQA 3O3CA 5H02A 4BATA 4AUMA 5LNK6 1KQGA 1QF9A 3EMKA 1SG9A 3OU6A 4L0QA 1GP2A 4HLCA 3RVQA 1RLOA 1YOVA 1F2UB 3LG2A 4F4FA 3ZH9B 2O54A 2P3QA 2H52A 1Y8QB 1TYBE 1ZIDA 2VPWA 3QXXA 5F1KA 1REQB 1TL7C 2NU7B 3GA7A 1ZH8A 3F71A 1Q3TA 2O2HA 4L5JA 1O6CA 1XMXA 3H18A 1XV5A 3C48A 5DX1A 5AKKA 3B38A 4HRXA 4DV7B 1GY8A 4OG2A 2C7OA 3VNVA 5L4LA 3ITDA 1TCBA 1XMOB 4V2UA 4FC6A 5IS2A 1SUEA 2JIQA 3WIBA 3ZHQA 1ZD3A 3FF4A 4YMIA 2ZR7A 1FU8A 4C6RA 3VC7A 3H83A 5A4JA 4CKCB 2V0GA 5DNYB 5GVSA 4I66A 1K7EB 4MO2A 1AGRA 2BHTA 1XT6A 3IEUA 1ESDA 1VCOA 1E77A 3HG7A 3T15A 1N0VC 2VBFA 3UMBA 3STXA 2QLNA 1BHJA 3BEDA 4I4NA 4QFDA 1MOQA 1QFZA 4BVFA 2Q5EA 3T3EA 2CCGA 4HXGA 1DDIA 2OV4A 2QTBA 2A9VA 2GZ1A 3CZ5A 3P9ZA 5DFAA 5JVDB 2Q5JA 5EKUA 2ACKA 2O8BA 5DEIA 3SXUB 4BE7B 2HI0A 4J1QA 4LXUA 3K0CC 3AESA 4MW9A 4BRWA 2Z1MA 5EXTA 1E1QD 5I01A 3T06B 2DHDA 3FDZB 2H7YA 3B78A 1WLYA 3FUCA 1OZFA 1C9YA 5BV8A 4CEHB 3SDSA 2Q9BA 3OFVA 3VZBA 1L9KA 4OK6A 2AOUA 2R5NA 1EK0A 1HEYA 1G21B 2NOAA 3ELBA 2NQ8A 1WEHA 3TZKA 5C34B 3V46A 2UXBB 1GRNA 1Q57A 3OPNA 3IQIX 2EYQA 1U5CA 2IOFA 2M6RA 1J8DA 5CGZA 2RD2A 3GAAA 2COEA 1Q20A 3BH7A 3PC2A 1YNOA 2QVXX 3WRYC 2G77B 3D5TA 4ZC1A 1EE1A 1Y3BE 4DDMA 1QTRA 3RBAA 1FY2A 3H2JA 4YJ2A 2CL5A 4FJ0A 2C0PA 4IOMA 1RHQA 3PTZA 2CLLB 4MWBA 4P4LA 4UHBA 1QO0A 2OZLB 1DC3A 2G88A 3A1FA 1T8TA 4FYJA 2FOIA 4RH0A 3NDPA 2VHEA 5HXAA 2ZYGA 2E4UA 1PQUA 1YUMA 4H27A 1JIUA 4NECA 3O3MB 3OZXA 4LE2A 3VPHA 3OQBA 1FOEB 3NUGA 4OSPA 3U7FB 5CNMA 2KI5A 1KMMA 2NUBA 1QYWA 2YWDA 3OEWA 2DBYA 3VOSA 4WINA 5JXWA 1CDZA 3KOWA 4XM0A 3PNQA 2XUGA 2X8BA 1N2CA 3G1TA 4FB5A 5JWOA 2H06A 3BRSA 5C4MA 3G0BA 3V48A 2JIZA 1MOSA 2ZSKA 3STUA 1D5CA 3PGKA 4RVOA 5D1NA 4TTPA 1OFTA 1U99A 2JHFA 5C0OE 4O4LA 3KTOA 2B25A 2ODAA 2VSQA 4S05A 2G70A 1XKTA 3R5SA 1DEHA 4NCBA 4Z49A 2X2PA 3DBRA 4PXSA 4GX2A 4EATA 1NVFA 4Q1CA 1O6ZA 1V95A 2X19A 1K89A 3A9TA 4PBRA 4UASA 1DHRA 4QSHA 1FX0B 4CKXA 1KOFA 5I4IA 5L3QA 2PSDA 2CXTA 1KEUA 3GC6A 1OXKB 2OK8A 4UZEA 1NBAA 2HF8A 1UXKA 1TEHA 1HYBA 3MB8A 2H65A 4LUCA 1Z2PX 4UXIA 4D5EA 1VIDA 3MTAA 5FJIA 3HXMA 4X6LA 2UU9B 3ESAA 3FPEA 3OPQA 1J20A 5IYZA 3T38A 4YCSA 2WNSA 4M1WA 2QMHA 4UBLA 1G5RA 2ZBVA 2ZB3A 3EE6A 2XQVA 4KQXA 4EY6A 1T36A 4YDSA 2DULA 4AICA 1Z0IA 3M4YA 1V37A 3BB3A 4LRXA 2FK7A 5I51A 2IZ1A 5JLAA 3PPIA 3VJRA 3PFHA 2IIVA 4HJXA 4JXZA 1CV2A 1XZAA 2BMWA 2VUUA 5JS6A 3O4RA 4CU2A 4M88A 3RU2A 1C80A 1L8OA 1KP2A 3NOOA 3ODPA 1UQTA 1N0WA 2CD7A 3PNLA 5L51A 1G8KA 1B3RA 4G26A 1DTWB 1JJFA 3LL4A 3A6DA 4KACA 4LXHA 4E15A 4HNSA 1FDWA 2PD6A 1IATA 1KO1A 2ZRAA 5FULA 1A9XA 4YRRA 4RANA 2A1UA 1SY7A 2GTHA 4FS3A 2BKXA 2BW0A 1EJ0A 1HE1C 1JH8A 2G76A 2PKQP 2O3RA 2Q5IA 3H1PA 3AC0A 4JQOA 4NKRA 2GZ2A 3EXHB 4HX5A 3U19A 1DL5A 1V8FA 5BWBA 4NXMB 2H1HA 3TL6A 4W8GA 2O7RA 2YC2C 2YL2A 1CFJA 1ZUIA 5K3DA 5L9AA 2P1DA 3L7IA 4MQ5A 4IL5A 3Q7QA 2DQSA 3E7FA 1LRKA 3LHIA 3D3WA 5EXEA 4RK0A 1DMSA 2CE2X 1OMOA 1EINA 3AW8A 1RLTA 1MG0A 1ZVMA 3U7HB 1O03A 1ULZA 3H7IA 3X1MA 1PS0A 5CG2A 1KRXA 1E6WA 1PTKA 4LPKA 3X1KA 1C0IA 1CRLA 2IHUA 3HC7A 4R8LA 4IZIA 5JZ9A 1PL0A 2G17A 1OXMA 1UKCA 2R5WA 3N75A 1GO2A 3P9YA 4WLVA 3TRFA 4JENA 4ZKEA 5FUQA 2BKVA 4LIPD 4M1QA 3QPUA 1AG9A 4A36A 3IVXA 3WIEA 2TMDA 1JG4A 3WL4A 5JAIA 1R15A 3JZFA 1KE1A 3VOAA 1I4TD 2C2WA 1E2QA 1T2DA 3JW8A 1XZHA 1Q0QA 3OY7A 3RS2A 3W4IA 4CHGA 2HMYB 1JDBC 2BBWA 3I58A 3U62A 5FWDA 3C41J 2MSWA 2I7TA 3RS5A 3SBOA 1UJCA 4LOAA 1I94B 3BWBA 4WDRA 3WWPA 5LKRA 4ND7A 3E9CA 1PT6A 4LJRA 2O57A 3W8EA 1SRRA 1KKLA 4MV9A 4D3DA 4GMKA 2E4XA 2ZAIA 5JAUA 1ZSVA 4C3UA 2FEOA 1YVDA 2FX3A 2HBZA 4JYCA 3RF7A 5BOSA 4U2BA 2FEXA 4DWWA 5BNFA 4ZOLF 1UIRA 1CEQA 3VR6A 2WU4A 5BUCA 4MKHA 1B8NA 1SVKA 4UM5A 3T7KA 4DIBA 2P2NA 3KLMX 3QE0A 3VU9B 1YXMA 1XJQA 3W78A 1KYZA 4JC4A 5FL7A 5K0JA 3M4JA 3RK0A 3LGXA 4IFBA 3U0VA 2DLCX 1CUYA 5IDWA 1QO9A 1YR6A 2WSMA 3Q6NA 4X8MA 2F3UA 1B2LA 2J6CA 2I9PA 5EVJA 4EUNA 2AKYA 1IY2A 3RQIA 5F7JA 1VL6A 4KQ6A 3EGWA 2HZ7A 3FWZA 1IHUA 3F98A 3F9RA 4NNOA 5DYYA 1Z35A 3COVA 3R74A 2IOQA 2VQ3A 4BMZA 4D98A 5FX2A 1K9VF 2D7DA 4AIRA 1XVTA 2ZRLA 2DCUA 3ZNNA 3UZUA 3CH7A 4WN9B 3HCBA 4BP9A 3DMRA 4UTXA 4V0ME 5ALRA 3R6LA 2OBMA 1H3NA 2XI4A 1OT3A 1Z6GA 1CG6A 4F9EA 2D1QA 3THYB 2XY4A 3HCRA 5HE9A 1Z7YA 3OQJA 4G09A 4KGVA 1FTGA 3K1AB 4YMHA 3F3MA 4MTCA 3VYWA 4I1SA 4WN3A 1WCIA 2MSEB 1R6BX 2A9OA 1K6EA 2V7UA 3CEMA 3L05A 3PITA 1KR2A 1M8PA 2CNLA 3FCOA 1NYLA 3OVMA 4G0NA 3BGOS 3DL0A 5U4XA 2FWRA 5KVAA 3GROA 4X1YB 2A88A 2VSYA 2ZBUA 4FOOA 3FRIA 1GRCA 5LNK1 5IT9A 3KR9A 5BWCA 1BU8A 4Q34A 1R3DA 1E1LA 2JI6A 2UZ4A 1EKXA 1AKRA 1TPYA 3QVKA 5TMPA 5F5XA 5HIAA 1V2GA 4MLZA 1OIXA 2ZBPA 3D4NA 2RCYA 5DW3A 1A71A 3WB2A 1QRSA 2BLNA 4GI7A 3C7KA 3UQYS 1ZJJA 2EBUA 1KMHB 1LTKA 3JASA 1J23A 4ZVPA 5JZMA 4GI5A 4XD2A 1W0KA 2ODTX 2ZR8A 4G0PA 4O33A 4RWZA 3WMRA 4XIFA 3JV7A 4HZIA 1QPGA 2Z4TA 2Q3CA 4JBYA 4OI1A 3QE3A 1SCNE 4TT3D 4RLHA 1W19A 3JAKB 4C0KA 4S2EA 3EOAI 3GZJA 1MVLA 4L28A 4BO7A 2B4QA 2FSPA 1LBIA 2JVKA 1SBIA 3EVNA 3Q3GE 4R3UC 3UHOA 2JGEA 1FTNA 4ESOA 3KCNA 1MQSA 5DBIA 1FYXA 1SHZA 1NQWA 2JARA 4FQ8A 1BU5A 4Q03A 2BCGY 2J48A 3AUKA 1AKNA 1HFJA 5CGQB 3DWFA 2FPKA 2X13A 3QHQA 4YJ2F 2ZRHA 5T3YA 4AULA 3T1YB 5ALJA 4KR0A 4B6FA 1Y5RA 1V47A 4F8JA 1AKUA 1MXFA 1DKLA 1YJQA 4L9WA 4LQCA 4JYAB 3JQ9A 4GOJA 4HXYA 2AFHE 1CR6A 4WI1A 4BU1A 4DMLA 5AM0A 1ML3A 1NJ8A 2G0AA 2BTOA 4PO1A 5J1SB 3ZJYA 1NZFA 1WUYA 2I3AA 5CA0A 5ES4B 4XR4A 1ZD4A 1B76A 2PIAA 3HUFA 3G2OA 3R77A 4TXMA 3C7TA 5EPUA 5AFSA 1YAJA 1ICIA 3TOCA 3VAAA 2CVPA 4RKRA 3FNGA 2FXIA 4RSHA 4ZXFA 1CUBA 2W8BB 1V7CA 5FEUA 5GPBA 3CX6A 5LQMA 3SKYA 4U9IS 1V8ZA 1GD1O 1X2BA 3TTVA 5FV7A 1VPTA 3BTOA 4NPAA 3NWBA 5CBKA 1HFWA 3R44A 4OGKA 4R83A 2IU4A 4GBGA 3FOCA 2INGX 2C20A 2ZI9A 4HH4A 5F1PA 3ZDAA 4Q9HA 3OCYA 2R44A 4FEAA 2ZWVA 1KBQA 1O6BA 2JFNA 3OMLA 3WRXC 3O7MA 4G4SP 1C9EA 1WP9A 3CLTD 2VDJA 3I42A 3P9CA 3PFCA 4CQLB 5CA1B 4MVJI 1FNBA 2GVNA 2QU7A 3KOMA 1LTQA 2VCYA 5JCJA 3EDCA 3SR0A 2W11A 1RQGA 1GRVA 2B94A 3ESBA 4G1MB 1BMFA 4XVRA 1T8WA 2V03A 1RI5A 3DAYA 5HCUA 2OPHA 4UE3S 4NEGA 4YPVA 2Q21A 2YHBA 1SWWA 1TIKA 4AYWA 4QECA 3ZX4A 4PVDA 2K87A 2Q7DA 5FBHA 3V00A 4FTWA 4V0QA 1QP4A 2WHXA 1XA4A 3OU7A 4OHMA 2XUIA 3AF3A 3H0EA 3KUCA 1S2LA 4TTJA 1CUWA 1QIHA 4PCVA 2OP1A 3JX9A 3WOVA 5ARBA 2GCEA 2X5JO 2VSFA 1N2EA 4U6QA 3PE6A 2A5YB 2F17A 3ZQ6A 2P2CA 5DXJA 2M9MA 3KOYA 2D5BA 3T5DA 3GQBB 3H2ZA 2GTIA 5HUQA 2VA9A 1DJPA 3GJZA 5SICE 1PKXA 1SBTA 1XXLA 2FKNA 4TTAA 3RBZA 1JLSA 3RTGA 4E4TA 4K2HA 3HL4A 4PS1A 2IUUA 1GNTA 1EM8A 1A8HA 4WNAB 4FKMA 3G17A 4TKMA 3UOWA 4QU9A 2WIGA 3WWDA 2CBGA 5SY6A 3S8YA 1Y8RB 3QENA 1V5EA 2ZRBA 3H5NA 1S1CA 4K87A 4PRLA 3OFSA 2OKCA 1OLSA 2XBLA 4CL8A 4P0PB 1UBJS 2E1PA 4RPJA 3KB6A 1YS1X 4H08A 3UMGA 1EXVA 5ALHA 1K06A 2R60A 2YWBA 2V5UA 3DFIA 2AHRA 1E9BA 1LW6E 3EPRA 1CRPA 2A59A 2AKAB 5JT1A 1TVKB 2AVDA 1B0PA 2EJWA 5B1SA 4F4IA 3DJYA 1VL0A 5JATA 4JU8A 2C84A 3BILA 3LK6A 4FI3F 2GBIA 3DWIA 5KQPA 1SXJB 5FRDA 3VVBA 3LXUX 3F97A 5H70A 2XCTB 1WPRA 4YUZA 4JJKA 2X41A 2YW2A 3JQAB 2MHCA 4GI1A 3SICE 2HJ9A 4QO7A 4EG7A 3FNBA 1U3DA 4KPUB 4X20B 4R1TA 2RJ3A 3JQFA 2ZRGA 3E03A 4KW7A 4BWVA 2AEJA 3QIVA 4JR0A 1XNRB 4F3KA 2EJUA 5K99A 4WXHA 4IRUB 3O47A 4IEEA 4CQMA 4O3MA 5LUAA 4BLUA 4NBNA 3E70C 3SHOA 4PNPA 5KWJA 1K5GA 2RB4A 1QZXA 1F4LA 2B2NA 3F2VA 4RV4A 1ENZA 1PUJA 3AEZA 4P58A 1EFKA 1FFXB 5AVWA 5AOAA 1M2FA 1QM5A 4IFIA 1WULS 3NEAA 4MVXA 4F2DA 2XUDA 4KFTA 1QFJA 4EFKA 4R2JA 1XQ9A 1C4WA 1XELA 3ORRA 1RXYA 3N76A 4DG9A 4QIHA 3THXA 1KZ6A 4ITUA 2VHVA 4CM8B 1QWSA 1L4UA 1R8YA 4M86A 4NICA 1O0BA 3C0KA 1DWQA 4QYSA 3BBLA 4LYHA 4IDCA 3M6FA 2DR2A 4RTPA 1VSUA 2CZQA 5JXGA 1UXOA 2XRYA 2IOHA 3TNFA 4CHTA 2PZMA 4DLXA 1BA2A 2PT6A 2ADMA 3UXYA 3VR5D 1QG2A 2BGTA 5E9WA 1P31A 1NI4A 2O2IA 2QMQA 3QMWA 2QSJA 1TQDA 2ZJ3A 1KI6B 2E48A 1HOTA