1JT9A

Structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
266
structure length
247
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glucosamine-6-Phosphate deaminase
publication title On the role of the conformational flexibility of the active-site lid on the allosteric kinetics of glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 247
sequence length 266
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jt9A00
4L5IA 4TM7A 4L4YA 1UJ5A 1FRZA 5HJ5A 3NWPA 1VL1A 1XTZA 2BKXA 3HHEA 2J0EA 3E15A 1M0SA 2R5FA 1FSFA 3UW1A 4L50A 1DEAA 1PBTA 4R7TA 3BXHA 1HOTA 3HN6A 4R9NA 1FS6A 4L5JA 1FQOA 1LKZA 4NMLA 3LWDA 1O8BA 3EFBA 2WU1A 3TX2A 1KS2A 4X84A 3L7OA 4OQPA 1JT9A 3ICOA 4IO1A 1UJ4A 3EB9A 3KV1A 3U7JA 4TM8A 3BXFA 2RI0A 1HORA 2OKGA 1NE7A 4GO1A 4OQQA 4M8LA 3IXQA 1LK5A 3NZEA 3KWMA 4L51A 3OC6A 3ENWA 2O0MA 2GNPA 1CD5A 3BXEA 4L4ZA 3LHIA 3ENVA 1UJ6A 4GMKA 1LK7A 1FS5A 3E7FA 3CH7A 1Y89A 3ENQA 2W48A 2BKVA 3CSSA 2F8MA 3BXGA 2RI1A
chains in the Genus database with same CATH superfamily
5DCWA 2D8MA 4WXRA 4CMKA 1DAEA 5JXJA 1ZXBA 1A4UA 2JEZA 1MB4A 1J56A 3TW0A 5CAEA 1EDOA 4E15A 2RHTA 1TA4A 4LYDA 1XDDA 4QNNA 5A7FA 4W1QA 3V8BA 1MO6A 5TV2A 3IALA 1YJ5A 4PV7A 4PSCA 4RPCA 4LFCB 4X85A 1NW7A 3E2PA 3RS4A 3RSZA 3TIXB 2RIRA 1AKTA 3CUYA 2P9YA 3CQ9A 3ZHQA 1WPQA 3HA2A 2H17A 4DQVA 4TSFA 3L43A 1ONPA 2W8BA 1HZZC 1W4AA 4CXMA 2EJTA 2J7PA 2MIIA 4B7AA 3UHJA 1XPRA 3CMMA 5GONA 4XB2A 2Q5OA 4Z4QA 4EY7A 4PICA 1P31A 4D3FA 2OZKA 1A2BA 1JR2A 1ZH8A 4I4TA 4RTOA 1FP4B 2GAAA 1F2TA 1FNDA 2XE8A 3QLTA 2QTLA 4FPXA 4MEAA 4RDIA 1CDOA 4O3FA 4PYOA 2VLBA 5B1DA 5L3ZA 4BNVA 5AKHA 5ESRA 3DOFA 3HE3A 3F1LA 3JZIA 4JGBA 4BQOA 3IKVA 1VPVA 2X2FA 1P2DA 1C5KA 3FM9A 3RM3A 3KTAB 5BSUA 2XBLA 3ORFA 1VL2A 4RVFA 3AF5A 5BMVF 3BB3A 2R2GA 3FCUB 3TX2A 4Z8YA 1SCIA 3MOSA 1G5QA 4GIBA 3B9QA 3X1YA 1F4LA 3UW3A 5K6AA 5FPPA 5F2NA 2LCQA 1XU7A 4L3OA 1N9KA 1LSOA 3NBYC 1KDOA 4C14A 3AHGA 5BSEA 2GJ4A 5CB4B 4MVJF 3NFRA 3PUJA 1SC9A 4ITRC 1V1MB 1BJRE 2RSLA 2JFXA 1GRNA 1N75A 4ZYYA 3QVMA 4KLNA 5CFOA 3CR3C 4BZXA 1QF6A 4LI3X 3NHWA 3EMKA 2GD2A 2GM4A 3V7FA 3WJ1A 5H83A 2X2OA 5KSWB 2VPZA 2W7TA 3F78A 4RQTA 5HUJA 5DGXA 1G6KA 1UDXA 2ZJYA 3GLHB 1IRXA 3PLRA 1QFZA 1UK7A 5EP4A 5AD1A 3COPA 5LOVA 3R5TA 2DM6A 1R9NA 2A5LA 3EVZA 5BWBA 3GQVA 1OFGA 2WSYB 2YQZA 3CLTC 4WERA 1SXQA 1U7XA 2BEWB 1T5SA 3KSZO 3NHRA 2YFYA 3UYKA 1G20E 1GQRA 5JXIA 5M2QA 1C30B 1F0YA 3CRZA 4KNYA 2AYZA 4MGZR 4FB5A 4MYSA 5ADHA 4FK8A 4WOCA 4Y6GB 3OP1A 2YWCA 2NUBA 2W2KA 3NHKA 4LWOA 2DJ5A 1MZPA 3U80A 3N5CA 1M8KA 5JADA 1XRLA 3QIAA 2QD2A 2UYYA 1MP0A 3FVTA 4WINA 1G20A 4IDHA 4F4JA 3C3JA 3MGBA 2DR3A 4YMGA 3LHFA 4UBMA 3H9BA 1NJFA 3NB0A 3TW8A 1FVOA 3EWIA 3E58A 3SEFA 2QMEA 1SIWA 5H81A 4GWKA 5KX5B 1EFCA 3IVXA 2ZXUA 2Q50A 3NMUF 5BVGA 2JLYA 3Q7PA 4N5DA 1U2RA 4B8YA 1N5KA 1ZMXA 1NXQA 2ATCA 5JH7B 1RXVA 1O4VA 4X94A 1Q12A 4JQSA 1SUFA 4YCBA 1YZGA 1ADGA 4P36A 4EPVA 3KYDA 2VQFB 1N36B 1Z0IA 1PRYA 3LJKA 5J2UA 2JI6A 2W8ZA 4HB3A 5KJ1A 3NRCA 4JL5A 5JWHA 3JAKA 1KBZA 1SD5A 2OOKA 5F21A 2HXSA 3SDBA 2BFEB 1L1RA 3GFOA 1V11B 1YRYE 1U9CA 3W5UA 3R24A 1AKVA 4MA0A 1W75A 2P77A 3WJ7A 2P62A 4AJPA 1SHZA 3ACDA 1XTBA 1CHDA 4YB8A 3DEAA 1DKMA 1QRSA 3RF6A 1IPFA 3USES 4PVCA 5E3IA 2XYVA 2GCEA 2JGDA 3LWBA 4X3OA 1WAMA 4FFNA 4I55B 1DINA 3CLHA 3ETCA 4NOLA 4R9UC 1IY0A 3OSZA 4O4LA 1FDSA 2AMJA 3EOAI 3QITA 1Q1AA 3K5WA 4UVIA 5F7ZA 1VG8A 3AETA 1M8JA 3ZCTA 2C7BA 2D5AA 3QXSA 5EWMB 1K0UA 1F48A 1QYDA 3PUIA 4N1AA 4UXIA 5JBQA 3ICWA 5KI6A 3HFJA 3P19A 4JJFA 2WD7B 5CTJA 3LY9A 5JDIA 1LNZA 1MC8A 2VAWA 1YB2A 4HBGA 2X1MA 5JFTA 4U02A 1AQNA 5C34B 1QLJA 3JARB 4CETA 1NQOA 1ATZA 3DBVO 3IPLA 3LFUA 1H5QA 4RCZA 4DGQA 2YH2A 3UICA 2CBGA 4AURA 3PNPA 1GXSB 4OYLA 4Q7LA 2QQ5A 4RFVA 3W7VA 4F0JA 5T4EA 1XU4A 4P7KA 1FDUA 5ENDA 2PUHA 4AN1A 5JXHA 4BMPB 2R1TA 3KVNA 5CDTA 3LUHA 3AL2A 4MMZB 3KQHA 2WIBA 1QYCA 3MGCA 3VMFA 3TFQA 1G3RA 2OKGA 5EZYF 5JCJD 1N8TA 1XRSB 3KEOA 1MAWA 1XFDA 1JDZA 3AKZA 4JYPA 1ZN8A 5EE5B 1N7GA 3FI0A 4I14A 3D54D 2ZM6B 1EP2B 1ZXXA 1FLNA 3A27A 1JDJA 2FMIA 1I01A 3I39X 2BGGA 3VZCA 2YXNA 2YHIB 2RGEA 3PDIB 1E96A 2F3QA 1T8YA 2O2XA 1D7AA 4XFKA 5DM60 4C4AA 2FYTA 3VFDA 4FCTA 1D1PA 3HK2A 2V54A 3WGZA 2I9PA 2GN9A 1QHHA 2X0RA 4DJAA 3F3SA 1WUKS 3LIPA 4LDAA 2AN1A 1Y8QB 2X5OA 3B9PA 2QM7A 1XAIA 1B1AA 2RK6A 1GWNA 1PNVA 2DOKA 3DLCA 3I5MA 3IQDB 3QMMA 4PHFA 4P4GA 2PLNA 5C8VA 5SYAA 2Q6TA 1D0VA 1S7GA 1L8OA 1DG9A 2ZRDA 1RRCA 1UJ2A 2XNCA 1M2JA 3WGIA 1ACJA 3UJHA 3STWA 3OKAA 5GPBA 2QRGA 3FLAA 3WFIA 2Y1DA 1JHUA 1C14A 4DYHA 3MT7A 1NI4A 1ZRSA 2Z6VA 3NNNA 2NW6A 3NJ4A 1H6DA 5J47A 4DIMA 2ZXFA 1E2DA 2Q7XA 3TMKA 4DW8A 4G0UA 4AUMA 5C8YF 2XVYA 5JAPA 3KQUA 4IMRA 4MYTA 3TRJA 3V3TA 4I50F 4N0QA 4OHVA 4KR0A 4CGZA 5AFSA 5JMOA 2JFPA 1C1DB 3L8ZA 4NR0A 5IVIA 2WUWE 1UBUS 2F1HA 4OI2A 3A3PA 1XF1A 2VDWA 4BB9A 3NUZA 4M54A 3C7AA 1OQAA 4RLQA 5G41A 1H2EA 4WACA 3LBIA 4R2JA 1JBQA 1JLKA 3C74A 4W82A 2Q5QA 1CB0A 1GUYA 4FSHA 4QASA 3G82C 1XMPA 4D0RA 4WKPA 3UK0A 1JEYA 3KZCA 1HE8B 4EFKA 3CY6A 3MOIA 3L7AA 3OHPA 2G5GX 2WVHA 3HVHA 1DQYA 3BUSA 2JHCA 4A8PA 4CTMA 1I0IA 1A7JA 1P9NA 1HYQA 3ZHZA 4IEEA 3F97A 1OKKD 2G0TA 1U1DA 1FUKA 2ZT7A 4DRYA 1QKKA 1E6UA 1HUQA 4FIZA 1ZNWA 3LP5A 1NBOA 4KVAA 4ARVA 4EG8A 1D1TA 1UFQA 4ZO4A 4F8YA 2PUFA 2A9JA 4Z7QB 4EF5A 1BCSB 3QV2A 1CV2A 1FU4A 5HKAA 3VVMA 4LQCA 5FBHA 1N9ZA 1YZLA 3IUYA 1RI5A 2DUNA 3ZK9A 5K6RA 3FPGA 4ZCRA 3ESRA 1ZJ6A 4PZYA 3TTSA 2V1UA 4NDAA 2RBKA 3X1WA 3DGFC 4YV1A 1XHLA 4P9NA 1U2EA 4FZJA 3D4IA 3WL6A 4BO1A 2NGRA 3ISJA 4IIGA 1OBFO 3IMGA 5REQB 1S2NA 4DE5A 4CMEC 1LLQA 3PEVA 2OG1A 4CG3A 4LE2A 2QZZA 3HO1A 3PC8C 2D0OB 3Q7RA 3U7RA 2MTBA 1ZK3A 3GFQA 1E0SA 3OQBA 5THKA 4C0QC 2POCA 1BN7A 1T2DA 2Q2VA 2XE6A 4WI1A 4R01A 5ECGC 1QYRA 2XB8A 4PFSA 4F5DA 1G8HA 1RRKA 2HO5A 2JJQA 4GZLA 4MS1B 3GLQA 4F6CA 4UJ3A 2AXEA 3H16A 3HR8A 3IHKA 2W6JD 3OWHA 2KM1A 3HA7A 2QU8A 2H4ZA 1SVUA 2IY8A 1PT9A 3OX3A 1MR3F 2A4MA 4HFJA 4RSMA 1DV1A 3OOEA 3AJRA 1R2QA 2OFFA 1A8IA 1Q3HA 3HP7A 2H1OA 1Q1NA 5FOQA 1GTSA 1T2UA 2H5JA 2EGHA 3ZW7A 3MT0A 3BDVA 1DAFA 2VWQA 2MSWA 2OL4A 4W5OA 5JRDS 1LW6E 2PS0A 4TTPA 3LLUA 4EF6A 4A5OA 2OCGA 4Z3OA 4N39A 2GPNA 3T1QA 3ZGVA 1JA9A 1ZONA 2H1VA 1W6UA 5B1HA 2HGZA 2IIVA 5TPZD 3ST7A 3LW8A 3R5KA 2Y1FA 1DPGA 1U2GC 3UH1A 3HMQA 1KO4A 3GT4A 1Y3FE 3OCWA 4TXJA 4E32A 3OURA 3QNWA 2AZMA 2XCSB 1Q21A 1D04A 2B4TO 1Q92A 3AF1A 4B33A 3JATA 2UVQA 2WSSD 3GQBA 1K3UB 5A4JA 4PG4A 1OAOA 1X1AA 2QZ4A 5ECYA 1GQOA 2I65A 2N1BA 4UHFA 3U39A 5LNK6 1KYIA 4TQ9A 2X41A 4Q1FA 5BOSA 2E18A 1W5EA 3K4PA 1X70A 4QPPA 5E1OA 2XJ4A 1GFWA 1VJTA 1V45E 3U0BA 5EP3A 3QWAA 3L7DA 5CA0A 5BSHA 4I1RA 1R4AA 3H75A 2ISQA 3PC3A 3SYLA 2YWHA 2XWJI 5JZOA 3O4FA 1SPBS 1UBHS 4Z4CA 2Q6KA 4U00A 3RHFA 1FOEB 3DHWC 3TIVA 4H4EA 4HEA6 2Q6IA 4EBFA 5C1DA 1M2VA 4BFUA 7REQB 2UUCB 1N0WA 3DDCA 4FFRA 4P31A 3MMPA 3D81A 2FR8A 2XW6A 4KXVA 1OLOA 1A3CA 4IV5A 4ZREA 4L8VA 3HCFA 3LWNA 2H63A 5KVQA 4J1TC 5TRTA 3ANTA 3T15A 1C0IA 3ZWDA 1MO4A 1YOVA 2YZ7A 2ZANA 3CNLA 1WXDA 3OZSA 2IEBA 3WZLA 3SKYA 4OKSA 2MINB 5EWJA 1EJBA 2J0QA 4HFRA 2H3HA 3A2KA 1HT2E 1YKFA 3LTEA 5CG1A 3ABRB 4OHKA 1RBZA 4QQRA 2BDEA 4QOJA 4ASUA 4GLFA 2GJ8A 1LPNA 3FFXA 4G5HA 2YY5A 1E7YA 4EJ2A 2JLVA 1SKYE 4LHSA 2GNOA 3K7EA 3KJNA 5HQTA 2VCHA 4HVAA 5EUMA 1P81A 3F67A 2PKCA 2VDNB 1ZD3A 1DAHA 1TYEB 3WNZA 4YPVA 2Z1NA 1RM3A 1U28C 1Z2OX 2HU2A 2VHEA 2Z8XA 3AVOA 2NMVA 4S1OA 4MWCA 2HTEA 2J9RA 3NOQA 1O5IA 2RHLA 1YHYA 3DCYA 3P94A 5LZ7A 4BLPA 2EKPA 4TRRA 8MHTA 1QMGA 2F3SA 1VE6A 2GPTA 1OTHA 2C4NA 1NUUA 1OV6A 1Y48E 1SWVA 1K8RA 4PQGA 4CLEA 2P9EA 2Q1YA 1T8PA 1O57A 2O6LA 2DHRA 5FWDA 3RTEA 1DKLA 3CCBA 3SSMA 4CCWA 3AVXA 1PL7A 3QKSA 4CN8A 3CFYA 4HT3B 1JT2A 1H3EA 3PD7A 2P2NA 1QV7A 2K7ZA 4HNQA 1MQAA 1EVQA 2V6BA 2I6XA 2RONA 3CZRA 4GI5A 2ZZNA 5M3BA 4GZ5A 1FTNA 3EPKA 2KPOA 3K2BA 1WPRA 4IEIA 1ZD8A 3NM5A 5L3SA 3NGLA 1PBNA 4KSBA 1H5UA 4FM9A 3LKZA 2I78A 3NHUA 3F98A 5A4MS 4K2AA 4KQ2A 2FWIA 1L7AA 5TF4A 4DWVA 3DMGA 3O2SB 2VSOA 1POWA 3OKFA 4L95C 4EOGA 2FPGA 2AL7A 3A9VA 3PQ3A 4K9RA 4ANFA 2VRNA 3C97A 2NO9A 4AC9A 2DP4E 4LSGA 1QKJA 1JFRA 3B2QA 2P3QA 3I12A 4ZZ1A 2BZSA 1E2NA 1S2DA 2XUQA 1WB9A 3NDRA 1D1QA 1P4AA 1OKKA 2CLOB 1V8FA 2EZ8A 4ZZ2A 3CRRA 4CCSA 5CAEB 4P0PB 4PPNA 4UFNA 5HJ7A 3ZDAA 3MJCA 4LUCA 3TRIA 1LLDA 2YOHA 2ZOSA 1OWNA 1RYEA 1T2AA 3MWDA 4FHCA 2BR5A 3KJZA 4LOAA 3SYRA 3ACBA 1BS2A 1VE7A 4Y1GA 3GFPA 1P5HA 3KU1A 4NULA 3FGPA 4ABTA 1W5TA 2RJ3A 3OFNA 1M1ZA 1BEEA 3E8XA 1PG2A 2A5GA 2ZB7A 2H92A 3KR1A 4U8HA 2W8BB 3DDOA 3V4RA 4NG5A 5DEIA 1W5BA 3DVAA 3NOOA 2AYXA 2NV0A 3PQ5A 3AF3A 3TLEA 5A9SA 5GONB 5MN5A 3ED5A 1OTXA 1V41E 2IPOA 1A7AA 2QRQA 3MHPA 5DTEA 3R0VA 4I4TB 1JWAB 2CJWA 3O3MB 5T3YA 2DECA 3GF4A 2PRSA 4FOPA 5KCZA 5TE9A 3D2AA 4J0EA 1GG2A 1Z8DA 3K30A 4CU2A 2EOAA 2Z4RA 1GILA 1DRWA 4QUGA 1A8SA 2ZDHA 2XGMA 3FCSB 4E2FA 3EE6A 3TNYA 1BSVA 4O4IB 1W76A 5TQJA 3THXB 4GP6A 2W6JA 4B7UA 4CQNA 5HJ5A 2XDYA 4XASA 1P4GA 2O14A 3DE3X 2OZEA 2Q5EA 4LVNA 2HA3A 3HZOA 3MUOA 4DSOA 4EUFA 4CIBA 3ZDDA 1M1YE 3FGNA 1HQCA 3A9SA 4JD5A 4KXMA 4WKOA 3DMHA 3DS8A 3WFZA 1C9KA 1DNPA 1UQUA 2G40A 2IU4A 2GCPA 4NPHA 4ZAVA 3NTLA 5A4FS 2YZ2A 3OKPA 3MTQA 4C1BA 4GHWA 4ENPA 2Z4SA 3OTIA 3HVIA 5TPZA 2NU7A 4GLLA 5CIQA 1I80A 1PFWA 2B5VA 2HSWA 4FYMA 1W6RA 1M1YA 2PSJA 1FFEA 3B6KA 3OU6A 1Z45A 3BIFA 4FBGA 4WECA 2OPHA 2VWPA 4TVSA 4DXHA 2VBIA 3A9UA 4MWGA 2C54A 3NALA 5LOVB 2WSSA 3H4VA 5ARCA 1CF4A 4ZJYA 5KDDA 1JMYA 3NDIA 1C2TA 1R6TA 2Z9BA 3KSBC 3WIUA 5LLTA 3HYRA 5BW8A 4BAGA 3C1AA 1V95A 4L6CA 4B3BA 3HYNA 3B3AA 3R0XA 2JLUA 3JZDA 5KPJA 1TQ2A 3AJ9A 4RF3A 2XDQA 7GPBA 3CLVA 5M04A 4YV0A 2BEKA 4F2WA 5CXQA 1TADA 5DP2A 1OT5A 2W2KB 1KA9H 4OQNA 3SIXA 1IM5A 2JGLA 2PS3A 5IAGA 2XUHA 1EA7A 2QD3A 1F6DA 4Y30A 4YAOA 2ZYTX 3HB7A 1LSUA 4ESEA 1VKHA 2P1RA 4TM8A 2GPJA 1AHIA 5IJZA 5ICGA 5JDIC 5K8JB 4IHQA 2V0GA 3WGOA 1NE7A 1NRXA 1QIGA 1D09A 1A95A 1YCDA 3FSGD 5D3KA 5HILA 2VAMA 3F5SA 1PFKA 3TW8B 1DEXA 1KARA 3H11A 3QWFA 2H0QA 4EX7A 4CMJA 2CL6X 4QGSA 5TF0A 5BYKA 5BVGB 2FW6A 1RE0A 1N6PA 3HKBA 3QVUA 2A9KA 3QX7A 2WYWA 2FZWA 4CTOA 1UAYA 4JLNA 1A5BB 4U2GA 1ZJJA 4M83A 4Z1OA 1E5XA 1XV5A 1ZVJA 4Q4HA 1UP4A 1V8BA 4UULA 2DETA 3ZHSA 3GJ8A 2VIIA 3NQ41 2XMZA 1DLJA 3RBVA 3JAKB 3P4YA 3PD1A 4EZIA 4RACA 1PJSA 2QUZA 4RVDA 1IATA 3SHFA 2I62A 2R5WA 1DCFA 1NRIA 4M49A 5ANRB 5CDFE 4JOSA 2XF8A 4OEHA 2PUDA 1GHTA 5G1OA 1WO8A 2EFCB 3BREA 3A7EA 4DWJA 2XUAA 2ZTUA 4W5WA 2R8RA 3H9EO 4QTZA 5KAMA 3ZK8A 4BMOB 1P62B 4URVR 4BC0A 3TUZC 1OH6A 4H17A 2JGDB 2LXNA 4P33A 1IBMB 1DQPA 3W1VA 5CDFA 1EFAA 3VDMA 5IHXA 3BX1A 1XZMA 3FKQA 1OUMA 3KOUA 2ORVA 4O4LB 2ZI9A 1P1RA 3AETB 2QJWA 2VJQA 3AR4A 1GG9A 3L0YA 521PA 1JR6A 5EAIA 4LFBB 3ROQA 4S0XA 4DV2B 3ANYB 1XXHE 4DSNA 2GAJA 2J9FA 1RXUA 1WG8A 5HDQA 1M6VB 4TYYA 1ZZGA 4JJIA 3D4NA 4LOHA 4I66A 1N6KA 4HFMA 3VKWA 5B6IA 2ORYA 2XTAA 4FGWA 4CIAA 3ORRA 2DQSA 3C8ZA 2JLWA 2J5QA 3KR9A 1CLUA 2ZJ6A 2BDUA 2JAXA 3LRXA 2ZYIA 3QU5A 2QYSA 5JAQA 3WFJA 4DCGA 3U5TA 1XXHA 1E3TA 1T9HA 1G5TA 1FTQA 4U39A 3UB4A 2RH9B 3VPHA 2LZ0A 2R1TB 2AR0A 3KSRA 1W581 2XQJA 4IUDS 3K09A 1I4WA 1XTVA 2DHCA 2FEPA 3JR3A 3MMZA 4IDQA 3AGQA 4M0MA 4RIGA 3FTNA 3H2SA 1F8FA 3T1NA 2FQYA 2PJZA 1SIUA 1LJLA 1W49A 3I5UA 3IAUA 4NECA 3TIIA 2VJAA 2Z1MA 5LPNA 1UR5A 5DPMA 1GPLA 3OE1A 4BTEA 3LS2A 1R8JA 4LDQA 3QEAZ 2AMYA 3QLUA 4ENVA 1MAUA 2XYHA 3K9BA 4D92A 1ZGZA 3KDSE 2TECE 3D7NA 3T1OA 4QDZA 1X3SA 1LF0A 5DVZA 4P2BA 1GLNA 1MXHA 2FP4A 3BD9A 2DFDA 3I04M 5AI4A 3T06B 4YAEA 3A4IA 3EEOA 1KS2A 4OHZA 4KV7A 4QGGA 3LA6A 3K1AA 1WXEA 1EUCA 3GJ6A 3GEPA 4PFKA 3S6JA 1QK3A 1FSPA 3DAOA 2O2SA 3VNQA 4F3TA 5GZ6A 3EB9A 4D9KA 5IVKA 3ELWA 4LZWA 4WOBA 1JNYA 3QZUA 3GRUA 3O1IC 4LZNA 3D43A 3GIWA 3KSAC 1AS3A 1TMGE 3SHTA 4GKBA 5JSZA 3OJOA 2EYQA 5COBA 1J9GA 1B0AA 1VTKA 4ZRNA 3RSSA 2D1RA 3UUEA 4EYSA 1JX6A 4BNMA 3FROA 1ITZA 2OORC 1OW3B 2YX1A 3KU4A 3PJGA 2CJYA 5F9HA 2BF4A 4GR4A 3I6YA 1E92A 2PX0A 1FU7A 1DELA 2I3ZA 1OPRA 1JG3A 3USZA 4C78A 2BJWA 3DLTA 4BE7B 1WL8A 1T5TA 2F8LA 4L7QA 2VDWB 1US8A 4JJAA 3ROGA 2QS9A 7MDHA 5JS1A 3KHUA 2FW8A 4D25A 4MV9A 5PNTA 2R48A 3ZY3A 5F5LA 5EE1A 3PXXA 4A26A 3UK2A 1JEYB 3NRJA 5DM70 3WL4A 1UPAA 1ZS9A 2ZCUA 3KFVA 1E3IA 2Q3HA 3ZHBA 4C3VA 3QOFA 4ZYWA 4XWKA 4KRGA 2ZSUA 4DMKA 1CQZA 2QXYA 2GHTA 4UBNA 3RRBA 3E53A 4QQFA 3ZI4A 3TQIA 4D9JA 4ESVA 4JVNA 3AZQA 3F9RA 5EP1A 2JNWA 1U0TA 4MZXA 3RROA 2ZCVA 4S2UA 3G7NA 2YIMA 5LL6P 2NV6A 4IZOA 4PGHA 3RD5A 4DVGA 1Z7YA 3PNOA 3RASA 3KHKA 3EF0A 1D03A 4OXNA 2E5LB 3V80A 4KVZA 1RFLA 1V6AA 2GZ1A 4UAJA 3GI1A 2RGRA 3FYTA 3IT0A 3S55A 2ZUFA 1B8UA 2X8JA 5EZ6B 3D3NA 1OAOC 4RSRA 4QD3A 1ULBA 3KLOA 3VX3A 4KO1S 2QQFA 1ZK0A 5CGZA 2WKQA 2H5IA 3KXPA 4HFNA 4PW0A 3TM5A 4MGHA 4BBZA 2DUUA 5FJJA 3ROZA 4YAKA 4I1UA 5BRJA 3UTDA 3VU9B 2CGEA 1QJCA 5KWJA 1GUAA 1W0KD 2I54A 1VSBA 3W05A 1QRAA 3ZZ1A 1DAGA 4R6WA 1VIMA 1TCVA 4JB0A 3E70C 2VP0A 1CUUA 4NEHB 3FNGA 1TCBA 3HJTA 2OV3A 4HB0A 4RTLA 4OJTA 1UQRA 4CMIB 3C3XA 1KBOA 5FL3A 2B8WA 3E03A 1D2EA 5E6SA 1TCUA 4RJIA 4R8SA 1CR4A 4HH0A 4YECA 1JTVA 1JFFA 2RK4A 3GOHA 5KNDH 1A77A 1ML4A 1C7IA 1JQAA 1XNJA 4JT2A 4UPVA 1T34A 2I8CA 1U1CA 3NANA 4JI6B 2CK3D 1ETHA 3MAGA 1XXLA 4KGZA 5LR6A 4RJJA 2OHGA 2OENG 2A0FA 2IT1A 3NWJA 4FQ7A 2WWGA 1H8ED 1KVTA 4US0R 3ZX5A 5JO9A 2YJZA 1U9ZA 1W4CA 3RU3A 4L4SA 4LCEA 3PHJA 7YASA 5IJWA 4XCQA 4CTJA 5LBTA 1BX1A 3MS4A 5JS8A 3K70D 3JATB 3GQBB 4QARA 1PG0A 2I67A 1OC2A 4S2EA 3BCUA 2ZI7A 2OCYC 2WFAA 4JJGA 5BOSB 4F93B 1GTL1 4Z51A 3M1AA 1NIPA 2H52A 2PU5A 1NPDA 5JJCA 2H2GA 3JW8A 3PHCA 4GVPA 3SE7A 1W94A 3TLCA 4AW9A 1YV9A 4JP1A 3TTUA 5C52B 1PWXA 4OHWA 3AP2A 1T8TA 3EF1A 1HF3A 5KHOC 3INYA 3WAKA 2EEZA 3ULKA 1A88A 2E5FA 3MWGA 1S2OA 5BSFA 3TI7A 5F9FA 3PB3A 1RZ3A 3JAMA 1MJGA 3SHVA 2HUNA 1M2VB 2O2DA 3WHKA 3RIHA 1ECJA 1Y4AE 1UKZA 2B0JA 2C3UA 3F7OA 1P1CA 3M4NA 3ODPA 2NVWA 2CVFA 5AJYA 2Z2JA 4LE1A 1GRCA 2EZTA 2O0MA 5K03A 1NJ6A 2P9FA 4DIDA 2RGNA 1YOVB 4MHSA 3QEOA 5DHFA 1WXFA 1PEYA 3SBXA 1RWNA 3PPXA 4OBWA 1RI2A 5EWJB 2GA9A 2RHCA 2DFNA 2IYEA 2O3RA 2C2BA 3LM8A 4P3PA 5DNEA 1K4YA 1M2KA 1R0BA 2ZYDA 4H0FA 4MJ7A 3FDIA 3SSOA 3BT7A 3SK0A 2HBRA 4N82A 1J70A 4K6OA 4V0ME 2ZR8A 4EKDA 4RD4A 1E3QA 1HDCA 5K3BA 4I8XA 1OCEA 4JQYA 2PKYX 3GJSA 1JGTA 4KE9A 4KQKA 4MCHA 3TNFA 5HKOA 5AUQA 5I9IA 2AH5A 3EJ6A 3QTTA 1N6IA 4L9RA 4DCVA 4AS3A 3GO4A 2HA6A 5HMLA 2J0SA 3NHPA 3H17A 4UHCA 5DYNA 5FUVA 3FFTA 4NNJA 4V0MA 1NL3A 4IDFA 4N01A 3U26A 6ADHA 3BGDA 3HJNA 1OMOA 4WXMA 5AW4A 2E4VA 1WUYA 2Q3LA 5D3QA 2G09A 3QKSB 5U4QA 2YXPX 3CEPB 5HR5A 5ALKA 1UBOS 1SO8A 3A1TA 4GUDA 4NEQA 4OQEA 3AEYA 1QRUA 4LHVA 1D6NA 3FX2A 3GVXA 2YJ5A 5EMLA 4Z2YA 1ULSA 1GSAA 4YXFA 5BRNA 3PUXA 2C7PA 2C5HA 2XKJE 4LBZA 4XTCS 5L3SB 4MJXA 5IABA 2REQB 1Q5PA 2D1QA 4EY8A 1PBTA 4ENQA 1YZFA 1IOZA 2CD9A 4YPOA 1QU2A 3CR7A 5BN5B 3A2NA 3IUBA 3NDBB 2BE7A 4FNGA 2FPGB 1U3CA 1BXRA 1KC3A 2Q62A 2V6MA 4QYSA 4R2KA 4RD0A 5KHAA 2N0SA 3HN6A 3IXMA 4HLDA 4R1QA 1Y9EA 3UTCA 5HK9A 3LL7A 3AEZA 3NNSA 1T5BA 3SC6A 2N46A 1F17A 4PSDA 3N7AA 1EYZA 2BBSA 4OHFA 1YCHA 4QDJA 3C6YA 1BDBA 1N2CB 5TARA 1F2UA 3WP0A 2OVBA 5T8KA 5A4KA 5HYVA 3PZRA 3VTKA 2H2HA 2IX9A 3MAJA 1RQNA 4ZQGA 1V6SA 4PNZA 2PFSA 3DV9A 3N8HA 4HYYA 3VHQA 1MQ8B 2J3DA 4D9BA 1GU7A 3RKRA 2DAPA 4Q4DA 2DQYA 3R7WB 3D7RA 3IE1A 1P1BA 4K86A 3V4FA 3DVAB 4GP7A 1EINA 5A9SB 1QIFA 1WMSA 1XHFA 1MV5A 1RT9A 1ZH6A 2YRFA 3K6SB 4CV2A 3PQ2A 2CJWB 2MMGA 3MWJA 3QEKA 4N3NA 4NATA 3KKEA 1U8ZA 4JB2A 1Z4JA 3ZQJA 5DBFA 1I4TD 4PN7A 4RVCA 4L0DA 4Q7JB 3DOEA 4RPHA 1ES9A 5MN6A 3KYCA 1W0KA 1Z4IA 2CWWA 3GJQA 2BGLA 2ZB8A 2EG9A 1QLWA 3MN1A 4EYEA 2NO4A 5HOEA 4PQRA 4UNQA 1E0JA 3DZCA 3DPUA 3CN9A 4NE7A 3IYLW 4Q48A 2VYCA 5BR7A 1N57A 3QH4A 4MI9A 3TQTA 1B26A 2H2DA 3B6EA 3LPAA 2XUFA 1KAHA 2LCIA 3I4FA 1JLHA 4IQ4A 1JWLA 3D0QA 1TQHA 1LVHA 1SPXA 3HVRA 1HQKA 4BATA 1YDGA 2GN6A 1X7ZA 2J48A 2P2SA 4JLBA 5I7VA 3G9XA 4D9MA 2CK3A 1NMXA 2HQ1A 4FQ5A 4KV9A 1AUXA 1ESNA 4BB5A 1H8EA 3HFRA 1KYZA 3FUXA 3O74A 2Z2ZA 4F86A 1RIIA 1M1YB 2NVUA 2GWHA 2C5AA 3EVDA 3FUCA 4J4HA 4FB4A 3KXLA 1FFHA 2RI1A 4UVGA 4G86A 2PX3A 4BKPA 5BWMA 3O21A 1PW5A 1SVKA 2IV7A 4XQ9A 2AZDA 4FFBA 4OX9B 1Q84A 4WDRA 1OJLA 3EGDA 1FRZA 4RKRA 5G02A 4KQMA 3AWDA 2H7YA 2F1OA 1JA1A 1JMVA 2VT7A 1MGOA 4WW0A 3B1VA 2QE6A 2XDQB 3DULA 4M53A 1L7MA 2DG2A 4U8GA 3TLKA 1LVGA 1UBCA 4GOMD 1M0EA 1WCXA 3E8SA 3NIDB 4R51A 5B3JC 3DAGA 3VSCA 4UUOA 16PKA 1WWKA 2H5LA 2RBGA 2XMSA 2ZWPA 4NCIA 1XEFA 5ALQA 4XYLA 3WBKA 1ZVVA 4R71A 4QUDA 3BRQA 3K0EA 1OBOA 4P38A 2ZSIA 4LYFA 4EGAA 3IUSA 3KSUA 4L50A 1Q15A 1D2CA 4NWIA 4R3WA 3SXUA 5KX5F 3C8MA 1C3EA 2E6UX 3H4TA 4G81A 3H11B 1RQGA 5CCEA 4ZOEA 5JH7F 4PGFA 1X7WA 4EWLA 4G4JA 1BE1A 5IN5A 5AKKA 2R68A 1FTWA 4B3GA 1EBFA 1WZUA 3O8RA 1QHGA 1UMCA 4K9MA 4Q4HB 4PYMA 3CWZA 1ZR4A 2G5CA 2PS1A 4KQJA 1ECCA 2BSXA 4YJKA 3ZWCA 3BE5A 3N2NA 5I8ZA 2R44A 2WWIA 2CWDA 4MB0A 3F74A 4OLJA 3TNJA 1L3CA 2NG1A 1DVRA 4FJ2A 1Z8NA 2XVZA 1MF7A 2H9IA 5HKKD 5EY5B 1I5RA 2GKSA 5FT9A 4BPRA 1U2SA 1IU9A 1IB6A 3EQZA 5CPBA 3VVLA 4F3RA 1GZ5A 1HO3A 1SXHA 2HM7A 2HLNA 3QLUC 2FUG6 2F64A 3BXFA 2R1UA 4I55F 1Y4SA 4K28A 2EKDA 5SICE 3WWZA 3VV3A 3ZXIA 3JZAA 4JITA 4WIAA 3BH7A 1T2EA 1FU8A 3HJRA 3UVEA 4ACAA 1B8NA 3BZBA 1XZPA 4QU8A 2JAUA 4MI1A 4MYRA 5J4YA 4QBHA 3IEIA 3L9XA 3R4VA 3I45A 1PT7A 3ZV7A 1UM9A 1TIPA 1TO2E 5SY4A 4MVCA 4Y9RA 1Z5WA 1N6RA 2FKNA 2J9FB 2VDRB 3LQ1A 1SG9A 3TIGA 4E11A 3F3MA 4TTJA 3FMFA 5BWOA 2C98A 3KUUA 2A94A 3W5SA 1E0KA 2HJ9A 3URKA 4F1WA 1JPVA 1T91A 2WYUA 4CHTA 2XMRA 3FXAA 3NC4A 1IB0A 2AD1A 5FCDA 4P54A 2GR9A 1E1DA 1P77A 5JBIA 5DNYB 1NVBA 1XXHB 2VDPB 4JI5B 4GQBA 4BMNA 2JIRA 4J43A 4QXAA 3RIGA 3W8EA 2C1ZA 4IJ5A 5TS3A 1ORVA 1T2VA 2CFIA 4MDYA 3V6LA 3RVJA 2QDXA 1G63A 2XA9A 4KFSA 3RJTA 1NDUA 1PJ8A 2ARKA 2FUKA 2A35A 2P5SA 3M6XA 5DJ5A 3SQWA 1YJCA 3TLYA 3H05A 4DTIA 3DTVA 3AP1A 1D0SA 3IDSA 5JNVA 1GNRA 1DZIA 1X0XA 2WNSA 2IE0A 5A5DA 1I1NA 3DCIA 3LECA 4K8OA 2IIBA 5DTMA 1J8FA 3RLFA 4B3IA 3VO2A 4Q3BA 5JVDF 1F0PA 4MRMA 3RQIA 3MINA 2AUNA 4Y8VA 4BO0A 4EB0A 5FR1A 3ITNA 3TH5A 3BHJA 1G8AA 1A5TA 3G2KA 3WIVA 1YF3A 2FP4B 4GI1A 2JCSA 5K8TA 3GEIA 1XZNA 2UYQA 1NXXA 3KLPX 1YNSA 4OHMA 4X92A 4C5AA 4V0QA 4Y1FA 1U0SY 1LCIA 2PBRA 4GQAA 3CEJA 2IEYA 5JNSA 2BY4A 1JI3A 3G0DA 1KYWA 3LSYA 3K1AB 4U2CA 2JAQA 4KWIA 1EUCB 1TYDE 1U9YA 3QBJA 4MWDA 2G1JA 3V1TC 2NIPA 5LMUB 1WBDA 3RT9A 4KW7A 1GCIA 3UJNA 1XTZA 2NSJA 2XEDA 1QUEA 2BFCB 3CUWA 3E1KA 1FDOA 2P27A 4TV8A 4ND2A 3T3MB 3UUFA 3EW9A 4CHGA 4M55A 3ROKA 2WC1A 2VHVA 3TNLA 3RYHA 1VYTA 4E5UA 1T9GS 3G1TA 2GEUA 5JSZB 5MGBA 5EIOA 3ED1A 3U4MA 2DLDA 5A5GA 2R97A 3GUHA 1UXOA 4OGKA 2PZBA 2ZUUA 3A10A 4R9SA 2CZCA 2XB4A 1AHNA 1PLLA 2JASA 3RSOA 2B4RO 1BIFA 5TY0A 1SZCA 1TO1E 4AZ3A 2V3WA 4AKTA 4LCBA 2NU9A 1EDZA 1WS6A 3WQHA 5JIBA 1PKEA 3UMRA 4X3PA 2QPTA 1US8B 1G8JA 3ESQA 4QSHA 4DANA 2EXXA 1EKXA 1PGQA 1DDOA 3CEHA 3EC1A 3L79A 3M4YA 1AA6A 1P9LA 2D5BA 2VDKB 2P4UA 1ZGBA 2Z5FA 2V3CC 5HFAA 2J32A 5D7NA 3PFHA 3T7TA 2W58A 3ZIAD 1WVMA 1JE1A 3PCRB 5CNMA 3ZDCA 1M2GA 2H2FA 4BCDA 1ZGJA 1V7QA 1RQ7A 4BFZA 1PGPA 4QNRA 3K0AA 2QJOA 2AEMA 5FOXA 3AEKA 4HMOA 1FLDA 2XIJA 3QE4A 4NZNA 5EJIA 2E5WA 2PHZA 3MXTA 2ZE5A 5EMKA 5TMDA 3VYWA 4EHNA 2ZJ5A 5EJMA 4C7KA 2J08A 4R5HA 3N74A 3X2FA 2QZSA 5J4LA 4W5RA 1R3UA 1GRVA 1Y3HA 1YRWA 3D8NA 4LTDA 4AIIA 4LA4A 2ABWA 3BFJA 1JLSA 3QQPA 3QFTA 2DBYA 5BSWA 5A05A 1O89A 4N65A 1R1DA 1XCLA 4GOJA 5K0SA 4TMKA 3ZVMA 3TVTA 2I80A 3ZVNA 1G3IA 5B58C 2Z30A 2H3EA 2WT4A 2HCRA 3FF4A 4Q3CA 4I1PA 1PFVA 4Y9DA 3DGEC 4TL8A 4ZEVA 1ISMA 5IKEA 2ZKIA 2AEFA 3PNSA 3ZU3A 2PZFA 1XT6A 3GR6A 1JEQA 2VEDA 2NNLD 2X8JB 4PPGA 3V8RA 4E22A 1Z5VA 1EVLA 1F9EA 4DY4A 1P75A 4R68A 3H6HA 1WU7A 1ESCA 4C0JA 1LDEA 2D0IA 1O2DA 1QGOA 4KXXA 1Z29A 3RNLA 2EKQA 1FNMA 4HH4A 4PCLA 3A3YA 4QOGA 2EFHB 3SYTA 3QWBA 1DMSA 1VI6A 3WVNA 4ND8A 5F3DA 1N2BA 2HIHA 4JLMA 2Q2WA 2QYTA 3OF5A 2AF4C 5JYDA 2IKSA 4NCAA 3NBFA 2JH8A 4QX6A 3ZVLA 4ZT3A 1A8PA 5G3YA 5IT4A 1NI3A 1SBQA 4LZZA 2H4HA 3KZVA 4M1QA 4R7ZA 4UD2A 5HRAA 3GLFA 1PJ2A 3II6X 1KVQA 2IYOA 4XSVA 1C3OA 2C9DA 1E20A 3LT2A 4RKFA 4CM9D 4FGKA 1KY2A 1OBVA 2ACKA 2GZAA 4DG9A 1QVWA 2QG4A 3KZ1E 5E6SB 3UGTA 4JI4B 4TYWA 5LA6A 3H0KA 1RI1A 1ZXLA 1JFFB 5IASA 3KKMA 3TW4A 4D46A 1CUIA 3QENA 1ZN7A 5CG2A 2KJQA 3UBTA 3ZBQA 4BBPA 4OYHA 2J4FA 2WD8A 4FFOA 5HKKA 5CLGA 1JYFA 3BH6A 4IUYA 2IF2A 3OH8A 1J8MF 1IXZA 3RS7A 3V55A 1UJ5A 4KXQA 4U5XA 1QHSA 3KBOA 2F3TA 4U6QA 4UBLA 2B7LA 3SC2A 4MRNA 3CO0S 4MCAA 1AKYA 1L5QA 3EFOA 4AWBA 4RD2A 1E0DA 4H18A 1V9LA 2E4WA 1FFAA 4LJ9A 2DJIA 4M88A 4PWZA 1N3YA 1YVRA 2O05A 4XA8A 3U19A 5GZ3A 2OOSA 1A9XA 2IH2A 3G89A 1R88A 2VI5A 2YCBA 4WZZA 3VR5D 1QV6A 2Q41A 4PO9A 2Q5IA 4D3SA 4LGMA 1XZKA 2OM2A 5I4KA 1QOQB 2I55A 1Q0UA 1L4MA 2XQVA 3PJEA 3WLSA 2JCXA 1TPZA 3QI2A 5CDSA 4MPDA 3BXHA 1E7RA 3GV0A 4FD2A 3VNAA 3EN0A 3ETNA 4FVTA 4CMAA 2DUJA 2BISA 2QL9A 1HNNA 4K0RA 1YMQA 3LZDA 2BAGA 2WR8A 4XCXA 1ACMA 2CDNA 1P5RA 1CVRA 3EG9B 3LP8A 3DB2A 3EFBA 2I22A 5C7YA 1L5YA 2JGFA 3PXAA 1L5VA 4TUYF 5K09A 1CVLA 4RF5A 3B6IA 4CGYA 2B6NA 1I1HA 1JG1A 2QRNA 1XF9A 4G0QA 5EG5A 3K05A 4W5JA 3PX2A 1ZHOA 2DHDA 3DL4A 2D5IA 4MWEA 2IYNA 1QO7A 4E5PA 1QDEA 5DX8A 5HTKA 5GGYA 4YHHB 2H8GA 3A4NA 3LQ4A 1H9AA 1UP7A 2WJHA 4B7CA 5HTOA 2X0JA 5EMJA 4R41A 4GYWA 3GAFA 1GP2A 3V4SA 1M0TA 5AJUA 1TF7A 1OA0A 3GFSA 5T8KC 4AMUA 1DWPA 3GDWA 4G1BA 3PSAA 5CJPA 1HM5A 1MTZA 2G6BA 3GZTB 4MRRA 5U1PA 3I3SR 5A62A 2NVBA 4H6PA 1NR1A 2Q0XA 1C8KA 4NESA 4OVKA 4DIOA 3WL7A 2OO7A 1KK3A 1KR2A 2WZCA 3O82A 3DWFA 4EELA 2SKDA 3O4HA 3OKCA 2EJUA 1O9GA 2X2EA 4KYTA 1TZMA 1JHRA 3CF0A 1JP7A 3SVTA 2XUDA 3UGKA 1T35A 4L16A 2CUKA 2QL7A 3T9FA 5EMHA 5FORA 3K9CA 3L46A 2NTNA 2RKBA 3JU3A 4AWXA 1UBJS 3R3SA 2P9QA 5FO1A 4YDRA 1T8RA 4KRYA 3RIMA 1YJAA 1TM2A 1TZCA 4C0KA 2QP4A 4PQFA 3F6EX 3S40A 4KGVA 3TL6A 2HLHA 5IU6A 3S2IA 4F6LA 1K6IA 1BDMA 1BS1A 1HI9A 2AXPA 1R0SA 1U0EA 2SECE 2XKKA 2UVDA 4IYJA 1OXTA 1FB5A 4ZIRB 3H87A 1JFTA 4ZV9A 4ZCPA 2QBYB 4JEUA 1BXRB 4NSNA 3ZIAA 2VN8A 1YACA 4QQ8A 1IQ0A 3BXGA 4B45A 3EWSA 1A9TA 5HQ3A 4JZYA 2A30A 4A5SA 2F43A 3AX6A 2FX2A 5CYFA 5LDDC 2Z3ZA 5DM1A 1Y1SA 1IG3A 1QS0A 3N0RA 1SWWA 3W4JA 4EVQA 2VWGA 2ZJFA 3S1SA 4TLDA 3TEMA 1ZISA 3VKFA 3VKUA 1S2LA 4W7IA 2BZGA 1KXZA 5INTA 3AJAA 1F2UB 3DZIA 1RTTA 3UG6A 5JEEA 4ND6A 2FK8A 2IUYA 1T3GA 4NK5A 4A92A 1HPLA 2WIGA 4HWSA 4PZCA 5FOWA 4B1FA 1XP5A 2BKAA 4BGEA 4XDGA 4ZOBA 1XAGA 2XUIA 4F7DA 4YCNA 2WRZA 1CRZA 3N76A 3VDNB 2QX4A 2PQ0A 5GONF 3K70C 2EJWA 4A3SA 3QOXA 2D1SA 1FQWA 4I4TF 2O50A 3OPQA 4MUKA 1GUFA 4CT0A 1B8PA 4AZSA 1RPZA 4DR6B 1PSDA 1U02A 3GPCA 4FEAA 3GYGA 4E5NA 3T7JA 1QVZA 2JKVA 1A2QA 5KBYA 1J8QA 4GE0A 4HX5A 5CA1A 1HT1E 1U7WA 2HQOA 3DV2A 2P7HA 3GA0A 3KYCB 4PX5A 4C21A 2GT1A 3ZIUA 1ZP6A 1PD1A 4Q3OA 4O4IF 1L8QA 3ZH9B 4FNMA 1LTKA 4KIJA 1RRFA 3CZPA 4CYMA 2DLCX 5CT9A 3CYFA 4IILA 2IHVA 2HV8A 4Z8XA 3R8CA 1W9HA 1DQSA 4CM9A 3HXMA 3RYTC 2OV6A 1QB7A 3LUKA 3B12A 4G1VA 1C7RA 4KPUA 2HGSA 4JGGA 1T6ZA 2H1IA 2VAVA 2X5KO 2FG7C 2P9CA 1YZYA 1L7OA 3OT5A 4RGBA 1VPWA 1G7CA 3N28A 2EBUA 2P9BA 1I2CA 3UK6A 4IS3A 1T8SA 2HI0A 1J22A 1X7ZB 3Q5EA 4ZHQA 3PX7A 2PR7A 1X3LA 4HRVA 1EE2A 2WT8A 2JVJA 1L9XA 3K96A 3I1JA 4WQMA 4DDKA 2O57A 2JLXA 1T43A 2VF4X 1P9WA 2PN1A 3LQFA 2NVUB 1M54A 5LOVF 4MINA 2Y4NA 3F1KA 4IFBA 5BNWA 5LKAA 2EX0A 5DRYA 3RYCA 4BL5A 1X1DA 2DFKB 1DV2A 2PUTA 3GN2A 4FFBB 3S2SA 3C48A 1DFIA 3LO8A 3VR5A 3M4ZA 2H4YA 3KKKA 5BMOA 3EGDB 1YA8A 4OJYA 3UAWA 1T36B 2VH2A 1SCAA 3NYIA 3V32A 3WMEA 5I48A 1YQTA 2WHRA 3RT1A 1LD3A 5A1JA 2X9NA 4WVLA 1RDFA 3HFSA 4JQZA 4M99A 4C2BA 4XVQA 3WLAA 1F7VA 1U5BA 2P78A 5SYNA 1WX1A 4CLHA 3C3BA 1ZM9A 2C7VA 3LC7O 5E9QA 2XOXA 4OTZA 4EECA 4FE7A 4LK2A 4ALIA 2ZBQA 1Y6GA 2CVQA 2N9UA 2LDXA 3CS3A 1ZG3A 2QT9A 2UZ0A 1SQ6A 1ZMBA 2NWQA 2BFDA 2H8KA 2V5UA 2QYHA 4QPNA 3SXUB 1YRBA 1JHDA 1YS1X 1C3JA 1NULA 1LLUA 4AO7A 5ILOA 3E0QA 2V4UA 3W6UA 4AIRA 1HX7A 3FWPA 2QUBA 4CL3A 1KEZA 5LZ8A 1X7WB 3HN7A 1MVLA 1EU1A 1KU6A 1QYIA 3GAMA 4NDZA 3MWKA 1T1JA 2WIDA 1RE1A 4MLPA 4F06A 1RLTA 1UMCB 5JSYA 4KWTA 4K6GA 4BLTA 5BQ5A 2BP7A 4IIJB 3OF2A 1E2MA 1Q0HA 3MPUA 3W5CA 4ZVRA 4P2GA 5EIFA 1LSSA 3FCCA 3ETLA 4YMIA 1S02A 5LM3A 1Z5OA 1ZWKA 3T3HA 2QMQA 4ZYUA 1GTJ1 5JHHB 3DL0A 4L8FA 2XTMA 5JUWA 1E61A 1T15A 1UFKA 1A9RA 4LDJA 5FL7D 3JQPA 1L6IA 5EZQA 4PHTA 5DK4A 1CJKC 1LTHR 1T3LA 2RDMA 1HLPA 3EPPA 3OFSA 3LVBA 1MJGM 1NUAA 3LRTA 1VE1A 2IIPA 3TTWA 4X62B 2UYHA 4O4LF 2FDXA 4XM0A 5U9CA 1AGNA 2G82A 4MGYR 3Q12A 4RF4A 1VI5A 4XLTA 2R7NA 5EGSA 4V1CA 4UHDA 4A6DA 3OI7A 1T3ZA 3KAJA 4E30A 4N0DA 5DGCA 3L06A 4J75A 4Z9AA 5DWQA 1YR6A 2BGTA 3V8PA 3D0KA 5KWSA 2OFPA 5HP4A 1IMOA 2HHJA 2CXSA 1UBEA 2WDZA 3LNTA 4MV4A 3VNVA 4G1UC 3PFBA 1E1QA 3ZNQA 4WMLA 4F11A 1T2FA 2VJBA 5CM8B 4MV8A 2EJVA 1MENA 2V7VA 2CXTA 3D6HA 5JG7A 3TUJC 4A73A 2EP8A 4K9SA 4DSZA 3LVQE 4YC7A 4UNPA 3OCJA 1GCAA 2KLBA 3VKVA 2WSLA 3LFTA 2VA9A 4WJLA 2FUCA 5EXXA 5TR9A 3HA3A 4TXHA 3PKIA 3QUBA 1OXMA 1VGQA 4KXNA 2Q3CA 2HA4A 1RAHA 1YMUA 3GHYA 2VH1A 1GADO 1MRZA 3N05A 5MDHA 1S8OA 2BZ1A 3HSKA 4IH1A 3ZLBA 4BX3A 3OZIA 2VRWA 3ZQ6A 2BMWA 4MGEA 3DTVB 4OL9A 4YREA 2PXAA 4I1YA 5JNWA 4N48A 2V7GA 2BW0A 5JAIA 1EJ6A 1XGKA 1WDTA 2B1RA 4LZJA 2GN0A 3SSNA 2Q1UA 3R3HA 1THZA 2JIPA 4MVJG 4O59O 3LA8A 3MINB 2FWAA 4UBJA 4WDQA 4OXRA 3LX4A 2J6CA 3EBOA 2H2WA 4BNJA 2P9JA 3LUCA 4EJ6A 2YICA 1OROA 3QI7A 5EXDA 3RFFA 1AGYA 4QLBA 3KLBA 3S2YA 1XJQA 3CX7A 4BY9E 2ZDGA 3X1DA 2IZ6A 1HKUA 5NLLA 1I1QB 2JS7A 4JI7B 1E4EA 4PAQA 4IVRA 3R3VA 4BP9A 4WSOA 4RK1A 2ZYSA 3L4EA 1RXYA 2Y0PA 5DISB 5EIWA 5LSAA 1O54A 4IDAA 4TV8B 4YIKA 5I9BA 3FBTA 4HDCA 4IOJA 7MHTA 3A7DA 2IFTA 3TO5A 2JAPA 3MT8A 2P67A 4HQOA 3WLTA 1EUDB 3WICA 2V9PA 5B4VA 5BR8B 4WADA 1L4HA 2PVCA 5FOTA 3R76A 3VZRA 2GXAA 3T38A 2OBYA 3HEMA 4QEDA 4WGFA 5D51S 4EGQA 2J0UA 2EGUA 4PHHA 1IWBB 1PD0A 4AZ3B 1EBBA 3PRYA 4R2LA 1PZXA 4H1WA 2CLIB 3FYUA 4BO4A 1Z5UA 2IK8A 3LXMA 4OKNA 4UBIA 2IBTA 1K8QA 2AJLI 2PRIA 3UXYA 4ZYTA 1XD2A 2V7WA 5K4AA 4X7MA 4NBRA 1T1RA 2I34A 1V71A 1DKNA 1FUUA 1NVXQ 1TUEA 2PZLA 3LKDA 4HTAA 4N6OA 4BNLA 1ZR2A 1N34B 2FKAA 3HUFA 3QE2A 4DEVA 4DM3A 3U3KA 4EB6B 4S24A 4HWKA 3K0AB 2QE7A 5LDHA 1LWOA 3AEKB 3IVCA 2PJRA 5HRUA 1SU7A 1ZRMA 3E15A 2WYOA 3CW9A 2P2GA 3V7YA 1F12A 4WNYA 3RGWS 4WASA 1ISSA 1Z0DA 3BAZA 2GLUA 3EXEA 4GRAA 2NYUA 1DWQA 5DGHA 2PPLA 3H7AA 4HYTA 4QDOA 5DFAA 3H65A 2BGMA 3F6BX 3RRJA 4C08A 3CB4A 1XQYA 4A16A 4NLLA 4PQYA 1NJ8A 3RC1A 3RSGA 1DO8A 1QRDA 2HK6A 3K1YA 4ZXFA 5T64A 4L74A 5HZMA 2FDRA 1P7WA 2Q9UA 1IAQA 3M70A 1M6HA 2CFCA 1JEQB 3DEKA 5TT1A 4DM4A 3AFOA 3KWLA 1JDPA 2E1PA 3S29A 4DDTA 1J1UA 3HVKA 2GDJA 4G8CA 4I9UA 2XTNA 5B7PA 3WRXC 2ZWOA 2XB6A 4YCSA 1RKVA 3O3OB 3P4UA 2QJTA 3P9YA 4OQPA 4RIIA 3WK8A 4D0NA 5I7OA 4RLFA 5ABPA 2RHDA 4YFVA 5IEBA 1OGYA 2IP2A 3L1IA 4PXSA 4ZZ0A 4GEKA 5L4SA 3GLFB 4DREA 2GD0A 4MQFA 2ZXEA 4H1VA 2YJ6A 3R7AA 1V8OA 3DOOA 1C3OB 1O6BA 5AR1A 2I3GA 3R7FA 1MJHA 1TFUA 3QUTA 5A7HA 3IXQA 1ISRA 3MUNA 2P3SA 4N5IX 1D4FA 1ZJ5A 2XGSA 2FW7A 4BCCA 2YXDA 2ZIZA 3CRQA 1MABA 3QUSA 3AVYA 5CURA 4B6JA 3ANNA 3RHTA 2XRFA 1JU3A 3Q87B 1KJWA 2CB0A 4RXMA 1N2IA 5HE9A 3ZE1B 5J4KA 1GL3A 3I2YX 3RKSA 4EHIA 1JKFA 1IBCA 1NXWA 3SC3A 2HV9A 3EFOB 4H31A 3H99A 2GRJA 4UCQA 1SUDA 4BNGA 1K7SN 2CEAA 2Q3FA 4FFSA 5JV5A 2YFKA 4BFSA 4X64B 1XVVA 1MDFA 5I51A 1B0UA 2G07A 1AUQA 4LQDA 1XAJA 4TWIA 1XKLA 1J42A 1ZD4A 2FCAA 1F4PA 1PS0A 3I9KA 4R2MA 2BMJA 4RY2A 1BGXT 3KHSA 4LSZA 1GLGA 4YRSA 4JDUA 3H18A 4GMKA 3TCXB 5JZSA 1HE3A 3DUFA 1XYYA 2P6RA 2IZ5A 4NYMR 4DCPA 5CA0F 4FCVA 3W06A 2ONYA 3UNXA 1GPNA 1JBKA 2WNHA 3RU7A 2YYAA 1WUTA 1AD2A 4NYJR 4U4AA 1JDBC 4FW8A 4JLDA 5ESXA 3K2IA 5KU1A 5HW0A 1BMFD 3MC1A 4FDMA 1KOFA 4CNBA 4HO1X 4A6PA 3GJXC 2VNAA 5A7GA 5JQGB 3ORQA 2PRKA 3C41J 4GI3A 4EVRA 1S1CA 1P7ZA 2PS9A 4HY3A 1AMOA 4Y6OA 4BNZA 5A0FA 1IPHA 2ONZA 2OY0A 1P2VA 4CR6A 3JTMA 4Q05A 3GLTA 3N87A 1S9DA 3O8CA 2OAEA 221PA 3M6AA 3QA9A 3B1JA 4COKA 4B0PA 4RIEA 4DV6B 4L6AA 2XZPA 4PF1A 3VR6A 4FOTA 2V4ZA 4RTJA 4DMLA 3HZHA 1IN8A 1N0UA 1L7EA 1QBKC 2FQXA 1KP2A 3I9MA 4LAFA 3X2EA 3WBFA 2FOLA 2PEZA 2A84A 3LRPA 1H2BA 4L28A 3VISA 4GBGA 4Y2GA 4DMGA 3UAVA 3VNRA 1SVMA 4IJUA 2WP8J 4EY4A 5BN4A 3RLIA 4AF8A 1DQZA 2PUWA 2DWQA 4MVJP 2IYAA 3HLKA 1IK4A 3KRTA 4J3FA 3A3NA 3THYA 1CEYA 4COOA 4GPAA 2IYLD 2Z56A 4EVSA 1BU5A 1GFSA 1CIJA 4F9TA 1NNLA 4MKHA 1AMUA 2D3TA 1YR2A 4IOKA 1H4TA 1VIYA 4MYUA 5BW5A 1VCNA 2IITA 1JR3D 1Z6AA 5COAA 3DLIA 1JDBB 4OHYA 2ONKA 3GJ4A 2PZMA 3CNOA 2XNDD 1Z4PX 3IT1A 3K9LA 2HCTA 3I09A 3KEQA 2Q3JA 3IR5A 4NJMB 4FOSA 5IDQA 5HPYB 5DLDA 3JALA 1X9HA 1P17A 1OT3A 2X7HA 4IJQA 4UU0A 2C99A 2CJFA 2X4IA 3BSFA 4AG5A 2J5BA 3CLKA 4UDXX 1P6UA 1A96A 3HLYA 3KM0A 5B4UA 3DBRA 4B4VA 1P1JA 4DBLE 1MH9A 1VPTA 3JRXA 3N59A 1Z8FA 3JQQA 1MVNA 3QRWA 5FR2A 4E07A 2R7AA 5HQ3B 2PWZA 2JFWA 2R8EA 3A6GA 3M82A 5ED0A 2F43B 3WRWA 3M0EA 1SUIA 4OJMX 3KWMA 3DA8A 5ELLA 1QS0B 1I51A 3QPUA 1W34A 1E2HA 4PSVA 4DLBA 2B30A 3HJCA 1BH6A 5AKLA 5AKGA 1EBUA 1X8XA 3BMOA 3AJ8A 3GRAA 4X8OA 3RAJA 5T6MA 3KETA 1B3RA 1KTVA 1Z0UA 2IWRA 4BVHA 13PKA 4RJKA 1IY8A 5EKSA 4PXAA 1RWOA 1EGVB 1VBKA 1NSYA 2AZTA 2BR4A 3MCZA 2ZAOA 4RQAA 3HUTA 2HC9A 4V1CI 3ZBTA 4CFSA 2WJWA 3HZRA 3UT5A 2BHSA 3F3YA 3P0HA 1RJDA 1KOLA 3L93A 2CXUA 2XNHA 2FXIA 3JD4A 3VSEA 3EC2A 2ZSBA 4M22A 4TZ6A 3RW9A 5KQGA 4JDPA 1RCFA 1ZA2A 4PS0A 1WSWA 4RMIA 5GJBA 4EPWA 5FI1B 1CW2B 3BYZA 4I5EA 4X0EA 3QNUA 5DM0A 4FWBA 5DBHX 1PR5A 3MJSA 5AXCA 3FTEA 2FHSA 2I99A 3BQ9A 3OQJA 4UHJA 5B2FA 5KKCA 1CUFA 2N75A 4PZLA 3D8RA 2WNIA 4MGKR 3V4LA 3G2MA 5CA1B 1Z33A 5K0FA 4KOAA 4J7CA 4LJ8A 5DBEX 4DPKA 2RAVA 1ESZA 3DAYA 4XQGA 1IY1A 4UTOA 2AFIE 4V3CA 3FI9A 4TZTA 4X24A 3TLAA 3AMVA 5HKBA 1OJ7A 3TYXA 4RXUA 2CBZA 2AK3A 3AY0A 4JXJA 1EPUA 2COUA 1E2GA 4KPUB 2PKWA 3L0PA 1RNLA 1Z18A 1SCNE 2N1MA 1PX0A 4ZEXA 4C7VA 2JF0A 3MBKA 3L6BA 2I4MA 3VRHA 2IZ1A 4E70A 1DHRA 3HSSA 3N8DA 4EZEA 3CCFA 4B46A 3GZ4A 1E2JA 1R6BX 2AFIA 4F91B 2PANA 4ZHQB 4J9UE 2X0EA 1K97A 2WJYA 2HU7A 3DLPX 5CA0B 2WJZB 5JRJA 5LNK1 5FTLA 2YXEA 1WOYA 1XMXA 3TD9A 4UHEA 3V34A 4A9AA 3W5AA 3JYPA 5IUKC 1K4KA 3DMFA 4E5KA 4TMXA 1H4SA 2VSNA 1ZI6A 2AKYA 1G4HA 3KJXA 4FXPA 5BSMA 2DZDA 3L82B 3LIIA 5G4LA 4A1FA 4EI8A 4UFPA 4AJEA 1PVDA 4UBOA 1U3VA 2ECQA 1Q0QA 2NTYC 4R1LA 2ZBFA 4KFRA 4X9XA 5G3ZA 3RYCB 1PJRA 3EQ2A 4E3ZA 3B1YA 1C3VA 1JPNA 1NTOA 1R27A 4P7BA 1RMTA 4HEA1 4RCYA 1ENPA 4MO9A 4ZO9A 3GJ0A 1NY6A 4EZBA 5C7LO 2JIBA 1MBZA 4LY9A 4YN3A 2NQ2C 3DE7X 1LBEA 1YS6A 2PR2A 1F20A 2ATVA 4MW5A 3VR6H 1U5BB 1EXNA 5EUQB 4XFJA 2CLSA 2DKOA 3BEOA 3QY0A 5IDYA 4LOJA 2OXTA 2H08A 3AHHA 3MS2A 3PI7A 1O96A 4GZ3A 4YMWA 4BO7A 3V8MA 4BQIA 4EYQA 1BMFA 4TWRA 3CJQA 2DHQA 2OXEA 1GOTA 4OY3A 4R0MA 4I3HA 4U7GA 2FSSA 3AERB 1CRWG 2B9EA 1IN5A 1VKJA 1XDUA 3HBJA 5F64A 5K3AA 2EW8A 3QE3A 1CKEA 2BFDB 4NY1A 5DXFA 1LDGA 2AF3C 3TSCA 1JZTA 2EX4A 5AK0A 3IP1A 3WG9A 1DAIA 2I4NA 2Z57A 2AZXA 3AHCA 3KQTA 4F4IA 1FYXA 3QVWA 3JR7A 1B8VA 4P3XA 1L4FA 4QM6A 1OX5A 4Q9DA 5ALPA 2QTWB 1FXUA 2QLJA 3ZR4B 1NVUQ 1DG3A 4H3VA 4ABYA 4ZCMA 5CITA 4FNOA 3OU7A 4Q1BA 2OA0A 3U4DA 2V58A 1H1LB 4OFWA 1ONOA 1MAVA 3MCAA 3PIRA 5G0VA 4BLQA 1IHXA 4JP2A 3ELBA 5JYCA 4MRAA 3U6KA 4G0WA 1N5LA 3G0CA 4MV3A 2O52A 3BTOA 4N7RA 4MA4A 1EWRA 5G0WA 1OI4A 1ZHFA 3TEFA 3GCXA 3PHIA 3LC2O 3ZV4A 1NF3A 4ZAXA 3USCS 4QBFA 4QUHA 3FPCA 5SZKB 3ABSB 2WU3A 4UM8B 4WK0B 1XC7A 4N49A 1PNRA 4LRYA 3TR5A 4WD3A 1QANA 1RQ2A 1WIWA 1ZW6A 2AR9A 5JD4A 5F1YA 2D7CA 1ZI9A 4J0IA 4KLRA 1GRRA 2GJ9A 3W7AA 1CZRA 4ZQHA 4BVFA 3U4QA 1JR3A 3EAQA 2F8SA 1KH2A 4V1CB 4NFLA 4RENA 2DF8A 3S99A 1SVNA 1XLUA 3H6KA 3LKBA 2I4LA 4KU4A 4WUVA 2XNDA 4BRWA 2E4ZA 3VHLB 2CF6A 4HQKA 4EG4A 4J3JA 1CZLA 4MI3A 5AJXA 2CXNA 2NYAA 2J33A 3RC9A 1J2EA 2A9PA 2MU1A 1IQPA 3AEQB 3B7GA 3OTHA 1OY1A 2AJBA 1RAIA 1ZY2A 3L84A 1ISFA 1CVIA 4YTEA 2R96A 1ICEA 2QSJA 1NLFA 3OZAA 1H93A 1FNCA 1LF5A 3CRW1 2GYUA 3KVVA 1TM5E 4R3NA 1IH8A 4DCTA 4RVSA 4MVJE 4ZCIA 5IM5A 1UZNA 4CE6A 1VPLA 3HLTA 1NYQA 1YVDA 1NF8A 3HHEA 3HN2A 3R3ZA 4RLSA 3KS9A 4CZ2A 1R9MA 3I2FA 1N5JA 2QLLA 3NCTA 1I6MA 4WLNA 4DV3B 1Y3AA 3FYUC 2VBGA 1XK7A 1UOQA 3GJRA 1L5ZA 1PIWA 2G25A 3G8AA 3K15A 2Q5LA 1Z0KA 3A1DA 2OZVA 4KI7A 4MVJA 2VXCA 1G55A 3JQ9A 4EI2A 5EN4A 3SFZA 1SOAA 1ZL2A 2VUHB 4ETWA 1EXDA 4QFBA 2WF6A 4BVBA 3DOUA 5B7QA 1NZDA 1YKSA 1Y5MA 2WWWA 3GGPA 4HXYA 3ZCRA 2Q6VA 3KZOA 3GEBA 3WZMA 4A0QA 2B1QA 2GEJA 4Z9XA 3UOWA 2EYUA 3EGXA 2H9AA 4QDKA 4U7JA 3CRNA 4M1WA 4POAA 2G9ZA 1JR4A 3GMSA 3KQMA 3OZFA 4ZOCA 3E7PA 4YP6A 4DLVA 2NSYA 3RFUA 1C9MA 2V7BA 4F8EA 1M73E 2D1FA 1CX9B 1E4EB 1PJCA 5FNZA 4AN0A 4EMSA 4U7HA 1W2GA 3I9JA 5KSOA 3EQ9A 1JKJA 4I1OA 4WY5A 2AX4A 2RH8A 4QU9A 1J1IA 2QDKA 2WWYA 3QJ5A 5IARA 5IJ0A 2X40A 2NADA 2CUZA 3DEYX 3BS4A 3V4VB 3H5VA 4FMDB 1UZMA 2OZPA 1R5OA 1V7PC 5EP2A 5ER6A 5GY7A 4AX4A 3MWLA 4R1MA 5CMLA 1B6RA 1BWPA 4AF7A 2J0UB 3OG9A 1M5TA 1I7QB 5JSFA 1J6UA 3KVYA 4CF4A 1X39A 3THSA 3FYUB 1TTQB 4GR9A 2ECPA 1V2GA 1N8SA 3MELA 4PC2A 4QUAA 1XD2B 2C9MA 2B61A 3MJFA 5ALVA 3PS9A 4OUKX 2A1TR 1CR0A 4ZC1A 1K92A 3JD0A 1CUEA 3C3DA 4L0QA 1J39A 4QPDA 3ZWXA 2PWPA 1B93A 3JQGA 1G6OA 2KHZA 2ZBGA 3KKZA 4M3NA 2RGCA 4YAIA 5JJLA 4NFYA 5DLPA 4E7PA 4Z3DA 1Z6XA 1X1BA 2PLAA 2XJ9A 3HNPA 2WFMA 1KPGA 2Z2YA 2NP7A 5CVEA 2QD5A 3PT5A 3E61A 5AVJA 1PZEA 3TMAA 1I3LA 1R0XA 1P29A 3EXEB 2WILA 1USWA 3AM1A 1AO0A 5FPSA 3TFOA 1NVWQ 3H1PA 3RAEC 4X95A 4RDXA 1MX3A 3FAKA 3VBCA 2F55A 1EG2A 2DERA 1WUJS 2FPXA 1TF2A 1J7JA 2PVSA 2Y68A 4X91A 4WX2B 5DYIA 2PBZA 1AHHA 4Y2SA 5H3HA 3TGPA 3ZHOA 4P92A 2CSUA 2QTAA 1TLFA 1E2IA 4YS6A 4CM7A 4NU8X 1SU8A 3MD9A 4C06A 1C7FA 5DNUA 3NU1A 1IZ7A 3T3GA 3JCZA 1ML3A 1PLJA 2RGWA 4Q9HA 4UNRA 2XXAA 3OJCA 3R5JA 2GDZA 1P7YA 1RVV1 3C6XA 1TZ2A 2BEVA 1XBTA 5U4XA 3EUWA 5IT5A 3JSXA 2MHCA 4DM7A 1UDAA 3NDPA 4ZVSA 1L1FA 3ODGA 3ZWYA 3KEFA 3DZ8A 2WWTA 1V3TA 1D9XA 3H83A 3I0ZA 4MQFB 4N8SA 4Y7CA 1R6DA 4D9IA 1ZU5A 2DGDA 5COQA 4Q66C 3ICEA 3OE7D 2ZTLA 3NUQA 2OHOA 1C8BA 2VUIB 1JECA 2HRCA 1NVDA 4GOXA 5I9SA 3QKUA 1F6WA 4B8ZA 4NMWA 3U7HB 1ID8A 1E9CA 2V59A 3BMCA 4DF3A 2WG1A 3W2HA 4BAZA 4QOFA 4XXHA 3GGOA 3SAJA 2I1WA 4DNQA 1FCJA 4YUVA 2I87A 3DE0X 2PMEA 1MABB 2A92A 3PNQA 4F6RB 2YW2A 4DC1A 1KMHA 1JPUA 2BMVA 4RTPA 2IZZA 1IPEA 2B5WA 3NASA 1VDZA 4DEXA 1E18A 2PLWA 2PIAA 5KVSA 2QL6A 2A5FA 2JFHA 4JOQA 1UPXA 4X6LA 5BVHB 5CYOA 1HDOA 3U13A 5DMHA 1B7GO 2ZGVA 5ESWA 3B6JA 3S5UA 3W7BA 5TIIA 3EEIA 1PSZA 1YQ9A 1LI4A 4HDKA 3COZA 1UFOA 1AXGA 2EG5A 3CUSA 1PUXA 3TJZA 2CNBA 4FYVA 1QWOA 4K9NA 4R1TA 4MVJH 4B83A 2VJMA 1U99A 2AG0A 3UAYA 5DBOA 3BPSA 3DUFB 4P93A 3WK6A 4YAGA 1I8TA 1P6QA 5JANA 3IP7A 1ID1A 3OPVA 3DWIA 3LPNA 1THTA 3OQHA 4F04A 3A1CA 4DFDA 3LUJA 3UPTA 3MHTA 5AW1A 1EX1A 1G8SA 2DCUA 3HR7A 3K73O 1TA0A 4OBBA 5CVUA 1H2AS 2CUTA 1XAHA 1DXHA 2HA5A 3DDZX 3HCPA 4L27A 4UUMA 1P44A 1KOJA 2VZ0A 3NTOA 4K8RB 3STUA 5L4NA 1OH7A 3SGLA 1N2ZA 5G0UA 4J0QA 3FETA 3REGA 2OSBA 5AW6A 4DY6A 2QRLA 3DLBA 1SULA 1N5MA 2O48X 4Z49A 3AUUA 4PO3X 2YVQA 4DDWA 2YHUA 1SBZA 5ICEA 4KTVE 4Y1EA 1F51E 1NXPA 1ENYA 1FRFS 2JZCA 4F2HA 2ZROA 3IPXA 1XDSA 2ASEA 2MR6A 1H6AA 1O95A 2XPCA 2F9LA 5EPOA 4IXTA 1X1CA 4J07A 3L7YA 1TIBA 5HJEA 2GNAA 5IF9A 4EFLA 1E6KA 4CM1A 2HPAA 5A5FA 2X0KA 2FMUA 1RJ9A 3AHFA 3CE9A 3Q7TA 3WMRA 3ZZTA 2BGJA 3PI6A 3GELA 4PCVA 1YFJA 1JKMA 1R5NA 2R4TA 3CRVA 3GT3A 1YASA 4JT8A 5EKDA 4FLEA 5BN4B 3EBLA 2EARA 2B78A 4I5IA 2QVBA 4E2XA 3OC0A 3VA7A 5AESA 1NXVA 2XWSA 3HDJA 3RC7A 4WJKB 3THYB 1L4LA 1TVMA 2XYRA 1VLVA 2CYAA 5GGXA 1QG4A 2PGLA 3B48A 4LMPA 4UDOA 1G8GA 2AN3A 5JY1A 3RE1A 1L1QA 1QH9A 1X13A 2VPPA 2BSQA 2XHEA 4FDTA 5IPFA 1AVTA 3PA8A 5AM2A 1CR2A 3PEUA 2WWXA 3CSUA 1KE2A 4DAOA 1W9MA 3HJAA 3MZ0A 3PFGA 3WYFA 3ZE0B 1HLGA 3AP3A 2P4EA 2VAXA 2P1ZA 4EEXA 2ZI3A 2WF7A 4D6YA 4E12A 5IC6A 2ADMA 2AQIA 4HUQA 3DL2A 4E2WA 3M2TA 1K5GA 3FPKA 4I2NA 4FILA 5CFPA 3NP9A 1JV2B 2TMDA 4K2HA 1JA0A 4B3CA 1T24A 4QUEA 3DFFA 4J1NA 4D96A 1E62A 4ZO6A 3E5NA 2CT8A 2V74B 2NZYA 4PYKA 1CF2O 2BCEA 1V39A 5AYVA 1Z34A 2ZRCA 4BRSA 4DR1B 3F5QA 2XUZA 3P2JA 5B3LA 3TK1A 3GYBA 3OJEA 1HQDA 5DB4A 3SLRA 1Q50A 2LRHA 2OESA 1LRLA 5EKXA 3BMOB 2HWXA 1YFKA 2GVNA 4JC5A 4JXZA 1EHYA 4PGAA 1HYHA 2WY2D 3C5EA 1I3KA 5BXYA 2IYQA 4YALA 3H2KA 1SEPA 4NF2A 3BXXA 3UT5B 1ZM7A 3OZUA 2OO3A 1OGJA 3ADKA 1AV7A 1VCOA 3WHIA 3HU1A 5J5AA 5JAUA 4IJMA 1R74A 3OVMA 1NVKA 1CRLA 3OZCA 4DQDA 3U7FB 1TM4E 2IXEA 2ZUVA 1VXOA 2NTEA 3CH6A 1H8HA 3SBEA 1MN6A 5ITVA 1ADCA 2ZK7A 1NVTA 2JHAA 1DTSA 2XD4A 1U0OC 2XMCA 3PTAA 1Q57A 1QOPB 2PWAA 3A1FA 4ER3A 4O6VA 1PR2A 3RQSA 2UXDB 2R1VB 4CODB 1NVAA 2GKOA 2FWPA 4MS3A 2FSHA 4BMVA 1NT2A 3M4XA 4EG3A 2YY6A 3M5CA 3D6UA 3DF7A 3JQ8A 5CHYA 4DR5B 4HG2A 1TJYA 3RS9A 4C1NA 4BWFB 1TZKA 2QUJA 5IKXA 5D6OA 1LJ8A 4G07A 4E4YA 1U0HC 3G68A 4UW9A 4ETMA 2F3UA 4CEIA 3VM6A 3RV3A 4MVJI 3DP9A 4JUAA 4C29A 1HYEA 2IXGA 1TQ4A 2G1KA 2WJIA 4A15A 3PXBA 2AFIB 4MUGA 1E2UA 2R00C 3IDAA 3VGJA 2NUPB 2B69A 4F84A 2OXCA 3T7DA 5IC4A 3A37A 1I2AA 3AR7A 2AOUA 3OOWA 4JU9A 2HU8A 3VR2A 3O3NB 2G9UA 4YMVA 2B9VA 5IRCD 1RD4A 1Z2PX 5BURA 4QGFA 2EKLA 3LY7A 1LZKA 3UHPA 2E4YA 3WYAA 1UPBA 1FFDA 1T9ZA 3SXJA 3WIDA 2O7RA 3DZDA 3H9QA 3CVXA 1Z68A 3FTDA 2WDPA 1NMQA 1Q0SA 5D3MA 1IN6A 3AVVA 5AVQA 1EJ2A 1ZVQA 1IEWA 3HKDB 4S04A 1T9AA 2OV1A 3U1TA 5KNBD 3GBVA 4Q1VA 1QKIA 1ZLYA 2XUJA 4EMUA 4JI2B 2QNRA 1YBVA 5CH8A 3TINA 1UBGA 4NU5A 1Z6PA 5AHKA 3MCUA 5JYEA 2NO0A 2RJNA 1O96B 1TAQA 1DSSG 4JZKA 5HJ2A 4L9AA 2AI1A 3SR0A 2GK3A 3P0RA 4YNBA 3CGWA 3U7EB 4BQFA 4JJZA 4MULA 1DADA 4RM2A 3K0BA 1P7PA 2PV7A 4UAUA 1KFEB 1QONA 4YJ3A 3RC2A 1VRCA 1G6Q1 3Q0EA 1JXOA 1E69A 1DI0A 2EWMA 2OILA 4Y2HA 1DEAA 4L3VA 1JJIA 4LW8A 4NXNB 4EFDA 4M0EA 4PZPA 4BO3A 2JKYA 4NBUA 3T3OA 2CYCA 3CA8A 4D6PA 3AFHA 1X1TA 4URZR 4Q9IA 3LBFA 3RSCA 4IIJF 1X7GA 3EDCA 4JKIA 1CJSA 3SYMA 3JWEA 2QRMA 1G9TA 2OPBA 5IMBA 3VPDA 2EQ5A 1ELOA 2XCLA 2PGXA 1CPYA 1JEJA 2V4MA 4O2BA 1KJZA 3IC5A 4UASA 3RUDA 4BV8A 3O73A 4CI0B 4F4UA 5EJ8A 1DIHA 4W5TA 4YMLA 2QRVA 3M9LA 1C81A 2Q4TA 1QPBA 4G67A 2AG1A 3L7OA 4NZPA 5AOAA 4DR3B 1YB4A 1NBEA 4NABA 4JIMA 3JQ9C 4NCJA 2C78A 3IAXA 1Q1EA 1KJJA 4BZWA 4Y2VA 4RHFA 2QJFA 4ZCLA 1G7TA 2VZEA 4RFSA 2NV2B 5EIBD 4L4XA 4RU1A 2Y1KA 4KPGA 4XWOA 3PPIA 5EHZA 3P7MA 2D3WA 2GBPA 5KTOA 1QZ3A 3G6KA 1CJMA 3U3XA 2I9KA 3U4QB 3SBOA 4KBFA 5JZ9A 2B1GA 5FXMA 3V2GA 1P1FA 1BEZA 4PG6A 1DC8A 4YK7A 4Z53A 2PWYA 4ZZIA 3E4DA 4XR4A 2NAFA 3LCUA 1PFGA 2DUWA 2E21A 3HXLA 2QW1A 3D2CA 4HAYA 4OLBA 2E3JA 4QJ4A 5K9ZA 4E3WA 1O6GA 2ZZMA 5AKYA 1IM2A 4OSPA 1NHGA 2OZLA 3CNEA 4JEHA 3CBQA 2G83A 1DHTA 1Q19A 4D80A 4JUDX 3TXAA 3RR2A 2QF7A 3S68A 4B4DA 3BXEA 3T41A 1EMDA 3FRJA 2AJCA 4MCJA 1M74A 3I9FA 4X90A 2O2JA 5EINA 1A1SA 4DDVA 1WNTA 4BNFA 2CHQA 3C87A 4RVOA 2UYOA 1L7VC 3W8NA 4KK4A 4IRMA 4LXGA 5T7BA 1U5AA 4ML3A 4NYJQ 4E5YA 3ZHRA 1GGFA 2YTZA 1MQ9A 1ONSA 2ROQA 1DJOA 4JQOA 5D6NA 5AJVB 4YDHB 3NTRA 2L42A 2QV0A 3ET4A 4RHYA 4YR7A 2C97A 4Z2AA 3DBLA 3EGCA 1KZHA 5JATA 5CNKA 1B4DA 1XVLA 3VNBA 3EGXB 1RKBA 1XRPA 3Q88A 1LUAA 1DC6A 3P2IA 3SICE 4BNYA 1IVSA 5IAKA 3CE6A 1J8YF 1SBIA 2WB4A 1NLZA 1PJAA 4B44A 4XVUA 1JDTA 4F97A 4HDNA 1NY5A 4ZAYA 1XVTA 2ZYVX 4LZOA 4EL5A 1FJ2A 3WIOA 1IL0A 5FADA 3M5DA 4DB4A 1JKJB 3LQRA 4XIYA 1JZQA 2DMRA 5H7XA 3CX4A 2GO1A 1AY0A 1FFSA 3ZQUA 5IJ0B 1HEYA 2O8FB 4IOLA 5EIEA 3NHFA 3O4JA 3DFIA 3LCVB 3QF7A 3ZDRA 5EHXA 1E2LA 3LX8A 1XOIA 4R4JA 5IDVA 3CC8A 3R41A 1PEDA 4GEGA 1XRMA 1Z17A 3VC2A 5LN1A 5EJGA 4Q02A 2WV9A 3TZ6A 4I81A 4M0UA 4IXDA 1CZOA 2LPMA 5BPFA 4RJTA 2IPXA 4QREA 4YQZA 1HOXA 1E32A 1TKAA 1VHJA 3I30X 3I9NA 3NVAA 4M9XA 4F60A 4ZICA 5A71A 3F90A 3HB5X 1W1UA 5K3CA 5FPQA 1ZO8A 3AFMA 2OMKA 3CNBA 4PAWA 4RE5A 4ZODA 3L1JA 1UXKA 1MAHA 4PO8A 2VP2A 1ZCAA 2EATA 4G9GA 1LSJA 5FTKA 1CXZA 1AKRA 2W2VA 3BULA 3KPWA 4PYJA 3GJ7A 2KQUA 2PIDA 2R6DA 2ZRBA 3KD2A 3JQGB 3WK9A 1OWOA 1Z6GA 4CIDA 4W1SA 2VXBA 3A9WA 5ERYA 3LOQA 5EQDA 1Q7CA 5FBKA 4A8HA 1B3BA 3LV8A 2JATA 2O4UX 2QD1A 1MHPA 2X0NA 5DYYA 2H00A 1WF3A 4DXDA 5KNBA 3NPAA 4KAAA 4NV0A 2R47A 3I6ZA 2A78A 1RZVA 2GM3A 1DKPA 4UU7A 2BWJA 4LY0A 5DNWA 4D3YA 4Q1AA 3TSYA 2CHVA 4Q16A 5DSTA 2C20A 1F8YA 2IYFA 1LK5A 1KFKB 1LK0A 3H9GA 3URMA 3B51X 4F2DA 4RIHA 2AMLA 5M29A 1DUIA 2QL5A 1HBJA 4UUNA 4XPZA 5L3RA 4BCBA 1GAEO 2BGIA 2C03A 2QVYX 2MCFA 1Y1KE 5C51B 2ZSHA 3EOBI 4RL6A 2GB4A 2YC4C 1WF6A 1TJ5A 1A5AB 2FRXA 3PQ8A 3Q15C 3RS2A 2VDMB 1CNFA 3Q7QA 3PV0A 4GMGA 2ZYAA 2G0AA 3KJFA 2PUGA 2P35A 4MW4A 2XXAB 5EMNA 2L0XA 1VXRA 5K2MA 2BEVB 2OBNA 1E9EA 3Q7SA 1KAMA 4OU4A 4KIWA 1R4MA 5EZ5A 2V8BA 3AF2A 2HQSA 4Y7DA 2CZGA 2FX5A 4M1KA 1TXGA 2ERYA 3LZCA 4MV0A 4TWJA 4YJFB 4JLPA 4J3NA 1E58A 3LHIA 4FFWA 1WXHA 1VLZA 1D0IA 4JVOA 1SFRA 5AICA 4BBAA 1T9GR 2G08A 4GMXA 2BFPA 2E49A 2FUG1 4ZI7A 4MIEA 1KP3A 3U16A 3IEVA 2HJVA 4NU6A 1QQAA 2PRJA 2W48A 3B2EA 3D1JA 4C4TA 4Z5XA 3BMCB 4A10A 1AF7A 2Y9PB 4X61A 2ZT5A 1ZN9A 1F6BA 1YZKA 4ER0A 3R8XA 5D2CA 4RV4A 1W0JD 3GJ5A 3PQDA 4KPFC 1KMHB 1RR6A 2B8TA 2ADFA 3NAGA 4JV5B 2FW0A 3AKYA 3TQQA 1PZFA 3T5CA 4G2NA 5JNUA 2OBXA 2D74A 4W4TA 4UARA 3IMEA 4AU1A 2ID4A 1XDGA 1KFCB 3U3OA 3BMXA 4CW7A 1AK1A 3TKAA 1CR6A 3K0FB 4G6ZA 3BSWA 2P9TA 3DW1X 2BLLA 1OI7A 3SLKA 3T0GA 4DLKA 4XPIA 3PT9A 4OBEA 1UOEA 1C7QA 1F4VA 1VL1A 4HDKB 4X54A 4YAWA 4ZOQI 1UAAA 3U3ZA 5FBQB 2BCJQ 2VJMB 1ZYUA 4AJNA 4DSTA 5JXWA 2ALJA 3X3HA 5I4BA 2WFLA 4OQMA 1BTOA 5GQSA 2WUDA 1T2CA 1FF9A 4LRXA 4HMPA 3SIRA 4BJ6A 3EC7A 3IDOA 3R0QA 1IC6A 4DLUA 4DRXA 3PVSA 2VK1A 3L4SO 5DX1A 1DG1G 1QZTA 3PYLA 3DHNA 3N2KB 1VSUA 3RTDA 4KG7A 3PGKA 4QFCA 4LX8A 5JQGF 4UVDA 3VTZA 1U80A 1QH8B 5J9FA 5KYTA 1UFVA 4OLAA 5FULA 1WMAA 3MWEA 2EGGA 4YXWD