1JT9A

Structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
266
structure length
247
Chain Sequence
b'MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine-6-Phosphate deaminase
molecule tags Hydrolase
source organism Escherichia coli
publication title On the role of the conformational flexibility of the active-site lid on the allosteric kinetics of glucosamine-6-phosphate deaminase.
pubmed doi rcsb
total genus 89
structure length 247
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jt9A00
3NWPA 1HOTA 1NE7A 4TM7A 2RI1A 3ENQA 1DEAA 1FRZA 3EB9A 4L5IA 4R7TA 1CD5A 3L7OA 2BKVA 4IO1A 1JT9A 3BXHA 3OC6A 4NMLA 1M0SA 3KWMA 1O8BA 3NZEA 4OQQA 3BXEA 1FS6A 1UJ4A 1FS5A 2GNPA 2RI0A 1KS2A 4M8LA 2R5FA 2WU1A 3ENWA 4OQPA 1VL1A 2BKXA 4L5JA 1UJ5A 3CH7A 3E7FA 2W48A 1LKZA 3BXFA 3HHEA 3BXGA 4L4YA 3UW1A 1XTZA 2O0MA 3ENVA 2J0EA 3E15A 4L51A 4L4ZA 1FQOA 1PBTA 1UJ6A 3IXQA 4R9NA 3LHIA 4TM8A 1FSFA 3EFBA 3ICOA 1Y89A 3LWDA 4GO1A 4L50A 3KV1A 2OKGA 1HORA 4GMKA 3CSSA 3U7JA 3TX2A 3HN6A 2F8MA 4X84A 5HJ5A 1LK5A 1LK7A
chains in the Genus database with same CATH superfamily
4DLUA 5B37A 2LBPA 5PNTA 1X6VA 2B1GA 1T3LA 1RR6A 1JLLB 1MG0A 1DNPA 2HHLA 4GPBA 1DMSA 4JJ4A 1EA5A 4L28A 1N2GA 1Y33E 4ISCA 4F9GA 3VR1A 1JG6A 2NU6A 4LE1A 5JFTA 5A3VA 1M0WA 2HA3A 2VF7A 3CCCA 4JVLA 5LZ9A 1P0IA 1LX6A 1LD3A 1QYVA 1V1RA 2YYYA 3L1HA 5HSGA 1LNZA 2EW8A 1M8KA 2B69A 5DW0A 4PC3A 1BN6A 2R8EA 1RZ3A 1KXZA 5LL6P 1P7PA 2EGHA 4XUCA 3N1UA 1DC6A 1T9GR 2LKDA 2XWQA 4L50A 1ONOA 4N5LA 4NBLA 4D9CA 4F2PA 2PH1A 3SE7A 4EJSB 1SMKA 2QNIA 3B9QA 5HZMA 4BQSA 4L3VA 4KQGA 5IT5A 5BR1A 1OX5A 2W98A 1G4UR 4UREA 4FUTA 4UCQA 2CWWA 1P0CA 3RUEA 3PLAE 1M0SA 4Y9SA 2NG1A 2QN1A 4Q03A 4EA9A 4CM4B 4EI8A 1YQ9A 3PHBE 3R75A 5AM3A 4M9UA 1S3SA 4K6CA 3O0DA 3V8NA 2DULA 3UMBA 1DIOB 1PJ3A 5EP1A 1G8SA 3KJNA 1BXRB 1SVIA 3EHEA 3ELYA 3JQGA 4CGYA 4REQB 1VYUA 3JRNA 1Z35A 3U4QA 1X2EA 2OR3A 4HNTA 3HMKA 5M2QA 4L9RA 2JAOA 3SZUA 4KN8A 1UJNA 1MJGA 1NI5A 1EM6A 4TV9A 3MCUA 3TFWA 3K6RA 3U61B 1P2SA 2FVYA 5DB4A 2DOKA 2WFLB 3F98A 7ABPA 4L07A 5JDCA 1YOVB 3GYGA 3DDWA 1EQUA 1UFKA 3LX6A 2H18A 2O2SA 1NSFA 4EBFA 2B3DA 1F4LA 1PLLA 2LIVA 2XD4A 1IQPA 1Z34A 1YB7A 2C58A 2J59A 4OI4A 5FUWA 2ORVA 1ZGHA 3CKMA 4PIVA 4ZAGA 1OX6A 1KZYC 4IZ6A 4BP3A 3W5BA 4OBEA 4PX9A 4MPDA 1ELOA 2ZJ2A 4F4CA 4ARUA 2FYTA 1RLUA 3PWZA 4PYJA 1YE3A 2DJIA 3D81A 4I46A 2ZYWX 3QPBA 3CRMA 3W8FA 1KZ7B 2F1IA 2I71A 3QGMA 4JL5A 5DV9A 7AT1A 3E23A 4R31A 3MHTA 4QQKA 1T1SA 2GPBA 4RETA 4B8WA 4ALLA 4IIJF 4YAUA 3D7LA 3EXHC 4YDRA 4XYMA 2JIZD 2JEYA 5FLEX 2P67A 1BH2A 1Z82A 3PV0A 3EMVA 3UTCA 4OM8A 4NBRA 3LU1A 1VPWA 5JO9A 1JU3A 2XODA 1SUBA 2JANA 3WK8A 2KJQA 1H9AA 3IAS1 4YRDA 3H4MA 1YK0A 2V0NA 2VEOA 4IMJB 2DMRA 3RREA 3EISA 4QUDA 1JFLA 4MWEA 5HK9A 1PT5A 5D7BA 3CBGA 1G5QA 1JR4A 3G2MA 1IWBB 3H1BA 4HDMB 4KIWA 4N5DA 4RELA 1K8YB 4B35A 1NXTA 1HNZB 2G3YA 1CUWA 2MOKA 3S1AB 2RGXA 3R8FA 2WJWA 4BKQA 1ZD8A 3G5TA 3WGNA 4ZK6A 2PM8A 1C3EA 1QZZA 1UBFA 2HJVA 1MBZA 2KS6A 4AJEA 2P4HX 4J6EA 5KKAA 4O4HA 5B55A 4JP2A 1WB6A 3SDSA 2C7OA 1BFKA 1ZMOA 5K0LA 3UG7A 3W6ZA 4UJ3A 3ICCA 1DTWB 1GGFA 2ZI7A 2QTLA 2V4UA 1A1SA 3EGOA 5LWHA 4OGLA 4ES6A 2QTZA 1E8DA 5BQFA 3WA7A 1ZMRA 1RWXA 5TF0A 4R1SA 6Q21A 2ZIFA 4HNHA 5K4AA 1F38A 1OFTA 1P0PA 3GRCA 1S7GA 3RIXA 3WRXA 3U6KA 2VLIA 5K0BA 5IULC 3LNTA 2AJDA 3KSMA 1RPNA 3VKVA 3GHYA 2VHVA 1ODLA 3VO1A 4DLPA 5BN5A 2ZJYA 1O96B 2KWIA 5CDUA 3LQFA 3PQ2A 1DOAA 1JDSA 1ZLYA 2IU3A 3UATA 3L0BA 3ZIDA 2OQRA 3AP1A 4BQFA 2PBRA 5DBOA 1WOMA 2R7MA 4F1WA 2BEUB 2I9PA 1UOOA 3ZE8A 4MJLA 4K0KB 4HN4B 3PVZA 3LVQE 3PEVA 1TAUA 2IUTA 4OHWA 5DLDA 1AGYA 1SBHA 3PR1A 1Q14A 3IUPA 5F1PA 3WWZA 2CYBA 4L76A 4LQCA 3TDMA 2ZE8A 2JEOA 3NEPX 3EMDA 4GXTA 2PNJA 3PI6A 3PVCA 3AI2A 1L5OA 1T5DX 1UT6A 3D8BA 5EQFA 4IYJA 3G2PA 4EVQA 1MG5A 2I80A 3LBFA 5CB4A 3PKIA 4ZTBA 4ZOEA 4R71A 1XWIA 1ESCA 2XUFA 1GTRA 3P9NA 3AVWA 1NIPA 3EFOB 2CT8A 3IR7A 5DXAA 5SZIA 1XNQB 3EAGA 2P11A 1UMBA 2WZBA 3LBHA 1LX7A 4ZGBA 1G8GA 1H0KA 4DM4A 5BN3A 1K1EA 3T0FA 1ZK1A 3NHMA 2VT2A 2GEDA 3ESDA 1GTG1 4L4SA 3SAJA 2IYRA 3HV0A 4DQLA 4DSOA 2I7CA 1CVIA 4I4TB 4MA5A 3ZEAA 4QASA 1JQJC 3FOWA 1RLOA 1N32B 1EHCA 5LKAA 1J4AA 5HIAA 3FMPB 5I5GA 2EZ9A 3D4LA 3WL3A 1IBCA 3M1AA 4E5PA 3UUWA 2XZLA 1FVXA 1QNFA 2BMFA 4B3XA 1SCKA 5DHPA 2WV7A 1W8DA 2PV0A 3HA3A 3MTIA 2BJHA 3TG2A 2YKGA 4IIJA 5JJKA 2CNKA 2GPJA 1TUBB 1QMPA 2VWQA 3PJFA 4C0WA 3UV3A 5REQB 5EJ6A 2P5TB 2XB4A 4H3KB 4IIDA 4LSGA 2D0OB 4PSKA 3BRCA 3N5CA 3Q87B 4XSHA 3E35A 3ACCA 1H42A 3FHCB 4PFJA 4Y6SA 1SPXA 3DZ8A 3CLUD 1Y5LA 1MF7A 1GPDG 2FLVA 4XB2A 4UE6A 2VXYA 1TAQA 1FUEA 2GK7A 4A4DA 3UWMA 3KU4A 4U7GA 1GY8A 4IHJF 3JALB 4WEOA 4LF4B 4A82A 4BCBA 1KVQA 3KOMA 4FZJA 1PUIA 4M8LA 5GJCA 5K8LA 5BSFA 3TB6A 3NMUF 4G5RA 3H2ZA 3JQGB 1XN1A 4LKOA 2D2VA 2ZWVA 4DIDA 3ZDQA 3IUEA 1ZA2A 2YFQA 2VQ3A 1F0PA 1NM5A 1GKKA 3SEFA 3ICQB 1QBKC 2IGBA 4KJXA 2ISCA 4XR9A 4ACBA 4DR5B 2H2HA 1T36B 2HMYB 4RVFA 2A9JA 4WJZA 5HKKD 3WLQA 5CYGA 2AHOA 4WY5A 3FPGA 4B6EA 5K3FB 2QDXA 5KOHB 2W6PA 1JT2A 3FB4A 3M3DA 2A9KA 4MDHA 4AKEA 3BMCB 4DSNA 5CVDA 3VPAA 2I8LA 3Q3EA 3ABQB 4BNNA 4BWYA 4DA0A 4CF7A 3DO8A 3E9MA 1QZ3A 1RPAA 2GBIA 4U1RA 1WKCA 3BA1A 1NG1A 1Q74A 2QENA 3PC7A 4FYVA 1EFTA 3GMSA 1ODSA 3A26A 4KXQA 1AMOA 1I10A 2VBIA 1F0KA 1EFHA 1ZS9A 4PF1A 3LYLA 3IHWA 4FI3F 1JI0A 3EDYA 4FFRA 5K3CA 2SBTA 2XY4A 1F2UB 2DHRA 5IVHA 3QBJA 4L57A 3QOFA 3R7FA 3UMYA 1HZZA 4CGZA 1LPSA 3GGGA 2C2HA 2XHZA 3GGSA 1V7ZA 4AZWA 5U4QA 2WSYB 4LCBA 1ODCA 1PFWA 1PJBA 1OBHA 2R8RA 3PXEA 3AT1A 4Z6KA 2NW6A 4P5EA 3TW6A 1RMYA 2A94A 3HQ4O 4C4PA 4LWPA 1SVUA 2CLMB 3CZ9A 2XXAA 3UM9A 1R8SA 1T5SA 1CHNA 1ZQ1A 221PA 2VF4X 2ZTMA 5FWXA 3ZW8A 4FVTA 2IOQA 3WIDA 1XZDA 4EEKA 3KJFA 2VAWA 2FPOA 4DILA 1G5TA 3T0IA 1W0JD 2IPXA 1Z5UA 2B30A 2BEKA 5C8XA 1YB1A 1ULTA 5I3CA 2IS2A 5EN4A 1N9GB 4EPRA 2GEFA 2FPIA 2ZJ5A 2PEYA 5EKXA 3LIPA 4TKZA 4YWHA 2JBWA 2QVCA 1OLUA 1UINA 2VRWA 5GOTA 2YXEA 1Y80A 1P91A 2ZBRA 2I9KA 3LPDA 4YCLA 3A1DA 4KOAA 3E3LA 3FFBA 4MWTA 4DCTA 1XEFA 2QGFA 4DUYB 3C3MA 1KI1A 3ENNA 4YVFA 5CA1B 4HEA1 4L27A 1U2SA 4KL8S 5JY6A 2F43A 5FRDA 1UT8A 3CVXA 3U49A 1POWA 4TRJA 4DJ5X 2QGNA 1ESMA 5CCEA 4P7BA 3DTTA 4NEQA 2UDPA 1IZ7A 1FNNA 1G8FA 1SHTX 4JROA 3KT6A 4WD3A 2X1MA 2YY6A 3KEMA 1XHEA 1UKBA 2CL7X 4BO5A 2CYAA 1AV7A 2WYIA 1AS3A 5KCZA 2UYQA 3G7UA 4DR3B 2WFLA 2ZVDA 1BTOA 3EIWA 1YMQA 3FDIA 4QGFA 5EXPA 5DBGA 5TPWB 4RCYA 4ESHA 1FNDA 4HK4A 4RXMA 4YCMA 4AO8A 4TVSA 1A0OA 1O6CA 2WTBA 3QKWA 4UUPA 5EQJB 2XZDA 3FOBA 3X1ZA 2O4CA 4PCUA 1SRQA 5BSKA 2HFKA 5AVQA 2NVOA 3BK1A 3G2QA 3K5WA 1DZ3A 3NHZA 4C20A 3LCRA 4NABA 3IHKA 4UD6A 1HKHA 2OZLA 1LC3A 1OUMA 2HF7A 1BNCA 2VSOA 3ORRA 2R84A 2Z8YM 3WISA 3F2IA 3WGLA 1Q22A 1VIAA 4WLNA 3W78A 4NOLA 1OPXA 3T7EA 4P2BA 4EY4A 2VTKA 5CM2Z 1DDOA 3ZLVA 3OPMA 3D5EA 2Z98A 2Q3MA 3TS1A 2F67A 1IHPA 2FMTA 2V5VA 1LTQA 4PLCA 1TEXA 1K8RA 2VPTA 3ZDBA 3IQHX 5DULA 3QSGA 3ZTYA 3CLUC 4B87A 4KFCA 4N0MA 2IGTA 2PMCA 4HH0A 5F5LA 4FOOA 5JSYA 2NSHA 2R1TB 1QQ6A 2ZRKA 2EJVA 5A4FS 3AVUA 4I4LA 1G42A 3S2EA 1HLGA 2O7NA 4RVGA 2HFJA 1EBBA 4YQZA 5JXGA 1IRIA 1NT2A 1JG4A 3K1JA 5E9QA 4N03A 1MH9A 1P5RA 1E3EA 2C9MA 4C6TA 2GCEA 4P4LA 2OXCA 1UKCA 2YICA 1GTJ1 3H9EO 2V7QD 4XW2A 1DOZA 3ZI4A 1KFJB 2TS1A 3V6LA 1G4AE 4KTVE 1GAWA 5C8VA 3R7DA 2X4LA 1G8AA 2UVQA 2BYTA 1KSFX 3K0BA 3VHQA 3W1VA 3WJ7A 1Y9JA 1W36C 1WD5A 4PYNA 2FPMA 5KCMA 1SC3A 4Y30A 4DA4A 1GA4A 3EE6A 1JVSA 3IAM1 4Q1FA 4KKXB 1DO2A 1S8OA 2ZTLA 4EPVA 4F2GA 5KMGA 5H3CA 5GPBA 4RORA 1X7ZA 1NI4A 3OZUA 2ZYSA 5AOAA 4DUPA 4MV5A 4ZMRA 5GAJA 1XDBA 2E4YA 2ISQA 3FIUA 3MRXA 5K3BA 3NVKI 3C3BA 3VKGA 4P86A 1EGQA 2W6JD 3LSTA 3CEMA 3OE1A 4UBOA 4BEWA 3IPRA 2R1TA 3FLAA 2I7VA 4DBLE 5JS2A 5TQ2A 3EZFA 3OKPA 3BM5A 2BC9A 3GRAA 2F55A 1CR6A 4RNCA 1D07A 3HCDA 4O2AB 4WHMA 2IP2A 2PSJA 1FBNA 4D9IA 3HWWA 2GXSA 2PG3A 3LCMA 4PYMA 3VVMA 3AMVA 3U1TA 1D2CA 1H8HD 4IJ5A 3W7AA 1Z7GA 4YRBA 4EUHA 2OCIA 2VLBA 1JH9A 1UP4A 4NENA 2RI6A 4TKUA 4BLPA 3SEQA 4FNAA 3L4EA 2YHUA 1CQWA 4U9HS 3THYB 2A5FA 3ZXSA 5AJVB 5DT2A 3QFTA 1FU7A 5K8JB 3ZHOA 1NYRA 1TADA 5K0TA 3WGOA 1N92A 1YD7A 2I1VB 2O23A 3K0EA 3PB3A 4ITUA 1Z38A 5THKA 2A30A 5I6DA 1MO6A 2X23A 5TXGA 2AW5A 1YUNA 4NLLA 4GX5A 3IP9A 5LKRA 3BIFA 2Q3BA 1VMAA 4R2LA 4A6XA 1E1LA 4DIBA 1PDVA 2QN8A 4BN0A 5CFQA 5EI5A 5BT9A 5AI4A 1AKMA 2AJBA 4QYIB 4JELA 5KUTA 5K03A 2EEZA 4BVAA 1ZO8A 1Y7HA 3CG0A 3S68A 3QOYA 3TQSA 3U3DA 3B1JA 4EITA 3EBOA 2ZDQA 5CJJA 4DANA 2PIAA 3VPDA 4C87A 4P3OA 4PZUA 4V2UA 3EARA 1NOIA 1SVMA 3AHEA 1QR6A 3M2PA 4D92A 4TLCA 3NAZA 5AOVA 1LLUA 2VRNA 5KWSA 3P9SA 1T0PA 4UTNA 1FCJA 4DC0A 5DGDA 4WNAA 2G36A 4ZVOA 5D84A 3W5AA 4XRRA 3CS3A 1XL0A 3KJHA 2CLKB 2BMAA 4KIJA 2Q49A 1T2VA 1QMGA 4H0FA 1NQOA 1X8XA 3PQ8A 1PNQA 2VK1A 4WK0B 1MKYA 3RUFA 4FUQA 5TEWA 3KEFA 1VE5A 4DY4A 1L5RA 4AS1A 5A7GA 1Z2EA 5GTDA 3N2YA 1Q0QA 2O5EA 1QKIA 2QJOA 1O08A 2OWEA 2W71A 3EVBA 3HKDA 1QZUA 1DAEA 1XXHE 1TQHA 5KX5B 1FTWA 4C6RA 1Y6FA 2QX7A 1GG8A 3T5BA 2GN2A 2CL5A 1UADA 3L05A 3JQFA 3RKSA 1NSYA 1AQLA 4PHFA 3W79A 4IHJB 3EAFA 2DU8A 1IQRA 1OTHA 1R4NB 3CZRA 5KJEA 2YMPA 3R3XA 4DIEA 2W6OA 3WWYA 2Y66A 4Y2UA 1H2RS 3VPHA 1E6EA 2VBFA 3L0CA 3BWBA 5A0TA 1QIKA 3ASUA 4LYGA 3STUA 4FGKA 3W04A 1EHYA 1O95C 1Z7BA 3K0AB 2XCIA 4E2YA 2D1FA 2R6CA 4EZIA 1ZC3A 1SZCA 1SBQA 1UMKA 4XM2A 5JH7F 4P36A 1X0VA 1VZ3A 4L3OA 3HXTA 4D6YA 1ZRMA 2NU7A 2XMRA 4I8XA 3SLRA 3OZTA 1T2NA 3RARA 4KQ1A 3HFJA 3L4SO 5LNK1 4QDKA 3OQ1A 3AVXA 4MGIR 4HT3B 2LKCA 2WWVD 2D00A 3HFSA 4DPKA 1GPNA 3RT1A 2CBXA 3JVVA 2XA9A 1S4MA 2RGGA 4JI5B 4DR2B 2BFDB 2J33A 2Q3DA 2PJDA 3UWKA 4EUFA 4F3YA 4JT9A 3FTCA 1T2EA 2K2QB 4TL7A 1JAIA 2KE5A 4OGGA 3MGAA 3QJGA 5LQSA 2X8WA 4YO8A 2O52A 1Y8CA 2D13A 1WO8A 1IJBA 2QIPA 2FOIA 1JJIA 1TT5B 3B6KA 3EQ6A 1JHRA 4QSHA 4FYWA 5E8JA 3OT1B 1KC1A 3T3IA 4C7XA 1Z6PA 2O8DA 1XQ9A 1ORTA 3VMMA 3A6PC 4INZA 3GVIA 1CY2A 1GARA 2WWWA 1S8AA 5K9ZA 2YQ4A 5FOSA 3MRVA 4FEEA 4UM5A 2BGLA 1GOTA 3LO5A 3C1UA 2DBQA 2LDXA 4MS1B 1IVSA 3GZJA 4BVFA 1J2TA 1R5NA 4LNUA 2XQKA 3I8OA 3ROQA 5HBRA 3UGTA 5FV4A 3NTXA 3FBGA 5BPFA 1DEXA 2QX8A 1DTEA 1NFQA 1YH3A 3U7JA 1EB8A 2QRGA 2CJWB 3EGWA 2JGMA 3PENA 2A14A 3GG2A 8AT1A 3I1YA 3TRKA 3RTDA 1MV8A 1HOTA 4OA5A 1UOEA 2OLEA 2A3RA 2GVDC 1DAGA 4IFEA 3DMDA 3QZUA 4K2AA 4MPPA 3ZQ4A 4MTLA 3RHTA 5JI3E 5K8VA 1QIIA 1J33A 2VQDA 2IA5A 4LPSA 4U7WA 3RS8A 4AKSA 3UA3A 1V8PA 2G17A 1ZIOA 2JZCA 4QEDA 3F0TA 4KUGA 2YJ4A 1WABA 4HH1A 4UNNA 4LE2A 3SFZA 3QM1A 3AKYA 4PBRA 4DNFA 5M5BA 3KP1A 2XNHA 1O57A 1EXVA 2C2OA 1Q2UA 2IC5A 2YWEA 3NH6A 4BASA 2HT1A 3EVDA 2BTOA 2A5GA 5AQEA 1ZOIA 4G36A 1PSWA 1O9HA 3BJIC 1M1NB 4F85A 3DL4A 4BFXA 1IZ0A 3BBPA 1OTXA 2CVQA 2Q5QA 4BLRA 5DMXA 4Q19A 3O2SB 4BTVA 4EO9A 1G8KA 4QU5A 4M86A 2NMVA 3MTQA 3VGJA 3VR4D 5DNVA 3TQQA 2ZRDA 1YDEA 1X92A 3SQXA 2QP4A 1NLUA 2AZTA 3FYCA 3JRWA 1U6KA 4B6SA 4C78A 2W22A 4KXWA 4O5AA 2GXQA 5IFLA 5TJHA 3R7NA 3IEPA 2ZI9A 3I9FA 3NWEA 1WCIB 4IMIB 4IQGA 1W87A 3UFXA 4PYQA 1KYXA 3E81A 4OH7A 5DNDA 4MULA 2Z1MA 5CB6A 2I3DA 2GEKA 2Q1UA 3IAEA 3WYEA 4CR7A 2CUZA 3VKWA 1KARA 3IKVA 3L1JA 2I2FA 4YS6A 1TNDA 3U3KA 1QE0A 1KZGB 5A1TA 1Z56C 4OHYA 3BXXA 2ZRJA 1HG1A 1MQAA 3I6IA 4NBUA 4TWZA 2W6ZA 3PD7A 5EJ8A 1G41A 1IY1A 3I58A 2DHEA 2J7PA 2VA8A 1W4LA 4KWTA 4BVLA 1H6BA 4N01A 3AZOA 5K0CA 1IBKB 2AYYA 4B40A 1ULHA 2CFOA 4ACAA 3IKMB 3ZWBA 4ITVA 1V6SA 1YUMA 2R6AA 3AF1A 3BGSA 4LJRA 1LRLA 2ZRBA 5NULA 2VNHA 3TR0A 3KO8A 1MP0A 1WCWA 4QO8A 2Z9BA 3D2CA 5HTOA 1K8ZB 1WSDA 1WCIA 1QHGA 4RVOA 4RY8A 3EY9A 3M6LA 1R8XA 1Y8ZA 4RGYA 3NIGB 2FZCA 2QX9A 3HJFA 3BTVA 1BFUA 1KMMA 2HJ9A 1Z6QA 2V5UA 4D45A 4G24A 3OTHA 4MYCA 3AHJA 3C3CA 3H2HA 3TVDA 2FUG6 1N5RA 3QYPA 1QPGA 4EYKA 1IHXA 2XNSA 1HTTA 3EB9A 2VTBB 3MWKA 1XRPA 3B60A 4BL5A 1GPMA 3I92A 3SY8A 3OT4A 2B8JA 4BB5A 2MSLA 2PWAA 4WBSA 4OUDB 1EXDA 3MQFA 5ALZA 1ZWLA 2FN4A 1JFTA 1GQFA 1EK6A 1NV9A 2PMFA 2YIDA 4JQOA 3ZCUA 1FRNA 3VNAA 3IJRA 2YTZA 3NAQA 2X8JA 4IINA 4OYYA 3LTEA 5HFNA 2AR9A 5BYBA 3S1SA 2DRIA 2WWGA 4KR6A 4BC0A 1LSSA 1Q21A 3DT8A 1UXHA 4JMLA 4E4YA 2W6QA 4GKAA 4GMKA 3ZDRA 3MG9A 1QS0B 1V43A 4L5BA 1FMJA 1PBNA 4LY9A 1ZSVA 1GGKA 1LJLA 2OGUA 3STVA 4EL5A 1GCAA 5ALTA 4D97A 2O8VA 4Z7JA 2YJ5A 4WKCA 2DTDA 2G67A 4OGWA 4CNQA 2TYSB 3TW8B 3G5UA 2CL0X 4GX1A 3L18A 3OLWA 4GP6A 3A06A 5A6SB 2BHSA 1HH4A 2R65A 3CNQS 3DEFA 4FYMA 1MPTA 5EE5B 4CUKA 4IUCS 1NLMA 1H2WA 1XCLA 3DM5A 5LOVB 2JGAA 3C8HA 2WAYA 3OCVA 1JHZA 3PP8A 5HYVA 5CXQA 4I1VA 1G0OA 3EXFA 4O59O 4Q9IA 3FDJA 2BCJQ 3NHSA 1YR1A 2JVKA 4IJQA 2ZR9A 4ZPXA 2BH9A 2V7BA 3L8YA 5U9CA 3ROZA 4DHWA 1R0CA 1P2VA 2BZ1A 3E9QA 4FSXA 1KP2A 1MIOB 1VLLA 4Q21A 4RABA 4ASUA 1LTHR 1ISPA 3NHRA 1MVOA 1V3QE 3A3KA 3H17A 3AQ4A 3TLAA 5CDHA 2ZUDA 2Q07A 2VHTA 3KYIB 3T1VA 5D7NA 1PR4A 2Z9CA 3DHVA 5DHAA 1SURA 2M1ZA 3MVEA 1YB4A 3ROGA 3VNRA 4QAJA 5CD1A 2GB4A 1OFGA 4II2A 4OQLA 3TRDA 5IYZF 3WBKA 3SQLA 4BKRA 3VV2A 3A1UA 5AKYA 3RRJA 3B89A 3U4QB 2AG5A 2SCUB 3G6WA 4TS1A 3TAXA 3ZU3A 1W1IA 2R7NA 1II0A 3VFDA 4X65B 1N3YA 2Q8NA 3LLCA 4HRVA 5TS2A 1OA1A 4DRYA 1I4EB 1OGIA 2YFYA 3PI7A 3GUCA 1C7RA 1GUDA 1BCRB 2KHZA 2WYVA 4ND2A 4B31A 4EHJA 2GBPA 1YASA 1SD2A 1U8ZA 1R64A 1JNYA 1EFDN 1MAVA 4Q1DA 4AP5A 4HYYA 2C2YA 1MO2A 4LSZA 5C5DA 1AD2A 3TFOA 4GS5A 1WLSA 2CFTA 4FSDA 2J3IA 4FGWA 1M1YB 5DU2A 1Q84A 2DFLA 4NU0A 3MWEA 2BBOA 1O3YA 1L2TA 2NAPA 3M5WA 2VNIA 3P0RA 4Q3BA 4MVJE 2GOYA 2JFPA 2ZJ8A 3EWSA 5ESWA 2EGGA 1XPJA 4B76A 4YJ3B 4WN3A 3B5JA 3ZUGA 5EHNA 5LQMA 1JYSA 4X1KB 3EIUA 3A27A 1GR0A 3QXHA 4IR7A 3C74A 4ZQFA 1X7HA 4ZAXA 4COOA 1AMUA 4C7OA 2WP8J 4N5NA 4HDNA 4B83A 4OGKA 1GR1A 4PWZA 1BHJA 5AVSA 3R9XB 3BJEA 1Z0ZA 1Z5OA 2QY6A 1T10A 4AS3A 4QEZA 3WB1A 2Q0QA 4UHKA 4LY3A 3LE8A 4Q7JB 4A92A 4AMZA 1WS6A 4XD7D 4NJOA 4UHEA 3WADA 1ZNZA 3ET5A 1D9ZA 5FXMA 1E99A 2NXCA 2GMWA 4NYJQ 4RYDA 2EX4A 2M32A 3U7QA 4YIHA 2YRWA 1C9NA 1ODKA 4R1TA 1CB7A 4UAJA 1TZJA 3P26A 4GO1A 4YIKA 4ABTA 2WMDA 1MVNA 2I4LA 1IMJA 2MMCA 2OHGA 3FCUB 3OCCA 4KBFA 3J7TA 3TX2A 1OKKD 4NE2A 3V7YA 4KYVA 1GL9B 1RJWA 1BX3A 1DX4A 1U63A 1IJKA 5EJEA 1OGJA 1L4FA 1VHJA 1FXWF 2ZRAA 1WHTA 4E2ZA 2DYKA 4RFSA 1SD5A 1KJNA 4R1QA 5AVJA 3TO5A 1Z6TA 2Q9AA 4HNUA 1WXDA 5LYJB 4MV3A 3GGDA 3NTQA 5ALHA 4ENSA 3M9LA 4I4TA 4M0MA 2N42A 1RAEA 1C9YA 3KJIA 4B2PA 3EYWA 4UHJA 1JR3E 3HUEA 4FJ2A 1FVHA 4K6HA 3RS9A 3ILXA 3EPRA 4X71A 4DARA 1UWKA 3DAGA 4HDMA 3A6HA 3VYRB 3H8JA 3HJUA 2B35A 4RIFA 1R3DA 3GCXA 3MK31 3L7DA 1K4MA 3MCAA 3QLVC 4N3NA 5K1ZA 5TQVA 2XTZA 3V8VA 4CQMB 4P08A 1FZQA 2VCEA 2R44A 4LY0A 5TV2A 1OX4B 3ELUA 1IM2A 3GIDA 5EZYA 2FLWA 4A0HA 4HATA 2FEKA 2JA1A 1R5BA 1XYYA 1W85B 3NJ8A 4CM3A 1GSHA 5BSHA 3WIOA 4GEKA 2WYOA 3PUZA 1BW9A 4V39A 5TSDA 2V3WA 4JI4B 1WW2A 3BCHA 4Q9LA 1FQWA 1VCOA 3L1VA 4XJXA 3SQMA 4B2YA 3B3AA 3K32A 1JA9A 1TUEA 3R8XA 5BQXA 5T8KA 3A9TA 4NI5A 3ZDXB 2HUPA 1PR3A 2OK7A 4OV6B 3GLFE 2ZZKA 3ORFA 5DYWA 2E5LB 5EC8A 4MXDA 1EK0A 3L82B 4PGMA 2IEZA 1WR8A 4YMTA 5ALYA 3SJAA 3ENVA 1BYUA 2V6IA 1WW3A 4HYEA 4PQFA 4DEYA 2R86A 1PL7A 3WHIA 4R9UC 1KDVA 4ABYA 2AFHE 1E79D 3QWBA 5DTRA 3PRJA 2X0EA 3MWLA 4TZTA 1HDZA 4JWKA 3OWXA 2MT9A 1RHJA 1LRKA 4JL8A 4TWIA 4YASA 5IARA 5KDLA 4XCQA 3UICA 2JJ2D 2GJAA 2ZBFA 4DM7A 1W0KD 5BW5A 3IULA 3H9CA 2PGJA 4JQZA 4Q3OA 5F2NA 1X7ZB 3GCZA 2O8EA 1EMDA 4NAUA 4KNWA 5I7WA 2BFDA 2R1UA 5H3HA 4C1BA 3EHDA 4LDZA 5GONA 3TTUA 1V96A 5F7JA 2Q1TA 2R6ZA 3BWMA 3DMFA 4Y2RA 1VBMA 3V2GA 1P6XA 3E9RA 4Q3KA 4Y1FA 5BN4A 2GK3A 4R9VA 3RIEA 3CUVA 3T5CA 5DI3B 2DC1A 3WAGA 1AHHA 2RIRA 1XP8A 3W6OA 1E7YA 4DPLA 1DADA 2V45A 2Q0XA 3HZZA 1GADO 3K73O 4S05A 1ORVA 1GCUA 1SBYA 1Z73A 3HVIA 1XHLA 2PMWB 4N7MA 4Q00A 4TV9F 1RI2A 3U7GA 3HV2A 1VKOA 4JP8A 5G0TA 4JBHA 4Q3EA 1SGWA 5EWLB 2C0PA 3HE3A 5J4LA 5CEJA 3ICEA 4PLGA 1EVLA 1Y4DE 1O95D 1A9OA 2E37A 3E05A 4LYFA 4WXHA 5KHOC 1T8PA 2A86A 4XVUA 3JWGA 1YZ3A 1M34B 4NMXB 5EWMB 4HSGA 5IDVA 5KYVA 4HUJA 2B9EA 1AQJA 3CB4A 1AT1A 3SSOA 2QBYB 2DWQA 3ZTTA 4G9BA 2EIXA 3MJRA 3QEMB 4F86A 1C4WA 1LGYA 3HC7A 4I9UA 3AR3A 5JMTA 2JGEA 1PTJC 4OLBA 5AVUA 1YR9A 3FETA 4OXRA 2J0VA 1NASA 2ZBDA 1QRDA 2H54A 5D3MA 3LQ2A 1NVMB 3PLRA 4F72A 2IU6A 1X7DA 3IX7A 4JHLA 3ZY3A 1Z25A 2HXGA 4BMVA 4CKYA 2PFGA 1WOYA 4HAIA 1J23A 1TM2A 2NUPB 5KQGA 3PA6A 2EV9A 2QD5A 2OLKA 3R2JA 1P44A 3A6FA 4FSHA 1SHJA 5T4EA 2YASA 5IN4A 2XGSA 1X3SA 1CJTC 1BWPA 1J0AA 4DLAA 2HYDA 3GDHA 4BV2A 1M6EX 2H57A 2F3RA 3WFIA 2Y2VA 6YASA 2Q6VA 3OFNA 5ARDA 1HORA 4JNCA 1T6BY 1Y1QA 4ZQIA 4KH0A 4F71A 3S2IA 3Q7SA 2GKSA 4YUWA 4ZVUA 4G1MB 1HDEA 2C4HA 3LLUA 2V8OA 1ESEA 3HGQA 3WGZA 3GYBA 1B8NA 2PFSA 3OZGA 4J7AA 4JBLA 3GMIA 4YO7A 5E95A 1N0UA 4PZDA 5J23A 3AG5A 2IV3A 3SC3A 2DTEA 4GBGA 3GUZA 4UTXA 3UK2A 3FYTA 1A5AB 2GM9A 3CKKA 2JK0A 3DV9A 3CVYA 3HVRA 1Q1NA 4UDOA 5FA5A 3CVVA 1FDVA 3DBRA 1L4YA 2XB9A 5I4BA 3O95A 4AUEA 1EFUA 3NIFB 1RYNA 4TTIA 1MC1A 4ZYVA 2WLSA 3B7WA 2VHWA 3N0WA 3PFIA 1OFUA 4C30A 4A73A 4BQPA 5CLJA 4Q6BA 4W5RA 3WGVA 2I2BA 2XKJE 3FCXA 1H2ZA 3FRHA 4QDJA 2A9RA 5DM2A 4WKNA 1C8KA 3FVTA 2AQ8A 4QLAA 2D54A 3OLXA 4IO1A 3RVRA 1KSGA 3TPFA 5K0ZA 5K3DA 2OTCA 5B53A 2IYAA 4V0RA 2EDAA 5H4HA 1T25A 3NRCA 2HA6A 2ZUBA 3AU8A 1UEIA 2DGDA 2J48A 3MILA 4NK4A 4XYBA 2GN0A 1JFVA 1GPUA 1RBMA 4Z3OA 3JZIA 5G4KB 2GD2A 1Z4JA 4BMSA 2HWXA 2ZRMA 1RKUA 3K94A 1CFJA 3OFKA 1FB5A 1RLMA 5LPNA 1PN3A 3HLTA 3UUGA 1GXSB 1PNTA 4YQFA 4MKFA 1NBOA 3KHUA 5P21A 1NZFA 1VSVA 2CHFA 4W1RA 5D01A 2O5CA 3OY2A 1ZIDA 3VX3A 2QAGB 3GDOA 3LPAA 5CVTA 3G0GA 5EGSA 4Q4AB 1AIPA 1LF5A 4ZVTA 1YS9A 2C31A 2BKVA 1NUHA 2ODBA 3L0SA 3RABA 3GJXC 2FP3A 2QAGC 4JLJA 1ADBA 3OVMA 4IZHA 4URHA 3RYHB 4I3GA 5FFNA 5J47A 2ZYIA 1U9JA 4FQ7A 4O29A 3GI1A 2I4IA 2M6RA 2OBLA 3BHMA 2IHVA 2PSDA 4KAXA 4LI3X 3SZOA 4D0LB 5ISMA 5IZ4A 3RNOA 2HWKA 1ISSA 4DV1B 3SK0A 2WUWE 4G2NA 5J5CA 1WEHA 2H29A 2RK3A 5LBTA 1SPBS 2VFAA 3LDHA 2ZT5A 2PH5A 4K86A 2AN5A 1KZHA 3SFVA 4V02A 1NDQA 4OL9A 3V4OA 3R7SA 3C87A 4YDHB 1M6YA 4UVHA 4DPMA 1L3BA 3FN4A 1EFPB 3I73A 3KQSA 1A2KC 1E3QA 2ODWA 2VNAA 1PHPA 3FYDA 1E2QA 4IO0A 3LA6A 3BF8A 1DBWA 4WCFB 3SX2A 4H35A 3QVXA 4L3WA 1ADJA 3F1LA 2DQKA 4EHHA 1QIFA 3OZFA 1C1XB 1G21B 1RW4A 1D5CA 2HY7A 3F3MA 3CTMA 1P81A 5ICSA 1DKOA 4FIZA 4IHKA 4QGGA 1W73A 4H77A 1SVNA 1YIAA 3FHJA 3T5GA 5ELXA 1RPZA 4C0BA 2A4KA 4MQUA 3ZCTA 3PHIA 2J6IA 2FSVC 4JA2A 2VJMA 2IFTA 1JLLA 3KHSA 3I72A 2BGKA 4LBYA 3YASA 1G1MA 2ZBPA 2DE0X 1F6DA 1RWBA 3BB4A 3CF0A 1WV0A 1CNFA 3E0QA 3UAOA 5KYXB 4R3WA 3VNQA 4F2WA 3I45A 4M6WA 1NBMD 3ZQUA 2OQVA 2ZPTX 1D5WA 3W06A 2QZSA 2O8DB 3E53A 3ELDA 2C3YA 4KFUA 4KQXA 1E9CA 3FW1A 4Q24A 4MVCA 4XCXA 5CVEA 4JZKA 3CMMA 4Y2QA 5FBLB 4O1HA 3R6DA 2PRZA 2VAVA 1RYYA 2JDIA 1YFKA 1YT5A 2DUWA 4HDKB 1E4EB 3Q12A 4RTMA 1B8VA 4HR7A 3KQKA 4TTSA 3N5KA 3SHWA 3OUZA 4XOIA 2Y0CA 4ND8A 4FNOA 4LOJA 1H0RA 1RI5A 1MJFA 2X5OA 3UJBA 1KMCA 2QTMA 3LUKA 4QEKA 4KNVA 2PXCA 2A1TS 1QFXA 4KUEA 3C1AA 3E48A 2O7VA 3KOOA 5JVDB 2VF2A 2P6NA 1ISGA 3L7AA 3HTXA 3K1AA 2FQXA 3UK1A 3NDIA 3I05A 4BNZA 2YINC 4B46A 4B3TB 2AD5A 1SOUA 3PQ6A 2CLFB 1BVRA 4QYIA 2H2IA 1X9IA 3PNSA 5G0WA 2F9MA 3V00A 4Z2AA 3V4RA 1J1ZA 2FK8A 4YXFA 2HN9A 3I32A 1VJ0A 5IDWA 2FSHA 4GZ3A 1SBIA 2C7QA 3I5UA 4ATNA 1B16A 2WUDA 3AR2A 4YT4A 1AB5A 1HWYA 2IPAB 4N3GA 1RWKA 3NGMA 2PCJA 1I7QB 1ZICA 4M88A 3K5PA 1CS0A 1VE6A 1ZBQA 3N58A 5ALWA 4DQVA 1I3OA 2GEVA 5EKSA 1GKIA 4UUAA 1MAHA 1K6EA 2WMNB 3AY6A 3NBKA 2VKTA 1QXSA 3OPYA 3FJOA 1L1QA 4G56A 4KFRA 5AVXA 2PZBA 1CP3A 2LXNA 4PY2A 4WAUA 3ZJYA 2GUGA 4BNIA 2XGGA 2GYWA 4TZ0A 3FTDA 3PITA 1Q3HA 4KXFB 4O4IF 4U63A 4AZ0B 2N1MA 2BEUA 4HYQA 1ZAKA 1OZ0A 2P91A 4V2IA 5BN4B 3K4QA 7REQA 3HKCA 3CLSC 3JZMA 3HP4A 5IJ9B 2JGRA 3R40A 3GARA 1CUZA 4NX2A 3W8EA 3JQQA 2IY7A 2R68A 3A3OA 3BC1A 4MKRA 5CW2A 1R9JA 4A8PA 5JIBA 2DKNA 1OYOA 2IEAA 3CRNA 3FMVA 2JIZA 3VDQA 4DZRA 2EP7A 2DQYA 2NYVA 4FU0A 5CX1B 5CB0A 1H4QA 4AI6A 1M2NA 4HS4A 1CF9A 3HXQA 1PR2A 2OFWA 4I8IA 3TQCA 1MX1A 3GCDA 2CMGA 1UM9A 5CNIA 5DM1A 1FL9A 1IIBA 2OB2A 3AUFA 5ALSA 2PH3A 4Z1OA 1JTVA 3LPLA 4MEBA 1FS6A 5FNZA 1Y48E 2QSYA 3T1HB 3LY7A 2VT6A 4CU2A 3VXKA 2CDNA 3EEBA 1XLWA 1JR2A 3D6VA 1MLDA 3NFRA 4TZKA 4X1KA 1LKZA 4NH4A 4D0SA 1NMZA 3UAZA 5CDYA 4D1YA 5KVAA 2J4CA 3V4ZA 4UU0A 4BNWA 4UFOA 2Q2OA 5LD2C 2Q0HA 4X90A 1DBIA 3Q15C 2CHUA 4J0HA 2BMWA 4B1FA 4B09A 3IMEA 1GAXA 5CHYA 5HRCA 2ZJ1A 4L16A 4QXRA 2SNIE 3CLTC 3GPDG 3H6GA 5KVQA 3EGXA 1Y6QA 3TLEA 4QYSA 4DF3A 3FZEA 1ORIA 3DUFA 3HEBA 1D03A 1P39A 1X1SA 2F17A 3HS3A 4HTFA 2F3SA 4Z99A 3RPEA 3S1LA 3DB2A 4Z1MA 1EP2B 4F46A 5M34A 3DFMA 1MH1A 4KI7A 2OO3A 1KIMA 3UT5B 3ZGNA 5BR7A 1H8EA 4Q37A 3Q3CA 2WQ6A 3DP7A 3ZU4A 1HQCA 4C14A 3WFJA 1VLZA 2O3SA 1U7XA 5JD4A 3NLLA 1UC5B 4L51A 4AZ3B 1VLMA 3EUWA 4K5QA 3ZGOA 1EFVA 4R2XA 1D2AA 4AIRA 2ORWA 3IOCA 4NOKA 4A9AA 2W6IA 5LXTB 3I2HA 3RM3A 4XVCA 3K6SA 1MZPA 1VJRA 4XFDA 3B53X 1DXYA 1D9XA 2W0SA 3L8GA 1B26A 3OF3A 1KO1A 1H3FA 4JITA 4R05A 4NS4A 4ZAFA 3P9YA 4C06A 4D43A 3A4IA 1SG6A 4O2AF 1HQKA 1I5RA 5AVRA 1G8HA 2F4NA 2P3QA 5AICA 1BFDA 1FS5A 1XQYA 5FTJA 1NUUA 3S2UA 1CHDA 3OEEA 3ZLTA 1CW2B 5HRUA 1U0HC 3GT7A 4LMAA 3VQTA 3FI0A 2J32A 1D6MA 3JQ9A 3P2KA 4H18A 3FLMA 3IEXA 3M6VA 5F9FA 4TKVB 4U3JB 3QVMA 4QOEA 4R1MA 4JBGA 4ZTZB 3PUYA 2BE7A 1KVSA 1A27A 3KKPA 2Y1XA 3DWGA 3JVIA 4N40A 5ADUS 3QWHA 4LZWA 4NBNA 1WUKS 4LZLA 1ESNA 3KKMA 1FX1A 2OGTA 5JAHA 5GIOE 3MT7A 3BULA 1P1KA 5JNSA 1G6OA 5KJCA 3QEJA 4M37A 1E2LA 1RE1A 2GT1A 5E9AA 4XPIB 1EE9A 1PUJA 1ZD1A 4OKSA 5A06A 1PJSA 3GRZA 1FNCA 5FLYA 5KYKA 2OHOA 3QPCA 5EUQB 1ZKDA 4X8HA 3OM0A 1M8FA 2G1JA 4IWXA 1WMEA 4NNPA 3O7WA 1ULAA 4PZLA 1AOXA 1Y5MA 3DBLB 4JP5A 3VHXA 1K66A 4OHBA 1GTVA 3UIEA 2C2KA 1GUZA 1SRRA 3TX6A 4G1UC 4MW2A 3GU3A 4AWBA 4EVSA 4IV8A 2OD9A 1A7UA 4MUKA 3W3AH 2V7TA 3EIQA 1H1LA 1NPYA 2ZSHA 3JATA 1NVAA 3CXRA 2QU7A 2ZCUA 1TO2E 4UZEA 4CQMA 2VCYA 5HMLA 2JLUA 3LCVB 3H5LA 1WBBA 5AD1A 3NVMB 4MKIA 1TDJA 4Q12A 4O4JF 5E4JA 4GSKA 3JWIA 2P1RA 2UU9B 2COUA 4CKBB 2Q29A 1XHFA 2WPNA 3MBOA 1PP4A 2H6EA 3DLCA 4PC2A 2I3GA 3QNUA 3GLRA 3IMGA 4NBWA 4ASUD 1MDFA 2P5YA 1WZEA 4OHXA 3D9QX 3DE7X 1LQ2A 4MLCA 2VXBA 4ZAVA 1KYQA 2D2FA 1TVMA 1YZVA 2F1KA 1ZW1A 2R751 4UHDA 3ZBPA 5A5VA 5LU8A 2ZRHA 2EZ4A 3QH4A 4PZ0A 4ZEOA 4F2DA 2RBKA 1ODTC 4UEWA 3TMKA 3VSCA 3FRJA 1QKKA 4YP5A 3MZ0A 4UBNA 1GV0A 1IPFA 1P3Y1 5KDOA 2RC5A 3BXHA 1FFCA 1TA0A 2ZB7A 3PWTA 4I5DA 1OA0A 1TC1A 1J7KA 4KXVA 1X14A 2IXAA 2WT9A 2R6DA 1JDPA 3MXOA 5AVOA 4X44A 4BLQA 2VOEA 3OCYA 2IEIA 1JLSA 2OLJA 3H0KA 3KR1A 2HV8A 2OVFA 2XJ9A 4M99A 3B9PA 1I7DA 1DC3A 4JK3A 3NDPA 2IYXA 4WDRA 3WZLA 1XTVA 2R8PA 3Q3JB 2GBFA 1MUUA 2YYSA 4RV5A 4EB8A 1FU8A 4ZT5A 1GA1A 5IMBA 3VNVA 3DYBA 4RH3A 3DOCA 4DLYA 5JC1A 1UM9B 3EVAA 5KOJB 1GUFA 2X0IA 2CBZA 5JTTA 3EF3A 1J1IA 4IDNA 1BMTA 4LHEA 2RGEA 2OFPA 4LC9A 3WK9A 4HUTA 1KI3A 2FQ1A 2JVIA 4R9SA 3PXGA 4ON9A 2ZULA 1RSZA 2Y4OA 4LJLA 1DRWA 1JIQA 3MJ4A 1QQBA 4KODA 1UJMA 2H08A 2XNDA 2C9YA 4D57A 3H4TA 1GAEO 2TMDA 1L4KA 4PRZA 4XD7A 2FX2A 3DAFA 3GDFA 4B79A 4G67A 3ETDA 1FZTA 1NUPA 2CFIA 1ZI9A 4L0CA 4WLOA 1U1CA 5D85A 1ZI8A 2GTHA 3U4IA 4AVYA 5GJWC 4CTOA 3O73A 4XDYA 2GK6A 5U4XA 1XTBA 5FUBA 3COWA 2PWYA 2WHQA 4NWIA 4I9HA 1PFQA 3VX4A 1P72A 2QTBA 3C3EA 4NOMA 2FRDC 1J06A 2X41A 2ZFUA 5HR5A 2EJTA 3BE5A 4S0XA 3LG2A 2WF9A 1LRJA 4YEDA 4WADA 3C6BA 2C5GA 1R0WA 4KAAA 4IEEA 3W9YA 5JVDF 4W99A 2E7ZA 4DMFA 3R44A 2V6FA 3IELA 4MVJD 4DC1A 4YB8A 3K72B 2CLDX 1VRCA 5ALUA 4MGHA 4CUJA 4EMBA 2QZ4A 5EJFA 2WDPA 1P45A 1PR1A 1WCXA 3RFTA 3RU7A 3KSRA 4W6ZA 5IKMA 1QH1B 4XLTA 4DXAA 2F8TA 4JBWA 4L15A 5CGZA 2EQBA 3EXFB 3E5MA 2CV2A 3EEIA 2HJGA 4BMCA 5JG7A 3F90A 3IEKA 3L0PA 1Z22A 1Y0BA 2REBA 4FXPA 4A0RA 1ICEA 4F45A 2QT0A 2LIPA 4IKPA 4A2PA 4GDMA 2FW0A 5JMOA 5HJEA 2HSGA 4NBKA 4WN9A 1UXJA 2FZWA 1X13A 4R84A 4TTRA 3OIYA 1AZSC 4P8RA 3HZHA 1ISIA 4D8UA 1J0BA 4JT4A 2H3HA 4ARZA 1JE0A 1NKVA 3KPUA 4F56A 1MOPA 5L3ZA 1JQ3A 2ZR7A 3N2LA 2GNOA 1NTRA 3PDIB 1IXYA 4M22A 1OAOC 2VO1A 1TB4A 1X0XA 3A32A 1A82A 4H4EA 4QFDA 4YMUA 1J6UA 2I3AA 1TAGA 3F6BX 4MRPA 4P0TA 4FIDA 3R09A 4UTZA 1C50A 3HRHA 3L7LA 4ZA2A 5BYKA 1IN6A 1DFIA 3MJDA 9MHTA 4LRUA 2QROA 1QK5A 5EE3A 1UUFA 3PU6A 1CCWA 1GNTA 1KYWA 1LC0A 3L43A 2EJBA 3PCXA 2Y0DA 1DT3A 1XZPA 3ROXA 1WQ4A 2WF8A 2JIBA 2QL5A 1TJ3A 1BSVA 4KLAA 1UBNA 2IE8A 1DRJA 3LQYA 1N2CA 3KB1A 4FOPA 3UMFA 4GZ5A 2WUEA 3ZV6A 3MPOA 2DTXA 4J91A 1B4DA 1FSSA 3ABZA 1KDRA 1B42A 2D74A 5FPKA 5IH7A 3EPLA 1RI1A 4O4JA 1E61A 2WPDD 1J24A 2FPGB 4BB9A 1K2WA 4MKZA 1RD4A 3SJ7A 1C1DA 1RACA 4E22A 1DQYA 4JVOA 2JFQA 3U81A 1R6TA 2QRJA 3DDHA 5DO9A 1EGMB 1CC1S 3HR7A 4UM9B 1I2ZA 3CH5A 3PPIA 2GEUA 4K6FA 5JZVA 1PVVA 3QUBA 3AJDA 4YPOA 1WDMA 3FHLA 2H0QA 2QUBA 4M8SA 1TYDE 3ONNA 4QODA 2PZJA 1A7KA 1MFZA 2QVGA 4MVJM 1CRLA 1E3WB 4WXRA 3AEXA 1C4XA 3LY5A 4C4SA 1XCGB 4Y9RA 1TW2A 1ZSNA 1N2HA 3JWJA 3O8BA 1GVNB 4HMOA 1SXJB 4IGEA 3NU1A 4LXTA 1CRQA 5DYTA 5LXTF 4CVNA 1QHSA 4DV7B 4MDFA 2NSJA 1LA2A 1L1RA 3LGXA 2RGBA 3CZAA 1T5TA 3FWKA 3WLFA 1QUFA 4DWVA 5HOQA 3OZVA 2WM3A 1WW8A 4E12A 4P7JA 3O6VA 3E82A 3JVUA 3GLSA 3JY6A 2ILVA 3P20A 3GEBA 3KSZO 1XKQA 4IRMA 3WNDA 1YJQA 5D3MB 1M6VB 4BY9E 2YJ6A 3AO0B 2PUJA 1PJLA 2B5WA 3HHEA 4CDRA 3VR5A 3KJGA 1PG0A 1LH0A 3WICA 4B3JA 3SSMA 4FDAA 3H86A 1U3VA 4NJEB 2NP6A 3DDOA 4FHCA 4ND5A 3GFPA 4I1RA 4BCDA 1ZMBA 1ZCAA 5CDGA 4RVDA 3SC2A 4EGSA 2XI4A 3C8DA 4KWHA 2BFFA 2QXTA 3N6RA 4DYVA 4X3OA 3JQ7B 1CRWG 4DZZA 2J09A 2Q4RA 3ILYA 4CXMA 5KJFA 1G6Q1 1H3EA 1KZ1A 1CQPA 1QFMA 3R9IA 4G86A 3IS3A 3AOEC 2CHEA 2FFHA 1MRNA 2IOYA 3KQYA 2BRUA 4G09A 4OMDA 5BRNA 1O9GA 4QT4A 2CUKA 2YWCA 1Z47A 3C8MA 4MMZB 2JJMA 1NF2A 4QPJC 3TD2A 3F3KA 3N6XA 1L5YA 1FRFS 1U4SA 3Q41A 3MIIA 2ZTVA 1ZD3A 1JHUA 2FN7A 2LW7A 3N0VA 2PUTA 3AFOA 1YVPA 2Q9UA 2BFAA 1XZLA 1XC7A 1OV4A 3P0JA 4IPTA 4URWR 1P4GA 5D5PA 2O2ZA 1M7HA 3H1TA 3UPUA 2I3ZA 2C7BA 3UB4A 2ZSDA 4KQEA 5IBRA 1TLLA 4NOJA 4DWWA 1GYPA 5C18A 2OXRA 4JP1A 4HMQA 1QIGA 1SHKA 3QMWA 2QMOA 1DIRA 1MQ8B 4M0FA 4OKIA 2X7XA 1GQSA 3M2TA 3MEQA 5EQTA 2WKPA 4NMLA 4QOGA 3A10A 3D8TA 4QJBA 4FFOA 2P75A 4ZVLA 4NH0A 4NZOA 4CT5A 4EFDA 5BURA 4JI0B 4E6EA 2C4MA 2IDKA 3NDRA 2ATIA 4UTVA 1JMYA 3N39C 2W2TA 3DQZA 2FMIA 3PXAA 3JD3A 3RHZA 5DRYA 3N7UA 4ZANA 3RF7A 4MWGA 4WNIA 4ZODA 3V46A 4DJTA 1BE8A 2VF8A 2Q5LA 5ALLA 3AWDA 1D09A 3JVDA 1FNSA 4AY6A 3F8TA 4GI3A 4P4SA 2HWWA 4A27A 1CQIA 1RM0A 1QE5A 4KFSA 1ETHA 4ILEA 4ZMBA 5JPCA 2PJRA 2Q6OA 2EAUA 3TECE 3C48A 3AZQA 1P2DA 1UBEA 3EVEA 5E8RA 1Y6GA 1DO0A 2O0JA 1IU9A 2OP1A 3VPGA 4HGOA 4OVKA 5LQNA 2REQA 3EC2A 4YJHA 5J9FA 2WUFA 1T5OA 5HCIA 3DLPX 3U7HB 4H7JA 5K09A 1I9CA 5YASA 3DKKA 3R0IA 5IASA 4ZP1A 2HIGA 1STOA 3ZK8A 3QTBA 2HLDA 5KAMA 4YMLA 2IPOA 1BE1A 4MQ6A 4QICA 1YL7A 1A9PA 3RYCA 3L5KA 3B38A 2CNLA 4PHTA 4R54A 4UOEA 1L4GA 1PL0A 2QK4A 1V5IA 4HZIA 3RUCA 4EO4A 5FTWA 4DBZA 3JAWB 1DIBA 1RYZA 3SX0A 3TD6A 4EVIA 3C97A 1XA0A 2P2GA 3B6JA 4Q4HB 2JCGA 4GWLA 1JHOA 1XCMA 1XTSA 1NURA 2WJ6A 2ZI6A 1QGDA 1KK1A 2BKUA 4QOHA 3KBBA 3HABA 4LOIA 4WE3A 5KAPA 1N36B 3J81A 1OAOA 2XV1A 1W5SA 3DW3X 1E2NA 2JGKA 1X7WA 2JLBA 2DBRA 2HUNA 1Z7EA 1EVKA 1O8BA 1R4AA 1V6CA 2WWHA 3EEYA 4J7CA 4H1WA 1KS2A 2A0KA 4MW5A 2CVOA 4CM9D 2R1VA 3UJDA 4BKUA 1B0PA 2FWNA 1MW9X 4BE4A 1R00A 3IP1A 3Q7RA 2VBCA 4UCWA 1M8PA 3E2PA 1KI9A 2W42A 3HM2A 1E18A 2QLLA 2Q1SA 3GV0A 1M33A 1XD2B 4FGLA 4ZWNA 1W581 3O90A 1NKSA 1GGVA 1DEHA 1E69A 1JIJA 1UBSB 3OQIB 2QG6A 4ENRA 3WYAA 3IVCA 2FMUA 1ZK4A 4K6GA 1JEQB 3H2SA 1S0UA 5AQ1A 1DU4A 4E2FA 4TV8B 3ONVA 1LQUA 3ZDZB 2ZIXA 4LA4A 1XB2A 2FZ4A 2LD4A 2LV8A 4G6ZA 5FI0B 3UAYA 4LFAB 4KDFA 1FRVA 2YH2A 2JJ8A 3TYXA 3F5SA 5C7OO 3HNOA 4EDHA 5BRAA 4LC0A 6GPBA 1TMKA 2A5LA 3NTRA 1KJIA 4P9NA 4RLFA 3T3EA 1ICIA 1R6AA 4IWYA 1D1QA 2ZUFA 2XCSB 2W2XA 5MN4A 1G3MA 1NNUA 2ERCA 2G63A 4LGVA 3STYA 3K0SA 1X86B 4W7SA 1ENZA 2QJWA 1P7YA 2ZITA 3IP8A 2ZWOA 3IXMA 3DFKA 3U5ZB 2VQEB 3LYAA 2L2QA 4MO2A 4KXLA 3VJLA 1ZJ4A 3WO1A 2ZYTX 3PD0A 4EY8A 1CEEA 1TVKB 3X1WA 1L7EA 2GBGA 5C1PA 5IVDA 3GUUA 2G1PA 4OAOA 4Q1AA 1J0EA 2VPIA 3HN7A 4CCAA 4D99A 4Q7QA 2J45A 5C46F 3MTGA 5D6OA 5ECDA 1ZK3A 3LBYA 3MGBA 1C7ZA 2GPAA 4WBXC 3V8BA 4C2UA 2DWUA 4WFKA 4YHHB 1JMKC 3A4YA 4P1ZA 2B4YA 3DLHA 3VSBA 3BJZA 1F7UA 3R7WA 4WERA 5AW2A 4RTJA 2ID8A 1VI5A 4TWAA 3AV0B 4QRHA 3WSVA 3W9BA 3UHJA 3D54D 2KQUA 1HA3A 3HGMA 5A04A 1PWZA 1JEJA 1WRBA 4Z4EA 1ZNXA 4BZQA 3W5CA 1ZOLA 5JZ9A 1NVBA 2QQ5A 3NTOA 4ZO7A 3ENZA 1VL6A 3N8GA 5FR1A 1XVLA 3UN1A 3IPAA 5ESRA 4HGRA 4F12A 5J4YA 5I9MA 1SBTA 2AS0A 1WIWA 2EJUA 1JTFA 2ZZNA 1EX1A 1X15A 3GVXA 3ZWPA 3BQ9A 4A6DA 4OFXA 3BWVA 1V48A 1I8TA 3ZLUA 5I4KA 1JV2B 5H1YA 5LYJF 2Y27A 3I9V1 4I1SA 3O93A 2GZ2A 4Y2TA 2OT3B 5F78A 4FILA 1KP3A 3AEQA 4MGKR 3FTPA 1HKUA 1RKVA 4AX8A 5JW6A 4LYDA 2AZMA 2ZTSA 2PUHA 1JHXA 4JH0A 2O4UX 5FI1B 5TS3A 1UDBA 2NU6B 3ITDA 1AKQA 3L4BC 4RTOA 4P92A 3B78A 3ECAA 4NHOA 3DDUA 4ER5A 1GG9A 4XTCS 5IC4A 2FZLA 3OOSA 5U1PA 4KIFA 5A9SB 4K9DA 1M75A 1YRYE 3TRIA 5AJTA 3DO6A 1Z0UA 4ND8B 5JPIA 1LY1A 2G0AA 1COWD 1U9IC 1HBJA 3ZGVA 3Q9SA 3VDMA 1L4NA 3IGFA 1PZMA 4MWOA 4NCIA 3LOUA 2X8LA 5CB4B 5DNUA 1Z6ZA 3I6ZA 2CDBA 3MIZA 4YAEA 2XA1A 2XHEA 1S89A 4M49A 3CR7A 5T8KC 1SG0A 4NK5A 1YIOA 2QN3A 3P5BA 1M54A 3TNJA 1P6QA 3II6X 3E1KA 1G9XA 2XYRA 2JAQA 1DC5A 2F4VB 1XKLA 4BRUA 2V3VA 1ZCZA 1QG0A 4YRCA 2JLXA 5F33A 4JYZA 1USWA 3UG6A 2IS1A 2CNOA 1ZH0A 2BGRA 2IY9A 2HCTA 1J20A 2IDZA 3I2FA 3WLJA 1D3AA 3IIEA 1EFRD 5IPFA 2UKDA 1HEUA 1Y37A 4RF2A 4U2EA 5ESXA 3BXEA 2WJAA 1HRDA 2B8NA 2XITA 3Q6MA 1L1FA 1NG9A 3RTAA 3STHA 5IWCA 1KRHA 2QBYA 3TJZA 2PQMA 1KAQA 2A1TR 2QMHA 3SQDA 2FJ0A 5DGTA 5LDGA 1ZK2A 2QKYA 1JAXA 1DAPA 3OBIA 2J7KA 3ESXA 1U28C 2YHAA 4FGZA 5AK4A 5AK6A 1T4BA 4A2QA 4UTPA 3KQUA 3UANA 3UWOA 3UW3A 2GYUA 3OMWA 1YO6A 3KQWA 2IXFA 4C4RA 1Y1TA 2TMKA 4YROA 3RT7A 3SC6A 4E07A 3OMXA 1QF9A 3RFVA 1TA9A 3ZIUA 3R0VA 2O6HA 2RIPA 4MVJP 4E6PA 4B48A 3DE5X 1BE0A 3OZRA 5TVGA 2P4QA 4E2WA 5CVUA 4CEJA 2WP0A 3L4KA 4M1SA 3JQ8A 2PVCA 1AKYA 1BMFD 4OQPA 4TSFA 4YP6A 2ZRFA 2UZIR 5DHFA 1M2VB 1W1WA 3E22A 1K92A 3NBXX 3PFFA 1I32A 3IKTA 5IEBA 2HDHA 3HCPA 1N6PA 2R6JA 4G81A 4AM8A 1A8IA 2B83A 3TVYA 1Y1SA 3A31A 4OYHA 4CMBA 1IL0A 5JNVA 4GKKB 2YIVX 5A3RA 4QDOA 4MV1A 5L53A 4DLZA 5G53C 4JLOA 1J22A 3UXHA 3HL0A 1OBVA 2ZRLA 4GPTA 3ZXUB 4DDUA 1H3NA 3D1LA 5TX7A 3CO0S 3QE9Y 1YR2A 4D98A 5BSTA 2BEVA 1LW6E 2PO5A 1NJ1A 3CVJA 3MINB 3QENA 1SD1A 4NYMR 4G97A 2IEBA 3LHDA 4ZO9A 4KN5A 2OSVA 5J4VA 2DWCA 3M89A 1XLVA 2D1YA 2ODQA 3K8QA 5EZYB 5IVIA 4JKIA 4AY2A 2AR0A 3KPYA 2OP0A 3SFTA 3VSDA 1XP5A 3TL6A 2Q3LA 1P4AA 4EA6A 3BWCA 4OQ4A 1GTSA 3E7FA 3KYCA 1Q0SA 4R8RA 4BNMA 7GPBA 3WL7A 2XADA 5E6UB 1WB9A 5JCZA 2P2DA 2PMKA 1NJFA 1R4ZA 3FB1A 3KKZA 4CM4A 1TZ2A 3B2NA 1RI3A 1G64A 4HFRA 4URVR 2I0FA 3O2NA 3AG6A 2ZWIA 4JLPA 3Q2KA 4TRMA 3C3KA 4X8MA 4XSVA 3TLGB 4MR9A 1GPYA 1U2EA 2FFRA 3O83A 1HG0A 4UVDA 4RQTA 4OJTA 2ZRCA 3SHQA 1YFLA 2AG0A 5EJIA 1L5NA 8ABPA 3BRWD 2ZCJA 4XOUA 1KTIA 3I5MA 3SHTA 4HD8A 3TZLA 2RI1A 3B3FA 4RDHA 1P0QA 4JU8A 3JATB 1NXPA 4HDQB 4K9LA 4CM1A 3ADBA 1M1YE 3OMLA 1XCJA 1EAYA 3NT4A 4RM3A 1QG6A 2XQJA 4TVOA 1JHYA 2H2FA 3PC2A 1YZLA 4OHCA 5A71A 3RS3A 1M34E 2Y1DA 3C3AA 3HVKA 3SIXA 3VR6D 1QP4A 1RQRA 3NHFA 3JD4A 4IUBS 1AGPA 4YYEA 1D8TA 3H75A 1BHSA 5AHKA 1C41A 1M9NA 1EUYA 2PX8A 4YC7A 3DHNA 5I8ZA 5HKAA 3BB3A 2WG0A 4BV3A 3OAAA 1I2AA 3DLBA 3NHUA 4GXNA 4IIEA 3DZJA 3BMOA 2C78A 3EVZA 4K88A 2NXEA 2YVAA 3AI1A 2GBCA 4WPGA 1MT0A 3HJNA 4QBFA 4RDCA 3ZX5A 2X0NA 3G8DA 3JWEA 4KH1A 3VDXA 1KYVA 4J0KA 2HK9A 5C51B 3JW8A 5I9IA 3U1BA 4ZGWA 4GC5A 5EP2A 2WVHA 4C0LA 2XWSA 3JYQA 3EMKA 4KLNA 2XZPA 5FPPA 1ST3A 3WB9A 3P9QA 1A9ZA 1FOEB 1RU3A 2HNBA 2QWXA 4P4SB 5GGYA 1BDIA 5K6RA 3RLFA 3PQ3A 3AEQB 2Y1CA 3G2IA 4HYTA 4N0EA 4TKMA 1UKEA 2YOHA 3EEFA 4CKWA 3IT0A 1GO2A 1PDOA 1LWNA 3Q7PA 3VHXB 4CV0A 1V39A 1Q20A 4PQGA 2W2QA 1II9A 2FRVA 3RC1A 2BR3A 4RIHA 3FR8A 3WRYC 4A8JB 4AG5A 1LBIA 3RYIA 2LP4Y 1R66A 2Y68A 5DJ5A 6AT1A 4LNHA 3KK0A 1ONBA 4OP1A 1NZDA 4H59A 1V6AA 3ZN2A 4UW9A 4Z7NB 2O8BB 2DBZA 3RTEA 5E3IA 2W4IA 2WVGA 5F7XA 1UCFA 1PCXA 4FOLA 2WE7A 1IBRA 3G2KA 3ZXXA 1K8QA 2FW8A 1Z4MA 1Y5NA 1YL6A 1YC2A 2IYUA 3B12A 3R20A 4UMVA 4CMEC 4MW0A 4RESA 1YZQA 4HDSB 1JH8A 4NCNA 4RX1A 2EHDA 2G4VA 2X0JA 3IRVA 2PZGA 3LL4A 1PQPA 1EEXB 1U8FO 4AULA 3RADC 1JBEA 4Q48A 3GFTA 3ZGLA 1TF2A 2Q0SA 1RKQA 1TJYA 1LLDA 3B1XA 4O63O 1JNXX 3WL5A 3OJCA 1FXWA 1SUPA 1OPRA 2QUHA 1UBGA 5LDHA 4RK5A 2ZSFA 4IIBA 1FMCA 2BVNA 3TBHA 2H4WA 3T4UA 1SXHA 1BVUA 1UBRS 4D82A 1HK7A 4BO4A 4E3WA 4G5SA 1GPJA 2YV5A 4N8DA 5IDYA 4G0WA 4C2BA 1TD1A 1VPEA 3CUWA 4K9NA 1JHQA 2C54A 2QTVA 3CB2A 4LMBA 4JUBA 5K0SA 3VNUA 1Z0KA 5HQTA 4UBJA 2BUBA 2NV2B 4MIYA 4F8EA 2E4VA 2IUFA 1B2LA 3LPNA 3O47A 1ONPA 5JXWA 1SXJD 3PYMA 4L6CA 1PDWA 4OG2A 5ADWA 5IEJA 1GT6A 1T3ZA 1T5IA 4J9UE 4UBMA 2PS1A 5KBYA 4W5NA 3E4CA 3HPQA 4RTQA 5IDXA 4GRIA 2ZM5A 2YBEA 1BDMA 3JALA 4INAA 5HJ2A 5HM8A 3FCCA 5IKXA 3KOUA 2RAUA 1VKRA 3P9XA 3Q0TA 2IEDA 3DJYA 5JXHA 1YQXA 1CTQA 2P6RA 3H8VA 1JXMA 2QPOA 3ZV5A 4M1TA 5GJVC 4J49A 2JHFA 4WXYB 4MEJA 4IMPA 3H5NA 4X3CA 1XFDA 5LCXA 2G82A 1DAMA 3KQVA 2VJDA 2VA9A 4IRUB 4BRSA 3HJRA 4B3GA 4J03A 5MGBA 2Z2YA 5EKTA 1I3MA 2O07A 3E2IA 3KAJA 5BVGA 3UHOA 5DI9A 4UOQA 1USGA 2VWPA 1Y7PA 3DCNA 3U9SA 1Z75A 4IH9A 5JJ5A 1JQ5A 2C4VA 4OJNA 5FQNA 5IF3A 5BSUA 4F6RA 1MO5A 2PKWA 2RHHA 2VHUA 5GADl 2HK6A 5F76A 4E14A 3O3OB 4YJKA 3DPIA 3L8FA 3QFCA 1TYAE 4R41A 2WYUA 1RE0A 2EKQA 4MUHA 4KSBA 4CM7A 1ZN7A 2NYUA 1U99A 2W8BB 4BZWA 1Q1AA 3T7RA 3V6MA 3ZE2B 1D2MA 1IUNA 4DGSA 6REQB 4RA9A 3M6XA 2B2NA 4L9SA 3T06B 1B14A 1E79A 1YOBA 4FHFA 2J0SA 1XR3A 1G7CA 3HLYA 4KQ9A 3GCGA 1XZJA 3KJEA 3PHCA 4EB0A 4DA7A 3SNKA 3RWBA 4IUYA 4B4WA 2HMWA 3F9IA 4TT3D 4AQDA 5G1OA 4P53A 3V4SA 1LZKA 4DLRA 3X3HA 1UOQA 1D2RA 1GZVA 1IOWA 1Q50A 2CLIB 2ZAOA 1E2PA 4JIMA 5C4IA 4HDOB 3HKBB 3WYDA 4DNPA 1TM4E 2AIRA 2DPHA 4PSUA 3QNMA 1MVLA 4BN4A 1A2OA 2C9BA 1KHHA 4GR9A 3V1LA 5FWYB 3E4DA 4DV5B 1NKTA 1DLIA 1Q0ZA 2V0CA 3HWX1 1KH3A 1T9ZA 3KR0A 1Q0HA 1ATIA 2Q62A 3AOGA 1Q6ZA 3R7WB 4CTKA 5EPEA 2QYOA 4QRDA 1EIWA 4CL0A 4JJEA 2HKIA 1SUSA 2JB9A 4PTLA 3ESZA 5CNKA 4Y2XA 2CBGA 4G37A 2XSZA 1FW6A 1G8MA 1QQ5A 3JQAD 5JLJA 2YV2A 4M0UA 3PQFA 4GVXA 3OOWA 5DRTA 1UJCA 1AK1A 3KQLA 2B20A 4NRDA 4WLEA 3KZOA 4ZZ0A 1QYCA 1YCDA 2P9TA 9ATCA 1V7CA 2WUVA 4NXMB 2WHPA 1KO5A 1JG2A 3P0EA 4RU1A 4F9TA 3BD7A 4PPQA 4WKPA 1RXCA 5CAEB 4RLSA 3BH0A 4QE3A 1E7SA 3H6HA 2JJ1A 5P8WA 1Z8FA 1TPZA 1NE7A 4AZTA 3GMTA 4UUOA 1I4OA 2ZRIA 1DCMA 5KNBA 3WE7A 2OUKA 3CRZA 1PJZA 1FRZA 3U4CA 5TPZA 4EG8A 2FRDA 1F14A 3R3VA 4OK6A 3G8BA 3OTWA 4XD2A 5EKDA 4FKZA 1CQIB 2OB1A 2PZMA 3DEKA 3U37A 2CYCA 2FWJA 1ACJA 1K7SN 1XTKA 3THOA 2DR2A 2PUCA 3AR9A 1OZAA 5HIKA 4L8YA 2ZUWA 2HHAA 2G72A 2D5AA 3GFQA 1KL7A 2AJ8A 3P4YA 4MYTA 3P2MA 4JFAA 4W1PA 4AXXA 4TUYB 4D8YA 1WXHA 1L5KA 1HDIA 5B4UA 2I6GA 1XBTA 2ADOA 4XFJA 4B82A 5TMPA 2JLYA 1OJ7A 1PZFA 4C07A 4WASA 4TTQA 1NQWA 5JAUA 3IVGA 1BC5A 1JDNA 5IUKC 1I7NA 4W8GA 1YSCA 2VDKB 5CITA 4C3OB 4QJ3A 4BNYA 5A5FA 5K6AC 3PJGA 3D59A 3R7LA 1RVV1 1WMDA 1FYFA 4WCFA 1MQSA 1BCSA 2PV7A 3H5RA 3TQHA 1QGOA 3HN2A 3TTTA 3WMGA 4HWTA 5KINB 1K08A 2ARKA 2W70A 1H5QA 4GM4A 4CIAA 3NRJA 1CWUA 3ZU2A 4BNHA 1YRLA 2FPKA 4BB6A 1HXHA 1Q3TA 2FFAA 5H59A 1YDFA 2IT1A 3N7TA 5K4HA 1N57A 1CX9B 1DQNA 2JHPA 1D0SA 4JA0A 1VDMA 2PR7A 4JEHA 4N9QA 3BD8A 2B0JA 2ZWMA 3GD7A 5AHRA 3UJCA 3W3AD 2XE4A 4X8LA 4Z5XA 3OHPA 2HD4A 2QRQA 2VWHA 2C4KA 4MK4A 3CKLA 1VIYA 4O8CA 4HTFB 4TS4A 4O2AA 5CDFA 3FIJA 4BO0A 5IRCD 1XZGA 2FSSA 1ZMTA 3H3FA 3FMOB 3OT1A 3ZLJA 2O1WA 1IN4A 1ZU4A 1H2AS 4ZVSA 3LT4A 4C88A 1Q11A 1Y7TA 3PFHA 3PUJA 3BL6A 5KPJA 4LSWA 1BE6A 1Z08A 3WIBA 5M04A 2HNKA 3RK4A 2WWRA 4NBSA 3FMIA 3VNBA 4X8OA 1NRWA 1NW7A 3PE6A 4ROTA 4XSGA 3KWJA 4JEIA 5E0OA 5JZBA 1IYZA 4ARZB 3ER9A 4L8LA 3OFSA 2ETXA 1KZ9A 3B1VA 5KMGB 1J90A 2GDZA 4EARA 1OI3A 2QGZA 2OD2A 4XH9B 1K7XB 1RPTA 3F71A 4DB4A 1JBQA 2PT6A 3AFNA 4EYGA 1RABA 121PA 1HTWA 5F23A 2LCFA 2CN1A 5AW0A 2PD6A 3IL2A 2J4DA 3MMZA 5SZKB 3V7NA 5BN1A 4IDGA 4J0DA 1O77A 5JEEA 3EDOA 1OXSC 1OBCA 1SVOA 5ECWA 1SU7A 3QVLA 1P3DA 5AKLA 1M76A 5AMXA 4MLPA 3H3XA 2PYZA 1CUFA 1JLHA 2Z3ZA 3ZVLA 5GZ1A 3UWDA 1ES9A 3H87A 1ZJ5A 4RZIA 2PGLA 1B93A 2XGMA 4ENPA 5KHAA 4X6XA 3PS9A 2BPOA 1XEXA 5EEHA 5TF4A 1EWRA 1HT1E 2ZQ5A 3CSDA 4V0LA 4WI1A 4US0R 3OKCA 2NQTA 3QJYA 3RS0A 1MRSA 3NS7A 3UBTA 3HRKA 2J9FB 3HMQA 4UAUA 3BXFA 5EL0A 4NIMA 5LOVF 1P0FA 3CX3A 2JEZA 1EP9A 1GITA 3T1YB 2OK8A 5EHQA 5E7MA 3ZZ1A 1QIEA 1DIHA 5HTKA 2QDKA 3GLFA 1P60A 1T34A 2IPMA 2QMYA 1Z0SA 4WINA 3TOXA 3ZDYB 1R8YA 1K75A 2AG6A 4X3PA 1X42A 4D9NA 1Z5GA 1UF9A 1DTSA 3PJEA 3JQAA 1VSQA 4K3UA 3ZV4A 1Z6XA 1ZH4A 2UZ1B 2PY6A 2J5BA 3OC6A 1BMDA 1CZKA 4WESB 1PO7A 1NMEA 4M87A 1SVKA 2HSJA 2IOHA 4TS9A 1NW9B 3PEEA 1RWWA 4D8WA 1E2JA 4NDAA 1P31A 5FO1A 3KT3A 3NHWA 2EKZA 2AQKA 2X1VA 3MRSA 4U2GA 3CSUA 3QWIA 4BNLA 1WXWA 2D62A 4OYRA 4C7MA 1OHHD 1X1CA 3I6BA 3NYIA 3LWNA 4XWKA 1JDJA 4WKGA 3GJ7A 1W96A 1NLFA 3HZOA 3F49S 4RLHA 4URXR 1GKYA 4MV7A 2H1FA 3P9KA 1R0KA 2EDCA 3RI3A 1K3FA 1I1HA 4OEHA 1AKTA 2WKQA 4EATA 5BQOA 3R6LA 3LDAA 4DDHA 4ZKDA 3IOMA 2H8KA 4YI5A 3KYDA 1GHTA 4X61A 3LAWA 4ROSA 4EKDA 1OAKA 1P73A 3F67A 5DVZA 3UTDA 2R8XA 2J0UB 3FUCA 3UMRA 4I99A 3W6PA 4A8JA 1CUGA 3AOEA 2H5EA 1TCBA 1KIFA 1N7JA 2VXOA 1QCZA 4R9RA 3NONA 4C0HA 2C5SA 1DKPA 1BIFA 2OPBA 2P2SA 1VIVA 1C4OA 4OQYA 3WRYA 1I94B 2YS6A 1J8MF 1G3RA 1VCHA 4MVJI 1QHHA 3G17A 3LNCA 2XCUA 3O4JA 1SZJG 3VUFA 4GL2A 2XMSA 3LLSA 1VLVA 4PC6A 4K9OA 4BKOA 3SWWA 1EK5A 5CFZA 3E3NA 1K6IA 4GLJA 4YXWD 3DZCA 4MYDA 3VU8A 2VYND 2IX9A 2Y9PB 4F5EA 5IT4A 1IULA 1A8UA 1VCIA 3SCZA 2JIMA 5LQKA 2D06A 2JH3A 3B1KA 4HPJB 1X1DA 5HEKA 2ZDHA 3WB0A 1N5KA 4AD8A 1R0YA 4Y0VA 2IZOA 4G26A 1X7WB 4MRMA 4CMAA 3B51X 4FJ1A 3E70C 4CMIB 3OQMA 3I8SA 1RADA 2QTWB 2QHXA 4GR5A 4UZSA 2G1KA 1HSOA 1MNQA 4F5ZA 4I55F 1GIAA 4QARA 1CK4A 1VBNA 1WUHS 3KT0A 4REMA 2QMZA 1UFOA 1I7SB 1EXNA 1QGZA 2B5OA 1WV1A 2J3LA 5LB2A 721PA 3H65A 1QHHB 5EYPA 3DGFC 3VZRA 2VCHA 2JASA 2JGLA 5B2ZA 4ZQHA 3AI3A 5G1NA 1N2SA 2CJPA 2IHTA 3EDMA 4WN9B 4K26A 1E9DA 3WWPA 2VSYA 2ZCVA 4LBVA 4MW6A 3TSOA 2Q45A 3O8CA 2EP5A 2QRVB 1JUDA 2CNDA 3MS7A 5B1SA 4E88A 2CV0A 4A1OA 2XWBF 2QYHA 3GRPA 3KNZA 1YS2X 4F6CA 5AJYA 3C41J 4J7XA 4XIYA 3K20A 3H0EA 5EIBD 2XRZA 1OC2A 3W8DA 2EFGA 3H2JA 3U3MA 4KXYA 2AD1A 1TEVA 3KYCB 2C0QA 2TSYB 2W6ID 2ZAYA 1XQXA 1IXSB 1U3CA 3HR4A 1MGPA 3KZCA 4GPZA 3BD6A 2ZZMA 4DDVA 1WDWB 3OJXA 3N8DA 1EFLA 1UWLA 4R2HA 1P1IA 4P7KA 1BOOA 4FYHA 4PO1A 3B7GA 2PUGA 3RCBA 4QFBA 4RA6B 1Q1BA 2QVZX 4OLAA 4Z49A 4INJA 2G9ZA 1EK2A 5A4MS 5J58A 2XXAB 5ALMA 3SVZA 2PRYA 4HY3A 4BGEA 1TMYA 1N6NA 2EOAA 1W52X 2UYCA 1IBSA 1W94A 1Z0FA 1YQWA 3MGCA 4CG3A 4TYMA 4S1TA 1Z2DA 2YZ7A 4IZOA 2CSXA 4Q15A 5KVVA 3V9AA 4M98A 1U2DC 1T8SA 5AJHA 2B92A 1J0DA 4HWSA 1YDHA 4OHFA 4NCXA 5EY5B 2IYPA 5E6UA 1PFKA 4JSTA 3O2JA 3ABOB 4JLUA 3ABSB 4F0JA 1TJNA 1E7RA 2NV6A 3LX5A 1F5NA 1B15A 5MFPA 2V9CA 3UOAB 1XD9A 2VUIB 2JFYA 4OB7A 4EFKA 2VZEA 4UNQA 5LQJA 4YAOA 2H2AA 4HH3C 3MWJA 4PPGA 4DCJA 2GH1A 4UULA 5GONF 4M7OA 3TRHA 2PBZA 1Y63A 1KQ3A 1L5WA 2PD3A 3H8WA 1B41A 1DXOA 2C98A 4BV8A 2ZYHA 3H9UA 4RH0A 4UXJA 1XU4A 3EK2A 3PRHA 4YPVA 2PPVA 4L8WB 3AP2A 4X20B 2WU3A 4NCBA 1ZM3A 2IIVA 5ESDA 1GQOA 1VJCA 1ZVVA 2BFMA 2FU5C 4DV4B 2FEMA 5EOVA 5EP3A 2QRHA 5L3QB 5IM4A 1U1EA 1U6JA 1FPMA 2V97A 2F1JA 4N49A 3EVGA 3QXSA 5IAGA 4F04A 1ISHA 1Z2AA 4MMYB 4UD2A 3R5FA 5CLGA 1X19A 1ULUA 3DKPA 1HE2A 4MX8A 4OREX 3STXA 2VQ6A 4RTSA 3ZD9A 1C8VB 1PJQA 3AUSA 4C0QC 4B3BA 3EGCA 3IALA 3C7DB 3VPBA 3GFFA 1VGQA 3P0IA 2FTKE 2WWYA 3IERA 2CXTA 4JSYA 4QJIA 1G3IA 2GRJA 3LFHA 4DYHA 1VGVA 1M6HA 2RFLA 2Y1WA 1NVWQ 2ZBVA 1T2UA 3IBYA 3QQPA 4GM0A 4R4JA 3DYIA 1DB3A 4M0LA 5HGJA 2MYPA 3AUAA 2XIQA 3KLNA 1FVOA 3KV1A 3HB0A 2E87A 4K05A 5FDFA 1YF3A 5B3JC 1N1EA 2GZ1A 4HAZA 4OATA 2N47A 1VRWA 3CWQA 4BO7A 4NS1A 4YT2A 2J8ZA 1MO4A 4H16A 3RAEC 3BCRA 2RH4A 1KE2A 3RS2A 1NY6A 4E21A 3WNQA 4IQ4A 1I51A 3K71B 4TTPA 1GQYA 2BFOA 2NVWA 3PC8A 3PQCA 4KV7A 3IIKA 4E46A 1FU4A 3MLBA 3W7BA 2CXUA 1Z0JA 3ZHBA 3X0DA 4OX9Y 2DCMA 1E6MA 3HDYA 5F3WB 1B0UA 2R8YA 2AFIE 2HEGA 2V54A 3COVA 4OD0A 4EKGA 1MHTA 1W85A 5CVCA 4QZVA 1KZ6A 1QGUB 3E3OA 4JVMA 4OH1A 1AK9A 4GX2A 3B1WA 1VI6A 2VQFB 4YCCA 5ADHA 5HXAA 5KNLA 1U65A 3GVHA 1YAHA 5J2TA 2ZRGA 5JYCA 2WTAA 1V25A 3A70A 1IZ9A 2NVUB 3INGA 5CA0F 1US8B 3Q8LA 5CURA 2YJZA 4QTZA 5JASA 2P8SA 2UYGA 4OQDA 4TSFD 5HUQA 1E4YA 2RGWA 5DX0A 3HSYA 3DFFA 5TR9A 3ZI0A 2HHJA 3KUXA 4J3FA 1FDTA 1UKVY 1NVKA 1H8ED 4PX2A 4BKPA 4PFKA 4M9ZA 3T6KA 4EF6A 2PKQO 3KDSE 1T4CA 1NJSA 5C52B 1DQZA 4ALMA 3KALA 4X54A 4O4HF 1MXHA 1OZHA 2FQYA 4W8HA 1A9RA 1Q7TA 3GWGA 4OIMA 4Y9TA 2I03A 2HDWA 2BP7B 3N86A 3D0RA 5B4TA 4WKOA 1E4EA 2V6JA 3FGPA 4R8LA 4HWOA 1N6HA 2V74B 1IHUA 4EKNB 2ADFA 3AKDA 4FZ3A 4A0SA 3ZVNA 3B2QA 3I8XA 3F3SA 3AB7A 1YS1X 2Q5IA 3F3YA 3REQA 3FNEA 3A3NA 4YGXB 1NULA 2HF2A 3H7IA 3ZE9A 4FZ5A 1USUA 4QNRA 3NAMA 3R4CA 3PPVA 4ZDWA 1JMVA 5IUNC 3CUYA 1E3IA 2CVHA 1LPOA 2OXEA 1F8UA 5FTMA 3R6WA 4M1EA 2HO4A 2ZYDA 2D4HA 4Y9UA 5JRDS 3JARA 2IPNA 5EJ9A 4WH0A 5KS2A 4OF4A 5CVVA 4QGAA 3CNEA 3QBVA 1XTZA 4OUDA 4R2IA 3S3TA 1J9GA 3LQKA 3HJTA 2YVLA 3L7CA 2BHLA 4PG5A 4QPCA 1SELA 4GL4A 2P30A 3FYUC 4BC1A 3FPAA 3NHBA 5AJWA 1VI2A 2XDQA 4DV6B 2C77A 1TVEA 2RE8A 2FW1A 4BMZA 1SK8A 3OAAD 4ZCSA 4Z3DA 5JS8A 5L8VA 2GN8A 5F98A 4J2TA 3E9NA 4QUJA 4Q66C 4LE0A 2BR4A 2IRWA 2J9ZB 2QPTA 3JU3A 3NBZC 4MB2A 4EHBA 1AKWA 1C7FA 2VHYA 4B4OA 1EZZA 2CF5A 2H2DA 5K3SA 2LTAA 2PX6A 3TZBA 4JI3B 1CLEA 2B8EA 3NHJA 5E1OA 3EIHA 4PU0A 3HKCB 5JY1A 4MAAA 1T9CA 4M7PA 1I14A 1MA3A 4Y1RB 5DI3A 3KHTA 3KVNA 1U0GA 3EDQA 1N34B 3Q5DA 4B73A 1Y5IA 5I7EA 3CNLA 3Q8MA 4NYJR 4C03A 4CT4B 4KX3A 3H1AA 3IP6A 1XQVA 5TGZA 1P4SA