1PNQA

Crystal structure of r. rubrum transhydrogenase domain iii bound to nadph
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
b'SGHIEGRHMAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD(P) transhydrogenase subunit beta
publication title Conformational Change in the NADP(H) Binding Domain of Transhydrogenase Defines Four States
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 53
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2003-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1pnqA00
4JT9A 4HD8A 3LQ1A 1YTLA 4V1CB 3EY9A 3GLRA 3PKIA 5EJ9A 2JIBA 5EJAA 2A1UA 4K9QA 4C7BA 4C78A 1T9BA 2VK1A 2Q5JA 5EJMA 1Y9DA 3ZG6A 2H4HA 4FEGA 1M2HA 3D4BA 2OD7A 3PKJA 2NYRA 2NXWA 4UU8A 1J8FA 1M2NA 4UUBA 1YI1A 1PT9A 1PTJC 3IAEA 3ZGOA 2IHVA 4TWIA 3ZGVA 5DGTA 2FWNA 2Q5OA 3U31A 3GLTA 4QQ8A 1D4OA 4RJJA 4UTNA 5K6TA 4BVGA 4K9LA 1UPAA 2H59A 2VK8A 3CF4G 5AHKA 4K9MA 2FRDC 4GG1A 1S7GA 1PI3A 3PDHA 5MF6A 3RIGA 1Q1AA 5K2OA 1HZZC 5FEMA 1PO7A 2OO5C 5MFPA 4BVBA 1OZGA 2Q5LA 3GLUA 4Y6LA 5EJ4A 4F56A 2X7JA 3D81A 2EZTA 5EJ5A 4JU8A 3IAFA 4I5IA 5MGNA 1M2JA 1YI0A 1PNOA 4UU7A 1S5PA 2OD2A 4UUAA 4J1TC 4RJIA 2EZ4A 2IHUA 2OD9A 2H4JA 2DJIA 3E9YA 1YHYA 4MQ5A 1POXA 1OZHA 1O96B 2OORC 4GM1A 4X3PA 4BVFA 3EA4A 4GP9A 1JSCA 3CLSD 1E3TA 3F6EX 3JWPA 5DEIA 2W93A 1ZPDA 5K6RA 4KGDA 4IAOA 1YC5A 4L2IA 1YNOA 4RMHA 3FZNA 1MCZA 4BN5A 2AG0A 2Q29A 3CLTD 5IMSA 2H2IA 4QELA 1O97D 4BN4A 4GPEA 4TWJA 5DGDA 4UTRA 2C31A 1PNQA 1PVDA 2AG1A 2EZ8A 4F4UA 5EJ7A 1Q6ZA 4O8ZA 3K35A 1ICIA 1Q14A 4BVEA 2PANA 4JUBA 4K9NA 1M2KA 3HWX1 5MFZA 1T9AA 3FLMA 1XLTC 4QPZA 4RJKA 4D5GA 2FR8C 4R8MA 2PGNA 3HWWA 1U31A 2EZUA 2JI9A 1BFDA 1Z8NA 1U2GC 2JLAA 1V5EA 4X3OA 3JR3A 2H4FA 4Q9DA 4JD5A 4IG9A 4L3OA 2VBIA 2Q27A 4V1CI 1Q17A 1UPBA 4JSRA 2H2HA 5BWOA 2EZ9A 2IHTA 4JUCA 4RMIA 3CLRD 4HDAA 5BWNA 3EYAA 4K9PA 1UPCA 4K9OA 3F6BX 1SZCA 1OVMA 4G1CA 1N0HA 5BWLA 2VBGA 4ZZIA 2H2GA 2QQFA 3CLUD 2Q5QA 1U2DC 1V5FA 2WVAA 2WVHA 1PYDA 2FN3A 4D5EA 2H2FA 1NM5C 2JI7A 1M2GA 4JUDX 4GM4A 4BVHA 5EJ8A 1EFVA 4COKA 4MZXA 2BRUC 2UZ1A 2B4YA 2PGOA 1OZFA 3FSJX 4KXQA 4MPRA 2WVGA 5D7NA 1DJLA 4RMJA 3GLSA 3RIYA 4V1CA 2JI8A 5K3SA 4MPPA 4IF6A 2VBFA 4GM0A 1QPBA 2VK4A 1V5GA 4UTZA 2JLCA 1POWA 4BV3A 2H2DA 4UTXA 5FYQA 2JI6A 4MPJA 2FSVC 2A1TR 1SZDA 2VJYA 1MA3A 2Q28A 5EJ6A 4BUZA 4KPUA 4Y6QA 4Y6OA 4UTVA 3U3DA 1U28C 4FEEA 1YHZA 1YBHA 4J16C 2QQGA 4FVTA 1T9CA 3D7KA 2UZ1B 4RMGA 4JUAA 4K9KA 4JUFA 4ZP1A 4BV2A 2V3WA 1YC2A 1T9DA 4JU9A 1EFPA 4JT8A 3OE1A 4FZ3A 2HJHA
chains in the Genus database with same CATH superfamily
3GFRA 2WSLA 4IO1A 3ROMA 5CB8A 3CH4B 5KAMA 1OH7A 2BFFA 5LDHA 1UMKA 3JTEA 5JVDB 3K70B 3RD5A 5T4EA 1PJAA 3TTTA 3WIOA 1B8NA 7REQB 4JS0A 4JJKA 2QK4A 3MF4A 3CXRA 1CJUC 3OA2A 2WI8A 3GLHA 4A0SA 1G7SA 3AUTA 2A1UA 2AOWA 3M4XA 2R4QA 3ZHCA 5IXJA 1AUPA 3IPYA 3ANTA 4QYIB 2BM8A 2GUWA 2J3QA 1SKYE 4OD0A 5EMNA 5AVJA 3ZG6A 4CMAA 2ZB4A 3HN7A 3U44B 5HKLA 4US1R 1UBTS 1RWQA 1KZGB 2PFSA 2I2WA 2GWRA 2QSUA 1AB6A 3Q72A 3J80A 2GKOA 1GV0A 4EPVA 5FAXA 3K2BA 1TJ5A 4FS3A 3FPJA 2NXWA 1TM1E 3H5AA 4DJ5X 1C8VB 4EY8A 4LV8B 1J8FA 3MS7A 1GVHA 1XZNA 2ZUBA 3LW7A 4FK8A 4RVDA 1MBZA 2Y1CA 3PQ7A 2M32A 4BP8A 4DAOA 2OOSA 2PUWA 1PTJC 4CLOA 4B33A 5JBQA 3R9IA 4I5FA 2FOIA 5EMJA 4GDFA 1MOQA 3PPIA 3I2IA 1JEYB 5HBGA 1I33A 3MWYW 4E03A 1M72A 2E9SA 4BEVA 1M34A 2F43A 3OZXA 1NJSA 1XTTA 3A28A 1OLSA 5FI1B 3RVBA 5CW1A 4EVRA 4S0XA 4UTNA 2Q1TA 4FP9A 1XCPA 3O2QB 2BCJQ 3UCFA 5A4JA 1E5DA 2PLRA 3TLXA 4CQMA 2BOVA 4P4GA 1CQIA 1FYEA 1YDMA 1EVYA 2QRNA 3GROA 4HDCA 4MCIA 4YRSA 2RAUA 3DO6A 2IU3A 3C7KA 5LQAA 2WUVA 3ICOA 4DMRA 4TVKA 2DF8A 2OG1A 3KQPA 5H82A 2OV4A 3R5KA 2G71A 2REBA 4K9MA 1OLOA 1T35A 4TTQA 4TV8B 1V6SA 1G2IA 4MICA 1U2GA 2PSJA 2FF7A 1BO6A 5GZ3A 1WZNA 4FDTA 2VTEA 1U0LA 3RCBA 5A2GA 4E46A 1FVXA 1T1RA 1Q1QA 2GN9A 2QGFA 4BRUA 4O25A 5EHNA 4YUVA 5JMPA 5J4HA 1TM2A 1SC6A 2Q5EA 4NBVA 1J2EA 2X22A 3VOAA 4A03A 2WFAA 2NP6A 1K0UA 4FFMA 2F1OA 4DIDA 2VYNA 3U4QA 2C96A 1NVXQ 4O4HA 3T7KA 2OO5C 2JD0A 1XHEA 3L7LA 3DZDA 4D4MA 2GO1A 2XSZA 1HG1A 2IEDA 2ZBEA 5CPFA 1OYVA 3GNQA 3IP6A 1IN8A 2C8KA 3O92A 2I22A 2ZWVA 3TB4A 3ZV7A 1P0QA 4ZFNA 4HVCA 5L95A 3P9IA 1MJ5A 4YCSA 5JECA 4Z8XA 4M1OA 5LQNA 2Q5LA 1WJGA 1N8NA 4J94A 1ECPA 3UMFA 4WLVA 2BTQB 2XCOA 3C6MA 3L4EA 1DAIA 1TAHA 1XZEA 3NV9A 3ZDYB 2G09A 2OEPA 3QU2A 4Q3KA 3OJXA 3IQGX 4X7RA 4JBGA 5T3YA 2QRHA 1SVIA 1C1YA 1XZ8A 1L7QA 4RXMA 1IUKA 4AYTA 1SCQA 5F2EA 3R6GA 2QTTA 2ERXA 4CL0A 4JEUA 1DB3A 4W8GA 4ZEWA 3P2JA 3TJZA 3GGOA 1HRKA 2XCQA 3M1AA 1C1DB 3TOCA 4C87A 1T2FA 1SCUA 4JA2A 3FLEA 5U9CA 4FIDA 2HK8A 5EIEA 1Z5ZA 1EUDB 1QIGA 1W30A 2Q6LA 3LF1A 3OP4A 2D54A 4LBZA 2BKVA 2XQGA 3O4FA 2QP3A 4G26A 1QHSA 3R3ZA 4G9EA 5EJEA 5I6DA 4EJ2A 3CKYA 1GKUB 1H2HA 1EG7A 2YOFA 3I9V1 4JGBA 3RC9A 4WBNF 4FDLA 3IUEA 4H35A 1ZL2A 3QENA 2IUSA 1OIVA 3N28A 2PBRA 1KJ8A 2QX8A 1KVSA 2VEOA 3GJYA 4WA7A 1JI3A 1S3GA 1QCYA 3LWDA 1P1FA 1QH9A 1VLHA 4M6WB 2OV2A 3KCQA 1II8B 1FJ2A 1F0KA 1Z0KA 4XR4A 1KZ4A 3CWCA 1JKXA 1U99A 3GI1A 4HN4B 3VYRB 2RJNA 2CN1A 5TIIA 5FNVA 1NQAO 3BMXA 3OLYA 1DQZA 1YHYA 4R69A 4ZOCA 3QMMA 1POXA 2JHPA 3ES9A 4G9GA 2HRZA 4GMHA 4BKQA 3IEKA 4ROSA 5IBRA 4XB6B 5KYYB 3PG5A 4GPD1 1CQXA 4OMUA 3T41A 4BVFA 3MMNA 4YJ3B 1E3SA 5IK2A 2H9AA 1P1KA 2RGXA 5E1MA 4KUHA 1NBWB 4J9VA 4DYDA 2B82A 4GOLD 4MA5A 5JH7A 1SIBE 2ZYAA 2P3QA 5J2TF 3QPVA 2C9MA 4QEDA 5EGNA 1GQRA 3OD5A 3R7WB 2C29D 3ZGZA 4H0NA 2YJ3A 2F9LA 2EQBA 2RHMA 1ZD2P 3R77A 3VV3A 5DEOA 5B3KA 5B12A 1OCEA 5UKDA 1RLOA 3DBOB 4UAVA 2YHAA 4BFUA 2F3SA 2W93A 1H2RS 4H15A 4I5GA 4RQAA 4IV8A 3AJRA 2D1RA 2HCFA 2IEIA 3BSWA 2AR9A 4MW5A 4AQ7A 4QU8A 4EEKA 2AWNA 2O2GA 1GPWB 4K0KB 1H2EA 5A9TA 4FHCA 1PJRA 1F4LA 2OXFA 1C8BA 2C5EA 2ZFUA 3Q41A 4KOAA 2UZIR 2B61A 3D7RA 3VHQA 2ZUUA 1MQSA 4MLZA 4FZVA 2IYTA 3EW9A 2ZE5A 1VC2A 4EZIA 2PU5A 1UOEA 1VE3A 2J1LA 4C9BA 1ZHFA 2YQZA 2H1RA 2HRCA 3UO8B 3V32A 1EJ6A 1EH5A 3F3MA 3M4JA 1CQPA 3SBOA 4HUQA 3OEHD 5IN4A 3C3KA 4FI3C 3NEPX 4R1NA 3CE6A 3LDFA 4GT1A 2PUJA 1S89A 3AEQB 3AEUB 3KETA 1H4TA 1FP6A 1WUJS 1ANKA 1B0AA 1WQ4A 1NATA 2PBZA 4DQ0A 3HYRA 3NOXA 1KO8A 2OG2A 3I4CA 3UT0A 1E0SA 1CXZA 1EAYA 1JG1A 1BKYA 4NULA 4B2IA 4GNKA 1COWD 3S70A 2W4QA 2XUKA 4F4UA 3HWRA 1L4MA 1FLDA 3AKZA 2JGLA 4X94A 4AFNA 2E4AA 2FKNA 3K9HA 3DAHA 4EARA 1CY6A 1NKVA 1VSBA 4JC5A 2F6RA 3WIVA 5DTQA 3VAZA 4CEIA 2QN6A 4FCWA 5EPOA 3BK2A 5I9BA 5C8DA 2HA3A 2NZVG 3IMEA 4E88A 5LDDC 4TT8A 1AGPA 3T7JA 3FUUA 2P4HX 3KJZA 4C4YA 1RC8A 1DBRA 2O23A 4C08A 3JSXA 2DSNA 1T8PA 2KBEA 3QVLA 3ZS9A 4PQFA 4IH4A 1TU0A 1VI6A 4MR9A 1EMDA 2YNMD 3FDFA 2ONKA 3GLHB 1JFLA 1S2LA 2G4CA 2VUUA 4GQIA 1GQYA 5EWLA 4CU5A 4NXMB 2CE7A 4MKGA 1KE2A 2IBTA 1ZM2A 3T3NA 4OXIA 4FNGA 3KHSA 4P82A 5CJPA 5CLQA 3TW8A 3SU8A 4MW7A 1MB9A 2QD4A 2XTMA 5JFTA 4MEAA 3JRNA 5CT4A 1BFDA 2D2XA 1UDXA 3IP1A 1N1MA 3U2QA 3WYAA 5EZYF 3R9XB 1VMAA 4PQYA 3UT5B 2A67A 2E87A 3OCYA 1MTZA 4P5PA 3H5IA 3V3KA 1V5EA 2J9FB 1L4HA 4FFRA 4IJUA 4PAMA 3WK5A 3JR3A 3RWOA 3PI6A 2WMNB 1VHQA 3RKSA 4JODA 4CQLB 3SR4A 1YBAA 4RZ2A 4YRLA 3KT6A 4EMSA 2GCEA 1W94A 1YK1A 3ORYA 4LGMA 3GMDA 4RQTA 4QTXA 3O7MA 1FC0A 4IIYA 4EGFA 4OOEA 1XZKA 2BYTA 2O8FB 1GYRA 1N2CE 1F14A 1O6FA 2P8JA 5FWNA 4EJSA 5P8WA 1P0MA 2ZLBA 1R0ZA 1X7WB 3JAWB 3E61A 1XJCA 1N3IA 2FRXA 4JSRA 4M7OA 4O2BF 4U6NA 1I10A 3JD1A 1W29A 3CTPA 3HPQA 2B94A 3VH4A 1V8ZA 3R0VA 4UBOA 1OT3A 1KO7A 3K0CA 5IFKA 4MUFA 2BM9A 4NVRA 1F7VA 5LLSA 5JDCC 4HEQA 3F98A 4MUYA 3JARA 5KSYA 1CQIB 1PG5A 2HWKA 4MQFA 4QDJA 5IS2A 4TZ6A 3D6HA 3FYHA 3ZOZA 2W48A 3ZX4A 3C3XA 4CIDA 3FTQA 4DY6A 5I8WA 4X97A 2V8OA 3M6UA 4LCBA 5AH0A 3JZMA 5B2EA 3PA8A 4AJHA 4OAQA 3HLTA 2LD4A 3TRFA 2ZM5A 3REOA 4P3YA 2VSYA 1RXSA 1HV8A 5F77A 5EVJA 1TKAA 4NE7A 4QUJA 3VTAA 4Q3LA 4Q0MA 2QW0X 1FYVA 1JDJA 1YQGA 2ZIUB 4Q7EA 4X63A 4AW9A 2FG7C 4DLLA 2NTJA 3EXEA 1GCIA 4UATA 3LOPA 3SVZA 2UVDA 4MP3A 3WI7A 1ZIOA 1CF9A 1TQ4A 3IKVA 1A7JA 3PUVA 1M33A 5E4FA 3OBBA 1B0ZA 1Q0HA 1P4SA 5KYWA 2CDCA 4POAA 4DR7B 4RM3A 4RABA 3RHFA 2FMXA 4AJKA 5HTKA 5AW8A 3W5SA 3PE4A 4R1OA 6Q21A 3F2IA 1LX7A 3DD1A 2WVAA 3WLHA 4D0LB 4QFDA 3K3PA 2VNIA 3ANSA 3DTNA 4NMWA 4X8MA 2PUAA 3H1AA 1E0KA 3C6BA 2V9ZA 4EAAA 3GRZA 4L8GA 4BX9A 4CVNA 5JBIA 1HM5A 1K0FA 1KTVA 2FJPA 2H2FA 4YQYA 1N34B 4JBHA 1R88A 1E2GA 2RH9B 2JI7A 4WUVA 3RI3A 4F06A 4HAXA 4DNFA 2OR3A 2VKQA 1OROA 3DC7A 3IURA 3KDSE 4JUDX 4QODA 5EPEA 4AJEA 4ZMRA 2AQHA 3H13A 3BGIA 4L3VA 4Y0VA 5TB5A 5IKEA 4DR5B 5AI8A 2CXQA 2LCIA 4PZAA 1RAFA 4OL9A 5DNYB 2CZQA 2J7KA 2Q3BA 4IPTA 1N4AA 2XT9A 2B4YA 1KBQA 1VKOA 2NUPA 4R1MA 3FUTA 2Z8ZA 1GARA 3GV0A 2H7XA 2OCAA 4KYVA 4MNTA 3FRHA 1LCIA 4RX1A 4C7OB 2G1PA 3G5UA 4TN5A 1IHDA 3W2EA 2Z2YA 1CZNA 4JUIA 4YGXB 1SUIA 4XYGA 1DC8A 1M2FA 4FHFA 3EAQA 4AG6A 1LD3A 2O5VA 1P45A 4KEAA 1XQ1A 2L42A 2ECOA 4YWHA 3SICE 3WR5A 4ER6A 1MR3F 5KTRA 1Z26A 2R86A 5AUQA 4DIEA 3LQFA 1P72A 4J3JA 3H1GA 3HJUA 2IPLA 3ORRA 2EBHX 2QLLA 4D25A 2WJ6A 3IXMA 3RU2A 4YWJA 1WY7A 1X19A 2ZKIA 3HFJA 4OI4A 4PLFA 1JS1X 3D1LA 2I29A 3OFSA 4IJWA 3I52A 4ZOEA 2QUKA 1SC1A 4EF6A 3RYIA 4FMDF 4KLCA 3CNBA 4B3CA 3RLFA 3I42A 1GLNA 3L82B 1DG3A 1R9MA 1S3FA 3WYEA 4HDRA 1AMOA 5EAIA 1QVRA 5FR1A 3OSUA 4GOOD 4ENUA 3ELDA 5KYXB 1EZZA 1FQOA 3AF2A 2G08A 1L5OA 3D6TB 2OQRA 3R5XA 2H2AA 2H2DA 4ZT7A 2P2YA 3OZ7A 4WECA 3ZWXA 1LV8A 4LF9B 5HZHA 1QGOA 2X40A 1RR6A 3CONA 1I9GA 1ZA2A 3IQXA 3IRUA 4G23A 4XX0A 1VCIA 2WZQA 3V33A 5F52A 2OBFA 3PQEA 3QIAA 3QVSA 4LGYA 2XUIA 3AINA 3C43A 1JW9B 3BRWA 3HG7A 3VYVA 4J2TA 2DMRA 3KPVA 1H2AS 1YFKA 1MVOA 4JP3A 5EE5B 1CJBA 1ZM3A 2FHPA 2W2LA 1EXDA 2WE7A 3B9QA 3LDHA 4XD7D 1JJVA 1Y1TA 1MW9X 3QBDA 1C7EA 2CXHA 2IZOA 3OEED 4HTFA 5CD9A 3UWOA 3H1BA 3FFBA 4J7XA 3COYA 1T36B 1INLA 3HJRA 3PUZA 4GGMX 1V11A 2VF5X 3DE7X 3S5JA 4C22A 3P0RA 3WTBA 1C29B 2WIBA 1Z4QA 1J8YF 2Y1KA 3R5TA 3MJVA 3FHCB 3LNTA 3PGKA 3UW1A 3SOZA 1Q7RA 2BZ1A 2WYWA 3UXMA 4XJSA 3W05A 4HNTA 3O3NB 5FUMA 2J3DA 3QVUA 3IEMA 1OH5A 3ECCA 3UAVA 4AJNA 3FXAA 3MPOA 1XZGA 2R79A 3DHEA 2ONCA 1SH7A 4JLBA 2AZ4A 2VF2A 4FX2A 5CLLA 3QV2A 2C00A 5JNVA 2PX5A 3LWBA 4G6ZA 3WYCA 1E66A 3SX4A 1F8XA 3NRBA 1GHTA 2Q3LA 3LQYA 4BGDA 4M37A 3STXA 3GVCA 1NJ6A 3G2KA 3K1TA 4JUAA 4XWKA 3OQMA 4ENPA 4BIIA 4FKMA 4JR2A 3V42A 2XOKD 3QFRA 2R8PA 3ET4A 2B2CA 1QQ5A 1X9GA 4JLJA 1G2QA 1EHIA 4ZK2A 4K8OA 3ROPA 5LXTA 4TYWA 4ZICA 2A94A 4BFCA 3VU0A 5K0ZA 1I5RA 3ONWA 5AKXA 2VPIA 1EDZA 5K0EA 1UOQA 4ND8A 3RVQA 1BXRA 2HJHA 3AJ8A 2GSWA 4MI3A 4QBIA 1EVIA 4ZC8A 2KPOA 2ZJBA 3JD3A 1JQ5A 4YT2A 2BGLA 2XB6A 2ATXA 3ENNA 3PRYA 3NJ4A 5REQA 1CIPA 3GYGA 3VZRA 1Y1LA 4G37A 2HBYA 4QDXA 2I4LA 3RIEA 3ILHA 3QFTA 2IBSA 3BZUA 1X1TA 3LBNA 1M2VA 2GBLC 1RM4A 3ZE9A 3E9RA 3PQ4A 4PG8A 3FOAA 1NJ2A 2CBXA 2RI6A 3CSDA 1NVKA 3ESYA 3L4KA 4A2PA 4C07A 3C3DA 1R16A 1BGXT 1ACLA 3ZU4A 2QPLA 4MLDA 2NQTA 3NG1A 3RHZA 2H4HA 4C6SA 3UTCA 4FEGA 1RRVA 4DC9A 4F60A 1K6JA 1KC3A 3VR3D 4DNXA 3PNOA 1LEHA 2FZLA 4WFJA 2HW8A 1PE0A 4FEAA 2EBWA 4X91A 6YASA 5K0SA 1K8QA 13PKA 1BXGB 2YCLA 3PKJA 1OILA 3CUTA 3JTMA 1P29A 1BQEA 2AOVA 3DR5A 3Q1KA 5KQMA 4IICA 1WBBA 2J0VA 2R6FA 5CVEA 2XMDA 3D8NA 4YRBA 1DAHA 1E98A 3CPEA 1CR0A 3D8SA 1X8KA 4D8YA 2Q0QA 1NMXA 1WG8A 3CZRA 2VDVE 1NVBA 1LLCA 3A58B 2XCSB 1DADA 4D96A 4HAZA 2VJAA 2IHVA 5K5EA 1VBFA 2DBRA 2NXJA 4RVHA 1P2GA 4WMLA 3D3QA 3NWBA 3ZW9A 3K6KA 4F97A 2AZXA 2V4MA 3NOOA 4KFUA 4I19A 1E89A 3IB6A 5IUKC 1ES9A 5J63A 3SNKA 1FSGA 1HGXA 2J9YB 4LS3A 2ORIA 2PX8A 3T7EA 5LP6B 3TTUA 4K05A 1P7YA 2ZE8A 4GVPA 1YRWA 3INNA 4ILEA 4RELA 2I03A 2Q8QA 1P81A 3PQ8A 1RS0A 1C3EA 2QN2A 3PNVA 3UIEA 2W6QA 4UW9A 4CKEA 1GKYA 4KMMA 1O95A 2XDQA 3COZA 4E4TA 3HKCA 3UFBA 1RWVA 4DNPA 5J43A 1SG0A 4B7UA 2J4DA 3NIWA 4BX2A 4AKGA 4X8LA 5LQUA 1XTKA 2ZCVA 1CUVA 3KFLA 2QLJA 3DFFA 1TM5E 3NLLA 5D51S 1XMVA 3FM9A 2GYWA 3LDUA 1TMKA 4G4IA 3BTSA 1Z07A 3OF3A 2DECA 3MINB 4DCNA 2ABWA 1NUTA 4DLTA 4UPVA 4A2WA 4WKGA 5HKAA 2PLFA 1NQ5A 1OX6A 2QR2A 3IUSA 4Y8VA 3JR7A 1F0YA 4OGWA 3T5CA 1VPLA 3TW6A 4IGKA 1XIVA 1VRWA 1NQTA 1T4CA 1YSCA 4ILKA 5A5FA 2DPLA 4BC1A 4EUEA 2CV0A 4LF7B 1KOJA 1UBOS 1SKQA 1AKVA 1VCOA 3MUEA 4QQFA 5EXTA 3SEZA 3I76A 5ECWA 3L8CA 1TTTA 4PAOA 1CJVC 3FBTA 1QBKC 4G5YA 3OIWA 5FHQA 3ND5A 4I36A 3O3MB 1P1HA 1U80A 3L0CA 4HB3A 1Z06A 1DFIA 1SR8A 3M6IA 4OQDA 1CQJA 1I2DA 1RAGA 2FEWB 1YMQA 1NW3A 2Q0XA 1P9RA 1UFKA 4DEYA 1CDOA 1G21E 4XX1A 2PQMA 3GA7A 5IARA 3IHTA 5GZ6A 5FBHA 4BO7A 4F5EA 1RM0A 1YRAA 1NBAA 5K0NA 4IKPA 3RO7A 3WHIA 3HU5A 4IV5A 2NT3A 3ZHXA 3AHFA 4C0QC 4YCLA 4E08A 5I7AA 4DMKA 1RVDA 3U17A 4FUQA 4V39A 1F4PA 2PZMA 3TMKA 1CF4A 4XVQA 3A2KA 1GPDG 2EX1A 1AHPA 1DKMA 2PRJA 1IFXA 4E1AA 4MVJI 5M7EA 4ZO4A 4DCTA 1NRXA 5LOVA 3NO4A 2HSWA 3LSTA 3PX2A 2FP4A 5CBKA 4KSYA 1IDN1 4F4JA 2OCBA 1Y7IA 2FPUA 4Z2AA 3CO0S 5LYJB 1KVTA 1RYFA 2I6FA 1BS9A 1V1MB 4HFRA 1SXGA 3QYJA 2BCEA 5HPYB 1PHRA 1Z0DA 5C9ZA 3ROQA 5LJIA 4Q34A 2IH5A 3G8CA 1WU7A 1Q50A 4RKWA 4X3CA 1CETA 1I3MA 1KDPA 1KGSA 3AHEA 4C4OA 3KR0A 3QMVA 4U5XA 1MX9A 2Q1UA 1QX4A 3PEUA 2OP1A 2QNIA 1VE6A 4I4LA 4UHEA 2H1LA 5FFFA 4E13A 3EZNA 4R3WA 3AUYA 1KI6B 3DZHA 1YDHA 1ULAA 3MMZA 9ATCA 4II2A 1G18A 3EXHA 1L4LA 3I83A 5TVKA 3THRA 3VM6A 2QVZX 1H5QA 1QYCA 3UKOA 2GN4A 5FL7A 1JF8A 1NJ5A 3I1YA 4I3FA 5G41A 4M8KA 4U3JA 5JJBA 3FMFA 1KETA 3H2GA 3FJYA 3F8SA 5KJFA 4HJXA 4A36A 4XX0B 4GS5A 2WZBA 1P39A 2Q3EA 4ZI5A 3T3DA 1DWPA 4B0OA 4UNPA 4V38A 4H6PA 3G9UA 2EL7A 4JYMA 1DIHA 5K0FA 2V0NA 1URPA 3DOHA 1XMJA 4H17A 4M89A 5EE3A 1WHTB 5E6UA 4ZYZA 4PIMA 2C4HA 2JJ2D 2QWXA 2WPDD 4GWLA 4EG7A 3GJRA 3W9YA 4DLNA 1ULSA 1YB7A 3P0FA 5D7BA 4BO2A 4YRMA 3VKWA 5JQGF 3GLQA 2CVFA 2W6OA 2P8SA 1CRQA 3LY5A 2G80A 1ORHA 3EOBI 3PLRA 4OK5A 3BWDD 4FHDA 4W7SA 2XIJA 2D1YA 3RASA 1BKDR 3I8OA 2E4XA 1WR8A 4WFKA 4M1YA 2YWHA 4N0PA 1GIAA 4P6VF 5FOXA 4BN5A 4JXJA 5FFMA 1YF3A 5HQJA 1FFDA 1VMKA 2Z1NA 1RQLA 3KT3A 5C81A 4E3ZA 2P9YA 2QS9A 1MAUA 2L18A 2P78A 3A0RB 1AHIA 2FFAA 1ADFA 3JVEA 2GKGA 4P7JA 1JKFA 3LYHA 2VXCA 3L0BA 1DIGA 3DVLA 1P18A 1YL6A 1EWQA 2C5BA 5TJ9A 1NBHA 1P80A 2K4MA 4N76A 3FZQA 1VPEA 3VR6A 3O94A 2DY1A 2YVLA 4EZBA 3SXUB 4B81A 4BXOA 1E7RA 3DKIA 3A3YA 3FKSD 4TZ0A 3GPDG 4E5YA 1XRJA 2J3KA 4QPCA 2YV4A 2Q9UA 2GCPA 4XCVA 4CM9A 1SG6A 3ASYA 4EHHA 2BGMA 2C8JA 4BTLA 1Z5VA 2QG9A 3LBFA 4OIFA 1FS6A 4J0QA 2WD7B 2A9VA 4ND8B 1P17A 4JIGA 3Q7EA 4Z4HA 4PYQA 1OHHD 3CU5A 1JV2B 5AM5A 9LDBA 2CBGA 4OM8A 1NURA 1YKFA 5G2OA 4V0OA 3RREA 1ADBA 3H86A 4KX5A 3O8CA 5B53A 3BRCA 4MI9A 1KY3A 1YOBA 2X9QA 5JTTA 2I6XA 4PHGA 4N9WA 4Q9NA 3O8BA 3DO5A 1PWYE 4PF1A 3SAJA 4JI5B 1YS1X 2INGX 2RHOA 3G88A 5DP2A 4BC0A 3E9ZA 3Q8LA 3ZD8A 1UEXC 3W5JA 2O2CA 3KZVA 1OTYA 1FLVA 2X9VA 5ESDA 3SXJA 1OREA 2QAGB 3DSRA 5JPDA 1RIIA 4NV1A 1KDYA 2QJTA 4A73A 1V8OA 1RXUA 4QG3A 1FW6A 3S28A 3K4PA 1U8FO 1HQCA 3JD2A 4YRJA 2YRFA 3GO4A 4I4TF 2A4MA 4R2JA 2NQ8A 3NAMA 3I5YA 2CV1A 4F2HA 1US8A 2DKOA 6PFKA 3TO5A 2X0EA 3GQBA 4CL3A 4AECA 5AESA 1PQPA 1YACA 3HB0A 4YECA 3DVAA 1BOFA 2B36A 2C2ZA 1RWNA 3A1NA 2YHBA 3PYMA 2MSNA 3OA0A 4RV9A 4IG9A 1ZN7A 3MWEA 2J9ZB 1QIJA 1O6GA 5TMEA 1NC3A 2HWUA 1GZ4A 2N47A 3UG7A 4D6XA 2BFDA 4TTIA 1P1IA 3OLVA 1U2DA 5FTNA 4CTMA 1KZ6A 1PV4A 3GLFE 1W85A 2B7CA 3NKVA 1LI7A 1O8BA 4W99A 3DFIA 4E11A 2NU8B 3IIMA 3K8OE 3PQCA 4RCVA 4MRMA 2JHCA 2X1MA 3F3SA 4FSXA 3V9PA 3W0LB 5TE9A 4EQ6B 5DRTA 2JAPA 1NM5A 1UXIA 3KYCB 4KUEA 4ZO8A 3UMYA 4CKEB 5AW3A 3HBJA 2C5SA 2J0UA 2I33A 2D0DA 2RHLA 3U7RA 5CAEB 4M0DA 4WFQA 1ZOPA 5E3HA 3O0TA 1LPPA 3NBKA 3EVAA 1UK6A 5A3VA 2DLNA 3F6BX 5CNKA 5B57C 1DRKA 1QNFA 4N49A 2D5BA 5AVTA 4Y2JA 4QSHA 2CMDA 2HMTA 2GBCA 1N1EA 4HT3B 1YZLA 2LNDA 4DCJA 2VQSA 1JG7A 5K20A 4XYEA 5GOTA 2HU8A 3A05A 4C4AA 5IJ9B 3AEKB 1W76A 5I01A 2B5OA 4L15A 4N3NA 2ZRLA 4AZSA 2PS0A 1DAKA 1EVEA 3CG0A 4I2VA 1SUFA 2O1XA 1DG9A 2VZ9A 4RPJA 5ESXA 4D57A 1XDSA 3ADPA 4JLMA 1PUJA 4CW7A 4COOA 2BLLA 2NSLA 1GKIA 3Q8WA 4IX9A 4JP1A 4TUYB 1WVGA 4RKFA 4FFVA 2WAXA 1SC9A 3WX0A 1V5FA 5KB3A 3HXMA 3T4UA 3OE7A 2OZLA 1N6NA 3OBIA 1JLKA 1QR2A 2YN4A 2W2OA 2A5YB 5C2JB 4LZOA 2GN0A 2GPAA 4D9MA 2KX7A 3HM9A 4R1QA 4ZD6A 3HXTA 2H65A 5AJXA 4DAEA 3AU9A 2FP3A 3D8HA 4XPZA 4BNGA 3X1YA 3ZLBA 4EKGA 4OCZA 1QH0A 4G0MA 3GJ5A 4RA6B 5LC1A 1IXSB 1JZSA 1MW8X 2IZ1A 4F8EA 4S1OA 1TPZA 3SR3A 4COKA 2YOGA 3CRW1 2BRUC 3FIUA 1UDCA 1YMUA 1SRQA 1DBIA 1M74A 1XZDA 3QZUA 2Y8EA 4YRQA 2J3MA 2AD5A 2RHTA 2AG8A 1V43A 3LMKA 5EIBD 1OZFA 3D8TA 4JITA 4KLZA 6REQB 5FPYA 3OTQA 2YIDA 4EF4A 1BYIA 2HI0A 3LC7O 4IEFB 5CYOA 2WJAA 3FY4A 3KK0A 4YQFA 4X0EA 2XNSA 3E03A 4H1WA 3QIVA 4OP1A 3HXQA 4I66A 4TSKA 1UPUA 4O2RA 2FP4B 4NBKA 2XDAA 3VH3A 3TR5A 4E2XA 1JBKA 3SVLA 2AZMA 2CVPA 1S2MA 4F93B 2XRFA 2O6LA 1DBVO 2B8JA 1KQ3A 3F73A 4QPJC 4MRNA 4BRSA 3VR5D 4KIFA 3AH8A 1Z2DA 1VHLA 4P86A 1QF6A 3ZVNA 3QJYA 4PRKA 4BNVA 2BBWA 3R2JA 3HEAA 3DFKA 1P3JA 3AT1A 4RYLA 4NG5A 2BFMA 3NBMA 3F8WA 1PHPA 1XRSB 4LC1A 5EE0A 4EHIA 3VO1A 4XRGA 3U1TA 2HD4A 1TQ6A 2VNHA 3RK0A 2D00A 1JKJB 1CS0B 1QDUA 1TVKA 2BONA 4TRNA 5DNEA 3DWEX 3QHPA 4W5TA 1I2CA 4UNQA 5FYDA 2AZTA 1KY2A 1NQWA 3SX0A 4UEWA 3MAGA 3NM5A 3ITDA 1P33A 3PUJA 3PVCA 1DFGA 2X6RA 2XMBA 2D59A 4LNUB 4XH9B 3V1LA 3WNQA 4IFTA 3WL6A 3ZNPA 4CGYA 4UAUA 4JLVA 5CMLA 3LQRA 5LZ5A 1PL8A 1PWHA 3RC3A 4B5KA 2C4TA 5HIIA 1G17A 3VV2A 3PL5A 3HUFA 1BS2A 4RV4A 1RXCA 1NASA 3ZWNA 1KDTA 2QTFA 4Z54A 1R6BX 2G25A 1MA3A 1SMKA 1TCCA 4JSYA 1XVUA 4GI5A 1QOZA 4BAUA 2QPTA 2DSTA 4TKMA 2QL6A 2XNJA 3KR2A 1BFUA 1RXEA 1HYEA 1QIDA 2XITA 1EKXA 3WWEA 3ZVMA 1U4NA 1W2GA 4IZHA 5FTJA 4PC3A 4Y30A 3TDKA 2OAGA 4Q6BA 3FROA 1T0UA 2V6FA 4HG2A 3PEFA 2AQ8A 2QDXA 1TZJA 4ABYA 4NU5A 3QXGA 1M6NA 2O3RA 3C5VA 3LS2A 3OLXA 4O4HF 4ZWNA 4BNWA 1Q2UA 2WUGA 2PZAA 3FYTA 1SXJD 3FCUB 2YJ5A 4D4GA 4GDMA 1T3LA 5B3JC 4H59A 2JEYA 3IEIA 2GCOA 4FVTA 4E0BA 1NN0A 1JLMA 1PZEA 4IH1A 5ALSA 1EFRA 3FA2A 1TZ2A 2X0NA 1GAQA 1SCAA 2R25B 4AKTA 1WU8A 3L0OA 3X44A 2W00A 4CLHA 2G04A 1C7RA 4XQCA 4C0KA 5E1OA 3FPGA 3B6KA 4PXSA 3EIFA 1HK7A 2O5CA 4BV2A 1NXVA 4JLSA 4I3GA 4G4SO 1S2GA 4RH3A 1G5TA 3QPUA 4RAOA 5JS8A 2A9OA 3HDVA 4JT8A 1X80A 4LHYA 4BP3A 4XSVA 1KF0A 1OAOA 4EJ6A 2YICA 2P9TA 4KXUA 3REGA 3VR5H 1PEDA 1RNLA 1DE0A 1V3TA 3F7TA 2X2FA 2QMUA 2HQBA 3RUCA 3WIDA 2ALJA 3LHKA 2PLNA 4R71A 5C5CA 4TWAA 1JR2A 4LX8A 4DSNA 1BXKA 2AKAB 2J5XA 2B1JA 1G4AE 5DHPA 4AYXA 1WB6A 2KSQA 3EF3A 3A6ZA 5FWXB 1OBOA 4RLFA 3GG9A 4YRCA 2IZ5A 3UK1A 2WE8A 1U0JA 4HPJB 3WDLA 3HNOA 4HL6A 3JQFA 2ZIXA 3HCNA 3QKSA 4IDFA 2H0RA 1Y9DA 4XGIA 1JWBB 1Z88A 3F78A 2NOAA 5KWSA 2VT6A 2XADA 1G8MA 3D0OA 1V4VA 2ORWA 3I2HA 3LIPA 3PXEA 3R3WA 4WXRA 3V8EA 5J1SB 1JFVA 4IM7A 4JQOA 4LAFA 3CX8A 5FNVF 2GZSA 2HZBA 2YNMC 4RY9A 2K6GA 3A37A 1T6YA 2F3TA 4M49A 3KDAA 4EGJA 2O59A 1H8ED 3OCWA 4EW6A 3DO8A 2WWWA 1ZSVA 2P2LA 2K87A 3W3AH 2F62A 5COQA 1Z5OA 4QXOA 1NF2A 1V9SA 4JYZA 4YK7A 5JH7F 1LQ2A 2CLEB 3HKDA 3LPNA 3P2YA 2XMGA 2VHZA 3A31A 3ZU6A 5AT1A 3TZBA 1LPAB 2PT5A 5J2UB 2D7DA 4AIRA 3OCXA 1W75A 3RS4A 5KMGB 5CVUA 2JGJA 4DRXB 4WUTA 2DQKA 3KPUA 4HEA1 1KBZA 2ZJYA 1YS7A 2VHYA 3BAZA 2B1IA 1U3GA 4GKBA 3K32A 3KD3A 3U0BA 1EUCA 4W4TA 1F9AA 1HE3A 3UMRA 2ZI4A 2W83A 3H0EA 3N7TA 3TL3A 4ZXPA 1PX2A 2V7GA 3DLHA 2GRUA 2H63A 2PUHA 3OZGA 2IX9A 4PR0A 3UANA 1EDOA 4AJ2A 2H59A 4TQUS 5A7FA 1HNNA 1E3DA 3QOFA 3IEPA 3H16A 1S02A 3AVUA 4MVYA 4RVSA 5GJVC 2Q6TA 4EB8A 1C4WA 4HWRA 1HX7A 1QZZA 4GSKA 1Z7GA 4XWTA 2F1KA 3RTBA 5KSOA 1IN7A 2C5LA 1EYZA 1XEFA 3NBYC 4NC9A 4WVLA 1I1QB 2ZRFA 3OCJA 3VR1A 2DXIA 4JI2B 4OBBA 4GO1A 5DLEA 1GTRA 4AZTA 2ODBA 3K9LA 2WINI 3Q6NA 3TLEA 5FEMA 4BLVA 3F4BA 3WLRA 4MW1A 1N57A 4DADA 2JH9A 3ELUA 1CG6A 3OF5A 3KKOA 1B8VA 1M6VA 2W8BB 3RU3A 5A7HA 2UUAB 2ZRJA 3DA8A 3PJRA 3BOSA 3KP1A 3QHAA 4WPGA 2IWHA 3U5ZB 1QJCA 2JLRA 3UGKA 3V00A 2F8TA 3BFPA 4I1YA 3LUGA 3BQNB 4QOHA 5ER9A 1B26A 2GM9A 2G9UA 3ETGA 4RLQA 2ZTLA 4IIHA 4P08A 2FCAA 5EEGA 3KSRA 2ATIA 3U3KA 1C3LA 1SUAA 2OGWA 1VFPA 2ZITA 3MA0A 3ORHA 4MVXA 5DBEX 5JSZA 4XA8A 3ACCA 2GNPA 1I4EB 4LBYA 3TGPA 3HFSA 4KTTE 5TPWA 1U2EA 5IM4F 1H8HA 3OWOA 4BDSA 4ZV4A 4NZMA 1Z6QA 4BQFA 3Q85A 3TTXA 3K0HA 2NXEA 3PGXA 1H1LA 1DHRA 2X77A 2UV8A 4D9JA 2WYHA 4B87A 2Y99A 5JDIC 3ACDA 1E1MA 2NZJA 4DREA 2P65A 3A1CA 3T0GA 2AXQA 2Z5LA 4G0WA 4B3JA 1EDBA 2R96A 2PFKA 2CNLA 1F6DA 3VNQA 1ZH6A 1NA5A 5HHTA 3KBOA 4D3DA 3LUDA 3I04A 4RVNA 1XN4A 2CD7A 2VAMA 2YCBA 1DCMA 1UFOA 3A25A 4QG7A 1PNOA 1KK0A 1XRNA 4KLNA 4KQEA 1TFUA 4MO9A 5K99A 1XEWY 4CLRA 5DTJA 3ZTWA 4G5GA 4RK7A 2QTHA 2XODA 2GJAA 1IJEA 3HKBB 3ASVA 3AUUA 4Y9TA 721PA 1XV5A 3OX1A 1IHUA 2IZ6A 2EBFX 1WUHS 4LW8A 2DBQA 3AP3A 3IDZA 1EX6A 1A8HA 4R16A 5DHAA 4IDPA 4WXHA 4HXFB 3S2UA 2WSBA 3UMVA 4AZ3B 1Q1GA 5B7QA 4I14A 3EULA 4IOMA 1WZUA 4UDXX 3UWKA 3WJ7A 4MUAA 2ZXUA 1Z0ZA 4LCEA 4TVOA 5ERYA 1DWQA 4HAYA 2R7AA 5JMTA 2AS0A 4OHBA 5D3MB 2FPWA 3Q9UA 4H27A 4RY2A 2FW8A 3SQDA 3UG6A 3BFJA 1R27A 2DQZA 3IP3A 2ZUVA 4PCUA 5JEDA 1SCBA 2DR3A 1LXCA 1SQ6A 1ZMXA 4XB2A 1R4MA 2PCLA 1AMUA 5I47A 5LPNA 1A5AB 4M0UA 2AC7A 3MT7A 3W9SA 4INJA 1UC8A 4EENA 5CDYA 2O2YA 3Q9SA 1RKUA 4OUDB 1PZGA 2R6DA 5FIUA 2JVJA 3X2SA 1CY7A 3AOEA 4LTDA 2XNDD 3HLKA 2OP0A 4N40A 3SEQA 3WGJA 4OATA 2W98A 1PR0A 3H17A 4TKZA 4DOMA 5IVKA 1O5TA 1BOOA 4QPPA 4L7VA 5AMXA 3QLVA 3AX6A 1T3GA 1VLZA 4YRAA 1WAMA 2AV6A 3IPRA 1GRNA 4YXWA 4MS1B 2FUEA 2O8EB 4UCQA 2ZWAA 1XCOA 2ZUDA 2EFHB 1RYEA 4TQAA 2AVDA 4ARSA 4P7BA 4CG3A 5KDOA 5KNBA 3PEYA 2HSEA 2XAAA 1DEXA 3EGDA 4GP7A 5CLGA 4BO4A 5FPHA 2XUDA 1E7YA 1NX9A 4RZXA 1KPHA 3JQEA 4MQEA 3B3QA 3PQ5A 2BEKA 2IHKA 1M73E 4QM6A 1DKQA 2IYYA 1L4GA 4MV6A 4B8YA 4QICA 3LY8A 4BGUA 2VDWB 1USWA 2YJ6A 1FUEA 4UD2A 1G3QA 2QMZA 3L9WA 2PG3A 2ZSDA 4YJHB 2QG4A 3T3GA 4ZVQA 2XWJI 4GMXA 4XGNA 4AKEA 4UUQA 3WLIA 1W52X 3OU2A 2Y1LA 1SWWA 3KXKA 4RW0A 1WLSA 4EG8A 3LUHA 1P4HA 2ZR0A 2GCOB 5BPFA 1ETHA 2LDBA 1X92A 1N2HA 2IT1A 2MSEB 3EBOA 4LY0A 4K46A 4R6XA 1A4XA 2P62A 1N2OA 3RFVA 2C31A 3H4IA 3ORFA 1R6AA 2R1TA 2AEFA 4FHEA 1E9CA 4J43A 5AVUA 3II6X 1IHOA 3L1JA 1Q11A 3NC4A 3KQNA 3DTVD 3MBOA 1UM9A 2V5VA 4PS0A 3OIYA 1M76A 1T43A 2GPSA 2J85A 4IQFA 3SKXA 1U0RA 3QOYA 2Q6OA 1K27A 1Y8AA 1E7QA 1QP8A 1SVKA 2EHDA 3OOHA 4ZU6X 3V8RA 2PRYA 2X3UA 2J5BA 4X61A 4BNHA 1EK5A 1ZAKA 2NO4A 2N3ZA 5TEVA 4BO9A 1H9CA 3N0RA 4A6EA 1IN4A 4J16A 3THXA 1I01A 1ABEA 3LBHA 1C7FA 3ON5A 3PFIA 1YO6A 4RZIA 2Q0SA 4C3VA 1TEHA 4AMBA 4DARA 2Y0EA 1S01A 3QUCA 4Q9HA 3GDOA 5IC6A 4PFJA 5ED0A 4BJ6A 3D4NA 1ZOOA 1XTUA 4LECA 4J75A 5KX5B 3M81A 5AJZA 1STOA 3HKEA 5DK4A 3BMQA 1LZLA 5JZSA 5M2QA 2J5QA 4Q82A 4B6EA 3O47A 4E7PA 1XTVA 2V74B 2P7HA 1GNVA 1AQ6A 2O3JA 1CE8B 3Q10A 3BXXA 3NNSA 2BGKA 2WM3A 1D2RA 1TPYA 1YA4A 4MEBA 3OJCA 1C3OA 2B7LA 4EEZA 5AKJA 5IKPA 4LFBB 1IM8A 1ZI9A 1ZUNA 1KYVA 2AMJA 3A3PA 4R5HA 2QMHA 2JI4A 2O3TA 4CL2A 1F51E 1B8UA 2O5RA 4NS4A 4OI2A 3W78A 3ZPXA 2DR2A 5BMVA 3HCDA 5CIYA 1NR1A 2MYTA 1N5IA 1V3VA 2H4FA 1F20A 1P5JA 5AW4A 4Q93A 1UADA 4ZHQA 2BBOA 5IRCD 3RWMB 1R6TA 3ROZA 2BHTA 5LBTA 4BE7B 2C7RA 3IUJA 4YI5A 3JZDA 2IYQA 5HW0A 1UWVA 2X9NA 2QKYA 4OKIA 1KSHA 3B53X 3WGTA 1AKTA 2OBXA 3GFVA 1DOZA 3AI3A 3SJCA 3CZQA 2XKKA 1HFJA 1BMDA 1VJRA 2H2HA 3IILA 1OX5A 5BWOA 4REMA 4BZZA 4UHCA 2PV7A 4RDXA 5BR4A 4MMZB 1XTPA 2XUFA 2R5NA 3CUEF 4MS3A 2EDCA 3AJEA 1H9AA 3GELA 3K96A 3O31A 2BPOA 4QBTA 4IOLA 3S8MA 1I24A 2I67A 1PUXA 3D43A 1RZRD 4MV4A 2BJWA 2ZRQA 3ME5A 5FOSA 2B78A 3UH1A 2E82A 5EP3A 1YR2A 3CN7A 4DLPA 4DLKA 2GPJA 1UIMA 5B58T 4UU1A 2ZBFA 2AB0A 3DQZA 2X14A 4KV9A 3UHAA 3HBAA 3IE2A 3UAXA 3FBWA 2HCJB 4MIOA 5H83A 2CMFA 2VDOB 4HWPA 3BB3A 4TMZA 1RLJA 2VWQA 3Q9NA 2DP4E 3C5CA 3U3JA 5BV0A 2BEUA 4P0PB 2HF2A 4AY6A 4UE6A 3DXYA 4INZA 1PR4A 3HY3A 2TSYB 1K7SN 1ZW1A 2IW1A 3LZ6A 4R9RA 3OUUA 1RXWA 2CGEA 1PT7A 1P6UA 1TW2A 1DEHA 2DT8A 1FFAA 2XH8A 3MFQA 4F0JA 1XMQB 1HDGO 1J2YA 2IDKA 1GQSA 3W34A 5LXTF 1WVMA 2WU3A 1NVTA 5D6NA 3W7AA 2PZEA 4KKXB 1T1GA 4U9HS 4EPRA 1JH8A 4LXTA 1TF5A 2OVFA 4MAFA 2GR9A 4DV2B 3GLGA 2D4HA 4YDRA 4PVDA 2A9PA 4LGCA 2Z2IA 3L6DA 3ONVA 2QUAA 3BWXA 3DG9A 1M2GA 1SN7A 1TK9A 3V1UA 3TD9A 2MSDB 3CZCA 4GM4A 3CB2A 3F6CA 1CR6A 4QU0A 2B4KA 2IXGA 3DZIA 3DP7A 3R76A 1W5AA 4RTOA 4M0CA 5H7XA 1X1DA 2OGZA 3EGWA 1H05A 5EHXA 1HFWA 3IRVA 5JFGA 2BFEB 2JJQA 1EWRA 4M22A 3T3HA 1FXUA 1C9YA 3E3AA 1ZSNA 4J7CA 1LX6A 5JCPA 4M9RA 3QXXA 4DSZA 5C4MA 3FSJX 4KDCA 4O0LA 4AULA 4LJ8A 4V2UA 5EZSA 3BTVA 3TFOA 3GA0A 3IIJA 4YUYA 2G0NA 3NW9A 3JY6A 5GWXA 1A50B 2FMKA 3FNEA 4Y2XA 4BFYA 3URKA 1JZQA 2ETXA 3QUTA 4MPRA 3HEBA 4QEKA 5ALNA 3VUFA 1GDTA 4B31A 4CLRB 2ZKLA 1G2OA 1DBPA 2HB6A 4AF7A 7MDHA 1LSJA 1NNLA 2ARKA 5HXAA 3ZGXA 1JIJA 4IBOA 1R37A 2CMHA 4KVFA 1EU1A 1YASA 3KE9A 2BISA 4CV0A 4D97A 2X58A 2UYOA 3LHDA 2JI8A 2LR0A 4O02B 2Q7DA 3O8OA 4NIMA 5AXDA 4YRFA 1DKRA 1I7SB 3EQ9A 4KI0A 2V6BA 3FMIA 3JYHA 1BMQA 2IPMA 3ETEA 1MAHA 3L4SO 4RFSA 4QYTA 1OKKD 4TV9B 5CIQA 5HS6A 3VC7A 4B80A 5BSEA 1I7QB 2ZT8A 5C1PA 1ABBA 2EKDA 3OZIA 3AETB 2FPMA 3T3IA 1J8VA 5JAZA 1E2UA 3QVVA 2BMFA 1XP5A 3WGNA 1HDIA 3UAOA 3ZWOA 5KZMB 4KPEC 2PMDA 4OBEA 1P2VA 3HJBA 5DN6D 3VC2A 4HQRA 2YW9A 1OD6A 1KEEB 1L4KA 4ZYVA 2DBVO 2W43A 4EY6A 4DBVO 1QVAA 2ZTVA 4YQZA 4EGCB 3UM9A 1AKYA 1Z25A 4NPHA 3R3XA 4ARAA 3QELA 1TIBA 4KZKA 4LRSB 5ALKA 1CZOA 4S1WA 1NJFA 3JWHA 4G0QA 4HN9A 1K1EA 1OI2A 1P6QA 3NXSA 5D8DA 4LCJA 4DQXA 1X42A 1ZG3A 4U6QA 4C3ZA 2VJYA 3LF2A 1HUQA 1ISGA 1P0IA 2HBQA 2VYVA 1JXMA 4NOLA 1I6LA 2GK3A 1G8YA 1RHRA 5LZ7A 2PDAA 3TD6A 3D2CA 2QRGA 3EGDB 4L5BA 5TQ2B 4TMYA 2RHHA 3U3DA 3BJZA 3D5QA 4BV8A 3PEWA 1MGOA 4CMCA 1M34E 4XASA 3NIDB 1OX4B 2OA0A 4E5KA 2CUZA 4D42A 1S3IA 2F3RA 4RTSA 2QQ5A 1GILA 4O1IA 4BNMA 5HIAA 2ZIGA 2GZ3A 4GMGA 2MMCA 3EZ7A 3PWKA 4RJ2A 3ADOA 3ELBA 4PQGA 2WAYA 4FOPA 4C4XA 4NZYA 4EHDA 4BHTA 3KVYA 1E1RA 2X8JB 4LRYA 4YYZA 3IAS1 2Y3IA 1YVUA 4BGVA 4RTMA 2UZ1B 4K40A 5J4YA 3ADBA 2J6CA 3BB4A 2WLSA 4WCFC 4XOUA 4FDUA 4M55A 3GYBA 2JFOA 2OCGA 2F67A 3WZMA 1QU2A 2SECE 4JJFA 2AEMA 2QPOA 5DZSA 4BECA 3M4YA 2YY6A 2O2HA 5JALA 1BEUB 4LOLA 3S2FA 1TIPA 3G2OA 2XAUA 1XEXA 1EFPA 1R0XA 1I4OA 4N1AA 1PQUA 4D4IA 1VBKA 1W49A 3PX3A 2VR1A 3ILVA 5DO9A 2O07A 1P91A 2V5AA 3ITKA 4Y2GA 1ENYA 2WIFA 5KS2A 4W9MC 4A27A 1Z6PA 4F1JA 4S2UA 2FFBA 5LOVF 4DR1B 4PCAA 2V8BA 3F1KA 3RODA 1RRFA 1WXXA 3UOWA 4RIIA 1MC8A 3ICVA 5CFPA 1D6SA 1ZM4A 3LC2O 5BSRA 5AVYA 1HLFA 5FI0B 2C42A 3T3EA 3SE7A 4KO8A 3KU1A 2OTCA 3L0PA 2TMGA 3HB9A 1T2NA 2VK1A 1W25A 4OGKA 1VG8A 2B21A 1E20A 2E49A 1ENPA 2ODEA 2UZ3A 3AC0A 2OO3A 4UKDA 4PICA 2YS6A 1AUOA 1RHQA 3EC2A 5ALWA 3VI4B 3VPGA 2ZPUA 3TZQA 2A1TS 2XYPA 4X24A 5C51B 2O8BB 2GX6A 3M6VA 3IMKA 1J42A 1JPNA 2NN3C 3CQ9A 3KWMA 1YS4A 3M6WA 1SBHA 4RY0A 4RIGA 1C3OB 1U2SA 1M2NA 4UUBA 2KE5A 4OREX 2VYQA 5FA6A 1ZUNB 2ZI7A 4KMSA 5KOYA 3KQWA 5BUCA 2DHEA 4WI1A 4H1VA 3WRYC 4YEDA 3IQIX 3AY7A 1E2JA 2W2XA 4IVNA 4ZAVA 2OO5A 5TPZA 3K72B 3F5DA 4R7ZA 1WSDA 3A1EA 1GG2A 3K8QA 5JC8A 1GVNB 3A10A 4QSMA 2HCTA 3UJDA 3KKMA 3F4LA 3TPZA 4E94A 4LFAB 2XBUA 2VHWA 1A71A 4UHJA 2BMDA 1Q0UA 4C7JA 4IDAA 3T8YA 4DMMA 3QA3E 2IP1A 4P8RA 2AKYA 5HYVA 1FSZA 1U02A 3IESA 1VJCA 3RVPA 2QTVB 3PFNA 4D82A 1Q0LA 1Y8QA 2H00A 4DGQA 3HYTA 3QTLA 4G5SA 5AM0A 7YASA 5EJ2A 4Q05A 5ALUA 4BKPA 1IEWA 4C4TA 2FVXA 4RIFA 3U39A 3T34A 4OK6A 5FOUA 3V7UA 2WICA 4MV0A 2AW5A 1L4EA 3KHTA 5FT9A 5K8UA 2G88A 1SVLA 4I46A 1UJNA 3PQ2A 4WLEA 1M5TA 3W5VA 1ZI6A 2PAFA 5CG1A 1BCRB 4HQOA 2X0IA 4GVLA 2IYEA 4HNGA 2PKWA 2A9JA 2Q3FA 4R2XA 1C9JA 1YIDA 2HREA 4S1TA 5B5SA 5CVTA 2A9RA 3AXSA 3GUYA 5AOCA 5CTJA 3VDNB 1PO7A 1PX0A 4U63A 2N42A 4GQAA 1GJRA 2JGFA 2HM7A 3B9RA 2VVTA 3GQVA 4QHTA 4C3OB 2QAJA 2BEUB 2Q41A 4XDYA 3VQTA 3F9RA 1AQJA 4DDTA 4HYYA 4D8WA 3WGHA 3AHCA 3MILA 4FZJA 3S5UA 4BMVA 3VDMA 2E5LB 4RENA 1SBYA 2RGNC 1VPTA 3LQKA 3VOTA 3C5HA 2Q3CA 3IQDB 1R15A 4CFYA 3EQZA 3FW1A 4PXYA 4WOKA 2YR0A 3QE3A 3WVNA 4NCIA 4OHVA 4ED9A 2KW5A 3A1TA 3WO1A 4QIHA 5TQJA 5BV1A 1N9GB 2V98A 1K6MA 1LNQA 3N0TA 1U3WA 4PQEA 2HJSA 4RBNA 1KI3A 1XK7A 4E21A 1MQ9A 3NWJA 2NO7A 1ZY2A 2EC5A 3D3KA 1V8DA 2Q45A 4CQNA 4TLMB 4J8PA 2FZ5A 2X0KA 2MSLA 1A72A 3CY6A 3H5VA 3JAMA 2NTYC 5AW9A 1N0VC 4A23A 5LMNB 4I50B 3MZ0A 3JQ8A 4CF5A 2A1IA 1LKZA 3HY6A 1J7KA 4W1RA 4S12A 1RLTA 10MHA 4Q9LA 2GPWA 2IY7A 2WKQA 2IV7A 3KTOA 3WWCA 2G83A 3H4TA 3WKCA 2PCJA 3R40A 3TRHA 4DIMA 4YRGA 5KNDD 2F1HA 5AKHA 3D3WA 4RGYA 1XMPA 2G17A 3TOVA 4CMHA 5KYGA 2GYYA 3JYQA 5CNIA 1GY8A 2J0EA 4ND7A 4U6SA 1T2AA 4JL6A 5KHAA 1AKMA 5LU9A 4KJZA 1QS0B 1FDTA 1SC3A 5EIBC 2ZI3A 3RSGA 3P4XA 4FJ0A 5KBYA 3I8XA 4J07A 1P62B 2Z6QA 3EVGA 1ND6A 3N8NA 3U62A 3DL2A 4UASA 1JJAA 4RCYA 1NTOA 2CNBA 1K7YA 2GEDA 2WOOA 2QZJA 4L07A 4TMXA 4ZVTA 1VYUA 3TEJA 3O8OB 1N2GA 3EVEA 1RAEA 4GM1A 2B20A 1C3VA 2IEBA 3CVOA 3G1WA 3CKKA 3RYFA 1TJ3A 2QU8A 1GZSA 5EUQB 3FWKA 3ONDA 5IU6A 2PT9A 2CYAA 4C89A 1T6BY 1B8OA 3KRTA 3CNHA 4K26A 1SIWA 4UE3S 5A3RA 4TYMA 3CLSD 4HAVA 5WRFA 1P44A 2UAGA 4UE2A 2XTNA 1KP3A 1HA3A 3T7SA 1LS1A 2QT9A 3SWWA 1P4JA 5KU7A 2P4UA 2YXBA 1XD9A 1W8DA 3MGBA 1YDEA 2IXAA 3QU7A 3H11A 4U2DA 1TLTA 1U8CB 3C16C 5CX1A 5JLAA 4B43A 1ORRA 1IBMB 5FA8A 3O75A 2GTPA 4WCDA 1V2HE 5DX0A 2WFLA 1W8IA 3CF4A 3I9NA 5FTLA 5CFMA 2WQZA 4R9VA 2LTAA 5E4JA 2RH5A 1CUWA 2ZAIA 3QU4A 3L6CA 2XWQA 4NKRA 2ID9A 2V7TA 3NASA 4YRDA 1BD3A 2QG6A 4AO8A 4D41A 4RK6A 5HVNA 4B3GA 1BTOA 1W4AA 4JJAA 3V7YA 3VDXA 3A6HA 5LR6A 1O9HA 2COEA 3I2GA 5TS3A 1NUHA 1QG4A 4KVAA 1P8AA 3WYFA 4R9SA 1ZMOA 1MABA 1KI7A 2H1VA 1K68A 4MWZA 4RMHA 1T6XA 5FNZA 1X7YB 2VAPA 1WV0A 1QHIA 2DH5A 5FTKA 4LIPD 4F92B 3IL2A 3BSSA 2FPOA 3TZ6A 3GAZA 3W8RA 4BMYA 3KJNA 5KOIA 1XJ5A 5HP4A 2EG9A 4J2HA 2BD0A 4N65A 4DWWA 1V1RB 1J2JA 1XNGA 1AM4D 2V1XA 3BGDA 3GRYA 1ISHA 3L84A 3SDZA 1KL7A 3KLNA 3MOIA 1A3CA 4JVLA 2RH8A 1IZ7A 4R0NA 3TW0A 1RRKA 1JIQA 2AQKA 3M5DA 2QP9X 4CQJA 4B3MB 3L8GA 5KNDH 1GL6A 5JRJA 3GJZA 4UAJA 5DNAA 2UVPB 3VTZA 4HS9A 2D5IA 3OQPA 3OICA 1SXJC 1I8TA 1G7RA 3F6PA 3ND7A 1TLLA 3BRSA 4DMCA 1FX0A 4Y7CA 3JAKA 2PANA 3FNBA 4Z1OA 2GRJA 1D09A 1OGYA 4OOFA 3VR0A 1YFZA 3B2EA 1THTA 1C30B 1ZNYA 1LW6E 2XVXA 2VWPA 3CCFA 3N7AA 1JHQA 3O93A 5DHFA 3T52A 4JB2A 3W2HA 1IB6A 2ZPTX 3U80A 3UTDA 4OJMX 1EZ4A 2RHRA 3GJ0A 3LUCA 3L93A 4K9NA 2Y68A 4UAGA 2BZ0A 2P3LA 5EL0A 4XEHA 1ZL0A 3B5JA 5ELXA 5EXEA 5IZCC 3NR2A 4GYKA 1XU9A 1U3TA 4RDIA 5E7QA 3O2NA 3SOPA 1XLTC 1DOAA 3CJRA 1U81A 3QM1A 4B32A 5JDCA 2H1WA 2A5FA 2PK3A 2GZRA 1OH8A 4OHCA 4NMXB 1IY8A 3HR7A 1KEUA 2H1FA 2V03A 4Y9DA 3VX4A 2VJOA 4QVGA 1KJZA 3GHHA 2VP3A 4N41A 1II9A 3UEOA 3QX3A 1V7CA 1T3SA 4C5BA 4NMMA 4B6QA 2C2WA 4D8UA 3Q8KA 2EWMA 3PTZA 4URUR 5KYTA 2LRHA 2WWTA 4E22A 3PJEA 1R4NB 3EVTA 1PJTA 2EW1A 1W2HA 3E0QA 4YV2A 1GRCA 2CJPA 1U2QA 2PXXA 2GD6A 2BY4A 1JA1A 1KK2A 3ZHTA 4FC7A 4O59O 5EUCA 4YRZA 1KKLA 1OXBB 2HO5A 4KNYA 3C8HA 2FKAA 1ULTA 5AUOB 2PZLA 3MJTA 3S68A 3O03A 3ZDXB 3I04M 1VKHA 3JPWA 3ZDFA 4U9IS 1NLZA 2PVSA 1RJFA 5G4KB 1LSUA 2OBYA 2PJUA 3CRZA 1QLHA 4PGGA 3T35A 5BY2A 1SQGA 3VH2A 4HDAA 1A04A 4B8WA 4G0OA 1TCAA 1TMYA 3B3AA 3EGXB 3PPVA 4IOJA 3GEMA 4OSOA 2C20A 4HBGA 3OQBA 4L02A 5E1DA 1JA0A 1GNPA 4MRVA 4X00A 5BQPA 2ZVDA 3EXIB 2GF9A 4H7HA 4QBHA 2A0UA 3ANXA 2QVXX 3OLQA 1C1XA 3S40A 4I4CA 5IX8A 1HNWB 4DLXA 2A59A 2R60A 2HLPA 2CVQA 5LM3A 3DE3X 3N9IA 4WJLA 1MFZA 1PNVA 3DPSA 3IC5A 4NBWA 3WBJA 3FLAA 5JIBA 3PNYA 2A8YA 4Q9KA 5H02A 1E1KA 1RCUA 3U3MA 1XC7A 3I6QA 3R3HA 4LYFA 3DMNA 5IYZA 1JHXA 1XSEA 2WUDA 2C2KA 1FYXA 2QRPA 2XVYA 2GPTA 3CR3C 3OO1A 4ID3A 4C1NA 3GT7A 5BN4A 4DB4A 3OM0A 1G9TA 1E9DA 1G7TA 4O1MA 4YO7A 2O8DA 1SXHA 3WGOA 4GP6A 4F96A 4XJVA 1QGYA 3KUKA 3MWLA 1GPH1 3OZTA 4MO2A 2B0CA 3SD7A 5CM2Z 5K51A 3PD1A 1GPYA 1YL5A 4GR4A 4CHGA 4ZGWA 2P1ZA 2VHUA 3U61B 1WPRA 4U02A 2IU0A 1C0PA 1ISRA 1YOVA 4HGYA 4WT7A 3GJTA 4L6AA 4DG5A 3QX9A 3UJ8A 4YALA 1BJRE 1GGVA 1VKJA 5GJCA 2FW1A 1T10A 1W19A 3N8IA 3QMPA 2E2WA 1QQTA 3ONFA 4XIGS 2IYPA 1RHJA 2WF8A 3DULA 4YYEA 1A2QA 2WQ7A 4PQRA 4NE2A 2O4CA 3QG5A 3PGA1 3VPFA 4XR9A 5LBIA 2H1CA 1VKNA 1M7HA 2QN1A 3OM8A 5HE9A 3VFDA 1Z2CA 5C32A 1MLDA 3T15A 5FPPA 3CEJA 3EF0A 3IELA 3PS9A 3IVCA 4M87A 3LZCA 4KXQA 3CMMA 1H1DA 2NZWA 4FFWA 2ANBA 1FDWA 1ZU4A 1PNTA 2RI0A 5E8RA 5DM70 1CP3A 3DLBA 1QK5A 3A11A 4XKJA 3WGLA 1YJCA 2NXCA 5EJGA 5ALHA 2QBYB 5D7NA 1Y89A 3D3WB 2CHFA 1YJQA 2P2DA 2BKEA 2JASA 3BBLA 1ZOIA 3STVA 4BWFB 4BY9E 1UKCA 3I34X 4JKOA 1C2YA 2EKBA 3H4MA 4V03A 2JAQA 4FCTA 3MWFA 3H3JA 4HEHA 3K0EA 1CCWA 1W0JA 2WTXA 2XDYA 3EFBA 3ZY4A 3DDNA 2YXNA 3FTCA 4TS4A 4B4WA 4ACBA 4L5AA 1KK3A 2R48A 1TVMA 1CJKC 4XWOA 3N0XA 2ZYSA 3TNDA 3VU9B 4DL9A 1CEEA 1QPBA 1JB1A 2OLEA 1JPVA 5DBHX 2F9FA 4MROA 2QL5A 4HDSA 2WSYB 3IDSA 5F9FA 1MNQA 1O77A 4PLPA 3CLRC 2WNSA 4YV7A 2J31A 2NSJA 2OHHA 2QT0A 3KXPA 1LPSA 4IWXA 2XB2A 3C3AA 3H84A 4QLBA 2WBLC 3SPXA 3DV2A 2I3DA 4EJFA 4U2GA 1P2DA 4WHMA 5AIAA 3BXPA 2DQSA 2ETVA 2VNJA 5FBKA 1IB0A 4P2BA 3REQA 2YFQA 4KQ9A 5A4IS 5D1HA 2K2WA 4HWGA 2XXAA 1A7AA 3BHNA 2V0CA 1D7AA 2Z8XA 3B9BA 2FWAA 3BWBA 4TS1A 2A1TR 2JFZA 2ZBVA 4KQ6A 2ZVPX 4LKRA 1BAPA 4UDYX 5ILQA 4YUWA 4LQDA 4H7FA 4K6OA 2C07A 2IXEA 2WFLB 1QZUA 3DMGA 1N0UA 1RLUA 1F5SA 3BE4A 1AU9A 1HNXB 3KZCA 5HQ3B 3EFOB 4UFNA 4B82A 4Z4QA 2PNJA 4NCJA 4JC8A 2B2NA 4QEZA 3OPNA 2GBLA 4ZO9A 4ZQCB 1DO8A 3IUNA 1XTZA 1Z2EA 2YW2A 1I6KA 1OB2A 2NTNA 5CIWA 2VP0A 3CA8A 5HZGA 3R41A 8ATCA 1TZBA 3BA6A 5CT5A 3SC2A 3IEVA 2QJOA 1V4NA 4PSDA 1Z6XA 4CMBA 4EFLA 4ENWA 5JCOC 5KHOC 4A91A 2ISCA 2JNWA 3L8MA 3L9XA 1DDIA 1DQRA 1QIEA 2GARA 3ODPA 1YB4A 4F5ZA 3GPBA 2IOHA 4UDOA 1XNQB 5ALXA 3KB1A 4HB2A 3PLNA 2ON6A 3K7EA 2PRZA 4R0MA 4FCCA 4PGHA 5HBRA 4A0FA 5I7OA 2VATA 4XM0A 4KRFA 3IQWA 1H65A 1GPKA 3E2PA 1YE8A 5H59A 2IYFA 1F6WA 1U98A 4KRXA 4J0HA 2P4QA 4W5JA 3ZZ1A 4BLSA 2JGIA 1NU6A 1QIFA 2G67A 3FSEA 1X74A 4XVRA 1X1BA 4D92A 5KYYA 2WWIA 3M4NA 2H06A 2VHEA 2VAWA 4UM7A 1H5UA 1J8DA 3ZEAA 4YUZA 2OCPA 1PZNA 2NU6B 4QE3A 1G6HA 1G6OA 1HMPA 3OURA 3EY9A 2XNHA 1GUYA 3K9GA 1Z33A 3X1DA 3O8QA 1TECE 3OJLA 2Z56A 5K8CA 4C78A 2I80A 5CRIA 4TWRA 1Z08A 2ZJ3A 4QJIA 2R44A 2J3HA 3C97A 4F6LA 3D1VA 3MS2A 1QYRA 2HSDA 1RXYA 5L3SB 1XZQA 4G2TA 1VSQA 3TB6A 2PUCA 3DYIA 5FTWA 2ZJ0A 4ZAGA 3C8UA 4CF6A 4YB8A 2WM9B 5ITZB 4L9SA 4WDQA 1GZDA 2SBTA 1PG0A 2X1VA 5F78A 4LZJA 1JHUA 1T2CA 2ZREA 3CF2A 3DXXA 5FOVA 4E6PA 5IKMA 1LLUA 2CD9A 4K88A 1MX5A 2FX2A 1TM3E 3ZC3A 3CX6A 2OB2A 3KOXA 2H1SA 4WXMA 1FSFA 2OK8A 4NFLA 4TWIA 4PO1A 3BC1A 4JLNA 3T7RA 3X1KA 4NYIR 3RSFA 1RPJA 1DAFA 1QPGA 1ZNXA 3OX3A 1EJBA 3Q2KA 3TIIA 1M6YA 2IQ5A 1QTQA 1LI5A 3PR3A 1RP1A 1PZMA 4I1OA 1EFKA 1RYYA 2ZUCA 5FD8A 5CCBA 2ZYWX 2UYQA 1TVCA 2MMGA 4ONEA 3PKZA 5CGZA 1DC5A 4BVGA 1RRCA 5JV5A 1Z68A 4Q1CA 2QZZA 1KSJA 1DPFA 4I9FA 3IAXA 3PDIB 1CS4C 3V7WA 3FX2A 4O4IB 1EGAA 1QRSA 2I2XB 4Z0HO 1V8FA 4B6RA 3MQFA 2I2FA 4DIUA 5CB4B 4YMLA 1VIAA 5AK3A 4NTZA 3H1PA 1S7GA 3G68A 4REOA 4ZQHA 4M88A 2P41A 5JZBA 1D1PA 5HKKA 4HNUA 4BMNA 3PDHA 3KALA 1UPXA 3OAAD 2AOUB 3BEOA 1AUQA 3QBVA 1FVOA 4FLEA 2W4IA 4FT4A 4M9UA 5IBPA 2OXEA 4A5OA 4TTSA 3ZDDA 1OU4A 3SYLA 3TEFA 3W6PA 4DCPA 2C4KA 2MWMA 2Z8YA 4FSDA 1X1EA 4NJEA 2OQVA 4QOEA 3T1HB 1OFUA 2C92A 5GGXA 1Z39A 2VCEA 1Z0IA 1XXHA 3PIRA 3W9UA 3RWBA 3ZCXA 4HS4A 4M2LA 3ZEIA 1PKEA 3OJOA 3LOUA 2WYUA 5BW6B 5BN4B 3RS2A 3KKLA 4JT4A 5HM8A 3RVRA 3H2BA 3H0KA 1FQKA 1LU9A 2P9EA 1WV1A 2ZIZA 5E2IA 3LXRA 1PJ3A 1NFFA 1QG6A 4MW9A 4UM9D 4JI3B 4W5OA 3PC2A 1DKNA 1B3BA 1THMA 2JIOA 2ZULA 5GV7A 4BATA 2JCBA 3OQNA 2REQA 1NE2A 4KXFB 4UQOA 1CY2A 1D0SA 1UWKA 3AVOA 3FYUC 3HBMA 3IBGA 3L5KA 4HRAA 1VJ5A 4R7TA 5A9SA 1PR1A 1DC4A 4GX0A 4LXUA 5EJ5A 3OG9A 1T4GA 3HCWA 4FBLA 3NTOA 4UD6A 1IULA 3D3JA 1FZQA 1NR7A 3IO5A 1XD2B 2GO7A 5HDQA 1VG1A 2QVYX 4I2NA 3VVMA 3ZTTA 4Z1MD 1JH9A 5JS1A 3RBXA 1J23A 5JNWA 4JI7B 4N5IX 1AX9A 4Y7DA 4KIUA 4FMCF 4EI9A 3E0XA 1UBKS 3O38A 2IWRA 1WXDA 2WTAA 1NVMB 3N6RA 3JWIA 4LYDA 2I4IA 4J1TC 2EP7A 1Z12A 1Z7EA 1D2AA 1W35A 2AXPA 3ESRA 1NMSA 1L9KA 1Y7PA 3CH7A 4O3FA 1CUSA 3QKRB 4AMUA 1D4AA 4FTWA 1U8ZA 2WLTA 1ZUIA 2YN0A 1NI3A 2R85A 5ARDA 2LKDA 2YZ2A 5ALDA 4TKUB 5BMVF 1KQPA 3BHJA 4CIYA 1XXLA 5K01A 1K5GA 4WDRA 3A26A 2IPXA 2FRVA 3F1LA 3CPSA 3HJGA 3PSAA 4IGIA 1GFWA 4R6WA 5ENDA 3ULKA 1H4QA 2SCUA 4TTRA 1E77A 1NFQA 2XCUA 1NUQA 2BDEA 1YUMA 4ZHQF 4ZJPA 4IFBA 4JH0A 3KZXA 3BUSA 3AM1A 4F2PA 3EA4A 1E6KA 3GD7A 3G2IA 3MHTA 4ZVSA 4WZBA 3AIOA 3WMGA 5IWAB 3EDQA 3JASA 1UXOA 3AERB 4Q5IA 5IDWA 5HTOA 3BJEA 1R8JA 3I5MA 4ZARA 3DBLA 4ZN6A 4DQUA 4UMVA 1H22A 4O6VA 1XX6A 4F9EA 5K2MA 3K70D 2OQIA 2OSVA 3PVZA 4S24A 4BO5A 2XB4A 3LVBA 4OBXA 3W4JA 1G59A 3PU6A 4NDNE 3FCXA 1LRLA 3V1NA 3A4LA 4QLOA 3EDOA 3QEMB 2XBLA 2FWRA 1ZPDA 2O52A 2PGJA 3CE9A 4PSAA 4MYHA 4WOBA 3SHQA 1UT6A 4X93A 3ZXUB 4LJ9A 1XNJA 1WP4A 4WLNA 4CEJB 2F7SA 2NV0A 3VNVA 3LKBA 1KY4A 1MB4A 3MCVA 1RKXA 4QO8A 3KOOA 3PFHA 4RNDB 4Y1FA 1JJIA 1SKYB 3NV7A 1SQ0A 3OFVA 1O0BA 4BVJA 1DKLA 1HT0A 1JQDA 4MQ4A 1O9BA 3KTAA 2HXSA 2JIZD 1SCKA 2X1HA 3ENWA 5CGQB 1FNNA 1NRWA 3WNCA 4C0BA 3LPAA 1LBSA 4UCWA 1QIKA 4WLUA 3UV3A 2R1VA 5SYMA 1M7BA 3RRYA 5M04A 3N8GA 1FBTA 3D2BA 4QELA 2W6ID 1L5VA 1AQYA 2FYTA 2OAEA 3G89A 3K2EA 3ICCA 3I9MA 1DU4A 3VUEA 3B3GA 3VNBA 3K0FA 3WGVA 4D9BA 4IEEA 4Y6GB 3AUXA 4KXXA 2XA1A 4CMEC 2NTVA 2PBFA 4EA8A 3GFTA 3ZU5A 4QVIA 1TA0A 5JS6A 2I4TA 3FUWA 3EZ2A 1VSUA 4MB0A 5CJ2A 3PHIA 3H42B 3S1AB 2C7QA 1BS1A 5CCDA 3IDFA 1AS2A 1Y8CA 2QTMA 3IODA 4NAVA 5LMZA 4LYJA 4FCVA 4UNNA 1P0FA 2QJRA 4QDUA 4PAGA 1JAIA 2Y67A 3SC2B 1U28A 4LJSA 1KZYC 1XT6A 4W63A 5DDIP 4AQYB 3OIGA 3QFSA 1B16A 1GL9B 2VPWA 1I1OA 5HG0A 4FB4A 4Y1GA 4E2YA 2V0GA 4KBFA 5GM1A 2C4UA 4PC6A 3VR4D 2XD4A 1PRYA 4OHPA 3W5DA 1PVVA 1NV9A 2PJDA 4PO3X 4ND3A 2Z4TA 1OLUA 2PZBA 4J4BA 4QFMA 3O9VA 2GAFA 1SQ5A 3NHKA 4FU0A 4AUMA 4ZDWA 1MEOA 3K9FC 1G9XA 1M6HA 4A26A 1YUNA 2QZPA 2WM2A 4HEA6 4LZWA 1ZJ6A 5AHRA 2RGRA 3AEXA 4K28A 2XKJE 3R7SA 2Q6VA 3ETHA 1KMHB 2B8TA 3OM9A 1CRWG 2X0JA 3EZXA 1OW3B 1GPLA 3EF1A 1L5MA 2XI4A 4NENA 5K9ZA 1T5OA 4FYWA 4EHJA 4I1SA 4P32A 3E9MA 2A9KA 4PX2A 4A8JB 1UJMA 4Q9DA 2FXVA 2WJPA 3Q5GA 2JRLA 3P0HA 2XEDA 3RK1A 2DWPA 2R7NA 3H19A 3ZLUA 3UBTA 2RONA 4V0QA 4BJHB 5AVQA 3RADC 1VSTA 4RFLA 3DBRB 3FIJA 4AS1A 3AVWA 5B64A 4EG5A 4EHLA 2RK3A 3ZDCA 3QFFA 3EEIA 4CM8A 4RPGA 1GEEA 4EY4A 2QN7A 3FVQA 4ZPJA 5F5XA 1YQUA 5JXIA 3EQ7A 4HDNA 5CT9A 3K4HA 3O90A 3ZHBA 1LH0A 3CUVA 1WDWB 4YMIA 1NG9A 1S1CA 1HY3A 4P3XA 3HYSA 4OQPA 4C2TA 5EZQA 3DEZA 1CPYA 2Y6UA 3HI6A 3LI2A 8MHTA 2FMHA 2FPKA 1FVHA 4WESB 5J23A 1HOXA 5H9VA 5B1HA 2FH5B 1ZD1A 3SF8A 1Q77A 4XAQA 3RNLA 3QKUA 1SVNA 3K4QA 4DN6A 3HVJA 4WW0A 1G8AA 2BRUA 2NACA 4OV6B 1JDBB 5TY0A 4YJ2A 3N2IA 4ZVLA 3GUCA 4IJ6A 4FGSA 1SOWA 3VPBA 4X45A 2OM6A 1FRZA 1QV6A 3IA2A 4Z7JA 2MIIA 3EEOA 3EG9B 4RU1A 4ZEMA 2BH2A 4J0GA 1KU6A 1SUDA 1VPVA 2Y2VA 2X5JO 4NOKA 4ZAXA 3I5AA 5BWLA 1HG0A 3DQQA 1SIOA 1ISSA 1U0FA 2FWJA 3A14A 3NTQA 5JD5A 4K9DA 5DKFA 1FMTA 2WABA 1JT9A 1JEQA 1DEKA 1OE0A 1R0CA 2F1IA 3RGWS 1P1CA 1DRJA 1JT2A 5CXXA 3F5QA 1VJ1A 3WBBA 4ZDIA 3LO5A 3VR4H 1YIOA 3ROKA 3D4IA 4KWIA 4NBRA 4RV5A 3V4PB 4CCYA 1FFBA 2YY7A 2GXQA 4ETIA 2ECPA 1NRIA 3NEJA 5IJXA 1HEYA 3KM0A 3WDKA 4GBGA 2DQ4A 2HXYA 2Z09A 1V1JA 2F3PA 2QE7D 2PO5A 3D7LA 3EPJA 5JG7A 3ICWA 4IVRA 4B2PA 2FGJA 3SZMA 3D7SA 1EJ2A 1SUWA 4FM9A 5PGMA 1AT1A 2Q4EA 3OWHA 1A5SB 1L7RA 5EIWA 2ZRHA 4FFLA 2R6GA 5TMBA 3ZGLA 5L3VA 1Z9BA 1X1SA 2I0FA 5KNCD 2CHEA 4QQKA 3FF4A 5FUQA 4YJKA 5ICFA 2KLBA 5KTNA 1EFVA 5AHXA 1H94A 3IALA 2CYBA 5FB3A 4ZCSA 3IMFA 1CUCA 3OLWA 1QDEA 3PFGA 4FWIB 4YQEA 1BVYF 4CF4A 2CLIB 3WKAA 3DDHA 3HXOA 4C43A 1J2RA 5ESWA 2IS2A 1XGKA 1Y8RA 1KQNA 1NVAA 1ZGJA 3C6QA 2B2XA 2R7LA 4URHA 3M8KA 5BP7A 3QEKA 4F3RA 3GNTA 1M54A 2BE7A 2ZAYA 3RAJA 1BE6A 5CH3A 3DW3X 3DTVB 3KYJB 2G9ZA 2P5SA 1DJLA 4Y1RA 4BFLA 1XJWA 1DC3A 5HGJA 2B69A 4WASA 2AF4C 2YZKA 4ZZ1A 4K81B 1XB2A 3OU6A 2IBMA 3N07A 1QVZA 1T24A 3BIFA 4W8HA 2QX7A 3EEBA 3AHJA 1R8XA 4MPPA 4UFPA 2EX0A 4G0ZA 1R0KA 4AJ1A 1Z3IX 2LPMA 4AL4A 5B3JA 4I1VA 4IJKA 2VK4A 3DE1X 3GEBA 3I9OA 2NV6A 4ZK6A 3EEYA 2V59A 2JGRA 2LGJA 1MAVA 3SYTA 5FX2A 4CV2A 4PYOA 4BO3A 3F74A 5BSKA 1J0BA 4Q4CA 1YV9A 2E55A 2QVCA 1N6IA 4XDHA 4BKUA 3S81A 3B36A 3EX7C 4LVCA 4M53A 2DERA 4X7MA 5CM8B 1GR1A 3A1FA 4F7WA 3TI7A 1K06A 4EYSA 3ZVKA 4OLFA 3ZJUA 4FLMA 4CI0B 1ZP6A 2WSSD 5DW0A 3IO3A 3Q2IA 2AW3A 1DTWA 4YJGA 1KJIA 2I9KA 1RU3A 2D74A 3U4CA 4WAUA 2YXPX 4J4TA 3QE4A 2WMDA 4RKYA 4E4RA 5EGSA 5B1DA 3TD2A 2IHBA 1JVSA 1JMVA 3O1LA 3WB1A 1V45E 2ID4A 3IV6A 1DUVG 3BCUA 3RU7A 3U7EB 1EE1A 4OJNA 1K86A 4MKRA 4EKIA 1F1BA 2YV2A 5KWVA 2OHOA 1FFGA 4Y2QA 2DPHA 5HM6A 1E2PA 1N2EA 2XT0A 2DHQA 2O2SA 3HCFA 4QDZA 2BSAA 3MTQA 4BCDA 4TQGA 2HA5A 2Z1MA 2PKXA 3U1BA 2IKQA 3NVMB 4UMFA 2FMFA 4KITB 4HNRA 4YV1A 5KNCH 3HO8A 1EA5A 3HSSA 1E2MA 1ZM9A 2I71A 2QRJA 1E0AA 2P4EA 3P0EA 5FBWB 1U0HC 1K63A 4XYLA 5IZ4A 3T5PA 4ARZB 3VI3B 3ISVA 1P8JA 3OPVA 4J76A 5TGTA 1P9OA 2RIPA 2QW8A 4BS9A 1LVHA 2N1MA 2HX1A 3H18A 3V7NA 4XCXA 2FPIB 3KTDA 1XVAA 4U8GA 3O2SB 3DT8A 4G56A 1CQZA 1NP3A 3GJ7A 1MIOA 1EQ2A 5CCEA 1NJ1A 2X41A 2YVAA 4JB3A 1K7CA 2B34A 3DLAA 4KDRA 5JNUA 5JTUA 1CD5A 1TZMA 2AHOA 1WXFA 1WE2A 3U48A 2XLCA 1AKNA 3CX7A 3ZNOA 4EJMA 1FFYA 1C50A 4JYAB 2VTBA 2IW3A 2YNMA 1O6BA 2QY6A 2VDQB 3BSFA 3L07A 3I01A 4LXQA 3R23A 1RP7A 1TT5A 5DGCA 1DVRA 3BE8A 4WK0B 4DHWA 2HK9A 4KNWA 4D4KA 2FHSA 4YGYA 4HH0A 3TRJA 4EA6A 1I51A 2B8NA 2JCGA 3MSXA 4UARA 1XCBA 4ZEOA 1N2CB 2JKYA 1N3YA 2XQJA 1SCDA 1GUBA 3L02A 4IGAA 4TTVA 4HDKB 1V41E 4Z7QB 5DX8A 1TKRA 2BV3A 5I7FA 3ZZ0A 3I32A 3TQOA 3LUAA 4N0QA 5JEEA 4ZAFA 3W8NA 1GZ3A 2VXYA 1MJGA 2ZTHA 1P77A 3OC6A 4H0CA 3TXXA 2QF7A 3GT4A 2LVBA 1G8GA 2BI7A 3THOA 5J1TB 1Q3HA 4KODA 5H70A 2W71A 1E9SA 4MVJD 3IBSA 4QX6A 3ZOKA 3TG2A 4HWSA 4BL5A 1OLUB 1A5ZA 2FWMX 1OI4A 9GPBA 5ADHA 2VK2A 1ZH2A 5A4KA 5JT1A 2JHAA 3HC7A 2QN9A 4XSHA 4ZA2A 3K6SA 4JQCA 4RHTA 4MRAA 2CXSA 5EN4A 4NU8X 4RGBA 5FLEX 1A96A 1AK9A 1O0SA 1XTSA 3TLGA 1PGNA 2XUGA 2VYND 2Z6VA 2R3SA 1UC9A 3JCZA 4KE6A 4N4AA 4R4JA 6AT1A 3LP8A 1Q7CA 3ZE7A 1N5DA