3N8IA

Crystal structure of the a isoform of human cytoplasmic protein tyrosine phosphatase (hcptp-a) in complex with 1-naphtylacetic acid
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
154
structure length
154
Chain Sequence
b'ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural Characterization of a Secondary Binding Site on Low Molecular Weight Protein Tyrosine Phosphatases
rcsb
total genus 65
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n8iA00
1A04A 5DKFA 3QLVC 2FMKA 1GUDA 2ID9A 3NNSA 1EWTA 4NCBA 1NXSA 1E6LA 4RK1A 1ZN2A 3Q7TA 4NICA 3TX6A 2Q5CA 4F8JA 4ZYLA 1ZDMA 4D6YA 3EODA 4YS6A 2OENG 3CG4A 1M5UA 3LKVA 4Z4FA 3RVNA 4MLDA 3O2JA 3KG2A 2WJAA 4RY0A 2QSJA 2GWRA 2VUIB 5TQ0A 3HS3A 3MIZA 4F3TA 5BR1A 2FEPA 2IPLA 3KKEA 1LJLA 3OQOA 2LPMA 4XAQA 3C3KA 1BDJA 4MYRA 3HVRA 3IP6A 2NUBA 5KQMA 4H3HB 4WUTA 4JB0A 1JYEA 3CTPA 1Z12A 3EGCA 3NBMA 6CHYA 1FSPA 5KQGA 4GPAA 4M88A 4KREA 1LK0A 3LTEA 2H3HA 2MYTA 4RU1A 5HQJA 1QP4A 3JTEA 3UUGA 3LUHA 4Z99A 4ZMSA 3JVIA 1NXVA 3JVDA 3SQNA 3TB6A 3CZCA 4LZLA 5FWYB 1XWWA 3CU5A 3O1IC 5DTEA 1EAYA 1UDRA 1XHEA 3I42A 4N76A 1JLKA 5KC8A 5KI6A 3MMNA 2PL1A 3RVLA 2R47A 1ZH4A 3BRSA 3R0JA 3OM1A 1H9CA 4PEVA 1Z18A 3RVJA 2M1ZA 3A3KA 3IP7A 3S99A 1AB5A 2WMYA 1YK1A 5EWLA 1QMPA 3IDOA 2YHBA 4ML3A 3MF4A 1QQBA 4L4UA 2E4WA 4E7OA 5D2CA 2A9OA 2L18A 3O74A 4MS1B 4MR8A 5CNJA 2JCGA 5CNMA 1D5WA 4KVFA 2P4UA 1U8TA 1MAVA 1DP4A 1SXHA 2JB9A 3HSYA 4LE1A 2PUAA 4JP1A 3KYJB 1R8JA 3E3MA 1P6QA 2RGYA 1FQWA 4G0MA 1DC8A 3BRQA 4TMYA 4EVQA 3QELB 3KCNA 1D2AA 4EYQA 4N0QA 4G97A 3GV0A 1L5YA 1MIHA 3EQZA 4UHKA 3RVMA 2P9HA 2ZWMA 3F7NA 3P9YA 1YMVA 4N0PA 3HV2A 3SY8A 2IPNA 4OLBA 5TPWA 1U04A 2PE5A 2GX6A 1SXIA 4NV3A 3Q7SA 2NT4A 1MVOA 1F4VA 4IILA 4N47A 3QLUA 3HUTA 1W9HA 5CNKA 2HQOA 1QO0D 2FN8A 4GNRA 1HEYA 2PAFA 2IPAB 3EAFA 4EYOA 1PNRA 4Z4IA 2RJOA 4OATA 3ROTA 1NATA 2DRIA 1Z15A 4G0ZA 1W25A 3O1HB 5GOTA 4F11A 3GA5A 4MR7A 1C0EA 3FFTA 2MYUA 1DG9A 3H5OA 2YHAA 4B09A 2OQRA 2WB4A 4W5TA 1RPJA 4DQDA 1IIBA 2LBPA 4WT7A 3A10A 3OMWA 3OLZA 4E7PA 1E6KA 5IUKC 3FDFA 3CFYA 3M9XA 2PUCA 2MSKA 3FGZA 4OBBA 1TMYA 3JS5A 3NHMA 3H5TA 5DGCA 3CS3A 4FE4A 5EWMA 3HZHA 4IRXA 1AB6A 4YCSA 1L5ZA 1LJUA 2L19A 4IMIB 5KC9A 2WJWA 2LUOA 2GI4A 3KHTA 1Z16A 5F64A 2FEWB 2TMYA 3CHYA 1D4ZA 3EDCA 1D1QA 3K4HA 4LDAA 1PNTA 3DLHA 2FTKE 1C4WA 3DBIA 3MQ4A 4RK6A 4RK7A 4KK3A 4MQFB 5TQ2A 4FE7A 1APBA 3OLVA 2IPMA 2LP4Y 2QVGA 3HDGA 4IF4A 4MS3A 4RKQA 3RVOA 4KRFA 3E61A 4QYMA 1OXKB 1FFGA 3G1WA 3LUJA 2B1JA 2PLNA 2MYPA 4D6XA 3DZDA 4EY3A 4PZ0A 3SM9A 2E4ZA 2B4AA 4Q6BA 5T3YA 3GBPA 2WWVD 2PL9A 2ID7A 4RWEA 4EVSA 1Z13A 5TQ0B 1KGSA 1NTRA 2O20A 4JASB 1TJYA 3Q7RA 4LDZA 1YVUA 1U2QA 4PE5B 1QQAA 2A9RA 7ABPA 2PUFA 4FB4A 1I3CA 4OG2A 4MLCA 5HM6A 1YMUA 5JS2A 5JNTA 4WWHA 3LUAA 2J48A 1Z26A 4QICA 4TLLB 3ROFA 1JFVA 3OQNA 3BBLA 3LUGA 5GQSA 3C3MA 3N0XA 1PEAA 3URMA 1PHRA 4KV7A 4MS1A 4YLEA 4Z4EA 2W42A 4LRQA 3F6CA 3QLVA 5DLEA 4KZKA 3I09A 2JVJA 4Z4CA 3H5LA 1P8AA 5CNIA 4JOQA 1USIA 4IMJB 3LMKA 3LKBA 4IGAA 1BA2A 1LBHA 4TN5A 1RNLA 1M2EA 4DADA 1ZESA 1JBEA 3KYIB 2FW0A 4RV5A 3M9WA 3KTOA 3KJXA 5JNSA 1BAPA 2FMFA 2WRZA 3DGEC 4Y9TA 4RK4A 1ZHHA 3OMXA 3RVRA 3RVQA 2MYNA 3GBVA 1EFAA 3H75A 3T38A 2FEKA 2L17A 5DCLA 4W5RA 1MB0A 3D02A 4JB2A 3BREA 3LFTA 4MRMB 4MAAA 1NY5A 2MSWA 2VUHB 3C3WA 3RVKA 3UK0A 2PUEA 2HPHA 4ZMRA 2QZJA 1RZRD 5TPZA 2FMHA 5TPWB 1JL3A 2QXYA 1ZY2A 1J56A 3N0RA 4P98A 3HDVA 2GKGA 3T8YA 1GCAA 4RK5A 2IKSA 4Q6WA 2FLKA 5CHYA 1KRXA 4W5NA 3O1JC 1SXGA 3T6KA 1CHNA 2LIVA 3NHZA 3EULA 1KRWA 4LX8A 3FMVA 4MQEA 5JNRA 4QYWA 4YV7A 2QVCA 3DGFC 4KNYA 2MSLA 2R4QA 4WXMA 5FWXB 3HM9A 4CBVA 1BVHA 1ABFA 4Q7EA 1RZRA 3SG0A 2VK2A 4ETMA 4Z4HA 2PUGA 2JVIA 1QO0A 1Z2DA 2HSGA 4G0QA 2GBPA 3OLWA 1MB3A 5ED4A 5IUNC 4MS3B 4MPTA 3GWGA 1BDIA 2KYRA 1BDHA 1QKKA 4YO7A 2IYNA 4RKRA 3RQIA 3EQ2A 4KQCA 5B3JC 1WETA 1M2FA 2PUDA 3JPYA 4OLAA 1JF8A 3H6HA 5IUJC 5HKOA 2A9QA 5FWXA 4Z0NA 5I4CA 1VRVA 4XFKA 1PEYA 4WZZA 3HXMA 1FFSA 1DRKA 1U0SY 3C6QA 1EWVA 4KQ9A 1Y1LA 3QLTA 5KQLA 1PUXA 4LE2A 4Z4GA 4YWHA 2FN9A 1KMIY 2JBAB 1DCMA 3HJFA 4ETIA 1ZGZA 1ISRA 5FBKA 4ZJPA 2R48A 3O75A 4H3KB 4O1IA 5EWJB 1S8NA 5IEBA 2FKAA 3QEKA 1TVMA 1RXEA 3NNNA 3ILYA 4YP9A 3RVPA 2E4UA 4YR7A 3JPWA 1DCKA 5TE9A 1E2BA 1CYEA 2IOYA 2XDYA 4PYRA 3TMYA 4Z9BA 1SD5A 3O21A 5EWLB 1DBPA 3QEMB 1JFSA 1URPA 1JYFA 3GT7A 3F73A 4MR8B 1QP0A 2E4YA 5B3JA 3VNAA 3GYBA 3N75A 1VLZA 1CEYA 3N53A 3OO1A 4LE0A 2N9UA 2VYCA 1TLFA 3A0RB 1U2PA 3QX8A 4G86A 5PNTA 4MRMA 2L2QA 2M98A 4MR7B 3D8UA 4RSMA 4MS4B 4RY9A 4RXTA 1ABEA 3HEBA 5TQJA 5IC5A 2CWDA 3N0WA 1YTUA 2FQWA 3ILHA 3OM0A 4NCAA 5C5CA 5BRJA 5IULC 3CZ5A 4RZSA 1NXTA 4RY8A 1NXWA 2PMCA 4N03A 4KPYA 8ABPA 4RDCA 4MR9B 3HCWA 1USGA 2CD7A 5IEJA 4L85A 5ABPA 5BRAA 3HO1A 3FFXA 2H0AA 3I45A 3OLXA 3LUDA 5HSGA 4RK0A 3H5WA 1XHFA 3L49A 3QELA 4KFCA 2FQXA 5EWJA 3T95A 1YS7A 1JH9A 1A2OA 2HQRA 2I6FA 1E6MA 4QPJC 4KMRA 1GCGA 4W5QA 4UHJA 1JX6A 2X7XA 4XASA 3F6PA 3H1GA 3SNKA 3FFWA 5T7BA 1DZ3A 2NZUG 1OXBB 3O2SB 1EHCA 4JA2A 2FQYA 1B00A 1F51E 1DC7A 1SRRA 3OQMA 2F8TA 4MQFA 4G0YA 3HUUA 4N41A 1RXIA 2HQBA 3N8IA 5IX8A 3MYYA 1JHZA 1A0OA 4HNQA 5JNUA 5KQPA 1ZGGA 2R25B 2FXIA 1K68A 1YIOA 3CRNA 1DBQA 4MGEA 1ISSA 3IPAA 5JS1A 2PJUA 2E4VA 1YK0A 4Z9AA 3TO5A 4G0XA 4EGSA 3QEMA 2CHEA 2FVYA 4PICA 4F06A 4D74A 1GUBA 3H5VA 2CHFA 3NNDA 3KSMA 2QU7A 3I5AA 2JRLA 2ZAYA 4RXMA 3CG0A 4WXEA 1P2FA 1USKA 2AYXA 2FLWA 3GL9A 3IP5A 3Q41A 3B2NA 4MS4A 4RS3A 3HK2A 2PUBA 1ZITA 4YRZA 2QV0A 3L6UA 1JDPA 5TPZD 3CNBA 3GRCA 3LUCA 1NXOA 3SAJA 4G0PA 6ABPA 3H5IA 3KS9A 1P6UA 2FSPA 3CLKA 1NXPA 2HJ9A 4S04A 3K9CA 3EJWA 1NXXA 2NT3A 3MM4A 3LUFA 4KK4A 1DRJA 5JNVA 2A9PA 1YS6A 3RH0A 1LBIA 4O5AA 1M5TA 4O1HA 4XLTA 3KLNA 3O2QB 3LUKA 4MQEB 2AYZA 2IDMA 4ETNA 1FFWA 3H6GA 5FBHA 1EWKA 3C97A 1VKRA 2QR3A 3LOPA 2QW1A 5C5EA 3QK7A 1DBWA 5KWSA 1JWLA 1QPZA 4JAVC 4EYKA 4ZPJA 1ZH2A 1T34A 2RJNA 3OLYA 4HYEA 3W9SA 2E4XA 2WY2D 4F12A 3JY6A 4G0OA 3UKJA 4S05A 3H1EA 5IBQA 3RVSA 5E3JA 2FMIA 4HNRA 3Q15C 4XXHA 2JBAA 2NZVG 3IP9A 3H1FA 3N6VA 3CKMA 3QLUC 1K66A 2BGGA 3VNBA 3KLOA 5BQ3A 1JFTA 3OO0A 5TQ2B 2PKXA 1JDNA 4OTZA 1DCFA 4EVRA 4NQRA 1QNLA 1Z2EA 3G85A 5EWMB 4TLMB 4DN6A 1QP7A 1TM2A 1Z17A 3A0UA 1D1PA 4XARA 1ZVVA 2V0NA 4P1ZA 3DLBA 2RDMA 2JVKA 3MA0A 4MR9A 1GLGA 4RXUA 4EUKA 5JNWA 3BILA 1Z25A 4YGXB 1DJMA 4H60A 5FWYA 4HNSA 4W5OA 1VPWA 2JK1A 9ABPA 1ZAYA 2F8SA 3QX9A 3IPCA 4EYGA 3TD9A 3Q9SA 3M6MD
chains in the Genus database with same CATH superfamily
4PIVA 3CO0S 1R5JA 4GXTA 1Q6ZA 3ELYA 4WUVA 3EXG2 3N05A 4L28A 1Q74A 1PLKA 4NCBA 5K5EA 3QFHA 5JARA 4CM8B 3DDZX 3EUEA 1CBUA 1E6CA 1QX3A 1JHAA 2XSZA 5J2TA 4XE5A 3UK7A 4DZRA 3RT9A 1JDVA 4Q9DA 1WSAA 1A9XB 3I01M 3THYB 2GJKA 3UHJA 3ER8A 4KAAA 1CQIA 1GCOA 1OJ7A 2CDCA 1AX9A 1N5MA 3N5KA 3UO8B 4AF6A 4FNAA 1BEEA 2IOFA 2NO7A 2ZTHA 5CIQA 3OPNA 1IHDA 4IFIA 1Z0AA 2VDRB 3ESBA 4MW5A 4QUGA 4D26A 3TW6A 4LBYA 1L7DA 5CIWA 2EL7A 1C5KA 4F5YA 4YRJA 3RS8A 4W1SA 4WZBB 4X84A 3DJYA 3OCJA 4UAGA 5F7XA 1RKUA 1ODTC 1T6YA 1T3TA 4FHGA 4G0WA 4MEBA 1WU7A 3AOGA 4M9UA 1T3LA 4I8DA 4HADA 1TA4A 2PT6A 1YDMA 3G5LA 3K0BA 2XBUA 5KQGA 5HP4A 4AZ3A 1IONA 1H8ED 2QL6A 3A4NA 1MD9A 2DUJA 4HDRB 1GZ4A 1EVJA 2MYTA 1UMCB 3QX3A 3E6AA 1PS8A 2QX7A 3UUGA 1T1SA 4HGZA 3AHIA 3OFJA 4QTXA 4EI2A 1M8KA 1G41A 2ZB8A 1X39A 5HHTA 4FZVA 3FWPA 1V11A 3DZGA 5P8WA 4AP6A 1JDBB 4MCHA 4ENWA 3EGWA 1AKEA 3GY0A 3NAGA 2ZJ4A 3JD2A 2AMVA 4R8VA 2WJZB 5FBZA 1YZFA 3V2IA 3CUVA 4KNVA 1L5WA 2O1SA 5DTEA 1GL7A 4K5QA 5CLIA 4ZVOA 4INZA 5KI6A 5LQDA 3ZK8A 2GK6A 1ONPA 3ITDA 5KMGB 2VBFA 1UXKA 3FWYA 4LQDA 4OGLA 1H9CA 4E15A 1I4TD 4HGRA 2HAEA 1NQVA 1JHPA 4LZAA 4DYVA 2I6UA 1NMEA 2QRLA 1DRUA 1XLTC 1QQBA 5AIAA 1IEXA 3O74A 4CKWB 2QRPA 2JCGA 1Q17A 3SS7X 3ZX4A 4N12A 1R3DA 1NW5A 1KKUA 2Y66A 2FP4A 4QDUA 1FUKA 1JFFA 4WH0A 1DP4A 1PE0A 1RBMA 1FIUA 3ON5A 3EYWA 1KI9A 3T1YB 3WJAA 4D3XA 2EGHA 1AKYA 2P62A 2VSYA 3D31A 3JQEA 3L6RA 1JQEA 1Z6QA 2YY7A 1N0WA 3PITA 4R9NA 2ZIZA 2WUWE 4U9UA 1DAFA 4JENA 4DNFA 1ISPA 1KQFA 3UTDA 1AD2A 2DWOA 3K0EA 3IB3A 4KDEA 5TGZA 3UNXA 4C0HA 5C18A 1BD3A 3LVBA 4U63A 1PGOA 1HDYA 4KEAA 1RP1A 1G6KA 1MO4A 5I7SA 1H6DA 5K99A 1VBMA 4G8DA 3LYUA 2Q6KA 5AW9A 3T1NA 5EE1A 5AKEA 2X3FA 3GP3A 3QLUA 1IHOA 1PJ4A 2ODWA 3K0AB 4JQCA 4Q9NA 1V8OA 1XZKA 2J3KA 2ZRCA 1SG9A 5DX1A 1U99A 2IPAB 1ECPA 2H2WA 2R7NA 3A6HA 3IKLA 4UUQA 5FLEX 3LS2A 4JXXA 5EA2A 1JN0A 3R3XA 3T12A 4QVKA 2RJOA 4N01A 2QL7A 4WHMA 4Y2HA 4CV0A 1RLUA 3FOBA 1QGED 1KU0A 4OGKA 2P65A 2WYHA 4BGUA 4QRHA 2DFKB 3Q1KA 3ZE7A 2W71A 3WWEA 2Y99A 4N4AA 1IG0A 3SQMA 4NK5A 1RPJA 2PSDA 4OUDA 5ELMA 1DPFA 2QE7D 1RQ2A 2QTTA 1EUYA 2XMRA 2BM8A 3MSXA 1T9BA 1EDEA 4U7TB 1LPPA 2MSKA 1GU7A 5EMLA 5GP1A 3R9WA 5LQAA 4ZGWA 4PBSA 1AC5A 2I4MA 4GF5A 2YZGA 5EIBD 1JE0A 1VSBA 4IZ6A 3ZXXA 2HYIC 5MHTA 4C7OB 4B33A 1J33A 4QU5A 4U0KA 2C5SA 5DI3B 3V8VA 1P2DA 4NOJA 4U3JB 2EL9A 1HDCA 1AB6A 4UAVA 4DTIA 3UMBA 4TUYF 1AURA 4EHNA 3OP1A 5T4HA 3KCQA 2HRZA 2J6BA 3EWAA 3TVYA 4QODA 3TRKA 3WFIA 3L8CA 2UUBB 4J1QA 1QHXA 3JQFA 1DIAA 3QVLA 4G2TA 1HOTA 2RI1A 4MUNA 4MUXA 4R9SA 2IBTA 2F6RA 2ZRAA 4QLAA 5BY2A 2YWHA 3RJ5A 1OSNA 5CBKA 4LJ9A 1RMQA 2IOQA 2QK4A 1Q0QA 4PHTA 4IF4A 5EZ6B 4IGEA 4D9IA 4ZV7A 1SR8A 2C07A 1SKQA 3LPNA 2H92A 2A0UA 1QYCA 4WKNA 4M89A 4AKSA 4LRUA 2OXCA 1HFKA 3M70A 1VPLA 2ZYDA 2OM2A 2ZBRA 3EC1A 1DOAA 2H00A 4LBWA 5CDYA 3I92A 3CCCA 1XYVA 3UJ6A 3DG9A 3FG9A 5BORA 3I83A 1JR6A 4RWEA 1OV4A 2HF2A 3EBPA 3S2IA 4QREA 1NLFA 4YV2A 1TQDA 1WD7A 4LCJA 5IBCA 1IXSB 3ODGA 3A58B 4CGZA 4PE5B 1NUPA 1C8VB 2Q3CA 2P30A 4WBXC 2C9ZA 4IPTA 3P20A 3G7NA 3PGVA 4L8FA 2VRCD 3Q3IA 4CFZA 4ZRMA 2B5VA 2OYCA 3RTDA 3W90A 5ES4B 2H1LA 3NRCA 1KMNA 3ZV5A 5EQDA 2DHCA 2FEXA 2VG8A 4CR8A 4IIGA 1D2EA 2Y1KA 2IXAA 4RKYA 5HFJA 3VZCA 3WSVA 2C4HA 3OQNA 2XMQA 3ZWDA 4AURA 2HPZA 3N2GB 2D0DA 1CUFA 4OXXA 4RF2A 1G7CA 2ZYUX 4LY0A 2JVJA 3PTAA 4AQDA 2QJRA 4PWYA 2GBCA 5CM2Z 3KKMA 4ZHSA 5M5BA 1GKLA 1LLDA 2ACKA 2CLMB 1IHUA 3PWTA 2AFHE 4FFDA 4XQ0A 2QL5A 2KB0A 1V3TA 1DX9A 2AD5A 2YJ5A 2CCJA 2O2SA 3K8YA 1E79D 1QS0B 3IA7A 4Q66C 3W2GA 2GVZC 3A36A 4XYLA 1DQRA 1R7RA 3M9WA 3MTDA 3E9DA 4ZOEA 5CW2A 3PNVA 4Y9TA 3RSZA 4E08A 4C04A 1ZHHA 4MICA 3RVQA 1XPOA 1KSGA 3JQBA 2G08A 1WMFA 3D4BA 1HKUA 4HBGA 3UYKA 4ER6A 5LOVB 3ZC3A 1X19A 1XTKA 1LPNA 3IMFA 2JEYA 3EA5A 4WLUA 3OQBA 4I50F 1IPHA 3WZ2A 2I2AA 1IBCA 1LLUA 2HADA 3FWHA 3U3JA 3I8SA 3V7WA 1J8DA 3TAUA 3SEFA 3WKAA 4BUZA 3L7NA 4ZMRA 1KTVA 1U8AA 5JS6A 2A14A 3E7WA 3NONA 4ROSA 2HA7A 3CUTA 1P18A 1AXRA 1T29A 1A76A 2GAFA 3LT5A 2JLZA 1FNDA 2IT1A 2Q4RA 5EXPA 1OXUA 3MPUA 1NMXA 2W8BB 3GLFE 5GJVC 4NY1A 3U9TA 2CLOB 4CG0A 1ODJA 1QIDA 4LX8A 4AXXA 4F2HA 2IZOA 1SU7A 1AVTA 3VKWA 2R4QA 1A8UA 3MAAC 1QHIA 1YS1X 1GRVA 2O1WA 4Q7EA 3VKGA 1U6KA 2GLUA 3OPVA 1W4AA 2VK2A 4YN3A 1A9XA 2BLLA 1A8PA 5E1MA 1QO0A 4TWJA 4BO3A 2QTFA 4Y0VA 4TM8A 4BAGA 1VHLA 3E58A 3GRYA 4YY3B 4YAEA 1HMYA 3NW9A 1XFAA 1BDHA 4NL4H 4EBFA 1NZDA 3DMPA 4DA9A 1JDJA 5ALZA 4ZCTA 2R84A 2QNBA 1RWBA 1SPXA 2EWMA 3KOWA 2GZ2A 4XEUA 3REFA 3W04A 2VQEB 3CH7A 4CQMD 1T9DA 3CURA 3OICA 2J3LA 4D42A 3KHSA 5JU6A 1EFUA 3MGGA 1GWNA 3UCEA 1S7GA 3PQ2A 3DE2X 1P5HA 1H6AA 1PUXA 1FUYB 2ZJ6A 5EUQB 2WIFA 5C31A 3GDGA 2D5LA 3U37A 3WI7A 3UBTA 1RI3A 1GR0A 4TQGA 3QBVA 2I2BA 2ZULA 4G9GA 2GSDA 4N82A 1BE1A 1M2VB 3X1YA 4FHEA 1YBHA 3RAEC 3O75A 4U5XA 1KS2A 2VPTA 1EWYA 5E3IA 2VK8A 3E9RA 1MDBA 3M49A 1FMLA 3P9CA 3WSTA 2P9ZA 3LBHA 1G55A 3ZWXA 3DE6X 2JIZD 4BCBA 3JPWA 3JYPA 3L0OA 3O0DA 3Q0TA 3TRIA 2V7QD 3D3WB 3OEYA 4Y2PA 4GE3A 3EF3A 4FN5A 4NBKA 3K53A 3GCGA 3O21A 3KLMX 2P3SA 4E07A 4RGYA 2BUCA 1IZ7A 2NWQA 2R00A 1YZTA 3UK1A 3KTFA 4C21A 5BNIA 5HS6A 1J09A 1IOLA 5FUBA 4MR8B 2P1DA 2X76A 4ZIRA 5CDFE 3EWSA 2OLKA 3KD3A 4UE2A 2FZLA 1EHIA 4O3MA 4UFNA 1L5SA 4YUZA 4C0SA 5JROA 3QSGA 4EA6A 2XD4A 1OB2A 3Q10A 1UM8A 3WB2A 4MA5A 4KXXA 3SGLA 1NW6A 2LV8A 2YW9A 3H1AA 2O3RA 4TX1A 3UUWA 4BP8A 3EXFB 1J22A 2X8BA 4LC1A 4LJ5A 4LNAA 3MGKA 3QH4A 4HV4A 5J5VA 2QAGA 4WN3A 2OO5A 4ZTBA 3UPTA 4ZVSA 3WVNA 3EISA 4MKFA 5ABPA 2R0QC 3OHPA 1UZUA 4EJSB 5K6AA 3EF1A 1FFAA 3ABZA 1V41E 2DQKA 4FSHA 3LYAA 2GT1A 2D5IA 3RRBA 4DLVA 1Z29A 1WNTA 5E4JA 1EXWA 2C98A 1YFZA 5T67A 5H9WA 3EW7A 1R0YA 4H08A 3MWFA 3AF2A 3NGMA 4C1NA 4HWSA 2GXAA 2FRVA 1E4VA 2OEPA 2GA8A 3B1ZA 3F6BX 1GRRA 3HGMA 4U7JA 3HRIA 5L95A 1QAOA 4YEDA 2IUFA 2PMEA 1BFDA 3VH1A 2JPDA 1TYAE 4B3BA 2XWPA 4EBBA 3OPYA 4INJA 2CB9A 1YS4A 2XWQA 4OMDA 2NQ8A 4Q1DA 2LW7A 4KU4A 5A0TA 3KSUA 2PDAA 3HJTA 3HPQA 3H11B 3VPDA 4UEKA 1Z6GA 3ASUA 5A5FA 3KVRA 2YNMA 3G0CA 4RW0A 5I8ZA 4F45A 1Z0UA 2DFLA 3GFBA 4DBLE 4IEEA 4S35A 5FOTA 2QZZA 4HNHA 4HC4A 4PGFA 4EPTA 4XUDA 3WMFA 4EY6A 1HYEA 4N0EA 2H17A 1W36C 3DVRX 1UJCA 3FHLA 3L4EA 4L15A 2CHEA 3OF3A 4G9BA 3VXKA 1SBIA 2GEKA 1E1CA 2X23A 3DC2A 3KTDA 6REQB 3ANSA 2NO4A 3FSRA 4PZLA 4X7RA 5EPUA 4RTQA 2CHFA 5FLKA 4YCCA 1EE9A 3HMQA 4UEQA 4EKYA 4LF6B 1RKQA 3F4LA 3Q8MA 3AUAA 3OUUA 1WQ4A 2O2YA 1QZXA 3A1EA 3HJGA 4N3GA 1GNTA 4TSRA 3WBFA 3FSGA 5EG5A 6ABPA 5E8JA 3QPUA 4A8HA 1MH9A 1UBEA 4EG3A 4O4IF 2N1BA 1TQ4A 2GSWA 1MOQA 3JR3A 4DPLA 4AUKA 3GFPA 2Q3DA 4LHSA 4WA7A 3DH0A 4KXWA 4QQNA 3PG5A 4AJOA 2FOIA 4R1OA 1OXMA 2YS7A 3KKNA 5EJ2A 5FPPA 3KSDO 2FGJA 1ODKA 5IJXA 4PCAA 1PYDA 4DM3A 1TIBA 1Y7LA 2QRZA 3DWGA 5JASA 4LSMA 4OI1A 3UJHA 3CUYA 3VYRB 4CNQA 5KWSA 3DQZA 3A9WA 3GCWA 3G0BA 3W9SA 2DFVA 4BJ1A 5JD3A 1JTFA 1PWXA 3OJEA 1XALA 3CR8A 5ISMA 1PJQA 5CH8A 3BF7A 2J0UA 3DO5A 2UUPA 5IBQA 5GVSA 3OX1A 2KW5A 1CR1A 2FPIB 3E15A 4MXDA 1FLAA 1XSEA 1ZW6A 1C3OB 2VHQA 4JLJA 2XVMA 1QX4A 2POQX 2VP6A 4FIZA 1AGNA 1ISGA 2CEAA 3U1BA 2XQFA 4MVJI 5KHLB 5AQEA 2WSYB 4BAUA 3ENVA 1H6BA 1L9XA 4P36A 1I7QB 1WXEA 3GZNB 5BYAA 2Z2IA 4ZWNA 4D4IA 1W5TA 3D6HA 3HKEA 5EWMB 2LXNA 2P68A 4L02A 5HMMA 1KP3A 4Q1CA 4LOIA 5EQTA 4AO8A 5TMPA 3CY6A 3IV6A 4I55B 5ALLA 3THRA 3ZNNA 4I5DA 1NN5A 4Q9KA 4WZAB 3K1TA 3K0FA 4XDHA 5AKXA 1F8YA 1VPWA 4J0QA 2GARA 2QXUA 2WOOA 2ZYVX 2CXOA 3S2GA 1USWA 2XVAA 1S2MA 3KB1A 3NHYA 2CHQA 5E9JA 1A5SB 1V6SA 1JB9A 5K8JB 2ZJ2A 4D43A 4LF5B 3FAKA 2ERYA 3NNSA 4B6OA 3ES9A 2Z6UA 4UUAA 1KZYC 2A1TS 2ZSUA 2ZUUA 2IE0A 3C3XA 1T2NA 1VBFA 1ZDMA 2I8LA 3S29A 1H2YA 3ACDA 3SSMA 4DSNA 2AH5A 1UBGA 2EV9A 4RVFA 3A2LA 5AO9A 1O6GA 2ATXA 1FC0A 2O07A 1CUDA 1K6JA 1RACA 1TZMA 1WSDA 2BEJA 3FUWA 3O31A 3O2JA 3TKLA 3VR0A 3EGEA 2DC1A 4M1OA 2E4AA 4E5NA 2OORA 3CF4A 3A9SA 2RSLA 3EY9A 3SIXA 1JBQA 1J39A 1TXGA 2XCIA 2Z5VA 1AQIA 4IS3A 5EP2A 1WXGA 4CTOA 3LGSA 4FCWA 4OQZA 2NXNA 4NEHB 2JGRA 4TLCA 4EFMA 3G8AA 2QR5A 4XWTA 3M4NA 6CHYA 3KQKA 1YHYA 2GM3A 3A9CA 4XIJA 2QGFA 2QX4A 3KKZA 4HS9A 1CUSA 4L9RA 3VC3A 2PU5A 3ROEA 4ITUA 4MUBA 4XWWA 3HDYA 1UPFA 1DTEA 1RJGA 4XPZA 1CG6A 4KG7A 3TR6A 3E81A 1K88A 1CS4C 2X41A 3DDCA 2H4YA 3O8OA 3OCYA 4C0QC 4U6QA 2AGVA 3EVZA 3FDZA 1GSIA 1Y6RA 3JU3A 3E4CA 3PJEA 2PXHA 2XUQA 2J6CA 1G3UA 1CTQA 1PGJA 2X1LA 3FJ1A 3LG2A 4HGPA 3FGNA 4PZUA 2XMCA 3BRSA 5JO9A 5C8VA 3OM1A 1OAAA 1CZNA 3BA1A 4CE6A 2GK3A 2I34A 1J20A 3IJEB 1UEIA 1RBYA 2RK6A 4HUTA 4LFBB 5DM4A 2V6MA 4YROA 5B7NA 4EGJA 2QEQA 1ND6A 2E4WA 3LRXA 1RAIA 5TMBA 1T1EA 4OFBA 4UOQA 3GHYA 3N0VA 3NZEA 1I4OA 3X1WA 3OIUA 1VMAA 2D06A 1ESEA 3A11A 2L0XA 3IAM1 4KVFA 4Y6GB 3ZKWA 3M1AA 4OYYA 4UASA 5CAEB 2AC2A 5A1JA 4TKMA 4W1RA 1U5BA 1I8TA 2Q49A 1KEPA 1P6QA 4XB6B 4CG1A 4DSZA 1JSLA 2FPSA 5SY4A 5I3ZA 3O7WA 2ZUTA 1BWQA 1UOQA 2Q9CA 4YT8A 1DAGA 5REQB 3P9KA 1RC1A 2DSNA 3F0TA 4G89A 3CLVA 3RYIA 4OK5A 1LI5A 3Q3VA 4RHEA 2CNLA 5FQNA 2V4UA 3R5KA 4NU8X 1HV8A 2EP8A 5JH7B 1AQNA 3GJSA 1IATA 2FOLA 2HREA 2GN9A 1BN6A 1F4VA 3EMBA 4Q3OA 5U4XA 3DQPA 4IUCS 2VAXA 4X71A 4ZIRB 5IT4A 1QO0D 2XYVA 1A9QA 4F9FA 4M37A 4ITRC 1LWNA 2ALJA 3P8ZA 2Z8XA 5JHHB 1SHJA 3OKCA 2O2CA 2I1VB 1UF9A 3EIEA 4DNXA 1Y6FA 1Y3DE 3ELUA 4JJGA 1ORHA 1YBAA 1O4WA 4G0ZA 2EGUA 3D6NB 1C1XB 3LJKA 4CR6A 1XNHA 4WI1A 1F4PA 2I78A 3A6FA 2GPJA 3DVLA 4BNWA 5J3JA 4HXEB 5A5EA 1KDZA 2ZI5A 5AK5A 1VRCA 3VZBA 4BTEA 1FP7A 1FP2A 4E7PA 1P7PA 4RCYA 1RC0A 3VTAA 4B9EA 5IK2D 3HKBB 1KORA 1XRNA 1AA6A 1NI4B 4UEJA 5FPHA 4OSOA 5MN4A 4MV7A 3EZ6A 4UNPA 2IGTA 1WZIA 4HUJA 3TXYA 1RLOA 2IZ5A 4X44A 4TT3A 2QW0X 3ZCTA 5EJ7A 2H0RA 2GBLA 4TRNA 1L3BA 4NKRA 1Y81A 2OC9A 4CLXA 1TK2A 1J2RA 4KDRA 4KQXA 4H2DA 1EVQA 1S02A 4OHUA 5DB4A 3S2FA 1JALA 4CDNA 10MHA 3LHKA 4O2LA 1D1QA 4UHHA 5GAJA 2ERCA 5CK4A 3VYUB 1X9IA 3Q0EA 2Z2ZA 2KWIA 2G1UA 3I1JA 5JUWA 4KE9A 2MMGA 2IU4A 4YRFA 3RVOA 1N0VC 2WZCA 2FCAA 1E61A 2ZIWB 1FFGA 1U8EA 2I1LA 1M1XB 3E7DA 1JLRA 3M3DA 4HJXA 4EY3A 1X77A 4PZ0A 2XKBA 3I2YX 5H3CA 4EFNA 3DT8A 5L3SB 4IVNA 4F56A 1VM6A 2BUBA 2WWVD 4BX2A 1XPUA 3V3TA 2XHZA 2GJ9A 1P9WA 3BIJA 1LRKA 1N0HA 5AWFC 1GAXA 1JILA 1M72A 2WFMA 2OAEA 3EDYA 2JFFA 5HNKA 2DEUA 1ECLA 1FRQA 3QLJA 3NHLA 3OZIA 1XEFA 3I3OA 2GZHA 3ID6C 3NIFB 4Z9XA 4DCOA 3BT7A 1TFUA 2LDBA 4DNQA 5L9AA 1N2CE 1YQXA 4JUFA 4BQPA 4ZAXA 3SZUA 2J48A 4LOKA 4EL5A 2V6FA 3HBLA 3O82A 3BZBA 2HLPA 2HXSA 1GG5A 4ZGBA 4BNJA 4MUYA 5I01A 4JOBA 3U4IA 3D0QA 2ZR7A 3HJCA 2Q1SA 4WTOA 1ZMOA 5L40A 1CDZA 2HTEA 4I6EA 2VNSA 4OOEA 1WB6A 2NV6A 2RHBA 1ZICA 3Q1LA 1ST3A 2I71A 2Y8EA 3GJ7A 1N5RA 2EG5A 3AI3A 3K35A 4O33A 4HVCA 1IZ8A 2QX6A 4HH4A 1XAIA 5H3HA 4FYPA 4F4IA 5A62A 2H2FA 3GXOA 3JQPA 1J1IA 2R8EA 1GVNB 3R7NA 1H2AS 3IBFA 2OZVA 3RLIA 5BMVB 4DABA 1JDSA 4UZSA 3RC2A 4DMGA 4J7XA 1IUNA 1Y80A 4RK4A 5C1DA 1A9RA 3DZBA 3FMIA 1T2FA 5TF4A 3HCBA 3SVTA 4R1PA 2V5VA 4D8VA 3KDAA 5IVKA 2Q9AA 2Z3WA 1OAOC 1YRWA 4XQGA 4H7IA 5DIZA 3R75A 4FHDA 4Q05A 3RJTA 4CV2A 4NFLA 3ZVRA 4BEJA 5FUMA 5CVCA 2HF7A 2ZYHA 5B2FA 2QZJA 1R0SA 4NJMB 4DXAA 4LOHA 3EA0A 4MQ6A 3ESCA 1J9GA 2CL6X 1BXKA 1UJ6A 3IS3A 1TM4E 1W581 4MYHA 4XYBA 4RDXA 3VU3A 5BSKA 4DMKA 3KTAB 4AMZA 1OH7A 2IF2A 2ZLBA 5CLGA 4UW9A 3WIVA 3WC4A 4BQSA 2PLFA 4G01B 1V95A 1SXGA 4XYMA 3BS4A 1KRWA 5L53A 1G5FA 2C88A 1G1MA 2R44A 4IIJB 3KQQA 3KR0A 4MQEA 5DT2A 3SDZA 4FN4A 4BFUA 1BHJA 2FKNA 3U6KA 3ZEIA 3GPLA 4QGGA 4TXLA 4E5KA 1ZU4A 3A14A 1GYQA 5ESXA 4MRPA 4D41A 3HV0A 1NVTA 3QKSB 2D6FA 1PF7E 2D3TA 3P0EA 1E3WB 2YTZA 3QIAA 2CSUA 2JVIA 5CDUA 3ZD9A 2PX6A 3ROMA 3N3BC 4KIGA 3OQ1A 1T2AA 4TZ0A 3R6WA 2BZGA 1UWLA 2GN0A 4TM7A 1QKKA 4N5NA 2ZWPA 4Y2JA 3TEMA 4IGKA 1MRZA 3VA7A 1PZNA 3WMRA 3F2IA 5FOVA 5ILQA 1R6DA 4NCKA 4DV6B 4DQVA 5ESRA 4MEJA 1NNI1 5MF6A 3UHFA 5KYKA 2GEVA 1GTVA 2H2GA 2VQ3A 2W2QA 2AOTA 2G76A 3HLTA 3LY7A 2J0SA 3HA7A 3UJ7A 2AFIE 4RHXA 4Z8YA 2LD4A 4Z4GA 5ITVA 2CFIA 1W2WB 2GF0A 5FIUA 4OXYA 2QPOA 4ZVKA 4F38A 1UADA 1RJWA 2WYWA 3D3JA 1RM5A 1RYMA 2RGNA 2F90A 3AVXA 2CL5A 3B3QA 1GYPA 4HQNA 3KPVA 2Z56A 3OWXA 5DTJA 2A0WA 3ZGYA 4FZJA 7GPBA 2X4LA 2IYUA 4X00A 5FNVB 1YOVA 3LNTA 2FCRA 1FUUA 1CNFA 2VHTA 4Z0HO 4PLVA 3VX3A 4UBIA 3W7VA 3ZCXA 4XR4A 3IEMA 2F1HA 3FKJA 4P3NA 2OP1A 2OHVA 5FYDA 4GQBA 4QARA 2XADA 4KPUB 5F9MA 1PG5A 1U28C 2CK3D 2GCOA 4JGIA 1NWCA 4EG7A 5KBYA 3GT7A 4WKOA 5DYTA 4RVNA 1R4NA 2PUTA 2BHNA 3EWNA 3MJFA 3Q88A 3KSZO 4UNQA 2XCTB 1ISJA 3G79A 4LJAA 2EZTA 2Y92A 4ILKA 2QMQA 1JTEA 2N9UA 2XQJA 1TX4B 4M49A 4OXRA 1YHNA 1O58A 4KTVE 1L4KA 2P79A 2ZIGA 4M99A 3O47A 3EXEB 1Z5ZA 3CH4B 4OQQA 3EFOB 2LR0A 4EO9A 3NM4A 5IDVA 7REQB 3GEEA 2OV3A 2OBBA 3LY5A 1MLDA 3ICPA 5HK9A 3WMXA 3C3JA 3LWZA 4PTYA 5LNK6 5IM4F 4HLQB 4UUOA 1BDBA 3CW2A 1M34E 5DM60 2BKVA 1N0IA 3DWFA 1XN1A 5HBRA 5IAKA 2HJRA 1OIWA 3ZHRA 4UVGA 3CZ5A 1IFXA 3BXHA 2E5LB 4N03A 4Z53A 1CJMA 4CMIA 4D45A 4EW1A 1D6SA 1TEHA 4EHDA 5B37A 2FN3A 1XTUA 4IMPA 2G40A 3GA0A 5CDFA 2WLSA 3GAMA 2VXOA 3QMVA 1C14A 1HTTA 4RK0A 4WLVA 2WD9A 2XNKA 1WPQA 5KWVA 2WIDA 5DBFA 1SXQA 3B9PA 4MLPA 1BRTA 4ZZ2A 3T41A 2PGNA 2ZKIA 4BNHA 1Z3IX 1PI3A 2AV6A 1VL6A 3OTWA 4KRXA 3FKQA 4OJMX 1TYEB 2H2AA 3ZDRA 2JIZA 2X2PA 1MIOA 3C3DA 4R81A 2EFCB 5F76A 3WBJA 4HUQB 1X3SA 1DC7A 1ZGAA 3HG7A 1U6JA 4HDSA 5BSUA 2WJVA 3QWAA 4IHJB 2JS7A 3WOHA 1L3CA 1PJZA 3BDIA 1T2VA 1YQUA 4AO7A 4TTAA 2ODAA 2CHVA 3EFOA 3KUDA 5A4MS 2VPZA 1Y6JA 4MK4A 3CF4G 4RACA 2JLVA 4B8WA 1ZS9A 1E94E 3PB3A 4PSKA 1YIOA 1E92A 5TY0A 2G5CA 1D4AA 1EM6A 3IE0A 3WR5A 3OPQA 1I6LA 2BEVB 3NALA 4LSZA 3KQPA 3ZW8A 4R9VA 3WGTA 5BN4B 2GHRA 1XELA 3NH6A 1KR5A 5JATA 4BGIA 1YVPA 4Q4HB 3DHNA 5BN5B 2YV1A 1FUIA 5K7SA 4RZ3A 1TVCA 2V5AA 2BMWA 4TSFD 4U5QA 1JHMA 5KCMA 2GRJA 4M0EA 3RJZA 2AYXA 4MS4A 1M3SA 2KS6A 3B2NA 3CF0A 4L8LA 1X7WA 4WFQA 4TOIA 3LUCA 4UAJA 4EHIA 1OBHA 3VOAA 3GRAA 1RLTA 3EZXA 1VYTA 2L82A 1L1RA 1BE6A 2HD4A 1HDGO 3QFRA 4LWQA 2V7EA 4YP6A 4ZAVA 3NEAA 3ZW7A 2OAQ1 4PLYA 3ZI0A 3TW8B 5LPNA 4X24A 4FFOA 4O59O 1O4VA 2IUTA 3N76A 4IHJF 1TA0A 4G0UA 3NLLA 2B98A 3IHTA 3NKFA 4WOPA 4DVGA 5FOUA 5JO0A 2UZAA 3FOEC 1RXSA 2HHJA 3LT2A 4M22A 3CZPA 4JP5A 1W1UA 3TSZA 5DHRA 1KAOA 2AEFA 4CYMA 2WDZA 3BD8A 1RZ3A 1VLHA 2QVLA 4E11A 1Q83A 2XCQA 2FWIA 3E1KA 1FDTA 2XGSA 4BQIA 1D09A 3IDQA 3E7FA 4GEKA 3JY6A 1GTL1 1QH0A 4U1RA 2OHFA 3DW3X 1DAEA 1NW4A 2FZGA 4J0DA 5INTA 3UOAB 3A26A 4DWWA 4Y0NA 1E3WA 2JBAA 2D4HA 2VEOA 2JIQA 3HVHA 1HTWA 1VBKA 4K3VA 1W36B 4EDFA 3SYRA 2G67A 3Q3CA 1MJGA 2G9UA 1J0AA 4XQCA 2BGGA 1ELOA 3RU9A 1E4EA 1TPZA 2A9JA 3KLOA 1CT9A 2I2CA 4M7WA 4G1UC 4ZCMA 2PKXA 2W6CX 4F86A 4MDEA 3E9MA 4GL2A 3PUKA 4RLSA 4Y2VA 1L4LA 4O4LF 5ECGC 3A3PA 2D62A 3CQ9A 3PP8A 1VKZA 2X77A 4LGMA 4OMUA 4CIBA 4UFPA 3MINA 2JAOA 2I66A 3G9TA 2W6MA 1KBZA 2J33A 3W6PA 5TDHA 3F46A 3A4VA 4HGNA 4UCQA 1ZWKA 1KP2A 3SJCA 4H60A 3NHAA 1CUUA 4HNSA 4LHVA 3HVJA 3CCBA 3EOZA 5H59A 3UMYA 2OKGA 1XJQA 2IQ5A 3P97A 3U7EB 1PJ3A 4JJ8A 3FCXA 3FI0A 2HBQA 5K8LA 1A04A 3CRQA 2FRXA 9ATCA 5FEUA 5KNDD 3S27A 2VPPA 3DDNA 2AJLI 1VL8A 3TZCA 5LZ2A 1R4ZA 1NXSA 4UDYX 1XMJA 2JHGA 1Z2CA 3O3CA 1YQ9A 5E7IA 4EI9A 5LCXA 2NN3C 3WYAA 4OUDB 5IJAA 3KELA 4TVOA 2AKYA 4NENB 2VUSA 2P7HA 4UCWA 5A3SA 1XTJA 4BFLA 2RAFA 1BQ3A 2WJAA 4J2TA 4D3YA 2WJPA 1IXRC 1W76A 2IYAA 5LC1A 3B1FA 4KPUA 2C0QA 3AESB 3H0EA 3B38A 3COYA 2AN9A 3IHWA 3QEBZ 1BDJA 4RNCA 3IKJA 1WV1A 3SX0A 5DNEA 2FPGA 5HDBB 3MAGA 3FZGA 4UTPA 4UMFA 4UE6A 3DTVD 2ZPTX 4FBLA 1QIJA 4JYPA 5KYUB 3N1UA 4IEFB 3OIVA 4XD7A 3CVWA 1KBOA 4Z3KA 4JXKA 4W5WA 1QRUA 1LK0A 1UK9A 3WQSB 1EVYA 1G5QA 4OLAA 3JTEA 3AIKA 4KMMA 4AUEA 1SCBA 1L5MA 4WA8A 1J8MF 4U2BA 2O8EB 4XX1A 2YS6A 4PNHA 2FPIA 3OJXA 3O8RA 4JLBA 1Z0JA 2AMJA 2HWKA 2WJIA 3BE5A 4NPCA 4UMVA 3W6NA 5IJ0B 1ORRA 1ARZA 3ECAA 6REQA 2CNDA 2ZS9A 1RWKA 4NG4A 1RCTE 4KPGA 1NBHA 1S8OA 2YCLA 2Z1NA 2HDOA 1YR7A 2Z2YA 2Z43A 4OK3A 4WSOA 2JLAA 1Z0IA 2CC2A 5DK4A 3SIRA 3SSAA 1D04A 1KYTA 3GEIA 1QFXA 2XT9A 2PSFA 1KFBB 1N2ZA 5D86A 3BTUA 2OOKA 1NBWB 4ZFNA 2A0FA 1BW9B 1VIVA 4G1FA 2VSOA 2QLNA 5H8WA 3FNBA 5G0SA 3LBNA 3AEKA 4DZTA 2NTNA 2Y0DA 1MAVA 2FFQA 4XCQA 1WW2A 4IGFA 4G81A 2VC2B 2WP8J 2YN4A 1Z0DA 3QIVA 5EESA 4CMJA 5B57C 3U7HB 4LJSA 1P1RA 1XQVA 3TBHA 5HRAA 3D8BA 1P4RA 4H3SA 1P1FA 3GV0A 4WDQA 2MTBA 3I0MA 4IZHA 3EXHA 5BV1A 1WF6A 4ESOA 2XVZA 2I54A 4GPTA 1ZH6A 2UV8A 4TRRA 1T0BA 3W3AD 4EHAA 1ZU5A 2GX6A 4GWGA 4R2JA 2ANCA 3STWA 4QG3A 3OT4A 5ALRA 3FRHA 3DJFA 3PDCA 5FHRA 1UMDA 3OH8A 4N6OA 4B35A 3IIMA 1C7RA 1ZNXA 3N87A 2ZJYA 4YPOA 5K4GA 3D81A 4H3VA 3CF6R 3N8KA 3BG5A 2VQFB 1Z28A 3EAFA 3HU2A 3KOXA 2IVFA 4MB0A 3QENA 4TMXA 5FKJA 5F52A 4EHHA 3AH8A 3L40A 3WGMA 1YRLA 1XQWA 5HBGA 4M1ZA 5DTRA 3ESXA 1XZPA 4ZCLA 2NU6A 4H9GA 3O1HB 3L0BA 1R0KA 2BR3A 2X8AA 3DMFA 3WISA 2QG6A 1LUAA 3GJ3A 4L2IB 3BB1A 3QPAA 4KQKA 2WAMA 1YI8A 4DQDA 1G0OA 3H5RA 5FL7D 2QNRA 3CFYA 5DLQC 3AF6A 3G23A 2NAPA 2WUDA 4AROA 1Y8ZA 1YU6A 3P2JA 4J1SA 5FFMA 2C00A 3U3XA 4BLPA 1D6NA 1TU4A 4CIXA 4JLDA 3A1DA 3B70A 2K7FA 3BE4A 1BVUA 1D0IA 4XYEA 4G3XA 4QLOA 2GUWA 3CH6A 3HWX1 3N6XA 3AUYA 1PW5A 2ZYTX 3KHTA 1B14A 1W4RA 4G65A 1ADFA 1ZC4A 1UM9A 2CFSA 3Q12A 4IZIA 3BK1A 3CHYA 3BUSA 3GPBA 3JQAA 2VPYA 4RPGA 5FB3A 3UC9A 3L01A 4HK4A 4P34A 3JYNA 5AJYA 3LBAA 2HA5A 2QTAA 4IWYA 1KJZA 3MQ4A 3OKPA 1KVRA 1Y8RB 4RKQA 4WZ6A 2V7VA 1BU5A 1NJ6A 3VDNB 3DTVB 1I2CA 4P4LA 1PX0A 4TV9F 3IPXA 5G4KB 1QIGA 3ZCUA 3Q8KA 5CTAA 3QXHA 2OR3A 4GRDA 1C3EA 2ZWAA 2GHQA 4NBRA 3RR2A 1OXTA 2HMWA 4PYLA 3GDOA 1U31A 1T9GR 3ZE6A 4IHAA 2GK4A 3AJEA 3UMMA 2GYYA 5ALTA 1TUGA 2QWXA 3BGVA 2PH7A 2FP3A 1N33B 1BJTA 4BQQA 2GNPA 1WHTB 2C5EA 4QQKA 4CIWA 3HLKA 5CA0B 5ALUA 4RKEA 3ANMA 3VDXA 1LF0A 3M9LA 1RXWA 5FRDA 4FB4A 4HDOB 3TWOA 3PTZA 1JXQA 4YX9A 4PWZA 4JT9A 3AX6A 3B7WA 4PW0A 2AFRA 4OHPA 5ICCA 5GM1A 4O4HF 1K0UA 2TSYB 4ZZIA 3C3MA 3HA2A 4GAEA 1V6AA 2WPDD 2ZGVA 4MGZR 5JAMA 1X1EA 4IIXA 4U39A 4XQEA 1T6NA 3WGKA 1PHRA 1SOUA 1IVNA 1G42A 3MCTA 1PU2A 1PR4A 4M46A 4Z4EA 4FIDA 4DJFC 1N6RA 4G5SA 1FSSA 2W93A 1RKXA 2HA3A 2OV2A 2HK6A 2BGTA 3KL4A 2AT1A 1X7YA 4EO7A 1USIA 4RFVA 3DCIA 4CM9A 3LMKA 5MDHA 4MWOA 2EKPA 3L1VA 4TN5A 1RNLA 1PJRA 3GN1A 5LYJA 4BNGA 1XXHA 1KJWA 4C5AA 2X4DA 3TLBA 4PS1A 2FW0A 1DUVG 2XZOA 3LGAA 5G4KA 5KSPA 2BBTA 2JJ1D 2FMFA 2WRZA 3OTGA 2O7NA 5EHNA 3DVAB 3QOFA 1T9CA 2A0YA 2OOSA 2PZAA 4JELA 2XF2A 3TIGA 1X14A 1E5VA 4BE9A 5JC8A 4JQYA 1KO7A 2PV0A 5DCLA 3W1WA 1LQ2A 2SKEA 4Z7NB 1QIEA 3HJRA 1ZAKA 5FNVA 2GBLC 4EW3A 1ENPA 3CLUD 2NZJA 3U44B 1M75A 1C3XA 4MKZA 1X87A 5F98A 1T0IA 3CX7A 4HFMA 2QRMA 1JNXX 3C7CB 2CNWD 3IOBA 4P98A 2BFPA 2JCBA 2GKGA 1AIPA 3BWXA 2HA2A 1V8BA 3A6LA 3VO1A 4ARSA 4RK5A 2IKSA 5FP0A 2FLKA 5H5JA 5KTMA 1K97A 1GDHA 3B9BA 1YOVB 3CPHA 3ETDA 3S8EA 5CRIA 2WUVA 1J0DA 1NRXA 2EFJA 1UWCA 2A4KA 2F1OA 4UBKA 1ETHA 3EFBA 1VTKA 2O2DA 3AB3A 1DMSA 3LM8A 3PXEA 4K6HA 2P9EA 2P40A 4LFCB 3JASB 1PLJA 4CM3A 4XB1A 2HCFA 1IQRA 1BKYA 2PM8A 1SURA 2V97A 4LYYA 1ONOA 1NV9A 3LRTA 5HEKA 1NJFA 2M6LA 3TIXB 4YV0A 3GWGA 4MJXA 2V0CA 2PWZA 3RT7A 4E2FA 2GGSA 3SXUB 4DGSA 3G13A 4MQBA 1J9ZA 2HWWA 5LQNA 1V7ZA 3EMDA 3MMXA 5B1IA 5AW1A 1ZJWA 1OY1A 4FLFA 2VDPB 1I2BA 4IV0A 4UUPA 2XGJA 2O4CA 5IUJC 2DR0A 1XDDA 3EASA 4KR9A 2H52A 1ZP6A 1LV8A 3UZUA 3GVXA 4X6XA 1BTOA 3GP5A 4PBRA 5E1BA 1TO2E 4N6GA 5TGDA 3HXMA 1EIWA 3OIGA 2FV8A 1KEWA 3TGLA 3M4JA 5JDCC 3GFRA 2C8VA 3K0AA 3QLTA 3SWWA 1XPRA 4FMCF 3ZHCA 5KO2A 2IYEA 1LFAA 3D4LA 4YWHA 5J5AA 4UU1A 2B8NA 1KK1A 3KLBA 3SF0A 4ECAA 2QMEA 2PRJA 1ZQ1A 3VNVA 2F8LA 3BCUA 4DIOA 3UAWA 2F8SA 3EEBA 3V2UA 5JAHA 1JLSA 3DF9A 4LF8B 1R0WA 4PINA 3C14C 1YU9A 4IV5A 1VSQA 4EF4A 1MT0A 3NQ41 3NTXA 5DN6D 4GX1A 3FY4A 5CBPA 4DV7B 1KFKB 2NU6B 3C6YA 5GIOE 1G19A 3G2QA 4FKBA 3GVCA 1VZ3A 2VHZA 3E8XA 2WTUA 4CTKA 2W4QA 1ETUA 4MHOA 5DX0A 5H81A 1UINA 3GD5A 5K6AC 3TKYA 3FH0A 1Q0PA 4C0XA 3A3OA 5HFAA 4QSHA 3TLEA 1WS6A 3CNNA 1ICIA 1R9JA 1YRHA 4LV6A 3DZCA 1AO0A 1J5PA 2AMLA 1SOAA 2MSCB 3CMCO 3EXEA 4MVJH 5ALQA 5B3AA 1JXMA 3FXAA 2ODEA 2F3TA 1G64A 2AL7A 3QX8A 4IUDS 3TTUA 4G5GA 2EFEB 4YONB 4ON9A 1J70A 3VC1A 5CT9A 1R10A 4QXRA 2GCNA 3IT1A 3KOUA 5DULA 2IYYA 4HH0A 3VAZA 5TLSA 4BWFB 1BXGA 1BQEA 1F20A 1X74A 3IO5A 3P9IA 4AK9A 4DDKA 1YTUA 2REXB 5LYYA 5IN5A 1GZUA 1R4MA 4GOLD 1A8HA 1M34B 2JJMA 1NLMA 4UHEA 3HFGA 3UJNA 4RDCA 4C4PA 1EFDN 3UENA 2P35A 3P0RA 4L85A 4BP3A 4XTRA 3W5IA 3DVQX 4QAJA 5IMBA 1V2GA 4MX8A 5F5LA 2O1XA 3F74A 1MVLA 4F4HA 1RHJA 1PR2A 5HSGA 5JBQA 4PQYA 3PHBE 3ETCA 3L18A 4NTZA 3ZY3A 4IDCA 1HYGA 5BO5A 4CMEC 1SM4A 4TLAA 3PIIA 1Y6QA 2PQ2A 4CT4B 4RETA 3JASA 4PTZA 2JLBA 4YRLA 3AF5A 1HFWA 4EKEA 1U7OA 2CNOA 4ARZA 1JP7A 3COVA 3O2SB 3P19A 4JEMA 4D0RA 2YJGA 1B00A 3CZMA 4DDVA 4ZI7F 4DANA 3BX1A 3NJ8A 4JZYA 1YGYA 2IU6A 2I5PO 4MQFA 3NIGB 4RD0A 3H97A 4IDGA 3V80A 2ZG6A 1YQEA 2OZEA 3CWQA 3EVTA 3DW1X 3I62A 3N8IA 4B3DA 4NE9A 2ZS7A 4OLHA 1E2JA 3X1MA 3N7AA 4HAIA 3NBUA 1GY8A 2CFOA 4UBLA 3BGWA 2PZMA 3PGMA 1S3GA 4LYGA 2W70A 2J7KA 5CFNA 3TQTA 2ZQ5A 3TVTA 1ZBDA 3AEQA 3M33A 3S1AB 5HRCA 3IURA 1M2OB 1VXOA 2B30A 1GPYA 4RENA 4FOTA 1V43A 2AK2A 2WD7A 2FEMA 3KFVA 3P4UA 5H82A 3WMEA 2NUPA 3GRZA 3QPDA 2YINC 3W0LB 4EGSA 4BYMA 4JVSB 3H3JA 1PSWA 1EFRD 4B87A 1ZRNA 1OYWA 3NWPA 4XDGA 4M6WA 2V0GA 4LVNA 1XNQB 2B78A 3LT0A 3R9XB 2C7VA 2ZWVA 4QGSA 1GDDA 1FFXB 1VA5A 2B8WA 1XZMA 2OV6A 2VSFA 5AVYA 5TJ9A 3V8NA 3VSBA 1AMNA 5JBNA 1XJ5A 5CGZA 4YRPA 4MI9A 3IQZA 1A8QA 4TYMA 3TW0A 4YRZA 4W8HA 2XUDA 1K7XB 3PDHA 3CNBA 5I47A 2C2BA 3K92A 4G6ZA 1XQ6A 2YWXA 4JKOA 3G17A 3INYA 1JQ5A 3PC8A 4RJJA 4X8MA 1FDRA 2BM0A 3FYUC 4ALNA 5A4AA 5JCPA 1MXHA 2PGIA 1X1RA 1FBNA 2OILA 1J5XA 2XAAA 4LA4A 4YYZA 5JXJA 3B3FA 4M53A 5B6JA 1L0BA 5E9WA 4PXYA 5CJPA 1IG3A 4B6SA 2CYCA 3M8KA 4LAFA 4M54A 4X5OA 3STXA 3OFNA 1LPAB 1AQLA 1NIPA 2N46A 4EEZA 3QQ5A 4UNSA 4DXHA 2M32A 1W8DA 4WX2B 3OLYA 1GUFA 3B8EA 2FW6A 4HB4A 1W5BA 1E20A 3I72A 1EXMA 4IMRA 3R2JA 3H8SA 4YP1A 1WPXA 3LQ2A 4V2IA 3IDSA 4RHYA 5FV4A 5FF9A 2CLKB 4K6GA 3VR5H 2IA5A 3WLKX 2MOKA 2HLDD 3WICA 2G4VA 4RM3A 1TM7E 3ENKA 1KMMA 1K06A 2DR3A 4FBGA 4LDRA 4UM9B 4PHHA 4REQB 4WACA 1K7EB 4AO6A 3NV9A 4IYRA 2BEUB 4AJNA 1Z6ZA 2ASEA 2EZ8A 3OO0A 3T15A 3WGGA 4YMIA 1PN3A 1AZWA 3N70A 4IWXA 1OPRA 4FDMA 4JWTA 4PC6A 4DY4A 2QVBA 2ZSIA 2Q0SA 4G8BA 5I8PA 1Z2EA 4OJNA 4DN6A 1KMQA 5IKMA 1Z17A 2F1KA 4RZQA 5THQA 5IXYA 3PS9A 2F3SA 4OQDA 5TR9A 3AJAA 1XTTA 4N8SA 3ZIDA 5JH7A 3EFEA 1HSOA 4JEHA 1L6RA 4EUKA 5AXDA 3X2EA 4GECA 1N3BA 1Z25A 3TQIA 4D8YA 1AQUA 4RE5A 5AKIA 4AULA 3H9JA 5E2BA 3MS2A 3VMFA 5JD5A 4QBGB 5KX5A 3KT0A 2ES4A 4URWR 9ABPA 4DB4A 3UH1A 4MOWA 3M6MD 5FOSA 1WB5A 5CH5A 4ZU6X 1OLSA 1BJRE 3L2OB 4Y7CA 3ZZ0A 1CVIA 1W34A 1GPBA 1II8B 3VKHA 3K05A 5C80A 5JXGA 4RK1A 2DXIA 4JVOA 5F33A 1XB2A 1R6UA 2H4JA 3DNMA 5FTKA 1LY1A 4CL8A 1UPBA 3FBGA 1AN9A 4XWGA 1NFRA 1V26A 2OENG 1AKVA 4FYMA 4OK6A 1H2RS 2GVDC 3B12A 3E0QA 4KO1S 4HQFA 1NQAO 3ZDAA 3MB8A 1L3IA 2GWRA 2ZETA 5FUWA 2XEXA 3GRPA 3MIZA 4GO1A 2M6KA 2X6RA 1SXJE 3OM9A 3T9EA 2WU4A 4TZTA 4X60A 2FPGB 4C6RA 2BKEA 4E2YA 1FS5A 4NP6A 2B34A 2NNLD 2EOAA 4L27A 3B3AA 4P0TA 4XAQA 2G9QA 2XMZA 2QOEA 4XSHA 2Q5EA 2IV3A 1Q15A 1ZMTA 1G1AA 3KZCA 4HOYA 1PQPA 4C6TB 1Z12A 3EGCA 3FPSA 3P32A 1DTSA 4WRRA 3RAGA 3NC1C 2PV7A 1F7VA 3D4OA 5BMOA 2EFGA 4RLQA 1IY9A 2PWBA 2ZRFA 5F2NA 4AS1A 4K8OA 1TIKA 2QPAA 1G5IA 1CUZA 2VJKA 1V2HE 3JVIA 5A06A 2ORIA 5ER6A 4TTIA 1B23P 1Y1SA 2E0IA 5IDQA 2CXQA 5JOQA 1VSUA 1UXOA 5DM2A 3C1TA 3PFNA 4GS5A 1H2WA 3NCTA 1G2OA 1Y8CA 4TS9A 4HBZA 1R66A 3IVXA 1Q44A 1Y5MA 2XZPA 2M1ZA 3KQMA 3UTCA 2BGIA 5DNDA 2ZBGA 4TYQA 4A2QA 4MUAA 1RP7A 1QMPA 1NLUA 2KLHA 2YHBA 1C7FA 1FXSA 3AFGA 4FYJA 4WNIA 1EK5A 4RPLA 3G2OA 2FAXA 4GSKA 2ONCA 1M9NA 2RK4A 1KE1A 2I29A 4RADA 3SZLA 5JMWA 2X2EA 1I5OA 2QRUA 5ALMA 1P73A 4BNLA 4ZT5A 3VR4A 5IH7A 1GFIA 3UY4A 4BNKA 1SXHA 2R6HA 3AWDA 3PRJA 1ZNWA 5HCIA 1EG2A 4QXOA 1YKFA 4HWRA 5HJ7A 4EQZA 2NX2A 4GOND 5B2ZA 4EL0A 5LXTB 1WEKA 2F3UA 2UAGA 4RJLA 2ZT8A 5C34B 1Q91A 1WDMA 2BFMA 3BIXA 4ASUD 4G97A 2AFIA 4TYYA 1U9YA 5AVKA 4JI5B 4P35A 4OJQA 1KGDA 4PPNA 2IYQA 3ZU2A 2QKYA 4KYVA 1P0QA 4AU1A 3ZCSA 1GVHA 3IQDB 4N0PA 3ZE2B 2UUAB 3NDBB 1T5BA 2DTDA 2FXVA 1RJFA 1OI4A 3B6JA 2Q21A 4I1UA 2I8AA 2UVPA 5EYPB 1Q6YA 2XH8A 2CFCA 2ZE5A 4NV3A 1TGVA 3UFXB 2BKXA 4N47A 3T3OA 2QBYB 4QYIA 3GIWA 2HNKA 3LBIA 2C7OA 3JWIA 3C6KA 5ALDA 4MP3A 3AF0A 5AP9A 1HEYA 4J1TC 3K30A 3W5SA 3DMRA 1OYOA 4HNGA 1I13A 3MS7A 4MYDA 2AXPA 4UU8A 3WXMA 1M10A 4BKMA 2JCSA 1U8ZA 3ROTA 5EOVA 1CY2A 1NATA 2EP7A 3A05A 4UTOA 2UXDB 1GPLA 1TGYA 4DOMA 1E66A 2K2QB 1QOZA 2G8NA 3W06A 3R5TA 3P1JA 2OQRA 5E6UA 2EWWA 3ZCRA 3I5YA 2VNJA 3AIIA 4IAOA 5FQOA 2Y1OA 4F84A 3H84A 4B8YA 4YYEA 1KDRA 3T9AA 3BA6A 3B13B 3VPXA 2O5EA 1FP6A 1MJ5A 4URHA 2F62A 1RWVA 1HBJA 1PIWA 1ZSYA 1XKQA 2X7JA 1XU4A 2WM3A 3MK31 3RC3A 4LMPA 5AVSA 4OYHA 2Q50A 1U1EA 3SJ7A 1P4AA 2ZCVA 3KWMA 5CM8B 1F4LA 1OI3A 1T0JB 4B7AA 1BS1A 1SBZA 4NXMB 4O2AA 1UZAA 3PYXA 4OQLA 4H1WA 2IV2X 3GLIB 2UZ0A 2IHZA 3LPMA 1O6ZA 1P2SA 2C1XA 4C2BA 3EDCA 1PJLA 2BEWA 3S7ZA 2RG1A 3KFXA 1HOXA 4ZVRA 1Y6GA 3VJLA 1BCRA 2KX7A 2R60A 3IVGA 3EQ8A 4OFWA 1SQ5A 3W2FA 3U7FB 2C7GA 3FHTA 4BMZA 3AESA 1HK7A 1APBA 1C8LA 1YRBA 2VLIA 3OLVA 4WBSA 1CE8B 5KAMA 2X14A 4RIIA 3TXAA 4CCYA 1Y3CE 4BEWA 4RTKA 1Z36A 1FA9A 4J9VA 1XG5A 1ZJJA 4NPHA 2G28A 5FUVA 1R9NA 3FZEA 2PLNA 3SC4A 4XFJA 1I1QB 1NRWA 1VKHA 2XAUA 4WFKA 3ILVA 3VV3A 2BFBB 2E4ZA 5BP7A 1XTZA 2COUA 2Z8ZA 1R6TA 3WGHA 3SU8A 4PCVA 4LF7B 1H0KA 2H1HA 5H16A 1Q12A 3WRYA 3K0FB 2XWBF 1SEVA 2VZEA 4TL8A 4ZOBA 4DUPA 2HO5A 1KI3A 2QY6A 3BSYA 3N3AC 4QG7A 1AMUA 5LD2B 1QQAA 1U2QA 3QYJA 3UOWA 3O1LA 1SQ6A 4WZBA 2PUFA 1TUBA 4Z2YA 3T9CA 1YMUA 5JNTA 2B35A 2DU8A 2VAVA 3FTDA 3LUAA 1TB4A 1Z26A 3M6IA 1T9ZA 2DWQA 1CJSA 3AEUB 3ZH2A 4MW1A 3RRJA 2YXPX 3BXOA 1K2VN 4IFBA 4P7GA 4CT5A 5KJ6A 2BGLA 4JQOA 2XUPA 3IHLA 3ERCA 4C2TA 3D6JA 3U7JA 1EUDB 4WAUA 2V9PA 2AQKA 2FPOA 2JFOA 2CYBA 4Q4HA 3QKIA 2J6IA 3F7OA 4RHFA 2I3BA 3DR5A 4IMJB 4RF3A 4WY8A 3LKBA 3RASA 2JIBA 5E0KB 5FI1B 1NVWQ 4LMRA 1NBAA 4TPKA 1BXRA 5LNK1 3GH1A 1CRPA 3I0ZA 4YJ2B 4NLLA 3DEFA 2ADOA 3AU8A 4MVYA 2ONYA 3V1KA 4AJ9A 2HY7A 2VA8A 4D97A 4YP7A 3A04A 5TQVA 5J4VA 3KEFA 2J32A 1UJ4A 2VDWA 3A32A 3NWEA 1FYVA 4RLHA 6YASA 4RULA 5CCXA 2PCJA 3OMXA 2C8JA 5TJHA 4TMFA 4DBLC 2YQ4A 5COAA 4PF1A 4ZVLA 3WNDA 2JA2A 4R54A 1H93A 2IZ1A 1E3MA 1EPUA 3U44A 2IRWA 1KK3A 1YB7A 2PAAA 4IZOA 4JUAA 2JFXA 1KC1A 5D3MA 5ELLA 3R77A 5ED0A 3RVKA 1XNJA 4IV8A 4R2WA 1GQ2A 4WOBA 4S2UA 3FSGD 1Q7TA 4H6VA 4L7QA 5G3ZA 2QXYA 1RJEA 2WWYA 1XMIA 2P27A 3FD8A 4HLCA 4EEKA 1N78A 3LGXA 1H05A 4GUAA 2P5UA 1HMPA 4YTEA 4CFSA 3HJHA 4M1TA 2A5GA 3PL1A 3UW1A 3LF1A 3U4AA 3R7DA 1J25A 3Q2OA 3T6KA 4M60A 1KDVA 6AT1A 4B0OA 1KQGA 2LIVA 4FINA 5AKGA 4GUDA 3F47A 4LNUA 4UATA 4X0EA 2HBZA 2QAJA 4EHJA 2JAUA 2J5XA 3PNBA 3C5CA 1ZOPA 2WSSD 4URXR 2G70A 2J87A 2VDOB 5DH9A 3GQBB 1FJGB 2ZTUA 4TTPA 3RVDA 2NVUB 1ID1A 3HVUA 4RZ2A 4MI6A 3X1XA 2P90A 2XA2A 4KPEC 1GA4A 2HSGA 4R1SA 1ZD3A 3OSUA 3B1YA 3TZLA 3WLEA 3MWEA 3OQPA 3LXRA 2FWMX 1KOLA 3KJNA 3LW8A 4ZT4A 4AYXA 3SVZA 3S40A 3F3KA 2BBWA 3RKUA 2GHIA 4AN0A 3LPLA 3IAS1 1DV2A 4RHUA 5KS2A 1GHTA 4ID3A 1K8XB 3FPKA 3K0CC 1L7AA 1JF8A 1KZ9A 3H6HA 2QJOA 2VRCA 4EUSA 1XVLA 4BHTA 3GMIA 1N77A 1WW8A 1FTSA 2DQ4A 3GWZA 1AU9A 3KQVA 1BFUA 5KOHB 1WLSA 1E62A 3GUZA 4P9NA 4R6WA 1WE2A 1YAHA 3TUIC 1QU3A 4LHWA 1WW3A 2FR0A 1D2HA 3D1LA 3RFUA 2VTKA 2P0AA 3KOZA 3RNOA 4DMMA 2HUNA 3T5PA 1TLTA 3O4GA 3HDTA 4ZA2A 4OI0A 3DDHA 1BCSB 1ZGZA 5EHQA 3U0VA 1BSVA 4YDRA 1KVSA 1UT8A 4FDVA 2P6MA 4O1IA 1AQYA 5CX4A 4R4JA 2D5BA 2M6RA 1O77A 4RMGA 1FU4A 2EP5A 2RHJA 3L46A 3MB5A 4FGKA 5IBPA 4DG9A 2ECFA 3IL2A 1K3FA 3QHAA 4RVDA 2AUNA 1NDUA 3BK2A 2HBRA 4OKNA 4W99A 2J9FB 3ZNQA 3GGPA 5FV7A 1WDTA 4Z9BA 1KQOA 2I91A 1KAGA 2Z30A 1P1BA 3D0OA 2IYSA 4I55A 3PCRB 3THXB 1I4WA 4YT5A 1JYFA 2A78A 2B37A 3MERA 5SV2A 1QH8B 3I30X 2X0FA 1EJ2A 2D3WA 1XJCA 1IMOA 2GPSA 2W0SA 3P5BA 4MW9A 3RSHA 7MHTA 5KREA 3AINA 3A2NA 4M9QA 5HGJA 1LPSA 3LZDA 4GI3A 2CFRA 4MVWA 3DBHA 4PSDA 4OXKA 5K3FA 4C7JA 5JAIA 3DMTC 2D1FA 3PQ5A 1OB5A 2RK3A 4JJAA 3SHWA 3CKYA 4S1OA 1YULA 2MDTA 2BDTA 4HDCA 3DD5A 2BDEA 4D96A 3W8DA 1WUYA 1JXOA 3V4FA 4X20B 3RYFB 3SZ3A 3ILHA 1QFMA 3I9V6 2AIRA 2DMRA 5BRJA 2R4UA 3I32A 4O25A 3TZBA 4BJHB 1NXTA 3B36A 3PUHA 2R97A 3K94A 3BWDD 4EKNB 1USGA 3WKDA 4C76A 4N48A 1TU3A 3D1VA 3VSEA 5GGYA 5KVSA 1TMKA 1YH3A 1ZOOA 4DRYA 1SELA 2Q2OA 2Q5OA 4GQIA 2NLOA 3SS9X 4LF4B 1T4CA 1ZM9A 3DOUA 1X70A 4LMAA 1Y7TA 4PO1A 4RSRA 3SC2A 3H2JA 5BT8A 3QG5A 3NHWA 3T95A 4C3VA 3BERA 3H8JA 3KUUA 3WWYA 4QXAA 1YJQA 1ZEMA 1Z0SA 3PEVA 4FR2A 4HXYA 4NYMR 1O8BA 4WLOA 5G1OA 5J2UF 4MMXB 3D7KA 3AR9A 1RE1A 3L8GA 5ADWA 2C96A 2FZEA 2WPNA 4LCEA 1JZSA 2IYXA 1Q7CA 1NY6A 1T43A 2ZBQA 2LIPA 2Y71A 2JIDA 4JX9A 4OCZA 1IBKB 2R5NA 3HY6A 3PRHA 4OSEA 1G98A 1CY0A 4BBZA 1ADYA 1WWKA 1KYIA 2AVDA 2VAMA 3B82A 3LX4A 5CXXA 3ZGOA 1FVFA 2FZWA 1K5HA 1DJOA 2Z4TA 1OLXB 2BI4A 3R23A 2YFQA 4FWBA 3T7KA 2C2YA 2R25B 4MPRA 3FB4A 2PZJA 1K68A 3CKKA 3PQEA 3IEUA 1Q11A 4G5HA 1B93A 3L79A 4NFHA 4DLWA 4I66A 2QZ9A 4DUZB 4N0DA 4XVCA 3I5MA 1E1LA 2EATA 2PMBA 2W43A 2X9VA 3BB4A 4WFIA 1UMDB 3WGVA 2DBVO 1HSZA 1V1RA 2J85A 2FVYA 3BFKA 2AWNA 5ALYA 1GTJ1 4PRZA 1PX2A 2QP3A 3B53X 1IRIA 3K6JA 1B2RA 2O8VA 3AV0B 1T1JA 4GOJA 2WA2A 4ZTUB 1KJJA 1GRNA 2QSZA 2Z9CA 1W96A 3MTBA 2IS1A 5GJBA 4CLOA 2R62A 5A4JA 3EXHB 5GV8A 2Q6OA 4L5CA 3G49A 3ADKA 3C3AA 5BSMA 4ZOQI 1XJWA 1PZXA 4GOOD 4PONA 4IS2A 3BD7A 2QIPA 3W6ZA 3KKPA 1FE8A 3V8PA 3A6PC 2GKOA 2RMKA 3GLKA 4E03A 1RFGE 4ZT7A 4D9NA 4F85A 4MRRA 1VHWA 1P0FA 5C8YB 1AS0A 4R0NA 1A7UA 4PPFA 4UVDA 5KJEA 4QJIA 2NT3A 4HI0E 2JI8A 4AFNA 2VP4A 4CG2A 4ZYTA 1DARA 2YWEA 4MKIA 3TNDA 3FCSB 3EHDA 1SUWA 1GP2A 1OX4A 3PICA 4BVEA 3OP4A 3EN0A 4P3KA 3COSA 5DGDA 5B30A 8MHTA 1X94A 4HSGA 5E6SA 3SHTA 1JPUA 1EWRA 1EGQA 4M9XA 4PCLA 5DYGA 5B7GA 3A3NA 5JDIA 2CNWA 2KHZA 2PBFA 4GMFA 2C2XA 2P3LA 2WKQA 4MEAA 4WZAE 2ZRDA 3VRHA 1D7AA 3WYCA 4V0RA 4TXJA 3VC7A 2GJAA 4Y1RB 1A4UA 1D1TA 2BBOA 4XIYA 4AZVA 4RDIA 1Q21A 2X22A 3H04A 4TS1A 3ZDYB 3X0DA 1R9MA 4A92A 4OMFG 3H1EA 3PGXA 1XAGA 4FLEA 2HRCA 4HNRA 4UNIA 5CP8A 4XDZA 2R751 4OYLA 2WYIA 5BWNA 3QLUC 1T9HA 2B8JA 3LIIA 1UBCA 3VNBA 3QA3E 3K8ZA 4DARA 2BMEA 1I7LA 2EGGA 2FPWA 1TOAA 4EI8A 3ZVMA 4Y7DA 3NTOA 1JU9A 2EXXA 1V5EA 1O94C 2WUGA 3CPJB 3ETLA 3OIDA 3G0IA 4OTZA 3OETA 4TMWA 4ZEOA 2QTMA 2GZ1A 1TM2A 3HP4A 2C1ZA 4J0EA 1YDEA 5KNDH 1DAHA 1ZVVA 1T8TA 2PNFA 5A3VA 3SLGA 5AKJA 3PXUA 3HWRA 5PGMA 4ND8B 2BGUA 4NONA 3JQ8B 4AYWA 2OZLA 3SR4A 4RAOA 1UDWA 1VHJA 5HQ3A 4A36A 3HNRA 1W2GA 2WWGA 2IIPA 1KKLA 2PFKA 3B51X 5TT0A 4XVUA 1QFYA 2I3ZA 3RI3A 2G3YA 2ID9A 2VR1A 1EWTA 2Y05A 4RMIA 5A4KA 4NU6A 2PFGA 3Q7TA 5BYBA 3UGJA 2PX0A 4KN6A 4GPEA 1H2BA 2A30A 4L76A 3CNEA 4NYJQ 2EW2A 4I50B 3ZGLA 2IEZA 1WJGA 1LPOA 3CLRD 4IOJA 3ZCPA 4COKA 1MFZA 3JV7A 1GTMA 1W6RA 3R5HA 4EYEA 5JJIA 1IN5A 2JJYA 2YOHA 3PXCX 2RGCA 1H9BA 3TM4A 3F6SA 3OQOA 4V1CI 5CD1A 5ARDA 1TAUA 3K5PA 4TZ6A 1B16A 1IY2A 1N9GA 1QC5A 1HURA 5CD9A 1Z0ZA 1BE8A 1U02A 1OOEA 2HZ7A 2ZXUA 3QKTA 4XCXA 2DFTA 3BD6A 1C0KA 2AMYA 3KT8A 4K87A 4CT0A 2D7CA 3WJ2A 1NVFA 2C9CA 3II6X 1VFPA 4V0MA 1L5HA 4EA7A 1N2XA 3NT5A 1RCUA 1G59A 2O05A 2QI9C 4I8IA 4D46A 1JG1A 3JVDA 3GLVA 1T0UA 3DCYA 3HQ4O 3HWWA 5BNZA 3U09A 4IF6A 4LGCA 2RGXA 1VG0B 4LZLA 3D59A 2YWDA 4B3HA 3G2LA 2UZIR 1EAYA 4S2EA 3PHIA 1R2QA 4FGWA 4X41A 1DXYA 2GCPA 1QZZA 4YI3A 2XNJA 1A96A 4QRDA 5BUSA 1DG3A 4XEHA 4DLNA 3F6RA 3TE6A 3D5EA 1ZKMA 1O9BA 2ZBFA 2IH5A 1Z5PA 2H06A 3CEPB 4NAVA 5EWLA 2W98A 4F4UA 2EZ9A 3GLIE 3SQOA 3UA3A 2VSXA 4QTZA 4GMKA 4BN4A 4MS1B 2XOKD 1WHSB 3PHLA 4D3DA 3CSUA 3M1IA 5TV2A 1TQHA 2CDRA 3TK1A 3S28A 1E6EA 2YZNA 1GTZA 3HZRA 4QWMA 1XE3A 2Q7OE 1JEYA 3IFSA 4XD2A 3M6WA 5HKKD 2AKEA 3MWJA 1EJBA 2Q3LA 5JALA 4AZWA 2YWBA 3E3AA 4K9NA 3FZNA 4C5CA 5KTTA 1XVUA 1RZVA 1MABB 3H7AA 3K6SA 2PR2A 3EUFA 4J7CA 4B83A 4EYQA 1OLXA 1L5YA 2Y1XA 3EDMA 4INPA 2AW5A 3MAJA 2G0AA 3BSWA 1QCCA 2QI9F 4YT4A 3CR7A 1M6WA 3DFKA 5JFTA 5E4FA 2IYTA 3FYUB 4MP6A 2IZ7A 3O3OB 4CVNA 1FTGA 3ZGXA 1YFJA 2IPNA 3CNQS 2L42A 1JI0A 3CEHA 1LU9A 2Q4TA 2CMDA 1AQ6A 1UFRA 2G1KA 3QP9A 5BXQC 4CTJA 4IILA 2O8DA 3QV1A 2YHUA 4HVLA 3BMNB 4NAHA 2EJUA 2HJHA 1SU6A 2VYQA 4GM0A 4O4IB 5LM3A 4CDGA 3GROA 4ZAGA 3CX8A 4DCUA 4OI2A 3GLHA 3K1ZA 4X65B 1CVLA 4BNUA 1JJBA 5AM2A 1PNRA 3PUZA 4R2XA 3PFIA 4F11A 2VHVA 4LZOA 4MRAA 1ORDA 4CQLA 1FYEA 4CU5A 1YRYE 4U7PB 1JA9A 2YHAA 2FUKA 1Y4DE 4NCNA 2XUFA 5U9CA 1H5NA 2FZVA 3ED5A 3SKYA 3GEGA 1PUJA 3PC2A 4HPXB 4KO2S 3MUOA 4CZ2A 3FDFA 1TPYA 3K6RA 3RGWS 2O0KA 1M54A 3LKDA 3R5JA 1VMDA 2PUCA 4KCGA 1Q7EA 2R87A 4BYGA 3PQ3A 2AI3A 3K09A 4HVTA 5C46F 1F8UA 4WY2A 1BA3A 1OFGA 5I7AA 1P33A 2QQGA 2VCYA 2NU7B 3ND5A 1C7IA 3O3MB 5AR1A 4CMAA 1VL2A 3C7TA 1OT3A 4HH1A 3JQGB 4Y9DA 4CKYA 2A6PA 1RMTA 3G7SA 1LJUA 2X6QA 4K6KA 4X97A 4YCSA 3CJTA 1YR8A 3HVKA 3EAQA 2VNIA 3JQ6A 4FDUA 3U7GA 3F8SA 3A9RA 1LDNA 4AECA 1KQ3A 4ENVA 4C3UA 3OC0A 3VR3D 3W78A 1NUQA 1SOMA 1KP9A 2D8AA 4MRSA 5NULA 3V8RA 4Q15A 2IODA 2P5YA 4OP3A 2FPPB 3TH5A 4DLBA 3O8LA 1PFYA 3H5NA 1SA0A 1US8A 3AR7A 3ZN2A 1GAWA 1ENZA 2F59A 2G4CA 2VJNA 2LTAA 1JIKA 3LY8A 4QYMA 3EGOA 4RKFA 3FRIA 3KKLA 3MBKA 4IVQA 1N3YA 2MMCA 3SBEA 4XQ9A 4NU0A 2Z3ZA 2MYPA 3LI2A 1C0IA 1DJLA 3TIIA 1DO2A 1E7SA 2P6PA 4UFOA 3TLKA 5D5QA 1J0CA 4Q0MA 3FR7A 1X8JA 3HN7A 1NUAA 4LSWA 5FR1A 1Z88A 1J21A 3PE6A 1GPKA 3CZ9A 4R8LA 3VR4D 2PGLA 3AEZA 5ALWA 3VV2A 1R4NB 1QO7A 4JASB 4PLWA 3ZQUA 4IFEA 2XSZD 4YJGB 1N8KA 1L1EA 1GYRA 2W2LD 1RHQA 4LWOA 3IDAA 4AJJA 4JBNA 5I9TA 1X42A 4YRKA 5JS2A 4BMSA 4KR3A 1P3Y1 1Z06A 3EGDB 1NYTA 3UMSA 4JA0A 4GI7A 2A4MA 4RVCA 1AHNA 4ZK6A 4RTPA 4CDMA 1GU0A 1X7WB 3RTGA 4NENA 5FLXA 5HKKA 4LEIA 4DRXB 1JVNA 2ZAIA 1DLIA 3DE4X 4MS1A 2CLDX 1VCOA 2CJFA 3AU9A 4Z4CA 1P77A 3N0TA 3VSAA 4RZXA 3FUTA 2VH5R 3DA8A 3KFLA 2ZSJA 1Z5GA 4HMPA 4AZTA 2P8SA 4C87A 4LHXA 3WDLA 4GBGA 1I7PA 3JAKA 3KPYA 4KXVA 4MUEA 2GAAA 2Y2UA 5DNYB 1P61B 2WSSA 4DIFA 3QZUA 1FTNA 4UDNA 1ZIPA 2J4DA 3VR4H 5E6RA 1T1RA 3B5EA 5K9ZA 2EBUA 5KIAA 3OEED 2BMAA 1BCSA 1VJTA 2ETXA 2PKYX 5IVPA 3IULA 3K9LA 1M2HA 1EFAA 1RLMA 1ZW1A 5B4VA 2L17A 1PL8A 1MB0A 2WAAA 2BAGA 3I34X 4AY5A 3KJZA 3LFTA 5SY6A 2PY6A 4WECA 2ZOSA 3DFIA 3EDQA 3PJFA 3WTCA 1GV1A 3D7SA 3OIWA 5I8WA 5IDXA 3IEVA 3EGIA 4J6EA 1DHTA 3GJ6A 3V6LA 5IW8A 1OREA 5TPZA 4LJRA 3ICEA 3A1UA 2H9YA 4I55F 2PGAA 5TPWB 4XVQA 1CJTC 3JAWA 4US0R 3KZXA 2B25A 3GLHB 4TWAA 4HB3A 2ZRLA 3O1JC 4JU8A 3EE6A 3O4FA 2P9FA 2VATA 1HLGA 4ZCQA 1C3LA 3RJMA 4CV1A 4ZHQF 1RYDA 3GGGA 5I6DA 1CHNA 4NMXB 1U8CB 1E7RA 1SUPA 1T1GA 1NR7A 5I9IA 3DGFC 4URVR 5HE8A 2MSLA 3LH5A 4Z4QA 1GQOA 1G21B 4LMBA 3SZRA 2E87A 2PRYA 3ZZTA 3KUXA 5IMSA 4FZ5A 2V03A 5KVCA 1DB3A 2VPQA 3N07A 1KPIA 4FQ7A 3ZWAA 5BW6B 2FHPA 1GTG1 1NBMD 4MPTA 4R1MA 3AT1A 5FWAA 1UBHS 5JVDB 2FW8A 4F91B 4YO7A 5FJIA 3ZHXA 2XNHA 4BRSA 5LDDC 3GYGA 3OY7A 3FCUB 1IK6A 3AEUA 1YL6A 3RS9A 4HWPA 1I3OA 5EJ4A 7MDHA 1VCIA 3DE7X 2XYHA 5E9AA 1PEYA 3RROA 5DP1A 1A4IA 1DRKA 4HRVA 1CUIA 3I1IA 5KQLA 4MGIR 4LE2A 4DV5B 3ADDA 3SJUA 3PC4A 1F8GA 4CJXA 3COWA 3AZQA 4ZPXA 4ZHQB 1EZ1A 4F6CA 2M1XA 1MTOA 1TUEA 2VDWB 4HATA