2WWGA

Plasmodium falciparum thymidylate kinase in complex with dgmp and adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
TDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords THYMIDILATE KINASE, PUTATIVE
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwgA00
5CK5A 2H17A 1XXHA 3PVSA 1NN1A 3GLHA 1W0KD 4AD8A 2GRJA 4OYHA 2N46A 4EPYA 1DARA 2W2TA 4TLBA 5B64A 3L43A 3ZZ0A 5JMTA 3NDPA 3ND9A 5DI3B 3OAAD 1OFTA 2DHRA 2VPPA 2XB4A 4GZMA 4AG5A 3K0AB 2EYUA 2QBYA 3GLFE 2OBMA 2CCJA 5GJVC 5EP1A 3NC0C 1L4YA 1SULA 5E95A 2CLDX 3GEEA 1R0WA 4C7OA 4TLEA 2OILA 4JLBA 3V4FA 2GXQA 1U8AA 2Z4RA 2F9LA 1MRSA 3BD9A 3PCRB 3K0CC 3ADCA 3AV0B 2QTVB 3BFXA 3GJ7A 1OXVA 1XEXB 3EXAA 1N0VC 1X8JA 1XZPA 1G18A 4KFSA 2WJYA 2C95A 1QVAA 3ND8A 3ZIAA 1L2TA 3A4MA 3AVTA 2J7KA 3E2IA 2QMOA 2W83A 3MMPA 4CRWB 1S1CA 3LQRA 3RHFA 4LPSA 4QC2A 2R6AA 2UZIR 1O3YA 2ZROA 1CTQA 1OIWA 1Z0FA 4IOMA 3RS4A 1OFUX 4F4CA 3GFTA 4M9QA 1FMJA 4LBZA 2XEXA 4BASA 5AJZA 2EWVA 5IT5A 2GVDC 2REXB 1DAHA 4EAQA 2F43B 4OI0A 3QJYA 4GOKA 3FFAA 2QP9X 2P67A 2A30A 4UNQA 1E2IA 2JJ2A 5EJEA 3DMNA 4C3ZA 1E79D 1OT3A 2QE7A 4GBMA 2CCGA 4IDHA 1CRQA 1R5OA 3C7KA 3M4YA 2AFIE 5DH9A 2I4IA 4Q21A 1KAGA 2ERYA 1NMZA 2NO1A 2RGNC 3KB2A 5FBWB 1RVDA 4P31A 2OFXA 2ZYUX 1SXJD 2ZVPX 2Q9AA 3MJHA 2F55A 3PFIA 1IXZA 1ZM3A 4JZKA 4WA7A 1P73A 5DISB 3N5CA 5H1YA 1OXTA 4N0EA 1VCNA 4TYQA 1BIFA 1H8EA 1HURA 2D62A 5B30A 3O8BA 4OHZA 4JT2A 1IJFA 1IN4A 3AP1A 4RFSB 4TQ9A 1G20E 3AM1A 2HLDD 2CJWB 3DOFA 2FU5C 2HJVA 2ZJ2A 1G4UR 4L5BA 2PLFA 4PPQA 4BFXA 2YC2C 1XD8A 2PBRA 1E9SA 1KMHB 3I73A 4HLQB 4WZ6A 521PA 1JECA 5KSZA 4UNSA 3WHKA 4KO8A 3TH5A 1S2MA 2AX4A 2HCBA 1E4YA 1KZGB 1G8FA 4LDJA 5J40A 4C30A 2YINC 3CO5A 2QBYB 4TYWA 2QGNA 1NVWQ 1P2VA 3B5JA 3PEUA 2CHVA 1OIVA 2G0NA 4G5RA 3LBIA 3OEED 4MUBA 4KYIB 3W90A 3GFPA 4PR0A 5EXTA 2QSYA 1E2FA 4QJ5A 2XX3A 4ZDWA 2WSMA 3VNVA 4GT1A 2RGEA 4WVFA 4RSGA 3W5JA 1JQLB 4HAUA 4B2PA 2ODWA 4PSKA 4Q4JA 3WP1B 1FNNA 1E0JA 1NBMD 4PHGA 2OCYC 4A8JA 621PA 4Z8XA 3F5FA 1NG1A 2H7VA 1BOFA 2KE5A 3ZQJA 1CR0A 2ZRCA 1RPZA 2O5VA 4NMMA 2ZRFA 4LBWA 4LC0A 3VU9A 5L3SA 3BFKA 3U7FB 3QI2A 3I72A 2B8WA 1G7SA 1GOTA 2YKGA 2QU8A 1KK0A 1Z08A 3MAAC 4P0TA 2ZI7A 2F6RA 1LS1A 1VKJA 4EPTA 3A58B 4BLSA 5BN5A 4PAOA 5AUNB 4M1TA 2YYZA 3VR3A 3OHMA 1ZC4A 1VG1A 3NXSA 1TUEA 5KHOC 1NVVR 3KB1A 3GD7A 3K70B 1EX6A 4UXHA 1DAMA 1VCOA 5JRJA 3LA6A 3GJ3A 3TUIC 1SGWA 2HYDA 5KSPA 1GAJA 2C78A 2R62A 2C9OA 3LLMA 4JKYA 2WWIA 3BB4A 1YQTA 4OQFA 4DSNA 2NQ2C 4HUTA 2BBTA 1XTIA 2HT1A 4JL8A 2EW1A 1Z0IA 3D31A 3EIQA 2ANCA 1COWD 4RY2A 1OFIA 2C98A 4O3MA 1Z47A 2IF2A 2QAGA 4GZLA 3W3ZB 1RIFA 2EFHB 2IUSA 2Z5FA 3KQLA 1GDDA 5D3MA 3VKWA 5J4HA 2QAGC 4Q48A 4WOPA 1SVOA 2RHMA 2VSOA 5CB6A 3TW8B 2Q0HA 2DFTA 1JR3A 1NRJB 3OIYA 3FDIA 1LS6A 3U3MA 4BEBA 3I1FA 4Q5IA 5CDFE 1XEWY 2YOHA 2FN4A 5D3QA 5UKDA 1ZCAA 3FKSD 2UKDA 3VR5A 1F2TA 2X77A 4JYCA 4CVNA 5HZHA 5FR1A 2VHQA 4YMVA 3BERA 4LJ7A 4BWYA 4WBSA 4ZCLA 5BXQC 1OXXK 5J5CA 2WWWA 4JBYA 3FPAA 2W2XA 2JLYA 2O8FB 3K8YA 2FGJA 2AKYA 3U3OA 1DAKA 4C4PA 4NDZA 5B57C 2SHKA 2GESA 4MGKR 3U3JA 1OH7A 4RD0A 3THYB 1XCPA 1TMKA 2C04A 1KNQA 3LY5A 4O0MA 2RHDA 4RZUA 5EZ6B 2MSDB 2V54A 3TAUA 4XTRA 4IVPA 3X1WA 3KTAA 1KDPA 2WWGA 2VHCA 2YWGA 2HYIC 2BMEA 2DWOA 2XOKD 2GK6A 5L3RA 4JLJA 2R6GA 4TWZA 1I2DA 4AURA 4QHYA 4BUJA 4I4LA 1NMYA 2JIZA 1HTWA 4DDUA 2KJQA 1EFHA 4EQ6A 2O8BA 2HV8A 3QKRB 2BVNA 1G5PA 4B43A 5KPJA 5F2EA 4JMPA 5AJXA 5FUXA 3GP8A 4LY6A 4OHWA 4QGFA 5TV2A 3I5YA 2CBZA 1C9KA 3SYKA 1B0UA 4S35A 2J0UB 3R7WA 1EFCA 4B48A 4AKHA 4DDTA 2PZEA 4AY2A 3CW2A 3KQHA 4NCHA 3ADDA 3VHXA 5HE8A 4BEJA 3EAQA 1SHZA 2HUPA 3CWZA 1AA9A 2C9YA 1GUAA 2BMJA 3L8YA 5A4JA 3QBTA 2MMCA 3REGA 3SJAA 4DCUA 4L9WA 4XSHA 3DL0A 3LV8A 1EFTA 2EQBA 3B1WA 4CW7A 1ANKA 1AJEA 4F7WA 4PC1A 4JVSB 3CKLA 1QHYA 2R6DA 2BOVA 1DS6A 3SFZA 2PT7A 2A5JA 3GEHA 3EPJA 2QI9C 5EXXA 1KAOA 2QQEA 4UXJA 1G7TA 3CF2A 4HLUA 3QF4B 4B3BA 2WWYA 1S96A 3EZ7A 3B60A 1XF9A 3AKDA 1GZSA 4HATA 3CF0A 4CEIB 3AVWA 2FF7A 2JJ8A 3IILA 4QBIA 1T8UA 3TRFA 4EPRA 2QGZA 3FMOB 1I4TD 1SKQA 2OE2A 2OSBA 1J70A 2HF8A 2W2VA 2ATXA 4MRPA 1J99A 2ZRDA 5EQTA 4M4SA 1MO4A 2J9RA 2I1QA 4M1WA 4PQRA 4Q01A 2ZJZA 4B6FA 5TDHA 1JXOA 1IN7A 4D4JA 3AH8A 4QHTA 1PLJA 2GCNA 4DBLC 1NMXA 4K46A 4QGHA 4QJ4A 4NYMQ 1IONA 2FA9A 1CBUA 1SVMA 1PLKA 2ZRAA 5C4MA 2JLXA 2FH5B 4R7ZA 2GDJA 3T5GA 4H1UA 2QRNA 4PHTA 4NP6A 4CGZA 1NVVQ 3K53A 3RDPA 5LB4A 2ANBA 4ACBA 4AWXA 1KI9A 1P7CA 3SDZA 2G1JA 4OK5A 2OAQ1 2YVUA 1OSNA 4RZXA 2ZS9A 5E4FA 1D5CA 3FE2A 4NCKA 4EJSA 3U44A 2OCBA 4PXAA 3MJRA 5J4VA 4KXFB 1XXHE 3U7EB 1DEKA 3B1YA 1CXZA 3LXRA 5GJWC 5FOWA 4DLZA 2GZDA 2F43A 3HWSA 1ZD1A 5FBRB 3C15C 2FFBA 4BFYA 6Q21A 2A5DA 4LJ8A 3WXMA 2GEDA 2QN6A 3N2EA 1AGRA 1HYQA 3K9GA 3B6EA 1GIAA 5FTNA 4CT4B 1IY2A 4AKGA 2G77B 3QPUA 1S0UA 2VP5A 1A2KC 4ASUA 5KOYA 1I2MA 5BW8A 5E7MA 4E09A 4O2RA 2QPAA 1TAGA 1NLZA 1LF5A 2IF0A 1FOEB 5BQ5A 2KI5A 3HU1A 5FI1B 4LV5B 3AVUA 3K0SA 2BBSA 2J87A 1NVUQ 4V02A 2P6NA 2RCNA 1YR6A 4UNRA 2VP2A 4D81A 2ZSDA 3WMGA 4ZKEA 2CVFA 3Q5EA 3T35A 2GJKA 5JCPA 1RZ3A 1F60A 1WXQA 4DDVA 3OEHD 3X1ZA 2CXXA 1MABA 2ODBA 1QHGA 4DCTA 3EPHA 1IN5A 1KKLA 3NTUA 1Q1BA 4JL6A 1VG9B 3CM0A 3PG5A 4JL5A 4HZUA 4Q9JA 1DAEA 1LW7A 3WRYC 3TSOA 4I1UA 2ZREA 5AJWA 1Q1QA 1QHXA 2AR7A 1NSTA 4M9SA 2R9VA 2KWIA 2EWWA 2JLQA 5E3HA 2XGJA 1H8ED 1WA5A 4HAXA 4D0LB 2ZI6A 4ZDIA 2ORIA 4G5OA 3OIUA 4A1FA 4ACAA 1GL7A 1W4BA 4HEJA 3WYGA 1Z6YA 3FMIA 2GETA 3MG9A 2O52A 2ZUCA 4M1OA 4NL4H 4AK9A 4EPXA 3GCGA 2R2AA 4ZPXA 4B32A 3C4JA 3KKPA 4B2LA 1D2EA 1N5JA 3CPHA 4YMSA 1TF5A 3A1WA 1G19A 1ZNZA 5DYIA 3SJCA 3EW9A 2ODNA 4ON9A 2XTZA 4TMVA 1M74A 3QKRA 1N2CE 2WIAA 4B3FX 3CX6A 1W0KA 2VLIA 3AP3A 3SJZA 2IT1A 2IWRA 3THWA 1PJRA 1XP8A 4DKXA 2O8DB 2VH5R 3VR2A 3L8ZA 1ZM7A 3SC3A 1Z3IX 4FN5A 5B58C 1QG4A 3ZS8A 3AVOA 4Q19A 4DSUA 2C99A 3TBKA 1IAQA 1BYUA 5K8TA 5FPTA 1YJ5A 1G6OA 1ZINA 3QBVA 4IFEA 4WAUA 2IL1A 4HDOB 4IXNA 3I62A 4JT4A 2ZETA 2VEDA 1JI0A 4W9MC 3U6BA 3A8TA 3CF6R 1VCMA 4R71A 5JJKA 5JWRA 4M53A 4KJZA 1XPOA 4PC6A 3B9QA 1SVLA 2YWFA 4JS0A 1N6RA 4UXIA 5JJLA 3NVAA 3GJ6A 5CK4A 3EWSA 1S9DA 3CR8A 4KSCA 5DYGA 4V03A 4RFSA 2ZRJA 1GTVA 5GADl 3H84A 4AYXA 2W0MA 5IHPA 4BLRA 3QXSA 2MSEB 2WWXA 4LUCA 2JATA 1E9RA 1AGPA 2VL7A 4JVMA 1D9ZA 4A36A 2P3SA 5FUVA 2WMOB 2XSZA 2ZXUA 4MRNA 1N5LA 2VP6A 4RD2A 5FOVA 2XJ9A 5JCZA 1VIYA 1GKUB 1TUIA 3CRMA 1FTNA 3CONA 4TLAA 1HV8A 4PHFA 3V4RA 5SZIA 3N70A 1U9IA 2JJ2D 4DB2A 1M7BA 3S1AB 2XNSA 2FZ4A 4FIDA 1G3IA 2B8TA 1FP7A 2OM2A 2Q21A 3GMTA 3IO5A 4JLNA 4QBGB 3GLGE 1DPFA 1E4VA 2PX0A 2WOJA 2ZEJA 1J8YF 1W0JD 3QKSA 4DJTA 4PZLA 2BJWA 2IXGA 4CYMA 3T1OA 3NBYC 4PPGA 5HCNA 1W4CA 2ZRNA 5FI0B 2GBLC 3WYFA 1TU3A 5FOUA 3ADKA 1COWA 4ZI2A 1OPXA 4LX0A 4ITRC 1GSIA 2IS1A 1DAIA 1UKEA 2QTFA 3ECCA 3KKOA 3KX2A 3NBFA 5CM8B 1XU4A 3VAAA 1E0AA 1SZPA 4XWAA 5DN6A 4GPTA 2V1UA 1W44A 2D7CA 1KKMA 2PCJA 1QHIA 4LHWA 4LV8B 4U7DA 1Q44A 2E87A 1CIPA 1P61B 3OESA 2B7BA 1JEDA 1A2BA 3TIFA 3LXXA 4QJ3A 1Z29A 4HAVA 4QOSA 3L0SA 4BZXA 4Q9KA 1OH8A 3B7GA 3MUFA 2PZFA 1FNMA 1NJFA 3HYTA 1E9FA 1OE0A 1T6NA 2VHJA 3QE0A 4DXAA 1GKYA 4W7SA 1UEJA 5LPNA 2V3CC 4GP7A 2GXAA 3X2SA 4Q1AA 2CJWA 3CRQA 2JEOA 2EFDB 1WDTA 1RYHA 4M9XA 2JIZD 2CLSA 3RYTC 3P26A 2FNAA 4Q9LA 4XWOA 3EC1A 1T5IA 1VYUA 4QM7A 4FCWA 3PUYA 1E3MA 1HEIA 1NKTA 1ZNWA 1Z8FA 3N2IA 4XD7A 1QRAA 1YZNA 4RD3A 4A2WA 1XD9A 3KQUA 1UAAA 4MKHA 2P5SA 1QHNA 3HJNA 1JAHA 3CRW1 4WZBE 1A82A 2J3EA 3LVQE 1D8TA 2BEKA 4G3XA 2IUUA 5C4GB 1E0SA 1KO8A 2FFAA 3CR7A 2ZRLA 2WHXA 3KDSE 3CIOA 3DVLA 3NDBB 1ZM9A 3OIVA 4PO8A 2QT0A 3TVTA 2DBYA 2ZJAA 1VG8A 4BGDA 2XITA 4BPBA 2FJUA 3BH7A 4TL8A 3AF2A 4DZZA 4XVQA 3MRSA 5E7IA 2GJ9A 3LWNA 4G5QA 1KDOA 1YZLA 4PX9A 1W5TA 1R4AA 2K5UA 2JJ1D 1QHHB 3RANA 1II8A 2ERXA 3FHOA 2QA5A 3VR6A 5DLQC 2ZE6A 4LV6A 3W9YA 3PR1A 3BIFA 3IUYA 2JLZA 3AVVA 3CNLA 4HB4A 4LOAA 1O87A 1QF9A 1N3BA 4TT3D 4A9AA 1IXRC 5EE5B 5EP2A 3VQTA 1E2PA 2DPXA 3ZS9A 1WMSA 1E96A 1FUKA 4OK3A 3C8UA 4KFRA 3OF5A 3EZ2A 3KUDA 2Q3HA 2VA8A 1ZU4A 2O8EB 1X6VA 2V9PA 2Z0MA 3CWQA 1W2HA 3LDAA 4YDHB 3A6PC 3SOPA 2J1LA 1ZP6A 2FSHA 4TMWA 2AWOA 3FKQA 4A8JC 4MH0R 3MLEA 4DLYA 5JWOA 5K8IA 3ZIAD 3OZXA 3K0AA 3CNOA 4D0GA 1W49A 2V8OA 1KI1A 1Q1EA 2BV3A 5JSZB 1HT1E 2BEJA 2HCJB 4KLZA 3ZVLA 3LVRE 3RNLA 1AS0A 1Z0KA 2CVHA 3Q8XB 1CULC 1VIAA 2VHUA 3K0FA 4JYBA 5CM9C 2F1RA 1X3SA 1G64A 4GFDA 3B2EA 5KTYA 4F91B 1M6NA 1E9CA 4LZZA 4TMTA 4WZAE 5TARA 4B6EA 3A1SA 1T5LA 1RJ9B 1L4UA 2JLUA 1Z22A 4NBSA 2OFWA 2WOOA 1F2UB 3T12A 2IYYA 4BLQA 3EWAA 5JSZA 1ETUA 1DAFA 2X1VA 4NTZA 5KNDA 3TSZA 1HE1C 3QIAA 1JPNA 1OHHA 4Q9HA 5HE9A 3H1TA 2R6FA 3U7GA 4X8OA 3WBJA 4B75A 4R98A 3H86A 4B3CA 1JBKA 4HAWA 1J90A 1S8FA 2GZAA 1GNPA 4LHVA 2J7PD 4US2R 1B23P 4R9UC 1SXJA 1DOAA 2QAGB 2FPMA 2QY9A 3BS4A 1FX0A 4UNNA 4A0RA 4QXAA 4Q1CA 2WJVA 3K9NA 4I1SA 3ICQB 1ESMA 1ZUIA 3GPLA 4FCVA 4XSGA 2ZU6A 4LHYA 4ESVA 2GTPA 4YDSA 2VYFA 2V6JA 5J4YA 2HLDA 3IO3A 3DO6A 4HZUB 1I4LD 3KTAB 3BFVA 4B44A 1Z28A 3KZ1E 3VNUA 4JVLA 3PEYA 3ADBA 3LH5A 3NH6A 1QHHA 5DSZA 3RRYA 4BLOA 4NE2A 4FD2A 1DG1G 2NGRA 1P4SA 1P2UA 2VSFA 3AKYA 2CHGA 2NG1A 1T8TA 3EARA 3HDTA 1UJ2A 3ONWA 2YOFA 3AP2A 2REBA 1OW3B 5CLQA 1T0JB 3Q9LA 4KODA 1KMHA 3A4LA 4MKGA 3U4QB 1MT0A 4LI0A 2I1VB 2VP0A 4TQAA 5FPSA 1WQ1R 4IHQA 4DCVA 1G9XA 5DIFA 3RS5A 4IOJA 2QENA 4LYFA 1JXMA 4TLDA 2FPKA 1G4AE 1NBMA 1N0UA 1MV5A 4OHYA 1PUJA 1OB5A 4LWZA 4RVCA 4HYYA 4OBEA 4D4MA 1M7HA 4KYUA 2J41A 5F3WB 4EFMA 4YMWA 3B82A 1KK3A 4CEIA 4C0AC 1SKYB 3WMEA 3GFOA 2OLJA 5JI2E 1TF2A 4DEXA 3UWKA 1XTRA 1V43A 3TK1A 5CITA 5KNCA 2FE4A 2IS2A 3LAWA 3SEAA 1PVOA 2CDNA 1XTQA 1GITA 1AKYA 2A5GA 4TTRA 4JJKA 1FUUA 4PC7A 2QAJA 1KNXA 3NKVA 1G8HA 4QBFA 3CUEF 1KO7A 1E99A 1E98A 4F38A 1Z2AA 4L16A 3QNUA 4IEEA 3VR4A 4PHHA 2Q3MA 3GJ5A 3PUXA 5FBVB 4US1R 2HT6A 1UPTA 4I1VA 3ZGXA 1CKEA 1P2SA 4IXMA 2QMHA 2ZYTX 1JPJA 1HE8B 4LHXA 1QZXA 2V1XA 2OBNA 3GQBA 1KK1A 2CE7A 1Z06A 5JS8A 3OE7A 5EUQB 2XB2A 3EA5A 2NPIA 3SYLA 2J46A 3H2YA 4D6PA 1XBTA 1XMVA 4BZQA 2H8KA 2ONKA 4A82A 2IXEA 4FXPA 4XWKA 4HI0E 2QM8A 2VP9A 5EE1A 4URVR 2EFGA 2KBFA 4NPHA 1AKEA 2W6ID 2BCGY 1I4DD 3T1QA 2I3BA 3PUVA 4LRWA 2LCFA 1ZJ6A 2BMDA 3S1AA 1SXJE 5F9HA 2BBOA 1H65A 3UKDA 2F1JA 5A5GA 1IHUA 2W6JA 1K5DA 2IS4A 4PAMA 5C1BA 2IXFA 1NVXQ 3Q5DA 3R20A 4PSAA 4Q7LA 4ASUD 4F4JA 5KSOA 2ZVQX 5JEEA 1Q1ZA 1L7VC 4LJAA 2PMDA 2IW3A 3L2OB 3B13B 3FHTA 4JLDA 1S3SA 1SHKA 1EGAA 2V55B 3IPYA 4A2PA 1TX4B 1R8SA 2ZE7A 4A4DA 1BMFA 1YR7A 2XSZD 5FL3A 1SXJC 4A6PA 4IJMA 3KQNA 4AYWA 4MGZR 1XFAA 3BOSA 5KYKA 2FEOA 4B47A 2ZM5A 3BH6A 3FOZA 1E1QA 1XCMA 2ZRBA 3TE6A 1IJEA 1KGDA 1UBGA 5L8VA 4Q66C 1F2TB 2WKQA 3SS8A 4DIDA 3ZD6A 4A2QA 4Z1MA 2AXPA 3D8BA 4BFTA 5IK2A 4JSTA 3RAPR 5G40A 1J8MF 3LX8A 4DLSA 4QNMA 3VTKA 2DFLA 2BM1A 4C0KA 1W0JA 1E2DA 3QEOA 4BFUA 2BMFA 3IKJA 2IYSA 3KJGA 3SHFA 1TEVA 1EESA 3QF4A 1NP6A 2GCPA 4D4KA 2GILA 4RKFA 5CJPA 1XXHB 1LVGA 2J0UA 1J7KA 1JJVA 3R7WB 4M9ZA 4W5HA 3DEFA 3DZDA 5KDLA 4GMDA 2RAPA 3RVBA 3LX5A 3DMDA 5JRZA 2V7QD 3I8SA 2FX3A 1VYVA 1GRNA 3GLFA 3QKSB 2PMKA 2G83A 4KI0A 5JECA 2PCLA 3UG7A 3Q72A 2O8CB 4MRRA 5H68A 3R8CA 3VX3A 1G3QA 1IN8A 1SXJB 4M22A 1OV4A 1K6MA 1T0HB 2G88A 1E6CA 2G3YA 3LLUA 4POAA 4C0SA 1H8HD 4CEHA 2JASA 1QHSA 4JLAA 1E2JA 2XNDA 1IOZA 2IYUA 3A1UA 4UQOA 2P6UA 3RC8A 1UM8A 4L9SA 2YC4C 2AKAB 2W00A 2OT3B 3IEUA 3BBPA 2JDIA 3AF1A 2EYQA 4YMUA 1KJWA 1Z83A 3VMFA 2A78A 1SVSA 4PC2A 2NOAA 3RSOA 3R9IA 5DI9A 1CS4C 3IBGA 2HF9A 5FL7D 1P9WA 4EQ6B 1DVRA 4RCYA 1S4QA 8OHMA 2AK2A 5BYJA 1U94A 1TADA 1KSJA 1WF3A 2AFHE 4C7OB 1G7RA 2PL3A 1XB2A 2LKDA 1KY2A 1Z0DA 4RFVA 3MWKA 5JHHB 4XH9B 4EPWA 1NJGA 4MDEA 3ZQ6A 3U6KA 4XTCS 3EIHA 3PV0A 4QG7A 1S9HA 4TL9A 3QG1A 1XWIA 2ZI9A 3X1YA 1WB9A 1F2UA 5BN4A 1Q57A 1A7JA 4WXRA 1BS1A 3UMRA 5G41A 2VF8A 1JNYA 1N5KA 2OAP1 5LD2B 3ASZA 4HZIA 3AF3A 3AKCA 5E7JA 4M1SA 3UIEA 4US0R 3UANA 5L3VA 1A5TA 3T34A 2YHSA 2ZPTX 2F3TA 1W7AA 1JB1A 1R8QA 4A0GA 4URWR 3QPWA 1LFDB 1OFHA 1EFUA 5AUPB 2ONJA 2GJ8A 1KZ7B 2IYLD 4LBYA 1ZAKA 3V9PA 5JLJA 3AVQA 4D4LA 4QL3A 3QXHA 4GMXA 4W5JA 5D3MB 2O8CA 5IDVA 3HR7A 2F1IA 4NKRA 2UVQA 1W36C 1X8LA 3QUSA 4BE7B 4XJXA 1AZSC 2REOA 3OFND 3TQFA 4PPNA 4DDWA 1XDBA 5AJYA 3RWMB 4EJSB 3U44B 3IDQA 2PX3A 4TTPA 1YKSA 4CT5A 2EFEB 4LJYA 4Q00A 2N42A 2R6CA 2CHQA 1N6IA 3L0IB 1ZIOA 3KFXA 4FWTA 5FL7A 3P32A 4FMDB 1TQ4A 1ZBDA 4KBGA 4XOIA 1WBDA 2GAOA 1E2LA 4ZO4A 1N25A 4IFBA 2IEYA 3A1VA 4M2LA 2J5XA 2WJJA 3ZYCA 3G0HA 2IYVA 3CX7A 3PXGA 1LF0A 2A2ZA 5SZKB 1XPRA 2XXAA 2FFHA 2EU8A 1N5IA 1KSHA 1EX7A 3W5IA 4MITA 4NYJQ 4E5UA 4P3YA 1HA3A 1KJYA 4E07A 1G6HA 4EFNA 1TU4A 4LBVA 1XEXA 4NYMR 4S2EA 4IRUB 4QNRA 2D7DA 3G82C 1AQYA 3LNCA 1TNDA 1RC8A 1Q20A 2IC5A 2XTMA 4KFUA 4AIIA 1L8QA 1II0A 1P2TA 1LV7A 2WJIA 3MGCA 4RZ2A 3AF0A 4XD7D 5FR2A 4DIEA 1EWRA 1VDZA 2XZPA 5CB8A 1VECA 4B35A 3SZRA 2FZLA 4B34A 5P21A 1R2QA 3RS3A 2WJHA 2ZI3A 1KTVA 4DLVA 2LWIA 2GCOA 1KSGA 3U3KA 2IX3A 1G8YA 2ORVA 3HR8A 2ZRHA 3NWJA 1US8B 1E2HA 4HB2A 4RKEA 3UMFA 4JLPA 2W58A 4GL2A 5LDDC 2ZS7A 4LPKA 3CNNA 2QE7D 1UFQA 1G21E 4FWIB 2QTHA 3B85A 4U02A 4AI6A 5J4KA 2ASEA 2QP4A 3ZVRA 2X8AA 5KDDA 3X1DA 4ESHA 3W6PA 2P6RA 2GEVA 3FKSA 1W1WA 1AIPA 1NG9A 2QORA 3PENA 3MWYW 3E70C 1FQKA 1KI3A 2JJ1A 4KCGA 2BKEA 2WBLC 1W47A 2WMNB 3LRPA 5EXPA 1UF9A 2RGXA 3VHLB 1LNZA 4TYYA 3AQ4A 1G3MA 3P4XA 2GAAA 3GJ8A 5FUYA 3ETLA 3K0EA 1PLLA 2DY1A 3QXJA 4Q7JB 3QPVA 4P33A 4TT3A 1XJ0A 2D06A 4LC1A 1NF3A 5DGXA 1XX6A 4HB3A 4P4UA 4M21A 5FBQB 3DDCA 3FFBA 2Z6VA 4JLOA 2GNOA 2OO7A 2YOGA 4LJ9A 2OHFA 2OXRA 5AUOB 3GLFB 3DKPA 3I32A 2ZU0C 3RS0A 3IEVA 3WNCA 5FTMA 4CEJB 1GP2A 4FI3C 3CRVA 4NZYA 1KO1A 2BJVA 2GBLA 2XOKA 1P9RA 1D6JA 5EP3A 3CX8A 3R8FA 5FTJA 4YXWD 4C0HA 4N0DA 4ZI3A 5FPKA 3PJRA 1ESNA 1TPZA 2R8RA 2ZJ5A 3OEEA 1RRFA 1G16A 2OCAA 4MUAA 1LY1A 3AB3A 3AGPA 4TQUS 2ZRPA 1UKYA 1Q21A 1C1YA 4MA4A 5JWHA 2F3RA 3THYA 1OXSC 4O25A 2KB0A 2WTUA 5DI3A 1E2QA 2DCUA 3P27A 3HU2A 4DWJA 1C4OA 3KQKA 4Q03A 3THXA 4IVRA 4ZDJA 1EXMA 4KBFA 5TVKA 2PJRA 1NSFA 1MOZA 4HUQB 4C0QC 3SJBA 3THWB 5EXSA 3SR0A 3K70D 1R6BX 4HSEA 4C2UA 1XTKA 3TJZA 5J4LA 3BXZA 1P75A 2ZYWX 4DSTA 1OXUA 2QMUA 3AUXA 1Z0JA 1W2GA 1GFIA 4WW0A 4PO9A 4F92B 5TB5A 3W34A 4KVAA 4OQLA 2BHRA 2E1RA 3DM9B 3GLGA 3BRWD 4LSGA 2CNWD 1GG2A 4DEYA 1R5NA 1CF4A 2RB4A 3UWOA 4PFSA 1KK2A 3SI7A 4J0QA 1N0WA 2WM9B 3GJXC 2XZOA 1WE2A 2AN9A 1W48A 4Q4AB 3GEIA 2GXUA 4IKEA 2OV2A 3A1TA 4D2IA 1E2MA 1GVNB 1OKKA 2C8VA 3OAAA 5EE0A 3QENA 2IYRA 3Q7QA 5CIWA 1BH2A 1GRQA 2BBWA 1DBSA 4NU0A 4K8OA 4XVUA 4KV9A 4MYTA 2CLCX 4Z8YA 2QL6A 1DELA 5AWFC 5H70A 2Q9CA 5FOTA 1T3LA 3MSXA 3E1SA 3A37A 1ZIPA 2ZAMA 4PANA 1UBCA 4NCJA 4IOKA 3SQXA 2ZANA 1FMLA 4JLKA 1JR6A 5AR1A 5GVRA 1XJCA 3I4LA 4CIDA 3EX7C 5HKKA 4D26A 4GP6A 2ZYVX 3C5CA 4Q18A 2PEZA 4B2IA 2VBCA 2OUKA 3ZZTA 2IEZA 4IDNA 1G8GA 2EVWX 3BE4A 1R0ZA 1U0JA 1CR4A 1F6BA 2NO9A 1R0XA 4KFTA 3BORA 3EC2A 4IVQA 2J0VA 1KI8A 1E1RD 4MKIA 3VKHA 1VYTA 2WZQA 4TMKA 4BFVA 4D0NA 1X86B 1X1RA 3CB4A 5EZ5A 3IHWA 3P20A 5DHAA 1OB2A 1IY0A 4DB4A 2B7CA 4URUR 4NCIA 3JVUA 3P1JA 1KYIA 1TEXA 2QUZA 4DVGA 4YQFA 2IBMA 4Y0AA 3KKMA 4DLTA 5HZKA 2ZR9A 1PV4A 5C18A 2W0SA 1D2MA 4OI2A 3QOFA 4NYIR 1MKYA 5FUWA 3AEZA 4FMDF 1V5WA 4UJ3A 1E2NA 3QVUA 5G53C 4G5SA 4GI7A 2C5LA 2JLWA 1G8PA 1Y63A 2PT5A 5FBLB 5C46F 2IS6A 3D3QA 4L8GA 4PO1A 1N6KA 4O2LA 1MRNA 1Z6AA 3WP0A 5JBQA 4Z51A 3IPXA 2NMVA 4B76A 2V7QA 5FH9A 4IEIA 4KAXA 4GOXA 4ZCMA 3MCAA 2MMGA 3P4YA 3SYNA 1XMSA 5FTKA 1UBEA 2WV9A 4V0ME 2FSFA 2NZJA 3HPQA 1II8B 3PEVA 1A1VA 5EE3A 2YV5A 4A15A 1T4GA 2RGCA 2D2EA 1CJTC 1J2JA 3R9WA 4MGIR 2FSIA 4BZPA 2XAUA 2Y8EA 1RRCA 4ERNA 4QRHA 3NBZC 3D6TB 2ZJYA 4DCSA 1ZNXA 3VFDA 4CF7A 2FSGA 4GOJA 1E69A 1HUQA 3MFYA 2GJAA 4QHSA 4P4TA 3W8NA 2QZ4A 3M1IA 4RD4A 4X8LA 1KHTA 4ILEA 3FWYA 3QKUA 3TGPA 1YZGA 3PITA 5GVSA 4IDOA 3DPUA 1GRRA 1NIJA 2CK3A 1KO5A 2C77A 2LKCA 1DAGA 3FMFA 3RLFA 3IBYA 1EG7A 4OHXA 4EJSC 1SVWA 1S3GA 3SN6A 4V0OA 5J47A 4Z54A 1G5TA 2P0EA 1MH1A 1SKYE 4TYPA 4JBXA 4NHOA 4M1YA 3K09C 1U0LA 1YE8A 1XEFA 3W6NA 4PQFA 2J0SA 3NEJA 5IK2D 2FDCA 1E79A 3TR0A 4Q1EA 3SU8A 2ZTSA 1U8ZA 2AL7A 4HAZA 5CDFA 4KSBA 2N1BA 1PZNA 2GWHA 2RGNA 4URYR 2AD1A 4BRWA 1QBKC 1UDWA 1II9A 4M1MA 4OQXA 1YRBA 2CCKA 3NC1C 1EK0A 4B74A 3B1ZA 1U98A 3UG6A 1VHTA 2Z43A 2WKRA 3AF4A 1OIXA 2IK8A 2BWJA 5JHGB 3PEWA 3AVXA 5TXGA 4KHZA 1CR1A 1OYYA 3UK6A 4RCZA 3TUJC 4BFSA 2J59A 2HXYA 4A0HA 2XXAB 2O8EA 3KXLA 1X8KA 2BC9A 1G3UA 2WPDA 4II7A 1M8PA 4MKFA 3T61A 3C14C 2CMKA 2H16A 4BQSA 1DO2A 4V0NA 1N6OA 5F98A 2P5TB 1ZMXA 2VIIA 2KSQA 1NLYA 4JJZA 1XEWX 3F3YA 3L0PA 2B92A 2HEIA 1E0KA 1ZUHA 5DE3A 5ANRB 2C9CA 5L3QA 2ZITA 2V6IA 5CLLA 2VSXA 221PA 2GZHA 2QT1A 2UZ3A 2Z83A 3UATA 5TMPA 4GRAA 3KJHA 2G9NA 4Q1FA 4ARZB 3DHWC 2PLRA 1YZKA 5C2JB 2OESA 2JDID 4OK6A 3J81k 3BC1A 2ATVA 2CK3D 3F8TA 1RW4A 5M04A 3O47A 4G5GA 3UMSA 4M1KA 1AS3A 1KIMA 4MRSA 4B3DA 3T15A 4RD6A 1HT2E 1KDRA 3I61A 3EASA 1ZM2A 2ZRGA 2NO6A 2O0HA 3RS2A 5F9FA 1E1RA 1P62B 4KLNA 4OQMA 5FOSA 3TKLA 3REFA 4D80A 5BWMA 1FFHA 3PQCA 4DLXA 1JQJC 2WWFA 4Q7MB 2JA1A 4Q4JB 2KBEA 2QM7A 4HLUC 4ABYA 2WIBA 3TW4A 4Q7KA 1US8A 3OEHA 1ZNYA 1VTKA 4AG6A 5G3YA 3EA0A 2BIFA 1GILA 2ZI4A 2ZRMA 3EIEA 2D3WA 1Q12A 2AD5A 4GSYA 1ZD8A 1G7CA 2QQ0A 3PUZA 3RRNA 5JI3E 3W8RA 2PH1A 3KKQA 5HR5A 1FQJA 1NN5A 2ZSAA 3LW8A 1WRBA 3PUWA 1GNQA 1IQPA 2TMKA 1F48A 4L4UA 2J45A 1T3HA 1VPLA 1XD2A 3DOEA 3FGNA 3W3AA 3THOA 2ZE8A 3QKTA 5DN6D 2GKSA 1E9BA 4FCTA 4GNKA 2D4HA 3F0TA 3WY9A 3U60B 2ZR7A 1F5NA 1ZRHA 1YZTA 1N6NA 3RRZA 2O8DA 2A5FA 2XJ4A 5A0FA 4HLCA 4PC3A 3RS7A 4TYNA 1GKIA 2QNRA 2MSCB 4N3NA 2GK7A 4TTQA 1FP6A 2RGBA 4P4SB 5EUMA 5JS7A 3D7MA 3G5UA 2ZUDA 3ZVMA 2W6JD 4BFZA 1KI4A 4DT1A 4ZV4A 3JVVA 4U5XA 1IY1A 2WAYA 1KJZA 2FGKA 1E9DA 5FFMA 1W4AA 1UADA 1XNJA 2P2LA 3VKGA 2A9KA 4KU4A 1Z5ZA 1ZD9A 3CPEA 1T91A 3KKNA 2H92A 1CJVC 4Q4HA 5KSYA 1JEEA 1XCGB 1ZVQA 3B9PA 4I81A 4IDQA 4K81B 2GEUA 4NYIQ 3VU9B 5IF9A 1N6PA 1F3OA 4FW9A 1AZTA 2P65A 3OIWA 5L3QB 1HQYE 1E1QD 1NBME 1RFLA 3U61B 4A6XA 4C2TA 2WICA 3B78A 5HTKA 3WNBA 4DCNA 3SBDA 4A8JB 5FTLA 2JAQA 1U90A 3BB1A 2WSSA 3EPLA 1E32A 4G0NA 3W6OA 1SVKA 3EPKA 2Z4SA 4Z1MD 3KL4A 2IHBA 5DHFA 4BFWA 3LQQA 4P32A 4YXWA 4LHZA 3QSYA 5K8UA 1HY3A 1AK2A 2Q6TA 2FG5A 4QBHA 4IDPA 2BM0A 3GJ4A 3ZD7A 1Z63A 2QRZA 1TF7A 1G17A 1KI6B 4D82A 1DTSA 2CL6X 2QP3A 2O0KA 5HCIA 3KFVA 1NY6A 2BDTA 1E94E 2VO1A 4QGAA 1KDTA 3U3RA 2VRWA 3WRXC 4EKDA 5HPYB 2GF9A 3CBQA 3R9XA 4HDCA 2ZR0A 2A3RA 5KNBA 3IIKA 2HDNB 3HPRA 3AVYA 2ZRKA 3K9HA 2FV8A 3ZVNA 3I3SR 1P5ZB 1ZM4A 1ZU5A 4LYHA 4Q4LA 4ZKDA 1E9EA 1DADA 4NYJR 4OI4A 3ICEA 2RKOA 1CJKC 1U99A 5FOXA 4DSOA 3LW7A 2FMXA 4Y0VA 1D2NA 3ZH9B 4RJLA 4TN1A 4CDGA 3TAHA 1GL9B 3GLIB 4LJ4A 4YC7A 1IBRA 2D74A 2FFQA 2WAXA 4IOLA 3TVDA 2CL7X 2ZSBA 721PA 4R2IA 4H1VA 4B71A 5KO2A 1H8HA 3FVQA 3GLHE 3LBHA 2WWHA 4NONA 4CEHB 5JFGA 2PZGA 1NN3A 1TQ2A 2OEPA 3CPJB 1U2RA 1Z07A 2IUTA 4FINA 4PPFA 5AK0A 1EWQA 2GF0A 1KY3A 3AUYA 4PQYA 2JLVA 1KMQA 1OKKD 2FOLA 4HLDA 1WCV1 2AXNA 4DUGA 1U0HC 1JJ7A 5G3ZA 1DO0A 3ZDQA 3A36A 3E5HA 1TQ6A 1FZQA 3RWOA 4MYCA 5KU1A 1XMIA 3NHBA 3RRMA 4OQNA 1YR8A 3B1VA 3TSWA 4E03A 5KPDA 1IXSB 2QROA 1JAIA 1U81A 4UKDA 4DRZA 2NIPA 2F7SA 4W5WA 3K70C 5KUTA 2VTKA 2JLSA 3I8XA 2QMEA 1DG3A 2H57A 1WBBA 2WSSD 4DT1B 2NO7A 4MDFA 3TLXA 1XZQA 3EZ9A 2Q9BA 1W5SA 3DKVA 4V0MA 2IYZA 3HYRA 3GJ0A 4URZR 5CIQA 3BAFA 4BLTA 1UKVY 4P4SA 4FMBB 3BB3A 3NIBA 2O8BB 4B33A 1KOFA 1QVRA 3L82B 821PA 4JSYA 4YLGA 3AGQA 4OJQA 2X19A 1RKBA 4M0LA 2DFNA 1FX0B 1R0YA 2IYTA 1R7RA 1YU9A 4TMZA 1G291 4F4IA 3T5DA 2YWEA 3QEJA 4V0KA 4AKIA 1E9AA 3ZLJA 4Q02A 4PZYA 3THXB 2ZJBA 3RSLA 4BLPA 4H9GA 4RZ3A 3WNDA 2ZQ5A 1XMJA 4JLMA 5JJIA 1KI7A 4BECA 5EP4A 1UDXA 4R2HA 1AQUA 1NY5A 2PEYA 4C0JA 3MWLA 1N6HA 4WIAA 1YZUA 1Z0AA 1U9IC 4LJ6A 2O8FA 1ZCBA 2L0XA 3A4NA 5DNYB 2B21A 1CU1A 3CRRA 2WKPA 2C96A 2D2FA 3O8DA 4QM6A 1SVIA 4YONB 4B3GA 3GLHB 2QG6A 5DO9A 2BKUA 2ZI5A 4TMXA 5B2ZA 1TL7C 3QXXA 2OFOA 1AN0A 2R44A 3IIMA 3NBXX 3IIJA 4ZIRB 2IYQA 5KDOA 3RC3A 2ZUBA 1LTQA 2H1LA 3GLIE 3OFNA 1YHNA 2ZE5A 3MWJA 2R65A 121PA 2A5YB 3LBNA 4HUQA 2XNDD 1ZUNB 1EFRD 3T1VA 4EPVA 3T1TA 2XZLA 5CJ2A 4TZ0A 1BYIA 3H0KA 1Y3AA 1NN0A 4C0LA 1KSFX 1ONBA 2A7QA 2RGGA 3UXMA 3PIRA 1LB1B 4DLUA 3K0CA 1OH5A 4NCNA 2OZEA 2FEMA 1JALA 1FL9A 4WXPA 4RD1A 4UNPA 1CJUC 4OL0A 1RRGA 3CZQA 1BO6A 3NH9A 2WJGA 4UJ5A 4XVRA 2OLKA 3KXIA 3KJIA 1FTSA 3SNHA 421PA 3B1XA 1W36D 4ZDKA 5L3SB 2G6BA 1Z6GA 1MO6A 3TMKA 2OCPA 4U00A 4A0FA 3TQCA 4GDFA 3FTQA 3JZAA 3BJIC 3IQXA 4HAYA 4A92A 3I5XA 4JVNA 2YNMA 3HP1A 2YJTD 3QF7A 1QG2A 4I1OA 4KVGA 2DR3A 3IHLA 1CLUA 1XTJA 3Q3JB 4HB0A 5HKKD 4QFMA 4X8HA 4PSVA 1FW6A 3SFVA 3CH4B 3BH0A 2IWHA 1Z6XA 4C0BA 2C03A 5CYOA 3KUCA 4QKQA 2C2HA 1NLFA 3QXCA 2H5EA 1A4RA 2ZJ8A 1P72A 3QG5A 3M6AA 3U2QA 4KITB 1GM5A 2OXCA 3QVVA 4V0LA 2GXSA 1K5GA 4LGMA 1G3RA 1W36B 3LD9A 2IYXA 4QGGA 1RJ9A 5TY0A 4TZ6A 4JKIA 2RMKA 1XTSA 3Q7PA 2GA8A 2NZ8A 3LFUA 1P60A 2ODEA 1OJLA 2W6IA 1OHHD 3HU3A 4JBWA 1Q3TA 4TL6A 2HXSA 2X2EA 1GNRA 2JGNA 2RGDA 2VF7A 3KXKA 3RABA 5AJVB 1ODFA 3NG1A 2J7PA 1EFRA 1MABB 1M1YE 2JCSA 5FPHA 2QEQA 1XRJA 2G0TA 5JEDA 1X1SA 5K8LA 4YMTA 4N1AA 1E2KA 1E2EA 3QQ5A 4DUGD 4E22A 1JR3E 5LBIA 3WYAA 4L15A 2DWQA 3IGFA 1BMFD 4FMCF 1CRPA 5LB2A 3ZJYA 2AHOA 5H8WA 1W46A 3WHLA 2NO0A 2ZAOA 5CYPA 2QPTA 4OI1A 3MD0A 2YWHA 1FPMA 1OF1A 2NTYC 4EUNA 4ZCIA 2DB3A 3T06B 4G01B 3EG5A 3DZ8A 1YR9A 5IRCD 4MRVA 1JR3D 1QDEA 3ASYA 2ZRIA 2GVZC 4LCBA 4DLRA 1M2OB 1RE0A 4M8NE 4D25A 4C9BA 3SBEA 2HJGA 1OLOA 4AC9A 2Q3FA 4FMCB 1RYFA 1ZC3A 2VHTA 4TLCA 3ZZUA 1DE0A 4LYJA 5GJCA 1ELOA 1KO4A 2G1KA 4DC9A 4DLWA 1MO3A 4LYAA 1NIPA 1XJQA 3TNFA 3C41J 4EIWA 3AVPA 4EFLA 4PZZA 3FB4A 4LK2A 3SQWA 2J0QA 4Q1DA 2CE2X 2RH5A 3K1JA 1UKZA 4Q4HB 1T3SA 4MYUA 4B3XA 4OJKA 3NEYA 1CP2A 3QY0A 1YVDA 3U7HB 1R10A 2PJZA 4I99A 3BGWA 1XD2B 4Q9IA 3TUZC 2FWRA 4XIGS 5EE9A 1GWNA 1Z6TA 4G1UC 4NH0A 3L0OA 2ZS8A 4B73A 4EDHA 3SE0A 1OH6A 1W4RA 2IHYA 2GCOB 2X2FA 3I92A 4TL7A 3UPUA 1SQ5A 2ZIAA 3X1XA 2VP4A 1ZW6A 1WP9A 2IA5A 4AKEA 4DHEA 1TQDA 3C16C 3JZMA 3M0EA 3TR5A 4TSFA 5ELXA 3FMPB 2O0JA 3GLIA 1XPUA 3Q85A 5BYKA 2CEAA 4MYHA 1G1MA 5SZHB 4ZIRA 5FPYA 4URXR 3K0FB 1D9XA 4F93B 2QSZA 1G41A 1VG0B 4PAQA 1CEEA 1RRPA 1HQCA 1G5RA 1CJMA 1VMAA 4HDQB 4X8MA 1VCIA 3OE7D 1AS2A 2JLRA 2WPDD 3EZ6A 4MQBA 4Q1BA 5LD2C 2CL0X 1NNEA 2AK3A 1KI6A 2ZJOA 1NL3A 3IQWA 5GJBA 1K8RA 3K09A 3V00A 3BWDD 3CLVA 1Z2CA 1YZQA 3LO5A 4IW3B 2WVJA 4JIMA 1T9HA 3BK7A 1M7GA 1P6XA 2DYKA 1VHLA 2F1HA 4BRUA 4JLVA 2RGAA 1TTTA 4CEJA 2DWPA 2OG2A 1M34E 5AUQA 3CZPA 2V4ZA 4AYTA 3CH5A 2B6HA 1AM4D 3FHCB 3AKEA 4Q47A 3FYHA 3K9LA 1S1MA 3U4QA 4PTLA 3B8HA 3SHWA 3VR1A 1OYWA 1BKDR 2OBLA 5JZVA 4CZ2A 2DFKB 1P9NA 1GL6A 1PUIA 2XTNA 2BCJQ 1ZYUA 3O8RA 1IN6A 2ORWA 3DM5A 3VX4A 2EFCB 1Q0UA 2H18A 4Q4AA 2VQSA 1KI2A 4ARZA 3GLGB 1E2GA 3WBKA 1CR2A 1U8YA 1YRAA 2E9SA 1NKSA 1MR3F 2FPLA 2F9MA 2IYWA 2AWNA 1R5BA 4OKSA 4MGYR 3C5HA 4LJ5A 2ECKA 1IM2A 2GJSA 2GHIA 1NI3A 1Q22A 2QPOA 1UBFA 3EZFA 5SZJA 3U5ZB 2ZSFA 3H4MA 4OHVA 2YZ2A 4TSFD 1MO5A 3WMFA 5BN3A 1Q3HA 3O8CA 2ZSEA 3NHAA 3KJEA 2NPFA 1HH4A 1P3JA 1UEIA 2CNWA 1N6LA
chains in the Genus database with same CATH superfamily
1VJ1A 1EX1A 1NN1A 1CX9B 1GAQA 1H5NA 3C3BA 3I4FA 4DE5A 2GRJA 4GQIA 5EIXA 4XD2A 4G65A 1P17A 1Y3FE 4TLBA 4ZI7A 1O6ZA 3NDPA 3O4HA 4HHEA 3WDLA 1Q1AA 3N2NA 2FLWA 4GBJA 4ZEVA 2WIJA 1OFTA 3MJ4A 4ZEWA 3K0AB 2EYUA 3O6VA 5ALSA 5IG2A 1MQSA 2W4QA 2HCFA 5BWBA 1PYDA 4TSKA 2WYOA 3WGQA 3B12A 4BV8A 1DT5A 3FSGD 1SULA 1SUIA 1WZIA 2Q1WA 1A76A 2VZEA 5E95A 2QX6A 1M2FA 5HX7A 2HHJA 1K88A 2OILA 2QVLA 2OP1A 2ZYDA 3GPDG 1IVSA 1OGIA 1DDOA 3RIGA 3K0CC 3ADCA 3AV0B 1LBEA 1EFKA 3F6RA 3EXAA 2ZYIA 1S2GA 4JJ8A 1S2OA 4Y6LA 4RIHA 3EVNA 4IH4A 4EEXA 4QAQA 4TM7A 3SS7X 1C80A 3EFEA 1G9TA 4BAGA 4C0WA 5JNWA 4CDRA 1U0SY 5CGQB 5ES3A 4N65A 1QMPA 2C5SA 3ND8A 1UK9A 2AQKA 5DBGA 3A4MA 5JZBA 2QMOA 2W83A 3BYZA 3CJQA 3UT5B 2NYUA 3W2EA 4LPSA 4F97A 1ZJ4A 2F59A 4W6QA 1JSRA 1Z0FA 2JC3A 1HOXA 2PSJA 3IBSA 3RS4A 1JHAA 5J2TA 2DSNA 2FR8C 2CXSA 4IG9A 4M9QA 4S1WA 2CLHB 1FMJA 4LBZA 2GSWA 4PBRA 4UM5A 1SUEA 5K45A 2YRWA 1PTKA 2G7MC 1NXVA 1CQJB 1OV6A 1YB4A 1OZ0A 3X43A 5KU7A 4MMZB 1N7GA 2P67A 1U0NA 1ACJA 1QYIA 1P0IA 2A30A 3RVSA 3R09A 3TM4A 1A9TA 3VSAA 1EXVA 2CWWA 1ZA2A 3V6LA 4C3ZA 2PUFA 1YE5A 2EKZA 4IDHA 5KTMA 3DTVD 3WGVA 3FNGA 1QU3A 4NI5A 3PRJA 4J16C 3E7DA 4B83A 1FFXA 1Y9JA 4MHSA 4F9TA 1UDRA 2W2OA 4DJAA 4EYSA 5KDDA 2NO1A 2RGNC 3DYVA 5EPUA 2Q4RA 1IRXA 4CPDA 2AMLA 2UVPB 1R9MA 3E15A 3QP9A 2Q9AA 3MJHA 1ICEA 3NZEA 4A27A 1Z68A 2ZDQA 4XSVA 4LDNA 3HDGA 4PZAA 1P73A 1ATIA 4INZA 3CLHA 4ES6A 3WO1A 3GGSA 5LCXA 2O5CA 1LDMA 3H2SA 3KC2A 4N54A 3UV7A 3MBKA 4RFSB 3AP1A 2YZ7A 1REQB 2AF3C 2FU5C 2HJVA 3K20A 2PLFA 4V0RA 3TD9A 3PEEA 1DKQA 3TRKA 3UK0A 2YC2C 2AMFA 2PBRA 3ED5A 2ZWOA 1VBKA 3I73A 1EP3B 4WZ6A 4F5EA 521PA 1JECA 3O2QB 4LXQA 5JYDA 1M75A 3X1JA 1YT5A 4F4UA 2Q3BA 4MV4A 4YMLA 3PKZA 1PX0A 4C30A 3AK4A 2YINC 3Q8WA 1YOVB 4KEAA 4A0SA 5AVXA 3G9QA 4HD8A 2G0NA 2YNMD 1ABBA 2ZB7A 5TT1A 4AAYA 2GAJA 1XJ5A 1TEZA 3M8KA 3TW0A 3W90A 2QVCA 3GFPA 4B4VA 2JJMA 2CLLB 3AHGA 2QSYA 1E2FA 5EZYF 4QJ5A 5I4IA 4ZDWA 4YRIA 4JYMA 1BEUB 2HDHA 2WSMA 2ZCVA 2AZMA 3NW9A 4WVFA 3TSYA 2R11A 4WLEA 4YDQA 3VNVA 4Z6KA 2Z09A 3W5JA 3N2LA 4XVHA 1Q0QA 4B2PA 3ADPA 4Q4JA 1B26A 5DXJA 1NBMD 4LHEA 1NATA 1WUHS 1ZX1A 3RT9A 2WUWE 3KU4A 4IWNA 2CW5A 4RHFA 2LTAA 4HVCA 3AX6A 2ZRCA 4NMMA 3B8EA 4MVJP 1MOQA 4G9EA 2QLMA 4LC0A 4AX4A 3KQOA 2BEUA 2P35A 3BFKA 3QVOA 5L3SA 3U7FB 3CO0S 2B8WA 4JK3A 4R1NA 2O7RA 3HBFA 1WXIA 2JGAA 3MAAC 5K03A 3M4JA 1LS1A 2DULA 2RAUA 3FHJA 4PXYA 2OHXA 2QTTA 2V7BA 4KAAA 5TMEA 5I51A 5AUNB 1R4MB 4DN6A 4OXRA 1U0EA 2YYZA 3RSHA 3R0IA 2DUMA 5F35A 1ZUD1 1ADCA 1UXJA 1M2VA 4CQNA 2COEA 1NVVR 3QVGA 3CC8A 4YYEA 2V3WA 1U2GA 1QOPB 3CN7A 2ZPAA 1Z82A 4UUQA 4X1KB 3LA6A 5KX5A 3TUIC 1SGWA 3ODPA 1I7LA 4NE7A 2R62A 2BPOA 4YQEA 2RKWA 5TGDA 3LLMA 1R6TA 5BURA 2R0QC 3O21A 1YQTA 4DSNA 1VPDA 4HUTA 3PRYA 4MX8A 1X9GA 3BWEA 5JSFA 3JZFA 4EI2A 2EW1A 2RIPA 2QW8A 3NXKA 1COWD 3SIWA 1A27A 4M87A 1OFIA 2HCTA 3DAYA 4HR7A 4DDHA 4DLBA 2IF2A 3HLKA 2PG3A 1RI4A 3DEIA 2OZKA 4GZLA 3MIIA 5ED0A 2IUSA 3BULA 3W3ZB 2HBQA 1GT91 4GXTA 1GDDA 4PGFA 5D3MA 3T95A 3VKWA 2QAGC 3MS4A 4DREA 5IUNC 3TTVA 1PL0A 2IEGA 4X5OA 2P7HA 3X44A 2QL5A 5CB6A 1YVEI 4JD5A 1MB2A 5D87A 2Q0HA 4YP1A 2A9FA 4YMIA 1N32B 3A6HA 1JR3A 4UM7A 3OIYA 3QE3A 4GYKA 2PR2A 4K9SA 2WI8A 4QDUA 1LS6A 3EK2A 5CXSA 3SOZA 3ULKA 3WNQA 1DKUA 4BEBA 3IX7A 3JWIA 5CDFE 2DT8A 2E4UA 5IDQA 2FN4A 5D3QA 2VBIA 4D4GA 3TTSA 1R4NB 4GOMD 2BMVA 3Q8KA 2ZSUA 3FLEA 2UKDA 1J25A 4O4JB 1GSHA 1YRHA 3AFIA 2Q8QA 5B1SA 1K5PA 1T4BA 4TV8B 2FRDA 4FE3A 4PYLA 2WRZA 4ZO9A 4KPUA 1NDHA 3ENWA 1XELA 2G9UA 4WBSA 1YI1A 2Q4OA 3DZFA 4MRMB 1WCIA 1OXXK 3B2QA 3E61A 4ZTBA 3ZHCA 2X5NA 3T4XA 3EF1A 3LVFO 1CZHA 4P82A 4IIXA 4EJMA 3FTEA 2O8FB 3U3OA 4LEIA 4EX6A 4PO3X 4B1FA 3KR2A 4C4PA 4J4HA 4NDZA 1IH8A 4PW0A 1OH7A 3U3JA 1CUYA 4ND2A 1KNQA 3FNQA 2NUBA 1XTUA 3L7DA 2RHDA 4BMYA 4C89A 3V1MA 5BV8A 4HN4B 5F3RA 2D54A 3E8MA 2VFAA 1MAVA 1PEAA 4XTRA 4MTLA 1NKVA 3D7NA 1KDPA 2YWGA 2Z56A 3KTAA 2MCFA 2DWOA 1G42A 2XOKD 3C3KA 3D4PA 5IMBA 4JLJA 4X41A 5AXCA 1L5QA 1QVWA 1SKMA 4I4LA 1NMYA 3RUEA 2A4MA 2W6OA 4A6DA 2I4RA 1N7HA 2KJQA 3L79A 5DT2A 3HV2A 3VU0A 3P2IA 1IWOA 1DBVO 1GUYA 1U2ZA 1XNGA 4LMPA 1X80B 5AJXA 1N8TA 4H18A 4UQPA 1B1AA 5LJLA 5EXEA 5C52B 2G06A 2C5FA 2HJWA 1BDBA 4MB6A 3EJWA 4XZ3A 2R4TA 3WLOA 4MWZA 2ACVA 4OLHA 5IFLA 4OOEA 3NTRA 2DBQA 1EFCA 4YRFA 1N78A 3MINA 3I5AA 4DDTA 4AKHA 1GKKA 1O96A 3CW2A 3KQHA 4UZSA 2WMYA 4NCHA 3DE0X 1CQXA 3PGA1 4YI3A 4JROA 2VQDA 2J32A 3K05A 2ZB3A 3I76A 3G02A 3VR3A 3KSZO 4RYDA 4BMNA 5I4CA 5GIPE 2C2YA 1HWYA 3UK7A 4DFDA 1JMYA 2X4IA 1K3UB 3REGA 4ZV7A 1U4OA 2O1XA 3HN7A 4XSHA 2C92A 5BQXA 4JFAA 1QIJA 2I2FA 3DL0A 1EFTA 4INPA 2C3MA 1M1UA 1XKTA 3RR2A 4MA5A 3B6IA 3FSEA 4PC1A 4BNGA 1P31A 1GARA 1MW8X 3CKLA 5K7SA 2CZCA 3KWFA 1KYYA 3NGLA 3Q6MA 1NXTA 2C4HA 3OHPA 3S1LA 3TB4A 4CTKA 1Z26A 1L4GA 1PVVA 3GEHA 3K92A 5JQGF 2BONA 1U28A 2FEAA 3IQZA 3FOFC 1PNRA 4R51A 4Z9FA 4O5OA 2PRKA 4CCYB 3Q6IA 3KR0A 4M55A 4F5WA 1I7QB 3DBVO 3QF4B 4X65B 4EY8A 2ZUSA 3QWHA 4TWIA 3OTGA 1RFGE 2EJCA 3PL1A 2R8EA 3AQIA 3CF0A 2BFDA 2E4YA 1NAHA 3OHSX 3B53X 3N2GA 5AVTA 1I2CA 2JI6A 2JJ8A 3IILA 2YZMA 2CY0A 3FZYA 3N7AA 4L08A 5IAJA 1MZPA 4EPRA 3P97A 4I5GA 3FMOB 4ALKA 1GHTA 1UBLS 2Z8YM 3OETA 1LZLA 1DTWB 2OE2A 3A6PC 4ND8A 3KQWA 1RZRA 3DJYA 5ELLA 2DERA 4R0NA 2CLMB 2KM1A 2ZRDA 1MO4A 3MTBA 2P40A 1TMOA 2Y71A 3G6WA 4IHAA 4AUMA 1OI3A 3JAKA 2X0EA 4J90A 1YBAA 4PNEA 4JEHA 1JXOA 1IN7A 3U80A 3QBEA 4QHTA 4ZVKA 3LT2A 1UP7A 1NBWB 2GCNA 1NMXA 3EVGA 2V3VA 3MA0A 3AIKA 1EUZA 6NULA 1TJYA 1YL5A 1KJJA 1MVLA 2FA9A 2B1RA 2QVZX 1SVMA 1UODA 4UVEA 3SZUA 1HSOA 4PRYA 5CGZA 4WKBA 5FX2A 1B8PA 2QAIA 2FH5B 5FP0A 2V7GA 1E3EA 3K1YA 2GDJA 4R7ZA 3V4VB 2QRNA 3HCNA 4FZVA 4P7KA 4ER7A 2IHZA 3F67A 3IEKA 3JWEA 2IVZA 3MRVA 4W63A 5GZ6A 4G25A 1IU9A 4Q1VA 1JJFA 1Y7LA 3L1HA 2ZSHA 4IHJB 3SDZA 2G1JA 3LC0A 1GEGA 1H2FA 2OAQ1 1OSNA 2AG0A 3C5WP 1BTOA 3FTPA 2XUPA 4FK8A 1ISIA 1ABEA 1UK7A 2BFBB 2Y1DA 2ZTHA 5K0NA 1NU6A 3NVMB 2F4VB 4JHLA 3QLUC 3VUFA 4KXFB 3NHKA 2CLFB 1CXZA 2VDNB 1HDOA 1WHSB 3GNQA 1BC5A 1DLIA 4KBYA 2AXQA 5A0VA 1SHJA 1VSVA 2WU0A 3EEFA 3EPRA 4BFYA 2FFBA 1GVHA 4GEGA 1FVXA 2LE0A 4TWAA 4B3SB 1BJKA 1MFPA 1SC3A 2QN6A 1LKZA 1S2LA 3DAGA 4YFVA 3N2EA 4MWBA 1IY2A 1Y7PA 2FN3A 3FRHA 2Z95A 4KXQA 2CYAA 3ZGYA 1LBHA 1QYRA 2UZ1B 2VNHA 3DBHB 3H11B 3W4JA 1WNTA 3ZN2A 2QR2A 4DNPA 1PWEA 1W85A 3D1VA 4X24A 3TDNA 1RLOA 3JQEA 2H85A 2QPAA 5E8JA 5DLPA 4ENQA 1JKFA 4M7PA 1EZZA 1HDEA 2IF0A 4QVGA 4MWDA 3GU3A 4OHMA 1FOEB 3FZEA 4XQEA 4DXDA 3WTCA 1ENZA 2OHOA 1E1DA 2YMLA 1F7VA 3K0SA 1J0DA 1WB6A 3GN2A 1IZZA 1UFKA 3E0XA 4MWTA 1TMYA 1YS4A 4RJTA 3NLLA 2QXYA 3K6JA 1Z37A 2QM0A 2P6NA 3R3YA 3SZ3A 2RCNA 1GLVA 2X0DA 2ZSDA 4D81A 1X7XB 1L5YA 2FRXA 3CLTC 4QTTB 3WMGA 1UC9A 2O57A 3TD6A 3UMVA 3LZDA 1L0BA 2A9VA 4LDZA 1T5DX 2GJKA 2MINA 3PBKA 4JH0A 3T4PA 4BP9A 4BB0A 1RZ3A 4B82A 4C21A 5LP6A 1Y48E 3GVIA 1FJXA 1O08A 1SCIA 1Z34A 2B1IA 3GCWA 3H5AA 1CQIA 1MABA 2GD6A 3OEHD 4PLWA 5KAPA 2AG6A 1JIQA 4M8SA 4DCTA 5I48A 1KKLA 3NTUA 1VP3A 2XQFA 4X71A 1CHDA 5KJ6A 2XRYA 2QMQA 2ZW9A 3MMNA 3QMWA 1VG9B 2CVPA 4RPHA 3CM0A 3DD1A 3PG5A 2VAVA 2VDVE 3KV1A 2Z8ZA 2GH1A 2H54A 3TG2A 3A1NA 1Q1QA 4RS4A 4I4NA 1NSTA 2R9VA 4UD6A 3G59A 4DHWA 1H8ED 4HAXA 2AYXA 2JGIA 4D0LB 4ER0A 3EH1A 4Z0TA 1THMA 2ORIA 4GLFA 4G5OA 1KJIA 4A1FA 3UHFA 1GL7A 1FA9A 1LRLA 3AJ8A 1BXRA 5AOVA 4BTLA 2YJ6A 4CGYA 5BSVA 1NR5A 2E7ZA 3COYA 3VKUA 4G41A 4DIUA 2O52A 4NL4H 3O1IC 4EPXA 2R2AA 4ZPXA 4B32A 2J3HA 1BCRA 3C3MA 3HA2A 3AERA 4V0SA 4M8KA 1N5JA 1JSLA 1GGFA 4FHFA 3BUSA 2CT8A 4J0EA 4JR1A 4MEBA 1N5OX 5DYIA 1SG6A 3ZVKA 3EW9A 2ODNA 1NM5C 3C8DA 4TMVA 1M74A 1DB3A 2PZLA 3O95A 3QKRA 2WIAA 4WA8A 4B3FX 3IDFA 4R7GA 2Z1DA 5F9MA 1CC1S 3NATA 3THWA 5LKAA 3GJRA 2R1VB 1EK5A 1N2XA 4MCJA 4DJ5X 1AA6A 4EG0A 4HGRA 4DYVA 5ICGA 3UUFA 1G5QA 5EFOA 3WWOA 5B58C 2IDZA 3QE2A 1MBZA 3BIOA 4FGKA 4JXJA 3ZS8A 5JARA 3AHJA 1BYUA 3DVRX 3DVSX 1UOEA 5FPTA 5AD1A 1ZINA 4MP3A 3EAFA 3IOEA 4WZBB 4BO4A 1UP6A 1VLHA 3Q7SA 2V6GA 2FUCA 4HBZA 4MVCA 3X2EA 4C6RA 3L7JA 2VYQA 4DGSA 4W9MC 2B69A 5CG1A 5LYJB 4BX0A 2W2KB 2HADA 1M8JA 1WPRA 3MCWA 4XJSA 4PC6A 4JEIA 4LRSB 3O5AA 3PXCX 3PYMA 5BQPA 3WB9A 4HP8A 4JS0A 4YPFA 1V35A 1UJNA 1N6RA 1I1NA 1VE9A 5DHUA 2BFMA 2VH1A 2X86A 4ZQHA 4NEHB 2HPZA 5BVGA 3GJ6A 5EVJA 2G07A 5LYYA 3EXG1 4FYJA 2YJ5A 3DCYA 3GVHA 2D1YA 2VZ8A 4RFSA 2ZRJA 1GTVA 1VMIA 2WWRA 2FW7A 4BE9A 1DBRA 1T6YA 4O4JA 5AOAA 4UU0A 2WWXA 1DCFA 4EVQA 2VL7A 3LOUA 3MOGA 3NI2A 4RV9A 2XMZA 2ZUFA 5JYEA 5C7OO 2YV1A 3IAS1 3F6CA 5FUVA 4AQDA 4DRXA 4MRNA 3SX2A 3SLGA 5JYBA 2AN4A 2VP6A 4S1VA 5FOVA 4OXKA 4ZZIA 4PRKA 1B74A 3EBLA 3ORRA 4Q0MA 3WV5A 4A10A 1X7ZB 2IX9A 4EZEA 1K6IA 5E9WA 1WSWA 2X9NA 3UQZA 4RKQA 3M5DA 1GGKA 1S8AA 3B20A 4BHTA 5JAIA 3V4RA 2CNKA 3N70A 1U9IA 1Y4UA 2NW6A 2H48A 3EVFA 3SDSA 1JW9B 4EFKA 2XRMA 2Q21A 4H7PA 3GLGE 3IO5A 4JLNA 1DPFA 3PKJA 5TSDA 4YHBA 2CJFA 2PX0A 5CEJA 3G85A 4PGHA 3PX2A 5BOSA 4R31A 3OLZA 4J6FA 3HK2A 2ZJ7A 1RBYA 3B9RA 3EISA 4PGGA 2VXOA 5FI0B 3WYFA 3HY3A 2ZYRA 1XZBA 1Y8RA 3D9QX 1J56A 1SBNE 3FI9A 3RYFA 4C6TA 2KLHA 2OD2A 2YZKA 4GRIA 4ID3A 1P29A 4OUDA 4RA6B 1PJ4A 4ZAFA 1Z5OA 5DN6A 2C94A 2V1UA 2AFHB 2Q3JA 4LHWA 3OT1B 2VH2A 2BGTA 1VXRA 1Q44A 1N75A 1I8TA 3OESA 1JFFA 3TOCA 4ROSA 4M46A 2B7BA 4PWYA 2HRZA 1A2BA 3TIFA 4X20B 4TV9F 2ID9A 2NXWA 2QNIA 1K7YA 2WSLA 3KM0A 4PLVA 2XI4A 4YCDA 4BZXA 1RAEA 5CT9A 2CJPA 2XZDA 1NJFA 3HYTA 4XDYA 1XK7A 2Z57A 2GN8A 3FLMA 1CCWA 2IOHA 1OE0A 1T6NA 3IVGA 2VHJA 1AC5A 3QE0A 1GKYA 1QIDA 2BZGA 1K2WA 1UEJA 1XCOA 3GR6A 4W7SA 4BP8A 2GXAA 2V3CC 4GUAA 3ZCVA 1YV9A 3RYTC 2Z3WA 4XCVA 2FNAA 1EP2B 3LHFA 4UHFA 1A2OA 4CKBB 4M86A 4AP6A 2AI1A 5JCOA 3PUYA 3JQ7A 1Z4JA 1NW9B 2ZR8A 3NWOA 4JUFA 4KGXA 3WVNA 4BMVA 3V1KA 1NKTA 5JXHA 1BHO1 2GRAA 4AZWA 2A88A 4H3SA 3N2IA 1QRAA 1YZNA 4RD3A 2C0CA 4M9RA 3W2FA 4XPIB 3E58A 2VQ3A 4YJGA 5AMXA 1A8PA 4K86A 4NG5A 3KQUA 1M6EX 2GCGA 4DM3A 3KLOA 1XZ8A 2P5SA 4KUHA 4XDHA 4R40A 1JAHA 3D6NB 1A82A 2BEKA 2JGDB 2B2CA 3LUKA 4J7UA 2FFAA 3CR7A 1EKXA 2WHXA 2ZRLA 1DIHA 1R6AA 3EUFA 1CUEA 1BW9A 4OHOA 2CUNA 2I76A 3CWCA 1AF4A 1YZ3A 2ZJAA 2PD4A 2WT8A 4GZ5A 1QO9A 1UINA 5G1OA 3W5HA 2FJUA 1ZCZA 2OLEA 3AF2A 3A9RA 1Y6ZA 4EENA 3BXGA 1I7SB 2Y99A 5K0LA 1Z8NA 4L73A 5K9ZA 3HFSA 5DYTA 1LLQA 1I2AA 2YV2A 4H4EA 3OC0A 1MA3A 1W5TA 2ZB2A 4X94A 3AEKB 4MV8A 1P4JA 5IKOA 1QHHB 2J9FA 2R79A 3PDIA 1KYXA 3RANA 5TIIA 1II8A 2H2HA 2ERXA 1NBIA 4IF6A 4JKOA 2NQTA 2XKBA 1TT5B 2Q5IA 2VN8A 1SCQA 5DLQC 2H31A 3VR6A 4EHDA 1FK8A 2PWYA 1APBA 3PR1A 1V39A 3E3OA 3ZOKA 3WS7A 3D2AA 4DRXB 5B1EA 3CNLA 1N4AA 4GR4A 3BGVA 1QF9A 1T9GR 1FY2A 1VKZA 1X7HA 2I6XA 1I6WA 3TQRA 3VQTA 2HWYA 1NW5A 2DPXA 3J7TA 1ZRSA 1WMSA 1E96A 5THKA 1F8FA 4FFWA 4KZPA 1ZD3A 4CG2A 3S7TA 2YYSA 4FC6A 1W29A 3LKVA 3FDZA 1C3EA 1D4OA 1IWBB 2JKVA 6LDHA 3TZBA 1JG1A 2PN1A 1FFWA 1ZU4A 2Y1CA 4QQKA 3RUDA 3SOPA 2J1LA 4EA7A 4FSDA 2AWOA 3KB6A 5J1SB 1LSUA 1ZISA 3FKQA 1Z7YA 5L7YA 1SXIA 1W25A 2CF6A 3OZXA 3E3NA 1R0LA 3O4IA 1SELA 1N57A 2QV0A 4H7IA 4NU5A 3HEMA 3ZDFA 4D0GA 2QNBA 2V8OA 1EDDA 1GYRA 5FWNA 4WJKB 4CM7A 1M0WA 1PFKA 4GE3A 4RXTA 4I6JA 4DQDA 1F06A 1QH0A 2EGGA 1XZAA 1YSCA 2GBFA 3HR4A 1Z7BA 3QSGA 1TYEB 1Z0KA 1WCIB 2CVHA 2H7XA 3Q8XB 3A11A 3GJQA 1XYYA 5CM9C 1C9DB 2UVDA 5FV4A 1LQUA 1G64A 4OH1A 1U8XX 3PIDA 1WWKA 2Q3CA 3I83A 1G2PA 2C4VA 4LZZA 5TARA 5KQGA 4DV2B 2BFEB 3A1SA 1T5LA 5CFQA 4I9HA 4QPCA 1I1QB 3T9FA 1FDTA 1GGHA 1NDQA 5AVQA 3AR7A 3IP6A 3ZKWB 5KYXA 2WOOA 4PN3A 1HQKA 5A4DA 4YCNA 1EE1A 2B1QA 3U3RA 4EKYA 5JSZA 3ZHQA 1KF0A 1HE1C 1Y4DE 1M8GA 1OHHA 3QIAA 3TSZA 4DC0A 4G97A 3PXDA 4DABA 2GHQA 3TVYA 3WBJA 4CKCB 5I7RA 2I7XA 1Z2EA 4QXOA 2IBSA 1LTHR 2HHCA 4BN4A 4N8DA 1MW9X 4P3XA 3BMNA 1J90A 4HAWA 4LHVA 2P27A 1RYEA 3B1JA 5EJ6A 2A33A 3O93A 2QAGB 1ZKMA 2QY9A 3IQDB 2C1EA 1A9YA 2WJVA 3H5LA 3K9NA 4BGEA 5JH7A 1TK2A 3HP4A 1EM6A 2X2OA 3CCFA 2ZU6A 4OLJA 2LDXA 2R6JA 3VPCA 1NNSA 3IAUA 3OZTA 2V45A 4GG1A 3HCRA 5LP6C 2L82A 3BMQA 4J43A 3ZHOA 4ZOLB 1EUDB 3DO6A 5DTJA 1KS2A 1KEEA 1J1ZA 2J31A 4LFAB 3RNOA 1MB9A 2G09A 3KQSA 3P9ZA 4B44A 3F74A 4RVSA 3WGZA 3AXSA 4NCAA 4JVLA 2BMAA 3VI4B 1V3VA 3KEFA 3ADBA 5DSZA 1T8RA 1E58A 1ZMRA 3AF6A 1NRXA 2JGRA 4NULA 3UN1A 3TN7A 1XAIA 4F60A 1TAUA 3RVKA 1P4SA 4H27A 5IWAB 3NBKA 3VBEA 5J2TF 1UJ2A 5CLGA 3AETB 4TQGA 4HQFA 1C8BA 2V8BA 2REBA 3Q9LA 3JSAA 3H2GA 3OD5A 4LI0A 3MELA 4TQAA 5AHOA 1V1MB 4FGSA 1JDBC 4IHQA 3VRHA 3RS5A 2QK4A 4NS1A 4UHBA 4UEOA 4LYFA 3P94A 5A0TA 4PICA 1NBMA 3IVCA 1PUJA 3AI2A 2YFYA 1WKCA 4PG8A 3L1JA 4NZ9A 3PNKA 1ZGGA 2VSNA 3FNRA 4GD3Q 4RKYA 4S1OA 2ZIXB 1NNLA 1RCUA 1VL6A 3MRXA 1YVRA 4K6MA 4MI3A 2JHAA 2YW2A 3WMEA 4QEDA 3RF6A 4QJBA 4L4RA 3C87A 3C4QA 4I1YA 4Z9BA 5C9ZA 1E3SA 1V43A 1XTRA 2OP0A 3TK1A 1OUMA 3DZIA 2FE4A 2IS2A 2UZ1A 3DBHA 4FC7A 1O9BA 4IPTA 5ETJA 3G89A 1T10A 3GWZA 5A4MS 2OOKA 3MJEA 4JJKA 4E11A 1FBTA 1RCTE 1UJBA 2FPOA 2QAJA 3HDQA 4PC7A 1KNXA 2VNSA 1G8HA 3OPQA 4QBFA 2OGZA 3USES 4F38A 4L16A 3QNUA 2VUSA 4DC1A 3G0DA 4TKUB 2Q3MA 3NIDB 3BTOA 1M1NB 4II2A 1UQRA 2IZ6A 3H9EO 2DHEA 1FW8A 2YTZA 3PUXA 3KT0A 3TI7A 1P2DA 3LSYA 5FBVB 2WB2A 4YAWA 1W75A 4MAFA 1B3BA 3AYXB 4I1VA 4NBKA 4DV6B 2W93A 1CKEA 2IZ1A 3ONDA 2PAAA 1QDLB 2QMHA 2PUAA 3VYWA 3M49A 1E3LA 2VT2A 4LHXA 2C7RA 2BFCB 1TJ4A 3PE4A 4OKIA 1SG9A 3RF7A 4J1TA 2CE7A 1RMTA 4DM4A 4YRDA 1Z73A 1FLNA 3KTOA 3S81A 5C51B 3EA5A 3LCCA 2AE1A 1ML3A 1WV1A 2O7VA 3G2PA 3MWDB 4IUBS 4QG3A 4D6PA 1HPLA 1XBTA 4ZICA 4BZQA 1P8JA 3IBCA 2QGFA 4FXPA 4B8ZA 1YQDA 3GEBA 1N0IA 4HI0E 5A7FA 2H1IA 2VP9A 5A7HA 1P9LA 1JU9A 3CY6A 4NPHA 1NX9A 4AP5A 2OQRA 4X0EA 3ZQKA 2ZSIA 4P84A 5LP1A 3KG2A 1SXJE 2IYFA 4KJXA 5HJ2A 2E48A 3KZKA 1NV8A 2ZJ6A 3O74A 3UKDA 1USUA 4HH4A 2WT9A 3PUKA 1IHUA 3GV0A 3BJEA 3NHRA 2H65A 3AT1A 4JBNA 4NVRA 4PAMA 2WY2D 3NR2A 4FVTA 1UQTA 3IERA 1HEUA 4PSAA 4Q7LA 4F4JA 5HIJA 5KSOA 4Q3KA 4WMLA 3ZJ4A 1I4EB 3DV9A 4PY2A 6ABPA 2ZZMA 1CF2O 1TI7A 1J5EB 4ZFNA 2O3QA 3VPSA 4UBLA 5EWLB 5A06A 4G0ZA 4KXUA 2V55B 4OM7A 4YUVA 5ENDA 4A2PA 1TX4B 4HNVA 1R8SA 2C5GA 3QUTA 2ZE7A 4ZVLA 3S44A 3TAHA 1BMFA 4A4DA 3KQNA 2ST1A 1SXJC 4AYWA 2ZM5A 3UJ6A 5HUJA 1PS8A 2ZRBA 1XCMA 1ZW1A 5IX8A 1DGQA 5AI9A 2PS9A 1UEXC 2YJ3A 5DLYA 2XA1A 5L8VA 2IHNA 2XYRA 3RV3A 1KEKA 1GPH1 2JJYA 3F46A 3TGLA 1N2EA 1DHTA 1X9HA 4OHFA 3R7BA 1VE6A 3ZD6A 4HDRB 2AXPA 1QVZA 1P4RA 5IK2A 4RF2A 4XCQA 3RAPR 4JEMA 2GA9A 1OI2A 1J8MF 1RM0A 3LX8A 1U3DA 2FJPA 4LY3A 2G82A 3D2CA 1HDIA 2XTJA 3TTWA 4C0KA 1W0JA 1E2DA 4JDUA 3EEQA 1U2SA 2KHZA 4AF6A 2OQIA 3ASUA 4MCHA 4RH1A 4ZYYA 2IYSA 1B0PA 2G71A 3KJGA 3KVNA 1O9GA 2HXGA 1ESDA 4LAFA 4ZOCA 4G0PA 3QF4A 3HFRA 5DK6A 3BD7A 2GILA 1GRCA 2D00A 1D5WA 4GNRA 1QBGA 4R1TA 1QLJA 3P2EA 1NTRA 4RKFA 4UAUA 1XXHB 1LVGA 1M5RA 1JJVA 4MVYA 1GY8A 3NYRA 4W5HA 3EXEB 3B52X 1Y80A 4RHCA 4GMDA 4MIOA 4GPBA 1L7OA 1XAHA 2DLDA 3DMDA 2Q2OA 4KE8A 4BVLA 3I8SA 4DSZA 4IDCA 3LY8A 2GD0A 3WIOA 4EZBA 1USKA 1PJ8A 1XMOB 4KI0A 2MDTA 2PCLA 4DC9A 4KNYA 2HO5A 1ADFA 4K9QA 2HIAA 3PKIA 3R6TA 4TN5A 1IN8A 1SXJB 1LPAB 1OV4A 3EQ9A 2G88A 1U6JA 1T0HB 4LQ4A 3OH8A 5JDCA 1S3IA 1V8OA 1I33A 2FG6C 3ORSA 2AFVA 3E81A 3OEWA 3K5WA 3A3YA 5D7BA 1XI2A 4JLAA 3IKMB 4BKMA 2IYUA 1WOMA 3HBAA 3DPSA 2VA9A 5TC4A 1YB2A 2GJ4A 3AY7A 2FZWA 4OO3A 1YC5A 5EIOA 2GMWA 4JYAB 1T8YA 4V3BA 1UM8A 2JGEA 2ZBFA 1R8XA 4XUCA 1YL6A 3BBPA 1VXOA 4OIFA 5KX5F 3AEUB 4WN9B 1ZSNA 3AZQA 1WEKA 2YHBA 3PWTA 3VZQA 4BKUA 1R50A 3QUCA 1SVSA 4FYXA 2JD2A 3WKAA 1F1JA 1ORDA 3WSVA 2WAOA 4YV0A 4TGLA 4OJNA 4C7XA 5CXXA 5KS2A 3GLRA 1RZRD 2YXBA 3E5RA 3RVPA 3VVMA 2JGKA 5CD1A 1NW8A 2C9BA 2QIPA 1TADA 3THRA 3UFBA 5JNVA 2AFHE 4NAUA 2PK3A 4D43A 4C7OB 1G7RA 1TUBB 1TQHA 1CVRA 2PNFA 2P9CA 1ZZEA 2FK7A 1WUYA 3EXFB 2HD4A 3QMMA 5FQNA 2FMTA 3L1UA 5FPQA 2EJTA 2QTRA 4OAOA 1E7MA 1K86A 3U6KA 1YO6A 2VQ6A 3PV0A 5LIPA 1Q0RA 3QG1A 3TRDA 1XDWA 2ZI9A 2FN7A 3X1YA 3OPYA 2P77A 1RWQA 1WB9A 3RHTA 5DM0A 4GC5A 3FPKA 1BS1A 1LA2A 3L04A 1UFOA 4IIUA 5CYFA 3V3KA 5G41A 2VF8A 1JNYA 2R48A 1U2GC 2Y1KA 3HB4X 3K72B 3VU1A 2R00A 2H63A 3TZEA 4ESEA 3U1BA 2J9ZB 1ACMA 2C2XA 2FPUA 5KNLA 3CLRC 3M2PA 5BXYA 1IWPB 1VHWA 4JI2B 1MQAA 5FJIA 1PW7A 1R15A 4US0R 1JIXA 1K27A 1FXWA 4RIGA 4RK5A 4F2HA 1PSZA 1JB1A 3JZIA 1XLUA 3LPDA 4TWBA 4EECA 3LCRA 1LFDB 3DTTA 3RC2A 1FYVA 1TVKA 1KIAA 2ONJA 3ZBQA 1KZ7B 5C1OA 3QI7A 3OZIA 1V7PC 1YAJA 4R9SA 2DWCA 4L27A 3V9PA 3RIYA 1I4OA 1KGSA 4UULA 1RU3A 2AN5A 5EYPB 1E2UA 4H1TA 4D4LA 3QXHA 4MEAA 3HUDA 5D3MB 1X19A 4EGCB 3DLIA 2BUCA 2UVQA 2IRWA 5JQGB 3UICA 3W05A 4XJXA 3OA0A 4XLZA 2REOA 2XNKA 3FNFA 3AFOA 3TQFA 4PPNA 3JU3A 4Q6BA 4TXJA 3HVRA 5DTRA 1NYQA 2JB9A 3BKWA 5PGMA 4EJSB 3IDQA 2NTEA 2PZMA 1JLMA 2HU2A 4EB6B 8LDHA 4TTPA 3U5ZB 4IZ6A 5D1NA 1BGVA 3EEIA 1Z5NA 2EFEB 4UZFA 1IY8A 1BW9B 4RPLA 4C22A 1VKHA 3DWIA 3ESRA 3M3PA 4LMAA 1DBPA 4FWTA 1WLSA 1QRDA 1QGZA 3GEDA 2LW7A 2O1WA 2WJ4A 1E2LA 1NBAA 5LNK1 3A1VA 4M2LA 3BILA 3WIVA 3G0HA 3SK0A 2VUIB 1GA1A 1LF0A 2A2ZA 5D51S 5SYNA 1UIMA 2FFHA 2EU8A 2RHTA 2XXAA 2UYQA 3RLIA 3IMFA 4PRLA 3ZU5A 2D1FA 5LQUA 1K08A 3DKRA 4F3KA 4R8RA 4DR4B 2LIPA 1GPBA 4E5UA 5LP6B 3H7AA 5AP9A 1QGED 4G8DA 2P0AA 4N3GA 4YO8A 3N3BC 4DW8A 5IEJA 2O54A 1HA3A 4E07A 1G6HA 1M1NA 2WD8A 1T36B 1KAMA 4NJOA 1SC1A 4UDYX 4S2EA 3RVMA 5HNKA 1OBHA 3G82C 3LNCA 1SCBA 3OX4A 1RC8A 2FI1A 3PQFA 4J9VA 3BL6A 4FFOA 3AU8A 3AJAA 1L8QA 3LC1O 5H81A 3RT1A 2F8TA 5MGBA 1P2TA 3CW8X 3IDZA 5IVKA 1GZ6A 3BEOA 1L7QA 3W1VA 3HRKA 2QD2A 1GZ5A 3K0BA 4W8OA 2HUNA 4UUPA 3PGXA 4C5AA 2GR9A 4GI3A 2XZPA 5CB8A 2GZRA 3PPXA 5HSGA 5KQMA 1DIAA 4MPRA 3D4NA 4B34A 2WJHA 1VP9A 2ZI3A 4NZOA 4WZBA 2ZQZA 3I9NA 3IR5A 1XVTA 2LWIA 3NNSA 2G1UA 3RFVA 4NFYA 5K99A 5KOJB 1KSGA 4WLFA 3U3KA 2IXDA 1Y81A 1G8YA 2NAPA 4EABA 3NPAA 1QORA 1TIBA 9GPBA 3HRHA 2QG4A 2OECA 3DA8A 5IAGA 2NU6B 4Z9XA 1ISFA 5JQGA 5HJ5A 4RKEA 3R2JA 3NQ41 4WGGA 4U9HS 3QEBZ 2GYVA 1RXWA 4GL2A 2Q8PA 4LPKA 3ZNNA 1FQOA 2ZUTA 2QTHA 2VS1A 1V4VA 2BT4A 5JY1A 5LJIA 2QP4A 1E6WA 5LU9A 4H7EA 1REQA 3X1DA 4ESHA 1NOIA 3BM5A 1C9YA 2CNOA 3W6PA 4CKWA 2GEVA 3FKSA 1IXKA 1W1WA 3GVCA 1AIPA 3M5PA 1LSJA 4NV1A 3V1NA 5KEIA 2WG0A 1XYGA 4O59O 4YDRA 5L45A 3TIXB 2BKEA 2C1XA 3OFSA 1E1MA 1T4CB 5EEGA 4WOBA 5ILGA 5HQ3A 3VHLB 2ONCA 1G3MA 4CM8B