1PNQA

Crystal structure of r. rubrum transhydrogenase domain iii bound to nadph
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
SGHIEGRHMAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAD(P) transhydrogenase subunit beta
publication title Conformational Change in the NADP(H) Binding Domain of Transhydrogenase Defines Four States
pubmed doi rcsb
source organism Rhodospirillum rubrum
total genus 53
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2003-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1pnqA00
1YHZA 2W93A 1PYDA 1N0HA 1M2HA 1YTLA 4GM1A 5EJ7A 1OZGA 2HJHA 2H2IA 3E9YA 5EJMA 2VK4A 3ZGVA 3FSJX 1T9DA 1SZCA 4TWIA 4UU8A 5IMSA 5BWLA 2VK1A 1OZHA 1Z8NA 5EJ4A 4KGDA 2IHVA 4JU9A 4JUFA 4F56A 4JD5A 1J8FA 2H59A 5EJ5A 1M2JA 3D4BA 4MZXA 1PTJC 1HZZC 1OVMA 2JI9A 3GLSA 1T9AA 5DGDA 1UPBA 2FR8C 1ZPDA 1V5GA 4RMJA 2EZ4A 4ZZIA 4RMIA 3GLTA 2UZ1A 1Q6ZA 4JU8A 3K35A 4UTXA 1U2DC 4X3PA 3ZGOA 5EJ9A 3RIGA 4O8ZA 5EJ8A 4UUBA 4MPRA 4C78A 2Q27A 3CLTD 2Q5JA 4JUDX 4QELA 3CLSD 2A1UA 3PKJA 1MCZA 1XLTC 2AG1A 4JT9A 2NYRA 4RJJA 4BV2A 2Q29A 4IAOA 4V1CI 2PANA 4ZP1A 4RJKA 1T9CA 1M2NA 1Q17A 4BVHA 4MQ5A 1EFVA 1PT9A 1JSCA 3PKIA 2BRUC 2WVGA 1YC5A 2OD2A 2B4YA 3HWWA 1UPCA 2H4HA 4JSRA 2H2HA 4GP9A 2OO5C 1T9BA 4UTNA 1NM5C 4HD8A 4UTRA 3EY9A 2IHTA 4UUAA 4HDAA 4Q9DA 4GM4A 2FWNA 3RIYA 2IHUA 3EYAA 4D5GA 2Q28A 4RJIA 4GG1A 2QQGA 5MFPA 3GLRA 1V5EA 2EZUA 5EJAA 4GPEA 2JIBA 2H2GA 2WVAA 4JUAA 1E3TA 5BWNA 3U31A 4L2IA 4K9LA 1U2GC 3EA4A 2EZ9A 5DEIA 4K9QA 3F6EX 2Q5OA 2H4FA 2VK8A 2X7JA 4RMHA 4D5EA 2FSVC 4FEGA 1YNOA 4R8MA 4JUCA 1YHYA 1YI1A 1S7GA 4IF6A 1EFPA 4BUZA 2NXWA 4K9KA 4FEEA 1UPAA 5D7NA 3CF4G 3FZNA 4F4UA 1O97D 1POWA 2JI7A 5AHKA 1V5FA 2JI6A 2JLAA 5DGTA 2VBGA 1U28C 4TWJA 1PI3A 4JT8A 2EZTA 5MFZA 4J16C 5FEMA 2H2FA 4JUBA 2VBIA 1YC2A 1BFDA 2H4JA 1D4OA 2OD7A 2FN3A 2OORC 1YBHA 3HWX1 3CLUD 5K6TA 1DJLA 4BVBA 2PGNA 1SZDA 4UU7A 4K9OA 3OE1A 1O96B 4K9NA 4V1CB 4BVGA 1PNOA 1YI0A 2A1TR 1PVDA 4K9PA 4X3OA 4FZ3A 1PNQA 1PO7A 4QQ8A 4BV3A 2PGOA 2QQFA 4BN5A 3CLRD 2JI8A 2VJYA 1Q1AA 1Y9DA 1MA3A 2AG0A 2C31A 3GLUA 1OZFA 5MF6A 4GM0A 4L3OA 5BWOA 3U3DA 2DJIA 2VBFA 1ICIA 4RMGA 1M2KA 4BVFA 3FLMA 5EJ6A 1M2GA 1U31A 2EZ8A 4KPUA 3F6BX 4Y6LA 2H2DA 4C7BA 3IAEA 3IAFA 3JWPA 4BVEA 4IG9A 1S5PA 5FYQA 4MPPA 3D81A 3LQ1A 4FVTA 2WVHA 1POXA 4KXQA 4UTVA 4UTZA 1QPBA 3JR3A 2Q5LA 4K9MA 2JLCA 1Q14A 5MGNA 4G1CA 4Y6OA 4QPZA 4COKA 4I5IA 5K2OA 2OD9A 4Y6QA 2UZ1B 4J1TC 4V1CA 2V3WA 4MPJA 5K6RA 4BN4A 2Q5QA 2FRDC 5K3SA 3D7KA 3ZG6A 3PDHA
chains in the Genus database with same CATH superfamily
2FWIA 1FDTA 1SCDA 1BWRA 2YWCA 5C8VA 4NKRA 1MB2A 2PGXA 4B5KA 4K1LA 3P0RA 4M4SA 4NAVA 2DWUA 1RZ3A 1YJAA 4HLCA 5JC1A 3HJFA 2O8FB 5A5DA 4DZZA 3HO6A 1V96A 1KJQA 1KZ9A 2EARA 2OGUA 4K6GA 3SC2A 1DIGA 4RK5A 4URZR 3UYLA 4D8TA 5BUZA 4WKPA 4J9VA 1WP9A 3ENWA 2JFYA 2XVAA 2B6NA 2VLBA 3AVQA 4O4JA 5ICSA 4EJSB 5TLSA 4FOTA 1K5GA 4DCMA 3FPEA 1T9GS 1YS4A 2ZIWB 3NFRA 1JR4A 5BMOA 4R1MA 3JAWB 1P6XA 5EJ7A 4BP1A 1NPTO 3QWHA 1RE0A 3I34X 1QHFA 3UICA 4E15A 1Y9EA 2I2DA 3R7WA 4ZHQB 2ODAA 1VI5A 1ZH2A 1I2CA 1RQ2A 1V8BA 3DFKA 4YDHB 2GM3A 3P2MA 5DT2A 2J3LA 4RM3A 1SHLA 1ULTA 5JCPA 1XXLA 2H1HA 3BWXA 3ZWNA 2N1MA 1N3LA 2EP8A 4PZDA 3CH4B 1S3SA 1A9YA 1CTQA 2WFLA 3HUEA 3IAUA 3LHKA 4RBNA 5CH8A 2OOSA 3SMVA 5KQRA 4GKVA 1FMTA 4EY6A 3E9CA 2PX6A 4K6OA 4G86A 3ZY6A 4H35A 2IYRA 6CHYA 4FBLA 4E3ZA 4B8YA 3HUDA 1JNXX 1HO3A 4MINA 3VDNB 4ZZ1A 1PIWA 5JI2E 1G5PA 1YR2A 4JX9A 4DUZB 2XITA 1UBEA 3Q12A 2FWMX 1TM3E 2Y1WA 3YASA 1L4HA 1RWNA 3OJEA 1U3VA 2JD0A 1UKZA 4MWBA 4N49A 1A82A 4C0WA 2ENUA 3CG0A 3N76A 5L95A 3ESXA 4FWBA 2IYYA 1UIRA 2WW8A 1NRJB 4MITA 3LX8A 2D5LA 3IR5A 2YICA 3T5BA 3L0CA 5IFLA 4LJ8A 2H59A 4QWMA 2RAPA 3EDOA 3ZKWB 1KP2A 1SIBE 4BFVA 2P1RA 5A6SB 3ER9A 5A4FS 2QBYB 1QGUA 2LKCA 3GJ7A 4GECA 2OXTA 4PY2A 2RD2A 1GJRA 3K0FB 3E4CA 1OVMA 2ZRGA 2HIGA 3MIZA 2J9RA 1XPUA 2ACKA 3PFHA 3B7WA 3KOUA 4WN9A 4FUQA 4YHBA 1BN6A 2ZRBA 3HCBA 1G8YA 3NS7A 2NUTA 2IX3A 1AUPA 3A26A 4PN7A 2JFPA 2RKOA 4JXKA 3DOOA 4N6NA 3VHQA 3H1AA 5J23A 3VJLA 4WSOA 5C8XA 5AI9A 3HDVA 2YIVX 3BWBA 3KKOA 1TKAA 1VGVA 3NPAA 4PC1A 3NNNA 2EFDB 1M5UA 5BNWA 4JEHA 3WDLA 4AMZA 3PGMA 4CCAA 5IZCA 5EUCA 3HJTA 2YRWA 4NY1A 6GPBA 4CKBA 1CQPA 3QYAA 3GLGE 3PUZA 3A4YA 3FMVA 3KU1A 1V39A 2C2YA 4YQFA 4MJ7A 1NW7A 1XMPA 2HBYA 2ZWPA 3A1VA 3QK7A 2P9EA 4GQIA 4CTJA 5JRJA 5LD2C 5G3YA 1J5PA 2YMPA 4B7ZA 4UC0A 4HDKB 5CB4A 3FUVA 3B1ZA 3RIEA 1M34E 4L0QA 3WAJA 5CNKA 2CL0X 4J0JA 4LXQA 1A0OA 1X1DA 1AV7A 2FPGA 2W37A 3NKLA 3FAKA 1BWPA 3T0FA 2AKEA 1KNXA 3DAPA 3D1LA 3B52X 4WACA 4WPGA 4EUNA 1KFCB 1V9LA 1WB6A 3BC1A 2CKMA 4UU0A 2V3CC 4HZUB 1HF3A 2OBBA 1ZX1A 4CIDA 1GNLA 1XLTC 5KREA 2IDMA 2X1HA 2R6FA 3IODA 3K5IA 2IY8A 2XWPA 2XUOA 4N48A 4M1KA 3ZCQA 3IUSA 3U13A 3VU0A 3UPTA 3WLRA 4Z86A 1Y5IA 4RJJA 4HFRA 4JOQA 4OI1A 3UTDA 1B73A 4IDFA 1DG3A 4B4WA 2DP4E 3K8YA 1NZDA 2JLVA 1O6ZA 1G8GA 3GFFA 1FU8A 2BONA 4NCIA 3B5IA 4M1ZA 4OQFA 4LSGA 4K87A 4NBTA 2B0CA 4LHWA 2YYYA 2C84A 4YRDA 1TZKA 2C3OA 4Q4CA 2CHVA 1YONA 3BXPA 3CUEF 1EFVA 4HO1X 4NJEB 4OYRA 1WUHS 3WFZA 4CMIA 4DJFC 4C6RA 1RE1A 3QQ5A 3KYJB 1ECJA 3KEQA 4UD2A 3BCHA 4A9AA 3U3JA 1WDWB 2VP9A 5I3ZA 5K8JB 1U80A 2HBQA 3OE7A 1LVUA 5TXGA 2VT3A 2J41A 5KJEA 4PX5A 2BFFA 3ZV6A 1Z5OA 3GPLA 1C9YA 2YOGA 3HWWA 1TYAE 3BWMA 4RU1A 3WJAA 2ZJOA 4CDNA 1CUDA 4B44A 3KR1A 3HKBB 5A2QA 4ER0A 2VOJA 1DEOA 1EX1A 1LW6E 3H8SA 4PQRA 5DN6A 4BGUA 2AW3A 4GX5A 3FZEA 2H4HA 2HJRA 1J1UA 3EUFA 1I24A 1RXIA 1BDJA 3BN3A 3LO8A 1BQ3A 4J2TA 2REQA 4RFVA 4X7RA 4RH3A 1IIBA 5A6VA 2PKXA 4BMDA 2K4MA 3H1EA 1B8OA 3AUAA 4HK4A 2IODA 4P86A 3SSOA 4QJ3A 4YRZA 5IANA 4NOLA 5E4JA 2PAFA 4KR2A 4N18A 4S04A 4EUSA 4PANA 3L8GA 4RQBA 2IZ0A 5IJ9B 1EZ1A 1E2EA 1RMYA 3ADKA 4LWOA 1U2ZA 3RJMA 2HA4A 4BMSA 2C07A 4FILA 1MDBA 2BFMA 2HWKA 2V58A 1OX4B 1T4DA 2G0NA 1USUA 2NZUG 4FS8A 3DEZA 3ER6A 3V3KA 3OQ6A 4I0WB 1JDBB 5EQJB 1XV5A 2GCOA 4G81A 2OCDA 5CYOA 2HL6A 3G9ZA 3TAUA 4AKIA 3CUTA 1IWPB 4O0LA 1W36B 4TXJA 4DABA 2Z6UA 4O0MA 4Y9DA 2D54A 1FQWA 1T3TA 3JQ7A 1KDRA 5A4MS 3PEEA 3TSOA 2UYGA 2PXXA 4GG1A 3EGDA 4ZAVA 2EF1A 3HB4X 3IIMA 4MUMA 2MSLA 4YP9A 4MYRA 3M1IA 3IQZA 1SVKA 3PZBA 2QYOA 4YCAA 2Q45A 2W8ZA 5E9QA 1Z7BA 1B0UA 2L2QA 2Y1KA 2JIBA 5GAJA 4DWOA 1YL7A 5KAPA 4D3ZA 1I4DD 3V1KA 3AYXB 3B3JA 4DR1B 1F8YA 1DAEA 3SSAA 1Q7CA 3OOJA 5EVJA 1YRHA 4IIJF 1A7KA 1Q2XA 2ZJ8A 3ILHA 3G9QA 3EGEA 1N5RA 1UZNA 4H0FA 5THXA 3E1SA 4DCNA 3ZCTA 2FCRA 2ZSAA 1UEJA 1U1EA 2A59A 1G2IA 4Q3LA 4KE6A 1O8BA 5FDFA 2GYUA 1AG9A 2JFBA 4Y67A 3NP7A 4RJ2A 1JAYA 3V33A 3RB8A 3PUVA 5TARA 4KWCA 1ZQ9A 2A33A 2HT6A 3H4IA 3MS2A 2FE1A 5BQ5A 1L8XA 1NQWA 1VRCA 2DFDA 2X9NA 4ALMA 2GN2A 2O2DA 3ESDA 1IN1A 1SVIA 5CJJA 3C6MA 1CY4A 1M10A 5DTEA 1YHYA 3SKXA 2DPLA 2NW6A 1YI1A 1RRPA 3H2ZA 3OZEA 4OSOA 4NCXA 3QF4B 4E21A 5KMGA 2OGTA 3TSYA 1KEKA 4NCBA 1YCHA 3HJBA 4DC1A 1SC9A 2DY1A 2ZG6A 3UT5A 4Q4LA 3DMRA 1KDTA 3LQFA 4GMKA 3AF5A 1B14A 5AMXA 1MOSA 2ZIXB 4U7JA 2IH2A 4RTMA 5DI9A 4JI1B 4D8VA 2QTCA 4EB8A 1KU0A 2CE7A 3DO5A 5HXAA 4QFCA 4FGKA 3MWLA 1T8RA 4DCJA 1SELA 2BEVA 1XRQA 3LYAA 2AYZA 1JV2B 1TVKB 3HKCB 4J0EA 4QREA 4Y2YA 3RIHA 2XYRA 4B7AA 4IGFA 3BHNA 5U9CA 1L8AA 3VR6A 2BDEA 5FPQA 4B47A 2JI6A 4A26A 3E5MA 4WXYB 2KLBA 5D00A 1RKXA 2RK3A 2XDAA 2SHKA 3FYSA 4JSYA 3UF0A 2V7QD 4B84A 5JH7B 2F1KA 4Q3KA 5G4KA 3B3QA 2IYEA 1TO6A 2RH4A 2ZT7A 4OXKA 3MSXA 4B7CA 3WTBA 1AIPA 2J0UB 1K8RA 5KHOC 4OQNA 1WA5A 4RABA 1SKUA 3A3OA 4L1KA 4LDAA 1XR3A 4NBLA 1S2NA 1RPTA 2GDZA 1DIOB 4BC1A 5JPIA 4B2LA 1KRWA 2DWCA 4UEQA 3H4TA 1NU6A 1XD2B 1AVTA 1ECFA 4X6YA 1SXGA 4CQLA 5HX7A 2HOQA 2EIXA 1FRFS 4CLOB 1PV4A 10MHA 3RS7A 4CGYA 1XNQB 5JCZA 3EG5A 5FQOA 2BP7B 2ODBA 3JD1A 5KOJA 1BYUA 1QBKC 3UEOA 3HCPA 4S1PA 1G1AA 4R2IA 1CW2B 4S24A 1DJLA 5BVHB 4Z9FA 1V6AA 2PGNA 3HXOA 3AUTA 4HAYA 3F46A 3BZUA 1BCSA 4AURA 2KB0A 1DEAA 4TKVA 3FYHA 5H16A 5TPZA 2OY0A 2P5SA 2Y1GA 1NT2A 3MCZA 1MABB 4QULA 4EYGA 1YZQA 4OHMA 3ZGNA 5JMOA 3M81A 2PIAA 4PYRA 1KI2A 2QN7A 1QH1B 1PNOA 1L5HB 3EUWA 3BMQA 1CYEA 2V6BA 3VQTA 1YUNA 2X8BA 1X8KA 1Z2OX 1PO7A 2GAOA 4LXXA 1Z36A 1AS0A 3O26A 3CZMA 4C0KA 4DY6A 1USIA 1HT0A 1SUCA 3N6RA 1BHJA 1RTKA 2V4UA 3IV7A 1XKLA 2HQRA 4HNQA 4AFNA 3ZBUA 1NR1A 1ZD1A 4F6LA 1TJ4A 2GLXA 3VVCA 5I7AA 2CJWB 2D59A 1V26A 1QG4A 5FL3A 2R9VA 3MFQA 4H08A 1D03A 1KZ7B 4RNCA 3DE1X 3ZTTA 2CT8A 1RAHA 3R3UA 4ZDJA 2ISSD 4CIYA 1MA0A 1YQGA 3ZC3A 3AKYA 3MLBA 3FVWA 3ZKAA 2GBIA 4DN6A 2FG5A 1NG1A 2PUHA 3IQDB 1Y82A 3BKWA 4NZMA 2ZSHA 4HH3C 4DBLC 4QQNA 2FH5B 4EO4A 1W9MA 4GM0A 1YKGA 3O91A 3QFFA 2OB2A 4OQQA 4JXJA 3O38A 1NWCA 4WBNB 5JYEA 4CBVA 1MQAA 4AKHA 4AUKA 1FMCA 3WLMA 3E27A 2ZE8A 2ZZKA 1YACA 8LDHA 5H3HA 2CD7A 3X2FA 3INYA 3K1ZA 2OP1A 1M2GA 4KX3A 2EZ8A 1A5TA 4J6FA 1O4WA 5CFNA 2D3TA 1MBZA 4TLDA 1Z6PA 1PD1A 1T6NA 4S35A 4BBJA 1VG0B 4F5EA 1APBA 1E3WA 3JWPA 3KB1A 4LDQA 4MDYA 2ZBUA 1QVRA 3G82C 3RIMA 4EHNA 1J1IA 3GDWA 3W8EA 2BBOA 2WB2A 5DFAA 2I3BA 5C32A 2PUDA 3G59A 1LK7A 4MV9A 2Y3IA 5A71A 1QCYA 1YCDA 3CLTC 3RU3A 1FOEB 1T0IA 2OO7A 4FFRA 4UTZA 2G4CA 4OHRA 5HS6A 1FSZA 1P7ZA 4IHJB 1K3FA 1GZ4A 1IOWA 1Z39A 2I3ZA 1IM5A 1LRLA 4LF4B 3I9NA 1L4NA 4DQXA 3ACDA 2REBA 5LQMA 5JZ9A 2GXUA 1PR0A 3BAFA 1IN7A 2Q5LA 1AS2A 2AFIA 5ALMA 4BQOA 4FFPA 3QMWA 3CCCA 3EDRA 4D45A 1P39A 4DA4A 3WHIA 2FETA 2RCYA 1U0SY 5LQRA 5HUJA 3L49A 3EXFB 1KAMA 2HAEA 3C98A 4OBBA 3K6SA 1Z26A 1P3JA 4XGNA 4GFDA 4H7FA 2EFHB 3GGDA 1PWYE 2V7EA 2C5FA 3RVRA 4XGKA 2JLBA 4UMVA 4X1KB 4CQMA 3S2IA 1AZSC 3KKNA 3PPWA 3RK4A 1FRQA 4Y30A 3DUWA 4FDAA 4MGIR 4MR9A 4TKLA 2D1FA 4KFSA 2P1ZA 2P5YA 1JSLA 2RHBA 3DJFA 3CMMA 3IUMA 2OENG 5D6NA 4NCAA 2MJLA 2TECE 4ATNA 5HJ7A 4QYXA 5BQFA 2DQ4A 4F8EA 4X8OA 3VYUB 4CMEA 4L51A 4MUHA 1FDUA 1I5RA 2R2AA 1RYYA 3TZHA 1L4KA 1RYMA 1IK4A 3AL2A 5E2IA 2ZUCA 1RM5A 2OV2A 4L72A 2JIMA 4QHSA 4WZBB 4NPAA 2VZLA 4MV8A 5F9HA 2V3WA 5K6RA 1TPYA 2FU5C 1YE5A 2HO5A 2VPZA 2VZ9A 4KQ1A 3OICA 3PQ7A 4FI3F 1I9GA 3NBQA 2HN9A 1SUEA 2QW8A 3P2OA 3AB8A 4JZYA 4M54A 1IZYA 1H2BA 4WZAE 1M54A 2P4EA 5EZYA 2XQIA 4J1TA 3DM9B 3FPCA 2UYOA 2J4DA 2PWBA 1N1DA 3QW4B 2IGBA 3KZVA 3RFCA 4YXFA 5FLXA 5HFAA 3HK2A 4ZCIA 2EKPA 2CXHA 4HTFB 8GPBA 3NIDB 4LK3A 5SYMA 3AVUA 5HCNA 1BQEA 3MMSA 2B4AA 2WWGA 3T06B 1GUYA 3ZJ4A 4YCSA 4IDEA 5IBRA 4AULA 5E1MA 2E21A 3SYNA 3DMGA 3QE0A 3BTSA 4JWTA 4P7GA 1SCUB 1SU8A 5FHQA 3PGXA 1VSBA 1VPTA 3TI9A 3ZVLA 3GA7A 4G56A 3G0DA 1E8MA 4F3CA 3T3EA 4NIMA 1Y3BE 4P6VF 3JR7A 2IBMA 1DFHA 2GK4A 2M2IA 3HXKA 2I34A 4JJKA 3BSWA 3T5MA 4W99A 4FN4A 3V4FA 4DSNA 2CCKA 2HRZA 3K70B 3FPAA 2JKYA 4BMNA 1U9ZA 3EODA 4CKCA 4DDMA 1D6JA 1PJ8A 3EVGA 3OIYA 3S2SA 4IFBA 3RWBA 4AJOA 3L9XA 3AUJB 3DM5A 1E0JA 1NQAO 3CKKA 4ZPXA 1Z5UA 4KPFC 5CA0B 2WUVA 1EGQA 4L4ZA 4B76A 2QG4A 2H48A 2V59A 3FCAA 1IPEA 3JQRA 1OXMA 2JFXA 3F96A 4L4YA 6ADHA 3U80A 2UVPB 5DO9A 3JRXA 2YC4C 4IYRA 1IMOA 1WR8A 3BG5A 3R3HA 5DULA 2BSXA 1QPGA 1UADA 1DWOA 3U7IA 3ZQ6A 4C5AA 5IFKA 4RHEA 3TIXB 3MWEA 2RC6A 4PAMA 4LXIA 5LSAA 4B7UA 3GFBA 3U26A 3FF1A 4KAFA 2R85A 1I3LA 3OX1A 2MMGA 1YZ3A 1D0VA 1TQHA 2H7CA 3N75A 1VB5A 4RZ3A 2Q8NA 2D13A 3TS1A 4G0YA 4P83A 2OCKA 5BN3B 3VNUA 1QZZA 3HJRA 4PFSA 4F56A 4NK4A 3KSMA 4JLAA 2WJWA 3RC3A 1N2HA 1F06A 3FMIA 4JNKA 4QTTB 2FDCA 2YH2A 5DASA 1HFWA 5CEEA 4BNWA 2J0QA 2VRWA 4GPD1 4LJLA 4PBSA 4OF4A 3F0TA 3IP3A 5E9AA 1HZZC 1QJ4A 4BHTA 4R84A 3V32A 4EB0A 1DTWB 5G0UA 4AF7A 2OBFA 2VF5X 4QGAA 3V34A 1P1HA 3VHRA 3KJGA 5JCOC 1IXSB 4R01A 3V55A 1VKNA 3CNQS 1ZMOA 4G89A 2ZCJA 1DE0A 3GUCA 3BRQA 4M60A 2WWVD 3RAPR 4YP1A 2VHZA 3SAJA 4LISA 2FR0A 3NDBB 3HACA 1KI6B 2JGAA 1WX1A 3NYWA 1P72A 1HE4A 3CX6A 3REQA 3R8XA 4EF5A 1QB7A 3H8JA 1MX5A 1ZUHA 1ES9A 1HDGO 5F4BA 2HNKA 5TMEA 2WU1A 4RA6A 1S0UA 2GCEA 5I5GA 1DC3A 1XRMA 2JEZA 4ARVA 1ANKA 1XA3A 2WU3A 5M2QA 4OH7A 3JAMA 2UU9B 2RJOA 5H02A 3AQIA 2BGKA 3TOVA 3DVQX 4BO2A 4CM6A 1D2GA 4WUTA 3DOEA 3MGBA 3N53A 2WYHA 4JA2A 4GSYA 4RHYA 4YT8A 3JZAA 1L5SA 2FSVA 2F3SA 1UDXA 1HBJA 1NI4B 3IOYA 2KE5A 3LY7A 4QUIA 5D2CA 5FP0A 4RTOA 2FPXA 1BHO1 2HF2A 4GI2A 3I5MA 4QOHA 2FPIA 2O2CA 3PC8C 3UJAA 1XT6A 2AKYA 2DVMA 2HEGA 1QE3A 1FUKA 1DTEA 1B0AA 1ZQ1A 2YV4A 2RGEA 3CLSD 1HI9A 1GVHA 3GRCA 4GWGA 3SF8B 3WQQA 4WK6A 1Q20A 1DKMA 1FXSA 2E6KA 2RGRA 3IJEB 1RP1A 3LGSA 5GVRA 4JT9A 4NBKA 1BYIA 3DZIA 2YV3A 4ER6A 1R0WA 2ZJBA 3I6ZA 5JS6A 2XQKA 3QNMA 4IHJF 5CEFA 2GK3A 4ZYVA 3FCOA 1L6RA 5CXQA 1RQPA 2IIQA 1OLSB 1D2HA 2FUNB 2W6ID 3NEPX 1HK7A 4HATA 4ZP1A 4BKQA 3VOSA 1T29A 4OI4A 3DDWA 4YMIA 2C5BA 3HA5A 4ZVPA 4ACBA 5LWHA 6ABPA 3K0CC 3QVTA 2XQGA 3ZYCA 4OJMX 1GPAA 4W82A 3M6UA 1KDZA 1GV1A 4MQ5A 3IP5A 5FBHA 3ZWBA 5IJZA 1Z4PX 5K09A 1YB4A 3SDZA 3DNPA 2FVYA 5B12A 1GGJA 3PNVA 1QKJA 1TNDA 1Z7EA 4XI9A 1NJ8A 3WRYA 3JQEA 5EMJA 4C0BA 4PLFA 1T4CB 4GBMA 4YGXB 1HMYA 4G1FA 1KQ3A 2YOHA 1NGSA 3AIOA 3EYWA 4IGEA 4OJYA 5IC5A 4YAOA 1EFLA 1R50A 1ZMTA 3ZYZA 4DLRA 4D9HA 3BFKA 4ND8A 1W9HA 2C8KA 4AZ0B 3DHEA 2D2EA 2XBLA 1M3SA 3OCYA 1A76A 1N8NA 3L7LA 4JQCA 4V2UA 4NXNB 4C4PA 1LK5A 3ANYB 5D5QA 4CKWB 2XY4A 3UQYS 1PR9A 2H0QA 3F73A 2IVFA 3ZXYA 3WAGA 4W9RA 2ZRQA 2ZREA 2WNSA 4Z51A 2A78A 4S0ZA 2BEWB 4RPHA 4XA8A 5K0CA 3C70A 1BRMA 2BD0A 2PMCA 4H3VA 3D8HA 2P2NA 1JQAA 2POQX 4DCOA 4MIEA 1Q77A 2QTLA 3B2EA 3HCCA 2G83A 3L41A 1PFYA 4JJEA 4KHZA 4LN1A 5DU2A 5GP1A 1FP4B 3RSLA 1CK4A 3PUXA 3BEOA 3RRMA 1H6AA 1RLTA 2NOAA 2QLFA 4LXTA 1QHNA 3RUHA 4F1WA 2ZUSA 2RHWA 3NNSA 1SVUA 5A05A 2NM0A 1UJ2A 5CYFA 4ZT5A 3ZWYA 4BCBA 3M49A 3SM9A 1CUUA 2P1DA 1NQOA 3ANMA 2HQBA 2X3FA 5C5CA 3WQHA 3CV3A 1JWBB 1GPH1 5JMPA 1IG3A 4BNDB 1TPZA 3CSSA 3NXSA 1CVLA 3OJCA 4EAQA 2PKQP 2VOEA 1N33B 2JHGA 4RHFA 1KGDA 1E3SA 4I08A 1BXRA 3RFUA 2JJ1A 1G59A 1V1JA 4QNNA 4UDYX 5EJAA 1Y81A 2CUZA 1PQPA 4II2A 4MB6A 3RF6A 3SIRA 2RAFA 3IA7A 4MQMA 2OE2A 5HZKA 1G6OA 1NVEA 3DCJA 1SUAA 2WWIA 2WVAA 4DT1A 4E09A 1Y98A 1LRJA 2GA9A 3QSGA 1RAFA 4JB3A 4ENTA 3U4QA 1E9BA 4KQFA 3WOVA 5E1OA 3NC1C 4CYMA 2R5WA 2IXTA 3RCBA 1HSOA 1T0HB 1G5RA 7GPBA 4QQFA 3E03A 1ZVJA 3I9KA 1A4IA 2G25A 3DT6A 1J8DA 4IVQA 1Z0JA 5DEIA 5D85A 1ECGA 1SD1A 1VIMA 1IZ7A 1Y1QA 3Q3CA 4AYWA 3A27A 1AMUA 5CFLA 1RI3A 5K0BA 2IH5A 1P2BA 1QHGA 4RMHA 2JFVA 3PWZA 4MUFA 2ZR9A 1XD9A 3TPCA 3X0DA 1RR6A 3VKHA 2AYXA 3FGOA 2H2AA 3DAHA 1E79D 4BAZA 3FYCA 3Q11A 4QOGA 3UW1A 4ENRA 5K3FA 3WNVA 5ITVA 4TTIA 3ZS9A 2H8GA 2X8AA 4B9AA 3VDXA 4DLNA 1LI7A 3WK8A 5SY4A 3ACCA 4ZZ2A 1JLLA 3QLUC 4ZO6A 5IHXA 1WD5A 1WB9A 3A2KA 4ZI7B 3NHWA 1ECBA 5EXSA 3LO5A 4NBVA 1ESNA 1ESCA 4QX6A 2W2OA 3QVJA 3S3TA 4EW3A 5AXBA 4TM7A 3R5XA 2C8LA 3S5JA 3VSCA 3WIBA 2QV7A 3NV9A 1V3TA 1H8ED 1UFRA 4KB5A 5D84A 2W2LA 3WMXA 2RHMA 1AHHA 1I7DA 5EHXA 5AHKA 4DMKA 3ADBA 4BXOB 2JLAA 4M76B 1SFRA 4MHOA 4EHDA 1ZHFA 1Z8DA 4Y18A 1P7WA 1DOHA 2G5CA 5EMMA 4BKRA 2QW1A 1WZNA 3CH5A 4I7EA 1K5PA 1C9EA 2XCOA 3I9JA 2YWFA 4EB6B 3BM5A 2HXYA 3M70A 4OKIA 3NT4A 1YS9A 3VC2A 4O2BB 1S8AA 5GMOA 3VMFA 4G4SP 1F6WA 1Z4OA 2BWJA 2H2FA 2YMMA 1MQ8B 1GZDA 2HNAA 3ETGA 3U40A 4YRMA 3SR4A 1C0LA 2YW9A 1D4OA 1HFKA 1NKTA 3C3EA 3RRBA 2N3ZA 2WF9A 3ASZA 4UBMA 1O0BA 2ZBGA 4Y1EA 1N36B 1DDGA 3JU3A 3CVOA 3UMVA 3R6WA 1SURA 2ACVA 4J16A 5DX8A 4QPNA 1F6BA 1Z4QA 3GXOA 5D6OA 3A1SA 3LC7O 3D0QA 3GA0A 3JD4A 3N28A 1CY7A 3EISA 4G8DA 4IJMA 2B99A 4ZMBA 5DNUA 3IALA 2XE6A 1U8TA 3DHVA 5BSRA 1VECA 3D8UA 4Z3KA 3P2JA 4B82A 5E1BA 1Y6FA 1MTZA 4AD8A 1DJPA 3UXEA 4H7KA 4EHBA 2ECPA 2GRUA 3E8MA 4LF8B 4MR7B 4JV5B 5D3ZA 4H3SA 3A4IA 3EDCA 3DOHA 4KGVA 3CFYA 5LBUA 5FJIA 2HGSA 3OA0A 5HG0A 4NV3A 5DRYA 4V1CB 4F71A 4W5TA 3VH1A 2ZBVA 1CQJB 1PT6A 3B53X 2EWVA 3JTMA 1IE3A 3BMNA 1U0FA 4YRIA 5AH0A 1QHEA 3QVXA 2E48A 1RADA 5DI3A 2FF7A 4FD2A 1HTBA 4U0JA 4ZCPA 1TJ5A 2VJMA 4F4FA 1YR7A 5FNVF 4EEXA 1SQFA 2GJSA 3G3EA 5EIXA 3LF1A 2GD2A 2QM7A 1CE8A 3AEUB 3MT9A 3OE7D 1IXKA 3TQSA 3UMRA 4Y2XA 1BDMA 3U6BA 4RW0A 5K51A 2LE0A 4HFMA 4FZ5A 4LMAA 3SZUA 3DP9A 1PJ2A 3UA3A 1X3LA 2JI8A 3R5SA 1GNPA 4LRUA 1CRQA 1IXZA 3E5HA 2W2XA 3LQ4A 3STYA 2X5KO 3TIIA 3T1VA 3K9LA 4GGOA 3UAGA 1SVSA 4PG7A 2VHWA 2UKDA 1JTFA 2O7VA 2REXB 2XTZA 1K68A 1UR5A 1JAHA 2A5GA 4UBOA 4PS0A 1A8IA 2C31A 4AJNA 5HUQA 3KVRA 5AUOB 5T7BA 5I7EA 4WCFB 3TJMA 1J00A 3EA0A 3BBPA 3C7DB 1DNPA 4HNGA 4AAYA 5BMVF 4IFIA 3GMIA 4JBWA 1LUAA 4MA4A 5KS2A 3ZE2B 3DL4A 5BP7A 4UHCA 2QSJA 3AT1A 4UFOA 2DU8A 1OWPA 4EI9A 3EVBA 2VF4X 1TMKA 3GJQA 2OXCA 4C1NA 1J25A 2JGDA 3TTTA 2J45A 3UBTA 1FRVA 3QTLA 2HDOA 3KKPA 4OJKA 4QXOA 3SYKA 2WABA 4PIPA 1U3WA 3HBAA 4ZC1A 3ZE7A 1EFHA 3HR4A 3NM5A 3CW2A 3E9ZA 5JJCA 4PX9A 4FZRA 4IG9A 4AZTA 2V7XA 4C06A 5AW3A 5DGCA 2FN9A 1A77A 1Z18A 1N3YA 4YA6A 3T7RA 2N75A 3FYDA 4ZOBA 2IUTA 2FUCA 1P3DA 1XMIA 2X77A 1U0TA 2J6IA 2Y77A 2BGRA 1GPDG 1ZGAA 4UQLA 2Y27A 3G9UA 4UAVA 2PZFA 5BSKA 4RV4A 3DL0A 3L1UA 1GNQA 4FGLA 3NBFA 2RHLA 4G9GA 4NNOA 3T95A 3HB7A 5JFOA 2AC4A 5F21A 2XRYA 3PXEA 4ESHA 3HG7A 1Z5NA 2R6DA 4BZXA 1BCRB 1XWFA 1ZH4A 5CFRA 3OJFA 3E22A 4FR5A 4WOCA 5IVIA 1FRNA 1IHUA 3O3MB 3TIFA 5C1PA 3TLJA 2C5GA 1Q14A 2CDNA 2GSWA 1GADO 1Z6AA 3PEFA 2X9QA 4AMUA 1CZOA 4DMRA 3OP4A 1ISGA 2C77A 2OKGA 3FVTA 1ARZA 1XPJA 4J7AA 3UUWA 3VH2A 4Q9NA 2C57A 3R41A 4FSDA 4DMGA 1DGQA 2O2HA 4NS4A 2X0DA 4BNGA 2HSJA 4CIAA 3TQOA 1YA8A 4C5CA 2OLKA 4RULA 3OZFA 1B42A 5MGNA 4YRCA 1HDEA 2ZYTX 4DLZA 1L8LA 1ZHHA 2XNDA 3LHDA 3QYJA 1YZNA 1K1EA 1R0ZA 1IH8A 2H65A 4Y6OA 2VNKA 1QTRA 3T61A 4EMTA 3NORA 2DCUA 1VL0A 3RYHA 4KMRA 2CNWD 1I10A 1P2GA 4MJLA 4MVJP 1NX9A 4PNZA 3VKWA 4I1PA 4RACA 2VJQA 3P32A 1LLCA 4JYPA 1IN6A 4MS1B 4M0MA 1MO6A 4MVJG 1L4BA 3EBOA 5ELMA 1TKBA 1I6KA 2C99A 4XR9A 3JASA 1N5IA 3QEMA 3B1XA 3QNWA 1QK4A 1ORTA 1F4VA 2VJBA 2Z98A 4RD6A 6LDHA 3WL5A 2CKDA 2ZJ5A 4CJXA 4OREX 3DAFA 5JJ5A 4DKXA 2FSHA 5DTIA 5HGXA 1Q74A 4QYIB 3VR6D 3IIEA 1I36A 4E94A 2HU2A 1SOUA 1GUAA 3QV2A 3L0ZA 1W1WA 4IOJA 1RLOA 5B1SA 3GAAA 2JLZA 1P44A 2UZ0A 1PFQA 2B98A 2GERA 2WSBA 2INGX 3WGYA 4N6OA 4ON9A 1DS6A 3Q5EA 3TLEA 1RHJA 1CUAA 1E7YA 2FVXA 4BZQA 1Y6QA 1EBUA 2JDIA 2WJHA 2PKWA 4DOMA 2PT9A 4G84A 3KWFA 3CU5A 4P82A 2XW6A 1PT7A 1VCOA 5HE9A 2G82A 4URUR 1QDEA 5FUWA 1CUJA 1H65A 5L3ZA 4N5LA 3NBMA 4ZI7F 4X20A 3GJTA 2FXIA 1GSOA 3UXHA 3F90A 2DE0X 2JC3A 2P69A 2XNCA 3K0HA 4QOSA 3EEIA 3T99A 4PG4A 1S1CA 4QU8A 4BQIA 5HZMA 3SY8A 1FNMA 1QZ3A 3FJ1A 3IIJA 2C2XA 5FBQB 5GGXA 4AB1A 4ESVA 4JP8A 3A05A 2DLDA 5LLTA 4OQPA 1GPJA 1GGFA 1LNQA 3AUSA 3P2EA 3QXHA 5BWBA 3TRKA 1OPRA 1H5QA 3NT5A 4UUOA 1KJIA 5TPZD 1V1MA 2FQWA 3NTOA 1OJLA 3T3IA 5LU9A 2WWHA 4LNAA 3ZWVA 2HV9A 3HU5A 2CVPA 2ZRAA 4ZGBA 4OHCA 4JXZA 1I1OA 1WIWA 2X9GA 5EJMA 4L9SA 3DC2A 4D4LA 5FHRA 5CURA 1L5ZA 1GG8A 3AUFA 4OUDA 5JZSA 4Q02A 3BGIA 2JCSA 1EP3B 3DH0A 1JDVA 4N4AA 4XARA 5NLLA 3L1HA 3V7FA 4DUPA 2GH1A 4IIBA 4ZOQI 2D6FA 3TR6A 4GYJA 4F5ZA 1T1GA 2KBEA 1UFVA 4YLEA 1QQAA 2UDPA 5JY6A 2XR1A 4Z9XA 4KFRA 1FDIA 3K0EA 2WSMA 3A3PA 4WZAA 4RK1A 2Q9AA 3QU7A 3FIUA 4MWGA 4CMJA 4JR0A 1OT5A 2DPMA 1FMJA 3L3BA 4PGFA 2P2YA 5COQA 4BFZA 1Z2PX 4DVGA 1D7OA 3U44A 2MINB 1T43A 3Q7TA 5CEJA 1WF6A 1XEWX 3IULA 2QY9A 2R8YA 5ER9A 3F6CA 2ACWA 4KXLA 3JSXA 4JUFA 1NBWB 3W6OA 3ZE1B 3CX7A 1PJBA 3KB2A 4YJHA 2H51A 4HQNA 4MW1A 5AVWA 2Q62A 4UNQA 3T4PA 3HBLA 3PSHA 1IJBA 1TZMA 4GC9A 2W9XA 3QYFA 4R2LA 2WIAA 4AUNA 1E1LA 1Y5MA 3LW7A 3VR6H 3NHSA 2P62A 3FUTA 5CX4A 4M53A 4BO6A 2OHOA 3FNHA 2IS4A 1B6SA 1BX3A 3MSCA 5FKJA 1JH9A 1ZJ4A 4FOLA 4KODA 1RP7A 1XJCA 2EBFX 3BQ9A 2R1TB 3OESA 1VC2A 5E1DA 3AEXA 1FE8A 3V8NA 9MHTA 5F76A 4JHLA 4NBWA 3CTMA 1R3DA 2NWQA 2L82A 4RKQA 2WWRA 3EEFA 1X7XA 3MF4A 4FLFA 1M6VB 1UPBA 1LWNA 4FJ2A 4J0KA 4QUJA 5DGDA 2VJPA 3MT7A 2NSYA 4D3XA 1XZQA 3H1PA 2SKDA 3O4HA 2EZ4A 4TMYA 4C4SA 1SJ9A 3PGLA 4IQ4A 4CIXA 4YRSA 4ERNA 5T3UA 3R5TA 1EDDA 1PR6A 4AJKA 2NU6B 2JCVA 1J97A 4BWVA 1ENZA 3GCXA 3NCTA 2C9ZA 3EHDA 1UXJA 4FKBA 1EUDA 1R0SA 4LRQA 1T2AA 5I9NA 2GAIA 1DXQA 3W78A 1RWMA 3F8WA 2AN5A 5I7OA 2COKA 4FK8A 4O8ZA 4TQGA 1KRXA 1RZVA 4IZ6A 1F0PA 1BS2A 1QHHA 1SC6A 4B6EA 2PSFA 2ERYA 3HDYA 4LMPA 1PWXA 4UATA 4WBXC 2X2FA 3D3NA 1MVLA 2A86A 1X7WB 1OYOA 3O75A 1J6UA 2RFLA 2HSZA 1KZYC 1RAAA 2F48A 3NYRA 2V3VA 4O2LA 3O8RA 4XPIA 1WJGA 5DMHA 4U00A 1A7UA 5M04A 1Z7GA 2JJYA 4OQLA 4KVZA 3KKEA 1PJ3A 3UJPA 3HNOA 3Q7RA 4KE8A 3W6NA 1JQBA 4R8KA 3GX1A 2QLMA 5LA6F 3O95A 4A2PA 3BSYA 3E61A 4NYJQ 1VJCA 3AHEA 3IQIX 3ODGA 4XIIA 5ECYA 1R4NB 4TV9B 5AKHA 2W71A 1ISRA 1KC1A 1CP2A 3G8AA 4RD4A 4QSHA 1SXJE 2PPVA 1D1SA 2EBHX 1X6VA 4RPIA 2GD0A 5AM1A 5TT1A 1I2DA 3UHFA 4EGCB 1D4ZA 4YMVA 2A92A 5HK8A 2VSYA 5LVAA 1D2NA 2R3SA 1WZCA 1KYTA 2H0AA 4XJTA 3QPVA 5IXSA 3TLXA 1AUVA 3QLVC 3ZDAA 2WFZA 3MZ0A 5B6JA 5I7FA 1JSCA 1L1QA 1UFOA 1SC3A 2ONYA 4MUEA 1YUMA 3G2MA 3WYFA 4ZV4A 2EBUA 1N5OX 1QIMA 2Q2OA 3KPWA 3L4BA 2CFCA 2IZ7A 9ATCA 1S7CA 2QF7A 1H2ZA 4WN3A 1RVV1 3VNVA 4D3FA 1HYHA 4CV1A 2QRHA 2XA9A 2Q8QA 3RFXA 5ICGA 5A7FA 3OF5A 1NP6A 1EK2A 3QEOA 3UV6A 2A94A 4LECA 3V7NA 1Q0LA 3QUQA 1Z5GA 1T34A 3AEYA 1W88A 1JSXA 1LTKA 1GGHA 1C1HA 1U8AA 2I6FA 4GP9A 4JENA 4NDNE 4ZVSA 3TR5A 3GB9A 3W5AA 3JQFC 1ZNWA 2VP6A 1KF0A 3QFCA 2PSEA 4CCWA 4CLRB 3QPUA 1LSOA 1Z6QA 1F1JA 4CL8A 1P7CA 2PCLA 3I6MA 1I30A 1EZZA 1XTKA 2X42A 3D1JA 4JB8A 1A8HA 2ATCA 4UCQA 5B1YA 3ICQB 4YJ3B 4RGBA 2NTEA 3LBAA 1VE3A 5HRAA 2ATXA 4N41A 5BT8A 4OV6B 4JJ6A 2PV0A 3NHJA 3OLVA 4TM8A 4F8JA 1TEZA 1VLVA 4I50B 1QG0A 4CKZA 4K8RB 4EBFA 1O9BA 1R6UA 3TCKA 4PZ0A 1QV7A 3D6UA 1ADBA 1OBFO 3HLKA 4JVNA 7ABPA 4Z0NA 4KITB 2XCSB 4EGQA 1NDQA 5KYUA 1YQXA 2KPOA 3ADPA 2MDTA 4M88A 4TZTA 4DZTA 3M4ZA 2V0GA 1DEHA 1CNMA 3B89A 2VXOA 5EEHA 3SZLA 1FXWA 2OFXA 2FMFA 3IAS6 4MXDA 2JIDA 2G88A 3SS8A 3RBXA 4FX2A 3W04A 2PSJA 3NIFB 4XX0A 5JUWA 1J2EA 2JVJA 2WSYB 4C29A 4EZBA 5IASA 4Q16A 2PH3A 3EB9A 4BZWA 3JYNA 3HXLA 3ZZMA 3IUYA 1ZMXA 3RADC 2JFHA 4B2PA 4I1VA 4RIEA 2JGJA 2NZJA 13PKA 3L04A 5BN4A 4OL0A 3THOA 5A3JA 2VL7A 4C4XA 3N7UA 1VHQA 4M0PA 4L2IA 4RA9B 1ST2A 3E18A 3GO4A 3RYFB 1TMYA 2IXFA 4H77A 4V0LA 2C97A 3UMGA 1PG0A 1PRYA 4KXNA 3BE8A 3UMCA 5JASA 5CBPA 4CHTA 4Y9UA 2GKSA 2QN8A 5I4CA 4RGQA 5IDWA 1GPNA 2OBLA 1ZD2P 2AEEA 1RYZA 2LIPA 3AZQA 3QKUA 4OMFG 4YYZA 3KTAB 3NIGB 3JS5A 3V3TA 3P0IA 2XDQB 4LZWA 5DYIA 1ZC4A 1OLUB 1WLSA 1JQLB 2ZANA 3UY4A 2IH4A 2YWEA 8AT1A 3F8SA 2O52A 3L2OB 5L7WA 4CCYB 1M8GA 5L53A 1C2TA 5BN1A 1QVZA 1KK0A 1CQWA 1FSFA 3K2EA 1DEXA 3RUFA 2PYIA 3AX6A 1G7TA 2QJTA 2NO9A 4Q9KA 1WO8A 1OCEA 2BMAA 3A6DA 3ISTA 4GI5A 1JEAA 3T35A 1KY3A 2W2TA 1SHTX 2NN3C 1Z2NX 1Z16A 4HVAA 1ZK1A 1LLUA 4OA5A 3K0SA 1E2LA 5DCUA 2H8KA 2W8BB 2HHJA 1KQPA 3F9IA 3PUHA 1C5KA 1SIOA 3ONFA 1NKVA 4WNAB 4BC0A 1RWKA 3GL9A 5D3KA 4KYTA 3D8BA 1YZVA 2NUAB 4AXXA 1I3NA 4UDOA 3FOBA 3WI7A 1O5OA 3KQUA 4J3JA 1QMPA 2YN0A 2FUG1 1KGSA 4WXEA 3D2AA 4ECAA 4HDQB 4M86A 2AQ8A 1U99A 2QNIA 3DTVB 5J2UB 4N65A 4CTKA 5I9TA 2FN3A 5EWJA 4Z4QA 3GLFA 1EX9A 3OFNA 5GONF 4RKFA 5DM2A 1YMVA 3T9BA 4LOLA 5LYJA 2IUUA 3CUWA 4V02A 2GUWA 3BXFA 3FPFA 4H2DA 3L93A 1NTOA 2FFBA 4PC3A 3PK0A 1DEKA 3AJ9A 2IPAB 3QVMA 4NDAA 4D79A 2BFEB 1FBTA 2D2FA 5K6TA 3KSUA 1LPOA 3H16A 1X0XA 5AHWA 5G1NA 4KIWA 3HRHA 5C18A 4N3BA 2O3SA 4KTVE 3ZDFA 5J47A 1I4TD 1QG2A 4KV7A 2AFHA 3EGIA 3BT7A 1NY6A 4Q4HB 3C48A 1DG1G 2ZRLA 1VIDA 3MS7A 1S8FA 4N0EA 5F51A 3PIRA 3W2TA 3ZIUA 4ZYWA 3S1SA 4X7PA 3SD7A 3RK1A 2DETA 2R1UA 1NF2A 1YZLA 1BEEA 1JYFA 2HIAA 2O2ZA 3DKPA 3H0KA 1RCTE 3C8ZA 2Q7OE 1AD2A 3OFKA 2NNLD 1Z6XA 1RXCA 2C4TA 4RZHA 5CNJA 3VI3B 3IJPA 3TLKA 3ORFA 4UTPA 1PGQA 2AIRA 4B3GA 2B78A 3CJRA 1H1LB 2Y6VA 4EBBA 1Q83A 1Z2DA 5JXJA 1JRLA 4BNUA 2PDAA 5J1SB 1KHHA 1TLLA 2GT1A 3CY6A 3BMOA 3W8RA 5KC8A 3R7LA 3ECCA 4ND1A 4D57A 5CU7A 3MOIA 1KC3A 1NE2A 2OA0A 3MHPA 4KRYA 1EFVB 1ZCAA 2VT7A 3QE3A 3BUSA 3WKDA 3VAAA 1JJ7A 4G0ZA 4FMCF 3ZDDA 1WSWA 4JL8A 1XG5A 1XELA 1KDOA 3NYIA 4MCJA 1P4GA 2JFFA 4MVYA 5ESWA 3K09A 4DSOA 2I6UA 5LC1A 3TX2A 5KTTA 2MYTA 4IEIA 2WD9A 1JPVA 1O95D 3IQFA 2VDQB 3NI2A 4MJXA 3NALA 4OK3A 5BWOA 5IJWA 5FTMA 1ORVA 1ZICA 2IYXA 4IDAA 1IY2A 1XZLA 1CR4A 3VH3A 4A10A 4O4HB 5ES4B 1I0IA 1PGJA 2GYVA 1A9OA 3KKQA 3M82A 3QKIA 3U9LA 4BVFA 5JI3E 5K6AC 2FZCA 4UPDA 1ABBA 1P1RA 4FPXA 4ND3A 2A7XA 3IB3A 1BMDA 2JCGA 3GRVA 5HUHA 4C30A 2H2DA 3SZRA 4BLTA 2F8MA 2XTJA 3U7QB 1H94A 3QVWA 2WOJA 1E2UA 1FK8A 3LQRA 1HTTA 1M0TA 2O6LA 2QAGA 2ZYIA 2L17A 3BIOA 5KUTA 2X9LA 1YA6A 3K6RA 4YH1A 1D9XA 3KKMA 5CM9C 2WVHA 2VDRB 1HE2A 3TB4A 5CFPA 5AOCA 2F4NA 4C7OA 2JJ1D 3S1AA 2E0IA 1LJUA 5IF3A 2R65A 2XV1A 3DZDA 3UT0A 1GXSB 1PW7A 2Q2NA 2ONZA 2QD1A 2I6SA 2VPWA 1GTVA 3QW2A 3UJBA 3GQBA 5IH3A 1DG9A 1SPXA 3ROQA 3OTOB 1E0KA 2QT9A 1DKQA 3FTDA 1S9DA 1DLIA 2FJUA 3ZV4A 1E1KA 3FMPB 3QY9A 3OCUA 4UEWA 1QIJA 2VC2B 3DR3A 3OWHA 3EDQA 2RGAA 3KB6A 3R3VA 2QT0A 4TL6A 3GP8A 1EXDA 2D7JA 2XADA 4B0PA 4BVLA 3LVBA 3K20A 2QN3A 2QRJA 2LCQA 4S1NA 5EIOA 3T5CA 1EGAA 4F2DA 1AO0A 1GFWA 2JVKA 2Z4TA 3MRXA 2Z5FA 4NMXB 1R6VA 3GVHA 5KSPA 1DIHA 1TVMA 5K0TA 1A8QA 2P9GA 2NQ8A 1S2LA 2XH8A 3HPQA 2GX6A 3O94A 3C45A 4K2AA 5ESRA 3ZIAA 3KM0A 3Q7EA 4RQAA 3L4KA 5BV7A 2FYTA 1XJ0A 4RVOA 1PK7A 4EQ6A 2XMDA 1UC8A 3OT1B 1NBAA 1HNZB 1N8SA 4R1LA 2OM2A 2PIDA 4GXNA 2XWJI 2ABWA 1O96A 3H65A 1FNDA 5EXXA 1SPBS 2UZ1B 3ZJ5A 2J0EA 1KY5A 4R5HA 4JHXA 5HWSA 4S3MA 5JJKA 5K8LA 1R6XA 1M1ZA 2YUTA 2Y6UA 1FS4A 3CVXA 4LXHA 1ZUWA 5K2MA 2B83A 1OWMA 5I8PA 1DKNA 3UIEA 1AF4A 4BB6A 3ET5A 4JKYA 4PFQA 3N2ZB 5C1DA 3GLHE 4G07A 1LWOA 3EEYA 3RS2A 3I5XA 2GWRA 3GEIA 4KUEA 4LX0A 4E31A 4EELA 3O1HB 4PHFA 4XZ3A 5K3SA 3N0WA 4C21A 3RYTC 4WFJA 4L95C 3LAWA 5LD2B 3F9RA 1R37A 5HQJA 2Z0MA 2QV0A 1QAOA 1EGVB 4LYAA 1RU3A 4P4LA 2QB5A 4US0R 3ZWOA 4C4RA 3QPBA 1NTRA 1SKQA 3G13A 4DR2B 2APJA 4UMFA 4MVCA 5F5NA 4V03A 4J75A 4J29A 1PSDA 4Q4AA 5DNWA 1Z0DA 2KW5A 1L7BA 3L4EA 1XLUA 4IGKA 1Y8AA 4CKEA 3H87A 4MQEB 1NW5A 2XOKA 3U62A 1Y4UA 4Z4CA 3UJ6A 4MKFA 4Q3DA 1EQUA 4JI5B 1KDYA 3Q5GA 1IN8A 1Z4KA 1LLFA 1Z9BA 2G0AA 4FX5A 3DZGA 521PA 3RC1A 4CQJA 4X97A 1TL7C 3IT3A 5FX2A 2HIMA 1U7PA 4HQRA 3UPUA 5CM2Z 4OCZA 3TXXA 1VLJA 4BBZA 5CVJA 1VCHA 3BIWA 3HHEA 2V5UA 5FQNA 5T6MA 1NU8A 1MPXA 5K01A 4QG7A 2CFSA 3GH1A 3UFXB 4EYKA 2GEFA 3FAZA 2PUGA 3NT2A 5TE9A 1NQUA 1RYEA 2B8NA 1L3IA 1A2OA 1THZA 1QG6A 3RSHA 1UBSB 1UKCA 4OHZA 2Q21A 4MYHA 2Q2WA 3N8HA 1SXHA 2EERA 3ZLTA 5L4NA 3HBFA 1QHYA 3HL0A 2OCAA 16PKA 2ZIFA 1KEUA 3AY7A 2R4QA 3I0ZA 4I55A 4J0FA 4MLDA 5TMDA 3W8NA 3ZNQA 2DWPA 5BUQA 1KY4A 1TVCA 2BJHA 4EF6A 1VKJA 4IKOA 2P0EA 5THQA 5LJLA 5EZ6B 4BP9A 2QN1A 1BEZA 1W581 3LLVA 4QQRA 5BWLA 4KGXA 4ITRC 4Q0MA 5KTSA 4OHBA 1Y4ZA 4N6GA 2I4MA 2Q5EA 3A14A 1NOIA 3TEJA 1NOJA 1PUJA 5P21A 3CUVA 2QZ4A 3E58A 1TCCA 3FDXA 4HEQA 1GLVA 1VL1A 1FDVA 3AR4A 4II7A 2IV2X 3AHFA 3HM9A 3T52A 3BDVA 1JXAA 3VOBA 3O0DA 5EYPB 3WKCA 3OSZA 5DCWA 5JZMA 1IULA 5BRNA 3SOZA 3GCZA 4I2VA 1BXGB 3Q3HA 5IYZB 2HCFA 4TLLB 4DDWA 5EJ5A 4U2GA 3W4KA 4BWYA 4MZXA 4LJRA 4KSYA 1YIOA 5AJZA 3A6GA 2GPWA 2HJ9A 2GD6A 3OEYA 4CUZA 2WJYA 1D2RA 5FOXA 2C58A 2Q6IA 4DA8A 4KCGA 3UKJA 2GJ4A 2Z3ZA 1VHTA 4MS4B 2IP2A 1T4GA 2XEXA 3D3JA 2GEJA 4ZGWA 2FR8C 4TXHA 2R0QC 4Z4IA 2GLUA 2ECOA 1VTKA 1JILA 1RYHA 2VP3A 4Q39A 4L6AA 4N9QA 1T6ZA 3BDAA 4JBXA 1A4RA 4KXWA 2EHJA 4IY1A 4OUKX 3SDBA 4C0XA 4EI8A 4G26A 2IPXA 3EJ6A 2XVZA 3EF3A 3RVKA 1DIBA 4AU1A 1FPMA 2G4LA 1GUFA 4KBGA 4YJFB 1PZEA 1E3MA 1CUEA 3WWDA 2DKFA 1KE1A 1PU2A 1RYFA 3GAMA 3LBYA 3NONA 5EE9A 2X0NA 1NFQA 3SG0A 4CMEC 4X1IB 4HSEA 3RIGA 5ITZB 2IBTA 3EQ9A 3OTGA 4QDTA 4MPRA 4NNJA 1Y9ZA 4ZICA 3KJQA 1GQOA 2IRWA 1G98A 2X3YA 2Q5JA 3CLUC 1PX2A 4N5NA 3FUXA 3GP3A 1SBQA 3EXG1 3PR2B 4UBJA 1EGMB 4YALA 5DXAA 3WG9A 4WCDA 2PGLA 2Y4OA 3C41J 1C1DB 4MP3A 1EESA 4GC5A 2J3DA 3KR9A 2C0CA 2GEUA 3ITDA 5J63A 5JQGA 2ZYVX 4HYQA 1T2EA 1TZCA 5BN5A 4LC0A 4CLDA 2JK0A 2KSQA 1DIAA 3FUWA 3X1ZA 4G0VA 4TS9A 1TCBA 1REQB 1YBFA 4HUTA 1EFRA 1JN0A 3QP9A 3A9TA 2WAAA 4ZCQA 2UUOA 1U1DA 5JYBA 3G7NA 1PFUA 3IKJA 4GXTA 1PNRA 1SG0A 2JLYA 3CEAA 2OCXA 2FMUA 5CDYA 4W7IA 2O8BA 4M1YA 3G17A 4L78A 2HXGA 1MOZA 3G88A 3QKTA 2C4WA 4UAGA 3WRXA 4IJQA 5F2NA 3CTPA 3GU3A 4Q7JB 1I6MA 3LY5A 5AI8A 3X43A 4XXHA 2GN1A 1E6CA 1PS8A 2W0SA 4BVHA 2GTPA 3E84A 2DPYA 1WVIA 3JTEA 5ANRB 4G4IA 3CR3C 3OZSA 1U9IC 2CE2X 3KR0A 4G5RA 1GFIA 1CDZA 3Q2IA 1RYDA 3FD8A 1DZ3A 2CMDA 3KKKA 3NOVA 4CG3A 4HVLA 5JFGA 4DGQA 2K5UA 2QL5A 2HWYA 3Q87B 721PA 2IEAA 4L02A 3RJTA 1NYQA 5KINB 1PVVA 3Q7QA 2H06A 4XLLA 2V6MA 5IP5A 1DAFA 2ODNA 3UO8B 5TQ2B 4OI0A 5CDFE 1XQYA 3E7XA 1SIWA 3BGOS 4XQGA 2I8LA 3FX2A 5EP4A 3ZU5A 2XMQA 2A1IA 1VOTA 2QUAA 4YJGA 1HE1C 1CLUA 3ESRA 4MVWA 3SC3A 1X9IA 3KDSE 4M9QA 2JLXA 2QJOA 4HTAA 3QXCA 4XWAA 4ARAA 3UCFA 4AN4A 1AN9A 2GHTA 3ESZA 4R16A 5F98A 4QXAA 3A28A 2HRCA 4RIHA 3QENA 3GGGA 5EZYB 2A0KA 2D1YA 3RVOA 4C9BA 3FNIA 3HY4A 1DWQA 1HKUA 2NSLA 4FIDA 1HQDA 5DLQC 4R0VA 4PCAA 1T3HA 1ZWLA 3LW8A 4FYIA 1KR2A 1XDDA 1Z6YA 2VSQA 4G67A 1QIKA 4TUYA 4G0QA 4X92A 5HDQA 3SXUB 5DNCA 4MUXA 2FWPA 1WVMA 1L7QA 4TKZA 1C81A 1GVNB 2BEUA 4E12A 3Q1LA 3FFAA 4PS1A 2CWWA 2FLWA 3F1KA 5H3CA 2OP0A 2ZAGA 3W4JA 5JHGB 4YRAA 1DWPA 1Y63A 4LI0A 4HADA 2EFEB 2R6AA 2ZAYA 3OLCX 2ZWIA 2VUIB 1V4VA 3ANNA 4JMLA 5SY9A 2C9DA 4LDNA 3ROGA 2JGIA 5EESA 2GXQA 4H1HA 1W0JA 4Q7EA 3MB8A 4RJIA 4MRPA 5G4LA 4N03A 2C2BA 4I4TB 5LP6C 5LOVF 3GLRA 1PFGA 5FAXA 1YULA 1JHMA 3IAM6 5B7GA 2QYHA 1I7NA 4M7WA 4H9GA 4A92A 1CDEA 1JVNA 1TDJA 3FDIA 5B4VA 1NBHA 2ODPA 3JQ8B 3I76A 4DV4B 2V6FA 2I99A 4CR7A 3GZNA 4Q6BA 1I4WA 2IYPA 1NG9A 3T6KA 4TYNA 3NJ4A 5COAA 2BV3A 4PC2A 1V95A 2I7CA 2F90A 2R8RA 1LFDB 3M6XA 3O1JC 3QF7A 2IF0A 3PT9A 4XTCS 1MXHA 1X77A 4GOMD 4DQVA 1IFXA 4QYMA 1GNTA 4EKGA 2GESA 2WT4A 1Q1NA 4NBUA 5NULA 3MWKA 2ENWA 5AI6A 1C1XB 2QJWA 2VK8A 3IXMA 5FORA 3DWIA 5EHGA 2CJFA 4YAIA 1O2DA 2BGJA 1ORIA 1G17A 4P2GA 5IT9A 3MERA 1K7YA 2FSVC 3MTIA 2HA6A 4N54A 3EXG2 5H59A 2IPNA 3OG9A 3OQJA 3PXAA 4IDNA 2VHVA 2I6QA 2H3HA 4QVGA 3K73O 3N8KA 1NYTA 1DZIA 3TX6A 1XEFA 3V6MA 2DPHA 2X22A 4EG0A 1NLMA 3RSCA 1K9VF 4TRNA 3COZA 3PFCA 1OWLA 3CRZA 3G6KA 3HC7A 5G0SA 5FV4A 1PZXA 4KZPA 2C5LA 4IW3B 2PSSA 2Q9BA 4IXMA 2IXGA 1YU6A 4HSGA 3A9RA 2D0PB 3FPHA 4HQOA 4IF6A 5EQFA 4EZIA 4ZDIA 2BF7A 3PL1A 2ZYHA 4S0XA 1KMHB 1XWIA 3E9DA 4GBJA 1P9RA 1YR8A 2G1UA 2YFYA 3R6TA 4MK4A 4TT3D 1G20B 1T5OA 1U3UA 4XWYA 5D7NA 3H75A 1HLPA 3UK6A 4OXYA 4D9EA 5LQDA 2IOQA 1TYCA 2GMWA 2JZNA 5DTMA 5FLYA 3U17A 3K9CA 3ZY5A 3R9IA 2X14A 1QIHA 3B1YA 1BXZA 1M6EX 4KBYA 1VM6A 2B1QA 5C3MA 1U9CA 4QGFA 1EK1A 4C2BA 5B6IA 1R6AA 3DZJA 4EA8A 1DJQA 1FLNA 2OZPA 3GRFA 3IVXA 2CNDA 4LC1A 1L7NA 3PNPA 1L4FA 1P33A 2JRCA 3RNLA 4ZIRB 1L8OA 2AVDA 1DTSA 2C2ZA 2ICAA 3EGXB 1UK7A 5I7VA 4JP1A 1YKFA 1BFDA 2DC1A 2BVNA 2ON6A 4MI1A 3OQOA 1BXKA 3OCJA 4LCEA 1E5QA 4P7FA 4ES6A 1C3VA 1SO8A 3HNRA 5KOHA 2ZR0A 3DBRB 4YAFA 2Q4OA 4CEIA 1XVVA 3GPIA 4YUWA 1DHTA 5PNTA 2HNBA 5FV7A 5JXWA 2GARA 2JIRA 4R1UA 5ELLA 4C2AA 2OLEA 4WH0A 1ZM3A 5EGNA 3E7FA 3TD6A 3UJDA 1RFGE 3LC1O 4KXMA 3V5NA 3ZK9A 3Q9LA 4WW0A 1ZGGA 4MLZA 3ZHQA 2QMQA 4EKYA 4V2IA 3D5EA 3AFHA 1HRKA 3OIWA 3BJZA 3QIAA 2PYZA 3OPYA 2HH9A 2XB6A 4CF7A 4QE3A 2HM7A 3FTEA 4WLFA 2J87A 3UT6A 1JW9B 4K9NA 3PTAA 1O95C 1SUPA 3VU1A 1Y6JA 5HKLA 1F6DA 5DDIP 2D06A 2X0IA 3JQBA 1A5AB 3G79A 1M74A 1DLJA 3SK0A 3L05A 3CZAA 2A1TR 4PYQA 4X24A 1T4MA 3GRRA 5DJ5A 1Q0RA 2JBAB 4X3OA 4AZVA 4KRGA 5KHAA 2P91A 3R7AA 2XBMA 2PGJA 2QEQA 5BW6B 4CDMA 5LKRA 2W70A 4Y98A 3GNSA 4I1UA 4MUKA 1E2HA 2FFQA 2IIBA 2PMDA 3I6YA 5HYVA 3NRCA 5K1ZA 4HPJB 3ZE8A 3ZOZA 4F92B 5ABPA 3STTA 1XXHB 2HIHA 2Y9MB 4WLNA 2IL1A 3MPUA 2BISA 2BCJQ 3JQ9C 3VR3A 3PPVA 3D3WA 1OWNA 3QH4A 4M8SA 5HOQA 1CQIB 5L45A 2IT1A 4EEZA 5KU7A 1EJ2A 2QM0A 1P8JA 3STVA 3OQMA 4TMVA 4TS1A 2WJGA 4B3JA 4TV8A 4JODA 1CDOA 2D8MA 3P96A 2AG0A 1ZK2A 3Q6IA 4TYQA 1XDWA 2IIPA 5EA2A 3ZQJA 3PFGA 4JBIA 5FUMA 4C2TA 1UKYA 1G4HA 5A02A 3NZEA 4E6PA 1E20A 4Z7NB 4KQXA 1DADA 2HBZA 1U6JA 1WV1A 1M67A 5ENDA 1C7ZA 4Z4GA 2DB3A 1Q15A 1OH6A 3LCRA 4BUJA 1K2VN 1H22A 1GDHA 5L9AA 1U94A 1FQKA 4D9BA 3PQCA 2G4VA 3A8TA 4FDVA 4M8LA 3PDIB 4V0KA 1VKRA 4ZI5A 3UGQA 2PLAA 4IH9A 3KETA 3CH6A 3E8SA 4DBZA 3OU6A 3WMRA 1VDZA 3T38A 3IYLW 1TQ2A 3PNOA 3E15A 1E9CA 4KXUA 1AE1A 2E5FA 3ZNNA 3TKLA 1SOWA 3VNQA 4J2HA 4BVEA 4LZLA 2XTNA 1S5PA 1IHDA 1TF5A 5K0ZA 1CY8A 3LQ1A 3QBVA 1V1RA 3ROPA 1TUIA 2ID9A 2O07A 4HP8A 5CAEB 1F2VA 1WVGA 2F1OA 1Z3IX 1KS9A 1B26A 3GDHA 3GBSA 4OM8A 4NFYA 5E2AA 3RFTA 4QQKA 1XDGA 3RHZA 1TU3A 3BD9A 3HP7A 4LZZA 3OQHA 4JROA 2FB9A 3K9BA 3UG7A 4LA4A 3W7AA 5AUNB 4QM6A 2JIQA 4P58A 2GRAA 4M46A 1NNLA 5JQWA 4BX8A 3KJZA 2XUPA 1KE2A 3FOZA 2V6GA 1YR3A 5KPJA 1JQ3A 2BUBA 2F43A 1CUBA 1J2TA 3K9FC 4B75A 2GZ3A 4JT2A 4IH4A 1PJZA 4MV6A 4YGYA 1SHUX 4NZPA 5FBRB 4FU0A 3DQPA 1YCGA 4S1OA 1WOMA 3MGGA 2O1WA 3CT4A 1EFAA 1LBTA 3ZX5A 1Y8QB 3PYLA 4QU0A 1H5NA 3N2KB 5CT4A 3EXHC 3DZKA 4OXXA 5EWLA 1WHSA 4YNBA 1DP4A 2FY8A 4AY2A 3O4GA 5EKDA 2QXTA 1BHSA 4LFBB 2ZYSA 3VZDA 4OHWA 2ZB8A 1XAIA 3FHOA 4KQIA 1QP7A 2ZTMA 5JSZB 1M9NA 2J3KA 1N3IA 4X1YA 2IKSA 2QU8A 2Y1DA 2YXLA 1U7ZA 3B9BA 3T7KA 1W1IA 2DFLA 1PV1A 4GPZA 4HPXB 3OLWA 4IDDA 1SC1A 1CRLA 1M8JA 2XT0A 2NV0A 3CZCA 1KTIA 3Q8MA 1YJBA 4IZHA 3GLIB 4M9RA 4LPSA 2OD9A 1VZ2A 4MMXB 1TT5A 4M9ZA 3BCRA 3PX2A 1OXSC 3LHSA 1JPUA 2VYFA 4GVXA 1T35A 3ZQ4A 2OV6A 4B8WA 3R7DA 4AY5A 1MHTA 1ZAKA 1RI4A 1FBNA 1F60A 4AY3A 5DX1A 5ILOA 2FWJA 3JATB 4IO1A 4MGYR 5J2TF 1WMDA 4EPTA 5EIBD 2G8LA 2JHPA 3KUCA 1JU9A 1XKXA 2DUUA 3L43A 1WAMA 3KPYA 4TTVA 4FSHA 3DMHA 4BRSA 2W98A 2I2WA 2ZDHA 4CF6A 1NSYA 2WJJA 4OOFA 3EFOB 1S01A 1XAJA 4KDCA 4HNHA 3GT4A 5DHAA 3O93A 3KQLA 5IJ0A 3K94A 3SEQA 2IP1A 1ZVQA 1VL5A 1GCGA 1DRUA 3KQMA 3NUQA 4DUGD 3OFND 1GG2A 2VDWA 5C80A 3FYUA 3O1LA 4MV4A 4E2FA 3EPKA 2GFHA 1XRJA 4J90A 4KMMA 5M29A 2O7RA 4JWKA 3WYCA 4FE3A 1RZUA 1XCMA 2B4RO 3C1OA 1XALA 2DTDA 3Q7PA 4RXUA 1DT5A 2QJFA 3ZXSA 1D4AA 3LHFA 3PCXA 4YP6A 4JBNA 1E4EB 3T0GA 3H1FA 3A7EA 4GYKA 1L5MA 2TMGA 4BJ3A 2G8NA 4BNJA 5CFZA 2PCJA 3RFVA 1KMQA 1BGWA 1JP7A 3KZCA 1U63A 3PWKA 3PGKA 4AKSA 4EDFA 3WYGA 2YFHA 4W8GA 4C43A 2O06A 2OHJA 2XNSA 5HKBA 5AVKA 1ZM4A 1FZQA 4DRXB 2OQRA 3L01A 1EWYA 2UUPA 3HXTA 2HRRA 3NHZA 2SICE 5EEGA 4QTUB 4ZTZB 3ZGVA 3DTYA 4N5MA 2G9RA 2FQ1A 3I92A 1YSCA 3UUGA 1E3LA 1YS7A 4WZBE 4A8PA 1OFGA 3L0SA 5T41A 4R40A 1DKUA 3A3YA 3F4KA 1AMNA 2H1SA 3KJIA 1KYWA 1Z4NA 5ILGA 1A4XA 4M0UA 4ND6A 3PNSA 1QMGA 1OZHA 5CITA 5KJ6A 3H9GA 2Q3BA 3ESAA 1P2VA 2AEFA 3EVFA 1U04A 2QTNA 4TXMA 2ZIUB 4TVSA 4HUQA 1D8TA 4IIYA 3D8RA 3M5WA 2W2VA 1O5TA 1KEZA 1LBQA 3P9XA 4J7XA 5ALNA 4B3RB 2C7QA 1X80B 1UZMA 5CT5A 3G0HA 1C41A 2ORED 4JP2A 4RENA 1M2JA 1Z5VA 2QTVB 4YJ2B 3V1NA 4IWNA 4DFDA 4EUFA 1XEXB 4DPLA 3JQ6A 1OAOA 3W06A 3W9YA 3K2QA 1ZH0A 1GRCA 1RIIA 4QLBA 3LI2A 4GYWA 1CY1A 3K30A 1E94E 4FOOA 1EEHA 4JYZA 1SZJG 1JIQA 1L4LA 2CWDA 3FTQA 3SS7X 4DG8A 5B57C 3DXXA 3U60B 4L8GA 1A1VA 4KDFA 4ZA2A 2Y1FA 3G5TA 5JTUA 3ICOA 3KYDB 5HIJA 1U5AA 3QKRA 3EIUA 2X1LA 1O7JA 2NQ2C 1LNSA 2AEJA 4H27A 3C24A 4MGEA 1ZU4A 2XUGA 2VDNB 3MJSA 2AN3A 3DWGA 4G5SA 4HS9A 3WC4A 2IE8A 2ZS8A 3CEHA 3HR7A 4Y1RB 2ZB2A 3WGTA 4G2TA 2FW7A 1GU1A 2WU0A 2WTBA 2WWWA 1A3CA 3GLTA 3HYRA 1PKXA 2GJAA 4J0IA 1B1CA 1JHRA 3T3MB 4AF8A 2HO4A 3H0EA 5C5IA 3D1VA 4TVBA 2A35A 3KT6A 2BFPA 3LX6A 3SZOA 3ZI7A 4BNLA 4O3MA 1HYGA 1U2DC 4W5HA 5KB3A 3ZEAA 4IDOA 3UAXA 5ADWA 1C9MA 2DTEA 4DYHA 1QIDA 2Q27A 4N82A 4JI2B 1PEYA 6AT1A 3KFVA 3NH9A 1MF7A 3P0JA 4JUDX 3GG9A 4O4LB 2E89A 1SEVA 5JAOA 1GAWA 5EMKA 3C1UA 3OP1A 3WJ1A 1YFJA 1G60A 1WXGA 1SBZA 2A1UA 1BTOA 2CXQA 3ZCXA 1E6EA 2B35A 4AQYB 2DAPA 3AR7A 3L7JA 2WZDA 4D46A 4LYYA 1Z0FA 4XYLA 5KBYA 1WZ2A 1W76A 1TZJA 5DLDA 3C5EA 1HT2E 4DVJA 2JB9A 3K96A 3MQ2A 2O8FA 1GG5A 3TDKA 1KEPA 2EG5A 3NHLA 1A4UA 3GPDG 4UMEA 3OJOA 1YR9A 3TRFA 4ZARA 1ZGJA 3KT0A 3A6FA 1VHLA 1C14A 1X7GA 3EIWA 1HH4A 3QHAA 1A9QA 4IF4A 3SIXA 3TOXA 4EJSA 3ZLJA 3WTCA 5BVGB 3JWEA 2PEYA 5DCYA 1JYSA 5CNMA 2CXOA 3JAWA 1GD1O 3EWSA 3U7JA 1P81A 3LGAA 3B48A 3W5IA 1R8JA 4LXGA 1VCNA 1WW8A 4XAQA 5CA1B 4ZHQA 2YXPX 1Q0SA 1PT9A 4F04A 3JWIA 1MC5A 4BQFA 5GJCA 5C1BA 5ICEA 1NN0A 1YC5A 5ECDA 2BHNA 5LQUA 4L27A 2BHLA 4O4IF 3EPLA 3HRIA 4DIBA 4KRFA 2Q41A 1EXMA 4ZJUA 1KAGA 5CTJA 2H29A 1H2HA 2HRBA 5AVSA 4QA9A 1OD6A 3B3GA 4F2PA 4RF5A 1V2GA 2ZE5A 3CKMA 1BGVA 2YKGA 3EAQA 2PTHA 5LP1A 3DCNA 3PGA1 3G2LA 5IK2A 3TQCA 1RRGA 2JNWA 1J7JA 3PEVA 4KE9A 1NUTA 1RQNA 3OT5A 4RMNA 4KG7A 5C4IA 3VA7A 4GRAA 4OFBA 4HAWA 4BFLA 4RTJA 3V2IA 3RVQA 2I1VB 3ZOKA 1RDFA 1Z63A 2L19A 3DEFA 1H93A 3MFYA 5AVVA 5GPBA 5HQTA 3IP7A 1QO0A 5ALKA 5H5JA 5H80A 3Q3VA 2PS0A 3LCCA 3I2KA 3OX4A 4GOOD 4MQ6A 3FWYA 3RK0A 4PGHA 3IPXA 5F5LA 2E4WA 1WKBA 4MGHA 2XOKD 3T41A 4LI3X 1AH2A 3HPRA 2XMCA 3ZKWA 1C0PA 1G66A 3HXPA 5A6SA 5HJEA 4WKGA 1D7AA 3LK6A 1P0IA 1BDBA 3TDNA 2QBYA 4UUAA 4IL5A 3RC9A 4HDAA 4TXLA 2JAXA 3K0FA 1QK3A 2LXNA 5AHXA 3DFMA 2A4KA 1TYBE 2CVZA 4G8BA 2RHJA 2IUSA 1C8BA 3U81A 5LZ2A 1KPIA 3HDGA 1MR3F 1V5IA 3HVJA 1RZRA 5DHPA 5EMNA 1D1TA 2LCFA 1RHUA 1TE2A 4HFNA 4Y2GA 4ZQIA 1FLAA 4DJ5X 1KKLA 4Q1DA 2JFWA 4JVSB 2D4AA 4DXDA 3IQWA 4NZNA 1XCBA 5ARCA 4EGJA 3PVSA 3CT6A 3L7CA 4KSBA 4OP3A 4DV3B 4CM1A 3CUKA 3ZBQA 1XAHA 1EBFA 5FOTA 2JA1A 2YZ7A 4JJ8A 2OK8A 5C0OE 2VHTA 3NM6B 1KOGA 4CM7A 2FPPB 5CDFA 2W6JA 2I4RA 2BZSA 3F6PA 1FFCA 3EA4A 4R6WA 2XKJE 3FSEA 3K6KA 5FUVA 1BKDR 1EAMA 3NXKA 4HDKA 4XM2A 1SUFA 1KSFX 3ZXIA 4YUZA 4L5BA 5ENZA 5I9IA 5T8KA 2VJDA 4JI4B 1X19A 3NBAA 1LB1B 1ADJA 3QU2A 4R3UC 2NO5A 2R25B 2ZJYA 1SQGA 3HCEA 4US2R 1Z06A 1JA0A 4DANA 4RVUA 3KQOA 4HZUA 5AKIA 1LZLA 4EM6A 4IVNA 1J20A 5A5GA 3PVCA 4RPGA 2C04A 3UPDA 5JDIA 4LYEA 1PQWA 4M7PA 2PU7A 1HQKA 2P9CA 5A5FA 2G77B 2VTEA 3IP9A 3PEWA 3EW9A 2CK3D 5CDHA 4D81A 1LBIA 4RHUA 4UVEA 4N5IX 4BUZA 1TK3A 5F3DA 2NXWA 1K0UA 2I3GA 3JAKB 1ZG3A 4IVPA 1TU4A 4JEIA 4R41A 2E7ZA 4PSUA 4KNVA 1PUIA 4XJSA 4A16A 2X8WA 4IMPA 1ZGBA 4I6JA 2R11A 2HZBA 2O8NA 2ZPTX 3W8DA 2C2KA 4O25A 1WCV1 5F4ZA 2JI7A 3MUFA 3ZWPA 6Q21A 1N6OA 4Z4FA 3ZLVA 1MV5A 2I55A 3ETCA 3JWJA 4NJEA 1C3OA 1UMBB 2OZLB 4YCMA 1DX4A 3EGOA 3FR8A 3HFJA 4TWJA 5AKKA 5FADA 2EEPA 3ZHTA 1G7SA 3RU2A 3GFOA 3ZPXA 4Z5XA 5HHTA 4YCNA 4FYYA 4YAWA 5G1OA 1Z0KA 3D3EA 5FEMA 2ZTHA 1OE0A 2H63A 4GKBA 4C05A 1YC2A 3OHSX 3HKBA 2MU1A 3VR4A 4JJZA 4ZI3A 4U5QA 1UF9A 1QX4A 1XVLA 2GFQA 2X8LA 3PDCA 4I4NA 1M6WA 2G04A 4QPDA 4V0MA 1EM8B 1EUDB 2PUJA 2XA1A 1G21B 1US8B 3AILA 3IT1A 2NXEA 4IWXA 3DV0B 4BLRA 2IV3A 1I5OA 1CJVC 5H8WA 3H9BA 1U81A 4M7OA 4DA9A 3DT9A 3S55A 3I05A 3OM9A 4XDZA 1CNEA 5CG1A 1KFBB 2YNMD 1B6TA 4KBFA 4K86A 1ZIDA 4AG6A 5IJ9A 4Z4EA 1IY9A 1EFRD 4S1TA 1E1QA 3F49S 3DMTA 5MN4A 4UU7A 2HREA 2YJNA 2AT1A 3A1WA 1OX4A 4MOWA 4XCQA 4PBRA 3MT8A 5JT1A 4BUCA 1WABA 3TOCA 3KUUA 3B38A 3KL2A 3DZFA 1JJBA 2OMEA 3JALB 3ZVNA 3L8FA 4O4LF 1KEWA 3MWJA 4OHVA 4UM8B 1TYEB 2DR0A 1KVRA 3GPCA 2CLMB 1J56A 4YAJA 3CPJB 3U4GA 5KVCA 3OZAA 1T3SA 2QMUA 3BJMA 3Q7IA 4JZKA 3WNDA 1PG2A 4LE1A 4RWZA 4JLNA 1DBIA 1RFLA 2FZKA 3I2HA 3U1TA 3WO1A 4R7ZA 4D0GA 1BVHA 2XMPA 3E9EA 4GICA 1QF9A 5BYKA 2IS1A 1W96A 2AOXA 2ZI7A 4Q37A 4AJEA 1CY0A 3KQSA 3F3KA 3H9UA 4EITA 3E4DA 2Z9BA 4Q1FA 4I8XA 3PICA 3G23A 3GT3A 4OL9A 4F5YA 1J9ZA 2QWXA 1PW5A 1X7HA 1CUCA 1ZP6A 2X7XA 3W9UA 2IDKA 3FWZA 1YASA 3MWDB 3D02A 4Q1AA 2I8AA 1R4AA 3PXUA 2BFNA 3NV7A 3UHAA 4PZCA 1K97A 2QD2A 3QYPA 4GL4A 3VPHA 4AT1A 4BPBA 4GMXA 1YQEA 2ALJA 1DCMA 4D9KA 4ENSA 2AL7A 4PX2A 2GD1O 3PX3A 3LUPA 4N76A 1N4AA 1R66A 3HCAA 5JAHA 3JY6A 1SRRA 2GPJA 5LXTB 3HDJA 5IN4A 4L8VA 1E5VA 1D2AA 3KR2A 4QICA 1W36C 4WLUA 1PCXA 5EFZA 4YT5A 1MEOA 3TDMA 4BN0A 5KKCA 1G7RA 3R74A 4UHDA 1SVMA 3C5HA 4WINA 3W5UA 3JV7A 1ATZA 5F9MA 2WMYA 3G2KA 3QF4A 1ZAYA 4O3FA 1R4ZA 2PL3A 4JB2A 2ZWAA 4Q5IA 5D3MB 5HJ2A 3BFPA 3NVMB 3T9DA 4I46A 3TL3A 5CHYA 3ZHBA 1ZNQO 1COWD 1RLMA 1SRQA 1SXJD 2A0FA 2AJLI 2WIBA 3QPWA 4UD6A 4DCSA 4R0NA 4EUHA 2ZIXA 2B1IA 4EX7A 5LDGA 2Q1UA 1CJKC 1MB9A 4MVJE 4M3NA 2D5BA 1OXBB 1FFBA 3MRTA 3RH0A 3MXOA 3M1AA 4IV5A 4XWWA 4FXOA 1ZZGA 1QIGA 1TVKA 1EE9A 3HKCA 1N0WA 2WD7B 4FGSA 4K5QA 4LWQA 5AJUA 2CZGA 3LP8A 3NANA 2BZ0A 1OC4A 2P2CA 3A04A 1W5EA 3P4UA 5EVCA 5T4HA 2BSQA 3G1UA 4QDJA 5LQSA 1HTWA 4R68A 2AF3C 4TYWA 2W83A 4JCOA 4TPKA 5D87A 2F55A 4LNUB 5JH7A 5DWDA 1PTJA 3PXBA 4TMFA 2FWAA 2Z95A 3H2BA 4LRYA 1I51A 2WRZA 1G2PA 3IHWA 4XX0B 2G7MC 1QGAA 2IHJA 2C9YA 2V7BA 3K5WA 2J0UA 3OQ1A 5LBTA 4E07A 3RF7A 3K0KA 1W5AA 3LT4A 3QVKA 4OAQA 3N2LA 1L1RA 5BXQC 4RLFA 2DFVA 2ODEA 5COBA 1JI0A 4OQZA 1YHNA 5EHIA 5GV7A 3A9CA 5I3CA 2YWBA 1XD2A 4DL9A 3UOAB 3ZXUB 2FGJA 3W2IA 3ZV3A 4ZJYA 4HY3A 2PNFA 8ATCA 4CLOA 2C78A 2V9PA 4OTZA 3FHTA 4IR7A 1P2UA 2BP7A 5HKOA 1YGPA 3QVSA 4OG2A 3I1FA 3HADA 1VXOA 1E32A 4KMSA 5BWCA 4RTKA 4K0RA 5BVHA 821PA 3A6ZA 4BEVA 3K7EA 5EE5B 1J21A 1IEXA 3A0UA 4C3ZA 5CJ2A 3P4YA 3EZ9A 2ZB3A 2D00A 3C8DA 2BKAA 3M33A 3BH7A 4Z99A 1GRQA 1MP0A 1L5LA 5CP8A 3UJ7A 2ERCA 1MABA 4I5FA 2R4UA 2E3JA 4OSPA 1Y33E 5K8CA 2E37A 4W1PA 4ZK6A 3F7TA 1IXYA 3C3DA 4IKPA 4MKGA 4XRRA 2QP3A 1OFHA 2H4YA 3DOIA 1QH1A 2YIJA 1L5HA 4MW0A 3M1YA 4IIEA 4FCWA 3V42A 2DEUA 1GFSA 1IEQA 2Q5QA 3AUKA 3NJRA 5LQNA 5JNRA 2C3PA 1Z4MA 3FN4A 2LIVA 4QJ4A 4U5XA 3K8OE 2ZYRA 1GAJA 4ZTUB 4UREA 4J4HA 2XVYA 2V9ZA 1ESDA 1Z0AA 4OEHA 4F21A 2YTZA 4HWOA 5TF0A 2VJAA 5AJTA 4ZD6A 2GK7A 2QXYA 4BNXA 7REQB 2QU7A 3EOBI 3G2NA 3NBUA 4XYBA 3ZNPA 3W2EA 4MKZA 1EG2A 1VMDA 2Q0XA 3OX2A 4HMPA 4IH1A 2CJWA 3GJYA 5JDCC 4DLBA 4FDTA 4E30A 4OOEA 3UA4A 4MV7A 1Z7WA 2FRDA 2YQZA 1T10A 1A04A 1BJRE 2FDRA 2WG2A 3EXAA 3QXGA 2GVNA 4M1QA 5HPYB 1FFSA 4E5MA 1ZEMA 2HF8A 1KXZA 2AW5A 4NJMB 1A8UA 4Q4JB 1N3BA 1OKKD 2RHDA 5DEOA 5J5AA 4AJJA 2NV6A 3KJFA 1PL0A 1XQXA 3RBVA 1HQCA 2C7PA 1WB4A 1IOVA 4KZKA 1TFUA 3AP2A 3T3DA 4IOKA 1RQRA 1JT9A 4NU6A 5FPKA 3DNFA 4X95A 3GLFB 4K28A 4HQKA 3K09C 4WBNA 4ZVOA 5ELXA 3HUTA 4UNNA 1CD5A 1X74A 1FYFA 2JK1A 3I64A 1PJRA 3T15A 5JZOA 7ADHA 1AB5A 3GD7A 2O7QA 1CZLA 1G8MA 2FCAA 4P98A 1AUQA 4NOJA 4XPZA 1T91A 3IBSA 4DHEA 2QNBA 2HMAA 1QV9A 3KD2A 3FW1A 3LP5A 1PZGA 4I8IA 3ZU6A 1MC1A 4CV3A 3VISA 1I3CA