1JT9A

Structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
266
structure length
247
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine-6-Phosphate deaminase
publication title On the role of the conformational flexibility of the active-site lid on the allosteric kinetics of glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 247
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jt9A00
3BXGA 4GO1A 3BXEA 3EFBA 1FQOA 2GNPA 1UJ4A 2R5FA 3CSSA 4L4ZA 4NMLA 1UJ5A 3ENVA 2RI1A 1DEAA 1LK7A 4L5JA 4R9NA 1HOTA 3NWPA 1XTZA 3E7FA 1HORA 3CH7A 3IXQA 4X84A 3ICOA 4OQQA 1FSFA 1FS5A 4TM7A 2OKGA 2BKVA 1CD5A 1O8BA 2W48A 4OQPA 4L5IA 1VL1A 5HJ5A 1KS2A 1FRZA 1JT9A 2WU1A 3U7JA 3EB9A 3E15A 3BXFA 2F8MA 1FS6A 4IO1A 1LKZA 3UW1A 3LHIA 4L4YA 3BXHA 3L7OA 4L50A 4L51A 4M8LA 2O0MA 1Y89A 4GMKA 1PBTA 3NZEA 3KV1A 1UJ6A 3OC6A 3HHEA 2BKXA 3LWDA 2RI0A 2J0EA 1LK5A 4R7TA 3ENWA 3HN6A 1NE7A 3KWMA 3TX2A 1M0SA 3ENQA 4TM8A
chains in the Genus database with same CATH superfamily
3JQAB 4YASA 2D62A 3VC2A 1QZ3A 3FVWA 4NCIA 3KIPA 3MC1A 4ZQGA 3T3EA 4LRWA 1BDIA 2GHRA 3GF4A 3B3GA 4TTVA 4DCJA 1HSOA 3CF4G 4R81A 5DNYB 1Y1RA 1GKIA 4DA9A 4L0MA 5EJ5A 4AURA 1AO3A 1EMDA 2J5RA 2PUBA 2J08A 1DUVG 2HY7A 3L7KA 1PFQA 5IAGA 2NUTB 1GPAA 2WJ6A 3RVDA 3CB2A 4Q82A 3ZY3A 3W5CA 4NIMA 1Q1GA 1F5SA 1H2XA 2ZB4A 5GJWC 3C98A 3DR5A 5G1OA 3IQDB 5HJ7A 1T3GA 4JUFA 3ZYZA 4IDBA 4H6VA 4O4HB 5TEVA 1DX4A 2ENUA 1JDVA 4EA6A 1ZWKA 3E7XA 3L7LA 4INZA 1CQJA 1UZNA 1XDUA 1ZGCA 4JJ8A 4ZO6A 1RE1A 3OCJA 4JQCA 4ZEWA 3TZQA 5EZ5A 3JQAA 5CK4A 5K3FB 4F93B 5IAKA 2QGFA 3H7IA 1Z0AA 4RPIA 4JA2A 4EG3A 3IE1A 3R20A 5FP0A 3CTMA 1HDYA 1BXGA 2XWSA 4YP0A 3H2BA 1DUIA 3I12A 3E82A 5BYBA 4WBNF 3GPLA 3QVVA 1YO6A 1Y1TA 2CHFA 1BN7A 3CB4A 1UFKA 3C8MA 1XA0A 3F6PA 4YR9A 4KN6A 3A1TA 2G25A 3O95A 5ALVA 1YDMA 3HACA 2XAAA 1TUBB 1JIKA 4G25A 3HR7A 3UAOA 3ZEIA 2OORC 5L9AA 2BFPA 2XR1A 1WMEA 1G63A 1WY5A 4QARA 2WC1A 4YUZA 3ZVMA 4B45A 2X6TA 5DGHA 1KQFA 1Q1QA 1LRKA 1QIIA 3HSYA 4LXXA 2ADFA 4O4HA 1FPMA 2IT1A 3UUWA 1UC8A 1SG6A 4DMLA 4OHRA 4A6XA 1YONA 4MRMB 4G1EB 4FD3A 3EB9A 4FDLA 3RVBA 1A9OA 5K3FA 3WZ2A 1M2NA 3ZGNA 5E3IA 3GUZA 4WI1A 1RE0A 4MW2A 1SH7A 3P9SA 3GRYA 3SQLA 4LRUA 2PN1A 2GARA 2Y0PA 5JT1A 3IPLA 1ENYA 2IOFK 2CJWB 1RPNA 2V7VA 1I3KA 4W7IA 1ZH8A 3RW9A 1W4AA 4JBHA 1PJRA 5ANRB 4ZP1A 3UY4A 1JG7A 2BCEA 2WWTA 2UZAA 1L5SA 3AB8A 3OEHA 1TUBA 5K4GA 4CF7A 5KYTA 3K9QO 3QIVA 4JLBA 1KDRA 2XXAB 3E1GA 5D84A 1Z5ZA 3LTNC 4KDRA 4C5CA 1I5OA 2XXJA 4DV4B 3O03A 1K6XA 4G0MA 1KYVA 1HTWA 4HQFA 3MLBA 3ISTA 3FHOA 3P26A 4QDZA 3UWKA 4OIMA 1COZA 4XH9B 4MRMA 2ZYDA 3JTEA 4AQYB 2UUOA 2QTRA 1J97A 1QLHA 2XIJA 4V24A 4KI0A 3ZWBA 2BDEA 1QIDA 1W5TA 3QKTA 4HD8A 1RI1A 4QELA 2HBQA 1H5UA 3MRTA 1G7RA 2QVLA 1ONNA 4ZI5A 1HEIA 4IIXA 1V3TA 1KTIA 4YP5A 4MVJP 1NE7A 2UYCA 3ICWA 1EXWA 2VP2A 2M6LA 2CJWA 4J43A 2CLDX 4PGFA 2A4MA 4TV8B 1EQUA 3VUEA 4ILEA 2CB9A 1QTQA 5EIHA 1P0MA 1E32A 2PX3A 2ZJOA 3MGCA 3WZMA 4P4GA 4Y6QA 1MW8X 2XXAA 1MOPA 2JA1A 2QM8A 4U6QA 3SIRA 1WMSA 2JIOA 2P4SA 2VK4A 3MLEA 3MGBA 4XB2A 4UE6A 4PQRA 1WXHA 1R0YA 1IZZA 3GGJA 4EHDA 5B1YA 5L8VA 2G06A 2IEGA 3BMCB 8LDHA 4UEWA 1XZQA 2P7IA 1L7OA 1JDNA 2F7SA 2VCEA 1D6JA 1DCMA 2IYFA 5KTSA 4WASA 1H2HA 1WIWA 2B69A 1T4GA 2UKDA 4RY9A 5F5LA 4TV8A 3L9WA 2IXBA 2JCGA 3HVIA 3W9YA 4ND4A 3PYLA 1RADA 3B51X 1RLOA 2VDMB 1RW4A 4Z9XA 2IYZA 3E7FA 4BDSA 3MLAA 4YJ3B 2PIDA 5T4HA 3H1FA 3KSZO 4LHZA 1M34E 2CHQA 5E9QA 3L7YA 2I8LA 1PWEA 2J4DA 3NCTA 3ZPXA 4KQGA 4DVGA 3FBWA 4YPVA 4YREA 1UAGA 1EVLA 2GFIA 4BJHB 2PG3A 1E4OA 3O0DA 3L01A 1IY1A 5AKGA 3CNQS 5F5XA 4ER0A 3IUNA 1NVWQ 2QP4A 3CLTC 3G2PA 2O54A 4KSBA 2CMGA 1NQAO 721PA 3KQHA 1H6DA 1IHDA 3R7NA 1JZQA 1L7DA 3KPYA 1AXRA 4QFMA 4TMYA 4G0QA 4FJ1A 4MB2A 2PE5A 2A58A 3ZQUA 2VYCA 2WM3A 1U4SA 1V7PC 1V39A 1K63A 1N92A 1Q74A 2H1FA 5DK4A 2OYRA 3RSSA 3WGYA 4W1PA 3U0VA 1XPUA 1CHNA 1AH2A 3EAFA 3G8AA 5EJAA 3A1SA 4NFHA 3OLVA 3QX8A 2FMXA 3HU3A 3TLXA 1CPYA 2XEXA 1NLUA 3WNCA 3UAGA 4P86A 4YJ3A 1X1TA 1EXVA 3MAGA 2ZWMA 3EY4A 4QYSA 1E3MA 5AOCA 4GNRA 3T0FA 1GTVA 2XMQA 2YTZA 3C87A 4RPGA 1SIOA 1CZUA 1VI5A 2CLMB 4Q4HA 4L2IB 2BR4A 4YCBA 4IMRA 4MVJE 3EC1A 4ZTUB 1VSUA 4P53A 5T3YA 1DAGA 4MPTA 1Z0UA 2FZ5A 3L04A 4PPNA 5DB4A 2PSDA 2W6MA 4A0FA 4CMEA 4EYEA 5DXAA 1ULSA 1YZTA 1PYDA 2FEXA 5TGZA 4PZCA 1JVNA 2YV2A 4R8KA 3R3HA 3W90A 3KKMA 2VPWA 3RR2A 3WIUA 3M1IA 4KDEA 5JJCA 5C1DA 1KO5A 2FGKA 2XW6A 5F64A 1KRWA 2Y92A 1RZUA 3DZ8A 3OMWA 4LDPA 1F8XA 5I7EA 2PR2A 3IJRA 2ZBPA 2OPHA 1BKSB 2I4TA 4UE3S 1WEKA 2WKQA 4X1YB 5HKKD 5KAPA 2AJ8A 3JR3A 5JXHA 2ZUEA 1CQZA 2WA2A 1NM5C 3OF5A 3QLUC 1UM9B 2YXBA 2DUJA 3FJYA 4KRYA 4RV4A 1J70A 2GPYA 5EKSA 4C6HA 3E48A 4C2TA 1E0KA 4OQLA 1P4AA 4XUDA 3EVZA 1Z28A 4MIYA 2ATEA 3KLOA 5EZ6B 1I7NA 1CZKA 4HO1X 2GZAA 3JRNA 3TINA 3GA5A 4Z7NB 4V3CA 1NZDA 2PSHA 2PJDA 2YWHA 3G02A 1EESA 5DX8A 5DI3A 1KIFA 1SRQA 3K0FB 4DLUA 5CBPB 2GYWA 3KQWA 1WR8A 1QAOA 2VP5A 3EZFA 3OOWA 4RFSB 5BO5A 1S8OA 3NV9A 1KAMA 2NVWA 3CUEF 3R5JA 2OESA 4TMWA 4EVIA 4BASA 3ONEA 2WIBA 4LGMA 4RQBA 3A1UA 5DTMA 4OHYA 4HWTA 4CQLB 4X1YA 5AKYA 5EKDA 5IUJC 3I45A 1R2QA 2FWBA 3WMGA 3RRXA 2OOKA 1SULA 4Z0PA 1UM9A 1SQ5A 1WAMA 3WLIA 3ZCPA 2ZGVA 3SDZA 3T1YB 1TT5B 3KDPA 1EEHA 1G3RA 3P9IA 5TVGA 5TF4A 4N0QA 1DO8A 3A2LA 3IL2A 2ZUUA 2NUPB 4PZPA 5ALXA 5EIEA 1W0KD 1OE0A 1ABFA 4KRFA 5DN9A 1JQ5A 5ALRA 1GZ5A 1KHTA 3TKLA 1AGYA 2ZJ5A 3C43A 3HUFA 1X74A 4DIDA 4FPXA 4CMKA 5CBPA 4GUDA 2YYYA 4NE2A 3N6XA 4WHMA 3L77A 1I4LD 1GEGA 1G59A 1DXYA 2AOTB 2IPNA 3AFNA 3WNQA 3FG9A 1KFKB 3UV3A 3OD5A 3EAGA 4GG1A 1Z2AA 2QS9A 1PV1A 3PX3A 4Y9SA 5IP5A 4CQLA 4DM3A 3JQ7B 4DQKA 1DELA 3LW8A 4IYRA 1FOEB 1NZFA 2IP2A 2C2WA 5IC5A 4DMCA 3CVUA 2FDCA 2C9CA 3I42A 1TT5A 1AGXA 2H4JA 4PSUA 5T8KC 4BFVA 1QHEA 2NUPA 2WBLC 3TRIA 1QPBA 3C5CA 4AY4A 1MAAA 5IUNC 1O87A 4PO8A 4QEKA 4KHPB 3IB3A 3CPJB 2QMUA 5KDLA 3DYIA 3DEAA 1IEXA 3EWSA 1G20B 4D0NA 4D3DA 2JFXA 4BEVA 4ZZ3A 5C8ZA 3M9LA 2ASVA 1OXTA 3SWWA 3BL8A 3KQVA 3Q98A 4X3OA 2Q3MA 4B32A 2AOTA 2B37A 3P2EA 4EGFA 1NMXA 1JHUA 3IALA 4ETIA 2WHPB 3M49A 4UC0A 1XNGA 2ZVDA 4ALJA 3JQ7A 1O95C 4X8LA 5FFFA 2QRNA 4RF4A 3I2JA 2VLIA 5EJ9A 3N70A 4HRVA 1DWOA 2HHJA 2B7CA 3VH2A 2DFLA 4L9SA 4D80A 5K0FA 3S0JA 1O6BA 3NUZA 5CMLA 4MJ7A 1PQUA 1U0HC 3RJZA 2ZCUA 1SUAA 1O0CA 2X5KO 2EYUA 5FTWA 3C0KA 5J58A 1NLZA 4REQB 1FX1A 5HKOA 3T9FA 1B6GA 3HDVA 2O7SA 1FNSA 4RJLA 3ZW9A 3LYAA 2XKKA 2W4MA 1ODLA 5CK5A 1W47A 5KNCD 1G20A 2ZR0A 2BZGA 1SXIA 3H1PA 3H19A 3M5PA 5ALYA 1IHOA 3GVPA 3EPJA 2O07A 4BLWA 5ESDA 1W6UA 3L7NA 4RF2A 1A8PA 1DU4A 1DX9A 3CLTD 3MT0A 3MS4A 4LZWA 5LBUA 3E5HA 3PLRA 4JUBA 1OB2A 1ML3A 4HHEA 2BGNA 1MUUA 4LJKA 3E9DA 3ZU2A 3AY3A 3H1BA 1B7GO 1B00A 2J0SA 1VE1A 3QV2A 3HABA 4OFZA 1AQJA 1J7KA 1L8AA 5B1SA 1TTTA 5JVDF 1P74A 5IVKA 3R3VA 1XQ9A 4LCJA 1L1EA 3PL1A 4I8DA 2VQDA 3FFBA 1P73A 2GA8A 1EA5A 1XDDA 2DMRA 3KJXA 1KBZA 2A5LA 3KV3O 4GQBA 4REQA 2FOIA 2IBTA 4IDEA 1O4WA 4N12A 2QE6A 3BN3A 2R7AA 3F46A 3UMVA 4NYMQ 5IS2A 2IITA 4I8XA 2Z09A 3CWCA 5AVVA 2VHXA 5CYFA 5ICMA 3RS8A 4CKXA 5E8RA 4DL9A 5F2OA 4H3HB 4EA9A 3R7WB 2QA5A 3QU2A 4KLAA 3ZH2A 1S0UA 4JAVC 1T8WA 1HE5A 1IQ0A 3KB8A 3MTQA 4XYBA 2O9JA 4L73A 3KR1A 4DUYB 2H9IA 2RCNA 2WHXA 1DKNA 4ASUD 5JALA 2G40A 4LYEA 1VG9B 3STVA 2WSYB 1TIBA 3SYMA 4UJ3A 5CB4F 3CH5A 1RPAA 1T5HX 3UHAA 1LBSA 3QFTA 1BGVA 3ZX5A 3VZPA 1EFAA 1CIVA 3EXFA 3PGLA 4IDGA 1V9SA 3GYBA 4X7PA 5F9MA 4I5IA 3WGJA 3ZJ4A 5B2FA 1AQNA 3DE2X 2IY9A 4WCFC 3QPUA 4NNPA 3ICOA 4GXNA 3MTAA 4J0DA 4BNHA 1AK2A 1IAVA 1QUFA 2C8KA 5EIBD 1WZCA 1CFZA 4ZICA 2FQWA 4JP8A 3SXUB 2O3RA 2OK7A 2DWUA 4MVJF 2OB2A 2R7NA 1GTJ1 1Q7EA 1FY2A 4Q4JB 1XVAA 5EHGA 2VF5X 4E5DA 5K6AC 1EFPA 4RQAA 4C2AA 2FLVA 1L4KA 2FUEA 3SE0A 5B64A 4Q1AA 4YR7A 3MRVA 1YFJA 3OAAD 4DZTA 4HYYA 4MDFA 4EQ6B 1N5JA 1T2CA 2WSSD 2X0JA 1L0BA 3GDFA 4B9AA 4MR8A 3ZKWB 1HXHA 4MVYA 1QNFA 3DT6A 4FHZA 1NF9A 4MV7A 1XN4A 2Q5FA 4IIHA 4QBHA 4H3VA 4FFWA 3HU2A 4A8JB 4QQRA 3BWMA 4RNDB 4XWTA 4BWGA 4DBZA 2W8ZA 1ENZA 2ATXA 1EFVA 3OZXA 4TVSA 3IYLW 3CNBA 4Y67A 2RHRA 1CLUA 4MJLA 1FIUA 1SKAA 2A9FA 1WTAA 4HVLA 3SVTA 1OAOA 3VRHA 3M6VA 4N7JA 5GZ6A 3SXUA 1WSWA 3IMKA 4UARA 4EY4A 3GBSA 2MR5A 1S3GA 1F6DA 2VJCA 1T3LA 2Y6UA 3KKZA 4NCXA 4Q4JA 1BS2A 1SBIA 3P9XA 2CLSA 2PZGA 4RKRA 4M46A 4TMFA 5J9FA 2XGJA 3SDBA 1Z7WA 2H8GA 3TQHA 1GQFA 2C4KA 2QJOA 4FYHA 5CITA 4M2LA 5BVGB 2BTEA 3KKKA 3HMQA 3BF8A 2DBYA 2ANBA 3DTVD 2WVHA 3IMFA 4GP6A 1GTMA 4PZEA 4EQ6A 4B4VA 5FUQA 2VYVA 1E2UA 1E9DA 3ZKWA 3JX9A 2GCEA 3S6JA 1BFKA 1V6CA 4JELA 4C3UA 2VP3A 4MWDA 2XEDA 1L5QA 5E9JA 5I45A 2ACEA 2NYAA 2COKA 1QQ6A 2E2WA 3D6TB 3PKJA 3Q8XB 5AO9A 3W4KA 1K0FA 2PH7A 4C14A 1JWAB 5A5EA 3I6MA 1M2OB 3MTJA 5DBEX 3EQZA 3VH3A 4M1KA 3C2QA 5KKNB 1MG5A 4QJIA 3ZCQA 3WNZA 3EZXA 2C7BA 2HPVA 3CX7A 3DCIA 1X8JA 3P8ZA 5AM3A 4MYTA 2QZ9A 1R10A 2X4GA 3PXXA 4GM4A 1VC2A 2Z56A 4YLEA 4F71A 3L4EA 2ONJA 4ESOA 4ZYUA 4OYYA 2NUBA 4O25A 1P7VA 3GDWA 2R79A 5D5QA 3SY8A 2HEIA 4NHEA 5BVGA 2HCTA 2NTNA 4HH0A 3D43A 4JU8A 4OK5A 3ILVA 5CB0A 1O95D 2XJ9A 1K86A 4FCCA 2VXBA 4ND6A 1UKYA 3DL4A 3SEQA 4OFBA 2J07A 4E07A 4D42A 1V1MB 4MGHA 1FQOA 2FUKA 3BJMA 4OHFA 1VLQA 3HO8A 3O4RA 4LBZA 1GHTA 2VAVA 1NVKA 3TD2A 5T57A 1DG9A 4P38A 2VXYA 2Q5IA 3HNRA 1ZM4A 1M2OA 4BNNA 5BSWA 2P0EA 2IEBA 3OIDA 1Z4OA 5C4IA 1GRQA 3D31A 3RH0A 4W5RA 2KQUA 4JC8A 1UK6A 1Z36A 1Q14A 2H5EA 1WHTA 3OBBA 4N3NA 4FQ7A 2EJTA 4H1WA 1ACJA 5CG1A 1Z2EA 1Q22A 2IC5A 2D5IA 3QJ5A 4RWZA 5AW3A 2V55B 1XEWX 3TEJA 1RJFA 3AKCA 5HF5A 1HE3A 5CX4A 1HT2E 4DDUA 2JKYA 4RTMA 4WEQA 3SSNA 1E66A 1TMKA 4F21A 1U9IC 1W0JD 1I2MA 2BFBB 3H5AA 4GC5A 4JB2A 4M49A 1Z3IX 4W9NA 3X44A 5C5CA 1RCFA 4HMPA 4X84A 1VP3A 4QYMA 4EFLA 3SVLA 1IXYA 3GD7A 4R0MA 3GBPA 1DZ3A 1QO7A 1V1MA 4MV9A 2PM8A 1QCCA 2ZZKA 3AKYA 3GBVA 4ZZ2A 5ILGA 5B7GA 5LYYA 4M99A 1C9EA 2RARA 1BC5A 4KIFA 2NMVA 2WHYA 3GZ4A 1SG9A 4J16C 1JI0A 1E0DA 3HZZA 4R8RA 4MPDA 4Q9JA 3IPAA 4HQ6A 1JDSA 1X1AA 2IVFA 1KGDA 2H16A 4TXNA 1UMDB 2CMFA 1GGJA 2OGWA 3FYHA 3ORFA 1R4NB 4UUAA 2CGEA 4ZCSA 2PBZA 4L4RA 5E38A 2ZE6A 3ZDFA 2P5UA 3ZDAA 3GRFA 3JVVA 4MR9B 4H77A 3RAJA 4DPMA 4M8KA 5JRDS 3CUVA 1YBVA 2BSQA 1MX5A 2RHJA 1M6WA 3Q3VA 2WIAA 4C4OA 4CM7A 2HTEA 5AVWA 4JA0A 5LYJF 5FPYA 3PEEA 3BXFA 1QS0B 1AZSC 3L1IA 3P9QA 3LLCA 3RUDA 5H8WA 3VR2D 1W581 1EK1A 1XNJA 3CX8A 5HE8A 5B3JC 2VP6A 2WM8A 2N1MA 1VRWA 3PWSA 4LOJA 2QRGA 4EG5A 4DLKA 1CETA 5CDHA 3FOZA 3I73A 5C1IA 3OIUA 6AT1A 1NNSA 1JR6A 3ZDXB 1LU9A 1VLVA 2Q45A 1FU4A 1UMDA 1U4OA 2QN2A 2VBGA 2XJ4A 4Y18A 1R4NA 4GOJA 1GV1A 2DBRA 2WP8J 4BATA 5LQJA 1RHRA 2WLSA 1OB5A 2DPYA 3V46A 4JT2A 1JEEA 3F5SA 5COBA 1B74A 3ZQ4A 4C5BA 4MR9A 5DHQA 3PPWA 4XIIA 1QCZA 1U3CA 2X9QA 3KYDB 4HFRA 1OA1A 2ZKIA 4UM9D 3HYSA 4WACA 2G36A 2WSBA 2V6GA 3HB4X 4GI1A 1QS0A 3QBDA 4Y2GA 3VYVA 4X66B 4XKJA 1O9HA 1D0IA 4TTIA 2G9UA 4RVDA 2GSDA 3RRZA 1K7CA 3J7TA 1E20A 5IAOA 1UBJS 3VO2A 4AZTA 2ZBVA 2RJOA 3PNMA 3TKAA 1LLUA 2O05A 5T41A 3ZK7A 3A2KA 2NO6A 4Y2HA 2GYUA 1J99A 3IP6A 1JQJC 2Z83A 3ZE1B 4LYFA 1RWPA 5ITVA 2WFZA 3HWSA 2IEDA 3TAUA 3ND9A 5LIRA 3A1DA 4E14A 2Z08A 2Y1KA 3BA1A 2HLPA 1B0UA 3KYDA 4P4UA 1EM8A 2JFYA 4AJ4A 1JWLA 4EPYA 4KH1A 5AKJA 2HV8A 2BH9A 1T9GS 4I50F 2XLBA 1XAIA 2FN8A 2FZEA 4K46A 4OXRA 3VAAA 2XB2A 1ZK4A 1K4MA 2R66A 2ZS9A 3GDGA 1KO1A 1KSJA 3T1QA 3LTEA 3N8GA 2WVAA 2YC4C 4CM4B 2PSFA 3ABOB 1L5LA 1MJNA 4LVUA 4RHUA 5JXJA 3V3TA 1I2ZA 1E2IA 4YPFA 2ZCJA 2PTHA 2R7KA 1BHO1 3O3NB 4IKOA 3D7KA 3H8WA 1QX3A 4MW4A 4C4YA 4RULA 3TR6A 4I2NA 4M0PA 5JBQA 4ND3A 3VDNB 1T9DA 4Q01A 4QLOA 1A96A 4WL0A 2C97A 5AVXA 1LW7A 3W8DA 1ZL2A 3VX3A 4D8YA 2C57A 5LBTA 1YACA 1XRLA 4KLCA 2CWDA 3RE1A 3FLEA 1WZEA 2HXYA 3TNFA 2EKLA 1GTSA 3D4PA 1G60A 3CGGA 3EA0A 2WABA 3MK31 3U3KA 1XC7A 1PN3A 1GNRA 2GZ1A 1SEVA 4FZRA 1FK8A 3E9ZA 3EOAI 4G3XA 4HDCA 4TL9A 4OI1A 5AMXA 4ZEMA 1P44A 1ZESA 5E8JA 2V7QD 4QGSA 3NU1A 3OTIA 1AZLA 4CM4A 3PHIA 3W34A 2R44A 1BRTA 1PGOA 8GPBA 2FPWA 3WMRA 5AVUA 5KX5F 1RCUA 2VATA 3Q7IA 4ETWA 3FOFC 4LZOA 4EB6B 1S5PA 5L7TA 3IQXA 1UC9A 4UTNA 1U8YA 4B7CA 4CLRB 3UT0A 5T67A 4QM6A 3C5HA 3LNCA 2VOJA 4QXRA 3T35A 1U2GA 1UK8A 3G6KA 2XBUA 1TKCA 2ROQA 5DNVA 1ZJWA 1U5AA 2WJJA 3I53A 1QK5A 3PDUA 2IUUA 3RIMA 4NK4A 3SHVA 5I01A 4X8HA 1Z0DA 1XEWY 4NJEB 4BUCA 2GF0A 1DRKA 1VE3A 3Q5EA 1T5DX 4M9ZA 3BSWA 2ODWA 3NASA 3FIUA 5KWIA 1CTQA 2C96A 3LZDA 1VZ3A 4TTJA 1R0XA 2XOKD 1EHYA 2WF6A 1JA9A 2XY4A 3NKLA 3H5NA 2I65A 4B4KA 3SJAA 4QTUB 3WAJA 1Q1ZA 4YFYA 4EB6A 4X6LA 1QLJA 1JDTA 4NOLA 4L6CA 1DFIA 1KE1A 3BQ9A 1NJFA 3FTPA 5DHRA 1NQWA 1TK2A 5IWAB 3WGTA 4EKYA 1TI7A 1UBSB 1Z5OA 1H85A 3BD7A 1XCLA 4RZ3A 1G16A 4R1TA 2NYUA 1RTTA 1YK1A 4B3GA 1G19A 1O6ZA 2SCUB 3GUVA 4J07A 4ZMSA 2EX4A 4EEZA 4LRSB 3LT1A 4R7TA 5LZ7A 3EIEA 3HQ4O 4ZI2A 1GSAA 2AJBA 1F4LA 1NOKA 1KKMA 3FZGA 1Q0RA 3SJCA 3FKSD 4LRTB 1NIJA 1UC4B 2P6PA 4D5EA 3F6BX 4EH1A 3ESCA 1R50A 2H17A 3O6VA 3ITNA 4OJTA 1RYHA 5CUQA 1FTSA 1IMJA 1IK4A 3OZEA 3SX4A 2H2DA 4GOLD 2PXHA 2E0IA 3ZG6A 2K6GA 4NC9A 2FWNA 2PNFA 2QJRA 5AJUA 1QZTA 4FR0A 1LTKA 2QZZA 4XM1A 1QTRA 1Y5NA 4MP6A 4PGMA 3UFBA 3ZZNA 2GASA 2WFLB 4FFPA 4RXTA 2O0KA 4NESA 2V7PA 2G4LA 3GWZA 2BGIA 2LDXA 4IGFA 2MJLA 3R09A 4NBLA 4AS3A 3FOBA 4IGKA 3M0EA 4KMMA 3IVCA 3Q3EA 4IJVA 4R1MA 3JYHA 2Q4EA 4P92A 1ESCA 3LLMA 3WGOA 3KHUA 5I7VA 1CRPA 5L4NA 4KR7A 1RM3A 2F17A 1HLPA 3NTVA 1RM5A 1OI2A 3LD9A 5G0WA 3RS7A 3SHOA 1WS6A 1G8SA 2WE8A 1FA9A 4FYIA 4PR3A 4X24A 3CVXA 5IMBA 5NULA 3I9NA 3E53A 3MXTA 4KGDA 2XQFA 3FNRA 5EZYB 1D04A 2B4TO 3TUJC 4GRIA 1BNCA 1RJGA 1TKRA 2XYQA 3OU2A 4AAYA 1XF9A 4QTYA 4N48A 4ONEA 1Z4LA 3M8KA 3FHLA 2D2FA 1V3QE 2NSYA 2OUKA 2E85A 1SG0A 4RGYA 2EEPA 1SD5A 1Y1KE 2WFLA 3I76A 2QPLA 2R48A 4LRYA 1UWCA 1PNTA 2PAFA 1HR0B 3X1MA 1CUGA 1PUIA 4F6RB 1JEAA 1GZSA 1MPXA 5E7JA 1N6RA 2IOYA 3BK1A 5DO9A 4B71A 5JH7F 3DEIA 3F49S 3MUOA 1CLEA 5IBPA 1PZHA 1G66A 3KAPA 1YR3A 5EE3A 4PN7A 2P9GA 5IN4A 1PV2A 4UUOA 4EMBA 1VL1A 2IDKA 4YAEA 5I5EA 5DM70 1DBQA 5EZYA 4LWPA 4F8JA 3AR9A 4G9EA 1UAYA 4P6VF 1E7MA 3CKMA 1JJAA 3SYNA 5E95A 3BXZA 4RJKA 1WUHS 4FDAA 3JRWA 1GG2A 4ZO8A 4CV0A 1IEVA 2ACVA 2X3UA 4QOFA 3G1TA 4AS1A 1U7HA 3KKPA 3PHJA 4OB6A 5ICEA 1H93A 2VH2A 3GXOA 1ZUNA 4JR1A 3RT1A 4A0RA 4ZCRA 4TZTA 2O1SA 3PJGA 1H2FA 3SKYA 4D6XA 4MB0A 1EH5A 4F6RA 5LDDC 1K2WA 1VJ1A 1E2GA 3O2QB 4J7AA 2YZGA 4P58A 4R1NA 4S0ZA 3WDKA 4B1FA 2D2XA 1OWNA 5FBRB 3H3XA 4R3UC 3OEHD 1SUBA 5FR2A 5EVJA 2IXGA 3EGVA 1EZ1A 1V5WA 4KFTA 4B3DA 4E5SA 5LZ4A 3KK0A 3BFPA 3M7IA 3WLTA 1B8VA 1SA0A 3KLNA 2XCTB 1MP0A 1N3LA 1SVNA 3COWA 5IHPA 5FFNA 3DTNA 5K51A 4GOND 1T4CB 2E89A 4P7FA 4ZVQA 5LDHA 3D2BA 3RVLA 4Z3OA 4BMPB 3EZNA 1MJGA 4J4TA 2QMHA 4CT5A 1KOJA 5CXXA 4KNWA 1U8AA 2XB4A 1I10A 3VKFA 1J9ZA 1PWXA 3KD3A 3H1EA 5E6RB 4V0MA 3QUCA 1M73E 3T5MA 4E2XA 2C61A 5CLFA 4UM8B 3KJZA 2BDUA 2EKPA 3MMSA 4O5AA 5CM2Z 4ZQHA 2O3QA 3C5EA 5DHUA 1I32A 1M8JA 2O23A 1CP3A 2J3JA 2R2AA 5L3VA 4IBOA 4JASB 4L3OA 3DGEC 4RS3A 4UQOA 4IDQA 3V1KA 3GLFB 3GFBA 3A14A 2CDAA 5CIWA 4BE9A 2YQZA 4C08A 5KSOA 5FNZA 2AKAB 2LBPA 4HYQA 3AF1A 3UW3A 1OZGA 1HMPA 4BRZA 2AG6A 1T15A 3ETNA 3NWJA 1GP2A 5JNSA 1T4CA 4R2WA 5KEIA 1KJWA 1LLFA 3W7AA 3OLQA 1YHYA 4AD8A 4PGGA 3M5CA 4FMCF 3AILA 3PUZA 1V6SA 5E6RA 4POAA 1KFJB 3CCBA 4GMDA 4C4XA 4AWXA 4GLOA 3WG9A 3UAWA 2BE7A 3BSYA 1J21A 2IYSA 3CZRA 3PD7A 5K01A 1EGQA 1EXMA 1RHKA 2PQ2A 2F9MA 1DWQA 2X5NA 3MJDA 5CD9A 3FFXA 2XYPA 3CZQA 3TQRA 1C14A 2OV1A 2M6KA 1YHNA 4RIFA 4DMKA 3GLFA 1JFVA 1FRQA 1JG2A 1V96A 1Y3DE 3WIDA 4KKXB 2XMPA 1FW6A 2DB3A 3WRYA 3PD0A 3RUFA 5IABA 4XGQA 4RW0A 1QC5B 1ZA1A 1T4DA 3TZLA 4QG3A 1M5UA 4LZLA 3CLVA 3O3CA 2CE7A 1ZS9A 3FAZA 5JC1A 4PQGA 3CFYA 3BS4A 1JKXA 1FTWA 4JBIA 1QF6A 5B1EA 3W2GA 1PKXA 1NLYA 2OVBA 5KNDD 5EQFA 3S2SA 1NBEA 1ONSA 4UFPA 1C30B 2ZT6A 4FW8A 3MWFA 3FMPB 2GKGA 1T4BA 3DT9A 4R54A 4IQ4A 5GPBA 3AINA 2CF6A 3A4VA 5BV0A 4DPKA 1XPRA 2VHCA 5EJIA 1EX1A 1KI4A 4WN3A 1GITA 2JBAB 5H7XA 5FTMA 1A5SB 2B92A 3FW1A 4IVPA 2Y0DA 1YJCA 2XDYA 2FFRA 1U2DA 2C5SA 4TOIA 2BHLA 1GQYA 1YSCA 2L82A 3R6WA 2I3AA 4MQEB 3IDFA 3C24A 1R8JA 4Z0NA 4X6XA 1RQ2A 4DHWA 5DOZA 2PKWA 3GT7A 1LZLA 3Q12A 4UDYX 1S2OA 2LKCA 1QC5A 5A5GA 2YY5A 3K8YA 3CNEA 3JD2A 3VDXA 4BRWA 1KDOA 4MQ5A 5LP6F 1RPZA 2NV2B 2XGOA 3JAKB 3ONNA 4RD6A 3D6AA 4YJGB 4ZT6A 2FMIA 3K70D 1LD3A 2CN1A 2PUAA 1P5JA 4G4GA 3K1JA 2I4LA 3PFWO 1PX2A 1OFVA 1C30A 3GP8A 1CY4A 1HETA 1GL6A 2I2FA 5MFPA 3IFSA 4IH1A 8ABPA 4KXWA 1GEEA 3PX7A 4RMHA 4AZ0B 5FI5A 1WLSA 2A0WA 4FW9A 4RM2A 5IXYA 1VPDA 3T1OA 1QYWA 1VIMA 4QJ4A 1JFRA 4IYJA 1WBJB 1I7DA 3KT0A 2OC4A 4P4TA 2O6HA 3UEOA 1A50B 3CX6A 1XLTA 4PYMA 5HILA 2ORWA 3WO1A 2PO5A 4EGJA 5KJFA 4RHTA 1P7CA 3HXKA 3PVZA 1YCDA 1XU9A 5BV8A 1MQSA 1NG9A 2GXUA 4O4JF 5JWOA 4KWCA 3DXFA 3RGGA 3R3ZA 1GCUA 5I7UA 3JAKA 5EZSA 1Q21A 5IZCC 2ZULA 2VNJA 4WW0A 3K73O 3X2EA 3CLUC 4K86A 1UBMS 2AOUB 1AKRA 3BWXA 3NOXA 2KYRA 4F12A 2O2HA 5I9IA 2FOLA 3IAEA 2O8VA 3V4OA 2VUHB 1HI9A 4C6TA 3JARB 1SCUB 3M4ZA 2BFEB 3U39A 4V0NA 4AZ0A 1UM8A 2PMCA 4J4BA 1PVOA 1KGSA 1XRRA 5LBIA 2FA9A 4EGCB 3AQIA 4MUEA 4DANA 2LD4A 1DRWA 2Y76A 2UV8A 3OZSA 3BJIC 1K98A 4FNOA 3OFNA 1P1IA 2QKYA 2QTMA 4NMLA 3KR2A 4RENA 2OO5C 2ANCA 2C4NA 3I64A 3JATA 1ETUA 3QKSB 3N8DA 5ESWA 3HS3A 4EG7A 2C7GA 1M0WA 3GGCA 2ACKA 4JLKA 2VJOA 3TLMA 5JSUA 3KCNA 5DNDA 1UP4A 3LO8A 4P54A 1ZMTA 3RVJA 5IDQA 4ENQA 5MFZA 3EMBA 3H99A 1T2VA 4IIEA 2XSZD 1NF2A 2BEUB 4V0SA 2XXBA 4AKTA 2AQKA 2FWJA 3ORYA 4OQDA 4Q7JB 3ZGOA 4EUEA 3GJXC 1FS5A 3VPFA 4Z4GA 2FFHA 1GG8A 4RE6A 1GKUB 2Z58A 1T2DA 4QTTB 4DCUA 4RK0A 1VGQA 1N1MA 5KDDA 3CLHA 1FFWA 4LHXA 4PC1A 5EXPA 5LU8A 1UMKA 1E6LA 1QH1B 4HAZA 1JQBA 2OXCA 3E3LA 4TLCA 4QUKA 2FVXA 2JDIA 5EY5B 3Q8MA 1CIJA 2OENG 5M04A 4BQPA 2ZAIA 5K3CA 1T36A 3B2NA 2ZKLA 3AK4A 1ZD9A 3K0AB 3ZWQA 4BJ5A 3I6ZA 4FFVA 4W5OA 3DLAA 3BTUA 1NT4A 3LP8A 4TZ6A 2I99A 2RONA 2BEUA 2NQ2C 1N2GA 2AOWA 3B70A 5EINA 4CE6A 2JFFA 3EIXA 1G6OA 2PZ8A 1WHSB 3LW7A 3IIIA 3K0BA 2V6FA 1SMKA 1CVRA 3LKVA 4XQ0A 3IULA 3W9SA 1ZFNA 2HB6A 1CDOA 3KVVA 5L53A 1T8RA 2KE5A 2XX3A 3EFOB 1R8XA 2IGTA 3NKVA 4F2GA 4NY1A 1Y6FA 2A5DA 1K7EB 2WG1A 4WLOA 3ZCUA 4I4LA 4LY6A 4BQRA 4YMWA 2ISQA 3REGA 4KRGA 3WISA 1P18A 4I1UA 2ZZMA 1RWVA 4M1SA 4E1AA 3RNOA 3BF7A 1L7AA 1QH1A 1YOVB 2WJPA 2F3SA 3FDZB 3GJSA 1SBQA 3PCRB 1ZOIA 4QPJC 4RGQA 5ALLA 4NEHB 4NDZA 3RS9A 4TWJA 3DHNA 3OEYA 3S99A 5J2UB 1E9VA 2BF4A 3S81A 2V6IA 3U7FB 3E3MA 1AF7A 1EGAA 1IG3A 1YU9A 3C4QA 3K0AA 4G89A 4WZ6A 4AJLA 3ADCA 2Z30A 3IUBA 1Y9AA 3PTLA 4HGPA 3ZD9A 3ZWOA 4M0FA 4Q05A 4JS0A 3LS2A 2GF9A 1JKFA 5EQJB 4IMJB 3ETDA 1V4NA 1WHSA 4FBLA 4OA5A 1VQ1A 2G1KA 2G5PA 4NFSA 4J7UA 4YA6A 2FPPB 3DE5X 3E70C 4HH3C 1JBEA 3EFOA 2BMFA 4NICA 2P9BA 4HRXA 5A5VA 3VHXB 4M1TA 3VC3A 2FK8A 2GPNA 4K2AA 2O8DB 5LQKA 4TV9B 5IDYA 1RWOA 1SBHA 1YOVA 3BE6A 3JD3A 3FDZA 4I55F 4BBZA 1Z68A 4OHVA 4U7WA 3CQ9A 2MMCA 1LC0A 3SMQA 2VT6A 5KAMA 4NZNA 3SZGA 3HCFA 2JJ2A 1Q0TA 3U4QB 1VCNA 4LE2A 3RHZA 2B6HA 2VLBA 5C5DA 1AKVA 4XSVA 1H0SA 5DGXA 1DPGA 2X5JO 2CY0A 4HFJA 4DEVA 3HBFA 1Y1LA 1OBVA 3G88A 2IQ5A 1QUEA 3DAHA 1YC5A 4FU0A 5IARA 5FEUA 1RCTE 2C0CA 2X8JB 1COWA 2IKQA 2QPAA 1B0PA 4ML3A 1C9MA 4TKLA 3M83A 3VHXA 1I8TA 2B8EA 5JO0A 1U0GA 2YUIA 1PK7A 2ODPA 4N5DA 3X43A 4ABYA 1FBNA 4Y30A 3UBTA 1DEXA 2O8DA 3AW9A 1SK8A 3G2MA 2Q3EA 5KC9A 1M2VB 3BRWD 4MICA 5BN4A 2YUTA 2BFOA 2H7VA 3EVNA 2B4AA 5AI4A 3VMMA 4F04A 2J7PA 3ZDRA 3ORHA 1PT6A 2RGNA 3PNYA 3QXJA 2AYXA 4Q19A 3T3DA 4ZYTA 3PFNA 4ZAVA 1B26A 5EJ7A 3D0OA 5DE3A 3QH4A 4FBGA 1F2UB 2AR9A 2X3YA 3E2PA 1EIZA 4F1WA 4G36A 1WF6A 1TM1E 3CE9A 3DZHA 4IIJB 4K9RA 1U1EA 2OLJA 4MARA 1RXEA 5KWSA 5FJIA 1ZZGA 3IQGX 1PQWA 2X8JA 3NGXA 5FBVB 4GPZA 4DABA 4JVMA 3ADBA 5J40A 1OWPA 1GAQA 4ZO7A 4PNEA 2GM5A 2WM2A 3L6EA 4TKZA 3BGOS 1KR2A 1HH4A 2BY4A 2WIJA 3L0CA 1E6WA 5F5NA 5MN5A 1M2VA 3HA5A 4YMGA 3GLRA 4JX9A 3GRRA 4YIHA 3VR6A 2YQ5A 5EJ6A 1C9YA 4KE9A 3M5DA 2F1OA 4B7XA 1H0HA 4FFRA 3SBDA 1NVVR 3L0IB 4GI5A 3T61A 3T7DA 3LK6A 4JYPA 3PIIA 4RHFA 3LX4A 4X7BA 2ZUVA 3WV5A 3MTGA 2AI3A 4YRZA 3LUCA 1A1VA 3A4YA 2JGRA 1F2UA 4U6SA 4U2DA 3CW2A 4JQYA 4A5SA 1EVYA 4KAAA 5CA1B 4ZGWA 4D9CA 3WL3A 3EPKA 3L5KA 2IVZA 2BV3A 4LGCA 1GJRA 4LYAA 3M6XA 2RJNA 1CUUA 4W82A 2ZUTA 1PQ4A 1ADBA 3GJ4A 5IEJA 4G8BA 2C07A 3OHPA 3F3SA 3C6ZA 4IV8A 2Y68A 1JSZA 2EJWA 3G5AA 1A4XA 3LDUA 5D5PA 3MCAA 2YN0A 3IIKA 4MGIR 1MMFB 1A97A 2X2EA 4TZ0A 5TQJA 1KO8A 3SF0A 1KPIA 1NUSA 4J9UE 2O8NA 4MP8A 3HKCB 2RGXA 4FCWA 3MIZA 5T5QA 3HDHA 3LVQE 3DS8A 5I4IA 2BFAA 1NXPA 5BSTA 4BAZA 1D9ZA 3GGSA 5DNAA 4M6WB 5BYAA 4HNSA 3CRMA 1TAQA 1ARZA 2F1JA 2MMGA 2B99A 2VPYA 3N59A 4ZVUA 4OAQA 2VCYA 3IQEA 4B6OA 3IVXA 2Z6AA 1V47A 2X5XA 5CA1A 3QYPA 3HJNA 4GMHA 4U00A 1VHTA 4P2GA 3YASA 3LQQA 4EUSA 5CD1A 1SWVA 4GMGA 3VKWA 3K0SA 2FPXA 2ZSIA 4U7TB 4Z9AA 3GUCA 1L9KA 3N6RA 2ZIVB 1QGUA 1BMTA 1LPNA 3RRFA 2BBSA 4I1SA 4JT9A 2H4ZA 2KBFA 2QF7A 4U3JB 7MDHA 3QVTA 2O3SA 1V9CA 4HEQA 4D81A 2ZM6B 2P6UA 3ICQB 4NYIQ 4DSOA 1EVQA 4BMNA 4C4SA 3HKCA 3GRVA 4DRXB 2ZWIA 1NRWA 4YONB 4DV1B 1C3OB 3M70A 1J56A 1V11B 3Q2OA 4TVOA 3ZX4A 4M6WA 5B7PA 4MAFA 4O59O 2VZ9A 2JCYA 3RASA 1H4VB 5G2OA 1PGPA 4DJAA 1ZM7A 2ZB8A 4QYXA 1R16A 2E4UA 3FKJA 5ILQA 5TEWA 5DMHA 3KXPA 4KQIA 2ZE8A 2R1UA 4URFA 5JSHA 1P3DA 3LM8A 1ABEA 5CVEA 5LZ9A 4MYDA 3HJAA 3VSAA 4KFUA 5BNZA 4J0IA 5EKTA 1BG6A 1ZJZA 2PWBA 3AUFA 3NHSA 2ZAOA 2QVZX 4YMIA 2PKQP 1OFUX 3SZLA 4ITUA 2PR7A 4BNWA 3KPVA 2R68A 4PPFA 1JHVA 3I9LA 1KU6A 4U3JA 5IAJA 1JH9A 4ZHQF 4F1JA 2PIAA 3OEED 2SKDA 3DMTC 3NTRA 3QNUA 5AKLA 4MQ4A 2NW6A 5COAA 1VXOA 4RL4A 4ZAZA 4DRXA 2ONCA 4R8SA 1EGHA 2ZSJA 3KHSA 5BN1A 1V11A 2VRCD 3JALB 1GPH1 1Y3AA 4QLAA 3VSCA 2CUTA 4EJSC 1SOUA 3LH5A 4LE0A 4ZZIA 3OZ7A 4Q9NA 5EYPB 1U2SA 2WU1A 4FMPA 4DIKA 4DDVA 4G86A 1K3TA 4FI3F 3TGPA 3ZV5A 3RU7A 3EUEA 5INTA 1HYBA 3OWHA 4XEUA 3BEOA 4XUGB 5EESA 3TFQA 4D9NA 5I7WA 5KQGA 4EA8A 1II8B 2I6SA 2QMOA 3LAWA 4ND5A 2ZTVA 2CZCA 4Q7EA 4D25A 1KC1A 5FL3A 4CV1A 3FHJA 1P0QA 1XPJA 4PIPA 4F4JA 3LOUA 3GJTA 1OLOA 1BKYA 4YT4A 3A3OA 4MWEA 5AI5A 1J22A 3AT1A 1A9YA 3JALA 1QNLA 1N8SA 2XAUA 3AZOA 1HWYA 1C4XA 1K88A 3KJQA 3L0BA 4O4LF 4ZO4A 4EVRA 2WKWA 1WBBA 1IHUA 1WB9A 3I01A 2G28A 4RPLA 4HX9A 1ZUHA 2V59A 2ZYTX 5EYPA 4B4DA 4DDMA 2EFHB 5IAEA 5B6IA 5IKMA 4R1UA 1HEYA 4ZQEA 3I1IA 3MJEA 1G7CA 5CEEA 4PX3A 2FFJA 4RVSA 4TKVA 1QHYA 1A5AB 2NXCA 4JI6B 5CPBA 1M1UA 1MC4A 2CDRA 4PCAA 1II8A 3E8MA 4H0NA 3B3QA 2CL5A 1SZPA 3B1FA 3I3SR 4ANFA 4JEIA 1MAUA 1BWSA 5LD2B 5JDIC 2W7TA 1EVZA 1HT3A 3G9QA 3AXSA 4B6SA 1YZNA 4AY5A 4JXJA 1OLXB 1U0RA 2GBLC 5ALKA 3KZ1E 5TXGA 4ZC1A 5A03A 1HMYA 4AW9A 3Q7TA 1ZVJA 4KXLA 4OUDA 5HUHA 2V74B 1RJDA 2Q9BA 3L4KA 2OCXA 4QDUA 3ZWKA 2O8BA 2GNPA 3L0YA 2GX6A 2ZXUA 4CDGA 3W6OA 3MQ4A 3VVBA 3RV4A 3TLJA 4C01A 4CHGA 1DXQA 3DZCA 1NW5A 1JKJB 3GA0A 3PUYA 4JJAA 4PHTA 4PW0A 3NDIA 2FI1A 2OBBA 1AKYA 5KKCA 2XCSB 4JNCA 1TDJA 1ZI6A 4HDNB 2B21A 3FSEA 3NYQA 1LK7A 1DXOA 1MRZA 1ZINA 3QE4A 4JITA 4CL3A 4I66A 5EUQB 5M34A 3Q87B 3VKGA 3K0CC 4Z49A 1ZICA 2IHUA 4YRPA 1P5ZB 4FEYA 1YZKA 2GBIA 3RF6A 3MQ2A 3MYYA 4LVCA 1UT5A 1OGYA 3CMMA 4XVHA 3PQ7A 2NAPA 1B8OA 3NM6B 4PO3X 2X15A 2GEFA 5J4KA 4OFXA 1W6RA 1NC3A 2OWEA 3JVUA 4TL6A 4IDNA 3C1OA 4RFLA 3GMDA 1SC9A 5KKAA 4UBIA 4KI7A 3BFVA 5G53C 3N7UA 1H8EA 1RXUA 4PICA 3LWZA 1QYXA 1ZXBA 4EF6A 3WL7A 1I4OA 4QOGA 1B8PA 3ZHTA 2E82A 2ZI9A 1G3UA 1M72A 3QA9A 2GUGA 4HDNA 1QWOA 4TPKA 3CO5A 3PVCA 4QODA 4UNIA 3TVYA 4DHEA 4PFSA 3AF3A 2ZETA 3B2EA 3KBBA 2Q62A 5HJ5A 3GCGA 4O5OA 4K87A 3G1UA 3MN1A 1MORA 4WK0B 2LCIA 1NVGA 4DTIA 6ABPA 1M9NA 1OFTA 1GAWA 1XTJA 1TU0A 4MV1A 4ALMA 4NJMB 1DEKA 3N8IA 3RUHA 1WZIA 2FY8A 1C0KA 1P45A 3QELB 3DQZA 2I2WA 3LFUA 1J2YA 4RVUA 1X6VA 5EE5B 4EL5A 5K8TA 3GRCA 3R0XA 2IWHA 1NWCA 3Q3CA 5FV7A 4UZEA 4LC0A 1G9XA 2C3YA 1V26A 2HGZA 3NHUA 2C59A 2A0UA 2X4LA 4GYKA 4NRDA 1JDUA 1X3SA 1QH0A 1F2VA 1P7PA 2BHTA 2PU7A 2X6RA 3GVXA 4X1OA 1Q0UA 3RD5A 4LJ4A 2B25A 4WY5A 3EAQA 1HK7A 3L0SA 1QDEA 1OGJA 1QFMA 2Q3FA 1PF7E 2OEPA 1G5TA 4OQFA 5B3AA 3QBEA 3H5WA 4QKQA 2YMLA 3D3QA 4FGJA 4YP7A 4YMUA 5F9HA 3V4PB 3NVKI 3ZGZA 2A35A 5HM8A 1XZPA 3E1SA 1GXSB 3VPCA 1KPHA 1PL7A 4XWWA 4OY3A 4QOJA 1XTSA 2AW5A 2R751 2WU8A 4Q1BA 4NJMA 1ADFA 3FFTA 5T4BA 2AG5A 2O2IA 5JJIA 1LSOA 3QELA 4JLDA 5F76A 2VQ6A 1S3IA 1LK5A 4J0HA 5I3CA 5G41A 2HA0A 4POOA 5EMLA 2CD7A 3BTSA 1ADCA 5ERXA 2CVHA 2EIXA 4IJKA 3RIGA 1E98A 1MABA 3ZEAA 2O5EA 2V97A 3I09A 1U8CB 4HB4A 1M0SA 4GKVA 4BB0A 4LY9A 3WNVA 4BQNA 4YRNA 2EFYA 4TM8A 1R6UA 2OCPA 2HA5A 2AJDA 1CW2B 5GWXA 4AMZA 4PTZA 3DDZX 3T5TA 4NCAA 2JIZA 4JB8A 4OFWA 3L9XA 3WLMA 3B3AA 4CG1A 2JAQA 3DDCA 4HNTA 1GR1A 1RBQA 3NDRA 3AJRA 5CFZA 1L7NA 1GXSA 3JQ8B 1Y8ZA 4JNKA 5HK9A 3O8BA 5KSYA 1G9SA 2X8LA 4ZDIA 3T4UA 3C6BA 1G9TA 2QK4A 4JI2B 1TLTA 4FNMA 1PG0A 4TMZA 1LXCA 3KNZA 4O29A 2WJZB 4HWPA 3A9VA 3OIFA 4A0QA 1CF4A 1C1YA 1GPJA 2B2NA 1YIDA 4M0MA 1WABA 3EBOA 5BWOA 1QYIA 2YDXA 1JJ7A 5AVOA 2V3CC 2FWRA 2Q9CA 1M7BA 4UNRA 1POWA 1I0ZA 4LF4B 1EE1A 1ZJ5A 1KO4A 2W2KA 3D3KA 2Y1WA 2ZUFA 2CUZA 3KUXA 4LSZA 4N18A 4RXMA 4TQUS 2XB9A 1QQAA 3QLVA 3ZVLA 5A4JA 3G0DA 5C37A 4P31A 3W5JA 3RLIA 4DSTA 1X1QA 3GELA 2PQMA 3IHLA 1VPVA 1FSFA 1N6IA 4GW3A 4DMRA 4HG2A 4I9GA 2AMVA 2FX5A 1E63A 2PS1A 3JQ8A 5CNIA 5DZSA 2CLFB 3O4JA 5HS4A 2O1WA 2RHLA 2CJPA 2MDTA 4IP0A 3WI7A 2ZT7A 5BSEA 3COZA 2IH5A 4JKIA 1PJQA 4FK8A 4TUYF 4J1TA 1N2EA 1EG2A 3GY0A 4KR0A 4OQPA 1DT3A 4Y98A 2Z3ZA 1YZQA 4LSWA 1JMYA 2C4VA 1PFYA 3F6SA 4AZVA 1ZEMA 2P9TA 2RKWA 3SBXA 1KOGA 5JQGB 5DT9A 5ALZA 2Q2NA 2QVYX 1E1QD 1XMIA 3WVNA 1ZK1A 2CYCA 3DHYA 4QXMA 3AKZA 3ICCA 1LNZA 1SU6A 1J0BA 3AR4A 4NZPA 3SFZA 3SYKA 2IBMA 2PL5A 4HQKA 4ZT5A 3T4XA 3NHKA 2PGNA 4CG3A 5B6PA 2FQXA 5IK2A 3VDMA 4F92B 3IP3A 4X97A 5ADHA 5JZSA 2DT5A 1P77A 5K3OA 3ROQA 1JPJA 3K8QA 4OX9B 2R6R1 4QBIA 1HZZC 2PD3A 4BB6A 4ARZB 1HRKA 2R25B 1JAIA 3TNYA 1XMXA 2NACA 2YFHA 2FPMA 4FILA 2PFSA 5KYXB 2H2AA 3QVJA 5TV2A 2Z8XA 1ZMRA 3HLYA 2FKNA 1NUPA 2PDAA 3DMFA 1SC4A 1QOQB 3RSQA 3MILA 4G0VA 3KOZA 4PS1A 2O0HA 4A73A 3SNKA 4HWKA 2W2OA 3A1EA 4ICIA 3NV7A 4IV5A 3D4LA 4K9QA 4U0KA 4V3BA 3G8BA 5JQGA 2GGSA 2HJGA 3NP7A 4Q48A 4M0LA 3SLGA 4MYCA 4DF3A 2Z2IA 1ISSA 3T1NA 4GECA 4KXNA 2GWHA 4IOMA 3H1TA 4OPMA 1VL8A 3HL4A 4ND8B 2YFQA 1IWPB 3H1GA 5DEIA 3MMXA 4NBTA 2WAOA 2Q4BA 3C4VA 1ODJA 1W73A 4PU0A 1C9DB 4XCQA 3QFCA 3SX2A 3CE6A 1E7WA 2HIHA 3P2OA 1XU7A 2HHCA 4IZIA 2FJ0A 4I4CA 3FCAA 3IV9A 4NU6A 4B74A 2QDXA 3LQYA 4V02A 4C3OB 4DY6A 5BPFA 1TAHA 2OTCA 2GZMA 2OBMA 1I24A 3PNPA 5FFMA 4XR4A 4QGBA 4TTTS 4HLUA 1ZEJA 2J3EA 1G0OA 3NHWA 4MPRA 3LDFA 1EUCA 5C1BA 2CMKA 2WAXA 4TXJA 3AEXA 2B94A 5BSFA 4IHQA 3HBLA 1IIRA 4NWIA 4CKBB 1FFSA 4FFSA 1U3DA 3RNLA 3ZXXA 1N0UA 3GOHA 4ZZ1A 4HI0E 1X1BA 2Y1FA 4F96A 4J1QA 4HYTA 1FDUA 3LGXA 1H23A 5HYVA 2HWUA 3G68A 4DPLA 2YKGA 2O2SA 1DG3A 1XVIA 3BMXA 5CVDA 3DZFA 1ZUD1 3CF2A 3HRIA 3MQFA 4F5YA 1JR3E 2PX2A 2ZBDA 2JHFA 4XQ9A 5CHYA 4EJFA 3KS9A 1NW7A 1IWOA 1UOEA 4UCQA 2EFGA 2NOAA 2IXAA 1JDPA 4RDCA 2YY7A 4EFMA 1N0IA 3IHKA 1HKHA 1PWYE 5CJJA 2C03A 1TVKB 2AOVA 2EFEB 4QUHA 2ZRIA 1JSXA 1ZJYA 3QK7A 2RGUA 3THSA 3JWHA 4MRAA 5CDTA 3OOJA 1IBLB 1Q92A 3IO5A 4CKBA 1T9CA 1JB9A 3OE7A 3I8XA 2L42A 5BQ3A 1SVMA 2NVBA 2QRLA 2VPXA 1SPXA 3DOEA 3OZDA 4D9KA 3EYWA 2IUEA 5CA0B 3MRXA 3B7PA 4LV6A 5IXJA 5K05A 3BX1A 2C8VA 2CXNA 1JVSA 3U9TA 5A7FA 1V4BA 2QTVB 2FGJA 5DGDA 1M8GA 2VH1A 3BWYA 2JLXA 4J94A 2VSYA 3N2GB 1PVVA 1VZ2A 1LBEA 2V54A 5EXXA 1UK9A 4LJSA 5JNUA 3F2IA 2X6QA 3EFEA 3M4NA 2GKSA 3HHPA 4MW5A 3LA8A 1TVKA 2DXIA 4PAOA 1WQ1R 4JN6B 4LZNA 2ICAA 2FQYA 1VSVA 1ZJ4A 5AKZA 4CEHB 3GC6A 2D7CA 3Q85A 2XE7A 4AKHA 2AK2A 2O8CA 2R1VA 4F4IA 2UAGA 2ETVA 4Y9DA 5FA8A 4RIIA 3PXDA 2H0AA 3A4LA 1IVYA 4Q00A 3HFSA 5CA0A 1VG0B 2W70A 2COUA 2DPXA 3GJRA 1GFIA 3VJMA 5K8VA 2DTDA 4LYDA 4Q9DA 3ESAA 2D7DA 2X5OA 1T1IA 1K89A 2QTVA 1RZRA 2RGCA 1YF3A 3JR7A 4B3MB 4G0NA 4ON9A 3GMTA 5AICA 13PKA 2GJAA 5FYDA 1FYWA 2GJ4A 3ZV7A 5G3YA 1U2ZA 3C5VA 3LBYA 4FHEA 2F9LA 1ZGJA 4IIFA 2BH2A 3RVMA 4D02A 1TIPA 4YP9A 2K87A 221PA 1J1IA 3DFIA 3L0DA 4OHOA 1XRPA 4RXUA 4XYEA 1Y6GA 1TEHA 3S8EA 5LC1A 3GHHA 2BJHA 2R6ZA 4XD7A 1QYRA 1D07A 2IOQA 3IP7A 5KNBH 3QE9Y 4KFCA 3KQSA 1F60A 2L2QA 5FB3A 4C76A 4CEHA 3HK2A 1KEEB 5HZGA 1U0NA 4MHOA 2FJUA 2J32A 5EEHA 3JQCA 3PEFA 4URZR 3VSDA 4BO6A 4K1XA 3SF8B 1D6MA 3PG5A 3FCEA 4H15A 3DF7A 1TRHA 2ES4A 1USWA 4J9VA 5TPZD 4G1BA 1QBGA 1U04A 2OAQ1 4NATA 1HOXA 2H2HA 6GPBA 3AP3A 4P2BA 2CLIB 3FNHA 3UA3A 3U16A 2E4AA 4FLFA 2VTBB 2YICA 3GN2A 3WYAA 5B4VA 3KWMA 2YV1A 1RAHA 1Y6QA 4Q4CA 2G9VA 1PR1A 3GFTA 2QE7D 4OHPA 3WLLA 1Q91A 1M34A 1OI7A 4G0ZA 1YZGA 5C7YA 2RAVA 2ECKA 2ODEA 2A7QA 1U90A 2V8OA 3IR6A 5C8DA 3QEOA 3A2MA 3JZMA 4ARAA 4F45A 5B2EA 1AXGA 2RC6A 2IF0A 1ZGHA 1MA0A 1T9AA 2ZS7A 3F6YA 3HXLA 3IOEA 4MEBA 4Q4AB 4ERNA 3Q9NA 4GKAA 5FLYA 2ORIA 2QX9A 3KFXA 4NBRA 3INRA 2UYOA 2IPOA 1P4HA 4JY7A 3LX6A 3KEQA 3AETA 2ZJ3A 1KEEA 4LHWA 3FSGA 2VZEA 1GKKA 1A2QA 1QHNA 1RI2A 2XUJA 3SF8A 1O5OA 1A95A 3NC4A 3X3HA 4DA4A 3G9TA 4HUJA 4PN3A 4D79A 1IZ8A 1YFZA 4ALKA 4BX2A 3PGKA 4EWLA 3V7FA 2FNAA 1B42A 3BXXA 2GMWA 1QFZA 2GEJA 1YVDA 3FPHA 4WJKB 1P2VA 5C8YF 3FOEC 3MHTA 1OROA 4X20A 2K2WA 5LWQA 2Q6VA 1GO2A 2VSFA 3TOZA 1KZ9A 2QJWA 4MVJA 4E2FA 1WVMA 3ONFA 4F4HA 2WHQA 5KU1A 4TLEA 4FFLA 4IVRA 4CMAA 4TLAA 5HA5A 4ZCTA 3GX1A 4HLQB 3AIIA 2Y8EA 4QWWA 3WGLA 1SNYA 3ZDZB 4ZYWA 3WWYA 5CYGA 1MGOA 1GUBA 4KAFA 4DWOA 2AA3A 3JQEA 2H0RA 4I4TF 1H1TA 1I4TD 4Y2JA 1NAHA 1F48A 1UXJA 2BMWA 1XCMA 4QA9A 4UW9A 2JEYA 4Y2PA 3TZCA 1R9NA 3QWIA 4M60A 2P9ZA 3BGVA 2I9KA 4G23A 1PR5A 1AS0A 1AN0A 3OQNA 1NYLA 1L5WA 5DOVA 5CXUA 4IXDA 5CXQA 3WK5A 5LXTF 4EKIA 1JJBA 3TW8B 5I9NA 3UOWA 5G0SA 3RVQA 4U7GA 4TVBA 4N0PA 4ZCMA 3NBKA 1X2EA 2PJUA 1KETA 2JIQA 4TVKA 1KZ4A 2IYYA 5AH0A 3R74A 2IP1A 2R84A 4BGEA 2IDZA 5HIJA 3STHA 5EHXA 1YR9A 4I08A 3EA4A 1TD1A 4XUEA 2IS2A 4X41A 1CUWA 2VTKA 2P6MA 3LIIA 4BRSA 4KGVA 1GL3A 4LK2A 5HIMA 3UMBA 5JSYA 2FN7A 4F72A 4QREA 4YT8A 3KQTA 2PUCA 1BMFA 1XLWA 2GZHA 3GLGB 2BI7A 2VJBA 3GCZA 4GRAA 3QKRA 3QJGA 2I7DA 2M98A 2PGIA 1EBUA 1BFUA 4GMKA 2UUAB 2ATVA 2HNKA 3CR3C 2PZFA 3ABQB 3B6ZA 3BGDA 3G0CA 3ZIAD 4DLXA 3LY7A 2XGGA 5FI1B 4YJFB 3ROMA 1OBOA 4C29A 2X13A 1ZMXA 2H3EA 3FYTA 2X2FA 3RJ5A 2HLHA 4UCFA 1XQXA 1A7AA 4JOCA 4KQ9A 2V9ZA 4PF1A 3T3PB 5H0IA 3U6KA 5JZBA 1DHRA 1YQDA 3QVGB 4C30A 3U81A 2YNMD 4DQ0A 4P36A 1K8YB 1DQZA 3ZS9A 2BLLA 1ZDMA 4FMDF 3BJZA 1ZSNA 1C3XA 3LPCA 3B12A 1EQ2A 1FJHA 1NI4B 5EQDA 8AT1A 1TCCA 3QTLA 3R75A 2P78A 3GLGA 3K0EA 2BF7A 1G8GA 1ZOPA 3SLKA 4WERA 2XZDA 2A9KA 1SVKA 4WNAA 3WICA 3FVQA 3AWDA 4Z2YA 5HWSA 2VPZA 4RJJA 5E9AA 1QOPB 1BMQA 1YNSA 1P7WA 1Q57A 3CY6A 3U3MA 1LFAA 1QV9A 2HWXA 2WAYA 3IS3A 4JT8A 2QGZA 4ND2A 4YJFA 5TSDA 5B5SA 5DBGA 4LY0A 1S9HA 1GDTA 4AO6A 2EWVA 2XDAA 4DZRA 4RZHA 2G7ZA 3QVGA 1EM6A 2GK4A 3B9RA 3T3MB 5AVRA 4Y9RA 3BHMA 4R6WA 5DU2A 3E6AA 4QULA 5E9WA 1J6UA 1OHHA 1Y63A 4JI0B 4HAIA 2ZYUX 5A7HA 5IT0A 3ACCA 3DZBA 3M3HA 3HEBA 4N3AA 4K9NA 3RBVA 4KXQA 1NI4A 2G9QA 3ZIDA 2I55A 4Q18A 3TR5A 1FP7A 3J81k 5BN3B 1S2DA 2IZZA 2M32A 3A11A 1VLHA 3A1WA 4LG1A 1ECFA 3RUAA 4CCSA 5I8ZA 3L7MA 4LOKA 3TW4A 2VN8A 3ZLBA 1W19A 2O5VA 5I9SA 4AVYA 5JJLA 2GCPA 2GZ3A 3CXRA 4G63A 3V42A 2AD5A 1IN5A 1X7DA 4NE9A 2X42A 3SX0A 5GTDA 1EIWA 1CQPA 3GZJA 4N0MA 1KVQA 4CTOA 5FO0A 1FYXA 1CD5A 1X39A 3RYFB 2ZUBA 1N2IA 3OX4A 5ARDA 2H1RA 3V8PA 1YGPA 5LYJA 3ZWXA 1YAJA 1DT5A 4BN5A 1OZFA 3GLIB 4A15A 2R8OA 4UBNA 3KU4A 3NKFA 2XWPA 3N5KA 1FJ2A 3K1TA 4OH1A 1SHTX 4FFOA 4JX8A 4K9MA 4CGYA 4PZDA 1KS2A 1NU6A 2EHDA 3HNPA 4OO3A 1VIAA 2X8AA 2Q21A 3E8SA 5BN3A 4UDNA 2MSDB 2PBRA 1U8XX 3RKRA 4M1YA 1M6HA 1PJCA 3U49A 1PT8A 2R6AA 5IJ9A 2WWVD 3UCFA 4R84A 2X9GA 3DE3X 5KWEA 3K31A 3LY8A 3UPDA 2WWWA 2VWGA 4RZUA 4Z9YA 4YEDA 2EVWX 3A6ZA 3DMDA 3HB0A 5A71A 3SS9X 1D2HA 3DAPA 3FUXA 3QNMA 2G9ZA 4RDXA 2FEPA 3ZI0A 1PL8A 3RYFA 1XELA 1TTPB 3N0WA 1YJQA 2ISSD 3K5WA 1ZLXA 3KD2A 3FB1A 4EW3A 1VPWA 3JWGA 1MU0A 1YAHA 4P3PA 3Q8LA 3Q6NA 5FEMA 4XJTA 2LV8A 1P61B 2CYAA 2C4MA 2W6JD 1D03A 2AN9A 2VNAA 2ZJ8A 3Q0TA 3ZHVA 1HFJA 3NDJA 1UJ6A 8ATCA 1YTUA 1MT0A 4JBYA 3EXHB 5LR6A 3NFYA 2NTVA 1G291 1ZYUA 2CLOB 3MOGA 3PT9A 4ZODA 5BNFA 1XZNA 3HWX1 4WECA 2D00A 3RC1A 4Z4FA 1O97D 3W5SA 2GBCA 4UTPA 4IPTA 1IE3A 4HAUA 4IY1A 2BVNA 1E64A 3SIWA 1L5GB 3NT4A 4MV5A 4KTVE 3H83A 1MGPA 5AM2A 1W5SA 2X40A 2O8EA 1ZCFA 2R6JA 3BICA 4PGAA 3S5JA 4ALLA 4ENRA 4YAWA 3U1VA 2W2LA 4TS9A 3SQXA 1ZCBA 5EIWA 4I50A 4BQIA 1L5ZA 4FYMA 4MVJI 3GCWA 4Q3KA 1PQPA 4CFSA 4EUHA 3AFMA 1M1YE 1SHKA 5EKUA 1DZIA 2VF7A 2ZQ5A 3A3YA 4D3SA 1TW2A 4S35A 3F47A 4F8EA 3SSMA 2WQ6A 3EQ9A 3EXHA 2DFVA 1VXRA 1N2ZA 3PWZA 5E0OA 3N87A 4R2LA 1I01A 1KVTA 4ZANA 4UAVA 3PPIA 5ALNA 1LRLA 2QLLA 3VC7A 4F46A 2PSJA 1B1CA 1KJQA 3SZOA 4MIEA 3HYNA 3OH8A 1Q0HA 1ODFA 2A5YB 3H4VA 4XYLA 4PS0A 2PCLA 5MDHA 3IEPA 3QYJA 1G7SA 3HRKA 3LPAA 4Y2RA 4K6OA 4ARSA 2ODBA 4B80A 4CM5A 1FNBA 3DFKA 1ULBA 3I2FA 4JLPA 1Q83A 4P84A 3RFVA 1DPFA 1BJRE 1RAFA 4J0KA 4Q24A 1T0UA 3JY6A 1CRWG 5GONF 4K0KB 1E61A 3NBUA 3KUCA 3R4CA 4OQQA 1FW8A 1W36B 4NXNB 1JS1X 3G82C 3UWSA 2VSOA 2QPTA 3GFFA 4W1RA 4BNLA 1I6WA 5DYIA 5JSZB 1YRYE 3L0ZA 2I3BA 2JVIA 4UBMA 4RESA 4G2TA 3TX6A 1ZRNA 3GQBA 3VR5H 4QGAA 4AP6A 5A0FA 3WL8A 5EZQA 2W2NA 5K45A 2ZI5A 4UEOA 3OUTA 4OMFG 4B4OA 4Z0TA 4HS9A 1EWRA 2A1IA 1FMTA 1LBIA 2BT4A 2XMZA 5F7XA 1RWNA 1ULHA 1CZHA 2I2AA 4RSGA 3C3DA 1X8LA 3H97A 1JLLA 1K9SA 3DDOA 4L3VA 4M0DA 3RANA 5CCEA 5KYUB 3MJTA 4QUEA 3X1YA 2HLDA 2Q9AA 2R8RA 3NIDB 3PWTA 2D1TA 3ZOKA 4B2IA 1RRFA 1DBRA 1UF9A 3RSGA 3EF1A 5SYMA 2EOAA 4K3UA 1TMGE 2XGMA 3EUAA 4MW7A 5JSZA 2A84A 5ED0A 2CV0A 2GO1A 3DV0B 2P11A 3RC9A 3AUKA 1JJIA 2OHIA 2OVFA 3L8DA 4EVSA 1E9EA 3KZVA 3IV7A 3PC3A 4WFKA 1ECBA 3I34X 3NNSA 3NT5A 4CMEC 5FTJA 3BIOA 1O2DA 4MA5A 3VYSB 5KYYA 2DWCA 2WYIA 1UKAA 2ZUSA 5KYUA 3MUFA 4PG8A 3UK2A 1HNZB 2F1IA 4WK2B 4Z6KA 1F9AA 2H4YA 3GVHA 1UXHA 1J2EA 3AUYA 4KXMA 4Q5IA 2GD2A 1UJMA 2PMFA 3AI3A 1HFWA 4NL4H 4BEWA 1MO5A 4QUJA 4AKGA 2YJ4A 4PBRA 4GDMA 3FF4A 3OSUA 5IVIA 4XTRA 3MTEA 2DP4E 3NR2A 1F2TB 3B53X 3GROA 4UVGA 4U2FA 1V8PA 3V8NA 2X0IA 3DV0A 1NMEA 3I72A 3F5QA 4TT3A 1QGED 3GFSA 3K4QA 3L46A 2ZPAA 2REQA 3DE4X 4HFNA 2H5JA 4R9UC 2ZYGA 2Z2XA 1YRLA 1T5OA 4IXTA 3VR4H 3NJRA 1E96A 2Y0BA 3QP9A 4FSXA 4L8GA 4J7XA 4ZYYA 3PQDA 4IIUA 4WKBA 3HDJA 2QXTA 4DLVA 1YJAA 1ZL0A 1E2QA 4YUAA 2VDOB 3DBIA 4EQZA 4JXXA 3B1YA 3H2HA 1NX6A 2IH2A 5DYNA 4EHIA 4B82A 4KXFB 4NBVA 4D4IA 1W52X 2PGJA 1J9EA 3UGTA 5JNRA 4KX5A 2QTWB 1N9GB 1GLVA 1JAYA 1ZW1A 2AXEA 4GXQA 3BAFA 3PC6A 1GTL1 1XQ1A 3L1VA 2QAGB 4BJ6A 1W34A 1ZXLA 2BFDB 1RYYA 2NZJA 1GOTA 2ZSKA 3DEZA 6NULA 3QMMA 1XTPA 4BQEA 2XB6A 3GJ5A 4LAFA 1L3BA 3GUHA 4NU8X 3L1KA 1VRCA 4QUIA 5CURA 4HRAA 4F3KA 3KDAA 2CL7X 3DLTA 3EWIA 3NS7A 4MWZA 3C3JA 3Q9SA 1IOZA 2CXRA 2V9CA 3CU5A 4GD3Q 1WE2A 3TKYA 4ABTA 3K9WA 1GWNA 1OASA 4DR1B 1WMAA 4IM7A 3DMNA 4KWIA 1CZOA 1GD1O 2W6PA 1N6HA 1VIDA 1VYUA 2FZCA 3A3NA 3E5MA 4K8RB 4L8YA 4EARA 1WEHA 3F9CA 3CNOA 2DHCA 3FWYA 1H0KA 1YQTA 4P22A 5SY6A 3AFIA 3CTPA 4BN4A 4GC9A 2H0QA 4RLHA 3WV4A 5LIPA 2FXVA 5AHRA 1QE5A 1N9GA 3AFHA 4D9BA 4DLYA 2A3NA 3CR8A 4JIGA 2QAGA 4C07A 4N1AA 2BFDA 4ZWNA 4OK6A 5KO2A 1G6Q1 3WBBA 3SIXA 4D0GA 3GDOA 2Q1UA 1CEYA 3DUFA 5GJBA 3KKQA 4JBXA 3O5AA 4PZ0A 3UKJA 1ZN9A 2Z2ZA 4F3NA 4L07A 1C9NA 1H6CA 1N1GA 4UE2A 4G0OA 2GJKA 3IUYA 3VTAA 4JYCA 2F64A 3M9WA 4XLLA 3EIHA 2XTAA 3PZRA 4AUEA 1XZFA 1ZO8A 5NLLA 4BOYA 5B30A 7GPBA 4GZ3A 1D3AA 5LUBA 1W44A 2VJKA 1TPYA 2ZR8A 3AVWA 2FAXA 5CT9A 1Z17A 4BLPA 1D7AA 3ZHXA 3R9KA 1HT1E 1JQKA 1V35A 4OM7A 1GPNA 4NENB 4BVHA 3M89A 4L51A 1QFXA 4RK7A 4F5WA 4YXWD 7YASA 1CNMA 5ECDA 1KMHA 1U7ZA 2II6A 3LOQA 4PSKA 1U8UA 2HMAA 3E23A 1TEXA 5IVDA 4G4SP 3FH0A 2I1LA 3T3HA 3TZKA 2IPLA 3ZNPA 1KJIA 1I36A 1WW8A 5EAIA 3HJRA 4GYYA 2R7LA 5HS6A 2PZBA 3ZI7A 1NR7A 2XNKA 2XCUA 4J76A 3EJWA 5IBQA 4V0QA 3RYIB 3T7JA 1A2BA 1W4LA 2JAWA 1SD1A 3W6NA 2Y1OA 3M81A 4NK5A 1E58A 4BVKA 4HEA1 2GA9A 5BV7A 3TEFA 5FHQA 4BNFA 2B7LA 2HCJB 5DMXA 5ULLA 3L93A 3WRXA 1DJPA 2B4KA 2JGIA 3WY9A 4W4TA 3UWMA 2ZRNA 5FOXA 4NENA 5CIYA 3BHIA 1GGFA 3ZZTA 4L3WA 1F6BA 1HV8A 1M74A 5K3BA 3NP9A 4KPEC 3MCTA 2NGRA 4MPJA 2WA1A 2ZIEA 3EE6A 2GHTA 2WJWA 2RHCA 3HTXA 2G9NA 2IRWA 2NTEA 2NUAB 3VR3A 2XT9A 5JHGB 3NBXX 5TB5A 1GPDG 3S44A 4DDHA 1IONA 1RAGA 1A9XB 1D1QA 2E55A 2CKDA 2M6SA 1RYBA 3I9FA 5LA6B 1J5EB 3TRKA 2HMTA 3OLYA 4GOXA 1YBHA 4GI2A 1NBOA 5EQTA 3RYIA 3T5AA 3KELA 5BRJA 2OLEA 2Q8QA 2D4AA 2ORVA 3P2IA 3WDSA 1KMMA 2BP7B 9LDTA 3ZHSA 4HTFB 3IHWA 2EDCA 4PZUA 2Q4DA 3S8MA 1FRNA 4IJ5A 4XWOA 1PZNA 2HU7A 3H9BA 4O1MA 3BRCA 3OZCA 4WKOA 1V45E 1Q3HA 3AVOA 1JTEA 4BFLA 1IMOA 5KUTA 5LP6B 2HWKA 3K6KA 4LCEA 2YV5A 3DE0X 3WQQA 4QEZA 3W78A 4PYKA 1NXQA 4RC9A 1CCWA 1XD8A 4TL7A 1UZAA 2IYLD 4NS1A 1S7GA 3OX1A 3VISA 1X9GA 3U4DA 4Y2SA 5IFKA 2C88A 4MINA 5LA6A 1J49A 3GLHB 4L8FA 4TS4A 4GZ5A 3RRJA 2ZXEA 2VA9A 5JASA 3HFRA 4CFZA 3N74A 3C41J 4HWGA 4TLBA 1GQSA 3FUCA 3U13A 1L7PA 2QG4A 1PS0A 4KAJA 4GU5A 3WGHA 2FSVA 2A1UB 4W5HA 1D8AA 2C4TA 3EW7A 3O38A 4WLFA 3Q1KA 5CH3A 2GWRA 2CJXA 3E18A 2W83A 1HKUA 4CKWA 1SCJA 1LPMA 4QRDA 5F7JA 1CDEA 4LWQA 1QIGA 3IQIX 1EFCA 4L4SA 3ZUGA 1A4UA 1VJGA 2B4QA 5A9SB 3E9EA 3UO8B 3GCXA 4IXNA 5TE9A 2PANA 1E3EA 4XVCA 5KQSA 1GNVA 2YVKA 3NPAA 5JARA 4Z3DA 1IQRA 4DR4B 3RVSA 1IULA 2RGAA 2PRIA 3DNMA 4LX0A 1NSFA 1QANA 1TYCA 4OLAA 3IMGA 5AJWA 3VA7A 4OH7A 1UFRA 1SBNE 5KIAA 1HSZA 3G9ZA 3TWOA 1G8MA 4X63A 2AE2A 1PE0A 2F2TA 4FOTA 2IP4A 3IIEA 3DXXA 4TKUB 1YS7A 4XDHA 2OT3B 5HGXA 1SUFA 2AJCA 4R69A 2XUFA 1CBUA 1UXIA 2HF8A 4H6PA 4XGIA 1E5VA 1OTHA 2POQX 4BC0A 2UUCB 4PG7A 1HQYE 1YL7A 1Z6QA 1WXEA 2EGHA 2O2EA 2WIDA 3KSRA 3TZ6A 2JJMA 5CFRA 1MIOA 1PBTA 2FSHA 2BGUA 3NHPA 3O26A 2PPLA 3UGQA 5FUXA 4HXYA 3Q11A 3UH1A 4O4JA 4ZARA 4A5OA 2VHTA 3R23A 1B16A 2HNAA 4RABA 4UATA 5CVCA 5JMOA 2OHOA 5K6RA 5A9SA 4BNKA 3C97A 4MQ6A 2ZBRA 1BU8A 5JXIA 4PRLA 3MERA 2DT8A 3HI6A 1WU7A 3RYHB 2G5CA 2Z0MA 3PUXA 4JYBA 4K5QA 4YRSA 1G21E 4JCCA 4A8JC 4UMEA 4QNMA 5BMVF 1Q16A 1PLKA 4A7PA 5KS2A 1JA0A 4LRXA 4TKUA 5J63A 2VDLB 1J8VA 2XADA 4FX2A 4YCCA 2QZSA 3OU7A 2O7QA 2XMCA 3TTTA 2ZAGA 4RZ2A 3NIWA 1QE0A 1M2KA 2F1KA 2MIIA 4MI6A 4REOA 4BFZA 1Z6PA 3BMQA 4YI3A 2P69A 4B7ZA 2QD1A 3D8UA 3A1VA 2J9XB 10MHA 2ZJYA 1HDEA 1LVUA 2HO4A 4P35A 5FX2A 2AK3A 1O9BA 5FOUA 5H4HA 3PNLA 1QDUA 2WZDA 3CIOA 5ECWA 4XFKA 2WLTA 5AVYA 1T9ZA 3RBZA 1SU8A 2WG2A 3CA8A 3RYHA 3FCYA 4BO0A 1P4GA 1DEAA 3MD9A 4OOEA 4DWJA 5HUJA 1D2AA 2PBFA 4ALNA 2JF0A 3BSSA 3LPNA 4BZQA 4F3TA 4E5KA 3PZBA 4BC1A 1UOOA 3WBKA 4WNIA 1L1QA 2G6BA 2PLNA 5I5GA 5HF9A 5AESA 5AW4A 3PNKA 1QONA 3DAYA 2J0UB 2YHAA 1A82A 3T9AA 1R37A 2Z6VA 1PVDA 4JBGA 1ISHA 3B5IA 4CTKA 1TQ8A 1JHDA 1J25A 2ID9A 1JHPA 4E6PA 4LISA 3TPCA 4MLPA 4XSGA 1R0KA 2AFHB 5FR1A 5C32A 1GA1A 4W9NC 2CMDA 1EJ6A 2MYPA 2GAAA 2XYGA 4P4NA 5H82A 4ZO9A 4BO8A 1UWKA 1D2RA 1TUEA 2ONYA 1B3BA 1F06A 3PFFA 1S4MA 4NVRA 1Z7BA 3G85A 3IO3A 1Y98A 2OCKA 1J0AA 3K53A 1TM2A 4FKBA 2FZ4A 2DR3A 4QPNA 1SXJD 3ZNOA 5U4QA 5KPDA 5B37A 4EDFA 3TGLA 3H5RA 2EFJA 3OPVA 4TRNA 4FMBB 3TDNA 4FE4A 1A5ZA 4ESEA 1SXPA 3RK0A 1EYZA 1VJ0A 3I05A 4GX5A 1X94A 2J0UA 3BCHA 5K3EA 1C3LA 4FINA 4AJHA 1OKKD 3PV0A 2AR0A 1OW3B 2W42A 1EDBA 1LKZA 1BS9A 3F78A 4FNGA 4ZCLA 1M0EA 1HNWB 4UU8A 2I4MA 1NQOA 4QATA 2IW3A 3KOUA 3WYGA 2C7OA 2P4UA 3GT0A 4CF3A 1GYPA 5SICE 1U28A 3RUIA 4AJNA 2ZW9A 2R62A 1WW3A 2AB0A 3BKWA 4FSHA 4HVAA 2WWRA 1XJ5A 1TF5A 2CBZA 3QUSA 1K66A 1YB5A 1WDLA 5IVHA 2AG8A 2XNHA 4FGUA 3LMKA 4QHSA 1QKJA 1Q0QA 3B9PA 1TYBE 4J2TA 3KV1A 4DV3B 4Y2QA 3NMUF 3WTBA 1I1NA 1MEOA 1O5TA 2Y9MB 1NBIA 3MBKA 5DDIP 2FX2A 2WSLA 5ADVA 3WK6A 1IEWA 3ROEA 4CPDA 4B7AA 2HQRA 4IGIA 1S01A 4ZGGA 1AMOA 4OQNA 3TBHA 3MXOA 1EBBA 4OKIA 4BIIA 4ARCA 3MTIA 4DBLC 2GBFA 2O2GA 3KSMA 4A82A 5FUMA 3F5DA 1B3RA 2HHHB 2FLWA 1KHHA 1RIFA 4FFNA 4L95C 1U65A 1EFRA 2GVNA 1F51E 5JLAA 3V2IA 2IDMA 3QSYA 1L4LA 2W90A 2P91A 2QIPA 5DWQA 4BXOB 2A5GA 4ZA2A 4F97A 2HKIA 2FRDA 4K9LA 1KJYA 1U0JA 5B6JA 3ZS8A 5KHAA 1GUAA 3K94A 1DIHA 1XWFA 3U7QB 1G8FA 4BYGA 4Q3LA 3E03A 4B3JA 1XUOA 5A6VA 3O9MA 3NPMA 4G8JA 1XZKA 2BMDA 1DUSA 3V55A 1ND5A 1WOYA 1VE5A 3HPQA 5LJLA 3IEMA 3H42B 4Y0VA 1SIBE 1SR8A 2Y1GA 5HQJA 4BPRA 1QORA 4EY6A 2QUZA 2C2ZA 1OQAA 3ZV6A 2ISCA 3L8EA 4IS3A 5L45A 1KTVA 4B76A 4MI1A 3CYFA 1ZC4A 1UBOS 3IKJA 4FIZA 4O08A 3QNWA 4DSUA 5HQTA 1GZUA 1AV7A 1TCBA 1XTQA 1LV8A 1ZK3A 2QNIA 4E94A 3H11B 4C0QC 4GR4A 2PUFA 4BXOA 4AROA 5DWVA 4BWFB 2OECA 2D1FA 3MJ4A 1SEPA 3FDXA 1MHPA 1S1MA 4RZSA 1H6AA 1NN5A 2V6MA 4IR7A 3U7QA 1K1EA 3GNSA 1H3NA 3QI2A 4BV8A 3GP5A 4GKJB 1TW3A 3SFVA 4KQFA 1DV2A 2QROA 2VCHA 1VL0A 3PICA 1LVGA 3A7DA 2IL1A 1FNNA 4A03A 4B3IA 1MQ9A 2FEMA 2MT9A 3WB9A 4WVFA 3PIRA 3K2BA 9ABPA 1L7XA 1Q84A 1YI0A 3JYOA 3NTXA 2X19A 1AUXA 3H1AA 3A9UA 3FCCA 2HHLA 4JJFA 4P08A 1VJRA 3ZKAA 2V98A 4EHFA 4RNCA 1FLDA 2ONZA 1JT9A 2WSIA 3QE0A 4QL3A 3DWGA 4URHA 2IU3A 5ES3A 3PK0A 2JEZA 2R8PA 4GLJA 3B52X 4MUBA 1C8KA 3DDUA 1U0FA 3VO8A 1G1MA 3CLRC 5D3KA 1Z4QA 3R3YA 5HFJA 4ARVA 4J0JA 4DCVA 4EM6A 1L8OA 3OO0A 3WWPA 4KR2A 1PK8A 2R65A 1U2GC 3G2IA 3OE4A 4YAUA 3VNVA 2E21A 3N0VA 3T7AA 2W2TA 1AA9A 1WULS 1P80A 2P35A 1RHJA 4M8LA 3ZLVA 1Z73A 2GT1A 4HZIA 1N2HA 4K81B 4Y1RB 4Q1VA 2FW6A 2W5UA 3OTHA 4GAEA 4HQLA 3ZH9B 3VKUA 4DC1A 1D1TA 4WESB 3UMCA 1T3TA 4GZ6A 1L4BA 5EOVA 3SG0A 2QRPA 2FPGB 4BB5A 2HFJA 3I6YA 4JYZA 1P2FA 1YOBA 2WU4A 4YGXB 5HCIA 1ZHFA 4JEUA 1ST2A 4FOSA 3K9LA 4WCDA 3RAEC 1Q12A 1MEEA 4NKRA 2ZJAA 2JJ1D 2IZ5A 3MJCA 3OOHA 1LJLA 3SYRA 4GPAA 3TH5A 3UJ3X 4L4XA 4O2AF 4TTQA 1FUUA 3T7TA 2OBLA 3T3IA 4TYYA