2WWGA

Plasmodium falciparum thymidylate kinase in complex with dgmp and adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
TDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords THYMIDILATE KINASE, PUTATIVE
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwgA00
3GJ7A 3IIJA 1E2IA 4JYCA 3QKRA 1M7GA 3V4RA 2XNDA 3RYTC 3EAQA 1Q1BA 5DN6A 3X1DA 3BFKA 2PH1A 1EFRA 1X8JA 3PFIA 3WBKA 1N6IA 1Z6AA 1TMKA 1MRNA 3GCGA 2A7QA 2X2FA 1SVLA 4KVGA 4BQSA 4RD4A 4OHWA 5DHFA 1ZU5A 4EJSA 2LKDA 1XB2A 1R8SA 1P4SA 4KITB 3AVXA 1OFUX 1KMHB 3T34A 4C0KA 5C18A 2OHFA 4Q00A 4N0EA 3VHXA 4QXAA 1E99A 2RGGA 5EXTA 1P62B 4B3BA 3M0EA 2JLXA 1OYYA 1IN4A 2QI9C 3D6TB 1W47A 1QHSA 4PC1A 2WPDA 3HYRA 2J46A 1AKEA 2REOA 4DSOA 4DDUA 4DCSA 2QZ4A 4HB4A 3RANA 3MRSA 2QT1A 4BFUA 3AP3A 2NGRA 4BZQA 2JJ2A 2RGBA 4HAWA 2VP0A 4Q9HA 4EFMA 4BLOA 4EFNA 4DDVA 4I81A 4HAZA 1N0UA 4PZZA 2OG2A 4TTRA 2DHRA 2J1LA 2GJAA 4JJZA 1FTNA 1I4DD 4M2LA 2Q9BA 4FXPA 4OI1A 4C3ZA 2EW1A 1S4QA 3QPUA 3EIHA 3AVWA 1W1WA 2KJQA 3AVOA 2GXQA 3GJ3A 1D8TA 3TUIC 2A5YB 2ZS8A 1ZC3A 2J0SA 3WP1B 4Q4JB 3U60B 3QXXA 1VYTA 1Q12A 2LWIA 4D0NA 3ZVLA 5C1BA 4RCYA 3DO6A 4AG6A 1DG3A 1TPZA 4A92A 2ERXA 4DBLC 1KI2A 4W9MC 1L2TA 1NKTA 1J99A 2WKPA 3K9GA 4C2UA 4PZLA 2IC5A 2CNWD 1NSFA 2JDIA 3HPRA 5DI9A 4GOKA 2IUTA 3GPLA 4AURA 4A0FA 4JVLA 1HE8B 1GAJA 2IYQA 5LPNA 1RRFA 4M1OA 4OK5A 2Q3HA 3K0AB 1DTSA 1FX0A 1K6MA 3LXXA 3CWQA 4LOAA 1E2KA 3MWJA 1EX7A 1KY2A 3VR2A 5B58C 4MGYR 521PA 1H8HA 1LS6A 1W2HA 3SE0A 4XD7D 1DAGA 2VHTA 4HLUC 4US2R 1Z63A 1GL7A 3AVPA 3GEEA 1XTQA 1E32A 2J0VA 3WMFA 4WAUA 5DLQC 4AG5A 2ZIAA 1FL9A 1S9HA 3PUWA 2XJ4A 4DRZA 3CB4A 1NKSA 2IF0A 2YNMA 2C9OA 3SYNA 1MH1A 2J45A 2ORIA 1RC8A 3U3RA 1JAHA 5K8TA 1Z29A 4AY2A 3F5FA 1EWRA 5G41A 4I99A 1FOEB 1SVIA 4P4SA 3UG6A 3SS8A 5IRCD 2BMJA 2V55B 4JLKA 2ZRIA 4GOJA 4YDHB 2ODBA 2OAQ1 4LYJA 2FU5C 1NMZA 4Q4AA 4DHEA 4KFSA 2W2VA 2R44A 3J81k 1T9HA 2OO7A 4BECA 1KDPA 1HYQA 6Q21A 1CR2A 1QF9A 1IY2A 1E96A 2Z0MA 1KK3A 1Q57A 2FE4A 2OUKA 2Z6VA 1QVAA 3I5YA 1XMSA 1Z2CA 2QMEA 1DBSA 2CL6X 1J2JA 4JBYA 5FTNA 1QZXA 2ZU6A 3EA5A 3I72A 3L2OB 2QP4A 4WVFA 5EP4A 621PA 3BAFA 5CYOA 3FHCB 1XD9A 2JAQA 2GA8A 3CO5A 2ZE6A 4JLAA 3K70B 2OSBA 2HXSA 4I4LA 4WBSA 1AIPA 3N70A 3NC0C 2E1RA 1F2UA 3P4XA 2G3YA 4MGIR 3KUCA 2NPIA 2VIIA 3NWJA 4UNPA 5F9HA 2VHQA 4BLSA 4B48A 1DAFA 3IBGA 3SBEA 1XTIA 3TNFA 5EE5B 2FNAA 3KQUA 3TAHA 3L8YA 4OJKA 1E0SA 4Q48A 2FZLA 3PEYA 3HR7A 2V1XA 1VTKA 1RKBA 5GJCA 2CXXA 2MMGA 1NMXA 4BLRA 5P21A 2FPMA 4C2TA 1PVOA 2C99A 4M0LA 3PUVA 3BOSA 8OHMA 4EPRA 4LYHA 5DHAA 1LV7A 2GK6A 4EKDA 1XMIA 2ZVQX 3MWYW 2GRJA 2ZRGA 4RJLA 1CR4A 1OXXK 5SZJA 2F43B 3B9PA 4OYHA 3H4MA 2F9LA 2UZ3A 3IDQA 4TZ6A 2QPOA 2O8EB 2MMCA 1SKYB 4HUQB 5ANRB 2XAUA 4K8OA 2GZAA 3PIRA 1QHHB 2KBFA 1BOFA 1TF5A 4D4JA 3TH5A 4GNKA 1V5WA 4QBGB 2ZS9A 1YVDA 1CR0A 3D31A 4TZ0A 1L7VC 1OV4A 5KSPA 1NVWQ 5HR5A 3T1VA 2V9PA 2JLRA 4YMUA 1XJQA 5AUPB 4B3FX 2ODNA 3BJIC 4LJ5A 4PAMA 1L4UA 2PEZA 5G3YA 4D2IA 1KGDA 4O3MA 1CJVC 3BS4A 2O8CA 1YR7A 2BV3A 5FBQB 4TLBA 1KSGA 4EJSB 4OK6A 1WB9A 2J87A 4HLDA 3RRNA 1MRSA 4DXAA 3GLFB 3T12A 5DSZA 3SHWA 3QY0A 1S3GA 4P31A 5SZKB 1XDBA 2AK2A 4A0RA 4KBGA 3SJBA 4Q4HA 3I8XA 3QBTA 3GLHA 4I1OA 3AF4A 4IOLA 3MWLA 2OEPA 4QGGA 1YRBA 3EWSA 1IQPA 4OI4A 3WMEA 1KAGA 2RHMA 2Z4SA 4LUCA 4D4LA 3CRW1 4CEHA 2Q6TA 3SJCA 2BBSA 1XEXB 3SJAA 1XPRA 2GILA 4Z54A 5IT5A 1FP7A 4TMVA 2CCJA 4RD3A 4B3DA 1UM8A 1J90A 1TQ6A 2D62A 4B43A 3QG5A 3GJ5A 1ZNYA 1G3UA 4GBMA 2WSSA 3U5ZB 4GL2A 3Q7PA 4KBFA 3M4YA 3IEUA 1T0JB 1RE0A 2HDNB 2HYIC 2XXAB 2FJUA 1S0UA 4DLWA 3QE0A 3LW7A 4ZIRA 4A36A 2UVQA 1C1YA 1IY0A 3KFVA 3CUEF 4LRWA 3U3OA 1ESMA 5F98A 4C7OA 2CHVA 2NZJA 1JEEA 2RGXA 4R2IA 3PQCA 4PC3A 4YXWA 1OXTA 1DVRA 1OPXA 3H84A 3HJNA 3K0AA 1IJFA 3D7MA 1G21E 1U94A 3BE4A 2XZOA 4Q9JA 5GJBA 4BLPA 1WDTA 2GVDC 3BFXA 4E5UA 4L4UA 1VPLA 5AK0A 3S1AA 2WTUA 5EJEA 2DCUA 1E1RA 4CW7A 2YINC 2ZRCA 4DB2A 2DFTA 3OE7A 1WF3A 5TVKA 4DKXA 4NCHA 4QC2A 4A2WA 1NBME 3B1WA 5K8UA 5HKKA 4TL7A 4LZZA 3I32A 2BOVA 2G77B 4OK3A 5C46F 1AS2A 2EVWX 2XZPA 4Q4JA 1JB1A 2AWOA 3NDBB 4RD1A 4ZPXA 5GJWC 4EPTA 4XWKA 1P2VA 1ZIOA 1XJCA 2J0UB 3T35A 1E0JA 1RIFA 4UJ3A 2X19A 4TLAA 2OESA 3U6BA 5EXPA 3DMDA 4Q7LA 5GVSA 3AQ4A 1M74A 3N2EA 3SQWA 4B2PA 5JJLA 2VSOA 2QA5A 3Q9LA 1JECA 4A8JA 5AJXA 2JGNA 5FPHA 1DADA 4ZV4A 2QT0A 3FKSA 4XTRA 1K8RA 3AVQA 4LBWA 5UKDA 2IWRA 3RWMB 3CM0A 1GRNA 1QG2A 2NO9A 2GNOA 3UMSA 2H8KA 2IWHA 4ESHA 1G3QA 1TQ2A 3IGFA 2V1UA 3IO3A 1FQJA 5L3SA 2IBMA 1CJUC 2YWHA 1Z6GA 4F4IA 3MWKA 2GTPA 3B13B 4CF7A 4TTPA 3NH6A 1EFUA 3PVSA 2NG1A 3CPJB 3U61B 1CKEA 4A82A 1CEEA 2QP9X 4ZDKA 5L8VA 3A4NA 2AXNA 2VHUA 4AC9A 2ZSDA 3P20A 2F7SA 3SYKA 1PLKA 1XTJA 1A7JA 4CVNA 4CEJA 1NVXQ 1GL6A 1DO0A 1KYIA 3B1XA 4MDEA 2NIPA 2ZAOA 4B71A 1DPFA 2Q3MA 2VTKA 5TARA 5JSZB 3CR7A 2HLDD 3DM9B 2BHRA 2ZI6A 2PT5A 2QGNA 5CDFA 1E79D 4KSBA 1G18A 4ZCIA 3CRRA 2QTVB 3BRWD 3QXHA 2BCJQ 2KSQA 2ZETA 4PHGA 1FUKA 2XOKD 4FINA 3MG9A 1Z47A 3P1JA 2E87A 2VSXA 4NHOA 2GZHA 5EP2A 1W7AA 3KTAB 1HUQA 1L4YA 4ZO4A 1TNDA 1M6NA 3NBZC 1HURA 4C0SA 2XSZA 4BFWA 5LB4A 1CJKC 4C0JA 3AUYA 3K0SA 4YMTA 1W4AA 1AJEA 3U4QA 3EA0A 5K8LA 2IEZA 3R20A 1NLFA 1QHNA 2CCKA 4YDSA 5IF9A 2ZPTX 4ACAA 4Q7MB 3S1AB 4QRHA 3BGWA 2OILA 1N6HA 1J8MF 1KDTA 3KL4A 2RGAA 3GJ0A 1DAIA 3L82B 4A2QA 2NMVA 2O8FA 3L0OA 2B8WA 4JLBA 3R9XA 4MKGA 4MUBA 3W8RA 1QBKC 2A78A 3IQXA 3W90A 2X8AA 5CIWA 1VDZA 4BWYA 2ASEA 1TF7A 4AK9A 5AJYA 2HXYA 5JZVA 3CRQA 5DI3A 3AVYA 2J9RA 1R0XA 2RB4A 3PUZA 2PMKA 4QKQA 1XNJA 4FCVA 4IVPA 4G5RA 2BKEA 2ZR7A 2GCPA 1XZQA 3BB4A 5TY0A 3HR8A 1GTVA 1F48A 4B47A 1Z0DA 3WHKA 4JJKA 1E0AA 4PQFA 3UWKA 2PZFA 2ZJ2A 2ZRHA 4KLNA 4TMZA 5KDLA 4CRWB 4FIDA 2XB4A 3EASA 1F60A 2QY9A 4G5SA 1HV8A 4ZI3A 2XSZD 3ZZTA 2IA5A 4NYJR 4IHQA 3CH4B 4V0MA 4E03A 4EQ6A 2XOKA 2J5XA 3ETLA 221PA 4V0LA 3X1XA 1NJFA 4DB4A 4D0GA 2JIZD 3NBXX 1GIAA 3TKLA 4S2EA 1K5GA 4TYYA 1B0UA 2QBYA 3K09A 1GDDA 5J5CA 1BYIA 2P0EA 1UBGA 1NN1A 2Q21A 4KYUA 2C77A 3GLHB 1TU3A 2QBYB 2FX3A 4KAXA 4Q9LA 3SNHA 1DEKA 1SQ5A 1NSTA 2H17A 2GXAA 1NN5A 4A0GA 3LFUA 3PITA 2ZJ8A 5JWOA 1XD2A 1X6VA 1PUJA 1WMSA 1UDWA 1R0YA 3A1WA 4IDNA 4KXFB 4Q66C 4NKRA 3AF3A 3CNLA 4UXHA 1FNNA 3I92A 4Q7KA 2EU8A 2IYLD 3AEZA 2HT6A 2O8DB 2JASA 2ODEA 1M34E 1G7RA 4DCTA 3CNOA 1NMYA 3CLVA 4NTZA 5JWHA 2RCNA 2CHGA 1CIPA 2FOLA 1N5IA 4LHXA 4B3CA 1LVGA 3UWOA 4M4SA 2GETA 1ZD9A 4C0LA 1Y3AA 2IHBA 1T6NA 3FKSD 3BB1A 4QNMA 4B3GA 2QAJA 4A1FA 1HY3A 1XMJA 3TE6A 1LF5A 1FMJA 4NZYA 2KE5A 2WIAA 3GJ6A 2ZRJA 1ZJ6A 1UKVY 2WJYA 1KSJA 4Q9KA 1VG9B 1CJMA 4A6XA 5ELXA 1EFTA 3BH7A 4M9QA 4Q1AA 4HB2A 2OXCA 1XFAA 2FV8A 3GJ4A 4LV6A 3OESA 4Z8YA 1OXUA 4B73A 3JZAA 3OEHD 3RDPA 2PBRA 4MRVA 3ADDA 4QJ5A 4Z8XA 3GEIA 1OH6A 2BBWA 3VX3A 5DO9A 2WVJA 3RS5A 4CT4B 3PEVA 1CLUA 1GOTA 1DG1G 1E2EA 1X8LA 2V7QD 1P73A 4PSVA 4GZLA 3LDAA 1UF9A 2ZANA 5HKKD 3HU2A 1D9XA 2ZRKA 3KX2A 2ZI7A 1FTSA 2WJHA 4GOXA 4RZ3A 4DZZA 2ZJ5A 1R4AA 1Z6YA 1M7HA 3NDPA 2BM1A 5FH9A 3ZVNA 5H70A 4URZR 5FTJA 1KI7A 3KKNA 4AD8A 1VYUA 3DOFA 4IJMA 3GFOA 3ICQB 3V9PA 3FMPB 1TF2A 4QM6A 4DVGA 3RS3A 2A3RA 5L3VA 3THWA 4YMSA 4DUGA 1P5ZB 1Z22A 3CX8A 2VP6A 4LPSA 4XH9B 3OIWA 4BFVA 4HYYA 1II0A 3SDZA 1RFLA 3SHFA 3WXMA 5F9FA 2ZRDA 1GWNA 2I1QA 2IS2A 2Q0HA 2H5EA 2JA1A 5JCZA 1F6BA 5JHGB 3QXCA 4B35A 5FPKA 1N6OA 4XIGS 4P4SB 4C30A 4KCGA 2CMKA 3PJRA 4J0QA 3E1SA 3IO5A 2DWOA 1KI6A 2VA8A 3G0HA 4ABYA 5G40A 1NRJB 1P7CA 2CHQA 2YVUA 2WICA 5FBVB 2R2AA 2FZ4A 4V0ME 3A37A 4NBSA 2ZE5A 3UANA 3BK7A 3FE2A 5AR1A 1GRQA 2YWGA 1ZD1A 1G3IA 3QNUA 5HE8A 4U00A 2IS6A 4Q19A 2HEIA 5FFMA 4DDWA 3AP1A 5JI2E 1WBDA 4YC7A 1VG8A 1OYWA 2WWGA 1RRCA 3MLEA 2PMDA 2ZEJA 2Y8EA 4JZKA 2R65A 2ZAMA 2ZREA 3NIBA 3TW8B 3LRPA 4MYTA 2ANCA 4JKIA 4P4TA 4Q01A 2ZSEA 3RWOA 4FI3C 4UXIA 1DARA 1JALA 1NNEA 3PCRB 1BMFA 3CF6R 2A5GA 3QJYA 3RSLA 5HTKA 3FWYA 3FFBA 4BFZA 2A5FA 3MAAC 2RKOA 3A8TA 2FGJA 3GD7A 3HU3A 1G3MA 2ZTSA 3KKPA 4H1UA 5TDHA 3SOPA 3LVQE 3V4FA 4CEJB 2NTYC 3NHBA 3KJGA 4JKYA 1JEDA 2J7PD 2XTMA 4AIIA 4B33A 2BWJA 2F1JA 3FMOB 4QBIA 1KIMA 3BXZA 2D7CA 2OFXA 2BBTA 3W8NA 1Z06A 3R8FA 2O8DA 1IONA 3ZGXA 2BMEA 3QIAA 1Z0IA 2AD1A 3THYB 1ZU4A 3B7GA 5IK2D 1U8AA 3UMRA 4N3NA 3ICEA 4Q7JB 2IYWA 3VR3A 2C5LA 1CJTC 2W2XA 1IXRC 3L43A 2ZR9A 4PZYA 2IYYA 3IKJA 1WCV1 3EC1A 4CYMA 1CF4A 5FUWA 5KU1A 2GHIA 2QQEA 4OHZA 4TQUS 5G3ZA 4W7SA 4BASA 3LVRE 4LJ8A 1MO3A 1DAMA 1XEWX 1S1CA 1NIJA 4EDHA 2VHCA 1E9AA 2OFWA 1OT3A 5LD2B 1JR3E 4RY2A 2ONKA 3E5HA 4KI0A 1EFHA 2IYUA 3RVBA 3MJHA 3TQCA 2WV9A 3ZVRA 3UPUA 4HAXA 1OIVA 1N25A 1XEFA 2JJ1A 3BFVA 2BVNA 2DFLA 5J4LA 2YKGA 4C4PA 4UNRA 1YZTA 2GCOB 1ZCAA 2BBOA 2V6IA 4A9AA 3TUZC 5AWFC 4OBEA 3LX8A 3BB3A 1EG7A 2GF9A 2P5TB 2A5DA 2VP4A 5J4HA 3KJEA 4PHFA 4DLXA 4O0MA 3KQHA 2CL7X 5M04A 2B7BA 4JVNA 1NVVR 2B21A 2UKDA 5HCNA 5E7IA 3BWDD 2WJGA 4UXJA 1ZYUA 1ZIPA 1Z0FA 4US0R 1WXQA 3VKHA 1G8PA 1RRGA 2QMHA 2OLKA 3OZXA 1RYFA 3OFND 1CS4C 1KTVA 1UBCA 3PG5A 4P0TA 1TQDA 2NPFA 3VU9B 1US8A 5JCPA 1IXSB 1N6RA 5FBWB 2QG6A 2O8BB 2VYFA 4MITA 3TLXA 3KB1A 3O47A 4JL8A 2C98A 2O0JA 4LHYA 2FA9A 3UXMA 5KNBA 2PCJA 1MO6A 1VHLA 3T06B 2VP5A 2ZYWX 4M53A 3D8BA 4ERNA 2MSCB 1J7KA 1Z2AA 5FBLB 3K9HA 3PEWA 3DOEA 1BS1A 5DISB 4DLYA 3IILA 4HAYA 4A15A 4P33A 5EZ5A 5AUQA 2DR3A 2ZR0A 4Q1EA 2IYXA 3AGQA 1BO6A 1H8HD 4HZUB 4XD7A 5FUVA 1R8QA 5JJIA 2D3WA 1SVWA 1Z07A 4XVQA 5FPTA 1HT1E 1SKQA 4LV5B 1XMVA 1NI3A 4CDGA 1U99A 3K9NA 2VSFA 1H8EA 3H86A 3DL0A 2JLQA 4A8JC 4IDQA 5KSZA 2DPXA 3TSOA 4OQFA 2JDID 3NC1C 3GLFE 1QVRA 1D2NA 3QF4B 5BQ5A 4URVR 1P2TA 3CBQA 4U5XA 3LQQA 1YZUA 1KO4A 3W3AA 4LC1A 4OQLA 2W00A 3A1VA 1EK0A 4PR0A 2FWRA 3BC1A 1JJVA 5KNCA 5LDDC 4FWIB 1MO5A 3IUYA 1VKJA 4C0QC 4IEIA 4KYIB 3T1QA 3C5CA 4PTLA 1KI1A 4DDTA 4F93B 2IW3A 3A58B 4F38A 1W2GA 3ZDQA 3ZQ6A 3L0IB 3WYFA 2QQ0A 4JYBA 2G1JA 3LBNA 2WIBA 1EESA 3L8ZA 1JAIA 3GJ8A 2I4IA 4D81A 5FTLA 2FSHA 3RRYA 5E95A 3QVUA 3CR8A 3ZLJA 1ZAKA 5D3MB 1P72A 3T5GA 3SR0A 1GNPA 2D2FA 1Z0KA 3AVTA 2NOAA 3U3KA 4WZAE 4AWXA 1RPZA 4EAQA 2XGJA 4RCZA 2AR7A 3ZH9B 1R5OA 1MT0A 1OHHD 2JLZA 1ZC4A 4YMWA 4G0NA 2WPDD 4PO9A 1OSNA 3SC3A 1OHHA 4NU0A 3VKWA 4LY6A 2TMKA 1G4AE 2G0NA 1OIXA 3KQKA 1GSIA 3AV0B 1FZQA 3RS4A 2IXFA 4AKIA 1TEXA 4TYQA 1B23P 4V03A 2GAOA 1KK2A 2YJTD 4LBYA 4P4UA 4TL9A 3WRXC 1GG2A 1SGWA 1G8HA 4Q1FA 2CE2X 1T8UA 1EFRD 4NCNA 1KO5A 1NVVQ 2OCBA 2ERYA 1KI6B 1TL7C 3EPHA 4MRNA 4DJTA 4Q18A 3REGA 4NYIR 1HEIA 4JSYA 3NTUA 2ZE8A 5FUYA 3EW9A 1G16A 1OXVA 3HPQA 3IEVA 4GP6A 3P32A 2V8OA 1NY5A 4POAA 1NP6A 1V43A 2HT1A 1E9DA 1LB1B 1UEJA 2XNSA 2CBZA 1XD2B 4WA7A 2JLWA 2PZGA 4QJ3A 4R2HA 4WXPA 1II8A 2F43A 3AUXA 1G5TA 2QNRA 3ZQJA 2QL6A 4NYIQ 1XRJA 2GXSA 2QMUA 2OAP1 3RAPR 5DGXA 5CK5A 4X8LA 1YKSA 4CIDA 3SYLA 1G7SA 5JBQA 1H8ED 1E2QA 1KKMA 3D3QA 4OHXA 5BW8A 2VP2A 1GKIA 1GKUB 1NIPA 1LS1A 2XJ9A 2ZSAA 3B6EA 4ZKEA 1KHTA 1XPOA 1E9FA 1ZW6A 2A9KA 4TL6A 2V6JA 4BUJA 1R6BX 4RZXA 1GITA 5FOVA 3ADBA 3PR1A 2GKSA 4KFTA 3VR6A 2CLSA 5JMTA 3KDSE 2P6UA 1O87A 3U7FB 1G8GA 4MRPA 2O8CB 2RGCA 3Q85A 3SU8A 1XXHE 2GJ9A 2ZYUX 4AYTA 1U8ZA 4ZCMA 4GDFA 4A8JB 5BYKA 5BN4A 1AZSC 3AKYA 4K46A 1E9RA 4JL5A 4KSCA 3E70C 3DMNA 2XITA 3I8SA 3WP0A 1HTWA 2FPLA 1E2GA 3M6AA 1TQ4A 2JLSA 2ZM5A 1FPMA 2QENA 3FTQA 4GPTA 3GLFA 5J47A 3AF0A 2C96A 4LK2A 2VQSA 1W0JD 4F7WA 1NVUQ 5EP3A 1XBTA 3OFNA 3K0EA 3R9WA 4GRAA 4UNQA 3FGNA 3MUFA 4X8HA 1IJEA 4IDOA 1G7CA 4B74A 2GXUA 2IUUA 2Q3FA 3FOZA 5FOUA 3K70D 1P61B 3QPVA 2HCBA 2NO7A 1E2JA 2FFQA 4TLCA 3R7WA 3W6OA 4NMMA 4BLTA 2F55A 1G19A 2A30A 4U02A 1E1QD 2R6GA 5JS7A 2QM8A 2BIFA 3TJZA 5FL7D 2DYKA 4FW9A 4IEEA 1TUIA 4OQNA 4JIMA 3KFXA 1M2OB 4HATA 2IYZA 4FCTA 5TB5A 5EE1A 4R7ZA 4G01B 4DT1A 4A4DA 4FMCB 2O8BA 3T1TA 4OHYA 2IL1A 1SULA 2FFHA 2K5UA 4Q02A 4TYWA 4AKGA 3PENA 1X3SA 2WAXA 3LNCA 1JXOA 4BFXA 2W2TA 1F2TB 1Z3IX 4G1UC 2JJ1D 4M22A 3QF7A 5FI1B 3SBDA 3IQWA 3X1ZA 2ZYTX 3BH0A 3CWZA 4R71A 2D2EA 2GZDA 1XPUA 3WYAA 1OKKA 1QHYA 1SZPA 5BWMA 4D26A 4AYXA 3TVTA 3I61A 4ZDWA 2AN9A 1IY1A 2QE7D 2C2HA 1P6XA 1X86B 4H9GA 5HPYB 2REXB 4TN1A 1E6CA 4RKEA 3EZ6A 2GJ8A 5GVRA 1ZMXA 2W0SA 3A1TA 3VX4A 1PZNA 4ZIRB 3KXIA 4CZ2A 1RVDA 1UKEA 4BLQA 3W34A 2GEDA 5LD2C 4WZ6A 1RJ9B 5IK2A 2CJWB 3OIYA 3WNBA 4B32A 1OLOA 1VCIA 1XEXA 2A2ZA 4KODA 5KDDA 4CGZA 1G5RA 1CR1A 3IHWA 3W5IA 2FG5A 1U2RA 5JSZA 4DCUA 1FFHA 1XP8A 4XVRA 5CJPA 5E3HA 4IDPA 1XXHB 4LYAA 3GQBA 3EPKA 2PT7A 3VHLB 2F6RA 2J7PA 1KZ7B 1IAQA 4KFUA 1R5BA 4C0BA 4ESVA 4LYFA 2P3SA 3A4LA 1ODFA 3THXA 2EFEB 2ZUCA 4Q1CA 1JBKA 3B78A 3IIMA 1L8QA 1OFTA 3WMGA 5TXGA 1E4VA 4DIEA 1E2MA 2F9MA 1BMFD 4NCJA 3C16C 4LX0A 2CVHA 3U4QB 1G4UR 4MKFA 1N5KA 2WM9B 4GMDA 5DNYB 1Q3HA 1WA5A 1Z0AA 5B64A 2Q9AA 3U2QA 5JLJA 3VNVA 2X1VA 1TEVA 2L0XA 3AH8A 4QJ4A 2Z5FA 3QBVA 2WHXA 4UJ5A 1DO2A 2OCAA 3DDCA 4IW3B 2IUSA 4HB0A 1VIAA 3LX5A 2Z83A 2WKQA 2IYVA 4QL3A 1Q1ZA 4L9WA 2ZYVX 3RC8A 1OFIA 3HU1A 4B3XA 3GFTA 4P32A 3LXRA 3GLHE 4MDFA 1AZTA 3EZ9A 3LV8A 2IYRA 2ORWA 3MCAA 3DPUA 1KMHA 2WSMA 2ZQ5A 3A36A 4FCWA 2AFIE 1YHNA 1T8TA 1OE0A 3LO5A 3TBKA 5FTMA 2GF0A 5E7JA 1QHIA 1UEIA 4LSGA 4BZXA 2C78A 1KO8A 4XVUA 2WBLC 5CM9C 1GZSA 4E09A 2C04A 4TSFA 2EFDB 2VHJA 1WBBA 2W58A 4MGZR 5HZHA 4JSTA 4Q47A 1AQUA 2WMOB 5F2EA 3KKOA 1D2EA 1Z0JA 5KYKA 2R62A 4Y0AA 3K53A 2QAGA 4PANA 4TYPA 3RS7A 1GUAA 1Q22A 2QSYA 1T91A 3DKPA 5BN3A 1G7TA 1KI3A 3W6PA 2ZI4A 1WRBA 2X2EA 2YOFA 1XEWY 2IT1A 1Q21A 2V4ZA 3DVLA 4DUGD 1ESNA 3TW4A 3DM5A 2DB3A 4TT3D 3TMKA 4URYR 1VIYA 4BPBA 1Q44A 1CTQA 1XU4A 3WRYC 1G6HA 3I4LA 2PX0A 1KDRA 4EJSC 1I4TD 1YZKA 4TMXA 3KTAA 1DAKA 3SI7A 2P65A 2XXAA 3Q3JB 1NG9A 1D5CA 1KK1A 2HCJB 1ZCBA 2HJGA 2P67A 3JVVA 4NYMQ 4O2RA 5TV2A 4ZDIA 1KSHA 1PLLA 2OLJA 2QU8A 5EE9A 1W36D 2V7QA 1CRQA 1X8KA 1P2SA 2H7VA 3BH6A 5JEEA 2EFHB 1LF0A 5CB6A 1SVKA 1Z6XA 3QEJA 3U7EB 5EZ6B 4DEYA 1NL3A 2FFBA 4E07A 2FEOA 4RFSB 4XOIA 3OEHA 4M1YA 1HQCA 3U6KA 1R5NA 1T4GA 1ZNWA 1P9RA 1CULC 2RAPA 2BCGY 2YV5A 3WBJA 1D9ZA 4P3YA 3TK1A 3THWB 1T0HB 4XTCS 3ZJYA 2AKYA 2BEKA 1I4LD 2IXGA 1MABB 1KDOA 4G5GA 5EQTA 5FR2A 5L3QA 1C4OA 3I62A 1PUIA 3ZVMA 3QXJA 2P2LA 4GFDA 3GLIA 1MO4A 2YOHA 4QGAA 4RD6A 2ZU0C 1NJGA 2FMXA 4LHWA 4F92B 1JXMA 4MRSA 1ZUHA 2ZJYA 2PEYA 2QORA 5H1YA 3R7WB 4PQYA 1HA3A 2UZIR 1SKYE 4L15A 3B1YA 2ZITA 2VPPA 3ASYA 2QRNA 2ZJOA 4JS0A 1QG4A 3ZS9A 1D6JA 1UKZA 2OT3B 3KB2A 1YZNA 5J4YA 2G0TA 1UFQA 2CLDX 1YU9A 2Q9CA 4OJQA 1FP6A 4LBZA 4G3XA 1HE1C 1X1SA 4CEIB 3TQFA 1P75A 2ZUBA 2J59A 1AGPA 4MYHA 3K70C 5JFGA 1A2BA 2ZI3A 2BMDA 2EYQA 1QHGA 3T15A 1OXSC 1S2MA 2ODWA 3E2IA 2JIZA 1RW4A 2PJZA 2WKRA 3Q7QA 4M1WA 5H68A 4ZI2A 5FTKA 1SXJD 3TVDA 2J7KA 4LI0A 3CIOA 4YONB 1KK0A 5KOYA 1P9WA 2CVFA 3K0CC 2EQBA 3UIEA 4HSEA 3T61A 5CK4A 3DEFA 4O25A 1A4RA 1ONBA 2W6JA 1BYUA 1CXZA 2ZRMA 4TLDA 2IYTA 2XEXA 3EC2A 4DCVA 2BEJA 1E4YA 1FW6A 1YR8A 4O2LA 2VRWA 4PC6A 4URXR 4XSGA 1VCNA 2C9YA 1I2MA 1AN0A 4RZUA 3ZYCA 3FDIA 1OW3B 4GP7A 5KPDA 4US1R 4ASUA 3FMIA 3R8CA 4II7A 1II8B 1Y63A 4JT2A 5KPJA 4L5BA 2FGKA 3F3YA 4DLUA 1E2PA 4BRWA 3W9YA 2VP9A 1QRAA 3VR5A 2G1KA 4V0KA 3LAWA 3SFZA 3ZS8A 3VR4A 3CONA 1UADA 4LJ4A 3C4JA 3ADKA 1XTKA 2ZE7A 1XX6A 5BN5A 2OBMA 4GT1A 1U0LA 2DFKB 3IHLA 1G1MA 4MYCA 4FD2A 3DHWC 4Y0VA 5D3QA 2GESA 3TR5A 4EPVA 4ZKDA 1G41A 2YYZA 1KO7A 4DSNA 4RD2A 2QSZA 3ASZA 4AKHA 2JATA 3FHTA 3QKUA 3MSXA 3THXB 4YMVA 2J0QA 2WWIA 2RMKA 3ZIAD 1AQYA 2I1VB 3KJIA 5FPYA 4KO8A 2EWVA 4JT4A 2VH5R 1K5DA 1S1MA 1ZVQA 1PJRA 1E2NA 3CKLA 3EZFA 3MGCA 1DS6A 1YQTA 4JLDA 3TUJC 3NBYC 1U9IC 1P9NA 4MA4A 1N6PA 1TU4A 1NF3A 4HZIA 1TADA 1Z83A 4BRUA 5TMPA 1Q20A 1YZQA 2CCGA 4I1VA 3BIFA 1E69A 4QM7A 3FMFA 4M1MA 4Z1MD 1E79A 2OE2A 3U44A 5B30A 4Q5IA 2KB0A 2HLDA 3SN6A 2GWHA 2VL7A 5DI3B 5CITA 3LBHA 2GEUA 1COWA 5CDFE 4ZCLA 4M8NE 3VAAA 1Q0UA 1KI4A 3C5HA 4PX9A 4TMWA 1JJ7A 3QOFA 5DH9A 1HH4A 5SZIA 2FSIA 4EPWA 2AX4A 1Z08A 2IF2A 3OAAA 4PXAA 3AKDA 1GNRA 1XTRA 1MABA 3L0SA 1I2DA 1OFHA 3QSYA 1E2LA 3WNDA 3OF5A 1WE2A 4V0NA 2YZ2A 4PSKA 3VMFA 2BKUA 1UPTA 3EX7C 2D06A 2GCOA 3NG1A 4OQXA 5DIFA 4NONA 1ZRHA 1EXMA 1GNQA 1KI9A 3PXGA 3KQNA 5AJVB 4IRUB 2KWIA 3IBYA 3CW2A 1OH7A 3K0FB 3G82C 4OI2A 1BKDR 1ZP6A 1JPNA 4PAOA 5HE9A 4Q4HB 1T5IA 1EGAA 2AL7A 4EPXA 5LBIA 1JPJA 3BD9A 3ND9A 4WW0A 4XSHA 5KTYA 3LW8A 4Q21A 5HCIA 2G83A 4DLZA 4N1AA 1S9DA 2AKAB 4PC2A 1RYHA 2R6CA 3TSZA 4JLPA 2BM0A 2QP3A 2RHDA 2WOJA 2C8VA 2QROA 3HDTA 5EE3A 2P6NA 5JJKA 4BEBA 3ZZUA 2NO6A 1YE8A 4TYNA 4W5JA 1R0ZA 2W6ID 3QVVA 2ORVA 3CX6A 1N2CE 2DY1A 3DKVA 5KO2A 1DAEA 1JNYA 1KJWA 1W36C 1II9A 1E2FA 4DIDA 2KI5A 2H92A 3EXAA 3QF4A 2D4HA 5J40A 1E9CA 3OE7D 3QKSB 4BFSA 3O8DA 4C0HA 3CZQA 1H65A 1NBMD 3TRFA 2REBA 1E1RD 5KSOA 1XWIA 2F1IA 3IPYA 1Z28A 1QDEA 1W5TA 5FL3A 2O8EA 3GLGA 2ZSFA 4MGKR 5BYJA 1Q3TA 1DOAA 2CK3A 4MRRA 1S3SA 3QPWA 1E2HA 3Q8XB 4LWZA 2HUPA 4YXWD 1LW7A 5J4KA 1PLJA 2P5SA 1NN3A 2WAYA 2ZRAA 3B8HA 3I73A 3TIFA 4URUR 3U3MA 3GLIB 1MOZA 1GRRA 1ZUIA 4D4MA 2NO1A 4PPQA 2G9NA 1EWQA 1SVOA 5L3QB 5C4MA 3VNUA 1YR6A 4BEJA 2J0UA 1SVSA 2CK3D 5JWRA 3C41J 1VECA 1SXJC 2PLRA 5FUXA 2WSSD 4ARZA 3Q5EA 3R9IA 4PPFA 1XCGB 1T3HA 2GCNA 1NN0A 2QN6A 2AHOA 2YHSA 3RRZA 1KMQA 3NKVA 4NCKA 1NBMA 3KKMA 1N0WA 2OBLA 3C14C 1ZM7A 4HEJA 1BIFA 1F5NA 3EIEA 3UMFA 2W83A 3AKEA 4LBVA 4G5QA 1S8FA 4UKDA 2FSGA 3A4MA 4C9BA 1SXJB 1NY6A 2WOOA 4IXMA 1N6LA 2W6IA 3GLIE 1G17A 1NG1A 2GBLA 2SHKA 3MJRA 3QI2A 4QOSA 4RSGA 1FX0B 1ZUNB 4LHZA 1DE0A 4GZMA 2JLUA 4PHHA 4QFMA 1X1RA 4KU4A 4M9SA 3PV0A 2CLCX 5H8WA 2YC2C 3SJZA 3TAUA 4B44A 1P2UA 4LJ7A 1ZD8A 3NH9A 4AYWA 3FVQA 3JVUA 1G9XA 4NP6A 3RRMA 3OIVA 3G5UA 421PA 4R98A 2BJVA 1N6NA 1FNMA 5CLLA 3NXSA 5JEDA 4M1SA 1E0KA 1GP2A 4MKIA 3EPJA 4OL0A 1KJYA 5FR1A 2VBCA 2ZJZA 4HDOB 5CJ2A 2QAGB 4QHSA 3VU9A 3H0KA 2WZQA 3FKQA 2BDTA 4CEIA 4Q1BA 4IOMA 2F1HA 4JVSB 5AUOB 4LC0A 1IBRA 3HWSA 2HF9A 3PUYA 4WXRA 1E3MA 5L3SB 4V02A 2OBNA 5FOSA 3RLFA 1KNXA 2O0KA 1ZNZA 5GJVC 4H1VA 2WJIA 4PPGA 2XB2A 1U0HC 3H2YA 2QGZA 4GSYA 4QG7A 3RS0A 4DLSA 3OAAD 3NHAA 1DELA 1U8YA 3ND8A 2QUZA 3CPHA 4NYJQ 2IK8A 2OZEA 3CPEA 1Z5ZA 2J3EA 1ZM9A 1COWD 3CRVA 2P6RA 2R6DA 4BFTA 4CEHB 3PEUA 4LJ6A 2N42A 3SEAA 1ZINA 1QHHA 5JHHB 2XZLA 2R6FA 2RGEA 4D6PA 4Z1MA 1CBUA 4PSAA 3B82A 4TLEA 3C15C 2C9CA 1U90A 2PL3A 2RGNA 3B9QA 3RABA 3KKQA 3NEJA 4IOJA 5EUQB 4JLNA 2FPKA 3K9LA 4ITRC 3L0PA 4OQMA 2ATXA 2RH5A 1M7BA 3K8YA 1SHKA 4IOKA 3I5XA 1W4CA 3A6PC 2F3TA 4HZUA 1FMLA 2GJSA 3ZIAA 4C0AC 4HUTA 1F3OA 3GLGE 4QGHA 2DWPA 4F4JA 1W48A 2QPTA 1KSFX 2AWNA 2I3BA 1ANKA 1C9KA 2IXEA 3QKSA 3QXSA 4HUQA 4EFLA 2YC4C 3NVAA 3UG7A 2ZRNA 4CT5A 2Z4RA 5C4GB 1KO1A 4RZ2A 2GDJA 2WWFA 3CF2A 2QMOA 3QEOA 1YZLA 4IVQA 3RS2A 4A0HA 2GBLC 2WWHA 4HDQB 4TQAA 1W4RA 3A1SA 4I1SA 2G6BA 3LLMA 4B6EA 1KZGB 1ZM3A 4E22A 4EPYA 2MSEB 5KUTA 3M1IA 5LB2A 3CH5A 3N2IA 3SQXA 2CEAA 2AFHE 2ZJBA 5EXXA 2OCYC 1G5PA 1J70A 4QHTA 3MFYA 4Q9IA 1KOFA 4ASUD 5JRZA 2BC9A 3NEYA 3LD9A 4TQ9A 3KQLA 2W0MA 4NCIA 3RC3A 2OXRA 4QNRA 5DYIA 1KKLA 3HP1A 3U7HB 5JI3E 4URWR 5C2JB 2W6JD 1G6OA 4NDZA 2OV2A 4F4CA 3K0FA 3FFAA 2Z43A 4I1UA 1A2KC 1E98A 2CDNA 2ZRBA 4IDHA 4NH0A 4DWJA 2IS4A 3LBIA 4BGDA 3REFA 1SXJA 5K8IA 2B92A 1G8FA 2PX3A 3ECCA 5B2ZA 5CB8A 1OH5A 2RGDA 1JQLB 3QUSA 1E2DA 121PA 1XD8A 3LLUA 4FMDF 3AGPA 4ILEA 2O8FB 1KJZA 3N5CA 2BJWA 1TAGA 4HLCA 1XCMA 2RGNC 3GP8A 4DSTA 1UJ2A 2DBYA 3VR1A 3KXLA 4B34A 5AUNB 1OIWA 4PO8A 1U0JA 4DLTA 4C7OB 1XTSA 1W44A 3H1TA 1GVNB 3C7KA 4DCNA 1E94E 3ONWA 1UKYA 2YWEA 2ZS7A 4IFEA 2CNWA 3X1YA 4M1TA 3AM1A 1JI0A 2F1RA 2HV8A 2PJRA 1G64A 4FWTA 1S96A 2QPAA 4MYUA 2ZXUA 1T3LA 4IFBA 5EXSA 3WYGA 3Q72A 4QBHA 2C95A 1TUEA 4ZDJA 2CJWA 2B8TA 3DZDA 5KDOA 1VHTA 4HAVA 4LJYA 3BBPA 3RNLA 5FBRB 1A5TA 3AVUA 1RRPA 2WMNB 2AD5A 3GLGB 3OIUA 2EFCB 4RKFA 4FMCF 5E4FA 2ZSBA 4N0DA 3CF0A 2YOGA 2ATVA 2NQ2C 3A1UA 5EUMA 3UKDA 2VF7A 1NLZA 4MQBA 3EPLA 1OJLA 1IN8A 1AS3A 2R6AA 2O5VA 4M1KA 5D3MA 1VMAA 4PPNA 4TMKA 5EP1A 2NZ8A 4HLQB 3EARA 1AK2A 4KV9A 2GEVA 3NBFA 4OKSA 4D4KA 1N6KA 5HZKA 1AS0A 4L9SA 2ZVPX 3GFPA 4HI0E 1XZPA 2C03A 4M9ZA 5AJZA 2JJ2D 1R7RA 4WZBE 3B85A 1Q1EA 3U3JA 4YQFA 3WNCA 5FPSA 5IDVA 3ZD6A 2KBEA 4B75A 4B2LA 1EFCA 2J41A 3P26A 4RFVA 3WY9A 3RSOA 4NPHA 1DAHA 3PUXA 3U44B 3FYHA 2H18A 4RD0A 5B57C 2ZI9A 4FMDB 5A0FA 1U81A 2DWQA 2NO0A 1YR9A 1E9BA 1XF9A 4LJAA 3VTKA 4TTQA 3SFVA 1Q1QA 2FEMA 1R2QA 4TMTA 4L16A 2GAAA 3IPXA 1KI8A 3CX7A 1T5LA 2VLIA 1FUUA 2BMFA 4JL6A 5FOXA 2JLVA 2ZRFA 5DN6D 4JLOA 3DZ8A 4A2PA 2XNDD 2FDCA 2WJVA 1LTQA 1M8PA 4TT3A 3GMTA 3GJXC 3B1ZA 4PC7A 4B2IA 4ARZB 2JCSA 2V3CC 4DT1B 1BH2A 1AM4D 3FHOA 1VCMA 1UBEA 3EIQA 1U98A 2D74A 1M1YE 2R9VA 3QQ5A 5CLQA 4JLMA 4JLJA 2WJJA 3BERA 2ONJA 2ZI5A 4UNSA 3C8UA 1W4BA 2IHYA 1D2MA 1JQJC 4K81B 4HB3A 2VF8A 4TSFD 4YLGA 3LY5A 4MUAA 1G291 4RVCA 2XTNA 4LCBA 4ACBA 1G8YA 5EE0A 5KSYA 1EX6A 1W0KA 821PA 3QG1A 2HJVA 2IYSA 1TX4B 3MMPA 4D25A 3KJHA 1W46A 5A4JA 4KVAA 2B6HA 2FFAA 1SXJE 3X1WA 2B7CA 3P27A 1GILA 3OEED 1N0VC 4BZPA 2G88A 3CZPA 2XTZA 4EIWA 1HQYE 2ZRPA 1P3JA 1MR3F 3UATA 3K1JA 3MD0A 3B2EA 1IHUA 4NYMR 2JEOA 2ZRLA 2QAGC 2LCFA 1XXHA 1GL9B 2D7DA 2QTFA 4UQOA 4DC9A 4LGMA 2QEQA 1KY3A 1TTTA 1UDXA 3FPAA 1O3YA 1XCPA 1RZ3A 1XJ0A 1LY1A 4G5OA 1WP9A 1OF1A 3UK6A 3W5JA 4BE7B 2FF7A 1ZM4A 1U9IA 2ZROA 5CYPA 4HAUA 2PZEA 2WWXA 3B5JA 1UBFA 4PQRA 1MKYA 1W36B 1R0WA 4HLUA 3ADCA 4ON9A 5FOWA 2PLFA 4EUNA 4PFSA 2QM7A 1Z8FA 1MV5A 4X8MA 4NE2A 4X8OA 4AKEA 2H1LA 4D80A 4KHZA 5JS8A 3AF2A 5DE3A 3LQRA 3F0TA 1J8YF 4KJZA 2IEYA 4KFRA 3W6NA 2CL0X 4LJ9A 2EYUA 4KLZA 3V00A 3ZZ0A 3I1FA 3K0CA 4LHVA 2IX3A 4D82A 1AA9A 1GFIA 5CIQA 1P60A 4Q03A 1KNQA 3HYTA 2VEDA 4Q4AB 1CP2A 4JBWA 4XJXA 1F2TA 5CM8B 2ANBA 2GJKA 1W5SA 3EG5A 2FN4A 3TR0A 1ZM2A 3OHMA 3AKCA 4TWZA 1IN7A 1AKYA 4GMXA 4NL4H 1CRPA 3B1VA 4EQ6B 3VQTA 2QE7A 1ETUA 3QKTA 4Z51A 1YRAA 4DLRA 1JR3A 2H16A 1IN6A 3EZ2A 5BXQC 2QRZA 1AGRA 4V0OA 1OKKD 2ECKA 4PAQA 3EWAA 1YJ5A 2MSDB 1JR3D 2OFOA 3TSWA 4XWOA 2R8RA 3WHLA 5KNDA 4DLVA 2QTHA 4D0LB 4JMPA 2HF8A 2DFNA 4M21A 1N5JA 3IIKA 4OI0A 2N46A 3QENA 1IM2A 4JVMA 3AP2A 1E9SA 2YWFA 2WWYA 1GKYA 5FI0B 3AF1A 4UNNA 3X2SA 2VO1A 1LFDB 1SVMA 4QBFA 3W3ZB 4DEXA 5KHOC 1E9EA 5SZHB 4F91B 3KZ1E 3I3SR 5GADl 3QKRB 5FL7A 2A5JA 2ZUDA 3LWNA 1E1QA 1GM5A 5AJWA 5F3WB 2O0HA 4JLVA 1US8B 4U7DA 3B60A 2JLYA 3JZMA 1F2UB 1A82A 1KAOA 4W5HA 3O8BA 2AK3A 3P4YA 1A1VA 3AB3A 1IN5A 4JBXA 3O8RA 5DYGA 2OM2A 3GEHA 4IVRA 3RHFA 3VFDA 1LNZA 3CRMA 4IKEA 5IHPA 2V54A 3AVVA 2IS1A 1VG1A 4QHYA 2LKCA 1W0JA 1PV4A 1R10A 4AI6A 3FB4A 3K09C 3VKGA 4MKHA 5A5GA 3ZD7A 1UAAA 3SZRA 5G53C 1SHZA 4LPKA 1G3RA 4TL8A 4B76A 2ZJAA 3THOA 2GK7A 1G20E 2AXPA 2E9SA 3EZ7A 4LDJA 4XWAA 4R9UC 4B6FA 3KXKA 2EFGA 4MH0R 2FH5B 1OB2A 4RFSA 4FMBB 2N1BA 2WWWA 1IXZA 3BORA 4PHTA 5L3RA 4PO1A 1NLYA 1ELOA 4M9XA 1Z6TA 1OB5A 1RJ9A 2F3RA 4IXNA 1ZBDA 3KUDA 1QHXA 3OEEA 3T1OA 2HYDA 4LV8B 1CU1A 4S35A 4DSUA 4L8GA 5J4VA 1WQ1R 1VCOA 1T3SA 4WOPA 4FN5A 3T5DA 4OHVA 1W49A 4Q1DA 1W0KD 4W5WA 3THYA 1ZNXA 2EWWA 1N3BA 1VYVA 4BFYA 721PA 2H57A 2X77A 4WIAA 1JR6A 4QGFA 1N5LA 1OH8A 5JRJA 3CNNA 2OCPA 3Q5DA 2PCLA 1HT2E 2GVZC 5JECA 4HDCA 5E7MA 3TGPA 3O8CA 1IOZA 1YZGA 4GI7A 4A6PA 3U7GA 4Q4LA 2JJ8A 2XX3A 5FOTA 1VG0B 1FQKA 2FSFA 3LA6A 3LH5A 3F8TA 2CE7A 2O52A
chains in the Genus database with same CATH superfamily
1EK5A 1JZQA 5CDGA 1U9JA 2AC7A 3GJ7A 1RLMA 2JFOA 1RXVA 1OX6A 4D98A 4U2FA 3V4RA 3O21A 3L49A 1FJXA 3R3JA 1R4MA 4QUDA 2XLCA 2BFOA 3TQOA 5FUBA 1RM3A 3OEYA 5JCJA 1Z6AA 1YMVA 2P9ZA 1XYYA 1TMKA 2WYOA 1Q7TA 3GCGA 3KHTA 3N2KB 3PHIA 2X2FA 4RETA 5AFSA 2IBTA 1SVLA 4F3KA 1YJQA 3OURA 4RD4A 4WEQA 1W4ZA 1ZU5A 5DHFA 4EY3A 1E0DA 4KITB 1UKBA 2O05A 3T38A 3T34A 4C0KA 2XVMA 4JI1B 3LTNC 3KDAA 3EA4A 5H9VA 1F14A 4N0EA 4B3TB 4WBNA 1W88A 1YB6A 1DV2A 5KHLB 4AUEA 3QH4A 1QHSA 3MUEA 4KUHA 3HYRA 1Y9JA 5A0VA 5BW4A 1AKEA 2REOA 1E2BA 1JHDA 5JXJA 2YJ3A 3FBWA 1DUVG 4RNCA 4BDTA 1H2BA 4WESB 1HQDA 4PLHA 4ZU1X 2WDZA 3RSSA 2QD1A 2E5LB 1UAGA 3F4KA 4Q9HA 2BGMA 3OJXA 3LUDA 5AKKA 2LDBA 1KS9A 2OG2A 1ZXBA 3GFBA 2AC4A 2J1LA 2OHVA 4JJZA 3TQRA 1QRUA 4BX9A 5IBCA 1E58A 4MDYA 3SX4A 2Q9BA 4E7PA 2WFMA 4OQPA 1BZYA 3ZBUA 3QPUA 3EIHA 5TJHA 2GUGA 1W1WA 3AVOA 3D0RA 1D8TA 2A0YA 3GXOA 4HEA6 2A5YB 3T9DA 1Z39A 1ZC3A 1WCIB 3KJQA 1YVUA 1W581 5LQSA 4Q4JB 1NASA 3WP1B 4D0NA 5TLSA 3ZD8A 3PTZA 3ZVLA 3S2IA 2GN9A 4HAOA 4DJFC 5JY6A 4COKA 1DG3A 3QWAA 3WV5A 3FDJA 1LRLA 1KI2A 2G9VA 4Z0PA 5LQDA 5HP4A 1DKMA 3WWEA 1B00A 3K4QA 1L6RA 5AK6A 4JBHA 3HPRA 4Q6BA 5J5VA 1FFEA 2IUTA 4MO9A 4AJLA 2R8OA 4CTNA 3GPLA 4AURA 2HMWA 4A0FA 1GAJA 4FI3F 2ERCA 3BD8A 4D43A 3C3KA 1PWYE 1RRFA 2LXNA 1OXMA 1LBQA 1JSRA 1RWVA 1Y5LA 4OK5A 2QPLA 3K0AB 4WK0B 1FX0A 3ST7A 5JRDS 3CWQA 3QEKA 1OLSA 5IJ0B 2BGWA 5KNCH 2I91A 1E2KA 1L7EA 4OXXA 3K1AA 4UU7A 4ND8A 3RHTA 1MJ5A 2X7HA 2FZGA 4QTYA 1U9CA 2VTVA 5SYAA 1DAGA 4IV0A 2VHTA 2P2DA 4FILA 2ZATA 5F35A 4WCVA 2ZQYA 4ZT5A 3VGJA 4US2R 1BHO1 1C3OB 1HLDA 4JGGA 3AVPA 2J07A 1XTQA 3PR2B 5DHQA 1WZEA 3ECSA 1QZZA 3BL8A 4AG5A 1YHYA 3RS9A 1AG9A 4DQUA 3EGEA 2Z4TA 3IVCA 5BRNA 1H5QA 1JSLA 3PUWA 1RCUA 2P75A 1NKSA 5AJUA 3DF9A 1YBVA 4KK4A 1X7GA 2ORIA 4TWIA 3UQZA 3QM1A 2IEIA 3PTLA 3RFXA 1JAHA 1X38A 3CE9A 1LDBA 1ZPDA 4OSOA 3A1CA 1H0HA 3QPCA 2BM9A 2QRPA 4CLOA 3H9EO 4NOJA 5A04A 1N9GA 1XUOA 5COAA 2V55B 3MPUA 3NYRA 3DMTC 3JX9A 3KCNA 4PQGA 4XM0A 1I36A 3SEZA 2FZCA 2VTDA 3N1UA 2FU5C 1T8PA 2FQQA 1NMZA 1TKAA 3C45A 4UAUA 3WAKA 1SC4A 2W2VA 3CTPA 4JBGA 3J81k 1T9HA 1VL2A 3EVEA 4WK4B 6Q21A 2IZ1A 1C9JA 2GD6A 1Z33A 1QF9A 1KFCB 1TYAE 2P11A 3DE5X 4RHYA 5TGTA 5IAOA 1ECPA 2Z0MA 1Q57A 2FE4A 3AEUB 5FUVA 2VJLA 2QRQA 3FSGD 4FOLA 3AR2A 3I5YA 5THQA 4E70A 3PD1A 4B7XA 1MB2A 3T7TA 3EA5A 3G8DA 5H81A 2C5GA 4BZZA 2J9XB 3WFJA 1S6YA 4RTMA 4TMYA 2R7MA 3DVAA 1DC8A 1C7FA 3HDGA 3FHCB 5FA8A 5LQNA 4H3KB 3ZKWB 3DLBA 2VDOB 1UC8A 1N92A 2G63A 2H1VA 1AIPA 1EGHA 2W93A 3OJCA 4I4LA 4AJNA 3VSAA 2E1RA 2PHZA 3A1FA 3VVBA 5H4GA 3C7AA 2VIIA 4F4UA 5F9HA 1C7RA 4PLGA 3EIXA 3IEXA 3IBGA 1Z2NX 4HGQA 1XTIA 1SNYA 1QZ3A 4PG8A 1M83A 1T43A 3GP5A 3MTGA 3P9SA 4RVFA 3H9BA 5EE5B 3TAHA 4AP5A 4NXNB 3VZPA 4X7MA 1F4VA 1BEUB 4HJXA 4OJKA 4ETMA 6YASA 4Q48A 2NUAA 2V1XA 1VTKA 4IDAA 5GJCA 1C9YA 2CXXA 4XRRA 5AM1A 1Z5NA 3LUFA 1Y6FA 3OT1B 2HF2A 3WWDA 2C99A 4NMXB 2H7CA 4K2AA 4EPRA 2W11A 4LYHA 1LV7A 4GMKA 1A9PA 5EMKA 1RADA 2C5EA 2ZRGA 3FNFA 2CN1A 1YC5A 4RJLA 1UL1X 1CR4A 2OUIA 4BJHB 1XR3A 1I33A 2WYVA 1UC5B 1H2EA 2F43B 1Z7WA 5EG5A 1S2NA 1B2LA 2F9LA 2UZ3A 4O59O 3UPTA 3COVA 1NPDA 4NMLA 4TZ6A 3PBKA 4HUQB 1OLXB 5FBZA 5IG2A 4XWTA 3PQ8A 2FMIA 2GZAA 2X5NA 1DQPA 2XLBA 1O9BA 3AESA 2HW8A 3E0QA 2WMDA 4II3A 1AUPA 3L40A 1COZA 1O8BA 4NSNA 1HNXB 4DR5B 3EIOA 2PMEA 1CR0A 1JJFA 1P1KA 2Q6LA 5FV7A 3FCCA 5IUJC 2Z2IA 1YQ9A 2JAXA 1JYSA 5KSPA 4BHTA 2X8JB 1EBUA 1EFVA 2FPRA 2ZJ6A 1W85A 1Z4LA 3DT8A 3IT1A 3UGTA 4AN4A 2N0SA 4BB6A 2CW5A 2H4XA 2ODNA 2PBFA 3K0BA 4DJDC 2PEZA 4ARVA 5G3YA 4D2IA 3ZLTA 2HK7A 2SNIE 4J8PA 4J9UE 3HSKA 2VT7A 4O3MA 3BS4A 1XYGA 1KSGA 3OLZA 2GQ0A 3N7TA 4OK6A 4Z49A 3P45A 3QLVC 3DFKA 2YRWA 3WGQA 3RRNA 2WSYB 3PU6A 1C3EA 3T12A 3QKIA 3E8XA 4YJFB 3HBFA 4R1QA 3VHQA 1H4QA 2FQXA 1UBTS 2C2ZA 2JIRA 1UQTA 4KBGA 8GPBA 1Z13A 4Z7JA 1PTJC 1B0PA 2J6HA 3G3EA 2GBFA 1T8WA 3RJTA 3QBTA 3GLHA 2GPBA 2NU6A 4I1OA 4R51A 4WZAB 4WCFC 3MWLA 4PLZA 2D2XA 1YRBA 3LPDA 4UMDA 3BSSA 3U40A 3EODA 4H31A 4AM8A 2ZUWA 1KAGA 4ARUA 2YV3A 4LUCA 1DQYA 2YJGA 3Q3IA 3F5QA 3IP9A 5KWVA 3SJAA 4UEKA 2CT8A 1XPRA 1XNQB 4TTTS 1XL0A 1R9NA 2ATCA 1FP7A 2IVZA 2Y6UA 3HJTA 3L4BC 4RD3A 3ZE2B 1LQ2A 4KR3A 3DCYA 3H75A 1T2UA 2QW1A 1RNLA 3OCYA 3TB4A 4GLJA 1TQ6A 2D62A 1J0BA 4LI3X 2LTAA 2RHWA 2A84A 4PZ0A 2ACEA 5BVHA 3U5ZB 4HQOA 5EYPB 2AYYA 3GFSA 3T5AA 3M4YA 3L1UA 3QK7A 1NNI1 3IEUA 3PWSA 4UBJA 3EOZA 3WMWA 3V5NA 3OQNA 2HDNB 4BGIA 2Z8XA 1ZAYA 1B8NA 5EYPA 1EAMA 3PF9A 3LW7A 1VBKA 1VSQA 3OSUA 2IUEA 2VHXA 2YH2A 3CNHA 1EFPA 3UEOA 4ZIRA 5KJ6A 1VLLA 4NABA 3KQTA 2B35A 3KFVA 3BZBA 5DEOA 1GR1A 1LLUA 3MT0A 2OPBA 5FAXA 3IBCA 3MGKA 5I9BA 1OXTA 1DVRA 3HJNA 1ZVKA 2GVNA 4GZ3A 1G21E 1SUCA 4E5KA 5K5EA 3K32A 4UUPA 3BGSA 1I3KA 2GVDC 1RM5A 2XW6A 3BFXA 3C8ZA 2GCGA 4E5UA 3DCIA 2PKXA 4IHJB 1QGAA 3S81A 2DCUA 3KSRA 1H2FA 4DCJA 4EZEA 2ZRCA 4X62B 1NUHA 1T1GA 1WF3A 5TVKA 5BUSA 4OGLA 3TLCA 5HOEA 4NCHA 2AI1A 3W2TA 3COZA 1DC6A 3B1WA 5BUZA 1JEQB 3JWJA 4NBWA 2PRZA 3ZX5A 2BOVA 1CB0A 4AJ2A 4L2IB 2R3SA 4ID9A 5DWVA 1T2AA 2PWBA 2HCRA 1QNLA 3OX3A 1PUXA 3L7JA 2QDXA 4GR5A 1EB9A 4ERXA 1SB8A 4N5HX 2E89A 2CWWA 4L8YA 5EZYB 3CLHA 1QIGA 1R50A 1JSXA 2V9ZA 1NT2A 3E1KA 3UYKA 4ICIA 4ZMSA 4LRUA 4CIAA 1XZEA 4P82A 2B34A 2I34A 3U1BA 2VSOA 3CMMA 4W1SA 2Z9DA 4F46A 4A8JA 3GQVA 5AJXA 1DBWA 4KMOA 2ZIUB 3OQIB 5FPHA 1DTEA 4XTRA 3KFLA 4Y2SA 3ZU6A 3BMCB 5UKDA 1XYVA 2IWRA 3AU9A 1BCSB 1H5NA 3CM0A 4HQNA 1IH8A 3N59A 3UMSA 2YIVX 5IEBA 5LWHA 5T3UA 2IWHA 4Y6SA 3UWSA 2GSDA 2XHZA 2PA3A 2PUFA 4JC0A 1H3FA 1TQ2A 1Z25A 3O4GA 4LKOA 5TEVA 4KR7A 1CJUC 1NGSA 1FP4A 4J0HA 4F4IA 4MB6A 1WW8A 3B13B 1IQ0A 1CNFA 4ZJPA 1QE5A 3QWIA 3U61B 1CSEE 1CEEA 1GTJ1 4CV0A 1E8MA 3H5RA 4H18A 4R1LA 2VHUA 3R74A 2J9ZB 3JD2A 1HKUA 1KYXA 4B46A 1EIWA 2Y77A 4IGFA 3CEHA 1RAIA 4NOMA 2CSUA 3VBEA 3SIXA 3HJAA 3OHSX 4CVNA 4GECA 2EIXA 4HQ0A 3QQPA 1SOMA 3UK1A 5HJ7A 1NVXQ 4HXYA 1KYIA 3B1XA 5IJ9B 4B3SB 2F62A 2NIPA 2ZAOA 4UMEA 3F6EX 2LNDA 4FDAA 4OMDA 1U3CA 1JHAA 2V7WA 3IBFA 4X1OA 3FZYA 4JENA 3DDWA 2WUVA 1Y5NA 2P6PA 3CR7A 4V24A 4X1KB 3GT3A 1UKAA 2PT5A 1TAUA 2OG1A 1RQ7A 2WD8A 1E79D 4KSBA 5JPCA 1SD1A 2XBUA 2NU8A 3I0ZA 5H0IA 1MGPA 1LUAA 2KSQA 1GPLA 4LVCA 1CRZA 3DVAB 4G09A 1QLJA 4W63A 4FB4A 2R8BA 4PHGA 5U9CA 3VO8A 1FUKA 3ZIUA 1O8CA 1Z47A 2XRYA 2BGJA 3O38A 4UBNA 5EP2A 1BDBA 2LCIA 1M6NA 1EJ0A 4AJKA 2COUA 5CNIA 1HURA 5E9WA 5EERA 2IZ6A 5LB4A 3RJ9A 4EF4A 2WAAA 4NJMB 1Q7GA 1SIBE 1VKHA 1E5VA 4FVTA 4YMTA 1AJEA 3U4QA 2VA9A 2YXDA 4IILA 1B8VA 3R20A 4OQZA 3R3ZA 1N5MA 1NLFA 2EX1A 1LK7A 1T0PA 2H1WA 5AXAA 1XU9A 1ZH0A 2ZPTX 1HDEA 3GPIA 2R0QC 3NAGA 3S1AB 1CS0B 3TI9A 4DIOA 3R9XB 1G0NA 2D54A 1XWWA 1QFZA 4WFIA 2APJA 5ECDA 5KTMA 3ES9A 2PIDA 3FN4A 1U3UA 4X24A 1YFKA 3AT1A 1HK7A 1CVLA 1T10A 4BWYA 5CIWA 2QXTA 2QX6A 4U7TB 5KX5B 1MV8A 2HXYA 1GDHA 1V3TA 1YRWA 1K98A 4UMFA 3PYLA 4ZO6A 2VRNA 5CB4B 5JZVA 2PUEA 1R0XA 3USZA 4EO7A 5B3KA 2W42A 1XNJA 2PVSA 1N1MA 1XZQA 3BB4A 3NTVA 4EG1A 4JUCA 1O5TA 3SSAA 1RAGA 3SIPA 2F3SA 1F8UA 4B47A 3DAGA 3F9CA 3R7FA 4LOLA 3AJ8A 2BI8A 1S3IA 3KOOA 1DC5A 4DM7A 1DAPA 2L42A 3UWKA 1V9CA 1L1FA 2OB1A 2ZJ2A 2ZRHA 1PJCA 3LUPA 2Q7OE 4KLNA 4TMZA 3IUPA 4XVHA 3KQOA 5DK6A 1K2VN 3EASA 1GQYA 2QY9A 3H8VA 1CB7A 3NUQA 4X66B 3T5PA 2OO3A 4NYJR 3G88A 1CE8B 4IHQA 5JXGA 1MX1A 3DPIA 3GUHA 4S2UA 1U5AA 1W6RA 3CX4A 4PWZA 4Q7QA 1KEUA 3NGXA 3EXEA 1HL3A 2GB4A 3WIEA 1NJFA 5LKRA 2VJKA 3T7SA 4DB4A 1ADGA 2R5WA 3NBXX 3A06A 4I3HA 3TKLA 3IP1A 3NOOA 4F9EA 1F0PA 1XC7A 5J5CA 5EJ6A 3HCAA 5BSGA 2VHWA 2C88A 3UXHA 2Q4DA 4TN5A 2W7TA 3L41A 2IU6A 3JWIA 4BAZA 1H85A 1MC8A 1K89A 3HMQA 4AZVA 4CQLA 5HGJA 1IDOA 3SNHA 3MQFA 1DEKA 1NSTA 2GXAA 3JQ6A 4MW4A 3OY7A 3AU8A 1QZUA 3PITA 1IZYA 1VB3A 4H16A 1U5BA 3X2FA 2SECE 4ZVUA 4CXMA 1UDWA 1R0YA 3A1WA 4IDNA 1XVAA 5EHGA 4Q66C 3GAFA 2VPWA 3CNLA 1POWA 3PE4A 4LIPD 4Q7KA 4CGYA 1R6DA 2OGZA 2ZBEA 3EZLA 2BYTA 1GPWB 1L8LA 4G0WA 2UVPB 1RI3A 3AEZA 2ODEA 3ZE6A 4DCTA 1G7RA 4OV6B 2B37A 5KWEA 1KIAA 1MAVA 3OZFA 4QE3A 1NMYA 1MHTA 4NTZA 3ZR4B 2P91A 4ZOEA 1L1QA 2HPVA 1JAYA 2RCNA 1O94A 5F5LA 4LRQA 4MWDA 1Y3AA 2IHBA 4IS2A 1P31A 2IEGA 1FDTA 4B3GA 3IAM6 4I8IA 2X8LA 2DFVA 1FMJA 4NZYA 4CEHA 3ADPA 4YS6A 1PW7A 4J1NA 4FKMA 1VG9B 5CFNA 1EFTA 1GYRA 4M9QA 4HB2A 3W5SA 1SD2A 4LV6A 3GJ4A 4C7XA 2L69A 2PDAA 3GLUA 3GQBB 5BSKA 5AVTA 1EHCA 2HRBA 3R9KA 2A94A 4GS5A 2C9ZA 2Z1MA 4B73A 5A4MS 1RWPA 2R84A 4KR0A 2FF5A 2I2FA 2XKAA 1ULTA 3HEMA 1PGOA 3DBOB 4OXRA 5ALEA 3ADDA 1ISHA 3RT9A 4E0BA 1DFHA 1RLIA 3RS5A 4P81A 2GMWA 4HWKA 1RLJA 1GOTA 4HFMA 4REMA 1X8LA 1T5HX 2FMUA 4CKCA 2NZWA 4BU0A 1ST2A 1GG8A 1AGXA 1ZBQA 3F3KA 1X94A 3KHKA 4LEIA 1V45E 3HU2A 4PLFA 2ZRKA 3RC2A 1Q3KA 3KX2A 3KR9A 5EJMA 5I7UA 5GV7A 3GHHA 4EBFA 2ZRQA 1E7SA 1MBZA 1XZCA 2RARA 3FUVA 3NTLA 4RZ3A 4AKSA 2DF8A 5JAOA 2ZJ5A 1R4AA 4F9TA 5AXBA 1VM6A 4IGIA 4XWWA 3FJYA 1CRWG 1V41E 3G0BA 4MJXA 4PZEA 2N75A 1SIOA 1KI7A 2G4LA 2OGWA 2OORA 3BGVA 3KKNA 4AD8A 3S8YA 3ZDDA 3GFOA 3I9JA 1J24A 3NT2A 1K0FA 1KY5A 9ABPA 1UZUA 4EL5A 3HZHA 4WOBA 2A3RA 1J0AA 2JCVA 4A91A 1Z22A 1KPIA 1NF2A 4IKOA 4ZI5A 2C57A 2FXVA 4DLNA 4PW0A 4JSRA 4PV7A 4R3NA 4Q6WA 1PFWA 4WFQA 5KYVA 1AKUA 1JN0A 1HDRA 1Q11A 3SDZA 1ZGGA 1RFLA 4IFIA 4DCGA 2HA0A 3DUFB 4MEBA 4R3WA 4U0KA 5K0TA 1VE5A 1I4EB 4DGSA 1I0IA 1BVUA 2IS2A 4IGEA 2H5EA 3HVJA 4N7MA 3EDOA 1IQRA 2J33A 2XCUA 3TFOA 3NX4A 4B35A 4TV9B 3U9LA 1N6OA 4IIFA 4WJZA 4C30A 2W70A 1BXGA 2NUTB 1ATIA 2DWOA 2YYAA 3OX4A 5BURA 1KI6A 1ICEA 1TJPB 3OOWA 1YKFA 2ZWAA 5G40A 1NRJB 3Q88A 4ABYA 4PYRA 1ZJYA 2WICA 1NQOA 2QJFA 1EH5A 2AOVA 4FE3A 4V0ME 3I01M 5JISA 3GLKA 4NBSA 4XPIB 4RORA 3P2IA 2ZE5A 4KAFA 2Y2UA 3BK7A 4MUJA 4YRJA 2A9JA 3REOA 3UANA 3G7SA 4F4FA 5KYYA 3PXBA 4PRZA 3IELA 2PZJA 5DM0A 4MS3B 5HE8A 3GPBA 1E5LA 3WB9A 3FNGA 4U00A 4Q19A 5HIAA 1NXWA 4Y2RA 4R40A 5JI2E 2WSLA 4QDOA 3G2QA 5E2BA 2C1EA 2Z3VA 2HMUA 4YCCA 4GBJA 3TFQA 2ZEJA 4GKVA 2P2YA 3ZH2A 3NIBA 4MWZA 2GTIA 2V8BA 3LF2A 3TW8B 4ME6A 1MC5A 5A4AA 3HY4A 2AE2A 2ZSEA 3V1KA 4F4HA 2P6MA 4UXIA 3TXYA 1EUYA 3ZTWA 2NT4A 2A57A 5ILQA 4IMJB 1RIIA 4MCHA 2AJTA 2A5GA 3RIHA 3RSLA 3D6AA 1I2AA 1R74A 7MDHA 2OZLB 2A35A 3ESAA 4H7DA 3DSRA 4L75A 4XW2A 3OUTA 4AJIA 3HU3A 3C70A 3KKPA 1V1MA 4H1UA 1BFKA 3V4FA 3LVQE 5AVUA 4X6XA 4R2WA 3KJGA 4PHCA 4K5QA 3UCEA 3KZMA 2BWJA 2F1JA 3FMOB 1J9ZA 4OBBA 4U0JA 3PCXA 3BXZA 3DWEX 1M54A 4QXRA 1ZK3A 3JD4A 1K27A 1PS8A 4C20A 1Z06A 3R8FA 4EDFA 4N7RA 3ENQA 3ZGXA 3OZ7A 3QIAA 2AD1A 3THYB 3EAFA 3S27A 3VR5H 2K6GA 3BA1A 1EP3B 1U8AA 2FEKA 4J3JA 4QELA 1JS1X 4Z4HA 1EVIA 2X8WA 5IASA 4U2KA 3ICEA 1ZHFA 2C5LA 4HQKA 4HDSA 4R16A 1EHYA 4R84A 1YR3A 2DUMA 2O2GA 1IHXA 2VSNA 3L43A 2R5NA 2ZR9A 4PZYA 3WLFA 4D4IA 3LQYA 2X3UA 5FUWA 2JA2A 3FFWA 4AY4A 2ZAYA 1DLIA 2HHJA 2NU7A 2QQEA 3ODGA 3OOEA 4OHZA 3UK0A 2QZZA 2M6KA 1WOYA 4KN8A 5E6SB 3LVRE 3MJEA 1NFRA 1KWGA 1MO3A 3ZGOA 1XEWX 3WADA 1S1CA 1YZYA 1DIBA 2XDWA 1PX2A 2WE8A 1MAHA 3N8KA 2DFPA 3II6X 4AMZA 2VHCA 5EJ4A 4DJAA 2I87A 1E9AA 1M1XB 1J1UA 4KC0A 4RY2A 2ONKA 3HRHA 1VHWA 1J06A 2C0PA 2FSPA 1E6UA 1XEFA 3E81A 2X41A 2BVNA 3BFVA 4YLEA 1HLFA 2QUHA 1ADBA 2KW5A 4DQDA 2L17A 4C4PA 4UNRA 5CEJA 3O8OB 3CVXA 1ZCAA 1PQUA 2GCOB 5BVGA 3U4DA 2C61A 5E1BA 1JH8A 3WL5A 5DRYA 5ER9A 1P3DA 3ZE7A 3K9BA 3SWWA 2GF9A 4DJ5X 3GUVA 1CUEA 2P5TB 5E3IA 3TB6A 3B6ZA 5KTTA 1V25A 4GF5A 4XJSA 5ILOA 1E1CB 1EFKA 1H9BA 1HE2A 1TFRA 1YNSA 3NHFA 1PRYA 4J9VA 5JPIA 3KQHA 3QWFA 1Z37A 2CL7X 2OQ2A 1ZMRA 4JVNA 4ZXPA 3BT7A 2R25B 4I9FA 4WZBB 5HCNA 3DYIA 4UXJA 1ZIPA 1Z0FA 4US0R 5TSDA 2QRMA 1WXQA 3VKHA 5CXSA 3UMYA 3CQ9A 3JWHA 3FPSA 2OLKA 2Q6VA 5A71A 5AVJA 1N1EA 2OGSA 1C4WA 3S7TA 3A6HA 4D9HA 1P8JA 2HU5A 1X80A 2GRAA 5TEWA 2NPFA 4XRGA 5C5EA 1O97D 1US8A 5NLLA 1F8YA 4F6RA 1IXSB 1W5BA 2QG6A 1P0PA 1LD3A 1RHKA 2OCIA 4EZIA 4YHBA 1ILWA 1KZ9A 1UOEA 2VYFA 3HN6A 2O8BB 2I3GA 2C98A 4KXVA 1GU1A 2IU3A 2O0JA 3BIWA 4LHYA 4DMMA 5KJFA 3UXMA 3GGDA 1Z88A 5KNBA 5EI5A 2UU9B 3K94A 2BI4A 4ETIA 2VP5A 3R40A 3D8BA 2MSCB 4WT7A 3SHTA 3CJTA 1BTOA 1Z2AA 3ZY5A 3ZHRA 3P94A 5AUQA 1EGQA 4GMHA 1R9JA 1C9MA 2W6OA 3ITKA 2HGZA 1BO6A 1YR1A 2XUZA 1UJMA 3QTLA 1TM3E 4HZUB 2EBUA 4IIHA 4YROA 1CZUA 2D3WA 1F8FA 1NV8A 4MV0A 3OZUA 2NV6A 1M1NA 3C8DA 1U2QA 5FPTA 3QV2A 1XMVA 4ENUA 4WN3A 1IZ7A 1U99A 2QJRA 3JZFA 3OD5A 5HRUA 1UM9B 2ZJ4A 1YJBA 1H8EA 4RA9B 3ITEA 3DF7A 4HWRA 4RAOA 4YCSA 5B7GA 3W4IA 2A0XA 3VC2A 4IDQA 1I13A 1JU4A 5DX1A 1DEOA 5FHRA 2JDID 2F8MA 3U9TA 4PLYA 4RL6A 1QVRA 4J3NA 1D2NA 5HW0A 2CXNA 3WGYA 5IXJA 4RTNA 5KYUA 3CBQA 4U5XA 2FG7C 2V7BA 3LQQA 4OQLA 5F4ZA 2OHXA 3VO1A 3T7JA 1IN1A 1SKMA 5H16A 4ZV9A 1JJVA 1BG6A 3AERA 1ZJWA 1MT3A 2BGLA 3KV1A 4IEIA 3C5CA 1NATA 6PFKA 4AZ0A 3BAZA 4DDTA 4K9NA 3CKYA 4DTCA 1KQGA 2Y05A 3NZEA 5K3DA 1PJ4A 3MZ0A 2RONA 3I23A 4MR9A 4F38A 5KTKA 3NCTA 1H66A 2OP0A 3SXUB 3D3KA 3L0IB 1PGQA 5DIZA 4JYBA 3WYFA 2NNLD 4QFCA 1UK7A 4DLAA 2WIBA 1EESA 3E3MA 3X0DA 2OLEA 1IHYA 4NCXA 4EGCB 1QQBA 1C3JA 4Z9XA 3QMVA 5E95A 3T3HA 1QO7A 1OTHA 2PD3A 1JILA 3ZLJA 3I1JA 3T5GA 3G2IA 3N2YA 3E5MA 3N9IA 3T4XA 1JIUA 1LTKA 1Y8CA 1QIDA 4LZPA 2P2NA 4L9RA 4WDRA 4WZAE 2MYUA 4AWXA 4EAQA 4E5DA 1XNHA 1KMCA 1R5OA 1EUCA 2JLZA 5DBOA 4MUGA 3S5UA 3WDMA 1PS0A 1T9CA 2WPDD 2YWRA 2P78A 2VPQA 4PO9A 4UM7A 5CD9A 1LBIA 3VKWA 4GYWA 3OY2A 4RIGA 2X5OA 4B6OA 1OIXA 4R5HA 1S7CA 1GSIA 5J2TA 3VPSA 5KB3A 1OJ7A 3GMDA 5CB0A 4K88A 4RNDB 2FSSA 2GAOA 1KK2A 2G9RA 4F7DA 5C52B 1ULBA 1MG5A 2V4MA 3AHIA 2I3AA 3LFHA 1X39A 5TPZD 4D9EA 1I6MA 3U5TA 2QLLA 4OUDB 4RKYA 1V11B 1TL7C 2VCYA 4IIBA 1QUEA 3PQEA 3PGXA 4MP8A 5KTNA 2PZKA 1XNRB 1H2XA 5DP2A 2OOSA 4FOOA 3EW9A 3FPCA 1G16A 5LXTF 1I7NA 3AK4A 3IEVA 4AP6A 3GFFA 3EDRA 2YDXA 4PRKA 2XA1A 3ZCXA 1Y7HA 1H2ZA 3HCDA 3EXIA 3QOWA 5JNTA 3ZJTA 5BORA 5BNTA 1RWNA 2FWJA 2YR0A 1B16A 1XN1A 3AJRA 4I9HA 5IAEA 4S1TA 1P3Y1 4CUJA 1QGZA 1II8A 2O5CA 4KE8A 1G4HA 4RA6B 1SXPA 1Y3IA 3KKLA 4NYIQ 1CZLA 3DL7A 5FDFA 5AI5A 1XRJA 2CJXA 3RAPR 1T9KA 1KZ4A 2P40A 1G6KA 4WUVA 4L08A 1DFIA 1YKSA 5JBQA 1TQ8A 4DA7A 1E2QA 2XT9A 1KQPA 2WKSA 2I7VA 4IJ5A 4OO3A 4UAGA 3B6EA 3AHCA 4YTEA 1P0CA 4YH1A 1SQSA 1PNOA 1XPOA 5IKOA 1WD5A 2CKDA 4XDGA 1OGJA 2I7TA 3AR3A 1JIJA 1TM2A 4HGOA 3A3YA 5FOVA 1V7ZA 3AHDA 1NPYA 4EF5A 3AFNA 3SQOA 1MF7A 5JS2A 2P6UA 2GWRA 5M5BA 2CMDA 4HY3A 4MRPA 1S5PA 1WMDA 2QTZA 4W1QA 3SU8A 3T0GA 2O8CB 1QV9A 2GJ9A 4ZCMA 2BH2A 4JIGA 1T6BY 2LBPA 4XQ9A 4EVSA 2JS7A 2A5LA 1FF9A 1KZ1A 1PG0A 4KSCA 4JL5A 1SCDA 5IBPA 1Q5PA 1WTAA 2H3EA 4ZQFA 3WGHA 1HYBA 2XITA 3I8SA 3MOIA 4HX2A 3ZN2A 5ADWA 1QE0A 2ZQZA 3FTDA 5EJIA 2G1PA 3GI1A 3M6AA 5HF6A 1I30A 1F0YA 4BC0A 2B8JA 2ORED 4GPTA 3SXUA 2ZM5A 2H9IA 3COYA 4NAUA 5J47A 3BZWA 3AF0A 4LDRA 1M6YA 2BFMA 3HV0A 1ZOPA 5G4KA 1W0JD 2HJWA 4FGSA 2H5IA 4HH3C 5GQSA 4BTLA 2WQ6A 1CD5A 3IOMA 1XBTA 4AO7A 1R88A 3OLVA 1FLNA 1WUJS 3MUFA 1IY8A 4X8HA 4Y1RB 3AJEA 1RYZA 1W85B 3AB8A 2IYEA 3IKVA 3AINA 3ZHOA 2CZQA 4ZVMA 3K70D 2PS9A 5DW0A 2W9XA 1FU8A 2BHLA 3G2OA 2VK8A 1NURA 6NULA 1QXSA 2FFQA 2A9RA 3MGAA 3VPGA 4N7JA 4EENA 4BKQA 4CN8A 2CSXA 4MINA 4OQDA 1QCDA 4GLBA 3DJFA 1EB8A 1G19A 4NDNE 1BKSB 1XF1A 3MCTA 3PD0A 3I6YA 4KXUA 1YZVA 1D07A 4CMIA 3GL9A 2HOQA 3TJZA 4ZYTA 3OG9A 1HRDA 1GV1A 2BUCA 3OLQA 1SPXA 1CPYA 1TUIA 2WR8A 3HCRA 3KFXA 3QV1A 4K28A 2IYZA 1DAOA 4H3HB 4LTDA 5EE1A 4CCSA 4IMRA 4FMCB 1RPTA 1G9SA 2O8BA 2BZ1A 1D7AA 1P2GA 2FFHA 4B6PA 4TYWA 5IVKA 3DTVA 3G2PA 3Q3GE 3S2EA 5AHXA 5BSEA 3QF7A 5GGYA 4OCZA 3NMUF 2H2IA 4U63A 3TZBA 5FPQA 1A8HA 2CBXA 3T3MB 3MUNA 3BICA 3CWZA 5L7WA 2QAIA 1DOHA 1C81A 4HRYA 4D6XA 2NPOA 1OKKA 1SZPA 3EGDA 4AYXA 2HJ9A 1GADO 4Y1FA 5DBHX 2R4QA 1VBMA 2ODTX 3V7YA 4O4IA 1QIEA 3GROA 3TM5A 3KSZO 3U7EB 4CG3A 1X86B 3BEOA 5B4VA 3ZWAA 1H3EA 1TA9A 3S6JA 1E6CA 2VBIA 5AW5A 5GVRA 3RTGA 1PO7A 2XE8A 4GLFA 1BRMA 1I5OA 1UWLA 4HTFB 5FFNA 5I51A 3KXIA 1UKEA 1EVKA 1SBTA 3VR3D 4O4HA 4F8EA 2GEDA 4UEWA 2YS6A 5LD2C 4WZ6A 2IOFA 4EW3A 3WNBA 1CFZA 3B12A 1U7TA 2Z2KA 3GVIA 1UMBB 1G5RA 5ALGA 1VLQA 1CR1A 4UDOA 2C8LA 4OFWA 2GM4A 1SU7A 1KYZA 1YGPA 1FFHA 4IH1A 4L4SA 4XVRA 3VA7A 3IDAA 1MORA 3UV6A 2WUFA 2QN8A 1T29A 4Y6LA 1FXWF 5E1MA 2LP4Y 5K3BA 2REQA 1KZ7B 1WSWA 1WXFA 3ELUA 3EG9B 2Y1EA 3NAMA 2BF7A 4ESVA 4LYFA 1PR3A 5TF4A 1ZK2A 2XGGA 3ZVKA 4P7KA 1ODFA 3ZQKA 1IHOA 4J7CA 1N75A 3X43A 5JT1A 4G0PA 3B78A 3NTQA 4U7FA 3WB2A 3QRWA 5EJ7A 2ODQA 4BV8A 2B3DA 4OIMA 1E4VA 1WZCA 2F9MA 1RQ2A 2OXFA 4LX0A 3HJRA 4RAQA 5ICSA 2H9YA 1K0UA 1NW8A 4EG6A 1G4UR 4GMDA 1GZHB 1Q91A 5KCMA 4BO3A 3N0XA 4R8RA 1F2VA 4OM8A 2V7VA 3AUAA 1M1NB 3ZI4A 2CLOB 3KAJA 5M2QA 2Q3EA 3QBVA 2WHXA 5F1KA 4E1VA 4K6GA 4XDHA 3FY4A 4KO4S 3G8BA 3SIWA 3DDCA 2D5BA 4HB0A 1BFDA 2AFHB 4K6CA 2V7PA 3B2NA 3UH1A 1TCBA 1FXSA 3HZZA 4TV8A 3TQSA 4ZGWA 2WKQA 5LU8A 2IYVA 4S04A 1ZCFA 4WADA 4N8EA 1P81A 5CTJA 4O6VA 3I30X 1XZGA 3NIFB 4JB0A 1DWPA 1UBRS 4QYIB 3GFTA 3I1IA 2UZ0A 1P9LA 4P32A 5EXEA 1U2DC 5F7ZA 5K2MA 5U1PA 2IKQA 2BKLA 3DZCA 3EVTA 4UBIA 3X2SA 3LV8A 2DKOA 3MCAA 1KMHA 3VAYA 5HF5A 2ZQ5A 1ZJZA 2AFIE 1T8TA 1OE0A 2Z8ZA 3KZVA 4PSCA 5FTMA 4ESEA 1H42A 3A31A 4LSGA 4BZXA 2FY8A 2QIPA 3OPXA 3U1VA 1N9ZA 2FMFA 3QHQA 1K6XA 2YVQA 2GFIA 4E09A 3P7MA 4OHUA 2WU4A 4CE6A 2YHIB 5IN4A 1WPGA 4OM7A 2H00A 2W58A 4JSTA 2P9BA 3OFKA 1YB1A 4BLUA 4LOJA 2R62A 2DZDA 5A05A 3HKCA 1XOIA 3GPDG 4Y2JA 3SQDA 3KJZA 1GUAA 3DWGA 4HXFB 3JASA 4YUXA 2QSYA 5BXYA 3AEKA 3GAZA 1KI3A 2C4MA 3M4XA 1NULA 2Y1OA 3FFTA 4CM4A 1TK2A 3L9WA 4R9NA 1XEWY 4E5SA 4EITA 5SYMA 4B4OA 1ZR2A 1SBQA 1C80A 3WX0A 1DJMA 3TW4A 3NBUA 3HVHA 1GD1O 1SOWA 2ZYDA 1VIYA 1XA4A 1OWOA 3UKOA 4BMOB 2CV2A 3DDSA 3R2JA 3QEBZ 2PX0A 4RXUA 1KDRA 2HUNA 3BE5A 5I9MA 3SSOA 2FYTA 1I4TD 3AI2A 1YZKA 4TMXA 2GR9A 1CJBA 1C41A 1W76A 1Z0ZA 3KTAA 4ZMRA 2I3ZA 2PR7A 1XK6A 1V5GA 3F90A 1IULA 2J5RA 4MPRA 3T1NA 1GGHA 3U7RA 1MB9A 2RK4A 4PZAA 2ZIXB 2XXAA 5LFAA 4POOA 2XZDA 1SOAA 3JVVA 3EFOB 5I8WA 3C2QA 4WPGA 3NANA 4JI8B 3L02A 1YL7A 2QU8A 1M67A 3TO5A 1U11A 4W4TA 3ABQB 1M1YB 3BH6A 4YV0A 4OLFA 3E3OA 3IPRA 2O3UA 5CB6A 4HNSA 1Y4SA 2H4WA 4HH1A 1MNQA 4INJA 4B6SA 2WB2A 3KQMA 1GNLA 3OCJA 3E3LA 4XOIA 2ABWA 5KJEA 1T4GA 5B7PA 3C6QA 1QF7A 5LOVF 4PX3A 5CLJA 1FP1D 4MRAA 4TSKA 2JZNA 1H6CA 3CZRA 2VDKB 4WGGA 1TK3A 5CB4A 3IQHX 4YRQA