2WWGA

Plasmodium falciparum thymidylate kinase in complex with dgmp and adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
TDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDILATE KINASE, PUTATIVE
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwgA00
4RD2A 2VF7A 1U0LA 3U7HB 5EQTA 2QTHA 4WBSA 1KSFX 4JJKA 1J70A 4JLBA 1ZUHA 3MFYA 1X8LA 2Q0HA 4FMBB 4WIAA 1SGWA 2QAJA 2ZSEA 1NBMD 5DYGA 3THWA 2GXAA 3FFBA 3WNCA 5ELXA 1ANKA 1Q1ZA 2JJ1D 2HXSA 5KHOC 2H1LA 1F3OA 2OLKA 3SE0A 2C9CA 2GJKA 2G0TA 2ORVA 2ZRMA 3K0CC 4WXRA 5P21A 2HUPA 3ZJYA 3THXB 2ZI4A 4PSAA 3KB2A 4MGZR 1KI6A 3CF6R 4W9MC 2RGAA 3KQNA 3LLUA 1G6HA 1N0WA 3ZZTA 2D2FA 3MCAA 3NBFA 4N0EA 4JLMA 2WKPA 2OLJA 3UKDA 2ZYVX 3ADBA 4A0RA 5K8TA 3IDQA 3OE7A 2R6FA 3EWAA 2JDIA 1T8TA 2QSZA 2GILA 3SHFA 4DLUA 4XD7A 2IWHA 1D8TA 1NMXA 1NLYA 2QUZA 3AQ4A 4QNMA 4C0KA 2G83A 1W44A 1EWQA 4TYQA 3AKCA 2PMDA 4ASUA 4QNRA 1NVVR 3ADKA 3AVXA 2NO1A 1GL6A 3C41J 2QMHA 1E0SA 4BLSA 3B5JA 4URXR 4RD6A 2FMXA 4NMMA 5CM9C 5JWRA 2P3SA 3QXXA 4Q9KA 1ZUNB 3ND9A 4JVLA 4R71A 2ANCA 3KUCA 1TEXA 5LDDC 5JECA 1G3QA 3TGPA 4B3DA 4CYMA 3BB3A 3QXSA 4LC1A 1A7JA 3H0KA 5CITA 3E2IA 2O8EB 2VBCA 2C03A 4IFEA 1Z3IX 1G8FA 4M9XA 2SHKA 3TJZA 1HE1C 1SZPA 2FPKA 4LI0A 3K9LA 2XTNA 3EC1A 1A82A 3GEIA 1NLZA 1OFUX 4PO1A 4PZYA 2V54A 4RJLA 5HE9A 4DCTA 1Z6TA 3DPUA 4TT3D 2I4IA 1TUIA 5FBWB 5JHHB 1ZAKA 4I1UA 4TSFA 3ZLJA 3NWJA 4OQLA 1GL7A 4ITRC 1U94A 4XVRA 4H1UA 2QGNA 4HZIA 4G01B 3LBNA 3CRQA 1VDZA 4UXJA 4KJZA 3AKEA 5AUNB 2CLCX 2XJ4A 1KY2A 4CIDA 3RC8A 2ZITA 4PR0A 3CX6A 3TK1A 1UKEA 4NYJR 4HLCA 3OE7D 3WMEA 3L0OA 2G9NA 4BFWA 1IY1A 3CF2A 1EFCA 2JDID 2G88A 2IHYA 2OEPA 3C4JA 4JIMA 4Q1DA 4XD7D 4R2HA 2DFTA 4UNSA 3A1TA 2AX4A 2J5XA 2ZSFA 3PQCA 5HTKA 3VMFA 4ASUD 4BFVA 2EYUA 1NJGA 2GWHA 2A5YB 1KOFA 1X1SA 1XJ0A 2QM8A 3K0AB 2AFHE 4PHTA 2P6NA 2FZ4A 3D7MA 5CK4A 2CMKA 1W48A 5B30A 1HY3A 2ZRAA 5D3MB 1T0JB 2XGJA 2F1RA 5UKDA 1G8PA 4FMDF 3O8RA 3A1WA 5J40A 5AJZA 3U5ZB 4JL6A 3QKSA 4XTCS 4RD3A 1Z29A 1OPXA 1K6MA 1K8RA 4KV9A 4UJ3A 3A1SA 5H1YA 3WBKA 1EX6A 5A4JA 3PEWA 1E2GA 1NVUQ 3QXJA 4Q47A 4QJ4A 3FDIA 4Q4HB 4R7ZA 1II8B 2V1UA 4LWZA 3W8NA 3SOPA 3E5HA 1ZNXA 1VG8A 2DFLA 2IXFA 2JAQA 4TSFD 2RGNC 1SHZA 1EGAA 2HLDA 3RABA 1NG1A 2BC9A 2QAGC 3R8CA 2J0UA 4BPBA 1YR6A 5TV2A 1DOAA 5KDLA 4DZZA 2IYYA 3JVUA 1WRBA 4L9WA 1ZP6A 1D6JA 2XAUA 3RAPR 1D9XA 1XTQA 4PX9A 5KSYA 4ABYA 2EFDB 1HYQA 1Y63A 2ZUBA 4PQYA 4LGMA 2R2AA 5BN3A 3SQWA 3VU9A 4F7WA 2QTVB 5FUYA 3KXIA 4B3XA 1GP2A 2IHBA 1G3MA 5IRCD 3K53A 3EZFA 3N2EA 3PEVA 3W3AA 1UBCA 5IDVA 2IF2A 3AUXA 1NI3A 3CH4B 3K9NA 3AP3A 2ERXA 1E2IA 3GQBA 4FCTA 1TUEA 2L0XA 3RRZA 1II9A 2ONKA 2X77A 2ZE7A 2IWRA 3R7WB 1A1VA 3R9XA 3SQXA 3QE0A 2PMKA 4PPQA 4X8OA 3ZYCA 3C7KA 1DAHA 4DXAA 3DZ8A 1CR4A 1YJ5A 1P62B 3QVUA 1QZXA 2KSQA 2Q9BA 5DN6A 5JS8A 4LV6A 3TE6A 4FD2A 4DT1B 3UIEA 1NLFA 4WZBE 4YONB 5CIQA 1FW6A 2O8FA 5JRJA 3A8TA 1E99A 2FU5C 5C1BA 2G6BA 3JZAA 2HYIC 4KXFB 3FMIA 5J5CA 2O8CB 2XNSA 3V9PA 1J8YF 2O8DA 1VHTA 4L4UA 1GUAA 4YXWA 4DIDA 2FSGA 2QQ0A 3E1SA 2HLDD 1DE0A 4BRWA 4XTRA 1G8YA 4CRWB 1E2MA 1N2CE 1W5SA 1AKEA 4GDFA 4RY2A 2DCUA 1ONBA 3I3SR 4P4UA 4Q1BA 4EKDA 4HEJA 3C15C 2GRJA 4KSCA 4JBYA 2REOA 3OEHA 5E7JA 4LHVA 4KFUA 2FFBA 4HATA 4KU4A 4CEJB 721PA 4IDQA 1E9BA 3NBXX 2BBOA 1Q57A 2QGZA 2JLUA 3Q7PA 4TQAA 1OH8A 1P2UA 3UATA 1IM2A 2QRNA 1XPOA 3IEVA 4KFRA 2XEXA 3K0EA 2DB3A 3OIUA 1U0JA 4C0QC 4K8OA 1FQKA 2OV2A 3MWKA 1FUKA 4EFNA 2QU8A 3GJ5A 4PHHA 1P7CA 4PZZA 2G77B 4NKRA 2R8RA 2FE4A 5BXQC 4U7DA 4Z1MA 2AR7A 3LFUA 2GZDA 1SVWA 1IJFA 3L8ZA 3PG5A 2ZVQX 4OI4A 4A9AA 2V7QA 2IYTA 3AVPA 3T34A 1DAKA 4WVFA 1IY0A 2XZPA 3TBKA 2ZM5A 4MQBA 3UWOA 4P33A 5HR5A 1TQ2A 4DEXA 3P1JA 4DIEA 3Q5DA 1E98A 1XEXA 1JR3D 1AKYA 2WAYA 2WICA 4AKGA 2ZJYA 4X8MA 4FI3C 4YXWD 1Z28A 3ZD6A 1ZC4A 4GZLA 1R0XA 5F2EA 1KI2A 4IXMA 1U2RA 2FJUA 1K5DA 2ZRIA 3LA6A 1NMZA 1P9WA 4O0MA 2ZTSA 4NYMQ 1TL7C 4GOXA 1QHHA 3OEHD 4NCJA 3U3RA 1JECA 1UKVY 2ZRNA 3FMPB 4Q5IA 5KUTA 3W8RA 2HT1A 1JXOA 4UJ5A 3W3ZB 1P9RA 4Z8XA 1BS1A 1RJ9B 1E2JA 4HB3A 3VR2A 3L2OB 1G5TA 1ZIOA 1Q1QA 2A5FA 3NDBB 1YR9A 3A36A 1L4UA 1UEJA 4UKDA 3OIWA 2A5JA 3KKOA 3UK6A 5KPDA 4MRVA 5FUVA 2QRZA 1KTVA 1Z0JA 1TMKA 3RS7A 4B71A 3R8FA 1DTSA 2BBWA 4Z1MD 3H84A 2ZAOA 3FHOA 1LF5A 1KO5A 3T61A 4DJTA 4EPTA 4OKSA 1OHHD 2V7QD 2WMNB 1YZUA 4HUQA 1VTKA 5L3RA 3A4NA 2QMUA 2NZJA 2HCJB 3DOFA 1M8PA 1NKTA 4DC9A 2AKAB 2HEIA 2D3WA 2W2VA 3FTQA 4RD0A 3LX8A 4A82A 2UZ3A 4URVR 4O2LA 3WYAA 2IK8A 2ODBA 3KQUA 5L3VA 1N25A 5BYKA 1KSJA 2CE2X 4DEYA 1NVXQ 2B8WA 2HJGA 4M53A 1MO6A 1YQTA 2JLZA 1QHIA 3OFND 3T1TA 1JQJC 4A2WA 4KO8A 4LDJA 1P2VA 2QM7A 1U90A 3CIOA 1XF9A 2EFEB 1G17A 1XD2A 4M1KA 1FL9A 3GFTA 4A4DA 4D2IA 4UNNA 2ZSAA 2WPDD 3BRWD 5HZKA 3MUFA 3T1VA 5FL3A 3VR4A 3H1TA 2EWWA 3WHLA 3GJXC 4A2PA 2QORA 5L3QB 1J90A 2WWWA 4EQ6B 4O2RA 4PPGA 1N6NA 1UKZA 1X3SA 1B23P 3KL4A 2PJRA 2VP9A 1WA5A 2QENA 3BERA 3I5YA 1YZGA 4IDOA 3ZZ0A 2ODNA 2QI9C 2V55B 2Z6VA 2ZJAA 1NG9A 1PZNA 3BB1A 821PA 5IF9A 1YHNA 5HE8A 4RFSA 3OF5A 5EZ6B 1QG2A 1YZKA 4OYHA 1DAIA 2H7VA 1HT2E 2ODEA 1U8ZA 2QA5A 3PR1A 1CR1A 4JSYA 1RPZA 4BFXA 3IQXA 4QGFA 5L3SA 3GCGA 2C95A 2H57A 2IYVA 3I8XA 3QNUA 4NYMR 1DAEA 2OFXA 3VHXA 4BGDA 2KE5A 2GEDA 1SXJA 4BASA 2DFKB 3B1ZA 4GL2A 1JAHA 3P26A 1YE8A 1KAOA 4B74A 4Q01A 4TYWA 1SQ5A 1SVSA 3LVRE 4CT4B 1YR8A 2GDJA 2F9MA 3EA5A 4AIIA 3U2QA 2WOOA 1GFIA 4M9QA 1GNPA 3S1AB 5EXSA 1E6CA 1N6OA 1US8A 2WJGA 4C0AC 1H65A 2DYKA 3A1UA 4U00A 1TNDA 3CX8A 4MRRA 3GLGA 1AS0A 2KBFA 2Q3HA 4LOAA 4KFSA 1XRJA 3SFZA 2EFHB 2R9VA 2ZYUX 5J4LA 2H18A 1WMSA 5BW8A 2IF0A 4RCZA 3TVDA 3ZQ6A 1CKEA 3NHBA 2VSFA 1P2SA 1P75A 2VP2A 4LV8B 4IDNA 2W00A 3WXMA 2W0SA 5FBVB 2PLRA 1R6BX 3UMRA 2E9SA 5J4YA 2Q9CA 4BLPA 4YMTA 4RSGA 4HDOB 3ADCA 1TF2A 4A8JA 4CEIA 4JL8A 5CLLA 4LJ4A 2QT1A 4M1MA 3THXA 3EIQA 5F98A 2R6CA 1W0KA 2CLSA 2CDNA 2WZQA 4KLZA 3BD9A 4OHYA 1SXJD 1JALA 1L8QA 2ZS9A 3SYNA 1SXJE 1XJCA 1W4CA 4TLDA 1JJ7A 4V03A 3U6KA 2PEZA 2XOKA 3LQRA 2CE7A 3CPJB 1G6OA 1H8EA 4LJ9A 1VYTA 2P65A 1O3YA 3O8DA 1FZQA 3KX2A 5DISB 2IL1A 5G41A 2NZ8A 2YWGA 1U98A 2FEMA 3V4FA 2GCOB 1DAGA 1FTSA 4GNKA 1Z6XA 1OIVA 4YDHB 5JHGB 3AVTA 4N0DA 4OBEA 3GFPA 3HPRA 1U8YA 4PAOA 3SFVA 3FHCB 2JASA 4NYIQ 5DIFA 3C16C 3V4RA 4D4MA 3P20A 4LPKA 3VR5A 4RZUA 2C8VA 4YMUA 2IYQA 1GRRA 1MOZA 1ZUIA 3CLVA 1SVMA 4ZPXA 3EZ2A 3K0FB 4V0NA 4Y0VA 3TUIC 5AJYA 4D80A 2KJQA 2QT0A 4PTLA 4D0LB 3TVTA 2Z43A 1W49A 1O87A 2C2HA 2G1JA 4MKGA 4QKQA 4C7OB 2C78A 3GLHB 3F0TA 4BEJA 1XCGB 3LXXA 3NKVA 2ZPTX 3LXRA 5E7MA 2FGJA 2VSOA 4XIGS 4GFDA 1W0KD 2CBZA 2FOLA 1VCMA 4Q00A 4LHXA 4KVGA 4R98A 3K70B 3WRYC 1JEEA 1GTVA 1T3SA 1PJRA 2NOAA 1ZM3A 1R7RA 4IW3B 4PAMA 4QGGA 3AV0B 2HYDA 4DLSA 1QHNA 3SN6A 4B6FA 2MMGA 4EFMA 4QBHA 2XOKD 3SBEA 3JZMA 2OO7A 4NCIA 1H8ED 1G5RA 4ZDWA 5KSOA 2KB0A 1XMIA 1L4YA 3OIYA 5FPTA 5EP1A 1JBKA 4DCSA 2D74A 1YVDA 5JSZA 2YVUA 3CRMA 4IHQA 3PEUA 2WWXA 2WJJA 521PA 3ADDA 1UDXA 3ND8A 2NQ2C 1G7RA 4LZZA 5D3MA 4ZI2A 4M22A 5EUQB 3EPKA 1XD8A 2GVZC 1GDDA 2J9RA 5G53C 3CNNA 3X1DA 1S3GA 2WKRA 3EC2A 3QG5A 2QNRA 4C4PA 4NL4H 4P4SA 4X8HA 1Z06A 3BB4A 4DVGA 1DADA 5AJWA 1II8A 4ZI3A 1D9ZA 1L2TA 1QHYA 2ATXA 2H5EA 3TQCA 1HUQA 1AIPA 1VG1A 3ZGXA 2YKGA 1UM8A 3TH5A 5FFMA 2JJ8A 4FMCF 1R10A 4D4LA 5J4KA 1T91A 3PUWA 3H2YA 4TTPA 3T1QA 2ZI9A 3B2EA 4FN5A 4MITA 3N5CA 1W36D 1PLLA 3THYA 3LW7A 1L7VC 3U4QB 4BZQA 2HDNB 4CT5A 3AVQA 2EVWX 3MJHA 3PVSA 4CW7A 2AK2A 4LJ5A 1NP6A 4ILEA 2FWRA 4WZAE 3SYKA 1G7CA 3AP1A 2ZRDA 1RRCA 4AYWA 3AGQA 5DSZA 4NYIR 3HWSA 3V00A 1KHTA 1GIAA 1T5IA 2D2EA 4A0GA 2YWEA 1Z47A 4HAWA 1G3IA 3SNHA 1GWNA 2FSHA 2GF9A 3SJAA 4Q4JB 1IN8A 3AVYA 2VPPA 1GOTA 3BFXA 3TMKA 2Q21A 4Q21A 2IEZA 4B47A 3NTUA 1KDOA 3R7WA 3MSXA 3EPHA 3KJIA 3Q8XB 4M4SA 3U3MA 3BH7A 4B3GA 2IC5A 5E95A 1W46A 4QXAA 1FNMA 1I2MA 1U81A 1OFHA 4OI1A 3UG7A 5EP4A 1AJEA 2ZEJA 2FGKA 1JNYA 2VHCA 4J0QA 4DB2A 4DT1A 2OCPA 2Z5FA 4MYHA 2IS1A 2RGXA 4HSEA 3ZH9B 1YZTA 1Q1BA 1IN7A 2IUUA 2OCYC 2NO6A 1NIJA 5TY0A 4MA4A 5JLJA 2AWOA 2OILA 1CJVC 5F3WB 2V1XA 4G5RA 2B8TA 2QAGB 2RGCA 1N0VC 1CR2A 4LJYA 1U9IA 4R9UC 5JCPA 3BWDD 3K1JA 4PPNA 3CB4A 4G5QA 621PA 3AGPA 4G5OA 4DCUA 5GJCA 3FKQA 1FX0B 2AFIE 3TRFA 3BFVA 3CPHA 2K5UA 1XMSA 2F7SA 2QMEA 3KQKA 1AGRA 1KSHA 1DEKA 4CEJA 4BFTA 4I99A 1EK0A 2V6IA 2V8OA 4PSVA 3EZ6A 3SDZA 3DM5A 4AK9A 4HB0A 5HCNA 2F43A 1N6RA 4D82A 4GT1A 1T0HB 1NF3A 1XB2A 4TMTA 4BFSA 4BQSA 2OAP1 4MKFA 4R2IA 4A36A 3W90A 1IXZA 2IXEA 2NMVA 1DAMA 3SJBA 4HLQB 4YLGA 2XB2A 1M6NA 4RVCA 1P72A 2NGRA 1OH5A 2UZIR 1IONA 1VYVA 4LYAA 3KJGA 4Q4LA 3T06B 1W47A 1YZLA 3MLEA 4Q7KA 3G5UA 3WNBA 4OK3A 1MR3F 5DI3B 3LQQA 5B57C 1TADA 3TKLA 3UANA 4DKXA 2CJWB 2GNOA 5G3ZA 3L0PA 4GOJA 5C46F 2FEOA 4LJAA 3UWKA 4AWXA 1XTSA 4URYR 1VCIA 2AWNA 2F3RA 2J0VA 4Q9LA 1P4SA 1XU4A 3IUYA 2IX3A 3OAAA 4URUR 4EJSB 4EIWA 1W7AA 2CHQA 1A2BA 2ZS7A 3B9PA 4Q4AB 4CF7A 3X2SA 4GP6A 4GMDA 1CLUA 4Q9JA 3REFA 1PUJA 1YU9A 3KDSE 2FA9A 1OV4A 2VP0A 4E22A 3FGNA 1Q22A 3THOA 1CULC 3VR6A 3AVUA 1XFAA 2A9KA 3VHLB 1XTRA 3OHMA 1QRAA 1RJ9A 4OI2A 3ZS9A 2BM1A 2DPXA 5AWFC 3BIFA 1J8MF 1SXJC 2FFAA 3KKMA 4I1SA 5EP2A 2YHSA 1E9SA 3HR7A 4B3BA 3GLFA 1W4AA 3J81k 4B75A 1A5TA 2WBLC 1P9NA 1S0UA 1N6PA 3IKJA 4IJMA 5EE3A 4QBGB 1E96A 1ZIPA 4BE7B 1I4LD 3RRYA 2CLDX 3P27A 3GLIB 1V5WA 4GBMA 3CBQA 2ZE6A 1KI1A 3P4XA 4A92A 3TNFA 2CNWA 4JS0A 5L8VA 1KDPA 2Q3FA 4AKHA 2ZRLA 5IK2A 2BEJA 3AKDA 2ZJBA 4C0SA 1WB9A 2J0QA 3KXLA 1RW4A 3AB3A 3TR5A 2J1LA 1OB2A 3BGWA 2ZRCA 5H68A 1J7KA 1TQDA 3MWLA 3QF7A 4BLTA 4OHWA 1G9XA 4A1FA 4XJXA 1T9HA 1GKUB 1LB1B 2EFGA 2REBA 3HU3A 2FX3A 3MRSA 2V4ZA 4OJQA 5FPHA 3SZRA 3ZVMA 5EE5B 2WSMA 2ZJ5A 1XMJA 2O8BB 4AYTA 2VHQA 1G21E 4M1TA 3MWYW 3R9WA 1MABB 3D8BA 3UMSA 4C0BA 2JLSA 2CVHA 1RE0A 4M9SA 5HKKA 1AZSC 4A8JC 3H4MA 3PUZA 4F93B 3U7GA 5L3QA 3DDCA 2XB4A 1E94E 2CK3A 1CRQA 1TAGA 3GJ6A 4D0GA 1SKYB 1KIMA 1Z2AA 3SI7A 3PITA 2C9YA 1XCPA 4DLWA 4DLRA 2G1KA 1W4BA 3NEYA 1HE8B 2YOGA 2X2FA 1ZMXA 3IBGA 4LYFA 3FKSA 3CR7A 3UPUA 3GLFE 5DHAA 4GP7A 5B58C 3IIKA 4NE2A 2BDTA 2ZR9A 2J7PA 4PHFA 4B76A 3TW4A 2GXQA 2OCAA 1W2GA 4G3XA 3CONA 3JVVA 2CNWD 3I5XA 3WYGA 3PJRA 2CL0X 5IK2D 1AK2A 2R6AA 2FPMA 4JLNA 4HAYA 3TUJC 3HP1A 1KAGA 2QY9A 4PSKA 4F91B 3DMNA 4XSHA 2ZR0A 2RCNA 1UDWA 2ECKA 1LFDB 2ZAMA 3K8YA 4E09A 4JLAA 1II0A 2ASEA 2PEYA 2NPFA 2PCJA 1F5NA 4P32A 4PC6A 4DUGA 2GCNA 3ECCA 4XVQA 3A1VA 2DFNA 2YJTD 5BN4A 5JWHA 3THWB 4GOKA 1SVOA 1KY3A 2VP5A 3P4YA 2FNAA 1Q3HA 3CWZA 2NPIA 3QKRB 1VMAA 1AM4D 1G4AE 4YMWA 1W2HA 2N46A 2YV5A 5G3YA 4DWJA 3KFXA 4C30A 5JI3E 4MRSA 2ZQ5A 1JEDA 2GJAA 1TU3A 1WQ1R 3ICEA 2FH5B 3GP8A 3I62A 3HYTA 4DSTA 3B1WA 5K8LA 1GZSA 2OBLA 4IVRA 3UXMA 2OBMA 2XTZA 3B6EA 2R62A 1R8SA 1M7HA 1NL3A 1W36C 1KK0A 3QJYA 4DLVA 3VR3A 2ZREA 1LV7A 2WIAA 3BH6A 4ZKEA 4NZYA 4TQ9A 4WXPA 1G8HA 2QP9X 4P0TA 4MDFA 4LY6A 3FKSD 2HF9A 1E2FA 4LC0A 1EG7A 1VHLA 4GMXA 3OEEA 3RS3A 2P5SA 4OI0A 2J45A 2F1IA 1T3LA 2J7PD 5DN6D 4HDQB 1MV5A 5KPJA 4PHGA 3T5GA 4WZ6A 3WBJA 1Z5ZA 4PANA 1Q21A 1QHSA 3AF4A 1Q12A 2ZS8A 4KHZA 4IXNA 1EFRA 2JIZA 2MSEB 2EQBA 3X1WA 1F48A 2UKDA 2PJZA 2W0MA 4JT4A 5FTJA 3QEJA 2PT7A 4CVNA 3CRRA 2IA5A 2ZETA 4DLXA 4DUGD 2QZ4A 4OJKA 2ZIAA 3BOSA 2NO7A 1ZBDA 1MRNA 1E9CA 3U44A 2FG5A 1G1MA 1IN5A 2DHRA 1Q1EA 4WW0A 3GJ7A 3OESA 3SBDA 5IT5A 4QBIA 1R8QA 2A7QA 4MYTA 4QJ5A 4JZKA 5JMTA 2UVQA 3BE4A 2F1JA 4UXIA 3W6NA 4ZCMA 1KMQA 2N1BA 4V0MA 2GCOA 3ZVRA 2I1QA 1G19A 1XPUA 1CRPA 5DNYB 1LY1A 4U02A 2C99A 3BFKA 4C0HA 1E2EA 1OFIA 4KAXA 2AHOA 2O5VA 1T4GA 1ESMA 3QF4B 2A3RA 2W2XA 5LD2B 4M1WA 1Z0KA 1R0ZA 3QG1A 1KI8A 2ZROA 3CKLA 2QPAA 2IYSA 3FFAA 4PC2A 1FMJA 3OEED 4G1UC 1Q44A 2CHGA 3B78A 4LX0A 1XBTA 2QG6A 1E4YA 2WMOB 4CZ2A 1GNQA 5JS7A 2EFCB 4KSBA 1RKBA 3A37A 5CIWA 4EPYA 5EP3A 3EIHA 4Q02A 3KJHA 5KDOA 3PUYA 4TL9A 4YQFA 1JQLB 2JIZD 4OQFA 4A0FA 2VA8A 2WJHA 2Z4RA 4PC7A 1COWA 3DZDA 4ZDIA 2Z4SA 4Q1CA 2CEAA 5BQ5A 4ZDJA 1C1YA 1NVWQ 2AD5A 4DLTA 2NTYC 5FOXA 2FPLA 1OLOA 1UFQA 1R0YA 3KXKA 5G40A 1VKJA 4Z8YA 1IXRC 2YWFA 4PO9A 3TSWA 3GEHA 1TF5A 3BS4A 4CEHB 1E2QA 1NMYA 4UNQA 2BCGY 2XJ9A 3U7FB 4KBFA 4NCNA 2GZHA 3GPLA 1U9IC 1AZTA 2XX3A 4P4TA 2QQEA 1WBBA 4JLKA 4V0ME 1HTWA 4JJZA 1XPRA 1OXTA 4E5UA 5DGXA 2GCPA 5KNCA 5SZHB 2F1HA 3MAAC 3GJ4A 1GAJA 4JKIA 3RRMA 4BFZA 2C96A 1Z8FA 4HUTA 4IRUB 4S2EA 3GFOA 2PX3A 5HCIA 3NDPA 1W5TA 2VO1A 3BJIC 1QF9A 4W5HA 2QBYB 4V0OA 2IYXA 3DL0A 5B2ZA 3T12A 1PVOA 1IJEA 2JLRA 4TZ6A 2G3YA 1RYHA 1KO4A 2ZANA 2J41A 1KKLA 4Q48A 5LPNA 1XD9A 2C77A 3FWYA 3QKUA 1KNQA 1W1WA 3QBTA 1Z6YA 1AA9A 4UNPA 1I4DD 4MGIR 4QL3A 1DG1G 3PIRA 1KK1A 4JVMA 4V02A 3UG6A 3D3QA 4N3NA 3GLHE 1Z2CA 2AL7A 3Q5EA 4HB4A 4QRHA 1COWD 3ZVLA 3QSYA 4IEIA 1CP2A 4TZ0A 3U4QA 1RZ3A 2ZI7A 5TDHA 3Q3JB 4PFSA 4D26A 2J87A 3EPLA 4GZMA 2GBLA 3IPYA 3KKQA 1XJQA 1R2QA 3B85A 3TSZA 1YZNA 3FYHA 1T5LA 1OSNA 4RD1A 1MO5A 2WIBA 3N2IA 3RS2A 5FBLB 2OAQ1 4LJ7A 1KJZA 1VG0B 1XTKA 2XZLA 4B48A 4CGZA 3NEJA 4F4CA 1MRSA 1DARA 5JWOA 1Y3AA 2ORWA 2A5DA 1PUIA 5TMPA 2GHIA 2CCKA 4QOSA 2OFWA 5FL7A 1UKYA 4TTQA 3GEEA 2ZRBA 1VECA 3WMFA 2NG1A 1WCV1 2GESA 3QXCA 1ZM7A 1IHUA 1TU4A 2MSDB 4OQXA 3PCRB 1N3BA 4BEBA 4OQNA 4UXHA 5H70A 3PFIA 1WBDA 4ZIRB 3NVAA 4H1VA 1U0HC 1M7GA 2CVFA 3QPUA 3QXHA 1NY6A 1LS1A 1KO7A 4D4JA 4W7SA 2QAGA 4RCYA 1YR7A 3EXAA 4IOJA 3VAAA 4NU0A 2IS6A 2D7CA 4LCBA 1MT0A 3GJ8A 4HZUB 3CO5A 4JLDA 1ELOA 4M1YA 4RD4A 1E9AA 1R0WA 3B13B 4YC7A 3IO3A 5CJ2A 4BFYA 1FX0A 4KLNA 4OHXA 1NSTA 2RKOA 2B21A 1HQYE 2BEKA 2C9OA 2AN9A 3M0EA 2JA1A 3G82C 2D7DA 1X1RA 3B7GA 4YMVA 3CZPA 1XEXB 4JVNA 3LBIA 3REGA 5JJKA 2VP4A 3A4MA 1P5ZB 1E0AA 4HDCA 4MUBA 5CK5A 3AH8A 3DKVA 3EZ9A 1FTNA 5JZVA 2ZR7A 2DWQA 3K09A 4O25A 5LB2A 4EPXA 4B35A 4F38A 2G0NA 2GVDC 3R20A 3R9IA 1D5CA 4AKIA 3KQHA 3RS4A 4XOIA 2GAAA 1FFHA 5FOVA 3A4LA 3BBPA 2IYRA 2EYQA 1XXHB 3I1FA 4EPRA 5GADl 1LS6A 1QHHB 1F60A 5FL7D 1R5BA 3W34A 5FTNA 3Q72A 4DLYA 1OE0A 4BLOA 2RHDA 2BMFA 2O8EA 3L0IB 2J3EA 4LYHA 4HLUA 2PZFA 2ZSDA 4JSTA 2BBTA 4I1OA 2JLVA 1J99A 4MKHA 3RDPA 4B34A 3U6BA 1N6KA 3ZQJA 1KJYA 4ZO4A 1N5KA 3ZS8A 1CS4C 2OHFA 1P73A 5BWMA 3F5FA 1DBSA 4LBWA 5EXTA 3FOZA 1GG2A 3WMGA 4ZCIA 4JBWA 3QBVA 4AY2A 1KZGB 3NHAA 4FXPA 3HU1A 4OHVA 2IT1A 3DM9B 2VP6A 2X8AA 1CJMA 2EU8A 3RS5A 4EJSA 3QPVA 1NNEA 1Z6AA 2VL7A 3SR0A 5FOUA 5FPSA 1Z83A 1ZNYA 2O0JA 4P31A 4QGHA 3VX4A 4HAUA 1E69A 4XWKA 2JJ2A 4HUQB 4K46A 5JRZA 2Q6TA 1QHGA 4JBXA 5KU1A 1AQUA 1TPZA 4NPHA 2VYFA 4EPWA 4Z54A 4ZDKA 1OB5A 4KODA 4TMKA 1QVAA 2RHMA 2WAXA 4EAQA 3LNCA 3AF1A 4ARZB 4M21A 3K0AA 2VHJA 1MH1A 1S1MA 2X1VA 4HYYA 4L16A 4XWOA 1VG9B 3WYFA 1T6NA 1MO4A 2BBSA 1ZINA 1UF9A 1KYIA 1FUUA 1XD2B 4IDHA 3HJNA 4NP6A 1CXZA 1NN0A 3RANA 5AUOB 5KNDA 2DY1A 2H92A 5GVRA 2OXCA 3VKHA 2JEOA 4F4IA 1HT1E 3IHLA 4Q4HA 1SHKA 2OG2A 4GRAA 1BYUA 2B92A 3LAWA 2ATVA 4H9GA 5TARA 5FR1A 4IOLA 3EA0A 1WF3A 2DBYA 4HAZA 1E2DA 3HDTA 1JJVA 4TLAA 1ZNZA 2WHXA 4D6PA 1ZU5A 2WSSA 3KZ1E 4ON9A 3VTKA 4RZ3A 2A5GA 1KDTA 1D2EA 1NBMA 2O8BA 4B44A 5JEEA 4RFSB 4US0R 4DSOA 2FFHA 3MGCA 4URZR 4NH0A 4TL8A 5TVKA 4NCHA 4QHYA 3EG5A 1RVDA 2JJ2D 4Q66C 3TQFA 1P3JA 3QVVA 3AM1A 4IKEA 1Z08A 3WRXC 4B3CA 2RGEA 1DG3A 4DBLC 3NG1A 1OYYA 2BKEA 4N1AA 5EXXA 4B33A 1SXJB 2W6JA 1IXSB 3CF0A 2ERYA 4M1SA 2AK3A 3AVVA 1OH6A 4KFTA 1Z6GA 1Q20A 1ZCBA 1Q3TA 3PEYA 1GRQA 3CR8A 2P6UA 1F2UB 1YRAA 1US8B 5KSPA 1KI9A 2WKQA 6Q21A 3F8TA 5C4GB 2XTMA 1E79A 4DSUA 2OXRA 1QHXA 1S9HA 2E1RA 1S9DA 3GLGB 4QFMA 3B1XA 3SS8A 5GVSA 1JI0A 3W9YA 3X1ZA 4MH0R 2C04A 4DDUA 5BN5A 3M4YA 2NO0A 1I2DA 1M34E 2O8CA 3VNVA 2BCJQ 3RLFA 3DEFA 3IEUA 3QY0A 4AG5A 5J4HA 1VCNA 3C5CA 3QUSA 2GF0A 1WE2A 4F4JA 2REXB 4LK2A 2QMOA 2GKSA 4B73A 5AJXA 2WSSD 1ZW6A 1E2LA 2Q9AA 4JLPA 5KTYA 3K0SA 3PXGA 1A4RA 2WJIA 1NBME 4HI0E 1W0JA 2Z83A 1KO8A 3QKRA 4TT3A 2X19A 1E0KA 5E3HA 1G18A 3SJCA 3SU8A 2OFOA 3TAHA 4A8JB 4CEIB 3W5IA 1TEVA 2GZAA 4IFBA 5E7IA 2VRWA 5EE1A 1IOZA 3N70A 3BK7A 3TLXA 2WWHA 4FWIB 1D2NA 1EX7A 4RKFA 3CX7A 1RRPA 1I4TD 1NN1A 2QTFA 1HQCA 4U5XA 1YZQA 2W6JD 2FN4A 2GK7A 3K70C 1BMFA 4KITB 2BMEA 3EWSA 1GILA 2IXGA 3HYRA 2YYZA 2JATA 1SKYE 2ZRHA 1FPMA 5AR1A 5FPKA 1GL9B 3IO5A 2ZE8A 1RRGA 2GJ9A 1CJKC 4S35A 4LBVA 1JAIA 4DDWA 3AVOA 3CM0A 1OXUA 1N0UA 1E79D 5JEDA 3DKPA 4YDSA 5GJWC 3AVWA 1FP7A 5FR2A 1KNXA 1E9FA 3PENA 2WVJA 4LJ8A 3AUYA 4BECA 2XZOA 1KSGA 2F9LA 1KO1A 5KNBA 2IS2A 4JYBA 5DLQC 2R6GA 3CH5A 2PCLA 4LRWA 2R65A 5DI9A 3B1VA 4KBGA 1GRNA 2RH5A 4IVPA 4TLBA 1RYFA 3PUVA 5GJVC 4PZLA 2QPTA 4WAUA 3NC0C 4B43A 4MRNA 3D31A 4C2TA 3LVQE 1TTTA 4PC1A 1XEWY 2ZRPA 3LY5A 3ASZA 2QPOA 2KWIA 4DCVA 1JR6A 5A5GA 2HV8A 5M04A 1W0JD 2JLXA 5J4VA 1YKSA 1S1CA 3EW9A 2ZVPX 1G16A 4JVSB 1G3RA 2JGNA 2GXSA 3AEZA 4XWAA 3WP1B 4LPSA 4TYNA 4MGKR 1EFHA 1ETUA 1G291 1W36B 4LJ6A 2J46A 1JPNA 2XXAB 3I73A 1CJUC 5FH9A 2W58A 2BWJA 3M6AA 1BMFD 3QF4A 3I61A 4US1R 2GBLC 1P60A 2BJWA 3NBYC 4LHWA 5EXPA 1KJWA 3Q7QA 2GXUA 4HAVA 4LV5B 3RVBA 3VKWA 421PA 2YOHA 4OK6A 4D81A 3AF2A 4Q7MB 5AUPB 4BFUA 5E4FA 2GJSA 2ZUCA 4Q1FA 5JSZB 1F2TB 2FSFA 1SULA 2B7BA 4ERNA 2B6HA 2LCFA 3ZVNA 2GEVA 2EW1A 2I1VB 3T35A 5JCZA 1GKYA 3IPXA 4QGAA 3LD9A 5JJLA 1ESNA 2IUTA 1OXVA 3RC3A 3TUZC 2VH5R 4I81A 5A0FA 1G20E 3OAAD 1N5LA 2J7KA 1QVRA 4QJ3A 4E03A 4P4SB 5KSZA 2C98A 2HCBA 4FW9A 2CHVA 2A30A 2OZEA 3L43A 5FTKA 2WWFA 4ACAA 4B2IA 2B7CA 2OT3B 2D62A 4E07A 5KOYA 3ETLA 2PZGA 3M1IA 2ZRKA 1UPTA 1DVRA 4HLDA 3RWOA 4MYCA 3EPJA 1M2OB 3E70C 5CDFA 4CEHA 1Z0AA 2MSCB 4EQ6A 4FMDB 2FF7A 2YZ2A 2ZJ8A 1ZD8A 3QPWA 5FTMA 3O47A 5FBQB 5D3QA 2IW3A 3ASYA 1M1YE 3THYB 1XTJA 2VF8A 4BLRA 3AF0A 1DO2A 2IYUA 4GSYA 1CBUA 3IILA 4I4LA 1E4VA 1OF1A 3LLMA 3NBZC 2IYWA 5DE3A 2CL6X 3KTAB 2W6IA 4FWTA 1KMHB 3FMOB 3O8BA 2J0SA 5JBQA 4F92B 4POAA 2D06A 1EFTA 1UEIA 3IHWA 2BMDA 3KKNA 2W83A 2BVNA 5FPYA 1LF0A 2QBYA 1FNNA 1RRFA 2YNMA 2IEYA 5SZKB 3K09C 4O3MA 3FHTA 3QQ5A 1CU1A 5LB4A 5JFGA 1G8GA 4A2QA 4IEEA 3LRPA 1G7TA 4TL6A 2GK6A 4LBYA 3G0HA 1GKIA 1ZM9A 3T5DA 4P3YA 3EASA 5ANRB 1E1QA 2F6RA 3CRW1 3MD0A 5IHPA 4A0HA 3VX3A 2XITA 1EFUA 3NIBA 2WJVA 3WHKA 2OUKA 2WWYA 1A2KC 4ACBA 4HLUC 1GITA 3F3YA 4YMSA 2VIIA 3S1AA 3VQTA 4EUNA 1JR3A 4LYJA 2IUSA 2O0HA 5HKKD 3L0SA 3L8YA 1KI6B 4QHSA 3IIJA 1XZPA 4DDVA 2FFQA 1H8HA 5DYIA 5CDFE 3O8CA 1ZNWA 2YINC 2CK3D 3TSOA 1LW7A 3EZ7A 2N42A 1JXMA 4D4KA 4EJSC 1KKMA 1UBEA 3EARA 3LDAA 4URWR 3KQLA 3X1YA 4M0LA 3VFDA 4AURA 3GJ0A 1C4OA 1U8AA 2CCGA 1E2HA 1IY2A 2CCJA 2VHUA 2DWPA 2R44A 1BKDR 2W6ID 3HU2A 1CF4A 5BYJA 3WNDA 3BH0A 4Q18A 4KI0A 4Q9HA 2BJVA 2PBRA 4IOKA 2OCBA 4DSNA 4D0NA 1WP9A 1ZJ6A 2F3TA 2F43B 2VLIA 3GJ3A 1MKYA 1BIFA 4NHOA 2WWIA 5EUMA 4ZIRA 4NTZA 3QKTA 3FVQA 1E2NA 2WOJA 3AF3A 5AK0A 3DOEA 5AUQA 2ZU0C 4B6EA 5HZHA 5JJIA 3KKPA 4OK5A 2Q3MA 4HZUA 1M74A 4JYCA 2ZI3A 1E1QD 2V9PA 5SZIA 1HV8A 4ZCLA 1BO6A 3RS0A 3MJRA 1OHHA 1KI3A 5FI0B 3RSOA 5TB5A 1QBKC 2DR3A 2OE2A 3ONWA 3CRVA 4NONA 4TMZA 5FUWA 1CJTC 1E1RA 4Q19A 4DLZA 4XH9B 2RGDA 1AS3A 1DO0A 3PV0A 4C0JA 2ORIA 4JLOA 4HAXA 1P61B 4Q1AA 2GA8A 4AI6A 1JR3E 1AS2A 1S2MA 1Z0IA 2IBMA 1AGPA 4B3FX 4EFLA 4C3ZA 1JPJA 3NC1C 1EWRA 2ZJ2A 4GPTA 2ZRGA 1H8HD 4IVQA 3OFNA 4JT2A 1DS6A 4BLQA 1IN4A 2W2TA 2ZE5A 1XXHA 1NN5A 2J59A 4WOPA 3TAUA 4QHTA 2AXNA 2DWOA 4LHZA 4RFVA 4L9SA 4X8LA 1OJLA 1KI4A 4HB2A 1YRBA 2WPDA 3QI2A 2WJYA 4QBFA 3C5HA 4MGYR 1Z07A 4TYPA 2P5TB 1T3HA 2ANBA 2PL3A 3K0FA 5FOWA 2A78A 5AJVB 3CUEF 3K0CA 2LKDA 3CNOA 3NH9A 5DH9A 4PC3A 2BM0A 1FMLA 2FV8A 1DELA 4GI7A 5CB8A 1U99A 3GLFB 1G5PA 1EFRD 5FI1B 2H16A 2CL7X 3GLHA 4C7OA 2BKUA 1M7BA 5LBIA 3QKSB 4ESHA 2D4HA 3AP2A 1OW3B 1S8FA 2Y8EA 3WY9A 4TL7A 4ZV4A 3EAQA 2R6DA 1QG4A 3HR8A 1Z63A 2ZYTX 1R5NA 3I4LA 3LO5A 4A6XA 4A15A 1OT3A 1CTQA 3FMFA 1HEIA 4XSGA 1LTQA 5CJPA 2MMCA 3T1OA 1IQPA 221PA 4JLVA 4JKYA 1E1RD 2C5LA 4TN1A 3DMDA 5H8WA 1G4UR 1WDTA 2LKCA 2TMKA 5SZJA 5GJBA 4Q03A 5DO9A 2JLQA 2X2EA 1N6LA 2XNDA 2F55A 2OSBA 1X8KA 2PLFA 2J0UB 2QP4A 4Q9IA 1CR0A 4ARZA 4BWYA 3FB4A 1AQYA 3H86A 1E2PA 1V43A 5F9FA 3MWJA 3LV8A 1RIFA 2HF8A 3L82B 1E3MA 4UQOA 4BRUA 1OYWA 4Y0AA 1DAFA 4AC9A 1KI7A 2RGGA 1IBRA 3IIMA 3K9GA 4G0NA 3ZDQA 4DDTA 4TLEA 3I72A 4TMWA 1XXHE 4C0LA 4TLCA 1N6HA 1S3SA 3VU9B 2ZRFA 4W5JA 4B2LA 4RZXA 1KZ7B 3I92A 1DPFA 4MKIA 2P2LA 2FSIA 1UAAA 3CW2A 1R5OA 4I1VA 4PO8A 4M1OA 1G41A 1MO3A 2ZJZA 4EPVA 4MUAA 1VYUA 1FQJA 4L15A 3CPEA 1KK3A 1N5IA 3I8SA 3ICQB 1ZYUA 4QC2A 3QENA 4UNRA 4AD8A 4WA7A 2RMKA 4MYUA 3IBYA 3PUXA 5FOTA 3RSLA 4FCWA 2BOVA 1R4AA 2AKYA 3K70D 5CM8B 2NIPA 5K8UA 2RGBA 2YC4C 3K9HA 4C9BA 1G7SA 2V6JA 2O8FB 2PZEA 2KI5A 2EWVA 2XSZA 2LWIA 1QDEA 4BZPA 2O8DB 3ZZUA 2O52A 2XNDD 2GAOA 2JCSA 2WM9B 3KFVA 3LH5A 4QM7A 2BIFA 2CXXA 1F6BA 2WV9A 3QEOA 1EESA 1OFTA 4Q4JA 2VQSA 4M8NE 1VIAA 2I3BA 1SVKA 1XP8A 1N6IA 2HXYA 3UMFA 1FOEB 2RAPA 3CNLA 3MMPA 4TMXA 2YOFA 1F2UA 4BUJA 1UADA 2VHTA 2IYLD 3FE2A 4K81B 1B0UA 2IS4A 3EIEA 1NN3A 3GD7A 4LSGA 4FIDA 5TXGA 5EE9A 1AN0A 3B60A 4II7A 5EE0A 3RRNA 3I32A 2E87A 1XX6A 3HPQA 1RC8A 4B2PA 2PT5A 3BAFA 3GMTA 2RGNA 2ODWA 4V0KA 3CZQA 1S96A 2YC2C 1TF7A 3KUDA 3MG9A 4TTRA 4M2LA 1XCMA 4NCKA 1OKKA 1VPLA 1ZM4A 5CYOA 1VIYA 4KCGA 5LD2C 1TQ6A 1E9DA 3U3KA 1NSFA 5KO2A 4PQFA 2P0EA 2Z0MA 3LW8A 1GM5A 4AKEA 5FOSA 1Z0DA 3P32A 4PXAA 2ONJA 1ZM2A 5EZ5A 1GVNB 4L5BA 2PX0A 5FBRB 1XEWX 1Z0FA 1E0JA 1Z22A 1PLKA 3SJZA 4US2R 4MRPA 4G5GA 4M9ZA 2VSXA 2XSZD 2QROA 1EXMA 2WTUA 2ZI6A 4G5SA 1ZC3A 4EDHA 1KK2A 4KYUA 1N5JA 3B1YA 3WP0A 4OHZA 4Z51A 5EJEA 4KVAA 4XVUA 3U44B 3C8UA 1SVLA 2QEQA 1XNJA 2HJVA 5FUXA 4Q1EA 2QP3A 1X8JA 2BMJA 1P2TA 1ODFA 4PQRA 3VNUA 3B82A 4DCNA 1FP6A 3RWMB 3D6TB 3ZIAA 5KDDA 1NJFA 2PH1A 1XWIA 4LUCA 1E9RA 1X6VA 2HT6A 1P6XA 5DI3A 4DHEA 2ZJOA 3BORA 5F9HA 1OIWA 5J47A 1UBGA 2CJWA 3B8HA 3SEAA 3GLGE 4QM6A 121PA 1CIPA 1NIPA 2WWGA 1ZCAA 2ZU6A 1HH4A 3SHWA 1IAQA 4TYYA 3AKYA 2VTKA 1XMVA 1E2KA 2ZI5A 1OKKD 4ZKDA 5C2JB 4Q7LA 1X86B 4QG7A 4Q4AA 1S4QA 2FDCA 2OBNA 2H8KA 3TR0A 1E9EA 2QE7A 4RZ2A 2BV3A 4ESVA 1BH2A 1KDRA 1ZRHA 1PLJA 3QIAA 3U3OA 5KYKA 1XDBA 3ZD7A 1T8UA 4MDEA 3X1XA 4LBZA 3DHWC 4V0LA 2GTPA 1WXQA 4TMVA 1SKQA 1TQ4A 3KB1A 3TW8B 4AYXA 4FINA 2XXAA 3Q85A 4IOMA 1E32A 1LVGA 1NKSA 1OIXA 1RFLA 2O0KA 3DVLA 3OIVA 2IYZA 4IDPA 3U7EB 4RKEA 2H17A 2P6RA 1BOFA 5C4MA 1OXSC 2P67A 1NRJB 1C9KA 4W5WA 4BZXA 4DRZA 1HURA 3NH6A 4KYIB 1W4RA 3RYTC 3GLIA 3ZIAD 3LWNA 1XZQA 3Q9LA 3NXSA 4NBSA 3W6OA 2QN6A 4FCVA 1IN6A 4JLJA 5C18A 4TWZA 1F2TA 4Q7JB 1ZD1A 3TIFA 1OXXK 2GJ8A 3DO6A 3VKGA 2VEDA 5CB6A 2OM2A 1TX4B 2V3CC 4NDZA 2QSYA 2YWHA 1NY5A 3W6PA 3U3JA 1NVVQ 5FTLA 1G3UA 1G64A 1UBFA 5CYPA 3CWQA 4JMPA 4PAQA 2GETA 3B9QA 1GSIA 3QOFA 1ZD9A 3A58B 1D2MA 1MABA 2ZUDA 1HA3A 2JJ1A 3W5JA 1OH7A 1JB1A 5JI2E 2A2ZA 1PV4A 3EX7C 2QE7D 4TQUS 5K8IA 3BC1A 1KGDA 8OHMA 2ZXUA 1ZU4A 2BHRA 2NO9A 5L3SB 1CEEA 2GEUA 3IQWA 3SC3A 4L8GA 3IGFA 2ZYWX 1XEFA 5DHFA 4DB4A 3A6PC 2KBEA 1LNZA 3C14C 3FPAA 3U60B 1SVIA 4JL5A 2AXPA 3VR1A 3U61B 2FZLA 3BXZA 2OESA 3SYLA 1GNRA 2QL6A 4LHYA 4A6PA 1K5GA 1UJ2A 2ZSBA 1ZVQA 3RHFA 4OQMA 4D25A 4C2UA 3KTAA 2ZRJA 4PPFA 1KMHA 3OZXA 4B32A 2RB4A 3KJEA 1Q0UA 1BYIA 4NYJQ 4OL0A 5CLQA 4FMCB 5HPYB 2AD1A 3RNLA 3GLIE 4AG6A 1J2JA 2JLYA 1VCOA 3LBHA 5B64A 4CDGA 2JLWA 3T15A 1XTIA 3LX5A
chains in the Genus database with same CATH superfamily
4LZLA 2QD3A 4Q1VA 1U0LA 3SIXA 1H3EA 1BX1A 2BZ0A 5EQTA 1HZZC 4JJKA 1OI4A 2UZ4A 2A1UA 1X8LA 1ADCA 4NK5A 3BX1A 3KOMA 4FLMA 1EZ1A 4OHBA 1ODJA 1SGWA 1DFIA 2P4QA 2WTAA 3PICA 2FF5A 3MYYA 4D8TA 1DKNA 2J07A 4H7KA 5AI0A 1JDPA 3P0JA 3WNCA 4V1CI 5DLPA 4DR3B 4M6WB 1Q1ZA 2F64A 4MP3A 3KJZA 5DM60 2VQ6A 4EEXA 4YUWA 1FPQA 1SIOA 1F3OA 2OLKA 2P3QA 3L7LA 4IJKA 3MC1A 3Q10A 3K0CC 3V4OA 1GTRA 1DUIA 3F73A 4DLBA 4DC0A 2ZI4A 4OEHA 4PSAA 4M3NA 5MFPA 4AD8A 3GT7A 1KI6A 2FLKA 1E62A 4F12A 1D5WA 3VDMA 2C5HA 4W9MC 2RGAA 3VH3A 1G6HA 3ND7A 4N82A 2D2FA 4F5EA 3BWCA 4FYMA 1E7RA 4TV9A 4NMLA 1EP1B 4R1NA 3K5IA 2DPGA 1U4OA 2QRHA 3IDQA 3OE7A 2R6FA 4RHXA 2CFSA 2GM9A 4HBGA 5DMXA 3F1LA 2OHVA 1L5SA 3RSZA 4NCBA 4CM3A 4FT2A 2CNOA 1T8TA 3OQ6A 5AHRA 1GZ5A 3SC4A 5JV5A 3ULKA 2G83A 4KPGA 1AO3A 3ESQA 3SQLA 1YA6A 4HF7A 4ASUA 3ZUGA 2VDUE 1JMYA 1WUHS 1DXOA 3W04A 4N3BA 1NVTA 1Y1PA 1WABA 1FYWA 2JIRA 2CMDA 2JB9A 2QMHA 3DE2X 4I14A 3OSUA 4RD6A 1NX6A 3WGGA 2FPGA 4X64B 5JWRA 2P3SA 4G5XA 1O96A 3NCHA 2HY7A 5K3BA 1VLVA 3T9FA 2RFLA 1DRVA 4F4FA 2WQ6A 2VZ0A 4XYBA 1W29A 2ALJA 1G20A 3OHPA 2A35A 1G3QA 5A3RA 3VC3A 3H2SA 4M55A 3AEKA 1KYVA 1DRWA 4IQFA 2WT9A 2O8EB 1PFUA 1Y7HA 2VBCA 3MINB 3O1LA 4OXNA 1Z3IX 1Z68A 1ZY2A 3WLMA 1BE0A 2SHKA 5I9SA 3ZQKA 3E3MA 3PT9A 3LOQA 4PO1A 3EC1A 1A82A 3GEIA 1NLZA 4DCTA 1GG9A 3UJHA 5CT9A 4JUBA 4W1QA 4I50F 5HE9A 2VJPA 1R6UA 4CW7A 2I4IA 3GJRA 5BPFA 1R66A 4XARA 4EGQA 3PFGA 5JHHB 1EM8A 1GL7A 3G9QA 4XVRA 4C87A 4L4ZA 5JH7B 3OQNA 5HP4A 2OXEA 3EK2A 4QPNA 1O0BA 2UAGA 1IH8A 1VDZA 2JCVA 4WXMA 4X93A 4AJLA 2CLCX 4CIDA 3CLUD 1GNVA 5HF8A 3H17A 2AI3A 3ZZ1A 2BW0A 4YIKA 2VYVD 4M1ZA 5D8DA 3ZGOA 3IT1A 3FF1A 3DVSX 3V46A 2G9NA 3R9KA 3EFOA 2FR1A 4P54A 4MNTA 2JDID 1M2NA 4JLSA 1RU3A 5LQCA 2G88A 1KC1A 5C7IO 5L8VA 4XD7D 2XIQA 1A76A 1XL1A 4UNSA 1B8NA 2P9GA 2C5EA 1GZVA 3PHBE 3QA9A 2GPBA 4N0QA 5HTKA 3SGLA 3HXQA 4YBRA 1A9RA 4QYMA 2UXDB 5H9VA 3HKEB 2OTCA 3K0AB 1RAIA 4LX8A 3NHPA 2J3LA 5FBHA 2IU6A 2CMKA 2XKBA 1D2GA 3A6FA 1HY3A 3V32A 1T0JB 1PR3A 2XKKA 2XGJA 2HSJA 1GEGA 4R1UA 2Z2YA 4W8OA 3A1WA 5J40A 3PE4A 1GZHB 2P5UA 2GT1A 4C08A 3BILA 5T57A 4AY2A 5H1YA 4MCHA 4EYKA 3WBKA 5U1PA 5A4JA 3F49S 3JSAA 4I1PA 1ISPA 2HSEA 2I2AA 2AUTA 4CFSA 2ZWMA 3I01M 4J0JA 5BMOA 3FDIA 1MVLA 2Z2XA 1LW6E 4BQIA 5SY4A 3W8NA 4FILA 5KSWB 3K1ZA 3SOPA 2Q5OA 3ZW8A 5BOSB 5ADVA 1VG8A 3PQ4A 5ELLA 1OUMA 2IXFA 4KQ6A 5M5BA 4N6OA 3W7BA 2FRXA 4CMIA 4X1IA 3K32A 5DU2A 1N2CA 1EGAA 3E1KA 4GBED 4BFCA 1XLVA 3R8CA 5JJ5A 2J0UA 4BPBA 3DLPX 1VP3A 5KDLA 1SR8A 3VDXA 1WRBA 1GA1A 3NBQA 1QHFA 1ZP6A 5JSHA 2YVAA 4NFHA 1D6JA 3TN7A 2PUBA 4LNUA 4QLBA 1XTQA 1UEXC 1G6Q1 4I9FA 4PX9A 3ZHQA 5LUBA 4XX0B 3O75A 4ALNA 4EHFA 5IABA 2CZGA 4PQYA 4IPTA 4LGMA 1G66A 1P1HA 3VU9A 1BHSA 5YASA 1N3YA 1T1RA 3HB9A 3KXIA 3P2JA 2IHBA 2V7XA 2VXYA 2OBBA 4CEIA 1DKPA 1P0MA 2AMLA 4HWGA 2Y6UA 3EZFA 1WMDA 3D7RA 3H6KA 3N2EA 4LZWA 4R51A 4RMHA 4AF7A 1ZVVA 3V8EA 2IF2A 3OZIA 4P80A 3K9NA 3RTAA 1R0KA 4QUIA 5MN4A 3F6BX 4IHJA 3WYEA 1E2IA 3U0VA 4IQ8A 3AY6A 1USVA 2EJCA 5IBRA 4IKOA 2HQ1A 3EHDA 3KWJA 3EXG1 3QE0A 2IYEA 4LGCA 2MSLA 1QIDA 2ZIVB 3DZ8A 3RYIA 2JHPA 4O0LA 4B7XA 1P62B 2B9EA 5DN6A 1F2DA 3BMCA 4H3HB 1ZJYA 5AW4A 1RTKA 1OV6A 4L72A 4FD2A 4PLWA 1RM3A 3ZCXA 1NLFA 4DT1B 1HNWB 5JIBA 3D6MA 1E9VA 3V48A 5BN5B 2NU8B 1YQUA 1FW6A 2C2YA 3A8TA 1LSOA 1VL2A 2G6BA 1V4BA 3JZAA 4R1SA 3FMIA 2BM8A 3ZCSA 2I22A 2A58A 2Z2JA 2XNSA 3V9PA 1M6EX 1TKBA 2XWBF 4JR2A 3ZQ4A 3KZOA 4DIDA 2HWXA 2O5EA 3FW1A 3UZUA 4FYHA 2HLDD 1DE0A 2CLIB 2IZOA 2LW7A 2RDMA 1MDBA 3DO8A 4CRWB 4EUNA 1E2MA 1W5SA 3F6CA 1AKEA 4GDFA 1ONBA 3I3SR 4WMLA 2X2OA 5ITSA 3NVKI 2C4TA 3CUYA 3HKBA 3A4YA 2VZ8A 4JWKA 4LXQA 3PGJA 6ADHA 4KFUA 4AMZA 4KU4A 4BQOA 3G79A 3GH1A 3PJGA 1QXSA 3CURA 3DE6X 3UHJA 3ZWOA 2NXNA 3AX6A 3M1YA 4NFLA 4OU5A 4BX2A 5B1HA 5HNKA 3Q7PA 4TQAA 3RVKA 1ZCFA 4A26A 5ARDA 2N47A 2ECFA 3I9V1 4K2AA 2QRNA 4ZEMA 1XPOA 1GZ6A 3IEVA 2VOJA 1YSCA 3UAYA 2XEXA 1TYZA 3D0OA 4FZ5A 4PG6A 3OIUA 5I9TA 5LN1A 4C0QC 5I7HA 1FQKA 2AR9A 1VFNA 2Q3BA 3QUQA 2O7VA 4NFYA 1ZA1A 2QU8A 3A2MA 2G25A 3BIWA 3GJ5A 3KC2A 4YQEA 5AVVA 4P3KA 4NKRA 3UMVA 4S1OA 2J3KA 3LO8A 3IESA 2EQ5A 5TGTA 4Q7QA 1GDTA 2ABWA 4QU5A 2JAHA 4R69A 1GZ4A 2GZDA 2ONCA 2FMIA 1IJFA 2HI0A 3L8ZA 2ZVQX 3PG5A 4OI4A 2V7QA 3T34A 3ZV4A 2G5CA 3E5NA 1IY0A 2XZPA 3TBKA 1C7FA 4MQBA 3R7NA 2OHJA 4MWCA 3FCUB 2J32A 3AR9A 1Q11A 1TQ2A 4HNQA 1MX1A 4K9MA 5DGIA 4C4XA 1M2FA 4DEXA 1E98A 1XEXA 2OQVA 3ZC3A 3IE1A 2WAYA 4MIOA 3VZSA 1ZD4A 1VA4A 2HRZA 3AI7A 3JQFC 4DV2B 1WB4A 4GLLA 3ZWAA 4BMCA 4YV1A 4OP2A 3PNOA 1XLTA 3ZD6A 5EESA 1ZC4A 4GZLA 2W48A 5BNFA 1B8UA 1RACA 3O7MA 5F2EA 1R6AA 1W19A 1WHTB 1EK6A 2BFWA 2LPMA 3PNQA 4IXMA 4WL0A 5BNWA 2W2MA 2ZRIA 1KZHA 4C6SA 1FSGA 2YWBA 1R88A 1NMZA 3V6MA 2ZB8A 4NYMQ 3TFQA 2BFDB 2HMAA 4GOXA 4BLUA 3OEHD 3U3RA 1JECA 4FYIA 4F2WA 4KHPB 3ZWDA 2W9XA 2XCTB 2RH9B 4LMRA 1X0XA 1ZR4A 1WPGA 3GJQA 3QU9A 5I4BA 4JOBA 3JZIA 1JT9A 3HFRA 1RJ9B 1B74A 4OQPA 1D6SA 2J0EA 4PZEA 3L2OB 2ZSKA 3L46A 5C3MA 1U0EA 2DLNA 1M1YB 3HP7A 4GMGA 4ND8A 4BMZA 2O2CA 2XEDA 3AL3A 3BJZA 2A7XA 3EMKA 3T41A 1B8PA 5EIXA 1NRIA 1EEXB 3GXBA 2EG5A 3IPAA 1O95C 3GUZA 3OIWA 4KGXA 3I6ZA 5KPDA 2XQIA 2ZZKA 4MRVA 4X90A 3EY9A 5L7WA 2QRZA 3RG2A 3TZEA 1IEVA 3H5AA 1Z0JA 3L7MA 3LQ4A 1TMKA 3WGHA 4B71A 1G5FA 4DV7B 4GQAA 2BISA 3BMOA 3EDYA 1EX9A 2OXFA 2PRZA 4Z1MD 3H84A 5K0TA 4X62B 1IWPB 5DT9A 3SC6A 1KO5A 2A84A 4L5JA 4QUHA 2R7MA 3T61A 1OHHD 3I5AA 1GJRA 1YZUA 3CZ5A 4RXUA 1T9CA 4XDZA 4QVKA 5HIAA 3ENZA 1NBIA 4TSKA 5BP7A 2AKAB 3FTQA 4M9RA 3CLKA 3HG7A 2XHEA 3O82A 4NBUA 4NZNA 4A82A 2GVNA 3L05A 4UPVA 3AY7A 2ODBA 1T6ZA 3DE7X 3WYAA 4P7KA 4DBLE 4URVR 5L3VA 4RVOA 3REQB 4MO9A 5BYKA 1WMFA 1I6MA 1QYRA 4EDFA 3BIXA 4URHA 1RXEA 1C4XA 2YRWA 3FZYA 1K7FB 4LGVA 1LKZA 2JGAA 1IG0A 2HHLA 3QU4A 4ND6A 2PS0A 1U0RA 1M67A 1V11A 1EVYA 4OJMX 2R68A 5L9AA 1CDDA 2WNSA 4H16A 4S0XA 1UXHA 3PIDA 3CIOA 1XF9A 5DXFA 3C48A 3V2IA 4N6NA 1G17A 2EFEB 2LRHA 4KK4A 4ARIA 2Z3WA 4FUQA 3R74A 4LJSA 1D4OA 1V2GA 3GFTA 2JAPA 4PLPA 2HJ9A 2PRYA 3BRWD 1CF2O 5FL3A 3T1VA 1VGRA 2EWWA 3CLTD 3A9RA 1SMKA 3IP6A 4A2PA 4UOEA 4GHWA 4IP0A 3DEHA 5L3QB 3U7QB 1J42A 3VR2D 2WILA 1UOEA 1UBNA 3M2TA 1WA5A 3I2GA 4GPD1 3DHNA 1TGYA 5GONF 3ZZ0A 2BDEA 1KZ1A 3OUUA 3ZCQA 4E70A 2P1RA 2YHIA 1JBEA 1GYPA 2QI9C 4Z0PA 4QUEA 3WGUA 3ZGLA 1LWOA 5A6SA 2VYND 4JI7B 2XCQA 1QAOA 2ZJAA 3RQSA 4BBPA 2TECE 3NM5A 4NPAA 3AIKA 1YHNA 2DHEA 5BUCA 3MCWA 3DBVO 1EIZA 1UJMA 2P6PA 3BXHA 3OF5A 4L74A 3WL3A 1JDZA 3D4OA 1XZEA 2IP1A 3NC4A 4RULA 4PFKA 1J8DA 1RE1A 4YA6A 2QX6A 4X1KB 3ZWNA 4WUVA 3I5YA 1USUA 1W93A 2OQ2A 4BFXA 4EJ2A 1RPZA 3GCGA 2H57A 2E89A 4I1IA 4R0NA 2JARA 2R1UA 5F5NA 5K0LA 5H81A 2OFXA 4BGDA 1U04A 2LIVA 4BASA 4EGCB 1Z36A 3P26A 2C7GA 1YE8A 4B74A 4QREA 5K51A 1E6LA 1TM4E 5LXTA 4MQ6A 1PQUA 2IZZA 2QRGA 5LP1A 3LVRE 2GDJA 3L6RA 2F9MA 2VT6A 2QRVB 4NU5A 2VCYA 1BFDA 2ZR8A 4ZAYA 2WOOA 4AIIA 2C4UA 2PNFA 3CTPA 3S1AB 4GECA 5CNJA 3UJ9A 4BGEA 3BSWA 1US8A 4L5YA 1N9GA 1QOPB 3O4RA 4HN9A 1J0AA 3ICCA 1OXBB 1E2UA 3OPXA 2DYKA 3UK2A 5CHEA 1TNDA 2V7WA 3HLYA 4YECA 3ZNNA 4QYXA 2RHLA 1AS0A 2V96A 2Q3HA 1XA3A 1KP3A 1XRJA 2C9MA 3PRKE 4L3WA 3ZE1B 4F60A 1PFVA 1NNUA 2EFHB 2F3QA 4RA6B 4L78A 5EHXA 4PZDA 1J0CA 3A1DA 3I83A 4ZI7F 3ZHVA 3OICA 1PGQA 1O5OA 4J4HA 1AHIA 1UP7A 2WMDA 3L40A 3QTTA 4RLHA 5BW8A 1J1UA 1FXSA 4UEQA 4O5OA 3ZQ6A 1ZN7A 4CNQA 2VS1A 2VSFA 3M6FA 1P2SA 5F4ZA 5FQOA 4RK0A 3IL2A 4DA4A 2XA1A 2QLBA 2Q1SA 2IY8A 3LUPA 2XYPA 3ZX5A 2GBGA 2QB5A 3ZCPA 3RE1A 1AB5A 2Q9CA 1GTJ1 4M6WA 1GKLA 4KW7A 1JVBA 4ABTA 1P1JA 3HGQA 1O5TA 4A8JA 3K2QA 3AHHA 2WV7A 5CLLA 1HT3A 4FDVA 2DGDA 5JXGA 2HREA 3W2IA 4LI3X 3GOHA 3EAGA 4ID9A 4XSVA 1ZZEA 5TF4A 2CLSA 2Q49A 3QUTA 4KLZA 2WZQA 3BD9A 4FFWA 4JHXA 5EFZA 1JALA 3MUNA 3OJLA 3SYNA 3AERB 3ELYA 4RKQA 4TLDA 3G9XA 3U6KA 3TLEA 4E31A 3LQRA 4E32A 3QX3A 4YJHB 2CE7A 3CPJB 3PPVA 1H8EA 3DDNA 1IHXA 1PTJC 2VVTA 3GVXA 3OM8A 3HLTA 4K0RA 1CZHA 2II6A 2APJA 1FZQA 3OX3A 1UP4A 3C0KA 3R4VA 4G5FA 4MAAA 5HYVA 3KHKA 1KEVA 4FQ7A 3SYTA 4D3XA 1UANA 3PDWA 1KTIA 3DTTA 1RWPA 3RT7A 4NNOA 1DB3A 1U98A 3P0FA 1NE2A 4G0ZA 4QBKA 3V97A 4F9EA 3VPGA 1XKTA 3D4LA 2DETA 1JG7A 2D2VA 4I55B 5E9QA 1A88A 3PCTA 3PBKA 5CA1A 1DIBA 2X9NA 4JC5A 4MX8A 3K8ZA 3ADPA 4GG1A 4I1YA 2YZMA 3ENQA 1CZOA 3GFPA 3HPRA 4KKXB 4LRYA 2FWIA 4PAOA 3SFVA 4F72A 3VA7A 1RAFA 2MWMA 1F4LA 2F8TA 4NYIQ 4DKJA 4RPIA 5DIFA 3C16C 3V4RA 3FNEA 1U2DA 3P20A 3SKVA 3VR5A 1YACA 3JV7A 3OBIA 2OCXA 2ZUWA 2ZP1A 1GRRA 3GH3A 3HVRA 4JLWA 2C2XA 1ZUIA 3CLVA 4EZBA 5I3CA 5KINB 2ZSHA 1ILEA 2OPBA 4ZPXA 2PMFA 1AURA 1KHHA 1NUAA 5FFFA 2DHDA 4CU2A 2PKCA 3TUIC 1U0FA 1MG5A 2B1GA 1GSAA 1NV9A 1TZ2A 1MLDA 4JUFA 1WCXA 5BVHB 4PTLA 5U9CA 4YTEA 2N75A 2Z43A 4MCJA 1V26A 2DTEA 4KO4S 2CHUA 2CHEA 3JVEA 1YQQA 2C2HA 4QX6A 4ZEWA 3ZNQA 4AJHA 1AH2A 3WL8A 4KR2A 4BXOB 4BEJA 3LXXA 4CE6A 2WD7B 2ZPTX 2FQ1A 5E7MA 1W0KD 2FOLA 3W8EA 1YQEA 5FA6A 4W5NA 3WRYC 1GTVA 1V8ZA 1PJRA 3FLEA 4X3CA 4MA5A 1P7VA 1ZM3A 2NOAA 3A6HA 3H5IA 2VI5A 3O3MB 4PAMA 2HYDA 2M6SA 3U37A 4DLSA 4DUPA 4NMWA 1VRVA 4B6FA 2MMGA 1SN7A 1X7WB 2IHTA 2XUGA 3PL5A 1BMQA 3G1TA 4PYNA 3FRIA 3QV2A 4BQFA 4K87A 2GB4A 2VLBA 3FJ1A 3H8VA 4RNDB 3TDMA 2KX7A 3WK5A 3VAYA 3OLVA 2QS9A 2WVHA 3FCAA 2VNSA 1QE3A 1N4AA 1XE3A 2CJFA 2PBFA 3I04M 3N7UA 3W05A 5F7JA 1C41A 2Y0DA 3EVFA 1GPH1 3AG5A 3HKEA 2WWXA 521PA 5BVGA 1TZCA 3ND8A 4N0MA 2D1SA 4TUYF 1G7RA 2GERA 2I1LA 2XA2A 3BXGA 3CJRA 1TAQA 4LZZA 3WWYA 1I1QB 4HR7A 4JB0A 4OCZA 5AKIA 2IDMA 5AW1A 1JKFA 3CNNA 5G53C 3X1DA 2ZGVA 4ZZ3A 1CQIB 1XTPA 2HZ7A 3I0ZA 4B7AA 2PA0A 1KJJA 4Y18A 1TO1E 3OC6A 5TPWB 5JYEA 3L4JA 5B53A 2QNRA 4L5CA 1YVPA 4OMCA 2EJTA 1KWKA 1R0SA 2PS3A 3JWEA 1M1NB 1BCSB 2H06A 1KF0A 4P36A 1BRMA 4MW7A 4OXQA 4MV4A 2J6BA 3T5MA 3Q3EA 2ENUA 2QUKA 3NT5A 5FA5A 2XZDA 4I1RA 4WXHA 3AILA 1DEAA 5A4DA 1FFXB 3DZHA 1HEUA 2H3HA 2NZWA 3VR5H 1R18A 4C6TA 1ZGZA 2AEMA 4B6SA 2JJ8A 1CNEA 2VDJA 2HGSA 1SPBS 3RKRA 3TWOA 2CWDA 4JX9A 5IJ0B 4AJKA 4ZGGA 3T7EA 2VJDA 5BWOA 3B2EA 1WZIA 4MITA 1C3XA 1PLLA 1Q19A 5HJ7A 4DMHA 2IYNA 1JDVA 5DK4A 1Y5IA 2VUUA 3PVSA 1FUEA 2W2KA 1RI4A 4TXLA 4C2BA 5C51B 3K2IA 2AJ8A 2WK1A 4FC7A 5AH0A 3TRHA 2JFPA 4TWAA 3SYKA 3PXCX 5EHNA 3HABA 3U13A 1PUXA 3MCUA 3QLTA 4MTLA 4OB8A 1G5HA 2LBPA 1QAMA 1EUCA 4X6YA 1Z47A 1G3IA 2C20A 2I8CA 5J59A 4XUEA 1GWNA 2GF9A 1GADO 3OZDA 3LA8A 1IN8A 2B5WA 2XDQB 2VPPA 3SJAA 3TMYA 5C8YF 1UPFA 5JTTA 1JKXA 2IEZA 4QDZA 3TW8A 4C04A 4DMKA 2NVOA 2FLWA 3EVGA 3EXIB 4LDAA 1RWBA 4PWYA 1JHYA 4G56A 1U7ZA 3K3PA 1WULS 3RTBA 3U3MA 2R8PA 4ZT4A 2XE8A 4J1TA 3U7IA 3RW9A 4H31A 1UKBA 2DKOA 2PX2A 2HQSA 3MELA 3ABRB 4OI1A 3AUKA 4CM9A 1Q2XA 4C5CA 1HLDA 1L5YA 4DT1A 4OMFG 4G0WA 3ITNA 5HJEA 3FYSA 2PPLA 3BE6A 1DAPA 4M8SA 2NO6A 2AJBA 2CD7A 1NIJA 4JSRA 5IWCA 3GMSA 3WQRA 2V1XA 1X9GA 2B8TA 2RGCA 3B7PA 3Q5GA 2O5CA 3KEOA 4F46A 3ZIDA 4PPNA 3CO0S 2ZIUB 4I4TB 3CB4A 3QWAA 1NU8A 1K7EB 3H5LA 3ONEA 4X6UA 3ND6A 4L4XA 1MOPA 5HTOA 1MJGM 1ZO8A 4G5OA 3KZKA 1RBYA 4Q6WA 4QZVA 4MARA 2B4KA 4ZFNA 5ALXA 4HNSA 4CN8A 3M5WA 2ODTX 3CPHA 4D43A 3KQKA 3ACCA 3KEFA 1AGRA 3OQJA 1SOMA 1YZFA 6PFKA 1BFUA 4X85A 4BJ1A 1DEKA 1HDIA 5CH8A 3UK1A 1YT5A 1UPAA 3D0RA 1CQPA 1EK0A 4UD2A 2ESRA 4KO3S 4PSVA 3SLGA 5JQWA 2Q3LA 1DC6A 3DM5A 3PHCA 1A4IA 3RSSA 5AW7A 4HB0A 1ORDA 4NULA 3PLNA 4BVFA 4D9IA 2VSNA 3HB5X 3P0EA 1BDBA 3WRWA 3FPLA 4DXDA 3AINA 3EDOA 1T0HB 3R1IA 4BFSA 1RM0A 2BGNA 2OAP1 1JJIA 3RUHA 4HP8A 4BQSA 3W90A 4A36A 2IXEA 1JSRA 3ABSB 1DAMA 4S2UA 2PYZA 1M73E 4R2XA 3SJBA 2JHAA 4RVCA 1OH5A 1IONA 4BTLA 3KJGA 3OZTA 3Q0EA 4XGNA 3T06B 3RU3A 3T7KA 1YZLA 3MLEA 2HD4A 3F3SA 2YJNA 2FEKA 3G5UA 4P5EA 4Q7KA 1AXRA 3VSBA 5C1DA 3DHVA 4RW0A 5LQUA 5DI3B 1ZH8A 1DRUA 4HPXB 2ZTMA 4NOLA 4PBRA 3TKLA 1CE8A 3PXBA 1S89A 1B0PA 4RESA 2CJWB 2GNOA 3AETA 4H77A 3ZKWB 3UJCA 5BV8A 3I39X 3UWKA 4LJAA 1J2EA 2JBAB 3QH4A 5JNUA 1KJNA 4URYR 2F3RA 1NJ5A 4Q9LA 5H3CA 3DFIA 5GV7A 4X91A 2MYTA 2BE9A 1YJ8A 4JU9A 1OC2A 3EIFA 4OX9B 4EJSB 4CLOA 2AG1A 4AJJA 2ZS7A 4FYVA 4CMBA 4YCMA 4CF7A 1FDRA 2A1TS 4GP6A 1X7YB 3AOEC 1M2GA 2JAXA 5KHLB 3FTPA 1SHJA 4LYYA 2NTVA 2AQKA 2VP0A 1THTA 1CULC 2I3ZA 5TF0A 1ECGA 1U2EA 1SBIA 1XFAA 4L4SA 2QV7A 4NBNA 5TT1A 1J00A 3IUQA 3EGXA 4FB5A 2BFCA 1O7JA 1RJ9A 1LVHA 3PWKA 4KQMA 2IGBA 1F4VA 2VDWA 3KOZA 3NBAA 5EWLB 3WGQA 5C80A 3W2TA 3OQIB 2HEGA 3FFWA 1AQNA 4E1AA 1SXJC 3FNRA 3IELA 3R5FA 2Y27A 3DVAB 3H3FA 1W4AA 2JK1A 1C3LA 2P9ZA 4KXUA 3B6ZA 1TKCA 2WBLC 5JDCA 3FROA 2R8XA 3OQPA 4HD8A 1T6XA 3IKJA 3HJTA 5HUQA 3MF4A 4QBGB 1E96A 4R1TA 3EHEA 4QWWA 4RH1A 1K7CA 5DNDA 3UKJA 1B26A 2JKYA 2ZE6A 3S3TA 4A92A 2ST1A 3ZPXA 1J0BA 1KRXA 1FLVA 3AV3A 1N3IA 2Q3FA 3WSTA 1T3TA 3RC2A 1WB9A 2ZJBA 2WJAA 1H5UA 5DZSA 1W76A 1OXKB 4K05A 2Q6KA 3PNSA 3ZGNA 2XVXA 4EA6A 5AQEA 4LDRA 1J7KA 1N8NA 2QQGA 5ALUA 4R5MA 2BFFA 3OT1B 4CF3A 4GM4A 3TS1A 1G9XA 1L8OA 4JIGA 1WB5A 3N8DA 2IEGA 3QELB 1T9HA 1W4ZA 2PFSA 3LF2A 1HEYA 3T6KA 3MRSA 4BJ6A 2OV3A 2V4ZA 2XNJA 4B85A 1XMJA 2SCUA 1DDIA 4INPA 2NXJA 4DRXA 1RQ2A 2WFAA 1MABB 2I34A 3OCZA 2AEEA 3W77A 2QZJA 3OX1A 4MUGA 1JLRA 2CVHA 4M99A 4WLFA 4EABA 1KRHA 3AEYA 5HKKA 1VE3A 3SDBA 1UL1X 1VE9A 3H4MA 5KQGA 1H4QA 3PUZA 5AXDA 4PNEA 2VP3A 4F93B 5L3QA 3OCXA 3VPAA 1PR4A 4DV1B 1PSWA 2CK3A 2Y9PB 1TAGA 4ZQHA 4D0GA 1FQWA 1SKYB 2V8BA 4DLWA 2YIDA 4KSYA 1YL6A 4M0DA 4ZV9A 1W4BA 2H4FA 2DPYA 2R7LA 3NEYA 1PJZA 2C31A 4P98A 1A97A 2O2SA 1ZMXA 3PKIA 5B3AA 4QTYA 4LOIA 4LYFA 4DR2B 3UPUA 2JA2A 1NMQA 1PFWA 3L7KA 3L6UA 3V7YA 1DV1A 1THMA 3QLEA 2ZR9A 3PGMA 4RMJA 3RYFB 5ARCA 4KE7A 2XDAA 3UAVA 1FU4A 1V45E 1J06A 2BGTA 2GXQA 1JGTA 1Z6ZA 2W90A 2OCAA 3EQ9A 4G0QA 1YMVA 1Y7PA 1SHLA 1UPBA 3CONA 2QUIA 1ID1A 2CNWD 5TRTA 3LUFA 4RQUA 2ZZMA 2CL0X 4BV9A 5AVSA 5IK2D 4LWPA 3YASA 4NOKA 3P9XA 2YN0A 1TJPB 2O07A 3HP1A 3TUJC 1BEEA 2E0IA 3FOEC 1Y80A 1AC5A 1U0BB 3DMNA 2CVQA 2ZR0A 4XSHA 5F5XA 1R37A 2ZAMA 3IMCA 1EWTA 2HCFA 4HH4A 2ASEA 2PEYA 4JLAA 3WB1A 1UR5A 1UT5A 3E9QA 4N7MA 2HWYA 5ECGC 1JQEA 2GCNA 4XVQA 1M72A 4JI8B 3FIJA 2YJTD 2XMRA 5IVDA 2V0GA 1TVEA 1RMQA 3IMGA 3FWNA 3P4YA 2QRVA 2FNAA 2FW1A 1Q3HA 1YR1A 2H4XA 2JGRA 2BEVA 3QKRB 4D3DA 3WL4A 1GYQA 3IA2A 2VJOA 2Y4OA 1Y6GA 1DC7A 4DWJA 4E7OA 3KFXA 3LT1A 1EA7A 4WNCA 2H5IA 4C30A 1GCAA 3BL8A 5B3LA 4QXRA 3D64A 1JEDA 3P8ZA 3DC7A 1WQ1R 3PQ3A 1HXHA 2DZDA 4GI2A 4YRNA 4N4AA 3T3GA 4DSTA 4UHBA 5K8LA 3KSAC 3OZSA 3N8IA 1FJ2A 4M8IA 2GARA 4FHZA 1ZBQA 1X7ZB 3V8RA 4UAVA 1EAMA 5BT9A 1J0XO 2P4UA 4X84A 2I76A 2O2HA 1JG6A 2OV4A 3QJYA 4OF4A 1PSZA 3QYJA 4G9EA 1LV7A 1HE2A 4WOJA 3DXYA 4QU0A 5L51A 1FMFA 3GA0A 3H5WA 4R6WA 3UGKA 1QM5A 4FEEA 4GPIB 4MDFA 2HF9A 1VSVA 1ZHFA 3D3WB 1VJ5A 3IS3A 4FX5A 2NU6A 3F97A 3OEEA 4IXTA 3CBGA 4OI0A 2J45A 4B2YA 5GY7A 1L7QA 5HZMA 1TM7E 2J7PD 3OD1A 4HDQB 3EDCA 5C8XA 4ZVTA 5E1DA 5DN6D 5KPJA 1AMUA 1BOOA 3LC7O 4NEHB 3WBJA 4B31A 9GPBA 3WISA 2PSFA 1XQWA 1I1NA 3O1IC 1H93A 4KHZA 1LPMA 3UYKA 3QYAA 1L8LA 1D6NA 2V7BA 5ALGA 5HQJA 3WLFA 4LF4B 1ZXLA 1L9KA 2MSEB 3A9CA 1MFZA 2WVGA 4GDMA 1AX9A 4JT4A 1PYGA 3CRRA 3NW9A 1VQ1A 5HS6A 4DLXA 2QZ4A 2WAOA 4NEGA 4CGYA 3AERA 2NO7A 2Z9CA 4HY3A 3KOUA 4BO1A 1GU1A 4KZKA 3B38A 4LVCA 4I2NA 3KJQA 4JMLA 2B78A 4RYLA 1N5DA 6NULA 1Y5LA 1G1MA 1I7LA 3MT7A 4YJHA 4B84A 2H00A 1W35A 3DG9A 4BGVA 3G49A 3Q7IA 3GJ7A 3KB6A 3SBDA 3X2FA 4RKYA 4B4WA 3EZXA 3OJWA 2XUPA 3S0JA 4RM2A 4HWKA 2UVQA 3MGBA 3KPUA 4HVAA 4DV5B 2XQJA 3T7RA 1YRHA 2G71A 4MS1A 5DGDA 3ZVRA 1E2BA 1YBVA 4NMXB 3RVOA 4JH0A 5I7UA 5DM2A 2GN1A 2I78A 5JASA 1TCCA 1XEAA 4KAXA 4MYDA 3VR3D 4TKVA 4DR1B 2A3RA 4FSXA 1CDOA 1ZH4A 2WE8A 4DQKA 3C7AA 3ESRA 1SIWA 3ROKA 5AT1A 2QVBA 4M1WA 1Y5RA 2VJYA 3NAGA 4HDRB 1R0ZA 1S3FA 5D84A 2QPAA 3CH6A 3CY6A 1FMJA 1BG6A 4IAOA 1OVGA 2YV3A 4AMGA 3OCUA 2Y2UA 2FW8A 4LCEA 5IXSA 1VJCA 2WMOB 1GNQA 5JS7A 1TA0A 1RKBA 1QG0A 4UUAA 1WD5A 1BW9A 5CIWA 4FYPA 3JQAB 1QUEA 4G9GA 4ZVQA 5H02A 2P40A 2RGUA 3E5MA 4LVOA 5D5QA 1D8AA 5BMVB 1EWYA 4TL9A 1G63A 5E1MA 4H7PA 1W2WB 4RDCA 1WZEA 4BXOA 2N9UA 4A0FA 1K4MA 2C59A 1WWKA 2C0CA 1VPEA 4HWOA 3U4CA 1BXZA 1ND5A 5T5QA 3ZWVA 3AKZA 3V9AA 3DZDA 1W6UA 1WXWA 1Q7EA 1CQWA 4Q1CA 4QTZA 2CEAA 2GYWA 4YO7A 5ALPA 2BR5A 5AM1A 1C1YA 5ILQA 1J56A 3WGKA 2FPLA 1OLOA 3R44A 3O38A 2CV0A 3O8QB 4YRMA 2NVWA 1K6EA 1VZ2A 5BQOA 4G0YA 5B2FA 3TSWA 2R0QC 5B7NA 1O2DA 2QTTA 1SRQA 2O23A 5AOCA 3UGTA 2IDKA 1JDUA 3L9XA 3V1TC 4CEHB 2FW9A 4HQ6A 2BCGY 1GPAA 5KYXB 2YVKA 3D81A 3CIFA 3SEFA 1BEUB 3VKFA 4F6CA 5LP6A 1Z0UA 2VTEA 2NQTA 5G2OA 1JA9A 4JLKA 3DT9A 1FJXA 2NYRA 4JJZA 2R6R1 2WHEA 3BREA 2VYCA 4R8LA 1DC4A 5EN4A 3UJ8A 4YMGA 5JNVA 1SU8A 3N74A 2GWRA 3ND5A 5KNCA 1L5QA 2EF0A 4EHBA 4U2KA 2FPIB 4K3VA 1CQIA 4FOTA 5EA2A 3RRMA 1O03A 1WX1A 1Z8FA 2C96A 2JCXA 2QTGA 3CUVA 3QYPA 4RAOA 4HUTA 4S1WA 1NMSA 2PX3A 1NQOA 3GGPA 3BHJA 3R0JA 5GMOA 1BCSA 1JQ5A 2DUMA 1T9GR 2IYXA 3GIDA 1IJEA 3GDFA 3E3LA 4P08A 4ZOCA 3T12A 1RYHA 4Q48A 1UBSB 4HYTA 1ZOOA 4UBJA 3F8WA 3FWYA 4IJUA 1C1DB 3GQBB 1DO8A 1FFXA 1V48A 2C07A 4I3GA 4R2LA 2J3HA 3KETA 1Z35A 1QTNA 2AYZA 2HIHA 1Q7GA 2QRQA 4KH0A 4KPFC 5B1SA 2B6NA 4B17A 4I5FA 1QNLA 3GY0A 1W1UA 5I7EA 2Q4RA 1T8PA 4RWZA 1ML4A 4LGYA 2BUBA 2JCYA 5CLHA 3RQIA 3OIGA 1COWD 3ZVLA 4E08A 1ZGGA 3QSYA 3QBDA 2XUQA 3VUFA 2GN2A 3PC8C 1JFVA 3ROFA 2J87A 4D26A 1OA1A 2XZTA 1ONSA 3GFRA 3KKQA 3PQDA 4NSNA 5BRJA 5J58A 5CURA 2GAJA 2QJTA 4H1HA 4DA6A 1OYVA 2GNPA 3TSZA 4DR5B 5ARBA 1REQA 5IN4A 3QGMA 2DF8A 1XK6A 4HNHA 1OSNA 1MO5A 1O6ZA 2IEDA 3EJWA 3EQ2A 4EGFA 1SURA 4O4IB 4XGIA 4OHPA 4LJ7A 3IRVA 3HCWA 4B81A 5A5VA 1MMFB 4R41A 1XTKA 4RU1A 3G23A 3Q8KA 4CDRA 2BZSA 3NEJA 1DARA 3UCFA 3NJ4A 2DWUA 2EL9A 1EP9A 3BKXA 1JJAA 1SUPA 2NZVG 4N5IX 2CCKA 3ROXA 5LFAA 3Q8LA 1YKFA 3AW8A 1WSAA 1SWWA 2YZ7A 3EXIA 1Q0LA 2F8LA 3EUFA 5FWXB 4A3SA 3B9RA 4M87A 3S2FA 3ZHRA 1ZS9A 3TRDA 1YDWA 1IHUA 4RIEA 4GC5A 3V4ZA 1ZD2P 4KR7A 1TU4A 1EZ4A 2FP4A 2ZKIA 1X39A 4OQXA 2DBVO 2VF5X 1OGYA 2VF4X 3M34A 5JAIA 1GSOA 4YWJA 4W7HA 2HDHA 4LF6B 1U2ZA 5KTSA 4OQNA 3WDKA 1WBDA 4ZIRB 3NVAA 5AVZA 3AJAA 1Q15A 5T7BA 3K4PA 1A9OA 4HRVA 4F5DA 1OU0A 2IHNA 2RGRA 2ZIXA 2HMWA 1UXGA 1QONA 1FUYB 1XAIA 4MVJF 4PFJA 1IHOA 4QAJA 4Y2XA 3VAAA 4CKXA 4YUZA 1ODLA 2HBZA 2QVXX 3JYPA 3KQOA 4I4TA 4BHTA 4EF4A 3FR8A