1PNQA

Crystal structure of r. rubrum transhydrogenase domain iii bound to nadph
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
SGHIEGRHMAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD(P) transhydrogenase subunit beta
publication title Conformational Change in the NADP(H) Binding Domain of Transhydrogenase Defines Four States
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 53
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2003-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1pnqA00
2H2HA 5DGDA 4KGDA 2VK4A 5EJ9A 1BFDA 1E3TA 1SZDA 1YI1A 4K9MA 5EJ4A 3JR3A 4Y6LA 5EJ6A 1YI0A 1PNQA 2NYRA 3ZG6A 3FSJX 3F6EX 2H2IA 4K9KA 5EJMA 2PANA 4UUAA 2VBFA 4MPPA 1MA3A 1T9AA 3HWX1 4JU8A 4JT8A 5BWNA 1PNOA 4UU7A 4RJKA 2JI8A 4JUBA 2Q5OA 1V5FA 5K3SA 3U3DA 4X3PA 4ZZIA 2EZ4A 4BV3A 5BWOA 1M2NA 3CLSD 2QQFA 1UPCA 2A1TR 2OO5C 3CLRD 4HD8A 4QPZA 4X3OA 1OZGA 4MZXA 1N0HA 4F56A 1YTLA 4JUAA 4G1CA 2JI9A 2FRDC 2PGNA 4K9NA 2VJYA 3EA4A 1POWA 4JUDX 4FZ3A 4Y6OA 4GM1A 2FWNA 5AHKA 4BVHA 1XLTC 2NXWA 1M2KA 1JSCA 4KXQA 5MFZA 1PO7A 3LQ1A 3GLUA 1S7GA 4D5GA 4BVGA 4BN5A 4TWJA 4KPUA 2JLCA 4GM4A 4JU9A 5K6TA 5FEMA 1U28C 5MFPA 2JIBA 1V5GA 3E9YA 1Y9DA 2WVHA 1T9BA 1PI3A 3RIGA 1NM5C 4UTRA 4UTVA 4Q9DA 2VBGA 4UTXA 4FEGA 2UZ1B 2OORC 5DEIA 4K9LA 4F4UA 4Y6QA 2V3WA 2FR8C 5EJ7A 1MCZA 2H59A 1T9DA 4J16C 1Q1AA 5EJ5A 2Q5JA 1Q14A 3D4BA 1EFVA 3EYAA 4FEEA 3CF4G 2H4JA 2PGOA 4JUCA 3F6BX 5K6RA 3U31A 2AG0A 4C7BA 4K9PA 1YC5A 4GP9A 1S5PA 3PKIA 4BVBA 2EZ9A 2VBIA 4V1CI 1OZFA 2JI7A 4RJJA 4JSRA 2OD7A 4FVTA 4R8MA 4HDAA 3OE1A 1UPBA 2OD2A 1PTJC 3D7KA 4BV2A 1U31A 4K9QA 2C31A 1M2GA 2Q28A 4GM0A 5K2OA 4BVEA 1ICIA 2H2GA 1U2GC 1OVMA 4IG9A 4RMJA 4ZP1A 3GLTA 5MF6A 1OZHA 1J8FA 2FSVC 2EZTA 1D4OA 4RMGA 4UU8A 1DJLA 3FLMA 1Q17A 5D7NA 5IMSA 3IAFA 1O96B 4BVFA 1Z8NA 3CLUD 5DGTA 3EY9A 3GLSA 1SZCA 4K9OA 4L2IA 3GLRA 2H4HA 3CLTD 2UZ1A 4MPRA 2VK8A 5FYQA 1ZPDA 1YHZA 2EZUA 4IF6A 3HWWA 4UTZA 1M2JA 2Q5QA 4BN4A 1T9CA 2FN3A 4I5IA 3JWPA 1V5EA 4UUBA 2OD9A 2QQGA 4IAOA 4D5EA 4JD5A 2IHVA 2IHTA 1PYDA 4RJIA 5EJAA 4RMIA 4C78A 3PDHA 2H2FA 1U2DC 1HZZC 2WVAA 2Q5LA 2H2DA 4BUZA 4TWIA 2H4FA 2X7JA 3D81A 1O97D 4GG1A 2A1UA 2BRUC 2JI6A 2VK1A 4RMHA 1YBHA 5EJ8A 4O8ZA 2Q27A 4JUFA 1POXA 4UTNA 1PVDA 3PKJA 1QPBA 2DJIA 4QQ8A 3RIYA 5MGNA 2Q29A 1EFPA 3ZGOA 3IAEA 4JT9A 1M2HA 2WVGA 4V1CB 2IHUA 4V1CA 4COKA 5BWLA 4GPEA 1UPAA 2B4YA 3ZGVA 1YHYA 2AG1A 2JLAA 4QELA 4J1TC 4MPJA 1YC2A 2EZ8A 1YNOA 4L3OA 4MQ5A 3K35A 1PT9A 2W93A 1Q6ZA 2HJHA 3FZNA
chains in the Genus database with same CATH superfamily
3GP5A 4JOSA 2B1GA 1ZUD1 3CO0S 4DIEA 5JUWA 1YB1A 5K8VA 4B2IA 1K5GA 1TT5B 3F6CA 3I6IA 2H2HA 3KT6A 3MOGA 1VLHA 1VOTA 4K03A 3RPEA 1XD8A 3FMFA 4MLZA 3SNKA 4E31A 2VK4A 3QUTA 3BGVA 3ENZA 3GDGA 2OGSA 2YDXA 1USGA 1T8TA 2ONJA 5ALVA 4QEZA 3OX3A 3L8GA 3LQRA 1NLZA 3U5TA 3EDQA 4UHCA 3W5JA 4DJ5X 3G8YA 3E5HA 1PQUA 1P2GA 2XUJA 4DM3A 2P9FA 2ISCA 2XLCA 2HWXA 3KKNA 4ES6A 3WSTA 3ZBPA 5A03A 3QU2A 5A1JA 1ZGCA 4UMVA 1YASA 2C1XA 4TSKA 4IDFA 4BP3A 5LZ5A 4BNDA 1UADA 4RTMA 3ODPA 4MUKA 1BE6A 4F9EA 5C1OA 2XCIA 1ZR4A 5THKA 2DHRA 4PGFA 4RZQA 5EHQA 4EL5A 4WA7A 2OBBA 1NASA 4LYGA 4YGYA 3EZ7A 1KO1A 1JPJA 3OCWA 3ACDA 2AD1A 4P83A 4QFBA 4YLYA 2PRSA 1A1SA 2WIAA 4Q34A 1WF3A 5B7PA 5IJ9B 3V3TA 1FDOA 3I45A 3JAWA 2WKQA 1X7WA 4L0CA 1SVUA 2POQX 4LNHA 4LOHA 2R79A 4OFXA 3C3MA 2Y1GA 3LF2A 2FGJA 2I2WA 3OY7A 2PSJA 3PX2A 5K3BA 2VHXA 1TO2E 3RFTA 5H70A 3VX3A 5IAGA 2WHXA 2WSLA 3OIYA 2NSJA 2XNCA 4GKAA 5ALIA 5EG5A 5GIPE 2JHCA 2WTMA 5B37A 3ZWWA 3L1KA 2ZBEA 1MJFA 3LNCA 1KVTA 4EA8A 2ZB8A 4WW0A 3DEJA 1AF4A 4IIXA 1RQLA 3B53X 3LO8A 3IKTA 4NBUA 2GBFA 2W6JD 2HJWA 1CB0A 1CQXA 3F9RA 4X00A 3UB3A 3ZNNA 1J8QA 1W1WA 3PYMA 5CNJA 1QHGA 4MWDA 4RZ3A 1UC4B 2WWTA 4AP5A 4KXYA 2HHJA 2PZAA 1EDDA 1DKNA 1PUIA 3ESYA 1VCHA 4EWLA 2BZSA 4FFMA 3QE0A 5A6VA 1DOHA 1ZCAA 2XOEA 1G42A 3IHLA 4CLRA 2W83A 4WOKA 4BBZA 5KWEA 4QO7A 3JTEA 3CZ4A 3DL4A 3DE2X 2HBYA 3HEAA 3UT5A 5AKEA 2V7VA 1XN4A 1GLVA 3I42A 1HYHA 4XQ9A 1AA6A 4JXXA 4XRRA 5DXJA 5I9TA 1YIAA 3G1WA 1X14A 1U7DA 2VDMB 3A1EA 2VO1A 2A57A 4J1NA 5L7TA 4YMHA 3HY3A 4W6ZA 3UKJA 5LDDC 1CB7A 2BAGA 5A4DA 1YQTA 3DFZA 2VYFA 3KWJA 1XQXA 5FUVA 3MTIA 4OQXA 4J0HA 1J39A 2XYVA 4UEOA 4YFVA 3CM0A 3E53A 1T5HX 3GPBA 4M0LA 2FWNA 2GM5A 2GRAA 5ALJA 4F6CA 4KO2S 5E0OA 1V6AA 3H5WA 4QU8A 1IZ7A 2ZBFA 4NDZA 1F9AA 4AJEA 1OFHA 5ICMA 4CUZA 4KNWA 4LGVA 3L8HA 4YRRA 1PGPA 4JLUA 3HP1A 2YWFA 3EGCA 3GPLA 1BHJA 4HCJA 3T3EA 1VKHA 3SQNA 3THWB 3CT6A 3Q0EA 5KJ6A 1EYZA 1V8OA 2IUYA 5EIEA 3M7IA 2PNJA 3UAXA 3K4PA 3G8AA 1JG1A 4XARA 1IXSB 1RT9A 2REQB 3M6LA 2QN3A 4V0SA 5BW5A 2IKSA 3K5HA 1G8PA 2BT4A 2BKUA 4N3CA 3C3KA 3H97A 2W70A 4CDGA 4C43A 1BDIA 1J90A 3AI1A 2IEIA 1GUYA 1OILA 4S35A 1CQJB 1V5IA 3R7WB 4JKIA 3VU9A 3DZHA 5LZ4A 2I87A 4ESOA 1MIHA 1D4ZA 4ZTBA 2H3EA 4IIUA 1G7TA 2NXCA 5HFJA 5ERGB 4OOEA 1P8JA 3HCNA 4LFCB 5K0BA 2ASVA 3HO1A 3CUSA 5J1TB 4JI0B 2BZ1A 2I1VB 2XWPA 4BNYA 3BJZA 1TUBA 2I3AA 1BX3A 2RHLA 4TXHA 3IQIX 1KFBB 5LQRA 2R8RA 3FNRA 1ICEA 5BVGA 1JMYA 2REOA 3F6RA 4KO1S 3GVIA 4DC9A 3P0RA 3Q87B 1EH5A 1A8QA 1NRIA 4LF9B 2WDZA 2HY7A 1SB8A 4EGJA 4YMTA 4YO7A 2CF6A 1NT4A 3V4RA 4IDDA 3DMGA 5JW6A 4UEKA 4MJXA 4U7WA 2K7ZA 3NBMA 4L8FA 3V97A 4EABA 1J9GA 5I5EA 1TD1A 2VQ6A 3Q88A 4ED9A 1P9NA 1RKVA 4LJAA 1THGA 4RFSA 3TQCA 1E5VA 3VZQA 1I2AA 1ZI9A 2FLKA 1I2MA 1ZI8A 1XCPA 2IT1A 4XD2A 3PNVA 4HS9A 3AF5A 2BHSA 4V3CA 3DE5X 1ESNA 1QYRA 3G8CA 4Q4AB 2PH1A 2VRNA 3KJXA 3SLRA 1KKUA 1KI7A 3RIEA 4D8VA 3GYGA 5CB4A 1S7CA 2ADOA 4ZAWA 1TLTA 5LB2A 1FFWA 3D59A 4C7VA 4D46A 1NBIA 4HAZA 3BWCA 3AFHA 1Q19A 3HADA 1UDBA 1ZJZA 2X9QA 2FR8C 2OY0A 2PO7A 2QVBA 3FPHA 3NG1A 3NGLA 2OFFA 4BKOA 5B2FA 5BWMA 2Q6OA 1VMKA 1N2ZA 5CVVA 2RJ3A 1FP7A 2HMSA 3FCXA 3GFRA 3K9FC 4AJIA 2AMFA 3D4OA 4YJDA 4MYCA 5CAEA 3D2LA 1ZUNB 4C05A 2F48A 2G09A 2XTAA 4XFDA 3BE5A 3E3LA 3QOXA 4ZCTA 1YZLA 2FN8A 5KYKA 2D1TA 2VPXA 2BR5A 2HSDA 3KYCB 3TLBA 1ZN2A 1DAEA 1NUTA 2ZT6A 1E8DA 2YVAA 3C1TA 3O74A 4IDAA 5EKSA 3TLMA 1H05A 1M8JA 4YRKA 1A2KC 2XECA 1AK2A 1UBNA 3OLYA 4OBXA 3MJ4A 2A6PA 2MSWA 2GHRA 1QGED 3EGXA 1CWUA 4BO2A 4MVJI 1CY4A 3GNLA 3ELUA 4MUHA 3PEEA 5DHPA 1YE8A 3FWZA 5DNDA 4RZUA 1GJRA 4B33A 5JH7F 1IPHA 4M0PA 3U40A 4EW6A 1FJHA 4MI6A 2ERXA 2EZ9A 3A26A 4EJSA 3DO6A 3OHPA 2OFOA 2TSYB 2GQ0A 2YBDA 4DDKA 4MI3A 5DFAA 2NAPA 1H4SA 2PWYA 2XMPA 4PNZA 4CG3A 3J7AC 3LF1A 3IO5A 3WL7A 2FQQA 1KDRA 1WU8A 3W90A 2JFVA 2NU7B 4HRAA 2RKWA 4XJXA 5E7IA 3ZWPA 5B30A 1CIPA 5KZMB 3RS5A 1W6UA 2I76A 1N2XA 1UKBA 2YRFA 5FUWA 3IQGX 3VOAA 3THXA 2LIVA 2IYZA 1GZUA 1IM8A 3VR6H 1NF2A 4QVGA 4OVKA 1D0SA 3TAXA 1HEIA 1JV2B 5CT5A 5A62A 4PPNA 2UXBB 3KLPX 3H65A 3EIEA 4TV8A 4B3TB 2JK0A 3O4IA 3P4UA 1WL8A 1O95D 1U2ZA 4W4TA 1GZ5A 1GNPA 1X1TA 1RBMA 4M37A 3VTZA 1BGWA 4RVCA 5I9IA 5KOYA 4OX9Y 1W96A 2VQ3A 2P9TA 3HACA 5FI3A 1VRWA 4RHUA 2JFWA 1KYXA 2CVFA 3N0RA 2OB2A 3N2NA 4FOSA 3A1DA 4PCAA 5HJ2A 1J06A 3CRNA 3EG9B 4QPJC 1WLSA 2W2MA 2O1XA 4ER5A 1P6XA 1OVMA 3AI2A 2NQ8A 3CXRA 4V03A 3LI2A 3R5FA 5C9ZA 5C5CA 4RIGA 2XYHA 1D2GA 4K46A 1KVQA 5HA5A 1XVVA 2GILA 4N5NA 3WOVA 5MF6A 3HB7A 1SUFA 3TQHA 1UPFA 5D5QA 2MINB 3QIVA 5F3RA 3QUBA 2PKWA 1HE8B 2AK3A 3DG9A 5CM9C 4AZTA 4HNVA 3TG8A 3FW1A 2I03A 4NQZA 3L2OB 1G5RA 1H0RA 3GEMA 4OU4A 3TIFA 4OHVA 1KU6A 3P0HA 4HQOA 2DFDA 2GKSA 3D3JA 1WF6A 4BEVA 5INTA 3QV1A 1ARZA 4JQOA 3S7TA 3IDFA 1EQUA 4B3FX 5A3JA 5K4GA 1Q1BA 3K4HA 4JQYA 1PQPA 3B1KA 1ZOIA 1E9DA 1FF9A 1Q57A 4E2FA 3KOWA 1H8EA 2QTHA 1Z8NA 1BCRB 2AS0A 1TO1E 2GZMA 2XOKA 3ABSB 4TROA 3AEKA 3RIXA 1L1RA 1L4GA 1TUIA 2C54A 4YTEA 4A8HA 2P68A 5TT1A 3H8VA 1JS1X 1U7TA 2PY6A 2RIRA 2VYVA 5DHFA 4YAIA 1J70A 5ILGA 4XFJA 2ZB7A 4KMMA 1ZGAA 4L8YA 4M8KA 3EW9A 2WIKA 4FCCA 3V1KA 3WICA 4BO8A 5CIYA 2FI1A 3NKLA 1KK2A 4AJ2A 3K2IA 4LWOA 1NHWA 4CQMA 3HS3A 2P78A 1GVHA 3LPCA 3Q6MA 1CR4A 1D7AA 4EYEA 2QSJA 2HHAA 3L46A 1SXJA 2RGUA 4IV8A 3IPAA 4ZO4A 3EJWA 2FPSA 5ALPA 1WHSB 1ECJA 1QE0A 4XYGA 4AVYA 2J3DA 4G5GA 3SZRA 3VO9A 3CUTA 4NOKA 4ZVOA 1CERA 1V2GA 1K6JA 1YUBA 2BL4A 3L5OA 5CW2A 5G53C 1SWVA 3KSUA 1U1GA 4TV9A 2A9OA 3FHCB 2MCFA 2V7BA 4MS1B 4HYYA 1T9KA 3T4UA 3U4QB 4KR3A 1KTIA 4FCVA 1UDXA 4YJHA 4Z8YA 1XF9A 1ZJJA 3R1IA 2I91A 2YVLA 4OHKA 5IZ4A 1VA4A 4IOLA 3PZBA 4G8CA 4FOPA 1Q7EA 2QD4A 3FOZA 1BMFD 1IYZA 1SUSA 3QE3A 1NI4A 2Q4OA 2UVPA 5IJXA 3KYIB 1IG0A 3B20A 2QN8A 1WXWA 3DZJA 1V9SA 2I3GA 4NZYA 3KZMA 4ILKA 3AVUA 2WABA 4LRUA 1GZ6A 2YUTA 5DRTA 5KKCA 3NBQA 2W6QA 4P31A 3CG4A 4Q1CA 5IYZF 3LSTA 2YUIA 1V45E 4M9ZA 5TPZD 1VHWA 1CZOA 4RM2A 3T3IA 4ZDKA 1DT3A 4S24A 3NGXA 5JWOA 3I6ZA 4TTAA 2NVBA 1X86B 3CKKA 3IXMA 4MQUA 5AYVA 3WLKX 4K1LA 5KYYB 1C9NA 1ZSNA 1G5IA 1RR6A 2H0AA 1TMOA 2OWDA 3PZRA 4ZQIA 3X0DA 4ESEA 1Z25A 1PCXA 2R6FA 5DTMA 2J4DA 4MQFA 1GV1A 4F1JA 1MJHA 3QG1A 1A8IA 4FN4A 3ICPA 2XNSA 3AUAA 3S1AA 3QVGA 3T5GA 4TWIA 4A82A 3W9BA 1RLUA 3QOYA 2ZUCA 4OHXA 2FPRA 3C3BA 2X22A 3FPBA 4HVLA 1PR1A 2EQBA 3D5TA 4LBZA 2BZGA 4NJEA 2VR1A 4KYVA 3AU9A 2E85A 2E6KA 5T8KC 1QP8A 1R0BA 3DR3A 3EZGA 4AO6A 1D0VA 3ZS8A 2WKPA 1SRQA 4LZOA 5I5GA 1M8PA 3WLLA 2DR0A 1GL9B 3CH5A 4YP6A 1ZU5A 3ELWA 2HF8A 2P4SA 2DRIA 3PNLA 1S8FA 2IBTA 3E6AA 4F3YA 1UT8A 4OGGA 2R6GA 1L5OA 2QD5A 3ZU2A 3KVRA 5C1BA 5JSKA 3NHMA 2V9ZA 3LE8A 1R8SA 5D3MA 4JFRA 5TR9A 3LNTA 4PO3X 4E21A 1WXHA 4RSGA 4TT3D 1QPBA 2F8LA 2DSNA 4E13A 4C29A 3C0KA 2OO7A 2DUJA 3RSOA 3LOQA 1V35A 1E9RA 1Y4SA 3N0XA 2PBFA 3K1ZA 4YJGB 1ZXBA 4DEYA 4W1QA 4TZ6A 1XTQA 3IV7A 4GGOA 3COPA 1KY4A 3LPLA 3ZWBA 4D0NA 3O8DA 3VSBA 4BY9E 3IA2A 4PW0A 2FFBA 1BW9B 2HEIA 5JXIA 4A36A 4CJXA 4J2HA 4CG0A 1I6KA 4XYEA 1Q1GA 3ZZTA 4ZIRB 4PCVA 4HAOA 2EJWA 1T91A 1EUCA 1QYDA 1ACMA 3L1JA 2B98A 2G5CA 4GLLA 1Q7RA 4OGLA 1IDOA 3TL3A 3UGTA 1REQA 5FTWA 4BRUA 2RH4A 5GTDA 4FS3A 4JLAA 1S4MA 2CJWA 4BC0A 1HQYE 1C2TA 2PR7A 4P5EA 1XB2A 4OTZA 2ODAA 4PHHA 1G16A 1TFUA 1E6LA 2HA3A 3PITA 1G3RA 3OPYA 3QMMA 5FQNA 3ZW9A 1JKFA 4XJVA 1MA0A 2ZI3A 1DL5A 5AVVA 2RGAA 1G59A 3ELBA 2XB2A 1NVGA 1WQ4A 4JK3A 3FUCA 5ENVA 1T2FA 3MGCA 1J2UA 2UZ3A 3ST7A 3VR0A 2AZ4A 3T4XA 4JXZA 2FW7A 3LKDA 4XASA 3E1SA 2EQAA 1QRDA 2NSHA 3JQCA 4LDJA 4GYJA 4CIDA 2JS7A 3IIMA 2OV1A 4X93A 2BFBB 1I2DA 2IZ1A 2TS1A 3NYQA 4M3NA 1ZSYA 2PUVA 3RC9A 3ZXSA 1I1OA 1M2OA 3RVDA 3O0TA 3PQ2A 2VH2A 1JKJA 4YA6A 3WMEA 1XC7A 4AS1A 4Z4GA 2HCTA 1S01A 3WQHA 4FGWA 3SXUA 4HH3C 2GSDA 1NFFA 1QQ7A 3KXDA 2XZLA 5H3HA 3RSZA 3N2IA 2GWHA 3JD4A 3NALA 3QYJA 4KAXA 4C5AA 3NDBB 1TT5A 1N9GB 2QRVB 4COOA 3F9CA 1QOQB 1XQYA 1WWKA 2RB4A 1WXIA 2VHYA 1EG7A 3G8BA 4CM9A 1UXOA 2G1KA 2RJNA 3BWDD 3FUVA 1E1LA 3OZAA 4C2AA 1RJ9B 3PUKA 1V8FA 2CVQA 2J6IA 1W85B 1ND6A 3H7AA 3OQVA 4GX1A 3ZPXA 1KERA 1LV8A 1NVWQ 4MKRA 4NE7A 3RU3A 2AXEA 1XZAA 4JBGA 3ANSA 5EP3A 1EXWA 1D2MA 1VJGA 3LRXA 4Y7DA 4A1FA 2ZRKA 1H2XA 4LRQA 4HTFA 3QMWA 3AEUB 4KQ1A 1PT8A 4EI7A 4PGGA 3DKPA 1SVMA 1WKBA 3PCXA 4J1TA 1QQBA 3IAAA 1PG5A 4JQSA 1NNLA 1T9AA 3A70A 1R3UA 2VF8A 1E1RA 1QP0A 3F3SA 4I0WB 3AJAA 4IW3B 3HLTA 5IJ0A 1BJTA 4PZ9A 4RULA 1CTQA 3B6JA 2H52A 4C89A 1Y7LA 5LZ2A 1U5CA 1NVDA 4HH0A 5EWJB 1QH1B 5IJ9A 1MX1A 1PE0A 2OZPA 3M4JA 4AZWA 3ZQKA 3I2KA 4AURA 3HUDA 4M8NE 4U9HS 5D3KA 2DFKB 4DBLC 1C1YA 3ROFA 1CQWA 4YMGA 1O97C 1RHRA 4N3BA 2AOXA 2VJMB 3RUPA 5SZIA 3WNVA 4L5YA 3CR8A 3HCCA 3C7TA 3AVVA 3UGJA 1UEIA 2RBKA 4Q4JB 3RARA 1DO8A 2R00C 3NHFA 2WUVA 3RRYA 4C5BA 2JFUA 4O2BF 1TJ4A 1QHHB 1I7PA 4JA2A 5BWOA 1Y7PA 2FUEA 4OL9A 4LHEA 2WKSA 5CJPA 5K4HA 1FOEB 2Y68A 3BMNB 1A8PA 3QP9A 2BFWA 5CXXA 3OMWA 5CBPB 4DJTA 2Z9BA 2EBHX 4FSHA 4G5XA 5J3JA 2FPMA 1FLNA 1SVWA 2Q8PA 4CG1A 1U2RA 3MS2A 3ADDA 5LOVB 1P4GA 2E82A 4IHJA 2IPNA 2XITA 4OI0A 1NX6A 5JCJD 3VKHA 1JDBC 4IJMA 3SI7A 2FQYA 2QLFA 3KLOA 2PT6A 1Q20A 1XCGB 5H3CA 3QHAA 3A04A 4R2KA 5CT4A 5KVQA 5AD1A 3ISJA 4FKBA 4RYDA 2I6FA 4YWJA 3VO8A 1A0OA 4EAAA 1J8MF 3NAGA 3P8ZA 4A16A 1WMFA 2J0UA 4R0MA 1EK0A 4FZ3A 2XQIA 1WW2A 4DZTA 1E5DA 2IUTA 4FD2A 1YR6A 2O5CA 1YB5A 4E2XA 4OAPA 2CL5A 4ZO9A 3LQQA 2C42A 4HNHA 3BFPA 4QDOA 2MSKA 5DCLA 1YVDA 1UFRA 4D74A 1R6UA 4HNGA 4FDUA 3I61A 2OCAA 3NIBA 5ELLA 4KR7A 5THXA 2Q3CA 1NN1A 1X19A 3E7PA 1BQEA 3SDZA 4ZI7F 4ZKDA 3IP8A 5IT4A 4PCLA 4Y6PA 3P9RA 3A7DA 3AFOA 2WAOA 4BO4A 3GLHB 1IOVA 3M1LA 4IGIA 2M6RA 1G60A 2XNHA 2JLBA 2JIPA 1W5TA 3BS4A 1AC5A 3KUCA 2BRUA 2H4XA 2REQA 1N75A 4NYJR 1GGHA 4V0KA 1I01A 5E1OA 1XCMA 4BQIA 1FNSA 3JZIA 4UMFA 1ZM3A 3EDOA 1B6TA 5D01A 2Q2NA 3R7WA 4YQZA 2ZJ0A 5B7QA 3U61B 2NW6A 2PMWB 4RDCA 4X94A 4BLSA 1CUZA 2IPOA 3ADOA 4MKHA 1AY0A 2CE7A 3KXLA 2QAGC 1QWSA 1SN7A 1UQTA 2Z2YA 3O4FA 4QDKA 1JTFA 2NO1A 3CQ9A 3HGQA 1HM5A 4AS2A 3ZIAA 3SF8A 3QWHA 4YJFA 4I19A 4C4PA 2L19A 3PA8A 1V5GA 5IDYA 3VUFA 1B00A 4LV6A 4CCWA 3CN9A 1UEXC 2BUCA 4C88A 5JDIA 1GFZA 1LSSA 1T4CB 2OL4A 1D6SA 1WOMA 1CIJA 2BBTA 3AJRA 3D8RA 5EP1A 4DLWA 1DU4A 3G0CA 4WLNA 4A26A 2FAXA 1NBEA 1NW7A 4B2PA 1KF0A 3GJ0A 5I9SA 3S5UA 2AE2A 2RAFA 4F4DA 4HEHA 4Q24A 5A4MS 1NM5C 1XEXA 1E1MA 4FYKA 1GDDA 4XGIA 2KS6A 3OEHD 3FZEA 1ECGA 4QOGA 5B36A 4WCDA 3QU7A 1UH5A 4Y2VA 5HTKA 4YH1A 3GEBA 2UZ1B 2ZE5A 4M0MA 1Y9ZA 4KGXA 1NKVA 1SUBA 2FW9A 1RCTE 4OUDA 4QXAA 4AXBA 4LOJA 4TT8A 5B4TA 2C7RA 2WD8A 1CYDA 2FMFA 2J08A 3O94A 3UMGA 1SVKA 1E6WA 1ESDA 1CHNA 4R2HA 5GJCA 3RRZA 4PLTA 3UKDA 4CCSA 4E5DA 3BD6A 3PPXA 3OU6A 3OZSA 4X7BA 2FMUA 2YS7A 3EXG2 3G0DA 3Q2KA 1ZVQA 4M1SA 2Z2XA 4ZVRA 2O3TA 3S2EA 3VPDA 3ZYZA 5DSXA 1EFLA 1JEEA 4YAJA 2JLRA 1T24A 3K8QA 3W6ZA 5E1DA 5FTNA 1FS6A 2QTWB 1LF5A 1ODKA 3LECA 5CHYA 5CLHA 1ZRHA 2XDWA 2PYIA 1K9SA 5ALQA 1HQKA 2X3FA 3TTYA 3K7EA 4IIVA 1KJYA 3FYHA 3OIVA 4UOZA 2AYYA 4ZOBA 3FFXA 4MWZA 5LQKA 1L7DA 1V96A 1HURA 1E0KA 1A04A 3GVCA 4OMUA 4LRWA 3FKQA 3KQVA 2H4JA 1T2UA 1XRSB 5CXSA 5K0GA 3KYCA 1K89A 4O2RA 4LF8B 1MO4A 1Q7GA 3O3OB 3ITKA 5AKJA 2FEKA 3U31A 4RPHA 2PXHA 1JE1A 4UARA 4Z0NA 2MWMA 3G9QA 1CJSA 3Q8MA 1V4NA 3HH8A 3S2SA 1FTNA 2IX9A 4RADA 1I5RA 4BN0A 4Z54A 2WUDA 1W73A 4QOSA 3P2IA 4DQUA 1TTQB 2HB6A 2JHPA 1MZVA 2ZRPA 1RM0A 5JFGA 4WZBE 4FKMA 2Q7DA 1S6YA 2K7FA 1V9LA 5ELMA 2OCXA 3D02A 2EVWX 3LJKA 1H3NA 2GN4A 4F5DA 1ABBA 2XBMA 1F9EA 1DHTA 3CCBA 3A37A 1A9QA 1U1CA 3AHCA 3NZEA 2VSNA 4RTSA 2PGDA 3NUZA 1QV6A 4LJ8A 3DYVA 3OFKA 2NZWA 3FTPA 4F93B 1A27A 2BFCA 1GSHA 1QRRA 3P26A 3C3XA 3K6KA 1R0SA 4KX3A 5GQSA 1RWXA 5BNFA 5GVSA 1U31A 4HRYA 2IZ7A 1COZA 3JD2A 4GL2A 3L1HA 4JZKA 4N7RA 1MJGM 1DT5A 4L4YA 4B5KA 4CU5A 3OWXA 2J85A 2YJ6A 1SA0B 3P0IA 3AK4A 3W8EA 3OU7A 2Z2JA 3D2CA 1II8B 3QA3E 4L0DA 1TM2A 5E2IA 4BZZA 4PYMA 4QSMA 3EEFA 5CVUA 4PN7A 5EJIA 2I8LA 5E6SA 2HA4A 2LZ0A 4IG9A 1UM9B 4N0PA 4D99A 4EMUA 1E94E 1GRRA 3EG9A 3JWIA 4YY3B 1DLIA 1G9TA 4MV5A 3ZGXA 5C52B 4LQCA 1Z5UA 5EJFA 1I1NA 1TYAE 3VPAA 2ZBVA 3M2PA 5AW7A 2VHCA 2EZTA 4NL4H 5JSHA 4DJAA 2WTUA 5ALMA 2HRZA 2D4AA 1T8RA 2DHCA 2MINA 1GNRA 2CBGA 3U17A 2XRZA 1Q0HA 5D5HA 4YRQA 1FRZA 3C6KA 3CX3A 2Y2VA 2NU8A 1DEHA 1Z2NX 5HUHA 1ZMXA 1OGYA 2GASA 4YIHA 1EWQA 1GR1A 3EBLA 5I3CA 3GA7A 3HJGA 3BC1A 1IY8A 3A6LA 3RJ9A 5KI6A 4E7PA 1J22A 1WDTA 1MG0A 3KFXA 5ALXA 2ZU0C 5D2CA 5BV7A 3QTBA 1NMSA 3PJEA 3G88A 1DE0A 4RNCA 1X7YB 2A9JA 1U0OC 3RIHA 3H2JA 2B1QA 4KIGA 4A23A 5GY7A 4EHAA 1HT3A 4D4JA 5F4BA 1BCRA 3H16A 4R6XA 5JH7B 1JXOA 2WAYA 4QUIA 4CEIB 4KQKA 1K4MA 2B82A 3B5EA 3FOAA 3QFCA 2RGYA 4EY6A 2P77A 1E98A 3Q41A 3T1QA 4R8LA 1COWA 3KO8A 3TDNA 3ZEAA 3Q3IA 1Q0LA 4Q9AA 2QV0A 1CZRA 1ZQ1A 2ZIXB 4QXOA 2P2DA 2WD9A 4ITRC 2G9ZA 3DCIA 4L50A 2DC1A 3THYB 3IUYA 4YROA 1Y5IA 3VTFA 2KBEA 3NYIA 3ZXIA 4GVLA 4G9GA 1LPAB 2EDAA 2HD4A 4PXSA 1AKNA 5FQOA 1X70A 1WHSA 3BDIA 1IJEA 4P3OA 4WXEA 1KQOA 2JZCA 3ZHRA 2YWJA 5AJUA 1Y8QB 2OQ2A 5KVSA 1W4CA 3R7BA 3HWWA 2H4WA 2DY0A 4KWCA 1SD5A 4PIPA 2ONCA 1VG8A 3MB5A 4WKCA 3CLVA 4MS1A 3EGIA 4UUPA 4WK0B 2VZ0A 1SXHA 5M2QA 2W2KB 1AGPA 3ORSA 3ZE9A 3U4QA 3EPHA 1YVEI 4BNMA 3EVGA 5EA2A 1C14A 2WFMA 8ATCA 4CKZA 3RRBA 1UJ6A 4FTWA 3JWPA 1NBMA 3BIOA 3KOYA 1V11B 3NWOA 3RVPA 4W5TA 2HDNB 3ZBQA 3KX2A 4GZ5A 4DM4A 1TM1E 1A9ZA 3QA9A 4TQUS 2WJ4A 4WXYB 3WXBA 1YL7A 2Q6TA 3W77A 5CTJA 3WLMA 3Q7SA 4P3KA 1TAUA 4ZAXA 2ID7A 3BXXA 3GXOA 1SWWA 3FNBA 2WJ3A 1OLSB 3FOWA 3LDGA 4KVZA 2V5AA 4O5AA 3WRYA 4B8ZA 5FX2A 4OL0A 3AF2A 4A0QA 4A3SA 1QDLB 1VP3A 3DE4X 1KC3A 5I01A 4KAJA 1L1QA 2B6NA 2XKBA 1ZNYA 2ZT5A 4L15A 1D6JA 4BFXA 4ZGWA 1VCOA 2GX6A 1HG0A 5TMDA 1PT5A 1S2OA 2OK7A 4AG6A 3O26A 4Z51A 3IVCA 2XXAB 1ODTC 5IMBA 4B6GA 4JLKA 2G82A 2GYVA 3IHTA 4EENA 5J2TF 2XVZA 2GN9A 3I09A 1YQQA 3PNMA 4F1KA 3RTCA 4XGNA 4EY4A 2A1UB 1BXRB 2HJVA 4KIJA 4TTQA 4YAWA 2GYUA 5E9JA 3WOHA 4B3XA 1L4MA 3DULA 2E21A 1H2AS 1O97D 2ZXEA 3GROA 2ZB3A 2O06A 2AJCA 3KQPA 2OBFA 1ISIA 2PKCA 3EPJA 2VK1A 4QC2A 1Y98A 2IDJA 1Y8ZA 2FWPA 1SQGA 3HSKA 4NNOA 4E2YA 2QN9A 4HNSA 1HDCA 2DBYA 1J9EA 4E70A 2ZUVA 1RQPA 4YXWA 4FNMA 3UJHA 1H0KA 4OXRA 1P0PA 2LPMA 4B0PA 2JFOA 3N7TA 3PXXA 4Z1MD 2X8WA 4Y2GA 2PQ6A 4OXQA 3WDSA 4GE3A 5JNRA 1VJ5A 1OXXK 1K98A 1E8NA 4RVOA 2ZCJA 1SG6A 3MIIA 4I5GA 1U0GA 1J8DA 1Z4QA 2P67A 1YZGA 4TKZA 2PYZA 2ZBRA 3Q12A 2YMPA 3V9AA 1TZBA 3ZVRA 1AXGA 5AW0A 3DV0B 2CMKA 5C32A 5JAQA 2P11A 3BSWA 1UZAA 1TPYA 3AB7A 5A3VA 1PFKA 1A4UA 4IJVA 5EJ2A 1BVUA 1V7QA 4YMLA 4RTJA 2O20A 4I99A 4CR7A 3WWEA 4Y1FA 2D3TA 3F8TA 2IHUA 3HEBA 1F5NA 4CQJA 5EIOA 1PJTA 2O2CA 2Z4RA 1XDSA 1MB3A 1P33A 3KEFA 4B17A 2GUGA 1YQWA 3BGOS 1XHLA 3MMSA 2DSTA 2NU6A 1SRRA 3JTMA 3OZRA 4GSLA 5F76A 3R6WA 1M7HA 3ZJUA 1D5CA 3L7AA 5JSZB 3B12A 1T13A 4FFRA 2AG1A 4MQMA 3X1JA 3QLVA 2ZCVA 3OI7A 5IYZB 4URXR 4MLPA 5B1DA 2AMYA 1YXMA 2WTNA 3GJ8A 4PU0A 4YREA 2Z3VA 3DQZA 5A05A 3OTIA 5HDQA 2O23A 5ARBA 2QTVB 4RPCA 1JJBA 1HQDA 3LY9A 4MQ5A 5KYXB 5J4LA 2HRBA 4XWYA 3RRFA 5AM2A 3C3JA 4NV0A 1ZZEA 2WINI 3TRJA 5G1NA 3G68A 3RSQA 4D9HA 1BE1A 3B1VA 1EGHA 3VX4A 1CJKC 5GJBA 1VG0B 3NJRA 4ECAA 3W5BA 2PL3A 1DS6A 1RJEA 3PPYA 1W19A 3CJTA 3ILVA 3IHKA 3TIIA 1XQVA 1Y7IA 1WE2A 1R6VA 1XEFA 3DZFA 3H05A 2X8BA 3HZOA 4I4TF 1N8NA 4JBYA 3ZZ1A 2HC9A 3W7AA 2OV4A 3ON5A 2BFBA 4Q16A 3RBAA 3OF2A 1P5FA 3I53A 2IY7A 1O0CA 4DV2B 4CIBA 1QS0A 5CPFA 1E1QA 2HMYB 2ZYGA 4GYWA 4JVLA 4B09A 4P5DA 1RMYA 1WXDA 1YI1A 2ODBA 1HORA 3ZWKA 5G0UA 1T2EA 1N9GA 4AS3A 1A97A 3WP1B 4U2KA 3GDFA 3SAJA 2H7VA 4EG6A 4AIRA 4GOXA 5JQWA 1I1HA 1L4NA 3KKOA 1F1BA 1RNLA 2OVFA 4TVKA 2CYAA 2WBLC 5GZ6A 3TNDA 5CB6A 3R9WA 2CNLA 1W85A 3GUUA 3I52A 1PTKA 1WZNA 4K9KA 4Y6RA 2FEXA 1BKYA 3FDXA 3JCZA 2PANA 3S6JA 2GM4A 3BB1A 1DIRA 4Y8VA 4HDMB 3AGPA 4BDTA 4RABA 5IK2D 4U6SA 5BUSA 4U7PB 3PUXA 3KTDA 3HDTA 3ZQJA 3MJTA 2G3YA 4EA7A 3G02A 3KDSE 2G88A 3KJFA 3N53A 1XAGA 3I1JA 3OPMA 2YHIB 2WJGA 3W1WA 3VH3A 1GPH1 2O8DB 1KZ9A 3TSAA 5LQAA 2J0SA 5DN6D 1DRUA 2HRDA 4OKIA 2CVHA 1RAAA 3REQA 3JARB 4UU7A 2BJHA 3VKUA 1VYVA 5K0NA 4P35A 2YY5A 1D03A 3EUFA 4QYTA 2UKDA 2VCYA 3EDCA 3IBGA 4YP1A 2XWBF 2NVWA 2JI8A 1VIMA 3OOEA 3RVJA 4R3WA 3FROA 2CNOA 4RAOA 3W6OA 2IS2A 5C51B 2Z3ZA 2YH2A 1QH1A 3JPYA 3OBBA 2WA2A 1P4AA 3L7YA 4XCXA 1U2TA 3JVDA 4NICA 1GCOA 4B74A 4FGUA 3IVRA 3VR4H 1QO0A 3WLJA 1P7VA 3C2QA 1AHHA 5P21A 3N5CA 3QPCA 1YCGA 3ZWXA 1YE3A 2GXUA 3CZMA 3OZDA 1MVNA 3OY2A 3TWOA 3BD9A 1DAGA 3BJEA 3KELA 2WYWA 1W2WB 1VHLA 1C9YA 4JP3A 5EXEA 2RGNC 4Q9LA 3TLKA 3TE6A 1AT1A 1ORVA 4A6EA 5KHAA 3VNBA 3TW8B 3ECAA 5CR9A 1FK8A 3WR5A 4G8DA 5ITVA 3CLRD 1DKMA 4HKTA 4PSVA 4QPZA 4LJ6A 2P9YA 3BMNA 4B3SB 4MYSA 4MROA 3ZWMA 4DDTA 1Q0QA 4JBLA 5F52A 2JZOA 3C3CA 3N39C 5LNK6 1IOZA 1RU3A 2FV8A 2QRQA 1E7SA 5CH3A 3TPZA 1BSVA 5LOVA 2QQ0A 3W5AA 1KYYA 2FRDC 4J0IA 1DIHA 5JI3E 1WSBA 4E08A 4EKGA 1ZVVA 2UYOA 3L0YA 2VJYA 1YD7A 1TI7A 2DH5A 2NV6A 1CP2A 2UV8A 3NUQA 5FFNA 4Q39A 2VF5X 1X6VA 1OXKB 4I8XA 4W6QA 3GRFA 3IVMA 2X5XA 3QYPA 3GR6A 3R75A 4MXDA 2R8ZA 2X0NA 1HSOA 221PA 5EWMB 4A2WA 4HZGA 4TTSA 4Q7QA 3GP8A 1SK9A 4FFWA 5DF1A 1QYXA 3D8NA 2P2CA 1WABA 5AHKA 4BVHA 2RB5A 4C3OB 4E51A 1W5SA 1U6JA 4BWVA 4D6PA 2J4FA 1XGKA 3B7PA 3C5HA 1CS0A 2G40A 3EQZA 2XQFA 3HA2A 3CV3A 5T5QA 3WYBA 4YX9A 1GNSA 4DC0A 3E1KA 4K87A 4L28A 421PA 2WU8A 2PE5A 1FW6A 2AUTA 2X9LA 4B3GA 4WKOA 2A7XA 4DILA 5A0VA 2IXGA 3EWSA 4KDEA 1CV2A 5JCZA 1G2PA 1ZD9A 4XQEA 2WFLA 3K0CC 4XUGB 1X0VA 2EW2A 3TL2A 1L5QA 2WYIA 3QNUA 1NJ5A 1OZAA 5K3FA 3RV3A 3E5RA 5I45A 2B8JA 3W8DA 5IC6A 3EG5A 1FVXA 4OQNA 3IULA 3JYHA 1G7CA 1ECBA 3OTOB 1GTMA 1EUQA 3ECCA 4KK4A 1F4VA 2Z5FA 3M4XA 3PBKA 2B4TO 1RRGA 3A06A 1MOSA 3IODA 4OH1A 1LNSA 5AI8A 1X1CA 3JVVA 1JQAA 3L7LA 5ALGA 1X1BA 5ARCA 3D6NB 3S70A 1RXYA 1G17A 1QVRA 3QWIA 1ZH2A 4MA5A 1MKYA 5D1HA 4ZVTA 3CFYA 1E9FA 2X0IA 4LDQA 5LQSA 2P69A 4EPTA 3KTOA 2CCJA 3P19A 4H1TA 1DWOA 3N07A 2ESRA 3AR9A 4FD3A 1YDFA 4O2BB 3H4IA 3JQAD 1X80B 3PQ3A 4KFTA 4L5CA 4C7JA 2VG8A 1F48A 2Y0DA 4UBLA 4L51A 3TPFA 1OGJA 3B3QA 4QXQA 4MB0A 4XR4A 3UJDA 4R9RA 1NNUA 2RHBA 1HYGA 1Q12A 2C4KA 3GB9A 3KHUA 2JB9A 3F1KA 1SEPA 3SEAA 2XUHA 1A69A 3ZS9A 1T4CA 4IDHA 1GFIA 3SF0A 2FR0A 2GKGA 4YJ2F 5JZVA 4WJZA 3PQFA 1OOEA 4QAQA 4LMPA 2W7TA 2JGMA 3CZQA 4LDAA 4UAJA 1EK1A 1H6AA 3RAEC 2MJLA 3GMIA 2W2PA 3L0CA 4GS5A 1P7ZA 1UZMA 2G04A 3E82A 2K5UA 5H82A 5E7JA 4PAGA 1SKMA 4FC7A 4JJZA 3RVOA 4FWBA 4Z4EA 1E3WB 2C96A 2QZSA 1W93A 3P2OA 5DEIA 1D4FA 4C20A 3EE6A 3AUUA 2D8AA 3ROEA 3TZHA 1N5RA 3HU3A 1XTSA 1TKAA 1Q44A 3EASA 4NTZA 3WFIA 1RMQA 4ZRNA 4QUKA 5D51S 4F21A 2C92A 3HDYA 4E7OA 2O48X 3JQAB 2QN7A 2ZTSA 3L1IA 4BBJA 4BLWA 5KTKA 2HBQA 5TY0A 5HUJA 4HAWA 3K70D 3OCUA 1UBEA 5CT9A 3V1TC 3WZLA 1E2BA 3RLIA 1RYDA 2E4WA 3QUSA 1N92A 1NUHA 3X1ZA 2FFRA 4U2CA 4F5YA 3WBFA 1HSZA 2EOAA 3EXAA 4EH1A 1OWOA 7YASA 3S40A 4QD3A 1L4EA 4PFQA 2G67A 2C0CA 4XM0A 1U9IC 2W4QA 4PHTA 4UVHA 4C3UA 2Q4DA 5EUMA 3X2SA 1LS6A 5LYYA 5LWHA 5GIOE 2QTBA 2C5FA 1XMIA 2B2NA 3U4AA 2GN6A 1TJ5A 5TE9A 1KDPA 2BMWA 1QVWA 2XE7A 4BO7A 3L43A 2J7KA 4YDHB 4YS6A 2JATA 5DYWA 1ORTA 2CL6X 3AL0C 4LTDA 2FWBA 1V3TA 2D0PB 5L8VA 2JIMA 3DBOB 1ULSA 3MA0A 1R9MA 2QNBA 4KDFA 5EHXA 4K9PA 4LY0A 2D5BA 1E2MA 4PTZA 1FP4B 4I46A 2V03A 3HPQA 5LD2C 2JVJA 3X1MA 2NP7A 3W7BA 4F4HA 5I9MA 1M6HA 4P3YA 2DBZA 3EUWA 3K9BA 4DQDA 3ZX4A 3K70B 1DTWA 1OZFA 5E4JA 3LHKA 3WADA 5CFZA 4W1SA 5AVTA 1I51A 3EC1A 1QIDA 2GEKA 1EKXA 1W8IA 3BTVA 1M10A 1QGOA 3OLWA 3LDAA 2OHXA 3CRMA 3FWHA 3NPMA 4Q7MB 3KVYA 3SKVA 1PWZA 1AZLA 4B3HA 5F7XA 2PUBA 1EG2A 4K9SA 3OA2A 2QY6A 4WPGA 3RASA 4B4OA 2GZAA 2F7SA 1ZINA 2ZAGA 1TLLA 3ACBA 4CMBA 4DXDA 4HB0A 2I99A 2QE7A 3O82A 1DRWA 1B8PA 4TS4A 3MOIA 3PHCA 1PTJC 4BATA 5B1IA 3TD2A 4B7AA 1NYRA 2ILVA 2KJQA 4M22A 4NC9A 2ZLBA 1OTXA 1YIOA 2A9VA 1NSTA 4GRDA 2RHOA 5GVRA 2AVNA 2Z1DA 3DMYA 4OXXA 1GNQA 3TQTA 5IF3A 4CKXA 1TVCA 5HKBA 4PZDA 5E3JA 3B2QA 1FCJA 1T6XA 1MEEA 1W5FA 2FPPA 5JAZA 1W48A 4KWIA 3T7EA 1SJ9A 1E59A 3ZVNA 2DVMA 2VNJA 2Z9DA 2VSFA 3GZNB 4IR7A 4WEOA 5IVHA 4H15A 1JHVA 3EC2A 3NAMA 4P5PA 2PT5A 1GGNA 1Z0ZA 4RK1A 2I66A 1MD9A 3M4YA 1H1TA 4NV1A 3KQLA 1W4ZA 1UM9A 4A7PA 1D4OA 2EL9A 3AERA 4R8VA 4FLFA 1OLXB 4PC1A 4B6RA 4HAYA 3O9ZA 1CBUA 3OZGA 5IKPA 1HG1A 1ZQ9A 4RJ2A 3S2YA 4CHTA 2WM2A 2I4LA 4NK4A 5D7NA 1Z3CA 1DIBA 2WUGA 5H5JA 3EOBI 5IMSA 1RAGA 1S3FA 2O2HA 2ON6A 3IYLW 2EJUA 1S1MA 1RYYA 2FUG6 2X4GA 3C6BA 1ZR2A 2P1ZA 3C3YA 1T2CA 2V8OA 1ULHA 2EF0A 2WU0A 4JAVC 5DNVA 4EF5A 5I7SA 2QR5A 1SD1A 1VJ0A 3KUUA 1CDDA 5BVHB 4YUWA 3HYSA 3Q9NA 1T5TA 4PTLA 4EEXA 4MEJA 1WNFA 5DX1A 3SJZA 3VBEA 2FZ4A 4MW6A 3ZHTA 4KPFC 4D8WA 4YCCA 4KE6A 3EY9A 3I9NA 5HHTA 1NVTA 5F9HA 1P29A 1ST2A 3DDZX 1X7YA 3IE0A 1L8AA 1FUYB 1B74A 2A5JA 4FI3C 4LI0A 3FB1A 3KBOA 2O54A 4DMMA 4YRFA 3A4YA 4IDCA 2NM0A 3PL1A 2CMGA 3VVMA 4GPZA 2OFXA 2FZWA 1M75A 2NNWB 4X1YB 4CU2A 4BMCA 2P6OA 4PO8A 2AFIE 4FZVA 1PIWA 1XQWA 1SU7A 1RPJA 3NOVA 2IS1A 4NX2A 5KREA 4RANA 1VI6A 4QBFA 5BNZA 3I0ZA 3H0KA 2J30A 2ZIXA 4H9GA 1U2GA 3TUIC 3L02A 1AKYA 5LMZA 2R8PA 1RWOA 2HYIC 3A4LA 3HJBA 2IKQA 2VQDA 2V7QA 3OG9A 3BE4A 1AV6A 3OVMA 3L0PA 1HDIA 1XLUA 1OREA 3AHGA 1Y8QA 4JH0A 1K2VN 1RLTA 4CE6A 4BKMA 1MT3A 4UBIA 5A4AA 1FVFA 1KFKB 2FWIA 2W2KA 2PXXA 1MG5A 1II9A 3FNFA 1YZUA 1CJUC 1CFJA 4KQHA 1IL0A 1VG9B 3IT1A 1M0SA 1Z0JA 2H07A 3F1LA 4CT4B 3HJCA 1RJWA 1V11A 5B6PA 4R01A 5BSFA 3G2JA 5DVZA 2GFIA 2YVKA 3ZHCA 1XP8A 3F67A 1D3AA 3GHYA 1Y1RA 2CDAA 4YALA 5B3LA 3ND8A 3F6YA 2FP4A 2K87A 3VDMA 4B3MB 2BUBA 1A7JA 1OLSA 1VYHA 1U8UA 4YFYA 2DKOA 4PPYA 1R9JA 3WX0A 1NXWA 4B87A 3LG2A 4DSTA 5EQFA 1N78A 3NCHA 1MRZA 1DP4A 2PJDA 3JASB 1LFDB 2P6RA 5FBRB 3DGFC 1F8FA 3NM5A 4AZ3A 2NP6A 1U11A 4IY1A 1U2DC 5LN1A 2X6RA 5AFSA 4F6RB 3AEYA 1OFGA 2R7AA 1QB7A 1ND5A 1CRPA 4QYWA 5AM5A 2XXAA 3S5JA 2EX4A 3LMKA 2H4FA 2F62A 4DCCA 1N32B 3OOYA 2HGSA 1ZM2A 4P80A 4PC7A 3EEOA 3DKIA 3FPAA 3H1BA 1KK0A 4B5LA 3UK6A 4BB5A 3C8ZA 2A1UA 1BXRA 1GKIA 1TUEA 2X9VA 3RUIA 3MAAC 3AY3A 3HSSA 2Q5IA 3ORFA 3KJQA 1IATA 4B83A 5HR5A 3ITEA 4N0QA 3BGIA 2O2GA 3F4KA 4XDYA 4RHFA 5C7YA 4GBED 1KZYC 1GAJA 4F45A 4Q1AA 1QFJA 3HU1A 3UC5A 1YRHA 2GERA 3X2EA 1C9JA 1DFGA 1E9AA 3LUGA 5DWQA 1AHPA 1HXHA 1YZ3A 1Q0PA 2W9XA 3RC3A 4BECA 4GUDA 5REQB 3VQTA 3RVSA 1BDHA 4DDVA 4ND1A 1MC1A 2V6BA 2JGJA 5EMKA 3N2ZB 3UB4A 1E6CA 2DFTA 4DB4A 4AKGA 4JR2A 2OBYA 3WYCA 1P91A 3OM1A 3TBFA 4X7RA 2VT7A 4R3NA 3VSDA 4G25A 4B9EA 1RQ7A 3DV0A 1G3MA 2NACA 3CY6A 3T15A 3DEHA 3PNKA 4R41A 4MUFA 3FHJA 4UFPA 2VF4X 3GJZA 1DADA 4QHYA 5AHRA 4G26A 3HGMA 4TL8A 5ESWA 1F8XA 5ADUS 3UOGA 3EB9A 4YCDA 5BWLA 4MVJP 3ESXA 1F8YA 2ZBDA 4KXLA 5AR1A 1UJ4A 3HFJA 1YHYA 1CUIA 1O9GA 2B61A 1F5SA 4X24A 2FYTA 5JHHB 2X19A 3IMEA 4UD2A 3YASA 3QFTA 1NYQA 1ADGA 1DMRA 4IIBA 1JG3A 5EIHA 5FT9A 1KDYA 3D3NA 2QQ5A 2XTMA 5TLSA 1XZIA 4Z7NB 3QX3A 3SKXA 2PMEA 1GU1A 1RM5A 3PRKE 3TQOA 4HQNA 4TM8A 3L4EA 1JSRA 1KJNA 1TE2A 4GVXA 3SN6A 2H92A 1F14A 4DQ0A 2HZ7A 4OLBA 2YMQA 2ZSDA 3ESRA 3D8UA 3F4LA 4TMKA 4XWGA 5H83A 3T5TA 3LX4A 5F1YA 1Z5NA 2FW8A 4LRXA 4D0RA 3BHNA 5J2TB 5LP1A 3JAKB 3HJHA 4AX8A 1JDSA 3KSDO 5EMMA 5FOTA 3HVJA 5KDLA 1R66A 2ZAOA 1NBAA 1DQPA 1ZAKA 4CM6A 1EQ2A 1V43A 2QS9A 1QHNA 2OHFA 1PBTA 1NAHA 2WWWA 4BUJA 3DMNA 4H4DA 3SYKA 4BV9A 2QTAA 3EVEA 1W47A 4MVJF 4XAQA 2VJAA 2VSOA 3MFYA 5DLEA 4GFDA 1Q91A 5IAJA 4I3HA 3URKA 5IVDA 2RHGB 3UKOA 5EJ4A 3IP1A 4UW9A 4ARCA 3VAZA 1GPKA 1UKCA 1RYNA 2EXXA 2VWPA 2WSSD 1VL5A 4LYYA 4QWWA 5AW3A 4G5HA 4G24A 1SVIA 2GAOA 1OA1A 3FRHA 2FR1A 4E3WA 4AB1A 3I9FA 3ZIDA 4RZHA 1NG9A 2NMVA 1E3EA 1BAPA 1IIRA 3EHEA 3FSJX 1XMJA 3MQFA 1WS6A 1CUSA 1HEYA 3K0HA 4FW8A 4INOA 3WAKA 4DMKA 5DEOA 1NQ5A 2RI1A 1IAVA 2I7CA 4Q6WA 3CKLA 5ES3A 4M98A 2ZUDA 3B82A 3W6PA 1AS3A 3L7NA 1LK0A 4RHYA 5I7OA 2PRYA 3BCHA 1ZUIA 3MRTA 5JCOC 1T5SA 2YWXA 4MPPA 1PFVA 8ABPA 2NTNA 1T9HA 3HXLA 2DB3A 1QWOA 1JDNA 4TX1A 1RHQA 3WK9A 1U0RA 2G4CA 2HRQA 2XR1A 2OSVA 1FQKA 1C0KA 1GCIA 5F64A 2JHFA 5J59A 1P5RA 2VP6A 1HK7A 1X8XA 3U0BA 5KTMA 1N5IA 4PZYA 4RJKA 4WECA 3A6PC 2BV3A 2Z56A 3WJAA 1DXOA 1E1CB 4YUXA 1W9HA 3JARA 3GBVA 3VOSA 4GNRA 3REGA 4HR7A 2L82A 4D25A 2IYLD 3W8RA 1FC0A 1V5FA 3AXSA 3A3NA 3U3DA 4PHGA 4PSAA 2ZJOA 4X3PA 3ZQUA 4Z2AA 1DEKA 2AFHE 1M1XB 2OAGA 3BERA 3U2QA 2EFHB 4CL3A 2IQ5A 1TGYA 2FDRA 3A3YA 3GJ6A 2J7PA 2C8JA 4KIWA 5FLYA 5FR2A 1L7VC 1Z4KA 4E4RA 1CETA 1GY8A 1GPDG 4G0XA 1M2NA 4O1HA 2JAQA 3D4NA 1KP2A 4LJ9A 4XVQA 1FFEA 1FX0B 1OSNA 2GARA 2OMKA 2Q1SA 1YL6A 3E9QA 2C00A 4CKBA 1FTGA 1KORA 3CONA 2PNFA 3DHVA 3LXXA 3HYRA 3I2HA 1W44A 1LPBB 2ZRLA 4JNCA 5BSUA 2XNDA 3WRVA 1VLQA 1RWVA 5J9FA 1EBUA 3JY6A 2HDWA 3TF5A 2V7EA 5BXYA 1UBGA 2BKVA 4AKEA 1ZD3A 4I4TB 1T5OA 4BGUA 1PNRA 2V1UA 4BXOA 4UKDA 3O4RA 2FWMX 4A27A 1R0LA 1ZBDA 2CD7A 3PDIB 3TI7A 1OI4A 4F5ZA 3TQRA 1WVIA 5AI6A 2OM6A 3D2BA 6LDHA 3AY7A 3BDAA 1UPUA 4IXWA 4MARA 3I5UA 3V4OA 3DP9A 3KRTA 1E4YA 2BGNA 2WC1A 3PFNA 3B6MA 3HYCA 4GM1A 4WJKB 2GPSA 4DGQA 4HRXA 5FEUA 4K6FA 1R27A 3BIJA 1E2GA 2Y66A 3VTAA 5CFOA 3F90A 3PX3A 4DANA 1VRCA 4D97A 4HL6A 3OF5A 1DC7A 1V48A 1ZU4A 4II3A 5H1YA 4URFA 4CL2A 3Q0TA 1DQSA 4DDUA 5EWLA 5JATA 2IEZA 1KR5A 3MN1A 1SU6A 3LQYA 2FP3A 1YB7A 3D0QA 3AINA 3GA5A 4R71A 4ARSA 1U0EA 1VLLA 2C3UA 4LIPD 1K6IA 1KSJA 4JY7A 3DXXA 3V4SA 3VJLA 1ZAYA 1G21E 4IDOA 4UHBA 3WIDA 3ZLUA 4BCBA 1CEYA 2QM0A 2JI4A 2WP8J 4ECEA 9LDBA 2WWYA 3H1GA 2QKYA 3FMIA 3R9XB 2BSQA 2FHSA 1CQZA 2AJDA 2XXBA 3P9CA 5EAIA 5HOQA 4RTLA 1MF7A 2QGNA 5AVRA 2QRZA 3OTGA 3P9PA 2ZBUA 1C50A 2ZIFA 4WD3A 3IALA 3ADKA 4WXMA 2K6GA 4MP3A 2EBFX 4YVFA 4DZRA 2OBLA 3EEBA 1SULA 5G0WA 2YY7A 3LLMA 3ZGYA 5K2MA 1J0BA 1EFKA 1GILA 1MORA 2D2IA 2FA9A 1Q5PA 1ES9A 3W5IA 1QPZA 2NO6A 3N5KA 3WK7A 3HB5X 1O6BA 1UBJS 2V7PA 3A1FA 1X80A 4KHZA 4O2BA 3UPDA 3MHTA 3D3KA 2ROQA 5K0JA 2BEVB 4EVRA 4UCXA 1L5FA 3QF4A 3VNAA 2AZXA 4OV6B 2XUQA 3SDBA 5KNCD 2O0LA 2Y76A 4BHTA 1DQZA 4LZJA 3LP8A 4NCNA 1YZYA 4RF5A 5H16A 3MELA 3EPLA 3IE1A 1JHUA 5B3AA 1D2CA 1YMVA 1C7QA 4P53A 4JI2B 10MHA 2WG2A 1N6PA 1LDNA 1OASA 1DAIA 2PGAA 2OTCA 3AUTA 1GL3A 3G1TA 4OY3A 5H7XA 1JB9A 1ZA1A 4N9QA 3VC2A 3WV4A 3UXMA 4FFBA 5IHPA 4D3ZA 3WLPA 3G6WA 4JJ6A 1DZIA 2BH2A 1Y6FA 4HSEA 1CW2B 2ECOA 4NYIR 4NONA 4CR6A 4K3UA 3AF6A 1VHQA 2X1HA 1EIZA 3OA0A 3QU5A 1Y3DE 4HNTA 2QTNA 2W2OA 3P9XA 3LT1A 1RAHA 4V0NA 3JQEA 4JHLA 1A3CA 1IK6A 1S9HA 3EULA 3OUTA 1KFJB 2N1MA 1UDWA 5C46F 2P4HX 3A9TA 3GAMA 3K5IA 3IIKA 4WGFA 5IJAA 3AHHA 4M9CA 2B83A 2ZUWA 3EVFA 1QG0A 2VHTA 4OGFA 2R7LA 5LLSA 1AKMA 4BNTA 3E48A 1L5WA 4EI9A 3NVMB 3BXZA 3DBVO 1LPNA 2VPZA 4X8OA 4QO8A 3L7MA 3WQQA 4ZI7A 2CLEB 4MHOA 5BWCA 3OKFA 1PUJA 3FM9A 1UEJA 5TQVA 4XQGA 4CQLA 3DAFA 2VJBA 5KNDA 1B8UA 3WMRA 3LY8A 4OBBA 2GZ2A 5MN6A 2ZZNA 2YXBA 3AR3A 3ICVA 2XUKA 4W9NC 4NFSA 3FYUB 3F47A 4INAA 5DBGA 4AJ1A 4LF6B 3A2KA 4I9GA 4IH9A 3AX6A 1IIBA 3G0BA 1P45A 1CK4A 3NUGA 3OM0A 1H4VB 1K8XB 3OZFA 4JGBA 4ZZ2A 3ZNOA 2BMFA 1CZLA 5IM4F 3C7AA 1G4AE 4IIJF 4ZOLF 1N36B 1K3UB 2P6UA 3DFFA 4LXYA 3F7OA 4O63O 2HZBA 2HDHA 1FP4A 4XGQA 1NP7A 5FIUA 4A6PA 4G0VA 4FYXA 1O5OA 3V3KA 2DAPA 2Q5HA 2L2QA 3RVBA 4JSRA 1G64A 1JZSA 5E7MA 2WWXA 2KX7A 3QKSB 5HZHA 1W36B 1GU0A 4DEVA 4UDYX 5CIQA 2BVNA 3IUQA 1OYWA 4NENB 4HQ6A 1RXUA 2RAVA 4W9RA 3MWGA 4YJ2B 2O7NA 3JZMA 2QPTA 1YR9A 3OQPA 1YS1X 4XCVA 4R2WA 3BK7A 3ASUA 3MBOA 1BNCA 1J9ZA 3QW4B 3D7KA 2QRHA 3WNBA 2AC2A 2DPXA 2P6NA 3ZU5A 4BNIA 8ADHA 2HSZA 3K9WA 2A5LA 3QVVA 4R68A 5K2OA 4HSGA 4BVJA 1JDTA 1SC6A 1VCIA 3CSUA 4BVEA 3CNEA 2QVCA 4FJ0A 3I04M 4GBJA 5H68A 1XLVA 2CDBA 1JDPA 2VDNB 5K8LA 5FKJA 3ZDDA 3HDVA 3OH8A 1K7SN 1JR3D 3SICE 4QOEA 3CF4A 4D80A 4ZIRA 1MP0A 4XR9A 2B5WA 4G23A 4G4SO 4DKXA 3GZNA 3UH0A 2E5LB 3MWYW 1A1VA 2FSVC 2PYDA 1YZTA 2UZ0A 4G0QA 3PGVA 1OPRA 3EN0A 2P2NA 1MR3F 3F46A 2R44A 4MCHA 4TYNA 1RC0A 2ZRFA 4M1WA 4UM8B 3G23A 5CU7A 4KQMA 2JAWA 4GSYA 1ULZA 4V0MA 4H59A 4REQB 1UMBB 4AJ9A 1ID1A 1RQNA 1TF5A 5JIBA 3PWZA 4A1OA 4DT1A 2XIJA 4DIFA 4GEGA 3AR6A 5I8WA 4E03A 2PZJA 4AQ7A 5B6JA 3GZ4A 5FTJA 2FY8A 3NHRA 1I4TD 3ZIUA 1KZ7B 3EGDB 2H5EA 2W2QA 4IMPA 3F7TA 4TYMA 3RRJA 4E5NA 4UAVA 4K6CA 4DRZA 1Z0IA 4ACBA 2I4TA 3JSXA 5BVHA 4A8JB 3Q4GA 4C9BA 1N6NA 5FUBA 2CSXA 4D9GA 2AG5A 2NGRA 3T34A 3TK1A 2BI8A 4NU5A 3HCPA 3U60B 1U9ZA 3CBGA 4TLLB 4TMZA 2FPGA 3CJRA 1ZJ4A 5C7IO 5AW6A 1J2JA 1Q1NA 4I4IA 2OYSA 2QF7A 3OZUA 1KEPA 1DBVO 1P0MA 3DTNA 3X43A 1E5TA 2ZT7A 3CCCA 3GRZA 1FDSA 1YRYE 4PRZA 1M0TA 3QGMA 2VZ8A 4X1YA 1JHZA 5EE9A 5AUQA 5BO5A 4Q0MA 3E9CA 1T0UA 4H31A 3KBBA 4HXYA 4WOCA 1GGJA 1LC0A 2BF7A 2OVBA 1RYBA 1UDAA 1JQEA 4FC6A 4EUSA 3BOSA 2E48A 2CNDA 4KIUA 1ENOA 2P9CA 2YICA 3A3KA 1L4BA 3BK2A 1E18A 2O1SA 1KH2A 4N6NA 4ROSA 1O0BA 2P9HA 1G5FA 3ZH2A 3QVTA 4EMBA 3RYTC 2VHEA 2WF5A 3J80A 2PS0A 5A5FA 4X41A 1PQWA 5A3QA 4BU1A 5K1ZA 4ZN6A 2DFPA 1YDWA 4KH1A 1A76A 3B7GA 4XUCA 3MTBA 3L4KA 4P4TA 3CPJB 3Q2IA 1RE0A 3QE2A 4UUBA 3GJQA 4A6DA 5F1OA 3VZCA 1WR8A 3TZKA 2WHRA 4DUYB 4CMIA 2GJ9A 2ODQA 4UEQA 4LHSA 1EBFA 2R11A 1YKSA 1AKTA 3LT0A 4GX0A 4Q21A 3W1EA 3D1LA 2GA9A 2FZCA 2P3QA 5AW5A 4D82A 3C7KA 3U6KA 3HB1A 2AI1A 5E1BA 3ASYA 1SCUB 1WKVA 4KRYA 3WWZA 5DNWA 1J97A 5DX0A 1QANA 4YMSA 3R8XA 3WHLA 1NFQA 2XNKA 1E61A 3C43A 1RRPA 3H9GA 3KQQA 3UVEA 2NG1A 5KYNA 1P1CA 3JQPA 3MCZA 3T5CA 5ICGA 3FCYA 1UKZA 4JB3A 1KIFA 1XJ0A 2WJVA 4JBHA 2QZ9A 5C0OE 8LDHA 4HDCA 1RBYA 4J2TA 5IVKA 3H8WA 4JR1A 2E3JA 4GMXA 1R15A 3H18A 4Z7JA 2DFVA 5ALOA 1C4KA 2JFNA 3VR3D 4F6RA 1G3IA 1UXJA 5NLLA 3OZVA 1N77A 5HUQA 1CZKA 3MXTA 4US0R 4NG5A 3PEYA 3C4JA 1TQ8A 1TADA 5JXJA 4AL4A 1I4OA 3LL7A 1PRYA 2D3WA 1JHOA 1Z2OX 4ZVLA 5HKKD 5H8WA 4P22A 1JJ7A 1IHUA 3WYFA 721PA 1SU8A 2O0KA 2YJNA 3GU3A 4B34A 5A4JA 4JI6B 5JNUA 1ORWA 1WDLA 2Z1NA 3D3QA 2J6BA 3QFFA 2CUNA 1NULA 1TVEA 4N6GA 7MHTA 2CFCA 2ZAMA 3UV3A 2IC5A 3N8IA 4DR4B 5FO1A 1G8YA 1LGYA 1F6DA 2GK6A 1X39A 3GLKA 4KV9A 1GLGA 1UBMS 3A28A 3QFSA 4EMSA 1YR2A 1GZ7A 2PZLA 1XEWY 3E8MA 1DJMA 1EFRD 2QP3A 3O1IC 4WBSA 2OA0A 4BKRA 4CMAA 5REQA 1X92A 1H85A 1I0LA 2RGEA 3TUZC 2EW1A 3N7UA 3USES 5CDYA 5KQLA 1U4SA 5BSRA 1OBVA 1SBZA 1O7JA 3IAEA 3WVNA 1NJSA 2N9UA 2WKWA 3EIHA 3B9RA 3HR7A 4RF3A 3I6YA 4L5AA 5AI4A 1J0AA 4YUYA 4H27A 1SGWA 1NW3A 1ENZA 2F1HA 5LCXA 5DCWA 1IXKA 4EO7A 1UBCA 3VH4A 4PX2A 4RK0A 3LRPA 1NC1A 3CIOA 4JYCA 3PNYA 2B4AA 1EEHA 1WTCA 2CY0A 3GD5A 4COKA 2H54A 3LXRA 5IAOA 3ZH9B 3OM8A 1V7ZA 3P96A 1TPZA 4TSFD 1ZH4A 3HXMA 2C57A 1W88B 4M2LA 4FR0A 3GCGA 5KPJA 2Q5EA 1G2QA 3H1PA 4MS4B 2A67A 1HL7A 1Z38A 3LFHA 4M1KA 5HS6A 3TBKA 2PO5A 2UYQA 3LBAA 4DRYA 5KX5F 4K0KB 2YXEA 3FVWA 4U2DA 4YP7A 2ILTA 2JJ1D 4J1QA 5HX7A 4FCWA 2H8KA 4K0RA 4WQMA 3PXGA 1ESEA 1YNOA 1JDJA 2WIFA 1P4SA 3KR9A 4H08A 3CVOA 4MDEA 3JATB 2FF7A 3K35A 1PV2A 5KHLB 2ZZKA 1ULAA 2GO7A 1JNYA 4KTVE 3CLTC 1B14A 3ZD9A 1A4RA 1G6OA 3KD2A 3FLEA 1BX0A 2G0TA 2H1FA 3WNCA 4BMXA 521PA 3NBYC 1NA5A 1LJ8A 2YASA 3AM3A 1E2LA 3NDRA 4HQKA 4BVKA 3L8YA 5BSGA 3NVKI 4ZMBA 2C1EA 2G83A 3BFKA 3KXPA 5J2TA 2BFAA 3IAUA 3V8PA 1FRFS 1VJCA 3JAKA 4BFUA 4EZBA 4O4HF 3D7MA 4KGDA 2EIHA 1BHQ1 5IHXA 2XYQA 3FPLA 4LQLA 2A94A 4UCQA 3BXFA 3GUHA 2XAUA 1CE8A 2FWAA 2G63A 1SZDA 2G08A 2ZTLA 1Y6JA 2XY4A 4DCSA 2JLQA 3GJRA 3A4VA 4DKJA 1N57A 5HSGA 2JBAA 4B7ZA 1Z36A 4JVOA 5HE8A 4RJTA 1JWBB 4B6FA 1MAVA 2I1LA 3G5MA 3F98A 4UHJA 4F8EA 2BBOA 4L02A 3Q7RA 3R74A 2IYXA 2WMDA 1IQRA 3I4CA 4IJ5A 3L82B 3VNRA 2ZRJA 1RACA 1XRLA 3NH9A 4OP1A 1A98A 4U7TB 2PUHA 4L4UA 4NS4A 4BCDA 1C4WA 3SU8A 3MCVA 2IITA 4BO6A 1R9GA 3HP4A 2G1AA 4I1RA 4QBHA 4J0QA 1NLUA 1KETA 1V41E 4RVNA 3PXDA 1EVIA 1FDTA 3DBHB 3I5AA 4RX1A 4CRWB 2V6MA 1T9GS 1M1YE 5EJ9A 4OP2A 1EAYA 2B1RA 3BL6A 3NORA 2GEFA 3QEBZ 1RFGE 2PUTA 1I9CA 3AW9A 2HLDD 3O75A 3AJ9A 3OIGA 1DKOA 4FFOA 5CEFA 4I6GA 3ETGA 3F78A 3HCOA 3T7CA 4R0VA 1N2CE 4UZEA 4EBBA 4DMHA 4Q3EA 5BY2A 2RGCA 2ZK7A 4L6CA 2JARA 3I4LA 5CT6A 4EEKA 4L8WB 1Z2EA 2C94A 3P0JA 1KKLA 1NMYA 1FW8A 4RSRA 1GDTA 4A8TA 1XAIA 1Y9EA 4U63A 2IYTA 4LS3A 1SURA 2IYNA 3GAFA 4R8KA 1PQYA 2GCOB 4RKFA 4V0QA 5B58T 3TSOA 4DLAA 3ECSA 2FZ5A 3NR2A 2WSYB 4ZRMA 3RKRA 4UFOA 3IPLA 4KWEA 3G7NA 2V7TA 3UM9A 1OX4B 5I4BA 5A7FA 4QDUA 4ASUA 4C7OB 1USUA 2JRCA 1ZD4A 1OZGA 1MC5A 2I6TA 2OCLA 2V97A 3FE2A 3JQ6A 3MK31 4GL4A 5AK0A 1MNQA 4HX5A 5I9BA 2VSQA 4NULA 4RK7A 3AJEA 4R3UC 4WLUA 2OCBA 4A10A 4DZZA 4E4TA 4KH0A 2FSHA 2QMYA 1RQXA 4L16A 4FBGA 2ONZA 2V4MA 5CG2A 3RDPA 1JLLB 2KPOA 1YGYA 4RACA 1KZHA 3D2AA 3UGKA 4BNHA 1T5DX 1DXHA 3EA4A 1V5WA 4LSGA 5JYDA 2FE4A 4WLVA 1Q3HA 4GU5A 3DL0A 1YE5A 4URUR 4NNJA 3S8YA 2JDID 3JD0A 4EPVA 4AKIA 5GJVC 3ZZ0A 2HQOA 3RS2A 4QG3A 3C15C 3WHIA 1DBQA 1G63A 4GZMA 3HKEB 5E8JA 4UM9B 4MIKA 121PA 5CFNA 4RTKA 5DT2A 1BQ4A 2CXXA 4CLOB 5JAPA 2GBLC 4CV2A 1SUDA 5DMXA 3UYLA 2XGSA 2W98A 4UD6A 4W7IA 4HB2A 2EFJA 5LU9A 3QWBA 1XQ9A 3BRCA 5AIBA 2UXDB 3TDMA 2QB5A 3DDCA 2R87A 3BEDA 1HTTA 2XQVA 2BBSA 5AXCA 1KJ8A 3TLXA 1Q2UA 1TVMA 2OKGA 1OIVA 2X0RA 1T3LA 4IZHA 3RBVA 2UU9B 1EP2B 1SPBS 3ELYA 2Z4SA 1NU8A 4TUYF 4DLSA 1JR6A 4Z3KA 2JEYA 2J07A 4M76B 1O95A 2C8KA 3NT5A 2VUIB 1RHMA 3RB8A 4Y3UA 4G5QA 5IDVA 4YRSA 5K3CA 1V47A 3J81k 6YASA 3Q9UA 4CKCB 3OT4A 4HAXA 4MAMA 4NMWA 3ROQA 3UT0A 2DEUA 3R0IA 5CVJA 1U1FA 4ZAGA 1M67A 5CB8A 4PO1A 7ADHA 2NSLA 4LQ4A 3VTKA 1ZXXA 2I2BA 3IOBA 3I9V6 1H66A 3TI9A 1AXRA 4R8RA 1J49A 1AGNA 1IC6A 4KNVA 1I3KA 5T4HA 3ZY5A 5K6TA 3V48A 4TMXA 4N7BA 1IPFA 3QXSA 3H99A 1Z3IX 2P2YA 4J6FA 1EIWA 1WBDA 5JFTA 5B58C 1C3XA 3FPFA 1T6YA 3TAUA 4NJMB 4LE2A 2C5EA 3OESA 1UWKA 2O57A 2QBYA 1CEEA 4KKVA 4NEHB 2Q3MA 1XZHA 5CLLA 5AKLA 2VAMA 1L1EA 3LS2A 3RIGA 2JIZA 3FMGA 5IWCA 1QNLA 3DE3X 5DNUA 3G89A 3RT1A 4UTVA 3P9KA 1KK3A 1XLTA 2BEVA 2A5YB 2CN1A 2GEVA 4G5FA 1C4XA 4P4GA 1OX5A 1B1CA 1V71A 2YHSA 3W6UA 4CV1A 2FXIA 3T0FA 1V16A 1BU5A 1YJXA 2AA3A 2HADA 3I6QA 2I2XB 2JVIA 2JIOA 4K6MA 4HB4A 5LNK1 4GE0A 1AO0A 2F3RA 4PQYA 2W0SA 3L8FA 2I2FA 3MVEA 2R1VB 4DHEA 4KVAA 1JT9A 3LKZA 4MR9B 3C3EA 3DZIA 3NHUA 3NTVA 1HYBA 2D00A 2MTBA 1H4QA 5IZCC 2HT1A 4B9AA 2BDUA 2E18A 3SQDA 3O7WA 2ORIA 2J3EA 2XUDA 3BPSA 3TINA 4E88A 4G5YA 2GMWA 4D3DA 2F55A 1SCKA 1IMJA 1I4EB 2FOIA 2P79A 1CVRA 4YUAA 1FFYA 1CUJA 1MPXA 4ZODA 5IKMA 4FMDF 5EJ7A 3B6KA 4HI0E 4TOIA 2HU7A 4LI3X 3OEYA 1AKUA 4TMVA 4J16C 2I80A 1Q1AA 4GX5A 4JI8B 3T9BA 2D59A 2PT7A 3ETJA 4TRNA 1I80A 1A9PA 1EWYA 5KB3A 4A0FA 2GJSA 1C1XB 4DIBA 4DJFC 3DDWA 2AGVA 3IR5A 3CTPA 2G5PA 3UH1A 3U1TA 5KWJA 4ZYVA 1EFVA 1TQ2A 1Z34A 5AW1A 1KRXA 1EXDA 1GZHB 1OGIA 4KWHA 4IDPA 3HYTA 2CLMB 3JQ9C 1KZ1A 3KT3A 2A9FA 3BTSA 3CBQA 1M6VB 2F1JA 1QYCA 4IQ0A 3QU4A 2Q2WA 3KV1A 2IIPA 4G97A 2AB0A 1V1RA 2AG0A 1W1IA 5ALTA 1AKEA 2QG6A 2XMBA 2AXNA 2ZTMA 4XIIA 1UR5A 1OWLA 1H1LB 3GX1A 3FYUA 1MAAA 3N8HA 4TL9A 4MQBA 4LSMA 1AA9A 5KSYA 1WPXA 4QUAA 1V26A 4OHYA 3GJTA 4DFDA 2WHQA 3DWEX 1KDVA 4GAEA 4G9EA 3Q8LA 4LDRA 4R7ZA 1FXWF 4S1VA 2V58A 1R16A 3NGMA 4GX2A 5TPZA 1XZNA 2CW5A 3F6SA 1FBTA 2R8XA 3PEUA 5DXFA 5EI5A 2HXGA 1YCHA 3AZQA 4GPD1 1NKSA 4LJ5A 1XPJA 3EW7A 4CF7A 2PUAA 1PNVA 5JMOA 4AN4A 3I8SA 3THOA 2DJ5A 1EP9A 1U94A 2QVGA 3QLUC 3QKSA 5F9MA 1UJNA 1AS0A 2C0PA 4I66A 4YMVA 1H8HA 3NP9A 1DDOA 3R23A 3PR2B 3GZTB 3DZCA 3OQHA 1R5OA 3DOJA 3LPMA 4YJ2A 2CLOB 1FNCA 1P1KA 3ZEIA 2YN4A 2EYUA 4BV2A 1R4ZA 1SKYB 4JGIA 3VDNB 5B3KA 3WL5A 1L5VA 2IYEA 5EQDA 5E2BA 1OFIA 1W0CA 1TJYA 1XEAA 3Q72A 1EDEA 5AJTA 5KCMA 2ZRQA 3ZE6A 3IMKA 3T7KA 1S9DA 2O5VA 4HF7A 1XJQA 4BEBA 3QW2A 2GJKA 4MUMA 1O2DA 2AUMA 2ZIWB 3G2HA 2QIPA 4TVOA 5JNLA 3FNEA 4ZEVA 5KOJB 1I7DA 1KS9A 4JOBA 4YRIA 2H18A 1EGAA 4GZ6A 1QHYA 2R62A 4FBMA 4EQ6B 3KQHA 1CNEA 1RXVA 2VF7A 3RS8A 4NFLA 2GPYA 5CNMA 3PTLA 5HF8A 1CDOA 2BFNA 1W25A 3NHAA 3H9EO 1T34A 4C0XA 1TMKA 4A4DA 3TMKA 4DDWA 4EY7A 5IDXA 3FLMA 5J5VA 3T5MA 2O7VA 2QP4A 3KQTA 3OQIB 3VOTA 3IAM6 3NTRA 2AK2A 3C8DA 3DHNA 4YONB 3E23A 3NYRA 2XWQA 1PYOA 4L8VA 5DLPA 1YR1A 4BTLA 4IX9A 3G9ZA 1BS1A 1R10A 2GCGA 2IA5A 1DJOA 1E58A 3EWIA 3PKZA 3VYSB 1KEZA 3WIVA 1UFKA 4KN9S 4N3AA 3JPWA 4FGSA 3NJ8A 3TTSA 4BVFA 1WXEA 3ANNA 4D4MA 2CDCA 1P0CA 3KR0A 3S8MA 5T4BA 3V5NA 5LP6C 1E79D 3IT3A 2O8FA 2ZJFA 3EGDA 3O7MA 4M1OA 4P36A 1VBFA 5EHGA 5EVJA 5FF9A 1GFSA 4YXFA 5F9FA 3QX8A 1T1JA 4TXMA 2PX3A 1YIDA 4U2EA 5F3WB 1ZCJA 3GYBA 1D1SA 2RMKA 3L5KA 3QVWA 2PL1A 3CZ5A 3JALA 3C6QA 1NFRA 4IIJB 4ZOLB 1ZJYA 3ELDA 3I8XA 4B73A 4DDHA 4EF6A 1OB5A 3W05A 4V0RA 4X66B 1MVOA 1RI5A 3HNPA 4BLRA 1XMXA 4KGZA 1NUAA 3W2TA 5SY6A 4KI0A 4L9SA 2DTDA 4A03A 1E2HA 1KAHA 1UJ2A 4JB0A 4DLLA 5LQNA 4NMHA 4X7MA 3WSVA 4DRXB 3UK7A 3CLTD 1FY2A 3UJ3X 3K2QA 2AQ8A 4LKRA 1NSFA 4O29A 1UBHS 3FTDA 1JB1A 3UJCA 2BM0A 2WVJA 1LZLA 2CZGA 2YRXA 4LRTB 2RAPA 3CE6A 4CLHA 1J2YA 4HDNB 4FDTA 4OOFA 3L6BA 1E0SA 3N2EA 4UTZA 2GTHA 1J42A 4DOMA 2HO4A 2P7HA 1TEZA 1NJFA 5JBNA 3JU3A 2E5FA 1I36A 4JKOA 4Y67A 5CAEB 3T0IA 1AN0A 1DKUA 3I1FA 4LY6A 2PR2A 3X1DA 2FKNA 1SBIA 1YZQA 4E4YA 3BMQB 2GSWA 4RGVA 1O94C 3D3WA 3NPAA 2C2YA 2PWBA 3MUNA 3FMOB 3A9CA 5CA0F 2HHCA 4NAHA 1XA4A 2ZE6A 1TEHA 1VYUA 3KZXA 3MWJA 5DSZA 1G66A 4J3NA 4J6EA 3IO3A 3FCSB 3LT2A 2VUHB 4D8UA 4EVQA 3VNVA 1QCDA 2Z43A 4N18A 1KEKA 3RIMA 3ANMA 1R0RE 1PYDA 4TTRA 3I64A 1P19A 4RJIA 4R2LA 4H6VA 4D4LA 4JMLA 1SCUA 3C4QA 3NP7A 3PPVA 4LW8A 4N9WA 5M04A 2NIPA 3FF1A 4QFMA 1GITA 3SCZA 3N86A 2WG1A 1GAWA 4J2OA 1IUPA 3GGOA 3NHJA 2SECE 4GEKA 2NO9A 3C97A 1HZZC 2GPNA 4WASA 3WLRA 3QKTA 4OK5A 5DYIA 5DNCA 1KI3A 1LNQA 3FLAA 2TMKA 2ZPTX 4RY0A 1DZ3A 1TX4B 4X45A 3WQRA 4E15A 1HE1C 1C4OA 1P31A 1XZQA 2AQHA 9GPBA 1TYEB 4KQ6A 1YFZA 1KYZA 3IR6A 3NHSA 4ZI5A 6AT1A 2P90A 4JIGA 1RCFA 1W0KD 1DG9A 5J2UF 2W0MA 2JKYA 4I08A 1T29A 1EINA 2WLSA 2FR8A 2MR6A 4RESA 4NWIA 2XE6A 3EFEA 3G6KA 1Y8RA 3PYLA 2B30A 1ZBQA 4PG8A 2H2AA 2NUTB 4FGKA 4CEHB 3DZGA 4EHJA 3KM0A 4RS4A 3SZGA 3DZBA 1PX0A 1XZGA 3BIFA 3HJRA 3WXMA 1FJGB 1WVMA 4GRIA 1N8KA 2IY8A 3T95A 3ZOKA 4CFYA 2QJRA 1ZEJA 3A2MA 1T1EA 1L0BA 2BR4A 2J8ZA 2XAAA 5LMUB 1S4QA 2YWEA 3L7IA 4OJMX 4RD3A 1PF7E 1XA0A 2PCJA 1C0LA 4POOA 4JB8A 2FLVA 1B8VA 4AP6A 1F2UB 2BGIA 4JC0A 4PO9A 5DP1A 4HT3B 1KOLA 3GOQA 4FI3F 1EB9A 4WZAE 1CY7A 4F2PA 4BLQA 3K94A 3ROZA 2Q1YA 2P0YA 4GD3Q 4M9UA 2EEPA 5CMLA 2WB2A 4ZA2A 1G1MA 2JLXA 1FBNA 3OPVA 4Q4LA 3TH5A 3NC0C 4F71A 4CGZA 3LVQE 2NOAA 3WGQA 1B3RA 2Z6UA 3L0DA 5SY9A 3DT9A 1M0EA 4IFEA 1JFVA 2Z2IA 4AMVA 4IIDA 3K09A 3DAYA 1R0WA 3VC3A 1KAGA 4YQFA 1KK1A 3T1TA 1LI4A 1XDDA 1IBCA 2HQRA 1AD2A 3FSGA 3MWFA 4BASA 3S8EA 1SCNE 4IMRA 5UKDA 3DD5A 1HKUA 3H5AA 3VYUB 2GF0A 1E7WA 1Q0ZA 5TGZA 3BMCB 1UDRA 1OKKA 4O2LA 3LK6A 2PD6A 4HFMA 4AI6A 3U4CA 1LQ2A 1W4RA 2IHJA 4S2UA 1EA5A 2UVQA 5F51A 3VKFA 1CUVA 4GOOD 1LEHA 2DE0X 3DHWC 2Y1DA 1SHLA 5FV7A 3JATA 3OTHA 2G0AA 4ARBA 3ZYCA 2HJHA 3FCOA 2IXFA 5EHIA 3TQSA 4BWGA 4RCZA 3FBWA 3Q6IA 3QXJA 4RQTA 4DHWA 2PSSA 3QENA 3IOEA 1G2IA 1E2DA 3N3BC 1Z6AA 2NWQA 3JYNA 2MSDB 5KDDA 3WG9A 4RBNA 2HQ1A 2EIXA 3LWDA 1E3QA 3GLIB 2AKAB 1QM5A 2D8MA 3KOXA 4J9VA 5HF9A 4YT5A 1V4BA 2WMYA 4PYJA 2IOQA 1D9ZA 5E6RB 4X62B 3P32A 1N1EA 4N8SA 4QJ5A 2W6CX 2GYWA 3GHHA 4NPHA 1FSGA 4UMEA 3ZJTA 2A7QA 1WUKS 2HNAA 2XQGA 3BULA 2I7DA 3OICA 4N41A 4HJXA 1QO9A 1XFDA 3LU1A 4S0ZA 1T4BA 4J8PA 4ZKEA 1KR2A 3UMVA 3IEIA 4CMGA 1PJBA 4RLFA 1N6IA 3WDKA 5BPHA 3P71T 4HWTA 3SEQA 4ITVA 4A0HA 5A1TA 4W8OA 1JNXX 1PR9A 1VIDA 2VBFA