1JT9A

Structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
266
structure length
247
Chain Sequence
b'MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine-6-Phosphate deaminase
publication title On the role of the conformational flexibility of the active-site lid on the allosteric kinetics of glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 247
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jt9A00
4X84A 1M0SA 2OKGA 1FRZA 4L4ZA 1LK7A 1FS6A 4TM7A 3EFBA 1FSFA 3EB9A 1FQOA 2J0EA 2WU1A 3BXGA 1O8BA 3KV1A 4L51A 3CSSA 3ENVA 3ICOA 1XTZA 1KS2A 2BKXA 1LKZA 3L7OA 3UW1A 4TM8A 3E15A 3HN6A 2GNPA 1PBTA 4L5JA 3NWPA 3BXEA 1UJ5A 3ENWA 3BXHA 3LHIA 4GMKA 2RI0A 4L4YA 5HJ5A 1Y89A 4GO1A 3LWDA 2R5FA 3HHEA 4L5IA 4NMLA 1CD5A 4L50A 3KWMA 1UJ4A 3NZEA 1VL1A 4OQQA 3E7FA 3TX2A 1LK5A 1DEAA 3U7JA 3BXFA 1NE7A 2F8MA 3OC6A 4R7TA 2RI1A 1FS5A 4OQPA 1UJ6A 3CH7A 3ENQA 4IO1A 4M8LA 1HOTA 2BKVA 1HORA 1JT9A 2W48A 3IXQA 4R9NA 2O0MA
chains in the Genus database with same CATH superfamily
1X92A 1D5CA 2E4WA 3KKLA 4GOXA 4MYCA 4Q48A 5DTQA 3RQIA 3ZI7A 2ZDGA 5GAJA 1TT5A 3P52A 4MMZB 5JMTA 2P7IA 3AP3A 3DKVA 2GHIA 4A91A 1Y81A 4RXTA 5ESRA 4FR0A 5GV8A 1TU0A 1G8KA 1QH1B 1YB5A 4CZ2A 4WDQA 1UFOA 4CL3A 4C3OB 1Q84A 4QNRA 3RQSA 4MKRA 1ENZA 3TUJC 4EUHA 2P5YA 1J56A 1N2CE 3IAAA 1Z0IA 3CZRA 5FBHA 3VH4A 5D1HA 2J4DA 4LCBA 1EBUA 2OG2A 1V43A 4ALLA 4F71A 4KQ2A 3P7MA 1C4KA 4M0LA 2XB9A 3W1VA 5AM3A 2Q7OE 5SY9A 3ABRB 1FYWA 1Y1KE 1CW2B 5I8PA 2YN2A 3GVXA 3FPBA 4IW3B 4TMYA 5FUBA 1KNXA 3I5UA 3N2NA 4WBNA 2DR3A 3A37A 2H1IA 1JV2B 3ZU2A 1XTRA 1W36D 4U7GA 4FJ2A 5JZBA 5LN1A 4DA7A 3O8BA 1IIRA 3AIIA 4TUYB 2YWCA 4BYGA 3G1UA 1AKEA 5HE8A 1UBGA 4LQLA 2GS9A 1K08A 4ROSA 1HRDA 4MZXA 4TQAA 5JVDB 4ZI5A 1U7WA 1Z6TA 4BIIA 4FFOA 1UMDA 4XTCS 2A9QA 1JSXA 4X24A 1P19A 4YQEA 2PUAA 2Z6UA 1SOMA 1CZHA 3BD6A 2WJZB 3NDJA 2V6FA 3F6PA 3I2HA 2ZULA 5DEOA 1VZ3A 1IY0A 3EOBI 4RIFA 6LDHA 5F2NA 4PCVA 2C2HA 4Q02A 3KP1A 4B75A 3IPAA 1W6RA 2GBLA 1OV6A 2OYSA 2YFQA 4EITA 4DQVA 2AWNA 2BCJQ 3KZVA 1FSPA 2QGFA 1N2CA 4BRZA 1XRQA 2JS7A 5NULA 1BTOA 2VUTA 3EYWA 3UT0A 2DKFA 2VR1A 2CV0A 1QOZA 5DM70 1WMSA 3KWFA 3NMUF 2QRUA 1JWBB 1O4WA 1P9OA 1DIGA 1X7XA 3AR8A 4GEGA 4G5SA 5ALXA 3I5XA 1BHO1 2VTKA 2YMQA 3MLEA 4JDPA 2H9AA 2QM7A 1FFAA 1ODLA 1ZH0A 1K3TA 2GZAA 2VJLA 3JAWA 1E8DA 3B9BA 4FMDF 1OB5A 3TLYA 2BTOA 3VOAA 1UP4A 3Q6NA 1EE9A 2MR5A 5BYJA 1X1SA 1Z74A 1Z5GA 2OAGA 3DEYX 1UMBB 4IJVA 4RESA 5IJ0B 4CKWA 5BMVA 3RIHA 3H5NA 1DAIA 1QBKC 2QD3A 3H87A 1F2UB 1Y4UA 2Y1OA 5KVCA 4BNMA 2OLJA 2J48A 2BKLA 1Z88A 2QG4A 3DCNA 4PLGA 1QF9A 4B4DA 1QCCA 1I9CA 2ABWA 3FCAA 1T0IA 4YNBA 2ZI9A 3MVEA 1SUIA 4B80A 4H08A 1DXQA 1ZU5A 2C2KA 2F3PA 3EXIB 4WD3A 5CHYA 5D51S 1N1MA 5B53A 2RH4A 1II8A 1NBAA 3COWA 3QGMA 4FX2A 1LTKA 5F7JA 1FY2A 4RJJA 1E2QA 2AL7A 4MQ5A 2G71A 2IHYA 1HPLA 3ET5A 3U3JA 3BIXA 3WLKX 1Z4QA 4LYFA 4MV3A 3U4IA 4FC6A 1C1XA 4IBOA 1QPGA 3K0FA 3O4IA 2QPOA 3BN3A 4RHFA 5K1ZA 4Q7KA 1KEPA 1KO1A 2IT1A 2NTEA 3PC8C 1Z18A 2XMSA 4BEWA 4ERNA 5AVQA 1SHZA 3VU3A 3RYCB 4KRGA 3DNFA 4GBJA 1UUFA 2EBFX 9ATCA 2FOXA 3N2YA 2VJMB 4KX3A 4A8TA 3QEAZ 1F48A 3F5DA 3CF4G 3AQIA 3JASA 4BPBA 3FHLA 1O95A 2OFXA 4NJMA 5T6MA 2XNDD 3X43A 5GVSA 1U0LA 1XG5A 2OB2A 4NICA 5HG0A 4C4ZA 2AUMA 1YOBA 3KG2A 4FBGA 1WHTA 4TRJA 3U49A 4OKSA 3T1HB 2YHUA 1LRKA 1ES9A 3DDWA 4H6PA 4IS2A 4CLHA 4DCNA 1A1VA 3WQRA 2R62A 1AUVA 2IUUA 4Q7EA 4C2BA 1SA0B 3PLRA 4Q39A 3J81A 1TA0A 5HZGA 4D0SA 2RGYA 2FFAA 1ZMBA 2ZUUA 2GUWA 4B3BA 3H9BA 1Y0BA 4OOFA 3TW6A 2FG6C 2JFUA 4PYNA 3A9RA 1UJCA 3M5PA 3BK7A 2PGLA 2OGTA 3QLEA 5G0VA 3VRHA 3OZSA 3ZIAD 4DY4A 3R5JA 3ZHBA 3A04A 2PX8A 3AHCA 4BGIA 4NECA 5CEFA 1MNAA 4QXQA 4XQ0A 4IX9A 5T64A 5CFZA 4DMMA 5JRZA 2F1RA 1RJEA 1E6KA 3FBTA 1JZSA 3RUPA 3KBBA 5CFOA 1R9GA 4KQKA 2O8BA 1MAUA 4JI3B 5BUQA 1SCBA 5CA1B 3BA1A 4JC8A 1GPDG 1E77A 1NULA 4N3NA 3R40A 5HNKA 3BSFA 3NYRA 2G9NA 4FCCA 2KMLA 4Y9TA 1GUAA 1IATA 3HDYA 2WF9A 1MIOB 4M0FA 4BV8A 4E33A 5BXYA 3CZMA 1U0JA 2MHCA 5FV7A 4C07A 2CBZA 3FYUC 2OV1A 1AF4A 5EMKA 3CNQS 4L5AA 2R66A 2NPOA 5D7BA 4N18A 5EE1A 1ZSVA 1DV1A 1NQ5A 3VR5D 1XB2A 2YHAA 2I2CA 5DSZA 3JATA 1UM8A 2O19A 2E21A 3O8OA 3SHFA 4LRUA 4LTNA 4RK1A 4GZMA 3RIMA 4A82A 4BIMA 1U63A 1N6NA 1KZ4A 3GJYA 4EG1A 4ONEA 1G4AE 4F72A 3ND8A 3WB0A 2JVJA 5THQA 2VK2A 1MH1A 2O05A 4XFJA 5AW0A 2VT7A 4IR7A 2RGNA 2QJTA 3QMPA 3ABSB 1CWUA 2DU8A 5TT1A 4AWAA 4EX7A 4MEJA 4UEWA 4K9MA 1BWRA 2QG6A 1ID8A 2JA1A 4LDQA 5IM5A 1VPLA 4K88A 5JQGF 1NF3A 1P1KA 4M0EA 3T54A 4D96A 2OG1A 2RI6A 3MINA 4J2HA 1IZYA 5THKA 3SE0A 4IG4A 4EW2A 4IJKA 3VNSA 1VECA 2BGMA 4WESB 4R8RA 4H7FA 4ZCMA 3N75A 3IKTA 4GIBA 1ZD2P 4Z51A 1EJ0A 4TV8F 4XWOA 5DFAA 4OJKA 1G20B 2CDRA 2RONA 2VUHB 4UXJA 5BY2A 1G9SA 4AY3A 5FXMA 5J23A 3WNZA 3BJMA 4OIMA 1WXGA 2GCOB 4JJZA 4QEKA 3W78A 4E5SA 3CGGA 4P38A 4YCDA 1R9JA 1NGSA 3HACA 5EJ7A 1D2GA 5INTA 3CW9A 5F9HA 3GAFA 2AJLI 4OKNA 1XRLA 4MHOA 4I1PA 1RRGA 1KE2A 4DLUA 4PYQA 2WHXA 3VI3B 1IQ0A 1ZMOA 4AWBA 1HM5A 1WMBA 3LBHA 5B58C 1WWKA 2CLLB 5IUNC 1TK3A 3GCWA 3ZCPA 3DAGA 1MO3A 3BGWA 3GEHA 3H3FA 4U3JA 4F6CA 1Y5IA 3AJRA 4B3DA 5IKXA 1G0OA 1BQ4A 2X1LA 3GIWA 2H1CA 4MMXB 4ZQIA 3TTWA 2XTAA 3AOGA 4UUQA 3X2SA 1OHHA 4Y3UA 4JP8A 2BONA 1V3QE 1E5TA 3MJVA 3RWOA 3UPDA 2LD4A 2X9QA 1JXQA 1LW7A 4HYYA 3ZY3A 2XKBA 1KMHA 5T6BA 3UMMA 1J9ZA 2C9ZA 4NMHA 2HNAA 3ROZA 1YZLA 3EPPA 3T3HA 3VYWA 3FGPA 2YYYA 2R7AA 3NDIA 4NV0A 1CIVA 2BKXA 3TRIA 4NZMA 2EJVA 1JEOA 1NOIA 1R5OA 3TEJA 2QT9A 3RYFA 2V7WA 3NCTA 1IQRA 3UAGA 4MH0R 2YS7A 2VNAA 5F5LA 4JYPA 4L8FA 1J2JA 1NVTA 1CT9A 1YZFA 4HH4A 2EARA 4DV4B 3IEXA 3S6JA 2M6LA 2QF7A 4E5PA 4ZU1X 4IJ6A 3RG8A 4ER7A 3Q8XB 4NMWA 2O4CA 5G4KB 3C43A 1Y6QA 5U4QA 3TVDA 3OMXA 2FWIA 2WVHA 1T4GA 4JEUA 4HATA 1B41A 4ZVNA 5BRJA 3CJRA 1ZC4A 5SY6A 6REQA 3PPVA 4KOEC 4RK5A 2LVBA 1G291 5JAOA 4X85A 1S9HA 3DG9A 4J9VA 1FMJA 2PZJA 5LR6A 4DEVA 1ZMXA 1OLXB 4WACA 5JI2E 4HDNA 2YJGA 3MTJA 1T4BA 3QBTA 4UNQA 3UMVA 4D8WA 4FQ5A 3AU8A 5EKUA 4QT0A 5T8KC 2R4UA 2LDXA 1F5SA 1IIBA 2UZ1A 3GCXA 2QL5A 3KDAA 3QWIA 4MNTA 1R4MB 1SXJB 4ZCLA 3WO1A 3ZPXA 3ROKA 4YR7A 2JGDA 3QRWA 4LKOA 1IY1A 2GYWA 2O7VA 2V0CA 3FOAA 4EMBA 1S1CA 4GOMD 1N9GB 3DMDA 3RS9A 6GPBA 3DGEC 3ZJUA 1ZIYA 3OZEA 1JLLB 2ZPTX 2VJYA 4CCSA 5HWSA 2PX2A 2VLIA 5EE3A 4OFWA 3LH5A 1EB8A 1JI3A 4G0XA 2A0XA 4HDMB 5F5XA 2NUTB 1YULA 3REQA 3ZS8A 2J3MA 4CQNA 4KMRA 1UZAA 1WLYA 1RLUA 2FUKA 2ZYDA 3L7KA 4LZAA 2UVDA 3EW9A 4PQGA 2W11A 4GXRA 4RPKA 3I6MA 2IUFA 4P82A 5JD6A 1XZPA 3K6SB 5KSOA 1KARA 4DXDA 3U2QA 4EA7A 4EELA 1ZRSA 2AN5A 2VHUA 3WL4A 1E9BA 4AP6A 3N58A 3QVXA 3GYBA 3MCTA 4R9RA 3RHZA 1GL9B 1SWWA 1FDRA 1FPMA 3PKJA 5AW5A 4JGGA 4BVKA 2JKYA 3GLHB 3GFQA 3X2FA 4BNDA 3UWSA 3ZCRA 2EJBA 1YJXA 1FYEA 2XUZA 4U2BA 1NV9A 1PP4A 2AB0A 1UKVY 2H48A 4OFXA 2DFLA 3GRPA 4WXMA 4XD7D 3KVVA 4DGQA 4RA9A 3HKBA 4NAVA 5G41A 3U7GA 2Q1XA 2V97A 4UU7A 4ZO8A 2NSLA 4L9WA 1FQOA 2XMBA 2X5OA 2PNFA 1SQ5A 2QLJA 1BFDA 3ZVLA 2AKYA 3FMFA 1CQZA 5ECDA 4NNOA 2J3QA 4R9VA 3L6DA 4EF4A 3CLRD 3HJFA 5EP1A 5FNVB 1TFRA 2J3IA 2JB9A 3N8DA 4FE3A 4GNRA 1NJ2A 4M9RA 1VP9A 5F9MA 1XMXA 1D8AA 2YQ5A 3HEAA 5LUBA 4MJ7A 3WB2A 4JI4B 2FWJA 2ZUEA 1NQUA 3VDMA 4ZHQB 3E0QA 1ZW1A 5GM2A 3T5GA 4C03A 4EHAA 1Q1NA 5F3WB 1J99A 2PH3A 1BMFD 2PZLA 4X1OA 2XZLA 3MMZA 3AGQA 5EUMA 2Y1XA 4G63A 3D4PA 4DJJA 3H86A 3IP9A 2HSJA 4WASA 1GLGA 3S27A 2QTWB 1QR2A 3S55A 3S8EA 1XVLA 2UYYA 3T9DA 1I1HA 3DEZA 1TMYA 2DPLA 2K2QB 3SJBA 1D3AA 1Q22A 2BISA 1NSFA 3IUYA 5JO9A 3UCEA 4BMVA 4HNUA 2XCTB 2ZAOA 2ZCUA 5I7UA 2QAGC 3VZRA 1OOEA 5IWAB 4LXUA 1L4GA 1QUEA 2IXAA 3RKUA 1O5OA 5HF5A 2YWJA 1V6AA 3VM6A 2ZJBA 1FE8A 2GJ8A 4BO9A 3E35A 5JMPA 4M8KA 1Y3AA 1Y63A 4B79A 2ZIUB 3NHPA 4PGFA 1AQUA 1LWNA 3EQ9A 4ZPXA 3BA6A 3WYBA 4TZ6A 1W88A 3TZCA 3HR4A 4BNJA 2VCYA 5K6RA 3P9XA 2RE8A 2ZVPX 1OR8A 4ZVMA 5L6LB 3OTQA 2GVDC 1KAGA 4L50A 3PS9A 5A03A 2D0PB 3SHWA 2HMVA 3GRUA 4L72A 1TO1E 1LDBA 3QP9A 1GFWA 4YRPA 4G56A 4BMPB 1MQAA 4C04A 3MFYA 4HDKA 2RKOA 1Z36A 2Y9MB 4L8VA 4LQDA 4X41A 5LU9A 5TQJA 2C2MA 2F4VB 3IDOA 1CRPA 4MV0A 3ZHYA 4OF4A 2BR5A 3JQDA 5LYJF 2VVTA 1EQAA 2YHIB 3FPGA 4M88A 4D6YA 1DTSA 2H52A 1H6DA 3KEGA 4KSCA 5JIBA 1HZZA 4GX1A 5KUTA 3K9NA 2Y0DA 2ZVQX 5SY4A 3V32A 1KR2A 1UC5B 3BFJA 1QLWA 1NMQA 4DCMA 1JKXA 5HQTA 3U44B 2WIFA 3MWFA 3NWOA 3WNCA 4N5DA 4DMLA 2VHTA 1IYZA 1FFEA 5CVJA 1O94A 2WU8A 3AESA 3OC0A 3M1AA 3USCS 1L7MA 3WIVA 5KOJA 1G59A 3FAZA 4EG4A 4Z3KA 3IBYA 2UVPA 4RZQA 1E92A 3U17A 1DJPA 4KQHA 1BE0A 3IA2A 4Y2PA 1RKXA 3EZ9A 2GZHA 3PFHA 6NULA 5EJIA 1RSZA 1RT9A 4XD2A 5I7AA 2VJKA 5KPDA 2IEAA 2JJ1A 4LVUA 1A2QA 2H1FA 2JFPA 2WJGA 2XOEA 2ZS9A 4A73A 1FVFA 2NO6A 4GVPA 1A95A 3D81A 4XAQA 4X7MA 1LJUA 1XUOA 1Q11A 2X4LA 3FW1A 4RW0A 2O54A 3FCEA 4BJ6A 5C7LO 3HL4A 4KXXA 1VG8A 5E95A 5TS2A 4AO6A 4EMTA 5JC1A 1QP7A 1YACA 1KI4A 1UBMS 5DNEA 1JFTA 3ODPA 3FDIA 5BYAA 2JAUA 3L82B 4HEA6 3FJYA 1DX9A 3RS7A 2JVIA 1HSZA 4QELA 1H3NA 2PMWB 2WFLB 3DFKA 3DTYA 3SYLA 1S2DA 1W87A 3BM5A 3U48A 3O4HA 4EPVA 2ZT6A 2ZYAA 3MJEA 3CO0S 2CLOB 3GA7A 3FYDA 3SX4A 3M5WA 1FFDA 3NO4A 3OCCA 2CEKA 2R6HA 1SB9A 1U6KA 2BPOA 3Q7IA 4NMXB 4AJPA 5B12A 2ZUBA 2XPCA 3GBPA 5JJ5A 1QFMA 3AI1A 3DO6A 5FUXA 1KEKA 3DULA 2B8JA 2QP9X 1BQEA 5FYDA 4GC9A 3OOHA 4PCLA 1HR0B 2XTNA 4MGHA 2A9JA 1FW6A 4ARBA 1TVKB 4A16A 1B8OA 2WVJA 4IILA 1Y6JA 3ED5A 4TKVB 4AYWA 4BNYA 4KITB 1SUSA 2OP0A 1MD9A 1E1RA 4PSCA 3IXMA 3KFLA 4OUDB 1KQOA 4H1HA 4OCZA 2IRWA 2V6IA 2YNMA 4RABA 1H9CA 4IRMA 3ZQUA 1ZGCA 3B1KA 3T7SA 4MS3A 1TZCA 4MKXA 3PZRA 2YXDA 3CRNA 1LZLA 3F74A 3OM8A 4G4SP 5IEBA 4GX5A 1TTHA 1C30A 3PI7A 2X5KO 4LMPA 3GEGA 5DYNA 3AF3A 3V42A 2JJ2A 2MYPA 3QV2A 4B2LA 1ZGBA 4A4DA 3CUWA 5TE9A 4AY4A 1U7HA 4O5OA 3I0NA 2BGGA 3TZHA 5GGYA 2P75A 1KERA 3HXOA 1FFXA 1MC8A 2OXEA 4JEMA 3LT4A 3PUZA 4XZ3A 4JBHA 5CD1A 1TQ4A 1S3FA 1SAYA 1JPNA 4GXNA 1W6UA 1X77A 3QU9A 4FZJA 1XMOB 2V45A 1JSZA 2YQZA 5IDXA 4U2GA 4HGOA 2PSSA 1FA9A 3Q2KA 4Y2TA 4FDUA 4KKVA 1P2DA 1R0LA 2G0NA 5IAOA 4R8LA 1F0PA 3G82C 3BIWA 1C1DB 3T7CA 5K05A 5KEIA 1L8QA 4KU4A 5EEHA 5F1KA 4BVGA 4A92A 3OVMA 3FPAA 4UBIA 4R1NA 4AZ0B 5BT8A 4UCWA 1URPA 4ZVVA 4P0TA 1JRLA 3U40A 1BKDR 5AW1A 3RVKA 1GSOA 4C06A 1UBCA 5I3ZA 4CI0B 1L6RA 4TSRA 3PWTA 1QAQA 4C6SA 3MIIA 4FN4A 5ERGB 3VAYA 3BDIA 4RXMA 1L7PA 3GRCA 3JQ6A 1D0VA 3V3KA 2ZPAA 1T43A 1R7RA 5HQ3A 4NCBA 4YASA 1T1GA 4ND8B 1W29A 3T5CA 1EVYA 2RAVA 2SICE 3E7WA 4QXMA 4V0OA 4X1YA 3GOHA 4ZV4A 1XP5A 3MWEA 4I8XA 4UNNA 4PE5B 3ZNQA 3OOEA 1JQLB 5KOIA 3WWOA 1XNJA 2WQZA 2XQVA 3ZG6A 3TZBA 3OEYA 4Y2HA 2JAWA 4JJ6A 4ZD6A 4JI7B 4DCTA 3COPA 3RTGA 3CKYA 3KWLA 1W59A 4Q4JA 2JIZD 3HBNA 2GHQA 3GEDA 1H9AA 2C3UA 2W6PA 2WOOA 3SQOA 3CA8A 4MO9A 2O2XA 5IXYA 2CLIB 4QULA 2PT5A 1YTUA 2D6FA 4QBGB 1BDIA 1JKIA 2VL7A 3VR4H 3BRQA 4YWHA 2XDAA 3ICWA 1GCGA 4D3SA 2ANBA 2WSSD 2O7NA 5A3RA 2XZPA 1NONA 5I7HA 3TKLA 1QV7A 2BKEA 3L92A 3HCDA 1FLAA 2CFIA 4FT2A 3C3CA 5AVJA 4ZVOA 4DVJA 4PZYA 1TNDA 2Q8NA 3P2KA 4HLUC 2PE5A 5KWVA 2HMYB 3NVAA 3TAHA 2QZPA 1JI0A 3R3HA 2O8FB 3BXGA 2FAXA 2O20A 3C3DA 2H2WA 3EGDB 3F71A 1AO0A 3ASVA 4JVOA 4UEOA 5G1OA 2QD1A 3PHJA 4IVQA 3OBIA 3WA6A 4I5DA 4R4JA 1CEEA 1GZDA 1BMQA 2VAMA 4XVQA 2HPVA 521PA 3WNVA 1M6VA 4O4HA 4QHTA 1TYCA 2J6IA 3C4VA 3EIFA 4ZV7A 3VR2D 3IP6A 3K4HA 5LLSA 3RSCA 4MWZA 1F14A 1G6HA 2AD1A 1B73A 3KL4A 1UWCA 3KYDA 3OZDA 4MRSA 1RRMA 2JANA 4FC7A 3GLUA 1UMCB 3VPDA 1SZCA 4M37A 3SBOA 5FPKA 4X60A 5IXSA 3HM9A 5JD3A 4GKVA 4YACA 2GBIA 3O8LA 4AXXA 4U7WA 5EQDA 1OBVA 2BSAA 2C9DA 3QU5A 4QU5A 2FKAA 3AUJB 1HTTA 4WECA 3I12A 3DCIA 3KJGA 3H84A 4Q7JB 3BHMA 2X3YA 1T10A 1ZM4A 1VI2A 5DV9A 2P30A 1TZ2A 4F2PA 1U4OA 3PF8A 1CS0A 4QBTA 4FB4A 1T35A 1G21E 4AU1A 2WPNA 5BR1A 1NTOA 2HA0A 3ZGNA 2IHJA 1YJAA 1KDOA 2IBSA 4OSPA 2ZXFA 1DPFA 3CV3A 3OZIA 1AVTA 1JDJA 2E49A 2H31A 3QEKA 4X7RA 5DWDA 4YV2A 4E12A 4XWWA 1EUQA 4KNYA 4JBWA 1S2GA 2BRUC 3OFNA 2XNCA 1EMDA 2BGTA 2HY7A 4JAVC 4J94A 4B48A 2G76A 3LDFA 3QEJA 3S70A 5JAHA 4FYMA 2Q7DA 4R3UC 3L04A 5EQTA 2PXCA 3DEJA 3B3JA 4RJ2A 4ECEA 2Q3LA 5AJVB 4EJSB 1I2CA 3CH4B 4RQAA 4RLHA 4ENPA 4GKAA 3LPDA 5DTJA 4X94A 2NYAA 2W9XA 2WJYA 1QHIA 3BXFA 3MXOA 4WK0B 5A6SA 1MOQA 3NW9A 1I10A 2P78A 2GD6A 3QM1A 2CF5A 2QXTA 2HLHA 4U9HS 1NLZA 3ZGLA 5K3AA 3ADCA 4NK4A 4AG5A 2GPTA 1P2BA 3AVPA 3IDQA 4RZSA 1DEKA 1GNVA 3EUWA 4G97A 5KB3A 2C7BA 2VZ9A 2CEAA 2FR1A 4RHXA 2IPAB 3SZGA 4TXNA 4EG8A 1BX0A 2O3JA 3QVMA 4MIEA 1ULBA 2AW5A 1XQ9A 4AUEA 3RFFA 5ES3A 4DSUA 1MXHA 2BEVA 4R0VA 1B6TA 4Q1FA 1G21A 1ORIA 3G2NA 5E3HA 4OQLA 5KNCH 1XCGB 5FTLA 1RZRD 3LDHA 4IFIA 1S5PA 3C3XA 2W98A 2XUKA 3HKCB 1FDTA 2N75A 3LBNA 3Q0EA 1Z2DA 2VYVA 4GRDA 4KDFA 4R0NA 4YAUA 2XCRB 3CUKA 3PXXA 1E4EA 2C2GA 1FC0A 1HDCA 3KALA 1T8UA 2IU4A 2JJYA 3TOVA 3E4CA 1R50A 4NENB 3HP4A 2WA2A 2AA3A 4Q9DA 1GNPA 5DE3A 3VC1A 4M9SA 4ZVPA 4NDNE 5DWQA 3MSCA 3IOMA 3ERCA 1GG5A 2AUTA 1XALA 2IU3A 1P9NA 3DUFA 3HNOA 3L4BC 4FNAA 4OP3A 4Z9XA 1U3TA 2YZNA 3DEHA 1DT3A 1G7CA 4HQ6A 2BM9A 4ETIA 1DKRA 3CRW1 3UMBA 1CUIA 3MOSA 1PO7A 5D1NA 5AM0A 4CF3A 3PX2A 1NJ6A 3SYKA 5EKSA 2J0QA 2GAFA 1IWOA 5ED4A 4HCJA 3FTQA 4ENUA 2A9VA 3CZCA 4CQMD 3KV1A 1Q0RA 1LGYA 3ANXA 3H5VA 3KV3O 4J90A 3I30X 3GVIA 2R11A 4OYRA 4R9UC 2DKNA 2QQ5A 3H42B 4B3SB 4G5HA 3B3FA 3EWIA 5F1OA 3ZUGA 1AV7A 1ZJ5A 3PTZA 5AHWA 5CFQA 3IB6A 1A9RA 4MK4A 1AOXA 1QR6A 1Y4SA 3F6BX 2E1RA 4QYTA 4R1TA 2XTMA 1OROA 3GT4A 1Q0QA 5FI1B 1RI2A 2HU7A 2MJLA 1X15A 3AERB 3OLVA 3TO5A 1E6EA 4DDVA 1JLMA 5C8YF 1UQTA 5KCZA 2BFAA 5F76A 3FLMA 2CXXA 4RIHA 4WOCA 4NCAA 5K6AC 1VPEA 2YV2A 4PQYA 2O48X 3FLEA 4IDCA 3FUUA 3IVMA 3EMKA 2FETA 1JEDA 1QOPB 3GO4A 1CRWG 3AONB 3A7EA 3QPBA 4KLNA 3OM9A 4MV5A 4QHYA 1T9GR 2HH9A 3OHPA 2ZRJA 5E38A 4OQMA 4DA8A 2JIOA 4P6VF 3RSOA 3VZPA 2EYQA 2YVUA 3PR3A 1ODKA 2I67A 1ZOPA 1IPEA 4F85A 3OM0A 1F38A 2OP1A 3R3ZA 3NIBA 5IJXA 3PRKE 3DTNA 1CB0A 2ATVA 1Z26A 5EKXA 4ZT5A 4FKZA 2ORYA 3SFVA 2I9PA 4ZGWA 4K87A 2HWKA 1RPJA 3LHKA 2WQ7A 4Q3BA 3LUDA 1I1QB 4ESEA 1GQYA 2PEYA 2HXGA 3F6RA 4LWOA 8AT1A 4URFA 1H93A 3RUAA 5B30A 3VJRA 1I1NA 2QRGA 4PN3A 5KYYA 5LNK6 4H3VA 3LO8A 2Q0SA 4M54A 4TS4A 4MRMA 4UBOA 2FSFA 3ZW7A 2O6HA 2C3PA 1C7FA 1YGPA 4A8HA 4QAQA 1M7HA 4EI8A 1Z0UA 1V41E 3A9TA 4O2LA 1EK6A 3EDQA 4UARA 5ALQA 3RSQA 3EGCA 2PU7A 3ZHQA 6CHYA 3G5LA 1XKLA 3RK0A 2VYFA 3GPBA 4QTZA 2GD0A 4Y7CA 3OLWA 2EL7A 3I1YA 3RCBA 1J90A 4XX0A 2Z09A 1MT3A 1T91A 3AL2A 4OB6A 4KI0A 2V5VA 1R6BX 1SRRA 1ORVA 2H9YA 1OLSB 4WW0A 3OQNA 4NX2A 4JKYA 4E5MA 2D59A 4TMTA 1M1NA 4LGMA 4DW8A 3PQ4A 4ODIA 4BB5A 1RXVA 2VTDA 4Z9YA 2BMFA 3SC2B 2FMTA 5A0VA 1NJ5A 2VUUA 2J9FA 1YBVA 2IYEA 1VA4A 4WBXC 1FS6A 1XC7A 3WLEA 5FQNA 4ZVLA 5D7NA 3AK4A 2F1OA 4M7RA 4MQ4A 5U1PA 4LAFA 2B1JA 1U8ZA 4OJYA 4ZARA 1CRQA 2MIIA 4ACBA 4CKEB 1PG0A 2JCXA 5KKNB 2V0GA 4X8MA 4ASUD 1US8B 4XLZA 1P81A 4I55F 1BA3A 2COUA 4A0RA 1MABB 1PR9A 2AMJA 4NFSA 1P2SA 1X0XA 4DWJA 2V58A 3QFCA 5EN4A 2NU9B 3P9PA 2ZSKA 1DE0A 1IN6A 1TUBA 3R3SA 2PYIA 3OTIA 4FGSA 4KDCA 1EXVA 1L4UA 4NNPA 1Z34A 5AKHA 3RVQA 1MC1A 3AMVA 4OYHA 4YJHB 3M3HA 3AF1A 2ZBDA 3EAQA 5KTYA 1VPDA 4AUNA 4HNRA 2BBOA 3NEJA 3KLOA 1P7PA 2XWQA 5E3IA 2FZCA 4RV4A 1Y8AA 3WZLA 3HU5A 1CBUA 1OFVA 3LUFA 1T4CA 3TL2A 4TMKA 3DXYA 3LXXA 4O2BA 4X0EA 5CK4A 3FG9A 4HNAB 1QK5A 3PXEA 4ZT2A 1Q50A 2RBEA 4JQOA 1NF2A 1CNEA 1DC6A 3G2IA 4LV8B 5BPFA 1E3LA 1VP3A 3B70A 1B42A 4M1YA 1G5IA 3REGA 1M2HA 1QMPA 2ZI3A 1Y9ZA 3H3XA 1CE8A 3ECCA 3K0BA 4YCCA 4YUAA 1GUZA 2HA3A 1XPUA 1FIUA 3PQCA 4Z8XA 3MHTA 2IQIA 2ODBA 3H5AA 2VKQA 1XTVA 4M0KA 4M4SA 4QOIA 2G72A 2MSLA 3TFQA 1Q44A 4ZVSA 5LQUA 3STHA 1K0UA 4YMIA 4K6MA 2EATA 4YGXB 5BRAA 2RAUA 1E99A 3PEFA 3E9QA 1I01A 2Q8PA 3LW7A 3CN9A 4L9AA 4H4DA 4Y6OA 7YASA 1QK4A 3TLEA 4TWZA 5KNBH 1CDDA 4PGAA 3GJ7A 5TXGA 1UDCA 4N03A 4QOGA 3WG9A 3WRXC 1E1YA 1NXQA 4MCHA 2HLPA 5CTJA 2BFPA 2AYXA 2PHZA 3R6LA 3P0FA 3QYJA 1HEIA 1SCDA 2VWGA 2XUFA 2VUSA 4GH5A 3FUCA 3WR5A 2QRLA 3H6HA 3L4SO 1MO2A 4UEQA 2HFJA 4PX5A 4PONA 5CM8B 3TQCA 2XECA 3UHFA 3CNNA 3GPIA 2JFYA 2ZVJA 4A0GA 3V4ZA 5IHXA 2DBQA 1W49A 4WKCA 2ZWIA 4NBLA 3WQSB 1P45A 1IXKA 2VYQA 2L42A 3U9LA 3THYA 1Q7EA 5SZIA 3D8BA 2IHKA 2DPYA 5DLQC 2BN4A 1JLRA 4RJIA 3FZYA 4TMZA 3OQ1A 2BLLA 4HQLA 1N8SA 3HDJA 1VJ1A 4IO1A 4TVKA 2JGIA 5ALKA 4G0YA 2GETA 1Z63A 2IXBA 5FOTA 5DIZA 4RY0A 2HSGA 1C0KA 4F3YA 1Q6YA 2QRVB 3H8SA 4TLEA 5FO1A 3G6WA 3VSAA 4F3KA 5KQSA 5AXAA 3QXHA 5DASA 5HKLA 4BFYA 5K8TA 1LLQA 1A77A 3WDKA 4OJMX 2Z56A 3EBPA 3GDHA 3KKNA 4R41A 1DAMA 5CPFA 1XTJA 1B15A 4MI9A 4QDXA 4ZANA 3I8XA 1M6HA 4B73A 3K70C 4HADA 4KWHA 2H1WA 2PG3A 4ZU6X 1L8XA 1H2WA 4IZIA 3QTBA 4OQYA 3AEKB 1XJ5A 4HWPA 3T1YB 1LPBB 1SCNE 4UE6A 4OXNA 5HF9A 3T4UA 1GZ4A 3LP5A 1PDWA 5IBCA 1BSVA 4S1TA 1WUHS 4AJEA 2YH2A 3T1OA 1Y8RA 3QEMB 4RJTA 3THWA 5IVKA 2C95A 3WGKA 1Y3DE 4KAXA 2OV8A 4EHIA 1FL9A 4W1PA 1BJTA 3DDSA 3NRBA 4RMNA 3ZJYA 8ATCA 5KKAA 5M2QA 2V9CA 2IYWA 1QIEA 4EABA 2E4AA 5J2UB 4PGMA 1C3OA 4IIJA 5KS2A 3SJUA 2H5LA 5JXIA 3KZCA 1YWGO 3JYQA 2CLSA 1U0FA 3H6KA 3LDUA 3MIZA 5TF0A 1RWOA 2HT6A 3NTQA 3WNQA 3Q8MA 1H4SA 1QCZA 3O75A 5KSYA 4X1KB 1OBCA 3UQZA 1QKKA 3ST7A 1T8YA 3K8OE 1TI7A 3M3DA 3QKSA 4E15A 4WA8A 5FL7A 2ZBRA 5ITWA 4OY3A 1DBIA 5EY5B 1LKZA 2W0SA 3K32A 4LJRA 3HXTA 4MV7A 4BMCA 1RI5A 2A59A 1JHXA 3R7SA 4RUKA 2QTGA 3OCYA 1GAQA 2NT4A 1TTPB 1FNSA 4ZN6A 2OVBA 2AIRA 2JGMA 4L07A 4EX6A 2ECQA 4KHZA 1Y8CA 4LDPA 3OICA 1NU6A 1N0UA 2WJ3A 1MC4A 1VLLA 1GXSA 2V7UA 4M6WB 4GDMA 4M46A 5F4BA 1SKMA 3O90A 1P1RA 3UJBA 1KU6A 1J0DA 3F7NA 1J97A 1P44A 1A82A 1OY1A 3K96A 3I61A 3OOWA 1DOAA 2CSUA 4KP7A 3OT1B 4FE4A 4OBWA 5EHIA 5LYYA 2WU4A 4Y0AA 3W2GA 5BYKA 2PAAA 3ZQKA 5DDIP 1QRRA 1KBZA 5CX1B 4CM3A 1NMYA 4I19A 1N3YA 3R6GA 4NR0A 3IX7A 3UJ6A 3N2GB 1A9ZA 1YI0A 1KAEA 4YI5A 2A9FA 4JV5B 3MTGA 4ZYTA 3BCSA 4MW5A 2JK1A 1TJYA 2IKSA 4V0RA 2YJTD 1JEQA 3LVQE 5B3JC 4ENTA 2G7MC 2VH1A 4DPMA 3F6CA 1EAYA 1FP4B 2IHTA 3ZWWA 1V8BA 1O95D 5HTOA 2X14A 1R8QA 1LY1A 3CZQA 1R2QA 1CF4A 1YIDA 4NV3A 3G6KA 2B35A 4IM7A 4U2EA 3H8VA 3GRAA 1Z0DA 5KJ6A 1MRSA 5LMZA 1GHTA 1SUDA 3IUJA 4CKBB 1MPXA 3IT2A 3ZE8A 3A3PA 4MUIA 4P3PA 3PQDA 3ORRA 3IT1A 1EWKA 4Q4HA 3TKYA 1GKKA 2KLBA 4N01A 1IEVA 3T7TA 2EJUA 3GPCA 4RVUA 1ZN7A 4TTSA 2HZ7A 2W8BA 4QGHA 4QYWA 4IGKA 4ARZA 1DFGA 2NTYC 1MH9A 2Q29A 2SHKA 1DGQA 1TYBE 4W8OA 5E4YA 2YUTA 3DDNA 4KR0A 1DAHA 5EZ6B 3SLKA 4B74A 3K9BA 4DSTA 2FN4A 3V2GA 5LZ8A 5K03A 5C8ZA 3PEEA 3DC7A 2W48A 3DDCA 4M1EA 5J5VA 4CR8A 4IX1A 3ZE9A 5K3EA 4JUAA 1BRMA 1H4VB 2WIBA 3H4VA 4D80A 2QZSA 3U26A 2OMEA 4AW9A 4F12A 2O5RA 5IPFA 4B44A 4PFKA 4MDEA 1J06A 5CFNA 4CQLB 4BEJA 5A04A 5EXSA 2ZRMA 1YFKA 4RPCA 3UJ7A 4K6CA 3ESAA 1QOQB 3STUA 4NDZA 3QVUA 2J6BA 3FROA 3K6RA 3CWQA 2PX4A 1N5OX 1Q0UA 1XVVA 1O0BA 1P29A 1Z12A 2EQ5A 2X6QA 3K3PA 1U11A 3ZEAA 4KNVA 5KMGA 3FOEC 1G2PA 1RM0A 1MB4A 4HGQA 3OUUA 3PL1A 5J2TA 1BXGB 1S6YA 2WTNA 3BIOA 1KYXA 1WPGA 4NU5A 1ZCFA 4DZZA 1ZUD1 3A3KA 4FEAA 2OXCA 5DM4A 1HYQA 3DQQA 1YONA 3IVGA 2PLRA 4JWKA 4B3IA 3AZPA 1XEAA 1P77A 4DCOA 3CLRC 1X7HA 2ZIGA 4F4UA 1JEAA 3K73O 4E31A 4JX8A 3DMRA 2DLNA 2DQ4A 2ZE8A 2R7LA 2DUJA 1H0HA 1WQ4A 1M2VB 3TG2A 2G17A 3QLJA 3UN1A 2YJ6A 3CYFA 4XCXA 2FEKA 4F2GA 5AM4A 1TD9A 2WHYA 4W5HA 1ZD8A 1AGNA 3WIDA 4EKGA 1OXBB 2P6OA 2BFMA 3WIOA 2CLKB 3EUFA 4US2R 1W9HA 3PE4A 1E3EA 1LPMA 2V7EA 4RIIA 4XIIA 4MVXA 4XWAA 5GV7A 5A1JA 3K1ZA 3QBVA 1YS9A 2B99A 3EEQA 2VNJA 3RU7A 3NAMA 5JSZB 2MSDB 3D6NB 4MQFA 4KRFA 4C21A 2Q50A 2OCYC 2ZB8A 5IM4A 2IGTA 4PAGA 2VBIA 3MRVA 3V4OA 1Y4DE 3KT0A 1ESZA 4DYHA 1ST3A 3MMSA 1P1IA 2X86A 5BNTA 6ADHA 4PLWA 3KS9A 4HAOA 4CDMA 4OHPA 4D42A 4RZXA 1IM5A 2H18A 4BO8A 4CTKA 4TWJA 2MR6A 1B93A 3MSXA 4ALKA 2CLCX 4WKGA 1KU0A 5CLJA 3HUEA 1P7ZA 5EYPB 5JLJA 4NMLA 4DLLA 4CKZA 4V1CB 4IIGA 2NZVG 1YAHA 4H1TA 5DNUA 1U8AA 1K2WA 2G8NA 1OFUX 3NC1C 3PVZA 3K9LA 3H1PA 1E0DA 4WCFC 5FWXB 5HM6A 5KU7A 1SIUA 1C3XA 2E89A 4IJ5A 2QXYA 2R8YA 4DQKA 2FWNA 5C1OA 2I8CA 2Z1MA 4FJ1A 4HI0E 4QUJA 1Z6AA 4S1OA 4YT2A 3C1AA 3OEEA 3B6IA 3F78A 5BSFA 3F73A 5KO2A 4GMHA 4B8ZA 1SG0A 4XOIA 2H1RA 2VF2A 3ABOB 2IIBA 1JPJA 3RAEC 3PWSA 3G9XA 5AW6A 5AVTA 1FLVA 3EFHA 3HN7A 2ECKA 4C7KA 4GR9A 4HVTA 4J6FA 2WWRA 4HXYA 4LZOA 1YT5A 5DCWA 4DA4A 1HT0A 1L7XA 1AQYA 1PGPA 4LCEA 1OHHD 2H2HA 2NUBA 4X00A 4D56A 1E18A 2WSIA 5EUBA 3RRJA 4B34A 4BNGA 3BD7A 4DZRA 4M9CA 4ZI7F 1GITA 2EFDB 1FSZA 1MEEA 5F35A 4E5NA 1DMSA 2V6BA 1PWZA 4U7TB 3HEMA 2VRCA 1C0PA 1OV4A 3FPFA 3KE9A 4R1SA 3M9XA 4TLMB 3RKRA 1GDHA 4DR3B 1XMIA 3VC2A 2J6HA 1E32A 3QJYA 4D3YA 1A3CA 3QY9A 4LA4A 3EUAA 4YAOA 2WVGA 2QNRA 4G5OA 2R25B 1GDTA 1GTJ1 2X7XA 4K9QA 1QHYA 3VYVA 2UXDB 1OAOC 1YB4A 4YUXA 1EDDA 3GEMA 3WHIA 3TNLA 3IUEA 4MV4A 3NV7A 3GRKA 1FMLA 3NAQA 4U6QA 2XVAA 3SOPA 3H0CA 1UJBA 4JFRA 3QE3A 4MO2A 2HMWA 1CZNA 2A6PA 2C7GA 4A8JC 4Z7OB 3NVDA 4ZXPA 3QMVA 1T1RA 1OXKB 2ZRDA 3JYOA 3ZHZA 4OLAA 4PRKA 5E8RA 5GJWC 4TZ0A 4MYUA 4C5BA 4D26A 3N2IA 2ICAA 2Q5LA 2W2KA 2P67A 3NIDB 4B32A 3M6AA 4HR7A 2CL6X 1P75A 2X6RA 5J4YA 3OURA 3FGOA 1QH1A 3OTHA 4HPJB 4DR5B 3ZD7A 1XFDA 4M1WA 1E63A 4IKEA 2HCBA 1AS0A 3MWKA 3TLCA 1UR5A 2VTEA 1DKOA 1MGPA 3D7RA 3OJCA 4JLDA 2OYRA 4RCZA 3WQBA 4LDZA 4A10A 2GXAA 1UL1X 3H1TA 4ISCA 1RVDA 1UADA 5EJAA 2N0SA 2H1LA 4TLBA 3PGA1 4MPTA 3ZX5A 1POWA 1CQIB 2CVPA 5A2GA 5DIFA 3NH6A 1JN0A 4DA0A 4UW9A 3LUGA 3F8WA 4TM8A 3SN6A 3ZCSA 3IKJA 2ZR7A 3WZMA 4B7CA 2KQUA 1JAHA 1A4RA 3GWZA 3WLIA 4YA6A 1GYPA 4HZGA 2XE8A 2OHVA 4K03A 3SF8A 4L5JA 4DABA 1AKWA 3DP9A 3F47A 3MM4A 4I50F 2AOTA 2VAVA 1RCTE 5FT9A 4YT4A 3IBFA 3QUQA 5C18A 2G4VA 2OBYA 4ZOEA 2GZ3A 1A5SB 1KSGA 4L15A 4EAAA 1N5IA 3NT4A 4EUFA 5BV1A 3GLFB 4GO1A 4Q9LA 1L8AA 1D0IA 2Q27A 2B2NA 2V6JA 1AKYA 1C8KA 4ZREA 5C7OO 4EW3A 3EVGA 3WMFA 1MN6A 1Q1BA 1NN5A 3Q5EA 1QDLB 3N87A 1ZW6A 4R31A 5EJFA 1YCHA 1W4CA 2YJ5A 3QUCA 2V4ZA 2QTMA 4FT4A 3M49A 1NW4A 4XUDA 4XTRA 1D03A 4YJ3F 3K0SA 5DW0A 3L5KA 3TF5A 3OZRA 1WZ2A 3SS7X 2GN9A 4EENA 1WCWA 2EKQA 4LISA 4PX9A 4RFLA 4M0MA 1AZWA 3T7AA 5EJ8A 3OP1A 4QUAA 3LQRA 2ACKA 2I4NA 1S7GA 3AJ8A 4IOLA 1XCMA 3I3SR 4MV9A 4WXYB 5H68A 2NGRA 3T35A 4L5CA 4C4SA 1FTGA 5L7TA 4X66B 1TE2A 5BSWA 3EDRA 1MT0A 1MMFB 1KI2A 1SCKA 1V2GA 1Z5VA 2KWIA 3EE6A 5DHFA 1IZ0A 2YUIA 5KC9A 1TEVA 1RXIA 2AGVA 1DWUA 2OM2A 2ATCA 4BNNA 2CMHA 1KQNA 3BHJA 5LQNA 3BD9A 3K9HA 4OBBA 3FNGA 3YASA 2WZCA 2QN8A 5C8XA 2PQ0A 4FILA 1UMBA 3NHYA 4RF5A 3SK0A 2YYAA 3GJ3A 3Q5DA 5IJ0A 1BEUB 4MEAA 2C2XA 3V33A 1JHQA 1TQDA 3GFGA 2W43A 1GCUA 1F17A 5EVJA 3LX6A 2ZI6A 2Q62A 4ML3A 4ABTA 2XRZA 5AWFC 2SKCA 1OGIA 2R47A 4ZCRA 3I92A 1T0BA 1G3UA 2OAQ1 2Z9DA 1X8LA 3H16A 3AKZA 4H35A 3R9WA 2VK1A 3S2IA 1ICEA 2W5UA 3NX4A 4KR2A 4TRRA 4BNTA 5IF9A 3OSUA 2JLRA 3FOWA 5K3FA 4N6NA 1SB8A 4LGYA 3UJHA 3EG5A 3TE6A 4YV7A 1X1TA 4P4SB 5B4TA 5SYNA 4IDDA 2H7YA 3JZDA 4ESOA 3RYCA 1X9GA 1UBKS 4P5PA 2HGZA 1FSGA 4EMUA 4K9DA 4KIGA 2IHBA 3BB3A 1IQPA 3CW8X 2EFGA 3EXHA 3PUIA 1K5PA 1YJBA 2G6TA 2H54A 2QIOA 4PLFA 3WK7A 5I7VA 1SEPA 1IBSA 5B3LA 1BYIA 2X1VA 3IRVA 4NU8X 4D1YA 2DTEA 2CNNA 3A1TA 3I0ZA 5ALIA 1DIHA 2WYVA 3HCOA 1GNQA 2RBGA 5JNWA 2Y1EA 1SQ6A 1E2MA 2P3SA 3P2JA 5BV7A 5E9QA 3TCNA 1OW3B 1U8CB 2YOGA 4N40A 3EMBA 4G9EA 5JZVA 1C9YA 1G3MA 2QTTA 3FVVA 1DEHA 4O4LF 4MXDA 3UMRA 2GZDA 3ELBA 4DMGA 4D8UA 2NSJA 4ZZ2A 1AKQA 2G4LA 2Q5HA 3ILSA 1M1UA 3GU3A 2DBRA 1WUYA 5EHGA 1GKUB 3HVKA 2DGDA 3RREA 1E5VA 1Q7RA 4EEXA 1GZHB 2OCDA 4HRXA 4A8PA 4E22A 2KB0A 4KFTA 3I04M 4WZBB 4ZQBA 4BATA 4BN5A 5BR4A 4O1MA 1O7JA 4JU9A 2BL4A 4IUCS 1GADO 5FPSA 5GQSA 1O94D 4QL3A 4AO7A 4UHFA 4X6UA 1HYGA 5J43A 3FNQA 3MT9A 1XCPA 1PGNA 2BMJA 2CCKA 1Q7BA 1MIOA 4MP3A 2P2YA 2X15A 4GR5A 2WJ6A 2Z3WA 1B23P 4YPFA 3E9NA 3NBUA 2JJ1D 2Y27A 1G20E 4PICA 5TQ2A 2JFXA 5IZCC 3HDTA 1SOWA 3U9TA 1U0EA 4BE4A 2RJ3A 3L8GA 1LK5A 1Y37A 5H0IA 3RTCA 3TEMA 4ARUA 1T9ZA 4RZ3A 1XD8A 1VL0A 3OFVA 4KE9A 5D86A 2ZRCA 2J87A 3UB4A 3M2PA 5I9TA 2WJPA 1WL8A 2WB2A 4QO7A 3M81A 1E7MA 1FDOA 3K2EA 4IMJB 1E58A 3JWJA 1T5IA 3T95A 3AVVA 3RUCA 1U2PA 1DIRA 2WF5A 3OA0A 1CQXA 3RS8A 2NG1A 3RSLA 4B31A 5L3QA 3G2KA 2VP2A 5JUWA 1NVKA 3FNHA 2ZRHA 2WF6A 4K0RA 4YRFA 3AF4A 4BUCA 1EUYA 4DV6B 4K81B 3HXQA 1DDOA 5BUCA 4LDJA 4HQOA 3DYVA 3HPRA 1K5HA 2EGUA 1IG3A 3QOFA 4L6IA 2K7FA 1SELA 3O4FA 4JP3A 3TL6A 3ACDA 1M5RA 3DOEA 2I80A 2REXB 2O14A 4A6PA 2M32A 2OO3A 3ONEA 1G17A 3FETA 1E2IA 3WTBA 3CLTC 4S1PA 1R12A 2I54A 3L7NA 1SULA 4UM9B 2ZZNA 1YQEA 3L05A 5FKJA 3V4VB 5J4HA 3ROTA 2WM9B 2W93A 1PFUA 3U62A 1BHSA 1G20A 4MPRA 1E1RD 1RI4A 4UE2A 2CC2A 2W6IA 5H82A 3AEUA 1GTZA 4C3UA 5ITSA 2ODPA 2YNMD 4RVDA 2GCOA 3OAAD 4OK6A 4K26A 1YQWA 2FFHA 4GECA 1AKRA 2CDCA 2WTBA 2ZRQA 1GGKA 1SBZA 1XK6A 1FU7A 3F6EX 3K4PA 3P71T 4KPGA 5C31A 2MSKA 2JJ2D 1CTQA 3IHTA 4QC2A 3UJ3X 4CJXA 4DT1A 4XSHA 2QTRA 5E6UB 1S3GA 4UNSA 2VNKA 4G1EB 2IUTA 2KJQA 1K27A 3AOEC 3OCZA 1SKYE 3TL3A 4A3SA 2X4DA 2ZRGA 3D7NA 4CT0A 5AVVA 5DXJA 5LCXA 1NMZA 2XNSA 1Y8ZA 2L2QA 2OHXA 2QLTA 4MS1B 2MWMA 2NSYA 3QSYA 3B1JA 2OL4A 1ESCA 1ZOIA 4I14A 4DUYB 3AC0A 1HDRA 3EHDA 2CVQA 1MRNA 3Q2IA 5L3RA 1ZS9A 2YRXA 2FX2A 3JRNA 5JAQA 1XVIA 5CRIA 5LZ7A 3LT5A 3ZWCA 3I6ZA 3V1MA 2OKCA 2AF4C 1CERA 1LJ8A 4G5GA 4YJKA 4C0QC 1GQRA 4WK6A 4HXFB 4UHEA 1JIIA 1OVMA 1CQJB 3MQ2A 3D8UA 4L6CA 4R8KA 2GN6A 4K1XA 1I3MA 2OBXA 4PVCA 4F6RB 1K6XA 1IN5A 4M9QA 2R8RA 4MWSA 2I03A 4BGVA 2D06A 3DT9A 3GLVA 1GU7A 2MMGA 3JQPA 4DCSA 4CTMA 5LP6A 1FNCA 1SXJE 4I6EA 1NQAO 2GEDA 3ZKAA 3T1VA 1LVGA 2ZGVA 3MCVA 3MAJA 3NHJA 1RCFA 4WJKB 3ROPA 2AX3A 2UYGA 1RHMA 1EDBA 1NM5A 1WZNA 4NEGA 4QXOA 4PZLA 4GPTA 1W85A 1LNZA 3KXIA 3RVOA 1UJ2A 2XW6A 1WO8A 1VHQA 2OCBA 3N28A 3UAWA 5GVRA 1JYEA 3AY7A 1Q0TA 3M70A 1ECGA 2BMWA 2O8NA 2ZTVA 4RHTA 5G4KA 1S2MA 5BR8B 4KIWA 3TUIC 4LOAA 2R751 1QQTA 3D4IA 3GUYA 1J21A 5IAEA 2GD1O 1NR1A 1DRVA 5AIBA 1U2TA 2WAMA 1JFFB 1UWVA 2WTXA 3DAFA 3QMWA 2VXYA 5FBKA 5FPYA 4B7UA 2FK7A 3SIWA 4G37A 2HPZA 3ETJA 5CIWA 5COBA 5ELLA 4D57A 2OD9A 1I3CA 4OI1A 3RODA 3RYIA 5J4KA 4UUAA 4E3ZA 3SDZA 2XR1A 3URMA 1MCZA 3UO8B 2ZWOA 4DAOA 3RU3A 4FEGA 2OCIA 3NHKA 4UU8A 1JQDA 1CQWA 1PZMA 3CZ4A 2C00A 3HBAA 3L0DA 3SZRA 1Z8HA 3R77A 4LHXA 4M99A 1C0EA 4O4JB 3T9BA 1JE1A 3RJ9A 3AT1A 2HO5A 3L7CA 1SXJA 4XYEA 1V16B 3BSWA 1CYEA 4Y1FA 3WLNA 2ZK7A 1M1YB 1EG7A 1EWTA 4L2IB 3E03A 4Z0TA 1JJVA 1W0JA 2IYPA 3ENQA 4IXMA 2NADA 3SY8A 2PJRA 3F5SA 5JZMA 3O92A 2FDXA 2YXNA 3ANNA 4KG7A 1HX7A 1QZXA 3P8ZA 4N54A 4FHZA 2FW6A 2WZBA 1MBZA 1COWA 1BCSA 1H2XA 4OLJA 2EZ8A 2HK8A 2PRZA 2ZITA 2JI9A 2IYAA 3W0LB 4XYGA 1N3BA 3H9GA 2OKGA 5B1IA 1XCOA 2CXPA 2ILVA 4EWLA 5LZ9A 4H0NA 5BWCA 5HK8A 3I01A 4O4IB 5CTAA 3CO5A 3EZLA 3QKTA 2X5JO 3ENZA 4HZIA 4KOAA 4LVOA 4NLLA 5ALUA 4CV0A 4QGBA 1SUBA 1HDYA 1U8EA 5BN1A 3PU6A 2LIVA 1F2TB 3BXZA 3DOFA 4C6RA 4CE6A 4ZYUA 3PTLA 5A05A 4AMZA 1QGUB 2Q3FA 1PCXA 2RIPA 1K06A 1HMPA 2WU1A 3IQWA 4O6VA 2WI8A 1AZSC 1K7SN 2AOUA 1QE5A 3AV0B 2DOKA 2YICA 1L5SA 1MUUA 1UQRA 3FNEA 3T15A 4Z3OA 1ZYUA 2Q2WA 2F17A 5KJCA 4EQ6A 3QWHA 4U6NA 5DBHX 1MAAA 5IUKC 3WP0A 7AT1A 3AWDA 4ND2A 1WSBA 4JLUA 1P5JA 1TJ3A 4FOSA 1CF9A 1L9XA 2ZQ5A 1V7ZA 3ADKA 3AF2A 4NI5A 4U00A 1E9DA 3DDZX 4L02A 4BV2A 3HZZA 3MB8A 1VPTA 2I87A 2J08A 1E79A 1JNXX 1H42A 1Z47A 3I2JA 4KUEA 4M38A 1JVBA 1JZQA 2V7BA 2A3NA 3MYRA 1ULAA 3W06A 5AR1A 3URKA 3MJDA 1PTJA 1ZHHA 2GXQA 1DSSG 4P4TA 2IZZA 3R7FA 3M6XA 2PDAA 5IDYA 5KSPA 5FB3A 4P35A 5L9AA 3DEIA 4CLDA 4G3XA 4YAEA 4JT8A 1CZRA 5DF1A 2W71A 2ZJ4A 4FGKA 3ILXA 3OIVA 3CF0A 2I7VA 4TL6A 3WSWA 5ALMA 1UC8A 1ZL2A 5I4IA 3CB4A 4CM8A 1U94A 1J9EA 2PBLA 2PK3A 3C5CA 4J7XA 1M1ZA 4PZAA 1MHTA 3HA7A 4RPJA 4P3KA 3HJTA 1H9BA 4Z9AA 2PWYA 3W6PA 4DLBA 5JWRA 4LHEA 4Q82A 1NXWA 2RGCA 1AA6A 3DLAA 3KCNA 3B2NA 4PQEA 4QDOA 4AICA 3GGPA 1U3CA 3K16A 4BLTA 4P34A 1C9JA 1ABEA 2A9PA 1H5QA 4YQYA 1DC5A 4IZ6A 1RS0A 2VYVD 4QDTA 1QYIA 1FFHA 1GZ7A 3WTCA 2QE7A 1PT9A 4OQXA 2GGSA 1VDZA 1PAUA 3AUUA 2OECA 1W0KA 2D5IA 2X2PA 2AX4A 2BMVA 1MR3F 3AR5A 5KYUA 4YUWA 1M34E 3NB0A 3OQMA 1VKRA 2LUOA 1EJ2A 3CBGA 4MGEA 1T2EA 4Y1RB 1DWOA 2ONKA 5HQJA 1QHSA 1JDBB 1BS1A 3AR7A 4TS1A 1GLVA 2PVSA 4R9SA 4OG2A 1MP0A 1V7PC 3A4IA 2PKQO 2GPAA 4X3CA 5TEWA 3HNPA 2I8LA 3ZHTA 4ZZ1A 1BJRE 5LDDC 1GTRA 4IXTA 4TS3A 5ECGC 2P2LA 4ZCTA 4OX9Y 1W1WA 4YUZA 1SG9A 3M3PA 4IQGA 4KLAA 3EBOA 5FBZA 4AIRA 4CM9A 4AQ7A 4Q34A 4HRAA 5DRTA 5LYJA 5ICSA 1X6VA 5LVAA 2O3SA 2YHIA 3JYPA 2BEUB 3UJ8A 3V6MA 4BZWA 1WA5A 3L9WA 1EP3B 3PC4A 4L9RA 4Q47A 2QZ4A 5BQFA 2QX8A 3DZDA 4UDNA 5BN5A 1L7RA 3MC1A 3OI7A 2QL7A 4X9XA 1EINA 4QTXA 3ZNPA 3PXUA 2OLKA 2DBVO 5AVXA 4P7BA 1YR9A 2V7QA 4PZEA 1J33A 2MCFA 2Z5LA 1JU9A 5C5DA 3D5QA 4MW0A 3WMXA 3RHSA 3NDRA 4EARA 1XIVA 4IH4A 3FMGA 1USWA 3R3VA 4GZ3A 4GM4A 2FW9A 5T67A 3VO1A 2ZXUA 3R20A 1M34A 1RPTA 4KUHA 5BORA 4GLFA 3A2MA 3UV3A 1NW6A 4IJUA 4ZZ0A 3KJEA 3RIEA 3M8KA 1TQHA 3OE1A 1WABA 1N78A 4RHCA 5H3LA 3L7YA 3KKPA 1WJGA 1WVGA 2DHRA 3KZNA 4V0SA 3W4JA 2VOEA 2O5VA 5AVYA 2GXSA 1RWXA 2XADA 4NU0A 2UZ4A 1U4NA 3OBBA 1MXFA 4Q3EA 4ZAZA 5C5CA 1EIZA 4FD3A 4IHJF 2GBLC 4OB8A 2PWAA 1D2RA 1PFWA 1QORA 3IXLA 4G4JA 3RC1A 3TR0A 4BKQA 5BV2P 5K99A 1P6QA 3TLGA 3RBXA 2AMLA 2WFLA 1CY1A 3GNLA 3IOCA 3FWHA 1RYBA 5U9CA 4UVIA 4F7WA 2JRLA 2O50A 1JQEA 3ZDCA 1U7UA 3PSAA 1V1RB 4BO2A 1ZVJA 3OCWA 3WMRA 4Q3AA 3R44A 1K8RA 3FDZB 4NHOA 3KQTA 4F4FA 2Y4NA 3CX4A 1ZGZA 1E6UA 1E9RA 4EPRA 4RD1A 1XJCA 5FAXA 4Y2JA 1YZHA 1C80A 3D0KA 4JI1B 1XT6A 2E4XA 2H11A 1WBJB 2FU5C 4W9RA 3V7UA 3QV1A 2QA5A 3AEQB 4YO7A 2P0EA 4UASA 1TEXA 5ALWA 5HKKA 2K5UA 3FYUA 2EAUA 3EZXA 1FDIA 1GL3A 2PQMA 4PG7A 4EVIA 4IMPA 4OUDA 3ZWAA 1E89A 4O02B 3CFYA 4XCQA 4Y1GA 3UK2A 2G88A 2OMKA 5HXAA 4RMGA 4DV7B 3ETDA 4ND7A 4PC3A 4C43A 4UUBA 1SZDA 2HBYA 3GGOA 2IITA 4ND3A 5CT6A 3SX0A 5CB4B 5LIPA 1P2FA 1A1SA 3MQFA 4IAOA 3ADDA 1DMRA 2NZJA 3C97A 4IIVA 1TCUA 1VBNA 3E7FA 4OU5A 2XUGA 3GGGA 721PA 5KYTA 1AC5A 4FVTA 3M4JA 1DKPA 2HM7A 3H2HA 4QOFA 5DTMA 2C5AA 3W6NA 4C29A 1KS9A 4CKXA 3W79A 2QUJA 3WAGA 2DERA 1LTHR 5CNIA 5CA0B 4RH1A 4C7XA 3ECSA 4NH4A 3SNHA 4KPYA 3IV7A 1ONSA 1DCFA 4LSMA 2QY6A 3K9WA 2XX3A 3P2YA 3WBKA 1EXDA 2A14A 2QDXA 4UZSA 4AZ0A 3Q0TA 5K8UA 3CZ5A 4UBMA 2W00A 3W5AA 1O89A 1NYTA 1XD2A 2G28A 1NXOA 2HF7A 2P7HA 3MGBA 4NC9A 4QTUB 3UG7A 3P26A 3H1BA 2PH1A 4KCGA 4PVDA 3CG4A 3P19A 4WN9B 4DUGA 2C29D 4ND4A 4PXSA 2ZM6B 4EUSA 3BDAA 3T6KA 4IINA 4BKRA 4ND8A 3AXTA 8ABPA 1ZD5A 1OUMA 3VBCA 1CIPA 4R9NA 2NYVA 2V74B 5IZ4A 3B6ZA 1NYRA 3E8MA 1A97A 1CUCA 3HRKA 1V39A 1LBHA 5KHLB 1SVIA 2QX7A 1KOJA 1OC2A 1V8PA 4DTCA 1RC0A 3HUFA 1FU8A 4HAVA 3D0OA 3K72B 2D8AA 3OJ0A 3DLHA 4Y6RA 4ARVA 3PUYA 2I6QA 2RK3A 4R2JA 1WUTA 2R68A 4A26A 2G63A 5FBVB 1Z08A 1NSYA 3K94A 3CR8A 4KB5A 4LW8A 4RD0A 4P5EA 2RHJA 4Q4AB 4J0GA 3L7AA 2XRYA 3D8RA 2R1ZA 4WDRA 2P4SA 4AJOA 4EUNA 2QTNA 1LBTA 3LFHA 5HIIA 5A2QA 2AKEA 4JLNA 4YXFA 3HCRA 1I6WA 2PANA 1U02A 3TM4A 2C3OA 1IK4A 3LOUA 2JJ8A 1YGYA 2FSUA 2EW2A 3JQRA 4G65A 1R8YA 4I46A 3U3KA 2EJTA 3FTFA 2ANCA 2K7ZA 4EB6B 3T61A 1SCJA 3ZLUA 3A1UA 3WLLA 2O8FA 3JQGB 1ZUNA 2PXXA 2QOEA 3MCAA 4KGXA 3WDMA 3KB2A 3RC9A 2YCBA 3EGDA 2X5NA 3N53A 5AUQA 1XAHA 1NVUQ 2GM9A 1Z2AA 3G7SA 2D1QA 3LKZA 3BB4A 1VIDA 3OE4A 5E4FA 3PXDA 1YK0A 4C0LA 5CXQA 3ANYB 1U3GA 4LRTB 1K7YA 1YR6A 3N5KA 1SXGA 4QU0A 2WT9A 4JBXA 1HDEA 1MX3A 2PL9A 2ZYVX 5LIRA 1MQ9A 2XVXA 1VBKA 3H2ZA 3WGNA 5CH3A 3LTNC 2QTVA 1G5QA 5K3CA 2DYKA 3DEAA 5DO9A 1L5HA 1SD1A 3WK6A 4CMIA 1M67A 1M33A 2F3UA 4GL2A 1SVKA 5LA6A 1H3FA 1ZNYA 1PLLA 4R1MA 4YAJA 3R0IA 1KC1A 4W5RA 2J0UB 3IC5A 4FUTA 4S3MA 1MA0A 4JT2A 4UTRA 2ZJ2A 1VLVA 4K3UA 1DELA 1X9HA 3L6UA 4MS4B 3C5VA 2D74A 3IA7A 3MA0A 3PWZA 2BEKA 1QYVA 3G79A 4YXWA 4DRXB 1SUEA 3UK6A 3F1LA 1JYFA 2JFZA 3HHEA 3I4CA 1GNRA 1I0IA 1OZ0A 1RWNA 3W5CA 2GO7A 3I83A 5HK9A 5LQKA 5CH8A 3DMTA 1BKYA 3FGZA 3HRIA 4BLVA 4QOSA 3DW1X 1W2WB 1YVRA 4YK7A 1K63A 4QBHA 3NBMA 1QLHA 2VH5R 5JYDA 2IH2A 4GXQA 5CX4A 3H2KA 3JV7A 2B3DA 3RAFC 1K75A 1UXIA 4GR4A 2HWYA 1KFKB 1JW9B 2ODNA 3DTVA 3MRXA 4JMPA 4JR2A 1WM1A 1VL2A 4IDHA 4Q21A 2DXIA 3TAUA 4KFCA 3BJIC 3U7QB 3H9JA 4UVEA 3R8CA 4EHJA 2HMAA 5I9IA 3OTWA 2EKLA 1YZKA 1PE0A 1WXDA 3HVJA 2NQ8A 4XM2A 2O4UX 2IPXA 2FDRA 4RZHA 4FCTA 1QP4A 1HG0A 1Y9AA 4MR9A 4YJGA 1KQ3A 1IC6A 3L6BA 1DG3A 2GF2A 3GMTA 3LF1A 1H2AS 1ENPA 1P8JA 5BNZA 1NW9B 2C57A 2ST1A 2YRFA 3DFIA 5A06A 3EPKA 3UPUA 4UXHA 4KYUA 1P0MA 3F97A 4JB8A 1KJNA 2BFOA 1C8LA 4G1FA 4RFVA 4POOA 1ZNZA 5EMJA 2RHHA 2ZLBA 2HT1A 4KVZA 2GN4A 4M36A 1QRAA 5FF9A 4K8OA 2OTCA 2GK4A 2XUHA 4MSUA 3ZE2B 3ILHA 4TKUA 2J1LA 3HKCA 1I51A 1JMYA 3I2IA 3PHBE 4FD2A 4MA5A 4NSNA 5CGZA 5EJ9A 1JX6A 3S2YA 4W82A 3N8GA 1R4ZA 2R87A 2PJUA 3EDMA 3MTBA 5IN5A 2OGSA 5AXDA 3ZY2A 2J5XA 4OHWA 3L01A 1WX1A 3ROGA 1G66A 4ERXA 1AURA 3ZE6A 3DL2A 4LY3A 5BN4B 1C4OA 2C04A 2OV2A 2HIGA 2WUVA 3T5MA 1TM4E 1B3RA 2PY6A 3QA3E 3RWBA 4BCBA 3F4KA 2I33A 3NU1A 2YKGA 1JHPA 1HLDA 2I4RA 2G07A 1E5DA 1RE0A 2AJ8A 3B82A 4X90A 3S2ZA 4BKMA 3OHMA 2RG1A 5KYXB 4QYIB 4WFKA 3IJ5A 4HNGA 3Q5GA 3B5JA 4J7UA 2TSYB 4O3MA 3A6HA 4MDYA 5D00A 1JIJA 1T9DA 3W6UA 4CLOA 5F21A 3ICOA 4YP7A 3T7EA 3EUEA 1RQ2A 3HCFA 1EUZA 3PP8A 4HWGA 1OTYA 5AMXA 5HF6A 1X94A 3FHOA 4RAQA 4YJDA 4NE2A 4GMFA 4BQNA 3EIEA 4JYAB 4QECA 3TJMA 4EATA 2HSWA 3IE0A 3DAOA 1S96A 3QEOA 3NHWA 2EBUA 5ICFA 3WYNA 5ERYA 1Y7IA 4NIMA 2QAGA 5C8YA 4JJKA 5LMUB 1RJWA 2JGAA 3UW3A 2FEXA 1GG9A 2A9RA 2EX0A 4FWBA 5EGSA 3C6KA 3TXXA 1UPAA 2IPLA 4RBNA 3M5DA 4BEVA 3ENWA 4LRXA 2OCAA 3W9UA 4E13A 4EY5A 3RC8A 2A1TR 2PMFA 2QYHA 4F4DA 3WGLA 3LY9A 1HDOA 1TO6A 2R8BA 4J1SA 3R7NA 4BX9A 4D3ZA 3SYMA 3ME5A 5TVKA 2CY0A 2G9VA 5B2FA 3FOZA 5FTMA 1O97D 1R0XA 4S2UA 5IX8A 3K9FC 1TCBA 3AG5A 1NVFA 4M0DA 7GPBA 3UGJA 1F2VA 1XTQA 2XYHA 1T0JB 2V4UA 4JBGA 5FOUA 1HT3A 3T38A 4EMSA 2BGWA 1SVUA 3P4XA 4HAZA 2DM6A 1VL5A 3TZKA 1W8DA 1J6UA 1UDRA 3OY2A 1REQB 2Q49A 5LOVF 1UBNA 4CG1A 2IZ0A 3Q3HA 1CUYA 1THMA 2FK8A 3C6BA 4RA6A 1D1PA 1OSNA 1H1TA 4PW0A 2G08A 2VRBA 2YDXA 3OLQA 4Y2XA 3AI2A 3W9BA 1RAEA 5BSUA 3WOHA 4CGYA 1DT5A 3NWEA 4PHGA 3R5FA 3HJCA 4FBLA 4OXKA 2HTFA 2VN8A 2FWAA 3ABZA 5IH3A 4EFDA 1VZ2A 4II3A 2PV7A 3ROFA 2RDMA 5HUHA 5FR2A 2A7XA 4D5EA 2EKBA 2BWJA 3BMQB 4ZOAA 2ZRBA 4CMCA 3JYLA 4IV5A 2WSBA 1EX1A 1L7VC 1C9DB 3QUSA 4OXIA 2NZ8A 3WKEA 3V4FA 4DJTA 3GGSA 4W9MC 2XMRA 1LPPA 1TZBA 4MCIA 1U7DA 3TW0A 3AUXA 4Q4DA 3DKKA 2AI1A 1W5FA 5KI6A 2BBSA 1K66A 1ZL0A 2WYOA 1G16A 2P3OA 4FDAA 4PSDA 2XA2A 4B5KA 2XKKA 5CLGA 2I7CA 5B4VA 1AUOA 1M1XB 3THOA 1NBWB 2OQ2A 1XXHB 1WMFA 4TQGA 1FLNA 5TIIA 3WGIA 2QENA 4M7PA 1CUFA 2DULA 3HYLA 1L5QA 4QTTB 2JFNA 4KLZA 1WU8A 3GV0A 4RTNA 1L5KA 2MSNA 1AGXA 5TVGA 2QXUA 1VE3A 3A28A 4YQFA 1E2HA 3K0HA 4V0ME 5CYOA 4B0PA 4CIYA 1I6KA 2XWSA 1VSTA 4YRQA 2D0IA 1J49A 1NXTA 2NNLD 2CYCA 2JI8A 1L4NA 5EE9A 1KYIA 4G1UC 2H4WA 2O3QA 5EE0A 4I3HA 2XCIA 2BFEB 2K4MA 1RKQA 1P5RA 3QNUA 4GI2A 5CDUA 2JATA 1M6WA 2WILA 1GCIA 4DQUA 5KOHA 4K0KB 4WCDA 2OCPA 3GARA 4P93A 3TB6A 2L17A 1JR6A 1QHHB 4PNHA 3EVEA 3HL0A 2ZYIA 1PD1A 4FK8A 2Y71A 3KVNA 1KO7A 2NU9A 3KOUA 3OX1A 4Q9AA 1PN3A 5AKKA 5EIWA 3E61A 3IRUA 1KAMA 4FS8A 4N0EA 4V2UA 1FX1A 1UBHS 2DUUA 4WLEA 2NTVA 2H17A 1CJCA 3TLAA 3OEED 2C3YA 4YJHA 3TOCA 4FFDA 4G0NA 3LLSA 4E3WA 4XQ9A 4ZVUA 2XWBF 1QYXA 1MW9X 3NNSA 4TWBA 2O59A 5C5IA 2PT6A 1GPH1 2ZU6A 2QTAA 1ZEMA 2BBWA 2ZKIA 3LLUA 5C1BA 1DARA 4PTZA 4EI9A 4Z49A 2D0OB 3CMMA 2GK7A 4FFBA 1GUFA 3BMXA 4FINA 4V0MA 1CUVA 3CRMA 4NU6A 1WSDA 4BX8A 5JXWA 3U4AA 3N1UA 1ZSYA 3EXEA 2Q2OA 2G0TA 3W5HA 2VRCD 3L6CA 3P96A 2C5GA 3N0VA 4X6LA 1MNQA 3MRTA 4MV1A 1HNNA 2FPUA 5TEVA 1DPGA 4OAOA 2I6UA 5T4BA 5DNYB 4MW9A 2HUPA 3RTBA 1D2CA 5EWMA 2FRVA 3G0BA 1UBLS 2ZIEA 4AECA 1JWLA 2VDWA 1MF7A 3DLPX 4AZ3A 2PRYA 3CUUA 2G5TA 3N86A 3B3AA 4G07A 1E1DA 4POAA 4URUR 3VOBA 1E9SA 4ZK2A 2JLBA 3EJ6A 4F84A 4KQMA 1R0YA 1P1CA 3ETHA 3O2SB 4OJTA 1R6VA 4EW1A 3T3DA 3TNFA 1QS0B 2QN9A 3DMPA 3NC0C 4JD5A 1Q1AA 1IEWA 4NBKA 5JCOC 1IZZA 1ZGHA 4U7JA 1BYUA 4MVCA 1NZFA 2BZ0A 3UWPA 5K0GA 2YVQA 3WWZA 4Y98A 1NC1A 4JB2A 5REQA 1CR1A 1Y9EA 3CRVA 3HMKA 1M54A 4NJEB 3IIKA 1EWRA 1S8FA 1P9LA 1SCAA 1OPRA 2P40A 2D1SA 3PGJA 3VDXA 4LVNA 3UMYA 5J1SB 1GQ2A 1KI9A 1OFHA 2P5TB 2B4QA 3DBVO 3KSZO 5DNWA 1VRVA 5SZJA 1RLOA 1J1ZA 5COQA 4PQFA 5KTPA 1AUPA 4DFDA 2GHRA 4QD3A 4QWWA 5IXJA 4K86A 1T2CA 3X1DA 1KI6B 4W7HA 1XL0A 2G0AA 2ZIAA 4HMOA 3TXAA 5G40A 4ESHA 3PXBA 5ES4B 3AP2A 2VHCA 1WB6A 4NYJR 3COJA 4GHWA 4S0ZA 1N8KA 2GVZC 4AXBA 2XXAA 4NJOA 1EWYA 4GEKA 3EGVA 4LOKA 2I22A 4NV1A 2W4QA 1OLUA 2CD9A 2C9MA 2NZ2A 5C34B 3VTAA 3ZBPA 4YRBA 4WNIA 4B46A 5HFJA 3OA2A 3G0IA 4OXXA 4R8SA 1KTIA 4NBSA 3ZWDA 4EY4A 1JKJA 2GBPA 3H9CA 1F2DA 1QNFA 3O82A 4HLUA 4IP0A 3TD2A 4CEHB 1AZLA 5EIBD 1YXMA 2IOHA 4JXZA 3AEKA 3ZI0A 4MJ3A 3G2OA 3C6MA 1T29A 1XV5A 1Z6QA 5E7JA 3A25A 2ATEA 2I4IA 3UOWA 2G40A 3ZZ1A 3R5TA 2BP7A 3KXPA 2PIDA 4NK5A 4JA0A 3UTDA 4DIFA 1UPFA 4ZDKA 2O2JA 3E48A 1Z7WA 1E3QA 2NYRA 1TKAA 3LPNA 1GZ5A 4UDOA 2X0DA 2BFCA 4GX0A 2R0QC 1U2EA 1ZLYA 2X41A 3IAM1 4L08A 3TLZA 1JR4A 3MYYA 5J2UA 2KE5A 4D9EA 3TKAA 5BNWA 1QX4A 1EDOA 2FFRA 2XDYA 1C4WA 4GM0A 1E96A 4NHEA 4DCVA 4DYVA 3X1XA 3B51X 3LPMA 1GPYA 3BAZA 3LJKA 1XROA 3WFZA 2RHLA 1IB6A 5FFFA 2NSDA 3TB4A 4XWKA 4IGEA 3KO8A 3DE7X 1L3IA 2JA2A 2QX6A 4KRXA 2Z95A 5JTUA 5CB6A 4LRSB 3F98A 4B4OA 3I2FA 5IANA 3PICA 3AVWA 3I0MA 4MKFA 1OVGA 1VBFA 2ZU0C 3VHXA 2A0WA 2BIFA 2G82A 4JCOA 2ILTA 4ARAA 2YC2C 3NBQA 4FYPA 1EE1A 1EA7A 3BJEA 4JQYA 5SICE 3VU9A 1ZWKA 3VYTB 1HQCA 3FNFA 3WY9A 2RH8A 3LD9A 3O7WA 1E0KA 1R18A 1Z62A 5J59A 2G67A 2AXPA 4IVPA 3G3EA 1Z7GA 4M6WA 4Z6KA 1HTWA 1P5HA 1Y3FE 4RL4A 3S81A 3C1UA 2J31A 2CHVA 4I6GA 4W1SA 2AZXA 3V1LA 2A33A 3L8ZA 5E8JA 3BZBA 3FSGA 3LC0A 1PWEA 3OT1A 5AKIA 4CN8A 5BXQC 1SXPA 4YHBA 1A8PA 4TQUS 3LBYA 1IK6A 5CX1A 3VOSA 2GT1A 2CXHA 4NNJA 1BZYA 2Q2QA 2ZYGA 4LNHA 3EC7A 3EEIA 3GP5A 4AUKA 3P45A 1VJGA 4A6EA 3L49A 4BS9A 4G0VA 1Q2UA 4ER6A 1VIVA 3LUAA 1FJXA 5J40A 4OM7A 2ON6A 2C0QA 1R0BA 2JGJA 4MWCA 1N6OA 1C5KA 2RHWA 3JX9A 5IYZA 4KV9A 1T6BY 5DI3A 3C6ZA 3D02A 4OQPA 1NP3A 4DN6A 2PR7A 2AN9A 4R1OA 2EWVA 3LBIA 4I5IA 5ARDA 2EWMA 2VNIA 2DQSA 1HE5A 1V95A 1Y8QB 3G59A 3E84A 3Q85A 1Q6ZA 2WAYA 4CKBA 4FHFA 5A9SB 1EFVB 1J23A 1BNCA 1LH0A 4PINA 4KIUA 2A9OA 5K0JA 5I7WA 2XCOA 4OH1A 2IYLD 1R0SA 3H97A 3V5NA 1B26A 1POXA 3TR6A 4CL8A 2Q5IA 4MI3A 4FR5A 1WZUA 1MC5A 2F1IA 1S2LA 4C4OA 3GMIA 3LXUX 4GM1A 3L4BA 4I1UA 1XCJA 1ULHA 4EPTA 1BE6A 1V4NA 3EA4A 4KKXB 3WGVA 4EECA 4L0QA 2WAAA 2IYRA 2GBFA 4IFBA 3PV0A 5KAPA 3VTKA 2JLQA 1CUUA 2H0QA 4KSYA 1Y34E 2LIPA 1QQAA 4G2TA 5FADA 4BLSA 4F5ZA 2WSLA 1RWVA 221PA 4RY9A 3GBSA 2B61A 2I4OA 3NGLA 3P9IA 1G2IA 1XSEA 3BMNB 2MU1A 1XRSB 1ZK3A 1VCHA 821PA 1IVYA 2B6NA 4HPXB 1KHTA 2FUG6 3G8DA 2CXQA 1JJAA 2EFEB 1JH8A 3VSEA 3AVTA 4C5AA 1B8PA 3KHTA 1UWLA 4LNAA 1YB7A 5HUQA 1A9XA 4Z4IA 1BW9B 3TTTA 5ITVA 1BXGA 3KHKA 1ECCA 2OO5C 3SGLA 4ZVQA 1E7QA 2IY8A 2CHGA 1OFGA 1P0PA 1EGMB 1WDTA 4BB6A 1FP7A 3IP3A 4RLFA 3L7OA 3BGSA 3WNBA 4GQIA 2B82A 1UJMA 1WF3A 3UTCA 1IWBB 4FLMA 4S12A 1X1RA 3HB5X 1U7ZA 1BH6A 2CV1A 4C1BA 1MTZA 5EGNA 3PCTA 5AXBA 5K6AA 1R4NA 5AM2A 4ND5A 2WICA 3H5LA 5BVGB 1O5IA 4L8LA 5IMBA 1A7AA 1ZI8A 2VDQB 5CIQA 5JW6A 1DG1G 5JXGA 1E3JA 2HI0A 3AF5A 3H2YA 5KNDA 1D07A 1D1QA 4R83A 4Y6QA 2OK8A 1SUWA 4MPPA 5AJYA 5AJWA 5AOBA 1ZVMA 5ILGA 3TPFA 1ODSA 1RYYA 2AEMA 2XIJA 3DZHA 1JUDA 5ALEA 3ITNA 4P83A 3IH5A 1QO0D 3TW8A 4DLYA 3UH0A 1D6JA 1ZG3A 1XKQA 2R00A 4OGFA 4QM7A 4UOEA 4XJVA 3HUUA 4K28A 1FRNA 4I4NA 3M34A 5F1YA 4E88A 4BKOA 2HU8A 2PUWA 2ODTX 1HWYA 3OQVA 4LECA 4OQNA 3EISA 3OIYA 3F7TA 5M04A 2B7LA 5D5HA 4F6LA 4TROA 1GRQA 3LT2A 3M6LA 2Y1LA 2A1UB 2PKXA 2W2MA 3TDKA 2JAXA 3ZHOA 4E5YA 1P91A 5HJ2A 5A4FS 1UMKA 3WI7A 2XODA 5FWXA 4H6WA 4RC9A 4H27A 1ESDA 4X65B 1ZUIA 2DHEA 3QF4A 2OPBA 1W36B 4FKMA 4PCAA 4B9EA 4JJ7A 1Z16A 1OX4A 3H9UA 2HCRA 3H4IA 4UHCA 3DAYA 1FXSA 2GEFA 4TVBA 5FWYB 1D4ZA 3KOXA 4ZFNA 5FOQA 5IHPA 4JL8A 1GA6A 1P7YA 2Q5QA 2WJJA 1CUWA 2P62A 3AJ9A 4NBTA 5JARA 1VA5A 3P20A 3VZQA 2VBFA 2C4NA 1GP2A 1LS6A 2P2CA 2GF9A 4L4UA 3BTOA 3O84A 4A2PA 3QUBA 2BVNA 1DXHA 2QT0A 2CUTA 2XF2A 4EHDA 2D4HA 2FJ0A 4C89A 4W6ZA 5JTTA 3AZOA 3CE6A 5TQ0B 4IF4A 3OEHA 3L7JA 4M9XA 1PZFA 3D64A 4IDEA 1NR5A 3GJSA 4OPMA 2JDIA 4WVFA 1IBLB 2X9GA 2YV5A 4Q03A 1SKBA 3FB1A 1LEHA 1EA5A 1XQ1A 1H2ZA 1Z38A 5EXTA 3GLQA 4D44A 3R9KA 3A4TA 2FZVA 1Z07A 3NFRA 1GUBA 3R8FA 3IKVA 3V00A 1GT91 4WLFA 3PUHA 3CXUA 5DYGA 4EJ0A 2OHJA 4DWOA 2P79A 1X1EA 1N7GA 4K7JA 4KO8A 1SU6A 1NURA 3IEUA 4M1OA 4BX0A 4EVSA 1R3UA 1V47A 4JLKA 2HA7A 1YMQA 4C6TB 1P7CA 1VYVA 3A1FA 3GLFE 2VJNA 3OCVA 4KQCA 1JAZA 3AHJA 3F4LA 4MUYA 3JVUA 2XYGA 3DVAB 3MFQA 3IR6A 3G0DA 3C6QA 1HV8A 1LK0A 1CRLA 4FMCB 4NL4H 4OB7A 4XDZA 1KVSA 1X74A 2B5VA 3ER8A 1KRWA 2ZYHA 4ZTZB 4ED9A 5ADHA 3A6PC 5AKYA 4B6QA 3DZFA 1FVOA 3IE2A 2ZIFA 3PVCA 4LBZA 4TTVA 5CD9A 2C7QA 2W8ZA 4PO8A 3ZGZA 4QFDA 2N47A 4CT4B 3FWKA 5LKAA 5JCZA 1QM5A 3B1WA 1LVUA 2ZRAA 4TYNA 4UD2A 2I6SA 2ZR9A 2CNLA 1JG7A 2C3MA 4WK2B 1Y33E 1PSDA 1CQIA 2H1HA 2B36A 2VZLA 1RQPA 3MB5A 3OUZA 4G85A 2HK7A 4L22A 1RI3A 1RFLA 3BAFA 1SXJD 2TMKA 4HDRB 4D3DA 1VCIA 4HMPA 1RD4A 3T1QA 5ALTA 1JEYB 2A3RA 4HJXA 1N3LA 1W0JD 2Z5FA 4JA2A 1R5JA 1Q0ZA 1UAYA 1J07A 2GKGA 3T0FA 4KW7A 4Y7DA 1ZSNA 4H60A 5DSXA 2PFGA 3N7AA 3ZWPA 2RK4A 3M89A 5LWHA 1U5BB 3QLVC 2FUEA 3HA5A 1COWD 1XA3A 3GLFA 5HILA 4FI3C 2OENG 1Z5WA 4FOOA 2AW3A 1K7EB 4HFMA 2RCYA 3WRXA 3OTGA 1CVIA 4ZYWA 2HDOA 2W2XA 4FFLA 2XGJA 1QTQA 1JJIA 1R4AA 1RAIA 2WF7A 5G1PA 4KC0A 1UAGA 4R81A 5LZ2A 4ZPJA 2JD2A 3IJEB 2B7BA 1PR2A 3WB1A 2O8DB 1J24A 5DW3A 2JFFA 2J8ZA 3KQYA 3P0RA 1I94B 4JLJA 3EK2A 5L3SA 1GPWB 5DU2A 4E4RA 1U5CA 3FRHA 2X0KA 1K4YA 1YS7A 3G02A 1Z7YA 4R54A 4YQZA 3VU0A 4YCLA 1JDPA 3Q2OA 1KBOA 4WOKA 1F8YA 5CEJA 4E5UA 2AJDA 3E18A