2WWGA

Plasmodium falciparum thymidylate kinase in complex with dgmp and adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
b'TDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDILATE KINASE, PUTATIVE
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwgA00
4EPRA 4XVRA 4GZMA 1TTTA 1RZ3A 3GLIB 3FDIA 4M53A 2WKQA 2O8FA 2IHBA 2IX3A 5K8UA 1Z2AA 5CM8B 2V7QD 3PEVA 1JNYA 4LZZA 4QOSA 3ND8A 4I1SA 4LHVA 3ZVNA 3TQCA 1E0AA 1ZVQA 2BCJQ 1K8RA 3RSOA 4HAYA 2VHCA 4AKEA 1SULA 3MD0A 4DZZA 5DIFA 2MSEB 1CR2A 1D9XA 2A5JA 2L0XA 1KSHA 1TNDA 2ZVPX 4K81B 4ZI2A 1PJRA 1XD2A 3PITA 2EVWX 4B3GA 2GAAA 3IIMA 3LFUA 1ZNXA 2NPFA 1GSIA 1ZBDA 2IF2A 4B6FA 1X6VA 1T8UA 1X8JA 4AYXA 3CF0A 4A4DA 2PT7A 3CR8A 2ATVA 1ZMXA 1W1WA 5AJWA 1XCGB 2GJAA 2BDTA 4I4LA 1LS6A 4A6PA 3LH5A 1MOZA 4M1OA 5CK4A 5CIQA 4TSFD 4ZDWA 3VX3A 3N5CA 2GJ8A 1UJ2A 2MSDB 1TF2A 1VCMA 3FMIA 2PMKA 4C2UA 1ESMA 2R6FA 4B35A 1BYUA 4J0QA 3VR5A 4PC7A 1J2JA 1XJCA 4DCSA 4NDZA 1O3YA 1MO5A 1G8FA 3TVTA 4B2IA 3TLXA 4HDOB 2HYIC 4LHZA 1OXSC 2EWWA 3A1UA 1F2TA 3QQ5A 5P21A 1OHHD 4O2LA 3TK1A 4C4PA 1G3MA 1KJWA 1NY6A 2CCKA 4POAA 2QEQA 3SHWA 4KBFA 3SJCA 3LW7A 1KAOA 4DSTA 3PXGA 2I3BA 2FNAA 1DOAA 1U81A 2IK8A 4OI4A 2ZRHA 5E7JA 5TY0A 4C3ZA 4KFSA 1NBMA 2RHMA 2Z6VA 1E69A 2OV2A 3L0PA 2J0SA 5FOTA 4XJXA 5KPDA 5DNYB 2VP6A 2ZSDA 4LJYA 1SVKA 2HF9A 1NVXQ 4C0SA 2CK3D 1GKIA 3R8FA 4RJLA 2VEDA 3PEWA 1I2MA 2Q0HA 3SJBA 5H70A 2ZSEA 2ZRKA 5K8IA 2OESA 1SZPA 4JZKA 3L2OB 4OI0A 4D81A 4S2EA 2QL6A 2IXFA 2VSXA 3EA5A 1P7CA 4WZAE 1S1MA 1E0JA 3NKVA 4I1UA 3K9LA 4V03A 4ASUD 1ZNZA 2ZI3A 4DC9A 1FFHA 1ZC3A 4WIAA 2FWRA 4A0GA 3ADDA 3DVLA 4EIWA 3U60B 2BM0A 2FF7A 4Q4JA 4B74A 4QJ4A 3R9XA 2BBTA 2PJZA 5B2ZA 4H1VA 3VU9B 1XPRA 1VG8A 3BK7A 2J7PA 5TB5A 1KDPA 3X1ZA 3U5ZB 2B7CA 4XVQA 5GJBA 1TEXA 2QU8A 4Q5IA 4BFSA 4KYIB 4NYMR 2QMHA 4BFUA 1UDXA 5E4FA 2MMGA 2PLRA 1X3SA 3I61A 3H86A 3U44B 3H84A 3K1JA 3KFXA 1KO8A 3B78A 3BXZA 3VNUA 4YONB 3KKQA 3AVOA 1DVRA 1G8YA 1OB2A 6Q21A 3QG5A 2ZJOA 2GXQA 2WJYA 3SYKA 2YNMA 2EFEB 3C4JA 2WICA 3WP0A 2Q3FA 1GNQA 5JJKA 1LTQA 2FEMA 1U98A 2NPIA 2QSZA 1J7KA 2XXAA 4QNMA 4FWIB 1ODFA 2CXXA 1Z0JA 4MGKR 4R2HA 3DMDA 2CLCX 3QKRB 2TMKA 1N5KA 5IT5A 2P6UA 2GXSA 1Z0IA 2IBMA 4B48A 2XTZA 4Q1EA 1GILA 3C7KA 1AS3A 5FTKA 3BFXA 4UNNA 5BYKA 1P9WA 4NHOA 4QG7A 5JS8A 4OJQA 5KNCA 4CDGA 3K70D 1XTRA 2ZAMA 4V0KA 4M2LA 2V9PA 2Z4RA 1FTNA 1C1YA 4MYUA 3REFA 3R8CA 2F43A 2EFGA 4Q19A 1EFRD 3NDPA 1UFQA 4QBGB 1AN0A 5D3MB 1GM5A 4JLDA 1NJFA 3MAAC 2ZVQX 3ZQ6A 4TTQA 4P31A 3UG7A 2WZQA 2VHUA 2N1BA 4KU4A 1AZSC 1EG7A 3G82C 3L0IB 1DS6A 2R62A 2IS2A 3QEJA 1TX4B 2OCPA 4HLCA 4JLMA 4PHGA 1CIPA 2C98A 2QUZA 2RGGA 4YC7A 3RAPR 3AVUA 3IHLA 1XCMA 1S3GA 4NONA 4RD1A 1YR9A 1U0HC 1KI2A 2GXUA 2ZUBA 3SBEA 4JLAA 2WWHA 4BPBA 2GKSA 3RDPA 4H9GA 4A15A 3X1WA 1W48A 4PQFA 3CPJB 3HDTA 2IS1A 3QSYA 4BLPA 1TEVA 2ODBA 3GJ4A 1GDDA 3Q7PA 4I1OA 3VKWA 2Y8EA 1GNPA 3AVVA 4Q4HA 1GRRA 3P32A 5GJWC 4DVGA 2AL7A 3DL0A 4ZCMA 2F6RA 4Q1AA 4AKIA 5F9FA 3WHKA 1VCOA 2WM9B 1OKKA 5L3RA 1EK0A 2J7KA 3TSWA 5B58C 1KMHA 2JJ1D 4YDHB 5HCNA 1G4UR 4WZ6A 3KKOA 3CO5A 1AQUA 5EP4A 3THXB 5FOUA 3EA0A 4AY2A 5FTMA 2XEXA 4PSKA 4TLAA 2IYWA 2ZI4A 4ARZA 2QT0A 2HCBA 5FPTA 1QVAA 3U7GA 2PMDA 3OEED 4BWYA 4M1MA 4RZ2A 2D7DA 1G4AE 4PO8A 4WZBE 2B8TA 1LY1A 2DFLA 3EZ6A 1AK2A 1FX0B 2HF8A 1E1RD 2FA9A 1S9HA 3MWJA 2DFTA 3OZXA 3D7MA 2XNDA 5EE1A 2XZOA 3IUYA 3OE7A 3VFDA 4O0MA 4DLYA 1OH5A 3W34A 2V54A 3SJAA 4B3XA 5LPNA 3B7GA 3TUZC 1JAIA 3X2SA 2P5SA 4RSGA 1CULC 2IUTA 1Z22A 1E2JA 5HZHA 1LV7A 3I8SA 3FMOB 1T0JB 1Z07A 3HPRA 2OUKA 4BEJA 4P4SA 1N6PA 1BMFD 3EZ7A 5AJXA 2GBLA 1L2TA 3MLEA 1TU4A 3J81k 2CCGA 1VIAA 5DYIA 2B6HA 1GRQA 3BH0A 2WWYA 3E1SA 1MR3F 3K0CC 1BIFA 4NP6A 2RKOA 3GPLA 1P6XA 1W0KD 4F4CA 3AUXA 4C2TA 2PX3A 4Z54A 4WA7A 1IXRC 1DAFA 1Z28A 2W2VA 3SI7A 4YMSA 5L8VA 1DAHA 2ZROA 5AUQA 5K8TA 2JJ2D 3BGWA 2G3YA 2P2LA 3P27A 2A5FA 1QZXA 3GLFB 3QXCA 5JLJA 1LFDB 2OO7A 3LXRA 2F1HA 2R6AA 1UKZA 1A5TA 1W7AA 1HH4A 2QNRA 4DDWA 4JLPA 2O0KA 3AH8A 1N6OA 4EPYA 3NEJA 2KE5A 2WSSA 5G3ZA 1J70A 1JQLB 4WXRA 3CIOA 1XXHB 2QTHA 4Q21A 5HE8A 1OFTA 3F8TA 3HYTA 2IW3A 4B3FX 1KK3A 5AUNB 2DBYA 3SC3A 2QBYA 2CE7A 4RCYA 1JEDA 4GMDA 2VSOA 4HDQB 5KSZA 3AGQA 4DCTA 4HZIA 1G9XA 2IA5A 4XSHA 2OAP1 5H68A 1P4SA 4TLDA 3W6PA 1U9IA 3JZAA 4NKRA 2VHQA 1G21E 2IYTA 2J1LA 1XF9A 2G0NA 1VHTA 2RB4A 2FDCA 3QVUA 3LA6A 2BV3A 3A1WA 4LC0A 4DDUA 1QG2A 3CRVA 3QI2A 1N5LA 1JXMA 5BXQC 4QM7A 3DZ8A 3LQQA 5KDOA 3ZQJA 1C4OA 1BYIA 1T9HA 3T12A 4JL5A 4ZDKA 1QHGA 5DN6A 3A6PC 2C78A 2HEIA 3AP2A 2ZS9A 4DHEA 1OH7A 3EIQA 3PR1A 3U4QB 5L3SA 1E0SA 3CZPA 2D7CA 1DTSA 3EWSA 2BM1A 1CJVC 1VYUA 2CLSA 3ZD7A 1VPLA 1OT3A 3T34A 1JJVA 4AKGA 4F91B 1XPUA 1CR0A 4DT1B 3LLUA 3R9WA 3EW9A 1YZLA 2VP5A 5AJVB 1OH6A 2V6IA 4NCHA 2GZAA 2FSHA 2CHVA 1KYIA 2WWWA 2VYFA 5AJYA 1N6IA 3DMNA 2IYSA 3Q8XB 1NG9A 3IBGA 1Q20A 4QRHA 4LJ5A 5CIWA 1FW6A 1OXXK 3ECCA 1PZNA 1AKYA 2BJVA 2ERYA 4N1AA 4Q03A 4DLWA 4XTCS 4FW9A 2YZ2A 2R6GA 2FX3A 1XWIA 3ZD6A 1KI7A 1SKYE 3RS7A 4GT1A 4Q00A 4DJTA 4FMDB 1KTVA 2AKYA 1WQ1R 4KYUA 4WBSA 3CR7A 3FFBA 4TQ9A 2AD1A 4LJ6A 2WV9A 4LX0A 1Z0AA 1QHXA 4HLDA 1XU4A 3N70A 3Q85A 4OHVA 2RH5A 1R4AA 4DEYA 3W8NA 5J4VA 4Q1BA 4LJ9A 1KI6A 3KXIA 2XB2A 4XH9B 3TSOA 3E2IA 1WBBA 2JGNA 3KX2A 3I92A 1Q1ZA 2O8DB 1OSNA 3M4YA 5EXSA 1P2UA 3AP1A 5J5CA 1SVSA 1TQ2A 4G0NA 5DSZA 4OI1A 2NO1A 3TKLA 2VQSA 5AR1A 5LB2A 1NBMD 2QAGA 1IM2A 3BOSA 2XNSA 1EX6A 4KCGA 4ACBA 2WHXA 5A4JA 2X19A 1E4YA 1W4RA 1PUIA 1Z5ZA 4MGYR 5DE3A 1E9BA 3QPWA 4LRWA 4X8MA 3CWZA 4HUTA 3FHTA 2ZJYA 4JVNA 4A8JB 4MA4A 1CS4C 3FMFA 1IY0A 5AK0A 1ESNA 2C9OA 2IUSA 4BLOA 4RFVA 2CL7X 1E94E 2XZPA 2OILA 3KTAB 4ESHA 2O8BB 3KUDA 1KSJA 2VP0A 5AUPB 1N0WA 4AG5A 4DUGA 4FMCF 1SXJD 3TQFA 4TYQA 3AP3A 1MV5A 2B8WA 2XJ9A 2YJTD 4UQOA 3V9PA 1OIVA 1Q3TA 2OSBA 1TUIA 4DDVA 1JR3D 3UWOA 4M1WA 4G1UC 1E9AA 2AWOA 3T1OA 4Q47A 1J99A 2QTVB 3EWAA 2ZRIA 3CRW1 5LDDC 2F9MA 1CRQA 2JEOA 2WJIA 2J7PD 4TMKA 3IIJA 2F55A 2O0JA 3HWSA 5CM9C 5EP3A 1ZM9A 2F9LA 3K09C 5LBIA 1ELOA 2ONKA 4JLOA 3PQCA 4EPVA 1MH1A 1QF9A 5C1BA 3ZIAA 1GIAA 4WAUA 4KO8A 1FQJA 3KKPA 5TDHA 4TZ0A 2IYLD 2DPXA 1GTVA 4US0R 4Q7KA 1MT0A 5E7MA 3AB3A 2VF7A 2ZR7A 2BEJA 1OXTA 2ANBA 4TLCA 3VAAA 2BMFA 4B3BA 1NNEA 2ZI7A 5TVKA 2G6BA 4V02A 3WMGA 2G83A 2CVHA 3PENA 4HB3A 3G0HA 3UG6A 1G3QA 1XEWX 1XMJA 3QKTA 4ITRC 1W2GA 3D6TB 1TADA 3E5HA 2F3TA 1JPNA 2O8FB 3DDCA 4C0KA 1R7RA 5CJPA 2ZRJA 3X1YA 1Z0DA 4I99A 4ILEA 2AXPA 5IDVA 3T15A 4U7DA 1NVVQ 1BO6A 3GJ3A 1NN5A 5DI3B 2EYUA 4Q1CA 4B75A 1M8PA 4D0LB 1W5SA 3THYA 1XMSA 1IOZA 1XD2B 2JLZA 2WKPA 4S35A 2QAJA 4IVPA 1M7HA 3ASZA 3HJNA 2C9CA 3K70C 1W0JA 1XZQA 4L4UA 3GLHE 4KITB 3AGPA 3LX5A 5BN5A 3AF2A 1WBDA 1YR7A 3ZS9A 1IN4A 4LJ4A 4ACAA 1CP2A 3L8YA 2D62A 3MWLA 1HQYE 1T6NA 2ZJBA 4G5SA 2C77A 5A5GA 4IVQA 2VHTA 2W6JA 4UJ5A 4PQRA 2OBMA 3IBYA 4QL3A 5FPKA 2ZE7A 3A4LA 3PUXA 3VTKA 4PR0A 1EXMA 4C0QC 1E96A 1T5IA 2J41A 1U8YA 4PAOA 2P65A 4ZCLA 5JHHB 1O87A 1OV4A 4CIDA 2Z4SA 1F2TB 1ZUNB 5J4KA 1G8HA 4OK5A 3AKCA 5A0FA 1GL6A 1R2QA 3AEZA 4MGIR 5IK2A 1KNQA 4DWJA 1II9A 2OBNA 4HATA 2QQ0A 3MJHA 4D4JA 3TJZA 5EZ5A 5SZHB 1VG9B 1II8A 1K6MA 1TUEA 2ZJ8A 4C7OA 3GD7A 3LVQE 3PCRB 4JT2A 3O8DA 1NSFA 2XOKA 3BH7A 1J90A 4TTRA 2IYRA 4LJAA 1KZ7B 5FL7A 5FTNA 2VIIA 4BLQA 4GL2A 2ASEA 2EW1A 1E79A 1QHSA 4TMTA 1JJ7A 5FI1B 3IDQA 2GF0A 2O8CA 4LYHA 1S96A 2ZITA 4BECA 1XEWY 2FGJA 4B34A 2OE2A 4W7SA 3UANA 1HE1C 1VYTA 3M6AA 1SXJB 3KZ1E 4PXAA 1NIJA 2G1KA 4PHFA 3BRWD 4WW0A 5B57C 1CEEA 3RS4A 5C4GB 1G7TA 1FOEB 3WRYC 3EARA 3TH5A 5E95A 2WWFA 5DLQC 1IN5A 1D2NA 4B47A 2JLXA 4Q4JB 1QHHA 3NXSA 3TNFA 5KDDA 5KNBA 3DM5A 1IBRA 2YWHA 2XNDD 3BAFA 4RD6A 3I4LA 5FFMA 1G7SA 3OE7D 2IEYA 1E2KA 2BEKA 2XX3A 1IQPA 2FEOA 1NF3A 2H92A 2OZEA 4QFMA 2RAPA 4AK9A 2FZ4A 1W36B 4JIMA 1ZU4A 2OHFA 1MABB 1T3HA 1ZRHA 1I2DA 2P5TB 4CT4B 1H8HA 2WJGA 4M1SA 3KKMA 3AF4A 1H65A 3HU2A 2GCOA 3MWKA 4RD0A 5FUYA 1SHKA 1Y3AA 2ZPTX 4P4UA 3EIHA 2VF8A 3A8TA 4M1TA 2ZR9A 1G5RA 3NTUA 3LXXA 2BVNA 2J46A 2XXAB 3BFKA 1M1YE 5B64A 2C9YA 1JB1A 3HYRA 3W3AA 4QKQA 3RNLA 4LHWA 1G19A 3DM9B 1COWA 1NRJB 3BB1A 4D4KA 2ZIAA 3K0AA 3KJEA 3TR0A 3IGFA 1BKDR 1F48A 2FPMA 1N5IA 1T4GA 4L9SA 2SHKA 2QE7A 4TQUS 2WWGA 4QGHA 1P73A 2JDIA 5H1YA 4TYNA 3MGCA 1OF1A 2F43B 5EXTA 4NYJQ 2EWVA 2WSSD 2HJGA 2YVUA 3OEHA 1E2IA 1YRBA 3KKNA 4NPHA 5G41A 4DEXA 1FTSA 3EASA 4UNSA 4GOXA 3FKSA 3KFVA 2VP2A 5KSPA 4BRUA 4US2R 2GNOA 1NKTA 3LBIA 3NWJA 1VKJA 4PZYA 4AD8A 3EPJA 3KJHA 4AIIA 2NZJA 4LHYA 2ORIA 5HTKA 2AN9A 2WSMA 3GLHA 4RFSB 3PUYA 3ZGXA 4HZUA 3SZRA 1PUJA 1ZAKA 3AQ4A 3VQTA 1W5TA 4QC2A 5DGXA 3OFNA 3RWOA 4EJSA 3M0EA 3K9GA 3T61A 4F38A 2QQEA 1SGWA 2FH5B 2NQ2C 1YR8A 3CNNA 1QRAA 1ZW6A 5JI3E 1II0A 1IY1A 4G5RA 5FOXA 3NC1C 4B2LA 4DLRA 3KQNA 1F3OA 1OJLA 2ZI6A 1TF7A 1HEIA 4KV9A 1F6BA 1YHNA 2GZDA 4B33A 1YKSA 3B1WA 4Y0AA 2HCJB 4Q9KA 4Z51A 2Z0MA 5DHAA 4Z8XA 4E07A 4Q4HB 3CONA 1FP6A 3MCAA 2ANCA 1DO2A 1ZD1A 5EUMA 4G01B 1ETUA 2GESA 2ORVA 3HU3A 1CKEA 1KMHB 1XEXA 3KJGA 3W90A 5TV2A 3FGNA 3B82A 4D25A 3T5DA 2GCNA 4LGMA 3EZFA 4G5OA 3EAQA 1DAMA 3CUEF 4ARZB 4D2IA 3A1TA 1TF5A 4CT5A 3CRMA 2GK6A 3L43A 4PPQA 1G8PA 3QKSA 2NO7A 2WIAA 1Z63A 2AFIE 4PO1A 2QMOA 5FOVA 2RGCA 2PL3A 2REBA 3TGPA 4AKHA 4PAQA 5FBLB 2VPPA 1DG1G 3OAAD 5FH9A 4B73A 4MYHA 5GJCA 5JWRA 4Z1MD 4YXWA 3FMPB 4URZR 3ZJYA 1Q3HA 5EXXA 5BN3A 3NH6A 2J87A 4LYJA 3F5FA 3KB1A 2QGNA 3VNVA 1S4QA 1HURA 3REGA 1AA9A 4LJ7A 2ZJZA 2ODWA 1GFIA 1NMZA 1DO0A 2HXYA 4WOPA 4LYFA 3GJ0A 4P4SB 3OIUA 1YRAA 3CPHA 1Y63A 3K9NA 3B9QA 4P32A 4XD7A 4BFYA 2JLVA 5BW8A 4LSGA 2JASA 2ZAOA 4HAZA 3RHFA 5KUTA 2X1VA 4V0NA 4TMXA 3ND9A 1UEJA 3W8RA 1TQDA 1AZTA 1FP7A 5JEEA 4QGGA 4CEIA 1WB9A 2ZSBA 4ZCIA 4QGAA 4AYTA 3OIVA 1MO4A 5GADl 4IXNA 1W4BA 1Z06A 3FPAA 3AUYA 3LW8A 3EG5A 1S2MA 5M04A 2R44A 4BQSA 2J3EA 3G5UA 5K8LA 1CTQA 1GNRA 3U61B 1F5NA 2ECKA 1AKEA 2QRZA 2WJVA 2A2ZA 4Q9HA 3THWA 4Q48A 3EX7C 3CRQA 4BASA 2I4IA 4F93B 5F3WB 1QG4A 3ZVRA 5UKDA 3GP8A 3PVSA 1RKBA 4CEHA 4JKYA 3QEOA 2QPOA 1KO4A 2ZI5A 3VR6A 3B1XA 2QBYB 1G6OA 2A5GA 1XTQA 1NIPA 3EPHA 5EE0A 521PA 3KXLA 4FWTA 3QG1A 4X8LA 1YZQA 3HR7A 4PQYA 3QF4A 1J8YF 2GJ9A 1SXJC 4UNQA 3AM1A 5JSZA 1G18A 4LJ8A 3A4MA 4MRVA 4YDSA 2PX0A 3FWYA 4QM6A 1QBKC 3I72A 4IHQA 2ZSAA 2FSIA 2QM7A 3WNDA 1RYFA 1KO7A 4R71A 3KDSE 5JI2E 2OFXA 4HAWA 4OI2A 1OFHA 1UDWA 2ZANA 4IXMA 2JATA 1DBSA 2BIFA 4JLKA 3B9PA 2JLYA 2YOGA 3GQBA 5EQTA 4Q02A 1YU9A 2GF9A 4RZUA 5DH9A 1YR6A 3CNOA 2K5UA 1KNXA 2QA5A 5L3SB 1SVOA 3MSXA 1VDZA 4N3NA 4CRWB 1DADA 1ZC4A 3EC2A 5TARA 1M34E 3RYTC 4NCKA 1WXQA 4IW3B 5FI0B 4CW7A 4IRUB 5L3QA 4C0AC 2QN6A 1P2SA 2ZS8A 3CKLA 4A92A 4ZV4A 5JWHA 3V4FA 4Q9IA 4EPTA 3B60A 1N6LA 1E1QD 4DLXA 4K46A 2O8EA 2LCFA 3CX7A 3JVUA 4IDNA 4MYTA 4PC3A 5DO9A 1W4CA 5HPYB 3B1VA 3D3QA 2IYVA 4ZI3A 2ZE8A 1FUUA 1RYHA 3UXMA 5JMTA 2O5VA 2NMVA 1KOFA 1W0JD 2YV5A 1LF5A 2I1VB 1ZNYA 3CF2A 2MMCA 3ADBA 1Q57A 3JZMA 4BZQA 4V0ME 1Z08A 4NYJR 4BFVA 2KJQA 1VIYA 3P4YA 5KSOA 4IFEA 3GLFE 3QUSA 1OLOA 3QKRA 2KI5A 4ZO4A 3B8HA 2UZIR 5AWFC 3QVVA 1A2BA 1NLYA 2D3WA 4HLUC 2IWHA 2C8VA 1Q1QA 4A0RA 2RGNC 2RGBA 3QJYA 1SVIA 2H7VA 4IDQA 1KI6B 1U8ZA 5DI9A 1G17A 3EPLA 2IYYA 5C18A 1JAHA 2ZS7A 2F7SA 1ZIOA 3LBHA 1XXHE 5IK2D 2XTMA 4ABYA 1XBTA 3GLGE 4E5UA 1D6JA 4N0EA 1UKEA 4YMWA 1ONBA 2JLQA 5FUWA 1CJMA 4QBIA 4GRAA 2DFNA 4YMTA 3MRSA 1R5NA 2W0MA 4M4SA 1H8EA 2QAGB 1SVWA 2H57A 4A0HA 4DIDA 1G7CA 3P4XA 3V00A 4W9MC 3K53A 1WF3A 1JR6A 4PZLA 3LLMA 4XTRA 1IHUA 3IEUA 5JS7A 3FHOA 2GILA 3DEFA 3MG9A 4EKDA 4JJZA 4B3DA 2KSQA 1E9CA 3CW2A 3KQLA 3ZVMA 4KBGA 3TMKA 3VR4A 1KO1A 4HB0A 5E7IA 2IS4A 2PEZA 2QP4A 3RS5A 3W9YA 4KVAA 2GJKA 2GWHA 2HT1A 2VTKA 3IPXA 4KVGA 3SYNA 2WOJA 1OHHA 1NLFA 4P33A 1FUKA 2RGEA 4C0HA 3A36A 3PG5A 2W2XA 2WMOB 2UKDA 4B71A 5FPHA 3BIFA 3IPYA 2H18A 3SN6A 3CX8A 3OF5A 2A3RA 3TRFA 3GJXC 2ODEA 1GKUB 3WNCA 3W5IA 1CJUC 2J45A 1KJZA 1US8A 3C16C 1AS2A 2FG5A 4QJ5A 3K0SA 3DPUA 3U3MA 1OFIA 1ZUIA 3DKVA 4EQ6A 3S1AA 4D0NA 5JRJA 3DO6A 2HXSA 1H8HD 2ZRDA 2QGZA 3AVXA 4NH0A 3BE4A 2LKCA 1NVUQ 3ADCA 2EU8A 2G0TA 4D4LA 1X8KA 4Q9JA 1HTWA 1TQ4A 2IEZA 1ZU5A 3HR8A 4U00A 2G9NA 1OXUA 4PPNA 4DB4A 2WMNB 1P9NA 2FN4A 1KKLA 2YOFA 3EXAA 2BCGY 2HJVA 3HU1A 2XJ4A 4ASUA 4DCVA 1XMVA 4NCNA 1IONA 3K09A 4D82A 3NHAA 5LB4A 3P26A 3CLVA 1JPJA 4E22A 4UJ3A 4MRRA 1COWD 4FN5A 4LBYA 4BFXA 2BWJA 3B6EA 2DWQA 1F2UA 1XNJA 2QE7D 2G88A 4HAXA 1T91A 1KK2A 4KLNA 2JDID 5KTYA 4EFMA 3AKYA 1RW4A 2AX4A 3THYB 3LDAA 1YQTA 2V1UA 3PUWA 1PVOA 2A5DA 4UXHA 1IN7A 5GVSA 4A36A 3FKSD 4M9SA 2RHDA 1EFUA 2ZRBA 3WHLA 4B44A 4YMUA 2PBRA 2OCAA 5ELXA 1U0LA 5FPSA 3AVQA 2EYQA 4IOKA 3IIKA 1JBKA 4JSTA 2PZGA 3WRXC 5CLLA 4BLTA 4E03A 1Q44A 2NO6A 1ZJ6A 4NYIQ 1DAEA 5KOYA 4GZLA 1SKYB 3SJZA 3KJIA 1GWNA 4FINA 1HYQA 2PT5A 1XFAA 4RCZA 2UVQA 4QHTA 1ANKA 3CX6A 3DHWC 1OYYA 2QTFA 3GLFA 2FZLA 1N0UA 2XSZA 2JCSA 1TMKA 3W6OA 4DCNA 1X8LA 3K0EA 3K0FA 4M0LA 5JHGB 4RKFA 4E09A 3CBQA 4LV5B 4DDTA 3IKJA 1XX6A 4JSYA 2OBLA 2CHQA 1A4RA 3EZ9A 5GVRA 1FNNA 3QPUA 2WWIA 1R5OA 1II8B 4EPXA 1GUAA 3GLGA 4C7OB 3BFVA 1BH2A 2IYZA 3BB4A 5G3YA 5BYJA 5B30A 5CB8A 4G3XA 1E3MA 2HT6A 4A2WA 2FU5C 1TAGA 4TMWA 2GZHA 1JXOA 2KBFA 3QKUA 4TL7A 3NBFA 4HEJA 4M1YA 3RLFA 3L0OA 4PPGA 1CF4A 1R5BA 4FIDA 4TL6A 3CH4B 1E2EA 4PSAA 1UF9A 2E1RA 3SBDA 2O8CB 1ZCAA 3SU8A 2RMKA 3IQWA 4HUQA 2P67A 3QOFA 4AC9A 4YLGA 2UZ3A 2ZU6A 1W36D 1WRBA 4A82A 4MRNA 2ZYVX 3QXHA 4A9AA 4OJKA 5E3HA 2YC2C 3WYFA 4JBWA 4I1VA 1P75A 1QHHB 1GL7A 2QG6A 2EFCB 4CYMA 2CCJA 5JZVA 4F4JA 1RJ9A 3I8XA 3FFAA 1GP2A 5G40A 4QXAA 2KWIA 4YXWD 4HB4A 1UEIA 3Q72A 4XIGS 1X1RA 1SQ5A 2ZRAA 1Z6TA 4DSUA 4MUBA 2GDJA 2CL0X 2ORWA 3RRMA 4KSBA 2CLDX 1A1VA 3V4RA 3U7EB 2GCOB 1KI4A 4XD7D 3TW8B 3F0TA 2JJ8A 4TMZA 3WNBA 1FMLA 1KDRA 1FQKA 1EFTA 3AVYA 1VECA 1UBCA 3OEEA 3NC0C 2ZRLA 2R65A 4QBHA 3NVAA 1G5PA 2J0VA 5FPYA 3IO5A 3RRZA 3B85A 3SDZA 2IXEA 4DCUA 1N5JA 5IHPA 3K0AB 4KFTA 1E1RA 1Z6AA 5FL3A 2GETA 2WWXA 4NL4H 3CPEA 2GAOA 1P61B 3TAHA 4U5XA 2OLJA 1EFCA 5CYPA 4HLQB 3VR2A 1HQCA 2Z5FA 4X8OA 4URVR 3QBTA 1SVLA 2ZRCA 5EP2A 2OFOA 3KQKA 1X1SA 2GVDC 4KAXA 1G3UA 2Z83A 2GRJA 2YWEA 2C04A 4PSVA 2ZRFA 1GKYA 2J5XA 1KMQA 3A1VA 2ERXA 3FE2A 4XOIA 5KDLA 3SOPA 5FBRB 2H16A 4NCIA 2E9SA 3CM0A 421PA 4AYWA 2NIPA 5KSYA 4LUCA 2QZ4A 3B1ZA 3NG1A 3PIRA 1NBME 1LW7A 1W0KA 5JCPA 3GLHB 5JEDA 4KFUA 3H1TA 2J0UA 1KI8A 1QHNA 1JEEA 4HZUB 4GFDA 4L15A 2BOVA 4M9ZA 5CYOA 3BH6A 4TWZA 2CE2X 1D8TA 4EJSB 3DOEA 4DB2A 4MYCA 1W46A 4KHZA 3BORA 1OKKD 3FYHA 4HB2A 1XCPA 3W5JA 2XGJA 3LWNA 2NOAA 221PA 3I1FA 4EPWA 2DCUA 1ZD8A 1KZGB 1CR1A 2ZRPA 4JVSB 1XEFA 2ZUDA 4TYWA 1SXJE 2JIZA 1SKQA 2CJWA 5JWOA 1UBEA 3KUCA 3AKDA 1G41A 1CU1A 4RD3A 5FBQB 1WA5A 1RE0A 2V55B 1JR3E 1Q12A 4M21A 2DYKA 2IHYA 4XSGA 3U7FB 3ZH9B 3U6BA 1VCNA 3R20A 3WY9A 5FBVB 3ICQB 4RZ3A 4CVNA 1XEXB 4Q1DA 4RY2A 1V5WA 1XRJA 2DR3A 2Q9BA 4JL6A 4CF7A 2AHOA 2D4HA 2REOA 2GTPA 5CDFE 3GLIE 1MO6A 4PC6A 2A30A 3IQXA 4FI3C 5KHOC 2QM8A 4MKIA 4PO9A 1LS1A 2WPDA 1G8GA 2ZEJA 1U90A 1Q22A 4O2RA 3CWQA 4GPTA 1RC8A 1K5GA 1S1CA 3LAWA 3W6NA 5HE9A 3R7WA 2C95A 4TZ6A 1KI1A 1RIFA 2J0QA 3QKSB 4JMPA 2I1QA 4QNRA 4XWAA 2NTYC 4LV6A 4JL8A 2V3CC 4KODA 2DWOA 3VHXA 2VP4A 3I73A 2D2EA 2OAQ1 1ZP6A 4ERNA 2C5LA 4NTZA 4H1UA 3RABA 2PZFA 4EFNA 4P4TA 3PJRA 3U3JA 1XPOA 1XZPA 4KFRA 1EESA 1WDTA 1M7GA 3UMRA 3GJ8A 1VCIA 4IKEA 4MQBA 5J4HA 1YJ5A 3EC1A 4DLZA 2J59A 3OIYA 2Q3MA 2F1RA 3TUJC 2IT1A 5F2EA 3LQRA 4ON9A 4R7ZA 4DLSA 5DI3A 2ZM5A 3B13B 4NYIR 3AF0A 3L8ZA 2FFAA 4Q7LA 2NO0A 1JALA 1NMXA 4FMDF 3TBKA 1RRPA 1CJTC 3MMPA 4JS0A 1ZYUA 1CRPA 1P2VA 3D8BA 4KI0A 3BS4A 3I32A 3TSZA 4OHWA 4B3CA 2V1XA 4OQLA 4CEJA 4CEIB 2ZRNA 4LY6A 4R98A 3LV8A 1H8ED 4A8JC 5LD2B 3VMFA 3SFVA 5ANRB 4F4IA 1D9ZA 1DAGA 1E2HA 4IEIA 5SZJA 1F60A 1A7JA 1AGRA 2H1LA 3RSLA 2FJUA 3P1JA 1KAGA 2V6JA 3THWB 5L3VA 1RRGA 1Z6XA 2FPKA 1HV8A 4PANA 1NN1A 1R0YA 2ZU0C 2G1JA 3QXJA 1VHLA 1Z8FA 3A1SA 4TLBA 3TUIC 4CEHB 4ZKEA 3TR5A 4A2QA 2FE4A 1Z29A 2GHIA 1IJEA 1FZQA 4Q18A 4OHZA 3WP1B 2IL1A 1R0WA 1UADA 1K5DA 2J9RA 5JECA 1IN6A 4OQNA 2HDNB 1TQ6A 2NZ8A 1NY5A 1YZNA 4GOJA 1T5LA 2HLDA 4DXAA 3QF4B 1D5CA 5DN6D 2LKDA 1Z47A 1E2PA 1U8AA 3Q9LA 5JSZB 1J8MF 4N0DA 1U99A 1L8QA 3BC1A 3R9IA 1XP8A 1HY3A 1P3JA 3X1DA 1FMJA 1FL9A 4LPKA 5JFGA 3LY5A 5EP1A 1Q1EA 4P3YA 3QY0A 3SQWA 3QNUA 1W44A 1Z0FA 1R8QA 5F98A 1GVNB 2R6CA 1R0ZA 4Q66C 3T1TA 2NG1A 4LI0A 4UKDA 4TT3A 2WJJA 8OHMA 3FKQA 2P6RA 5BWMA 4BRWA 2RGAA 1GOTA 1U94A 4Q4AA 3C41J 4PZZA 2BKUA 3THOA 1E2LA 4IFBA 1RPZA 2AXNA 1SXJA 2VLIA 3LBNA 4MKFA 2PLFA 1CLUA 1HT2E 1MRNA 1YZGA 2BBOA 4DLUA 1XD8A 2P3SA 3H0KA 1AM4D 2GXAA 5L3QB 1NVVR 1JR3A 2YWFA 5D3QA 1D2MA 1Q0UA 1FPMA 2WVJA 1XB2A 4L9WA 2PCJA 4L16A 4DKXA 2OLKA 1P62B 2BMJA 3KXKA 3TAUA 4ZIRA 5KO2A 2RCNA 4C0LA 1CR4A 2YINC 4NBSA 2O8EB 1WMSA 2ZJ2A 4CZ2A 1U0JA 4YQFA 5CDFA 1VTKA 2OCBA 3C8UA 3GLIA 3TVDA 3O8CA 4HAVA 5HCIA 3B2EA 1MABA 2AD5A 2W58A 2YKGA 2GEDA 2AK3A 1A82A 1GITA 2VA8A 4IVRA 4O25A 2P0EA 1EWRA 4CGZA 1DE0A 2OFWA 3RC3A 1Z0KA 1KK0A 2D06A 2JLRA 3K9HA 2GCPA 1A2KC 4FCWA 4C0JA 3RS0A 2X8AA 3SQXA 3PUVA 1PLLA 3GEEA 2ZRGA 4F92B 1KSFX 4OHXA 2O52A 4Y0VA 3WBJA 3GJ6A 4OK6A 3I5YA 5FTLA 4XVUA 1XTIA 3BJIC 3ICEA 5FUVA 1OIWA 4IJMA 2CNWA 2V8OA 3KB2A 1UBFA 1KKMA 3CF6R 4PTLA 1E9EA 5FOSA 4ESVA 4RKEA 1N25A 3BWDD 1PLJA 4HDCA 1KI9A 2GVZC 2XSZD 1XTSA 4II7A 3X1XA 4A2PA 2Z43A 4D0GA 2ZREA 1KK1A 1KO5A 4LBZA 3T1VA 4B2PA 721PA 2H5EA 1JECA 1E9RA 2N42A 3K0CA 3CNLA 4M9XA 4EJSC 2OM2A 5HR5A 3WXMA 3WYGA 1SHZA 1LNZA 2BJWA 4JYCA 4DUGD 1ZD9A 4MGZR 1E2DA 1NLZA 2QP3A 1IN8A 4W5JA 5TXGA 4PC2A 4BFZA 2QROA 2OXCA 4HLUA 2MSCB 2EQBA 4RD2A 1G16A 5AUOB 2DWPA 2D2FA 2F1IA 2RGNA 5AJZA 4RFSA 4KLZA 4MUAA 3LO5A 4ZKDA 2EFDB 3NIBA 2CL6X 1DAKA 1P72A 3OHMA 4MITA 4FMCB 1GL9B 1Q1BA 2Q3HA 1OIXA 2W83A 3AF3A 3JVVA 4UXIA 3T1QA 4DSOA 2W6IA 4RD4A 4B43A 1PLKA 3KL4A 5FR2A 3ZIAD 3NHBA 1ZM2A 1YZTA 1AQYA 4UNRA 1M2OB 1I4DD 1YVDA 3AVTA 1KHTA 1LVGA 3ZYCA 2CBZA 4FXPA 4D80A 1VG1A 4BUJA 1T8TA 3I3SR 4KXFB 3UKDA 5KU1A 2ZE6A 4DBLC 2XZLA 5C46F 5FBWB 1R0XA 1VG0B 1W36C 1I4TD 1OYWA 3E70C 5CITA 2CEAA 4LWZA 4TQAA 5HKKA 4LCBA 5BQ5A 2F1JA 1XMIA 2ZJAA 2FFQA 1US8B 2RGXA 1Z3IX 3TW4A 4EQ6B 4LBWA 4BFWA 2CDNA 1E4VA 1Z83A 3BB3A 2Q6TA 3DKPA 3FTQA 3S1AB 2X2FA 2YYZA 3QPVA 2DHRA 2WAYA 3LX8A 3VU9A 2QENA 2ZYTX 2WKRA 4MKGA 4ZPXA 2JLSA 1UKVY 2AKAB 1KJYA 4LV8B 2Q9CA 2QPTA 3ADKA 3AKEA 4JLNA 4BGDA 3KQUA 1EGAA 1KI3A 3A4NA 3U44A 4JBYA 4NU0A 2FOLA 3VHLB 3LRPA 3CH5A 3BBPA 4OL0A 3BERA 1CXZA 1YE8A 4URXR 3C5HA 4EDHA 5EUQB 4O3MA 1RFLA 2QMUA 1EX7A 1E9FA 1OXVA 1E2NA 3OIWA 4OHYA 2C2HA 4TYPA 5TMPA 1F2UB 2DB3A 3VR1A 1HT1E 4GSYA 2PH1A 4EFLA 3RS2A 4G5GA 1IJFA 3F3YA 4JLJA 2W6JD 3O8RA 1WP9A 5LD2C 3FHCB 2A78A 4LC1A 3GCGA 1E9DA 1GZSA 821PA 3QF7A 1W4AA 2V7QA 3I62A 4QJ3A 3GEHA 1DPFA 1N6RA 3TIFA 2DFKB 1HUQA 4A1FA 4M8NE 3U7HB 5CK5A 3Q7QA 121PA 2H8KA 4FCVA 4IDPA 4UXJA 4GNKA 2GA8A 4MH0R 4A6XA 5J4YA 5D3MA 3UK6A 3VKGA 3ZDQA 2OCYC 4G5QA 4FCTA 3N2EA 3SHFA 2NGRA 3LD9A 1S0UA 4BEBA 2XOKD 4PX9A 1ZCBA 4KJZA 2CVFA 3T06B 3RWMB 1NSTA 5H8WA 1BS1A 2BBSA 2G77B 2O0HA 3ASYA 5FL7D 1GRNA 3K70B 2YC4C 4OK3A 2ZRMA 3K0FB 2Q21A 4TSFA 2W00A 1E79D 1XD9A 4LPSA 4D6PA 2E87A 4PC1A 5J40A 2PCLA 2JIZD 2WAXA 4LDJA 1NG1A 1W2HA 4GMXA 2ZTSA 2ZYWX 1KDOA 5CLQA 4JYBA 4D4MA 1R6BX 3NBXX 4TTPA 3GLGB 1E6CA 2JLUA 4QHYA 5EJEA 1WCV1 4C0BA 3GJ5A 4GOKA 3NEYA 2ATXA 1DG3A 1Z6YA 2OT3B 3C5CA 1ZIPA 4X8HA 4PFSA 2ZETA 1N6NA 4XWOA 2VBCA 1G1MA 1T0HB 4IDHA 5EXPA 2AWNA 3AV0B 2ZXUA 2JAQA 4QGFA 3ZZUA 4TLEA 1XJ0A 5EE9A 1G291 4HUQB 2FSFA 2WPDD 4B6EA 4FD2A 4IEEA 3SE0A 1M7BA 3QXSA 4US1R 1XJQA 2ZYUX 4MKHA 4RVCA 4AG6A 2CK3A 4YMVA 2QPAA 2YOHA 5FUXA 4V0LA 5EZ6B 5FTJA 2IYXA 3FOZA 2IXGA 1NKSA 3DOFA 4QBFA 4K8OA 3WYAA 3THXA 4Z8YA 1RJ9B 1N6HA 1RRFA 3O47A 4LBVA 4L5BA 1B23P 2ZR0A 3GEIA 1ZM7A 2BC9A 4LYAA 4BFTA 3FB4A 3K8YA 3AVWA 4PHHA 4JLBA 3ZZTA 5IRCD 1XDBA 2GBLC 3VX4A 1R8SA 3QBVA 1G20E 3CRRA 2Q9AA 1FX0A 3AVPA 3ZVLA 4AWXA 2QRNA 3RC8A 3EPKA 1UBGA 1S9DA 2B92A 2IWRA 3TE6A 1OE0A 3GFPA 2IYQA 4TMVA 4M22A 2PJRA 1T3LA 3OESA 1DEKA 3AF1A 2A7QA 5IF9A 2W0SA 4IOLA 4B32A 3U3OA 2OEPA 5CJ2A 1IAQA 4JJKA 3OEHD 1MO3A 2KB0A 3SNHA 3UMFA 3N2IA 4Q7MB 2BMDA 4WVFA 1EFHA 3B1YA 2QT1A 3LVRE 3A58B 4Q1FA 3U3KA 5FR1A 2YHSA 2P6NA 1E98A 2IUUA 1N6KA 2IC5A 3U6KA 1NMYA 2B7BA 3OAAA 4W5WA 1KDTA 3UATA 4OKSA 1NP6A 1SVMA 4URUR 4Z1MA 3T35A 3UPUA 4OQXA 1LB1B 2KBEA 1ZM3A 2W2TA 3DZDA 4OBEA 4XWKA 3EIEA 1DELA 3C15C 3SYLA 4BLSA 2XITA 4V0MA 3L0SA 3OFND 3I5XA 5C4MA 2R8RA 4GDFA 4OQMA 1MRSA 2RGDA 5DISB 1S3SA 4BLRA 4MRPA 4UNPA 3PV0A 2GEVA 1M6NA 3LNCA 4DIEA 4AI6A 1NJGA 1E0KA 3UIEA 2QI9C 4EUNA 1EFRA 1G6HA 1U9IC 2N46A 1P2TA 1E2GA 2QP9X 2BBWA 2J0UB 2HLDD 2VL7A 4DSNA 2BMEA 4GI7A 1XXHA 3C14C 2EFHB 4IOJA 2C96A 1C9KA 3Q3JB 2VRWA 2X77A 1AIPA 3HPQA 3PEYA 4FMBB 1RVDA 2GEUA 2OXRA 1TU3A 2VH5R 3P20A 4KSCA 4Q01A 2WTUA 1LF0A 1N2CE 5KNDA 3UMSA 3B5JA 5DHFA 2A9KA 2X2EA 2WBLC 4PAMA 2DY1A 2CJWB 1Q21A 3VKHA 5SZIA 1DAIA 4GBMA 4TT3D 3RVBA 4HYYA 3FVQA 1G7RA 5C2JB 3KQHA 4ZDIA 1XTJA 4WXPA 1ZINA 4NCJA 3PUZA 2ZI9A 1QHYA 4TN1A 4BZXA 3BD9A 1HA3A 2BKEA 2WOOA 3ETLA 1KY3A 1B0UA 1P5ZB 3EZ2A 4URYR 5J4LA 1OB5A 3RRNA 1VYVA 1OFUX 4IDOA 1AS0A 1L4UA 1QHIA 1NI3A 2R2AA 3MFYA 2IYUA 2IS6A 4MRSA 5SZKB 3IILA 3U4QA 4TL9A 1E32A 2HYDA 5G53C 4DLTA 2JA1A 3SFZA 4P0TA 1X86B 3O8BA 3R7WB 1QDEA 1TL7C 1ZNWA 2FFBA 3T5GA 2JJ1A 4ZDJA 4L8GA 2ZUCA 3GJ7A 2D74A 2BHRA 4W5HA 4DT1A 2VSFA 5F9HA 1GAJA 3QE0A 5JRZA 4GP6A 1RRCA 3ZZ0A 2ZJ5A 4HAUA 2ZE5A 4PPFA 5JBQA 2GK7A 4IOMA 4HSEA 4R2IA 2FMXA 2PEYA 1W49A 1AJEA 4A0FA 2ZSFA 4NYMQ 5BN4A 2WJHA 3NH9A 2ODNA 2VO1A 1G3IA 2ONJA 1Z6GA 2QSYA 5JCZA 1VMAA 2XB4A 2CNWD 2F3RA 1MKYA 3U2QA 2PZEA 5DYGA 3W3ZB 3MJRA 1P9RA 1M74A 1E1QA 1IY2A 4OQFA 5FOWA 1AGPA 2A5YB 3GFOA 2R9VA 3Q5EA 3ONWA 5GJVC 3SEAA 4Q7JB 5EE3A 2ZQ5A 2XAUA 1JI0A 3NBYC 1W47A 2QAGC 1OW3B 3MWYW 4V0OA 4EAQA 1KGDA 4BE7B 4JVLA 2WIBA 3QXXA 1I4LD 2REXB 4CEJB 1BMFA 1HE8B 1IXSB 621PA 2VHJA 2YWGA 1FNMA 1ZUHA 1WE2A 3H2YA 4TYYA 1E2MA 5CB6A 3PEUA 5JJLA 2B21A 3M1IA 2FPLA 1N0VC 4GP7A 2V4ZA 1T3SA 4MDFA 2O8DA 1E2QA 3WMFA 4JT4A 4OYHA 4TL8A 1NN3A 3PFIA 2R6DA 1PV4A 5J47A 3RANA 1E99A 1NVWQ 2JJ2A 4F7WA 1KY2A 2W6ID 4DLVA 2AR7A 2C03A 1XTKA 3L82B 4RZXA 4C30A 4Q4LA 4JKIA 3IHWA 2QMEA 1KIMA 3SR0A 3WMEA 1N3BA 1OPXA 4D26A 2OG2A 1OH8A 4I81A 4A8JA 4URWR 3IEVA 1L4YA 5KYKA 3GMTA 1R10A 4MDEA 1UPTA 2H17A 4JVMA 2GJSA 5KPJA 2QORA 3KTAA 1G64A 3QIAA 2O8BA 4HI0E 4NMMA 1E2FA 3CB4A 3Q5DA 1YZUA 3CZQA 5EE5B 5HKKD 3RS3A 2IF0A 1S8FA 3D31A 2HV8A 1G5TA 1KSGA 1L7VC 1NL3A 2LWIA 1DARA 4C9BA 2CMKA 2JLWA 4M9QA 4NZYA 2QY9A 4M1KA 4NE2A 3RRYA 4AURA 3QENA 5HZKA 4U02A 1P60A 2FSGA 4LK2A 1U2RA 2FGKA 3GFTA 4LHXA 2CHGA 2AK2A 2XTNA 1UAAA 3MUFA 2HUPA 4JLVA 3U3RA 1V43A 4B76A 3IO3A 1GG2A 1UM8A 4Q4AB 2NO9A 1BOFA 1QVRA 3ZS8A 1UKYA 1CBUA 2FFHA 2FV8A 4QHSA 3UWKA 1EWQA 1JQJC 1Z2CA 2C99A 2VP9A 1ZM4A 4LOAA 3ZLJA 4PHTA 3SS8A 3VR3A 3H4MA 3HP1A 4Q9LA 1G3RA 3NDBB 3NBZC 4DRZA 4ZIRB 1CJKC 1D2EA 4JBXA 4R9UC 1YZKA 5JJIA 1E9SA 1TPZA 2AFHE 4BZPA 1NN0A 3A37A 3WBKA 1IXZA
chains in the Genus database with same CATH superfamily
1EWTA 1IPFA 3A9WA 1GGHA 3V80A 2Z5LA 4EPRA 3IVRA 4X5OA 3FDIA 2EZUA 3RC1A 2UYYA 5EQJB 4L72A 4QJBA 1OVMA 2HJSA 2X7HA 3QX9A 3M89A 3QU5A 5KI6A 4C4SA 2OGZA 2BFFB 4BGUA 2IX3A 3QHQA 1F4VA 4CUKA 1HMPA 2HA5A 2XMDA 4I1SA 1M1UA 3P9IA 5AKHA 4CUJA 3TF5A 3SF0A 1ADJA 2FMTA 3EF3A 5AKGA 2R8XA 1GHTA 3BEOA 4XJSA 3JQ7A 1EP9A 4W63A 5HIMA 3MD0A 4ZV7A 4DZZA 2EP7A 1D9XA 2C5SA 3F4KA 3OCJA 4K81B 2CL5A 3PITA 2WNIA 5DPMA 1I6MA 3IIMA 3UC5A 1ZY2A 2EZ4A 3CCFA 2NPFA 5CFRA 4AS1A 1ULTA 4GX0A 3KYBA 4KQJA 4XIFA 5EVJA 3RJTA 4HOYA 3RKSA 1TO2E 4ZGWA 1DX4A 2ATVA 2Q5IA 2C3OA 3H05A 1G1AA 4UM7A 1W1WA 5BSMA 1XCGB 2BDTA 1LS6A 4FCCA 4H6VA 3A0RB 4M1OA 2A14A 5CK4A 4FGWA 7YASA 3IRVA 4R1PA 5HMMA 5DBOA 4MQLA 5HF9A 1RM0A 3FMIA 1KP3A 2PA0A 4NNPA 4J0QA 2G82A 4JOSA 3VR5A 1J2JA 7REQA 4DCSA 3IAM1 3AJ9A 1UZMA 2Y3IA 1O3YA 1OC4A 4FT2A 4UE2A 5ICCA 2AYYA 4J1TA 1KQNA 4RL4A 2Q7XA 5J43A 2WVHA 1YOVA 4GKBA 5B6PA 1BWSA 1N57A 3M5WA 1TO6A 2HYIC 1FXUA 4MAFA 1ORRA 1UMBB 5EJ7A 2FMHA 3QQ5A 2YXNA 2ZWPA 5ISMA 1TTPB 1ZK3A 4GDMA 4O2LA 4XA8A 5DRTA 1MD9A 1W96A 1JKFA 3MM4A 3T38A 3NRJA 3TLCA 3V2UA 2X5KO 3CSDA 4DAOA 4RSHA 4POAA 2QEQA 4DVJA 4KBFA 5D7BA 2PO5A 4EELA 4Z4HA 3CZ9A 1T0IA 2ZRHA 3EJ6A 1GUDA 3FYSA 2A9PA 2CXQA 2NU8B 1T2UA 4EHFA 4CIXA 4KFSA 3DEIA 7GPBA 4UAGA 1M6VB 3KJQA 4B9EA 3F6RA 2FPIB 3DZGA 3H1GA 3L0PA 3X44A 5IEBA 4EG7A 5LKRA 3MOSA 2VDWA 3Q6NA 4L8VA 2G9QA 1W5BA 4LJYA 3X2FA 3PEEA 1NVXQ 2X0JA 3DVQX 3MIZA 3MRVA 3O2NA 4OXRA 1YI1A 2JRLA 3EGVA 5DTIA 4RJLA 5ALYA 1DC5A 2OB1A 2NUTB 3RVJA 3SJBA 1U4NA 4E2FA 4YMIA 3E2PA 5F4BA 1T6YA 1NP7A 1N36B 2FAXA 3ZDFA 3HKCB 4JZKA 1W34A 3GU3A 3JWPA 3V8NA 4D81A 2IXFA 2HUNA 2VSXA 8MHTA 1S1MA 4R2WA 1IQ0A 1E0JA 1Z5OA 2GX6A 1MNQA 2NSDA 4ASUD 4PN7A 1ZNZA 2ZI3A 5LQSA 2FEXA 3I5UA 4DC9A 1BX1A 3B3FA 1RM5A 2P9ZA 4D3FA 4XFKA 3DVLA 3EDMA 4W5OA 3DLBA 2AZXA 1YZ3A 1O96A 1IOWA 1BWQA 1LBQA 1MMFB 2BM0A 2FF7A 4ME6A 2BGUA 3LRXA 1KZ4A 4ND5A 5AP9A 1ISHA 2PJZA 3NYRA 1A27A 4OHPA 5B2ZA 4MW9A 1VG8A 1BRMA 2FSVA 4PAGA 3N8KA 2VYVD 1LDBA 3G9TA 3VO8A 4ZYWA 1PYGA 3T94A 3X1ZA 2ENWA 5E6SA 4DSAA 3B6KA 3A4IA 4PYMA 4NYMR 4BFSA 3ZWQA 3WIVA 3UW3A 1RDFA 2D13A 1X3SA 3I61A 1FX1A 1TK2A 3IUMA 2D1FA 3VNUA 3BXZA 4EA8A 3F47A 4IEFB 1L5HA 2H4JA 4J0KA 4TPKA 2HDWA 3QG5A 2K4MA 2ZJOA 4TXNA 1TT5A 4NENB 2WJYA 3SYKA 4BQOA 5HIKA 2IHZA 3C4JA 2EFEB 4WHMA 1WL8A 1M2HA 3RKRA 4KMOA 3KT3A 4LKOA 5D84A 1U98A 5LOVA 2XXAA 4EGJA 3OLVA 1SC4A 3KR1A 4EYSA 4JT8A 4R2HA 1Z0JA 1Z88A 1PDWA 3E3OA 2EKPA 2H2IA 3H9QA 2TMKA 4V0SA 1CZRA 4I50A 1YRQA 1JFFB 4X7PA 4CL3A 1VPDA 2AFHA 1Z0IA 2IBMA 3GRVA 2G25A 4MRMB 5DRYA 3TKAA 3FTFA 5BYKA 5FTKA 4UNNA 4NHOA 1HDEA 4MQFB 1MVLA 3MGKA 4OJQA 3I23A 4NATA 3IAAA 5CA1A 3K70D 3WB2A 2DQZA 4MYUA 1FTNA 1C1YA 3RW9A 2F43A 2ZM6B 4RY0A 3NDPA 3LHKA 4CMEA 3CVWA 1JG2A 2OXFA 4TRJA 2PNFA 1ES9A 2ZYSA 4TKUA 5J59A 5LXTA 2G80A 2O2DA 3QEMB 1GM5A 2VJOA 3AUAA 4H7PA 5JVDF 1NJFA 3UHFA 5D5HA 3VR4H 3ZWYA 3BMXA 4N5MA 1X7ZB 3W2IA 1ODCA 3VH4A 3TL6A 2D2IA 3FRJA 4AFNA 3C6MA 4ZARA 4D0SA 4L78A 2Q3CA 3RPEA 3VPSA 3IDSA 3OFVA 4UE3S 1IVYA 2C5EA 4HNTA 1OWPA 2P4EA 3VZBA 4DM3A 3VC1A 1BHQ1 4JMLA 1C8LA 2C82A 3HVHA 4S1WA 4HLCA 4ZCTA 3RAPR 4PHGA 2YWJA 1CIPA 1R3DA 4PNZA 3CINA 1QGUA 2FFJA 4CKWA 3C8HA 2PAAA 2AVDA 2P4SA 2NO5A 4YQYA 2ECPA 2RH8A 5TQ0A 3RADC 4AZTA 2Q5FA 3CKYA 3TXYA 1IMJA 4RD1A 1YR9A 1TIKA 4H7IA 4RDCA 1O8CA 3G1TA 2XUQA 3KELA 2DMRA 5HZMA 4C5CA 1YI8A 1JU9A 4N7JA 4A15A 2QJRA 2QVYX 2C88A 2Q27A 1EPUA 1W75A 4ND2A 4PQFA 3HDTA 3PC8C 4OHBA 4UHKA 5EUBA 2Y0PA 5ELMA 2ZRQA 3BHJA 4KE9A 2ODBA 2X1MA 4H31A 5H3CA 1GDDA 1HKUA 3U48A 1I7SB 4JLUA 1OGYA 3Q7PA 4I1OA 2YJ6A 5MFZA 3WL6A 3DDOA 1PFWA 2GAJA 4BO8A 1RJWA 2EIXA 1CK4A 3BMOB 4IZIA 3FVTA 4TVBA 5GJWC 3ZGLA 1OZFA 2WHPA 3W2TA 4B8YA 4WNCA 1OI3A 3AR9A 1QB8A 4WOBA 3TTUA 3HEMA 5L3RA 2ZWMA 1QFMA 1EK0A 1X1BA 1DXQA 5CFOA 3QEBZ 5B55A 1FXWA 3GX1A 4ZMSA 1A4XA 1P4RA 1Z74A 3MNFA 5FO0A 5EP4A 1BU5A 1GPLA 1PNTA 3QU4A 2OP0A 4E5KA 1UODA 2J0EA 2YV1A 3E9DA 1VRVA 4EY5A 2XEXA 3QUQA 4GOLD 1HWYA 4HTFA 1QQ7A 1Z68A 2HCBA 2QT0A 2AB0A 3BZBA 1OBCA 3NFYA 3SPXA 1QVAA 4ZVNA 4QVKA 3ASVA 3B52X 9LDBA 1RFGE 2VJAA 4C08A 3COSA 4EMBA 4RVDA 2C94A 2D7DA 2BFEB 1Y8AA 2WAAA 4WZBE 5KZMB 2B8TA 1B8OA 1L3BA 4WNYA 2DFLA 3F8SA 3I1IA 1AK2A 4JEHA 1LVUA 1E1RD 1TIBA 2FA9A 1S9HA 3OUZA 4ZREA 2DFTA 2PKQO 5EE1A 3E5RA 5KYGA 3IUYA 2XZOA 2CNLA 1DEXA 3KSAC 5FNVA 1OOEA 2QS9A 3A28A 4O0MA 3W34A 2SCUB 1OH5A 1TVKB 4Y2QA 2PL9A 3BSYA 5LPNA 3B7GA 1Z4IA 4O2AB 1WXEA 1EVEA 3PTLA 1AKMA 4OJMX 1CJBA 2P5SA 4K26A 3ZU5A 2WEKA 4DWVA 1GZ3A 1O94D 4MR7A 4AN0A 5CG2A 1TC1A 2YICA 1QH1A 3I8SA 2WYOA 5LBTA 3HHEA 1HGXA 3HPRA 3W6ZA 3WNVA 2HR1A 4BEJA 4P4SA 1N6PA 1JS1X 3SMVA 5CBPA 3EZ7A 2GBLA 2BISA 1HLGA 2QZJA 2RHBA 5DYNA 5DYIA 2B6HA 3BH0A 4QDUA 4YJKA 3QTBA 3WDKA 2YWXA 3JQCA 2FZEA 3MMZA 4WFJA 3KYCA 2OM6A 2VQDA 4ZO6A 3IXQA 4C2TA 3H42B 4NCBA 3V7UA 2G7ZA 3D7SA 1DAHA 3OQIA 2OCKA 4RJIA 5DTRA 5AUQA 2WQ6A 2JJ2D 5KB3A 5LBUA 2P2LA 3SXUA 3HN6A 3QXCA 1AC5A 4NDNE 1QRTA 3PHGA 2OZKA 1QPGA 4BJ3A 2CHEA 3BE5A 4TM8A 1W7AA 2VEOA 1R64A 4BQFA 1V3VA 4M9RA 1NE7A 3G2LA 1N6OA 1UQRA 2WSSA 2A9OA 4FE3A 1M1NA 1Y4ZA 2FY8A 3ZE9A 1JQLB 4FD3A 4WA8A 1VHJA 2G09A 5MN6A 1O5TA 4GGPA 2B30A 3RVNA 5DX8A 4WNAA 1XRSB 4GQIA 2IYFA 3EGXA 4ZYTA 2Y1DA 3PQFA 3SC3A 1PR0A 3DNMA 2QBYA 3L7BA 4BX0A 5M7EA 1ICEA 3ZE2B 5KSZA 5FWYB 3TZQA 2WG2A 4HZIA 4DCTA 1G9XA 3GFSA 2XLCA 4R8VA 3Q8KA 2OAP1 2OCIA 3BWYA 3CE6A 3BIXA 2CDAA 1EBBA 4IRXA 4M55A 3HN2A 3R75A 5U4XA 1U9IA 2PYZA 2PNJA 3C45A 1PL7A 4AWAA 2J1LA 4MS3A 4EB6A 3AFGA 4FFPA 2V8BA 3HJGA 3LA6A 3CRVA 3U39A 3L6CA 4OAOA 2GD6A 5BXQC 2ABWA 3ZQJA 1VSQA 3VR3D 4HDMB 1BYIA 1T9HA 2CEKA 1N2IA 4JL5A 4JI8B 2J9ZB 3A6PC 3GBSA 2HEIA 3BDAA 3TLGB 3PL1A 3PR1A 3GAAA 2BEUA 1CUYA 3OJOA 1VSBA 4F3NA 3CZPA 1KEVA 1DTSA 1ZQ9A 2C4MA 3EWSA 2GO7A 5AVWA 3OQOA 1VYUA 3ENNA 5FA5A 2ZDQA 3LWZA 4DAEA 3O5AA 3T34A 1JJVA 1FDTA 1ESCA 2H63A 2UZ1B 3BRCA 4I5IA 4MW1A 1EVJA 4NMHA 1YE5A 3VTAA 3SG0A 1JQDA 1CR0A 2P9GA 5DTQA 4Y2YA 2DUMA 3SSOA 3R9WA 3EW9A 4OHFA 1QV9A 1ZIXA 3MMNA 5JMPA 1JHOA 4NCHA 3RAFC 4QM6A 2CC2A 5A1TA 2HWYA 3GFBA 3QFSA 3UMYA 4KI7A 1E18A 3O4HA 1C3LA 1J07A 4BAGA 3ZK9A 2O9JA 1KYIA 3EUAA 3G8CA 5AJYA 5BN4B 2LE0A 2HREA 2YHAA 1WDLA 1IPHA 1RRMA 4QUAA 3FNIA 1Q20A 3IBGA 3TIGA 2C1ZA 2OZLA 2ZUFA 1MC4A 2PYDA 3G3EA 2ERYA 1AKYA 4PLCA 2BEVB 3D02A 3PCXA 2EEZA 4QDXA 4FW9A 3RU2A 3V46A 4KE7A 1AD2A 4AO6A 2BP7A 2R6GA 1LKZA 2F90A 3JR3A 3ZGYA 1SKYE 5ALOA 1NRWA 3D4BA 1CY7A 3JATB 4Q00A 3SXUB 1D1PA 4IL5A 3KZKA 3ZX4A 5EJEA 3HDJA 5K0SA 1DINA 3TTWA 4WBSA 3V7YA 3LHFA 2R1TA 1BE6A 1OUMA 1PS0A 2AD1A 4V39A 1V1MB 4Y1FA 1RMQA 4KK4A 5G0VA 1DDOA 4AJLA 5ITWA 2I33A 5F77A 1XU4A 3A7DA 5H7XA 4H27A 3AETA 2CYBA 2C4WA 3AV3A 1XZDA 5ENVA 4DEYA 3HY4A 2HH9A 1FNSA 2FR1A 4XPIB 3DAPA 5CVJA 2Q5QA 3E0XA 3D9QX 4L7QA 3S2YA 4TV9A 1ULSA 4XH9B 3RIMA 1CQZA 1MOQA 1X3LA 2BGJA 3QX7A 5LDDC 2DKFA 2ZZKA 3WKDA 1ILEA 2JGNA 1FSSA 1I8TA 5L6LB 1Q84A 3M4YA 3SK0A 3GEGA 2WA2A 1P2UA 5EXSA 3YASA 3AINA 4LYGA 1YQUA 4LRQA 1TQ2A 2FX2A 4LQ4A 5FWXA 2NO1A 5J5CA 2ZYAA 5AR1A 3TKLA 4E14A 4F85A 3Q0IA 2WT9A 3MAGA 3SZ3A 4P5EA 4JEIA 1FQWA 4QATA 5A4JA 5JNTA 2X19A 1YR2A 3DV0A 1W4RA 1Z5ZA 2PVCA 3DW1X 1HNNA 4MGYR 4QWMA 2VWPA 3T3PB 4DR7B 4PFKA 3OX2A 4A6EA 3DZBA 2BKXA 3AYZB 3CS3A 4KWCA 4ATNA 5C3MA 5ADWA 5K4GA 4C3UA 4PGGA 3OETA 1UP7A 2CD9A 1L1QA 3FMFA 2ZT8A 3M1YA 3I5AA 5IJZA 5K01A 3ESYA 1OX5A 4B79A 3KTAB 1U8UA 2O8BB 5BV2P 4MUFA 1H9BA 1BX0A 3M9LA 5TSDA 2A4MA 5B4TA 4ARCA 1WD5A 1BDMA 3QBEA 4TYQA 3AP3A 1O54A 3NBQA 4IFIA 1MV5A 2EIHA 1PEKE 1XRPA 2WWTA 1WPQA 2X22A 2XMCA 4BZWA 3TTTA 4B45A 1DFHA 2Z5VA 2OSBA 2YMLA 2R0QC 4DDVA 3GGPA 2IZ0A 2PUFA 3WO0A 5BW4A 1TK3A 2E49A 3CVJA 5FPPA 1QUEA 1J99A 1S2OA 1VJRA 2A0KA 2ZRIA 1N2SA 3GDOA 2WTMA 4TMKA 1SC3A 1N1DA 2JEOA 4MGHA 5FBKA 2PT9A 4HVCA 2F55A 3UQYS 2DGDA 3NDRA 1N2CB 2PZAA 3VDXA 5EC8A 2EW8A 2FDXA 1FCJA 1ELOA 3NNDA 2Z6AA 4PFQA 3IVGA 1QR6A 4ISCA 3V8RA 2P6MA 2YW9A 4TKLA 4AJJA 4N8EA 5G0UA 5C1BA 1NZJA 2VAMA 1GIAA 2DUUA 2QKYA 4KO8A 1FQJA 4GMGA 3WBFA 2B8EA 2YWCA 1F1BA 2OYCA 3WGMA 4MUMA 5E7MA 1MT0A 3RYCB 3AB3A 2VF7A 3ZCQA 1KPHA 4TLCA 2I76A 1SBHA 3D8TA 2B5OA 5TVKA 4V02A 5CAEA 1FFXA 5IP5A 2H08A 3PENA 3G0HA 3N0WA 1G3QA 1XMJA 1CUDA 4F4UA 3QKTA 1TQ8A 1LJUA 1A9TA 1T2AA 1HE2A 1WMAA 3PNMA 4LZOA 2HJ9A 3TL2A 4CLOB 3O9ZA 1JPNA 5DXFA 3WIUA 3EOBI 4C0KA 4EWLA 7ABPA 3KPWA 2PN1A 4L73A 4LDRA 4I99A 4YASA 1JQBA 2J9FA 3HHPA 5FAXA 4QYSA 4R1MA 3ROKA 5AH0A 4ALLA 3F6EX 1XAJA 3K5HA 1E7YA 2BLLA 2C2YA 3F71A 3HCCA 1NG9A 1Z4OA 1QGED 4D0LB 1GTSA 2QD5A 3IR6A 3THYA 3LJKA 3FZEA 2QJWA 1XD2B 1FW8A 2ZUEA 1IZ0A 3VZQA 4IVPA 3U1VA 3O1JC 1M7HA 2DUJA 5CVVA 1SZDA 3C3YA 3CNQS 3HJNA 5C81A 3PDJA 5B3JA 2C9CA 2ILTA 2NADA 3JD1A 1TJPB 3K70C 1XZQA 3PXAA 4L4UA 4S24A 2VDPB 4ZEXA 3SLGA 4MIYA 4O4HB 2Q4TA 2M2IA 2ZSKA 2X0IA 3A2MA 3LX5A 5FUBA 3AHJA 4FDLA 4FTWA 3VSDA 1Y0BA 3HRKA 1Z35A 4KAJA 4YWHA 1YNOA 3L8YA 4UNIA 4G5SA 1N2HA 1T6NA 2IDMA 2DR0A 2YX1A 1TTHA 4HN4B 3TAXA 2VHTA 3IXMA 4HRVA 1Z82A 2HLPA 3ROFA 2YN4A 4RGVA 5EIBC 5LDHA 3KQQA 3TQTA 5FPKA 2YJZA 2ZE7A 3PUXA 1SEPA 2AC4A 4PR0A 3TZKA 3T7RA 4IXWA 1T5IA 3HGTA 3Q7SA 1U8YA 3NCTA 4PAOA 2WFLA 5AKEA 3B2QA 3RFFA 5JHHB 3MN1A 1H4TA 4IQ0A 5SYMA 1NV8A 3N2ZB 1I94B 1ZUNB 4XGNA 1RPAA 1M8KA 1R2QA 4MVJA 4MGIR 3G5MA 1QU2A 2PE5A 2VJBA 2QQ0A 1NKVA 5KX5F 4D4JA 1V1JA 3TJZA 5EZ5A 2MWMA 1K6MA 2HJRA 4B82A 4C7OA 3LVQE 2HCTA 5BWBA 3CVYA 4JT2A 3DP7A 3GLTA 4CKBA 3WIDA 4TTRA 4UPEA 1BG6A 1UANA 5LYJA 1E9VA 1REQB 1DKOA 1KZ7B 2VNSA 4LJAA 5FL7A 2VIIA 4K9MA 4FGZA 1K8XB 5ERYA 1E79A 3ISJA 1V4NA 2P1RA 2ZSJA 4R2XA 3S55A 3SR3A 2D2XA 2VUSA 1S2LA 2GDZA 4OU5A 3DTTA 4LYHA 5IKEA 2O8CA 1S96A 1N78A 1PD1A 4Y9TA 4KRXA 4G1FA 5CURA 4BECA 1XEWY 2QVXX 3RG8A 4AM8A 3PQDA 2OE2A 4IX1A 3L7NA 3QPCA 3LUCA 4XCQA 1V2GA 2XRZA 1VYTA 3DGFC 3DBOB 3KZ1E 1KVSA 3RVRA 5B57C 3EUWA 4TVSA 3RS4A 5JYCA 1G7TA 2IZ1A 3B1KA 5LP6B 2HMVA 1QHEA 1G8JA 5E95A 3V8MA 1B3RA 2JLXA 1UDBA 1QHHA 4HADA 1X7WA 2P2SA 1A8PA 2VZ8A 1TFUA 3KP1A 3KL2A 3MWEB 4AJHA 5KNBA 4HJRA 2YWHA 3BAFA 4K6GA 5E4TA 5GZ6A 2A0FA 3IVXA 1XCOA 2XX3A 1CUIA 2NXWA 2AJTA 2FEOA 1K0UA 4QODA 1PHRA 2FZ4A 2C5FA 2N9UA 4C6TB 1W36B 4YJGA 1L7NA 4L0QA 1PJTA 4Z4FA 3S2EA 3WGOA 1H8HA 1W4LA 2WJGA 3PC4A 5BXYA 2OFFA 3D43A 5BSFA 2RHCA 3IP8A 1E2BA 2PY6A 3HU2A 1ZH2A 2H2HA 2PV7A 3MWKA 1SHKA 3O03A 1QV7A 3BXXA 4N6OA 3S2GA 5CFNA 3OE4A 4UZEA 1EFKA 2ZYRA 4CF6A 4BO7A 5L6MB 2VF8A 3D7NA 4CCSA 3HGQA 1ETHA 1Y33E 2CB0A 2QUHA 3JQAD 4PW0A 4JVOA 1CUVA 3LXXA 3W2FA 2BGWA 2WA1A 4IDAA 5LUBA 2C9YA 4OUKX 1Q2XA 4OEHA 3HYRA 3W3AA 1RT9A 1ZOIA 3LBYA 4FU0A 4KSYA 2Y99A 3BK1A 4ZWNA 1ZBQA 4FBLA 1ZOLA 4MLCA 1COWA 1DKPA 3UF0A 4D8YA 5A4MS 3TTXA 4OSOA 1XDGA 2BSAA 1GR0A 3T7DA 1T4GA 4L9SA 4HV4A 1GY8A 3H19A 2XYVA 4KDCA 4W7IA 3I4CA 2SHKA 4QYWA 1H69A 5IXYA 5JARA 1E89A 1VFPA 2IZ5A 5H1YA 5JXJA 1G5QA 3IHTA 3MGCA 4KQFA 3KIPA 5C3UA 5A6VA 1OF1A 2VR1A 3RARA 5BYAA 2BUAA 3GB9A 2EWVA 3FSRA 1JHRA 2CXUA 4G2NA 5FKJA 2W11A 5DNWA 1BDIA 4C5BA 1EDOA 1E2IA 1YRBA 4NPHA 3M4NA 5G41A 1LUAA 4MV6A 3OLWA 3CW8X 5F1KA 3HKDA 1OZHA 5EHNA 2UZ4A 1LDGA 3PFFA 4US2R 2H8GA 3SZMA 3ILYA 3LP5A 4X95A 5C7IO 5IZCC 2C8KA 2CXPA 3GVPA 3EPJA 1H2FA 4NE7A 3VI3B 3P9QA 4KQHA 3EXG2 4LHYA 4K9LA 1AX9A 4HQ6A 1E1NA 1UAGA 1XGKA 2O4UX 4MPRA 4N3AA 4ZPJA 3ZOKA 2WIJA 2OBXA 1P1RA 5KKNB 1VKOA 2PSSA 2XE7A 3M0EA 3ZZMA 3QX3A 3Q2KA 5CPBA 5DOVA 1Y4AE 4J0GA 5BUSA 3MPOA 3EUEA 3UB2A 4JXKA 4RE5A 4WXMA 3F1LA 3K0HA 3ZHVA 4JV5B 2OAEA 5J2UF 1ZW6A 4QTTB 4FOPA 1E7QA 4CQMB 3E9YA 1PK9A 4E30A 3MMSA 1F14A 1OJLA 4B6RA 5LYJF 5AFSA 3KG2A 3E9MA 2QRVA 1YHNA 4LF6B 2C31A 4B33A 1DBQA 4RZQA 2HCJB 1JHPA 4Z51A 5JY6A 1S02A 2ZSUA 2AN5A 4F71A 1KAEA 4CGYA 4CM7A 2JK0A 3GPDG 2AQKA 3A70A 1G9SA 3HEAA 3MVEA 2YFKA 4Q4HB 2V7TA 4D4HA 2MINA 1ZD1A 1A88A 2DSTA 5GTDA 1RQXA 1NULA 3VNQA 2C2XA 1CVLA 1FDSA 1P1CA 2FWBA 3HU3A 3NBMA 4IGFA 5DM2A 2KYRA 4B2YA 1QPZA 1O5OA 3KJGA 4BN4A 5TV2A 3VPDA 1WHSB 4FDTA 4GOOD 5FOQA 3FGNA 2PIAA 2X2PA 2H00A 1HDRA 4DABA 3CH6A 3EZFA 3N8GA 3TB6A 2C20A 3S7ZA 1DAMA 4INAA 2OZPA 4XJVA 1E0DA 3R3WA 4REQB 3QE9Y 4OB6A 3WJ1A 4EGCB 2BUCA 3FNBA 5KAMA 1T1EA 4DFDA 1S5PA 4IJQA 1NW5A 2IOYA 1U1FA 4UC0A 1AHHA 1UBHS 3HBJA 3M6IA 3M82A 4N4AA 1JF8A 3I6IA 2WG0A 1IUNA 4RTPA 1PW5A 1Z63A 2QMOA 4FB5A 2RGCA 3G2OA 1A9ZA 2PL3A 2WP8J 2JBHA 1V9CA 1AMNA 3OY7A 5JXWA 4YRJA 2ZJ7A 4HFRA 5FH9A 4CLHA 1WP4A 4K03A 3R3JA 5FJJA 1VPTA 4GD3Q 1A9XB 3NJRA 5LQNA 4FK8A 3T7EA 3FJOA 3L6RA 4PGAA 3FMPB 3ZJYA 3LC0A 1Q3HA 3HUUA 4FFDA 1ECJA 1CDDA 1IHDA 3MJEA 4RLFA 3I2KA 4JXXA 3RYHA 4YUVA 1Z7EA 2DPHA 3KB1A 3NOOA 3I4FA 2AEJA 4IS2A 4LJ7A 3REGA 3W6UA 2O06A 1L7PA 1P33A 2ODWA 3RFUA 3QA3E 3MTEA 3HYLA 2JLVA 4P32A 1KH1A 1D1SA 1UFKA 4OQEA 1R66A 2H2WA 1RXVA 1XT6A 4CF5A 5M2QA 4B8WA 3ESDA 2O7SA 2GAFA 5KCMA 2X1VA 2VDQB 3TFWA 2EX4A 3ND9A 1UEJA 4MAMA 3UTDA 3W8RA 5G0WA 2QD4A 3GLRA 1AZTA 1U7XA 2A1TR 3KV3O 4FQ8A 4QGGA 3Q5GA 2ZSBA 3OCXA 2X6RA 3DOHA 4ZCIA 4QGAA 4GPBA 3I1JA 4F1JA 1NNI1 4CU2A 3OIVA 1UPFA 3TEJA 5HUJA 1G5FA 2WIKA 1MT3A 3I2IA 4MWEA 4PLWA 1Z06A 1D5WA 4Q3OA 5F3DA 1GAQA 1JN0A 1CYDA 1GDHA 2GN9A 2HRQA 2I3GA 1C0KA 2R44A 3IEIA 1KFBB 3ODGA 4ZI7B 2IU6A 5K8LA 3FPLA 5I5EA 1GNRA 3QNMA 5FB3A 1F5NA 1T9GR 4EEXA 4ZTZB 1FDIA 2A2ZA 4Q9HA 3NMUF 3UUWA 4AS3A 4Q48A 3GRYA 1AQ6A 4A03A 3THXB 3BUSA 3ZNPA 1BGXT 1J9ZA 4IQGA 4P38A 4BNJA 2VXYA 4NESA 1W52X 1YZHA 4AY2A 1JSCA 1X19A 1JW9B 3DAYA 3PVSA 4P54A 4RAOA 5UKDA 3HBFA 4IYRA 2R2GA 4XCXA 3MT9A 3QEOA 2ZI5A 1KO4A 1P6QA 3DMHA 4I2NA 5KJ6A 3E5MA 3H9CA 2V7EA 4IIYA 1XTQA 5KYWB 1NIPA 4P53A 3EPHA 521PA 1L7QA 4Y6RA 1HT0A 3AW8A 3NQ41 1YZQA 4OUDA 1WDKA 2RK6A 2GJ9A 4WMLA 3FHJA 3GMIA 1E5VA 5KQLA 2ZJ1A 5F5LA 1G18A 4CLDA 4YJ2F 3WGJA 3A4MA 4MRVA 5CXQA 1CJSA 3OZCA 1QBKC 1E1LA 3LYUA 4HQLA 4YX9A 1L8AA 2A59A 4IHQA 2WM8A 4PY2A 2HL6A 3I64A 3GOQA 3KE9A 1RYFA 3M9WA 4PNEA 2OFXA 4CV2A 2Q1SA 1K88A 1D7AA 2XMSA 2ZANA 3I0MA 3QWHA 5E9AA 4H59A 4YRFA 5TNXA 1XZEA 4ER5A 3EEYA 1Q7CA 4JLKA 3ER6A 3IP5A 4Q24A 2BD0A 1JTVA 2GK3A 4J2OA 5EMKA 2I03A 3KFLA 2YOGA 3GQBA 4FZJA 3CRZA 5C52B 1WAMA 1PJLA 4JB0A 2GF9A 4RZUA 1E8DA 5JALA 4S1TA 1YR6A 1YGYA 3RVLA 5L3SB 3NIWA 1MQ8B 2GCIA 2QD1A 2PSDA 4QU9A 1UJMA 3VTFA 4I1PA 1LPSA 3LO8A 1ZGHA 4IIEA 1JSLA 4URFA 4KPFC 1TRHA 3TDNA 5FI0B 3G0GA 4CW7A 1LPNA 1EBUA 1DRVA 1JX6A 3SEFA 4BMOB 4C0AC 2Q4RA 2H1CA 4A1OA 2V3VA 3I2HA 2DPMA 1EXDA 3GGJA 4EPTA 3BQ9A 3G2MA 4DLXA 1LSUA 2LCFA 4IDBA 2Q2NA 2RDMA 2YHUA 4UHHA 4R9VA 5TEVA 4BN5A 3MW8A 3F78A 1JEYB 5A62A 1X15A 2XV1A 4BCDA 3LECA 3OKPA 1W4CA 3L46A 2BE7A 4X20A 3ETDA 5DLYA 1CUJA 1YJAA 4MLZA 3U16A 3B1VA 3D3QA 3JSXA 1ENYA 3N07A 3OPYA 5JS2A 3DEYX 2JFHA 1H3FA 3C39A 3DWIA 3ZHOA 5I8PA 2MYPA 3Q11A 2NMVA 1YVUA 2B78A 1KOFA 3DKKA 3ZOZA 1J0AA 4AP6A 4IJUA 1M2WA 3WICA 3D2BA 5K0JA 1BH6A 1DDIA 5ALHA 2PVSA 2JFQA 4EY8A 1BXZA 1ZNYA 3OT5A 2MMCA 1F0YA 5L3ZA 1JFVA 1RJFA 2UYOA 4TTTS 3P4YA 3DLTA 2VATA 2VDMB 4X9XA 4BNUA 2Y0CA 4Z7OB 3L8HA 4ZYZA 3COZA 5AD1A 5AWFC 1XDSA 4QOJA 2QQ5A 3QVVA 4PVDA 1A2BA 5I3CA 3ITDA 2C8VA 3RVKA 5JPIA 4TROA 4JI5B 1M5RA 2E48A 3QJYA 1SVIA 2XRFA 4B7XA 1KI6B 1ND5A 1U8ZA 1OX4A 1G17A 2XKJE 2IYYA 3AM4A 2E6UX 2ZS7A 4HXYA 1N9GA 3MD9A 4L3OA 3I6MA 1P4GA 5CA0B 5JZBA 1GAXA 3CZMA 1AKWA 4B3RB 3DE7X 3QMVA 2NSYA 2CMGA 4RPIA 3FDZB 1SBIA 3LUKA 4OLJA 4LGYA 1F51E 1ONBA 4YFYA 4YMWA 3PGKA 1GGJA 2JLQA 4HYQA 4WXEA 3OIDA 4QBIA 5CVDA 5LA6B 2FDRA 4YMTA 2W48A 5JZMA 2Y92A 3MRSA 3A9UA 1T8PA 1GPJA 2EJCA 3H5RA 5IJXA 1H8EA 1AGYA 3MJ4A 2H57A 4DIDA 1P81A 1YC2A 4Y0NA 3P4XA 1W4ZA 3GT4A 1KTIA 3JD2A 4RGQA 4N8SA 3ZTYA 5LP1A 5H3LA 1N7GA 3F7NA 1BAPA 4M88A 3DH0A 1JB9A 3S70A 4KMSA 1IHUA 4QXPA 2GN4A 5JS7A 1MZVA 2GILA 3FI9A 3MG9A 2VXBA 3LF1A 4EKDA 1AQNA 5KVAA 2JGRA 1E9CA 2KSQA 3VR4A 2X6QA 5LDGA 3RK4A 2PBLA 2C9BA 1KO1A 3LZ6A 2IS4A 2OG1A 3TJMA 3RS5A 5LIPA 4R40A 3W9YA 5F51A 3WK7A 2C7OA 3BIOA 4XZ3A 2HT1A 3LUBA 1M2OA 3IPXA 4KVGA 4P80A 5J2TF 2XLBA 2QTGA 4GBJA 4K40A 3W06A 4AJEA 4AMGA 1NLFA 1MENA 1O9BA 3BGVA 4MICA 3C97A 3PG5A 4KN9S 4PF1A 4ALMA 1MDBA 5K0CA 2H18A 1JQKA 3NGXA 3SN6A 3CX8A 2AJDA 4YMHA 4RTNA 3SX0A 2A3RA 1MC1A 1UXHA 1XL0A 3GJXC 2C97A 3NHFA 2VWGA 2FWNA 3LT5A 3TW0A 4DBZA 2Z3WA 3WNCA 4EB3A 4ZCPA 2AQIA 2MJLA 4QJ5A 1AS2A 4ND8A 3NWBA 3K0SA 1COZA 3WNZA 1P1JA 1RAIA 1ZUIA 3HP4A 5EWMB 3JAWB 2BEWA 2JKVA 3MAJA 3CNBA 5IVIA 4DTCA 1G21B 6NULA 1B8PA 4PNHA 4REOA 4PQEA 5KWJA 3AVXA 1XJ5A 3BE4A 1W93A 2VPWA 3WBBA 1QH0A 2G9NA 1TQ4A 2B61A 1QYXA 1CSEE 3HLKA 4U00A 4QSHA 4AZVA 1OXUA 3PHHA 4UMDA 3S3TA 4YHHB 4QULA 2PFSA 5A06A 5FUMA 1YUMA 3GG9A 3RAJA 3EXAA 3T8YA 1OWOA 2HJVA 3UGQA 5KWIA 1XMVA 2AJBA 2OOKA 3K09A 1Q6YA 4R41A 5E6UB 2I8LA 2CUKA 2Q07A 4ZT4A 1O0BA 3R3HA 4P2GA 4ENWA 4MRRA 4XWTA 4FN5A 1O8BA 4MW2A 3NKFA 3SLRA 3GELA 1FPQA 2IPLA 3PHLA 3MT7A 3PX3A 5IU6A 4OSEA 1F2UA 1Q0ZA 1H2YA 1FMFA 4N6NA 4CV0A 1E6UA 3VH1A 1XG5A 4K86A 5DNDA 3V1KA 1I5RA 3WQBA 5A9SB 3NHJA 2V1UA 1FU7A 3PUWA 3FVVA 5K3BA 3RV3A 4C78A 1LRJA 1A95A 2F2TA 2W4MA 1R0LA 3BKWA 2RHDA 3L49A 4L2IB 1APBA 5TPZD 3QELB 4YMUA 1GZ6A 1J2RA 4NH4A 1R9NA 4ZJUA 2OCAA 3GV0A 3B6MA 3QEAZ 1U0LA 3AVQA 1TUGA 4GU5A 2ZPUA 4E2YA 4QYIA 3U4DA 3VU0A 2J6IA 4F6RA 2PZGA 4GR4A 4G25A 4D41A 4E03A 1Q44A 5KOYA 4IDGA 1WCIB 3N2KB 4X61A 1KDVA 3SAJA 5KTRA 3WWEA 1EFVA 5AJHA 3DHVA 3TR6A 4JJ8A 4GE0A 4RLSA 2WDPA 1FFBA 3N2GA 3PGMA 1XQWA 4FINA 3F96A 4OB8A 1ECFA 3RVDA 5FLYA 3N39C 1N0UA 1CV2A 2JCSA 4RTLA 1TMKA 1YS1X 4Y2GA 4YRSA 3LC7O 4OXIA 3NOXA 5DCUA 5JHGB 1H0KA 5IKMA 3CBQA 4LV5B 1WXXA 2BRUC 1K6JA 1XX6A 2YYSA 2OBLA 2CHQA 3I6ZA 3IKJA 3UC9A 4EFDA 5DNCA 2V74B 4HWGA 5GVRA 4HC4A 4PRKA 2QV7A 4TZKA 3T9EA 1P6UA 2Z9CA 5A4FS 3GLGA 3QMMA 3HY6A 2J9YB 3LVFO 2FN9A 2XW6A 2QTBA 1E7MA 2NT3A 4LFAB 1FVXA 2GZHA 4TMWA 3E35A 4EVRA 1V96A 1BVYF 3NBFA 4M1YA 3RLFA 3DTVA 3L0OA 1CF4A 4XQ0A 4FIDA 3Q4GA 1JSXA 4BO2A 3CH4B 5I9MA 4BQPA 3OEYA 1CYEA 5JXHA 3DBRB 1ZESA 3GDFA 2E1RA 3I52A 4OVKA 1B6TA 1J6UA 1DI0A 5A02A 2B4AA 5K4AA 3SU8A 2RMKA 5I48A 2P67A 5K3SA 3TFQA 5JSHA 1P80A 1VOTA 4YLGA 2I65A 3PGLA 5IHXA 1PTJC 2UZ3A 3RRFA 4YT2A 5E4JA 3C6YA 4A9AA 1PJ4A 1EHYA 1JVSA 2B5WA 4OJKA 4QO7A 5LLTA 2OY0A 3L4EA 1SCIA