3N8IA

Crystal structure of the a isoform of human cytoplasmic protein tyrosine phosphatase (hcptp-a) in complex with 1-naphtylacetic acid
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
154
structure length
154
Chain Sequence
ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Structural Characterization of a Secondary Binding Site on Low Molecular Weight Protein Tyrosine Phosphatases
rcsb
source organism Homo sapiens
total genus 65
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n8iA00
3QELB 5CNKA 1P8AA 2JVIA 4Z0NA 3RVNA 1F4VA 3UUGA 2R48A 2HJ9A 3MMNA 3BREA 3Q9SA 3KS9A 4LDAA 1OXKB 1NATA 4CBVA 3CS3A 3RVKA 2PAFA 3HEBA 1QQAA 2WMYA 4LE0A 5CNJA 4F8JA 1DRJA 3OM0A 4ETNA 2FEKA 1MB0A 3KJXA 4Z4CA 3CZ5A 1U2PA 3JVIA 2GI4A 4Z9AA 3TD9A 2FMKA 4IRXA 4S04A 1UDRA 3LFTA 3OQNA 1ISRA 2YHAA 3D02A 3OLXA 5PNTA 1PHRA 2CD7A 2L2QA 3HUTA 4Z4FA 1VRVA 5EWLB 4YS6A 3M9WA 5JNRA 4MLCA 3EGCA 5JNSA 4RDCA 3A0UA 1JYFA 4O1IA 3C3WA 3OMWA 1ZY2A 3L6UA 3MF4A 4MPTA 4ETMA 2WJWA 1F51E 2IPNA 4KZKA 4L4UA 3FGZA 3SM9A 2J48A 4JB2A 3CKMA 1A04A 5KC8A 5IUJC 4RXUA 3N0WA 1QP0A 2F8SA 2JBAB 1URPA 3VNAA 3O1JC 3HVRA 4IF4A 2F8TA 2FMHA 3QEMB 2MSKA 4ML3A 4O1HA 1RZRD 3URMA 3G1WA 4LZLA 1VKRA 1AB6A 1K66A 2IPMA 3DZDA 3MQ4A 1Z2DA 4M88A 3Q7SA 4B09A 3NBMA 1NXPA 3OLVA 3QLUA 4PYRA 4Z99A 4EYOA 4W5TA 1NXXA 2VK2A 3ILHA 3NHMA 3GBVA 4YP9A 3SAJA 4KV7A 2CHEA 2E4WA 3SG0A 2NUBA 1MAVA 4GNRA 1XHEA 5FWYA 2QSJA 2FN8A 3RVLA 3KKEA 3P9YA 2Q5CA 5EWJA 3LUHA 3H6GA 4RK5A 5TQ0B 4EVSA 5IUNC 1Z2EA 1MIHA 3LKBA 4KQ9A 4YRZA 5KQMA 1DG9A 3H75A 4N0PA 4IMIB 3GWGA 2E4YA 2AYZA 1CEYA 1S8NA 1EAYA 2E4XA 1HEYA 4F3TA 4Z9BA 1U8TA 4RXTA 1JLKA 1NXOA 1XWWA 2VUIB 2VUHB 3E3MA 2A9OA 4RXMA 1LK0A 4N0QA 3CRNA 4TMYA 2NZVG 4NCAA 1JX6A 2QU7A 4D6YA 1TJYA 2HSGA 3OLWA 4YCSA 4MS3B 1DCKA 5IX8A 2CWDA 1M2FA 1Z26A 1QO0D 2MSWA 3KCNA 5KQLA 2QZJA 2W42A 3HJFA 3M6MD 1DBPA 1PEAA 4G0QA 5DGCA 5B3JC 2FTKE 3FMVA 2ID9A 3K4HA 4WUTA 3OQMA 3LOPA 2PUAA 1FQWA 2HQRA 3RVOA 4RZSA 2RDMA 4Z4HA 4KFCA 1BVHA 3T6KA 1H9CA 1ZESA 4XAQA 3CG0A 2QVGA 3N53A 4G0MA 1DP4A 4YR7A 4PEVA 3NHZA 4RKQA 2FEPA 1GCGA 3MYYA 3N6VA 4Z4GA 2PUEA 3LUKA 3HO1A 3H6HA 1C0EA 5TPWB 4F11A 4MQEB 3BRQA 3LUAA 4D6XA 1U04A 1USKA 1C4WA 5D2CA 4EGSA 5IULC 1YMUA 4LX8A 4P1ZA 1DBQA 3C3KA 5TQJA 4EVRA 5ABPA 4W5QA 4RWEA 3CHYA 2L17A 4G0XA 1JDNA 4RU1A 1BDHA 3H1EA 2NT3A 1R8JA 3FFXA 3JVDA 5JS2A 1NY5A 4LE2A 1YK1A 3HM9A 1LJLA 4OG2A 3HDVA 2IPAB 4Z4IA 3I45A 9ABPA 1P6QA 3UK0A 6CHYA 3G85A 2WJAA 2BGGA 1U2QA 1FFWA 3KYIB 3O75A 4MS4B 5JNTA 1FFGA 2TMYA 3GRCA 2HQBA 4G0ZA 5TPZD 3T38A 1E6KA 3OLZA 3RVJA 1GLGA 4XASA 5E3JA 3CZCA 3TX6A 4G0YA 4IILA 1TM2A 4F06A 1PUXA 2WY2D 3HCWA 2NT4A 2B1JA 2JRLA 4EY3A 5GQSA 2IPLA 4L85A 2FSPA 3A0RB 3C97A 4S05A 2FKAA 3O74A 4PE5B 2PMCA 3EQ2A 3NNSA 2VYCA 4JASB 1CYEA 2FMIA 4W5RA 2L19A 3T95A 1P6UA 2GKGA 5TQ2A 1YK0A 4HNQA 3Q7RA 4KPYA 3CU5A 4IGAA 4G97A 4MRMB 3GA5A 1SXGA 2XDYA 1RPJA 3ROFA 1Z18A 4JB0A 4NV3A 4EUKA 3EAFA 3QX8A 4DQDA 4EVQA 5DCLA 2IOYA 5CHYA 3GYBA 5IBQA 4E7OA 4G0OA 4XXHA 1APBA 3DLBA 1D1PA 2MYNA 2PL1A 4JA2A 1ZVVA 3H5IA 3L49A 3O2JA 3E61A 2RJOA 5T7BA 1DC7A 4RY8A 1I3CA 5DTEA 6ABPA 3O1HB 4N47A 5EWJB 4RKRA 3RQIA 3C3MA 5IEJA 2L18A 4PICA 3CNBA 3NNNA 4KRFA 4W5NA 5KQGA 1QO0A 2E4ZA 5EWLA 2YHBA 1BA2A 3GT7A 3OO0A 1USGA 4N76A 3LUFA 2JVJA 4FB4A 1WETA 3DBIA 4YO7A 3QLTA 4LDZA 4Q6BA 1ZAYA 1EHCA 5FBHA 2FN9A 3KYJB 4O5AA 3LUCA 4D74A 1CHNA 2FXIA 3BBLA 1GUDA 2FQYA 3GV0A 3LUDA 2JBAA 3R0JA 4E7PA 4YV7A 1A0OA 1JFSA 1JDPA 4RK1A 1NXWA 2PUBA 3I09A 1D1QA 1JYEA 1LBHA 5JNVA 4H3HB 3QK7A 1QNLA 3IP6A 4WXEA 5IC5A 3K9CA 1ZITA 2MSLA 2A9PA 3ROTA 1PEYA 1TMYA 2P4UA 4UHKA 2QXYA 1JFTA 3LKVA 1JF8A 3GBPA 2JK1A 2MYUA 5HQJA 2P9HA 4EYKA 3HZHA 5TQ0A 5DKFA 4G0PA 1RNLA 2H0AA 3RVRA 5HM6A 5B3JA 4MQFA 3KSMA 2FLWA 3JPWA 1DJMA 2JVKA 3RVPA 4TLLB 3EJWA 1Z17A 4ZMRA 1E6MA 4WWHA 1SD5A 2IDMA 3QLVC 2OQRA 3QX9A 2AYXA 1Z12A 3CG4A 1LBIA 4KMRA 4MR7B 5FWXA 1KRWA 2MYPA 5CNMA 3FDFA 1T34A 3JY6A 2N9UA 5EWMB 4JP1A 3RVQA 4DN6A 4KK3A 3S99A 2JCGA 2R47A 3HSYA 1D4ZA 1BDIA 1SXHA 3KG2A 2PL9A 4Q7EA 4LRQA 3HDGA 1JBEA 2DRIA 2JB9A 2O20A 2IKSA 3DGEC 4LE1A 5TE9A 3H5TA 2QR3A 2GWRA 3VNBA 1NTRA 1M2EA 2IYNA 3H5WA 5FBKA 1NXTA 3I5AA 3HK2A 4IMJB 4QPJC 5CNIA 1TLFA 4H3KB 5BR1A 4RK7A 4MR8A 4Y9TA 1QP4A 2H3HA 4MQEA 2X7XA 3KLOA 4OLAA 1L5ZA 4JAVC 4MR9A 1ABEA 3RVSA 2FQXA 2OENG 4FE7A 1QQBA 1YIOA 2PJUA 3T8YA 5HSGA 3OM1A 1ABFA 2FW0A 1P2FA 1IIBA 2RJNA 1ZGGA 2WWVD 1RZRA 4RY9A 4YGXB 1PNTA 2RGYA 4XFKA 4ZPJA 3B2NA 3TO5A 4MS1A 4TLMB 5T3YA 5ED4A 4WT7A 1DBWA 1JHZA 1W25A 3RVMA 3RH0A 2PUFA 1EWTA 2LIVA 4PZ0A 5DLEA 4Z4EA 4QICA 4TN5A 1DCFA 3QELA 5C5CA 1ZH4A 1E6LA 3EDCA 4JOQA 3A3KA 4MS4A 1MVOA 1YTUA 4RY0A 1KGSA 4MLDA 1NXVA 3HS3A 1QKKA 3CFYA 3HV2A 3MA0A 4NICA 4RK0A 1YS7A 4KK4A 5JNWA 4KVFA 4YLEA 3N8IA 3N0RA 2FLKA 3SNKA 3F6CA 3HXMA 2PUGA 4RK6A 3C6QA 4OATA 1JH9A 3KTOA 4OBBA 4ZYLA 4RK4A 1SRRA 1USIA 4DADA 2LP4Y 4ZJPA 1ISSA 1QMPA 1AB5A 1ZH2A 4XARA 2B4AA 5FWYB 5KQPA 3LTEA 3W9SA 3IPCA 4MAAA 2HQOA 3BILA 2FEWB 1EWVA 1BDJA 2FQWA 2GBPA 3Q41A 3TB6A 4QYMA 5JS1A 3SY8A 3DGFC 1BAPA 1YS6A 1ZGZA 3LUGA 3SQNA 1Z13A 4MRMA 1XHFA 1FFSA 3O1IC 4MGEA 1Z16A 4H60A 3EODA 1KMIY 5HKOA 3FFWA 3QLUC 3KLNA 1M5UA 1QP7A 3QEMA 4KREA 1DC8A 2PLNA 3HUUA 5GOTA 2LPMA 3MIZA 2M1ZA 2R4QA 2PUCA 4N41A 2FVYA 1VLZA 3I42A 2M98A 3N75A 2KYRA 3O21A 5IUKC 4ETIA 1GUBA 1FSPA 2R25B 3CTPA 3NNDA 2E4UA 5KWSA 3DLHA 2MYTA 3IP5A 4QYWA 3IP9A 4HNRA 4UHJA 4HNSA 2GX6A 8ABPA 1M5TA 5KC9A 5C5EA 3QEKA 3LUJA 1YMVA 1NXSA 2ZWMA 2CHFA 4OTZA 3IDOA 4MQFB 2I6FA 2WRZA 1D2AA 1ZDMA 1E2BA 2HPHA 3D8UA 1OXBB 3A10A 4W5OA 1KRXA 2A9RA 1D5WA 3F6PA 4EYGA 1EFAA 4NCBA 3O2QB 1Z15A 3H5OA 5I4CA 3F7NA 1DCMA 3KHTA 4KNYA 4F12A 1JL3A 3FFTA 5FWXB 1Z25A 2QV0A 4OLBA 2PE5A 4EYQA 2PUDA 1JFVA 1ZN2A 3UKJA 4NQRA 3JS5A 5TPZA 4ZMSA 4WXMA 2ID7A 2PKXA 1MB3A 1ZHHA 3M9XA 1GCAA 4XLTA 2WB4A 1VPWA 2QW1A 4HYEA 5F64A 3QLVA 1K68A 3JTEA 2LUOA 4MS3A 3BRSA 3Q15C 3OLYA 3H1GA 2V0NA 3OO1A 3LMKA 2E4VA 3H1FA 4Q6WA 4RSMA 4RV5A 3OQOA 2FMFA 5BRJA 3O2SB 1U0SY 1Y1LA 4FE4A 4WZZA 3F73A 1JWLA 1J56A 4MR8B 2NZUG 2LBPA 5IEBA 2QVCA 1RXIA 3IP7A 3EQZA 4G86A 1SXIA 1B00A 4MR9B 1DRKA 1PNRA 3MM4A 3JPYA 5KI6A 3N0XA 1DZ3A 4N03A 1W9HA 1EWKA 1L5YA 1A2OA 2A9QA 2ZAYA 4KQCA 5BRAA 4MR7A 5TPWA 1QPZA 4RS3A 1TVMA 3H5LA 4YWHA 7ABPA 1YVUA 5BQ3A 4MS1B 5JNUA 4P98A 5EWMA 3TMYA 3Q7TA 1RXEA 3GL9A 4GPAA 3ILYA 4MYRA 3IPAA 3EULA 3OMXA 1LJUA 5TQ2B 3CLKA 3H5VA
chains in the Genus database with same CATH superfamily
1XAJA 3C7CB 4F21A 2Q1WA 3DO6A 1E69A 2OFWA 1WMEA 4HEJA 2JH9A 1JQJC 2DTEA 2PBLA 3NP7A 2QLBA 3M0EA 2BFDB 2YMLA 3HR7A 3MTQA 5DGIA 3I30X 3QMMA 3DLIA 2P6RA 4M76B 1PWXA 3AM5A 4N7BA 3T52A 3FVQA 3VC7A 2Q5EA 3IMKA 1TKAA 3I8SA 2X9LA 3EQ6A 2H2HA 2AFIA 3OCUA 2H1FA 3S7TA 4IWYA 1O6GA 3LGXA 3MLAA 4EJMA 2IXDA 4X66B 2DT8A 1TADA 3EUFA 4NNPA 3WLQA 1M1YE 5BR7A 1IMJA 1KBQA 2QVZX 2R1ZA 3JVIA 4LSWA 4KEAA 1BGXT 1O94D 3RBXA 1M2GA 1II8A 4KWHA 5CDTA 3LFTA 3OQNA 2HF2A 5LD2C 5M3BA 2CD7A 3R5SA 3OA0A 1PW7A 4FFPA 1N9ZA 5IJ9B 4QUDA 2QX8A 1EG7A 4N0EA 3NI2A 4W82A 4DLLA 1P5JA 3GZJA 2UYHA 2ZTVA 1NG9A 1X7ZB 2IS1A 5F5XA 5IJWA 4DUZB 5ESDA 3H05A 4ETMA 4BVKA 2WD7A 3FRHA 4H7IA 4AULA 5A5DA 4GPIB 3MTJA 2C98A 4KZKA 1O97D 2QR2A 3GD7A 3U1BA 1QBKC 4XUGB 2EV9A 2I8CA 4YMLA 2QMQA 4Q3DA 5DYNA 1U3CA 4R5HA 4U2FA 3C8MA 4PNHA 3U1VA 1CT9A 1K6XA 4EFLA 3JSXA 3TEMA 4R68A 1Q3TA 3IP3A 3I2GA 1KZGB 3R7DA 1S96A 1XRLA 3UAXA 4BX9A 1QFZA 2V54A 4ZEVA 3W1EA 5KHOC 4GLJA 1HQYE 1UKYA 3ZGLA 4DIOA 3C6XA 4A73A 1QFMA 2Z98A 1QNFA 1V9LA 1FRZA 1HUQA 3OLVA 3OC6A 2NXNA 4KCGA 4PYRA 3IHTA 2IXTA 1ACJA 3Q88A 1A9YA 3A1DA 3DE1X 2H3EA 2XVAA 5FKJA 3EARA 5AW3A 1XXHA 1NYLA 3I2JA 4GI2A 1Y3DE 4ZCIA 4Q37A 4RK5A 3VUFA 5ISMA 5JO0A 1CQZA 1ZNXA 4OYYA 4Z2AA 4EW1A 1EVKA 2B7CA 2GZHA 3I1IA 5E0OA 4MI1A 4R4JA 2XWQA 3BWYA 4FR2A 5K3DA 1N5LA 4DAOA 1ZC4A 4GEGA 1TFRA 3G6KA 4B3TB 1JEJA 1J8DA 1H4TA 2ONZA 2W6OA 1Q7GA 4G4GA 2OKGA 3CC8A 1FFCA 4FT2A 3W4JA 3OT1A 3OJWA 1LJ8A 2QUHA 3CMMA 2PZEA 4YUWA 4GU5A 1H6BA 2EW1A 2NZVG 2PCJA 2YVAA 1DDGA 4H7JA 2OSBA 3RSHA 5BWMA 4V1CI 2QGFA 3U4QB 1GV1A 2R1VA 2CWDA 4JXJA 4J0EA 1M2FA 2WC1A 4ZGBA 4HLCA 3RASA 3VU8A 2XMSA 1JAYA 3GLKA 3FPBA 1TO6A 3M6MD 4DLAA 3HY6A 4LOJA 1ZXXA 2NXJA 3DB1A 5IJZA 2EGHA 2P3LA 3RF6A 3E7PA 2PUAA 1FQWA 4MQ4A 4PZEA 3RVOA 5DZSA 5IH7A 1KY4A 2RGGA 3PXBA 4NBKA 5CPFA 4KFCA 1JIIA 2X8JB 4FGLA 1EFRD 1AUPA 1HK7A 4HEQA 4JI3B 2EFHB 3WWPA 4Q4DA 1NMSA 1RYBA 1X0VA 4V2UA 5CU7A 4O2BA 2J7PD 3FTPA 5E4FA 1TJPB 2C9DA 3MYYA 4Z4GA 2X8WA 3HNRA 1FLVA 1OLXA 3LUKA 3OTQA 3R3HA 4YLGA 5K0LA 2I3BA 4A82A 2E55A 3PD0A 4MQEB 1L4UA 2Y67A 3IBCA 3L8MA 2Q2WA 5AOCA 5CJJA 5K6RA 4D81A 4EFMA 1GO2A 3L7YA 4P1ZA 3URKA 4TVSA 2WUDA 3R1IA 4EFKA 3TTXA 4W5QA 3WYAA 1J1UA 1AT1A 3WRXC 5I3CA 1I8TA 4BQQA 4DV7B 3H1EA 4DKXA 4YJHB 3ETLA 5JCXA 3C6ZA 4ZAVA 4J75A 1V3TA 1MO4A 1F9EA 2OFPA 1P6XA 1VLHA 2XUOA 2GKOA 3O8NA 2WFLB 3H9QA 2P9TA 1WP4A 1NYTA 1Q50A 1H9AA 3PQ3A 5IYZA 4G1FA 1Y34E 3ZNQA 4IVQA 2P3QA 4NHEA 1X9IA 4HXEB 1T0JB 5DNUA 2N0SA 4N3AA 3ESQA 1HH4A 3JZFA 3DVAB 1EESA 2HQBA 4M4SA 3GG9A 4MOWA 3AHFA 3CUTA 1OZAA 4W8OA 3RF7A 3VOSA 4BQEA 2Q4RA 2GASA 3RVJA 1L8XA 3CZCA 2Q4DA 4Y6PA 4IILA 2ZT7A 4EY5A 2C5LA 2WY2D 1X14A 4HFRA 4C30A 1VBNA 2NT4A 3ZGYA 4BRZA 4HMOA 3N2EA 3U7JA 3AIKA 2PZGA 4MK4A 1MDBA 5AKLA 4MMYB 2FPLA 3VJRA 4PTYA 3U3XA 1EM6A 3VR5A 4PAWA 3TNLA 2OZPA 3I64A 3BBPA 1NKVA 1THTA 1N8NA 3IUNA 4RM2A 3FKJA 2X5OA 4ZEWA 2GO1A 1DRWA 4I1VA 2R7MA 2FLVA 3W0LB 4YMTA 1SH7A 2VIIA 2L19A 3O7WA 3TFOA 2JARA 5J2UA 3AINA 2QZ9A 3EWAA 5BNTA 1E5QA 2MIIA 1KI8A 1XDDA 2I6SA 2XGMA 1WXHA 3PIRA 1TTPB 3DHNA 4Q9KA 5IZCA 1Z5GA 1ZM3A 3GA5A 2B5VA 2C99A 5D5QA 4PLFA 5AYVA 1MU0A 4A1FA 4E51A 3CGWA 1B3RA 1ZU4A 5HKKA 1KWGA 2QTMA 1A5SB 3I73A 3TW0A 1YIDA 4V1CA 4GUDA 3CLRC 4ZOBA 1H1TA 1NULA 3NUQA 2NU8A 5CPBA 5LZ8A 4GBGA 3FYHA 5B4VA 1XRNA 5EJ9A 1G20B 3L07A 2AFHA 2YWJA 4D99A 2GOYA 2GVDC 2ZI3A 1XUOA 2FPUA 4JELA 4WW0A 4B80A 4F60A 3D8HA 4NBLA 3GGGA 3IPLA 1XB2A 2JKZA 4IIVA 3LHDA 3D3NA 3UK6A 4XQEA 4K0KB 5AXDA 1YZQA 1OXSC 3LLMA 5MN4A 1DIAA 5IEJA 2HLDA 3M4XA 2O05A 1AK1A 5AJVB 3RWBA 2XGJA 1JKJB 3ZQ4A 2HA3A 3DEAA 1YV9A 1L7XA 5ALIA 1GFWA 4UTRA 3UHAA 1P8JA 2WBLC 3IXLA 5IC6A 3C3CA 1B74A 1QH8B 1EHCA 3AF4A 4IDEA 4IYRA 5B12A 1NUQA 3KYJB 5SYMA 2PANA 2VZ0A 5HW0A 1DUIA 3LUCA 1NC3A 3H9BA 5K0EA 2NQ8A 4N9WA 3DVSX 2G1JA 4YJ2F 1T8SA 3DMFA 3IMCA 4HATA 4X1IB 3UCFA 1U7HA 1P2VA 1Y7IA 3H5VA 2QJOA 3PDWA 5A0VA 3TTVA 3BG5A 5BW8A 3GEPA 4LVUA 1FJXA 5HIMA 3FJYA 1FW8A 1L5GB 3I61A 2XRMA 3AY3A 1G66A 3IP6A 2EAUA 2R2AA 2V6GA 4PVCA 1K2VN 2XBUA 4I50A 2ZRKA 5K9ZA 4XYBA 4Y0AA 3OUZA 1VI2A 2DTDA 2NVBA 2WTNA 1FFDA 4O0LA 2PRZA 1I3KA 3LKVA 3LX8A 4HYTA 3UOGA 1AS2A 1XLTC 2ZE8A 4EYKA 2W70A 4CCYB 1SU6A 5D7BA 5EHIA 4F3NA 1XWIA 2XMPA 1YRLA 2VCHA 1FYEA 3IAHA 1RHQA 5AVUA 2CMDA 1JNYA 4GBED 1GNQA 5I48A 4BN4A 3KQOA 3ESBA 4TS3A 4BECA 1JJ7A 1H2RS 2FLWA 3BB1A 3KPWA 1M8PA 1I1QB 4XTCS 1QZZA 5I51A 3M7IA 1E7WA 1CRWG 3PDJA 4XX1A 4RZXA 3ED5A 4EPXA 4CEIB 1QHNA 2IYQA 2B4QA 2WWFA 1OSNA 2XZPA 3BXFA 3HJRA 5ALLA 3U3JA 4HGRA 1WNTA 4O4LA 3GFVA 1TPZA 4FBGA 3V00A 2JBHA 2GWHA 3PF9A 3DMTC 1GITA 2V6FA 4JP1A 4B82A 4EB0A 4GT1A 4ARIA 3LCUA 4YQEA 2M6SA 3PC7A 2QY6A 2ORIA 5F76A 2R47A 1HEUA 3QE9Y 4B3DA 3FMOB 5L3QB 1C0PA 3GAMA 1JG2A 5CYGA 4JA0A 2PL5A 5K3BA 1GDTA 2I4LA 1PR1A 2QUJA 2PGOA 3HDGA 3RFVA 4ALIA 4AVYA 2O20A 4DLKA 4UEWA 4BO3A 2VL7A 4PGMA 1OX6A 3P2IA 3W5AA 4L9WA 2HEIA 3JQBA 1L7BA 4RTSA 4EB3A 1NOKA 1V5EA 3BC1A 2R5NA 3C6MA 2PIDA 2SICE 3FUXA 2W0MA 2EW8A 4FD3A 3T4XA 4ALNA 3BRWA 2CE2X 4E30A 2FVXA 2XNDA 4ARAA 2O6HA 1EXVA 3JWPA 1VDMA 1VSBA 4OEHA 5FQOA 5F3DA 2HWWA 4YJ2B 4YIKA 5AVQA 3CBGA 4RVGA 3BF8A 1ABEA 2FRVA 1Y7TA 2DPLA 2YJ5A 3QVSA 4GRIA 2D2EA 1TOAA 5DVZA 2VH2A 2FWNA 1H3FA 3SR0A 2I78A 4CI0B 2R7KA 4YGXB 1KO8A 3CIOA 5D6OA 5F78A 4BVJA 1NFQA 2DC1A 3FPGA 4JSTA 1KEPA 3HWWA 1TK9A 3ZS9A 4CTJA 3HGMA 1GA6A 1X9HA 4BWGA 1PZNA 4MDFA 3TKAA 1G3RA 4S0XA 3BYZA 1ORHA 4J4TA 5AO9A 2YYSA 2P27A 1XU7A 5CFMA 1ISHA 3WL6A 4M22A 3CZMA 5FPPA 1BHSA 1W96A 2YWCA 3UICA 4CUJA 4JJ8A 3VU0A 1CR1A 2EJVA 1ZK0A 4URWR 5HDQA 2Y6VA 1E9VA 5DFAA 4BTEA 1MABB 4EG1A 1T0IA 4QPPA 3MYRA 3I23A 2OGUA 3QE0A 4M9QA 4CR7A 4YRIA 4ARVA 2VUTA 1UMDB 3RTCA 4NARA 1AHHA 1TIKA 5DSZA 2QRJA 3K9LA 2PUGA 4OATA 3ILXA 5TMEA 1JEYA 1QDEA 4Q1CA 1ZCJA 2WWIA 2ZIUB 4LGVA 1VPWA 2VYQA 5JAPA 2YFHA 1MO3A 3HRHA 4PC6A 4PPQA 2Q27A 4GSYA 1ZGAA 3IPCA 4MAAA 1LKZA 4QDKA 3UPUA 3PFGA 4MP6A 4V3CA 4CF5A 5A5GA 3ECSA 3RK4A 1M34A 3PJFA 3FKSD 1NVBA 4C22A 4DGSA 2GDJA 4IZ6A 1UC5B 2WVHA 1O1YA 4RIEA 2IHTA 2ILVA 2Q5LA 3BQMB 1QG0A 2CXSA 2QZPA 4Q1BA 2XQJA 2I6TA 4EB6A 3DT6A 2ZCVA 5EIAA 5KJFA 2XNHA 1EYZA 1W6RA 2VTBA 4H6PA 4MYCA 2C2KA 3N2YA 4DYVA 4I66A 4GYYA 3DLCA 3N86A 1OYVA 3C7TA 3M2TA 1R0YA 3A11A 3LX4A 4LOAA 3BE4A 3OCVA 4KJXA 4RUKA 5EKUA 1FSPA 4CKEB 1TYCA 1GUBA 1OFUA 1JHQA 5LP6F 1HDGO 4BNXA 3IP5A 2WYVA 3VRHA 4QU8A 2BELA 3LIIA 4YRNA 4UXJA 3ZBPA 4BKPA 4CDGA 3IR6A 2BP7B 1GA4A 4YT8A 4WBNF 3WLHA 1I7SB 1EUDB 2I80A 1SUDA 1W7AA 3O1LA 1MT3A 4ONEA 4WLEA 3NTLA 4U5QA 2JKYA 4IYJA 1TC1A 2HPHA 4B8YA 2ZRAA 1BRMA 3ABZA 2PH3A 1P0QA 2PZLA 1ZKDA 2XHZA 2WWGA 4S0ZA 1D5WA 4ZC1A 2F3QA 3BJMA 2ZYHA 1RQGA 5LDHA 5LBIA 4I4LA 5K2MA 1KQGA 3SN6A 1T1JA 1OWLA 1JL3A 3HC7A 4MA5A 3MJ4A 1XRJA 3A1FA 4GOJA 4MEAA 4EKYA 2J9YB 3V7UA 2Q6TA 3ZI7A 4GMKA 3UKJA 3EZGA 4M1EA 1GPUA 1X1QA 4BP8A 2FDXA 3BWXA 4KQKA 4JI0B 4LY3A 2WB4A 5ERGB 2XHEA 2A7XA 1HLGA 3E22A 3RS5A 4E4RA 4MS3A 2YN0A 2QUKA 3DLPX 5J5VA 2O1XA 3K9FC 1R74A 1WDMA 3IQEA 1CUHA 2V7BA 3R5KA 4N5HX 2B1IA 3T7TA 3PFNA 4QO8A 4IS3A 1T1EA 3N2GB 3T7CA 2E37A 1RI2A 3FNIA 4FFSA 1C8BA 3GMIA 3H1FA 3OQJA 3RUDA 1U6KA 3AB8A 1ZNYA 2EDAA 2PZBA 1E58A 1EVYA 3KVVA 1X74A 5FOXA 3LXXA 4G07A 2IEAA 2PXXA 3RHZA 1M1NA 2YZNA 4TM8A 4AJEA 3ZZ1A 2IL1A 1KSHA 2FUG6 1ULZA 1UXGA 1K88A 2FI1A 2PX3A 3DPUA 5BQOA 2ZSBA 3VU3A 3IP7A 1K97A 3SF8B 1AN0A 4EOGA 4ZJUA 1L5NA 3D0RA 4A0GA 1VSTA 1R6VA 5LQMA 2RK3A 1UBHS 3I72A 3DP9A 3Q72A 4LTMA 3IB3A 4QSMA 2B92A 4CV2A 1PHPA 4NG5A 4DJTA 1A2OA 3BWEA 1T8RA 1XTBA 4KOAA 4NMLA 3ZHVA 3AM4A 3TZLA 1ZU5A 2HLPA 3ND8A 1J90A 1XR3A 1L5KA 4AZVA 2Y68A 5AXCA 1C7FA 1G7SA 4P98A 3ZC3A 5LP6B 2Y1GA 3SS7X 3AV3A 4D9NA 2NUTA 4DV4B 1Q7RA 3BSFA 4TMWA 3UAGA 1W5EA 4QC2A 4DVJA 2B6NA 1WMAA 1J39A 1W5FA 5I01A 5G4KA 4I55A 4TT3A 4HBGA 3NORA 2E1PA 4WBNB 1S02A 4Q21A 1PL8A 3RVNA 1Z33A 2UZAA 2RBGA 1R5NA 5EZYA 2FSGA 3NCHA 2A0WA 1ORDA 1PNVA 3PXUA 2XE7A 4QU5A 3SMVA 3ZYCA 5DBOA 3FOCA 3ADPA 4JUFA 3WYNA 3EPPA 4P4SA 1NBOA 2CNDA 4M38A 5K05A 4Y3UA 1N8KA 1WD5A 5EFOA 1KAMA 3QXXA 1UJ5A 2D0IA 1L7EA 4GPZA 4KXFB 4WFJA 3W8FA 2Z2YA 4N65A 5K6AA 1SVNA 4U0KA 2PYZA 1B42A 4C4PA 4G5RA 1XSEA 1CS4C 5FR1A 2IYTA 1D03A 3L1IA 1GA1A 3W3ZB 3WA7A 1AS0A 3GZTB 3WWDA 4DR7B 4IDOA 3DOHA 2GTPA 1NR7A 5BMOA 3RKRA 4K3VA 1AKEA 1CF2O 1PSZA 3F5MA 1GYQA 2PUWA 6GPBA 3KIPA 4L4UA 3UAVA 3SM9A 3RRMA 1I2MA 1PQ4A 3BWBA 1P9WA 3QVUA 5B1DA 4ZHQA 3IBFA 2JBAB 4JEIA 4JYMA 3HUFA 5HFJA 4KYVA 5CBPB 3AO0B 3H4TA 5DXAA 5B1SA 1MQAA 1DBIA 3Q9NA 4F3KA 4URVR 2IZ7A 1UBUS 1GD1O 1WTCA 3KSDO 2WM2A 2YYZA 4FQ5A 2I87A 4IUYA 4QTXA 4LYDA 2BTQB 4MYHA 1BJRE 5TR9A 3VH2A 3VZQA 4XWGA 1BE6A 2ZCUA 4ALMA 1J1IA 4BQRA 1RWKA 4Y2PA 5HIAA 3HCOA 1G21A 4WL0A 1VOTA 1ZIPA 2C3MA 3RC7A 4ITVA 4GWKA 3FNQA 3F96A 3RJZA 4KQ6A 3JWJA 3FWYA 1DTWA 1PZEA 5IKPA 1I10A 3ROMA 2Z30A 4HXYA 4TV9F 2IV2X 3TNJA 4IQ4A 1E3MA 3HR4A 3OZSA 3QVWA 1YZLA 2ID4A 4KLAA 2K87A 5P21A 1KC3A 1W0CA 3NIWA 2AHRA 3LKBA 4PLHA 4WZAA 3ESAA 4R8LA 3ZD9A 3ZHQA 3P0RA 4D9FA 1BHJA 3H75A 4KRXA 1U94A 3KKKA 1QQ6A 1HYBA 4ECAA 4EY8A 3DFIA 4JJ7A 3KLMX 3HP7A 4U8GA 4G5OA 1OLUB 1OMOA 1CR2A 2FZEA 1PX0A 1A27A 3V1YA 2VUHB 4CLHA 1KQPA 1T5BA 4Z7QB 1V8DA 3QIVA 4AMBA 1QRSA 4E22A 2O7SA 2HRRA 3JQRA 4AJLA 3RHSA 3G7UA 3DAHA 1KR5A 2WTEA 2WICA 1L1EA 3O3OB 1H4QA 3A2MA 1Z26A 3HDTA 1O2DA 3ADOA 4V0LA 1F7VA 3BH0A 2OPBA 4WXHA 3VO2A 4FXOA 1ZWLA 5IAOA 1TEZA 5DGCA 4EZIA 4YRPA 1QZUA 1NP3A 2AV6A 5JAUA 2AEJA 4FEEA 1TL7C 4E2XA 3QOXA 4LOKA 3T7RA 4O59O 2JI9A 3HFSA 5E6RB 3EQ8A 4X1OA 1L5MA 3LP8A 4ZO7A 3DXFA 4G4SO 1OFIA 2XMBA 1C1DB 1CYDA 4ATNA 2JLZA 2IIPA 5CIYA 2VHXA 3GARA 2NVUB 3U7GA 1T8TA 2AMFA 3H6HA 3X3HA 1E8DA 1KO4A 1R64A 1AGXA 5CDFA 3HE3A 3TDKA 2WSSA 3LBHA 1DAHA 4RHXA 5IFKA 5KPDA 4AK9A 2VHWA 4OXRA 1KFBB 3MJCA 3PQ2A 4RU1A 6REQB 2WP0A 1PFKA 2OV4A 1TYZA 2ZT8A 1G4UR 2X1LA 4B4DA 3OWHA 1YHZA 1XQ6A 4QGHA 1CUSA 3OETA 3TMAA 3U81A 1MQSA 2COEA 5LA6F 5ALJA 3W2GA 4GGPA 4D9IA 1HNNA 1P75A 4AWXA 1JDZA 2IPAB 3HB0A 1N0WA 1ULTA 3STWA 3ZWYA 1GKLA 4LWOA 2RJ3A 1AK2A 3FFBA 4TV9B 2VZEA 5KS2A 5JQGB 2EL9A 4IQ8A 1A8IA 5JADA 5C8YA 1UKBA 4RADA 1WDLA 4MVJE 2Z04A 1U8FO 3ZH9B 3COSA 2B4YA 4GSKA 3NIFB 2V5UA 5AM0A 3TK1A 1ZVKA 2X40A 4IIFA 5K0TA 3T5PA 1GXSB 1XPOA 3VU1A 2FN4A 3MPUA 4D0SA 1H42A 2PR7A 2GRJA 1D3AA 4RF4A 4ZQIA 2X0FA 1I32A 3IEKA 1OJLA 4IXDA 4UCXA 2WW8A 3A0RB 4HDNB 4L73A 3S2SA 3UVEA 3IUPA 3VNVA 2GARA 4OXKA 2RG1A 4PG5A 3AERA 3OCYA 4TGLA 1LLFA 2VYCA 4B84A 4PPGA 2PRIA 3C1UA 4Y2VA 2Z3VA 3R8XA 5A2GA 3V8VA 5I9NA 1Z8FA 5AM4A 1C81A 5HRAA 5C4MA 1P6UA 1J25A 4NL4H 2NPFA 1E6UA 1B8VA 3OC0A 1I9CA 4JDPA 4NJEB 3SQDA 1JR3E 2O3SA 1A71A 1ZI8A 3CVYA 2ZB4A 4N82A 2HMYB 1MH1A 4GWGA 3H2YA 3DDNA 4K9LA 1JGTA 3T7JA 1N8TA 3U3OA 1DE0A 8MHTA 2OXCA 1YB7A 3GYBA 3OIFA 3PHJA 3HHEA 1D1PA 2J85A 3KFXA 3OCJA 3ULKA 3WMFA 1ZVVA 1OVGA 5HMLA 1XMOB 3WTCA 4H7HA 4MVJD 4YXFA 3E61A 4QBFA 5T7BA 5ER9A 3THYB 1U0TA 2D7JA 4RIHA 3ZCXA 4URHA 3R7LA 5AIAA 2W5UA 3WV5A 2A94A 2ZYVX 4G25A 2QTGA 1XA4A 1TRHA 2GAJA 2HUPA 3K35A 4YMSA 3ZNPA 1AZWA 1XMSA 3WDKA 2H59A 1IBSA 3EFBA 3W6NA 4L7VA 4CCSA 2BHTA 4AW9A 3JARA 1XEFA 2HC9A 2OG2A 5LA6B 1XKTA 2QN2A 2B4RO 3LV8A 3FY4A 4OAOA 3WLSA 4PY2A 4S1OA 3FTEA 4WNAA 2BM0A 3IRVA 2CLMB 1E1KA 3PP8A 2JAWA 4GE0A 3CLUC 1UBOS 2FN9A 2BIFA 1QH1A 4AQDA 3A1TA 4LYYA 1GKKA 1BYIA 2Q7OE 1W9MA 3GLHB 1O58A 4ZAXA 1JR3D 1PVVA 1ZNZA 3BIXA 3EY4A 3HWRA 5ENVA 3DBHB 3Q0TA 1P9OA 5IXJA 2B34A 2QAJA 1IBRA 4JITA 4KN6A 4RA6B 5ICCA 3ZK9A 5A0FA 3UFXA 2EWVA 3CB4A 2Q2OA 1E1LA 2VNJA 3OM9A 4RNDB 3HHPA 5KYXB 2VO1A 3V97A 4EMBA 2BZ0A 1NLZA 3PICA 4B4VA 3HI4A 3I2KA 1Z3IX 4BP1A 1LK5A 3TVDA 5D87A 1A2KC 5U4XA 4F4UA 1CIJA 1Y1TA 4QBGB 2RGDA 3MGGA 4BYGA 2OFXA 1G5IA 4EJ6A 1N4DA 5HQJA 1M33A 4DCNA 2NTNA 3EGDB 2PSJA 4JYBA 4DDHA 4NEGA 1CNMA 4JEMA 1T9GS 1M76A 4BBZA 1F2VA 4HGPA 2CFCA 4EG5A 1PR2A 4TTVA 1HTWA 4D3YA 3S8MA 3VAZA 1IB0A 2CF6A 2ZJ1A 2F3UA 2ZAIA 1RHMA 3G5UA 3FH0A 1JEDA 1Y9AA 3VZBA 5HIJA 3Q0IA 1CP2A 4L5JA 4LTDA 4I3GA 3EH2A 5LBUA 4B7XA 4E1BA 3U4MA 3JYPA 2VQEB 4D7AA 1SU4A 3O26A 2WU8A 4Q9LA 5HTOA 3P0FA 4YMVA 1YVDA 5DNEA 4ZVLA 3UXMA 3WLPA 2YJGA 2VBGA 2BGRA 1GG8A 4E2YA 2H52A 1BX0A 2YOGA 2UYOA 5M2QA 2PL9A 1JFLA 4OHUA 4A1OA 3V4OA 4BMZA 4X60A 2F64A 1S2OA 4XLLA 4M0KA 3K09C 1GHTA 1ZS9A 5A05A 3RUPA 1FFYA 2XIJA 3QP9A 5JJKA 3QKSB 4HAVA 5LN1A 1TKCA 4CCAA 4GKJB 1M6YA 2ZYRA 1O0SA 2P9EA 3E82A 4ZOLA 2XQIA 4Y9TA 4IIJA 1SFRA 1IB6A 1OIWA 5K3AA 3D8RA 3H1BA 2GLTA 1D04A 1OZHA 3DZKA 2BR4A 1M2KA 1ORTA 1J22A 4RPJA 1W48A 3JQGB 5A5VA 1X7WA 4LXQA 5DK4A 3WGJA 1H5UA 3B53X 4I81A 4JU8A 3RYCA 1KEVA 2FW0A 4MUXA 4Y1EA 1GLNA 2BMEA 3RQIA 1RZRA 1GAQA 1ADCA 4JP3A 4RY9A 3IVGA 4L08A 4A4DA 5I9LA 3MOSA 2I34A 1VA4A 1N1DA 3CNEA 5H9VA 4EW2A 5CVTA 3ZWNA 5ALMA 4IRUB 1QVVA 3DE7X 1VP9A 3NRCA 4R9RA 1LV7A 1EUCA 4MRSA 3KE8A 2J0EA 3DMGA 1KZHA 4U63A 1VGVA 3T0IA 4DQXA 2WAXA 3VBEA 3Q6IA 2VH1A 1EJ2A 2NM0A 5ER6A 4PYOA 2Q46A 2GNAA 1UOEA 4UAGA 2P78A 4ZOAA 2ZUWA 4CMKA 2V65A 3O5AA 2WKQA 5D7NA 5EUBA 3KVRA 2GT1A 3A1UA 1RQPA 4P83A 3BAFA 3A9VA 3ISTA 1BKDR 4OHXA 4KK4A 3NBUA 2YHUA 4DOMA 4DQKA 1DXYA 1LSSA 1BXGA 1EDDA 1N2HA 2CNNA 2RHTA 2WIDA 4ZREA 3ZDAA 2R65A 3NDBB 2Y76A 1FU4A 3PEVA 3L8YA 1KMHB 3OURA 2A3RA 5FWYB 3A32A 3RC3A 3NQ41 2WF7A 2VLIA 1PTJA 4BO2A 9ATCA 3L0SA 2QAGC 5GONA 5BMVF 3WG9A 4EPTA 3SSMA 3MWEB 2GPWA 2JFBA 5EMMA 1UDBA 4IIYA 1BDJA 4YCCA 2EHDA 2I3AA 2W37A 1JPUA 3FIJA 5JS1A 4DRZA 2FUG1 2O52A 1X3LA 3DGFC 5I6DA 4Z53A 1E5DA 2R11A 4O25A 4YIHA 1ZIXA 1Y8CA 4O0MA 2CYCA 4MGEA 4KQEA 4BNFA 2ZS7A 2GTHA 2IYYA 2VP9A 3UNXA 1ICIA 3WGLA 1AF4A 1KMIY 3LDUA 3DKKA 4UDXX 4X6LA 2C4WA 2BGTA 4OV6B 1U99A 3I6QA 1T43A 1TPYA 1JI3A 1GL7A 3HUUA 2XT9A 5LR6A 2Q3CA 1T5DX 4PC1A 2R4QA 1V16A 3CSDA 2HIMA 2M98A 4L5AA 5AJXA 4J7AA 3U4DA 5TGDA 4AZSA 4HH1A 1YR6A 3OKPA 2IP1A 4EHDA 4CLXA 3MWFA 2HMAA 3G17A 4K3UA 2P2NA 2PR2A 5EZ5A 4WOPA 3HCRA 1J2JA 2ERXA 3O4RA 1H66A 3QEKA 1INLA 4P9NA 1U7UA 2ZWMA 1P1HA 4PX3A 1XYVA 3IDOA 3KHKA 4KBYA 4MWDA 4PYIA 1D2AA 4R84A 4R0MA 1PDOA 2UYGA 1E5TA 3S1SA 5EEHA 3A10A 1W87A 1EFVA 4M7PA 4YXWD 3AKCA 1WMSA 1ZSYA 2W2LA 4QFCA 1IZ0A 4KQ1A 4W1RA 4D0LB 4TWRA 4UVEA 4IZOA 4D80A 2W43A 1S2DA 5LXTF 4HDAA 4OHCA 2P6NA 3W7VA 5JXIA 5DISB 1NG1A 3N1UA 1DPGA 2GM9A 3G2IA 5DEOA 1G8PA 2X5JO 4FINA 1SIOA 2TMKA 4NZMA 4AJHA 1XD2B 2R6HA 1SJ9A 4H3VA 4P93A 4N5DA 2WHPB 3G8AA 4ZVMA 1Q7BA 1TXGA 5C46F 4EM6A 2QHXA 2ZR0A 5BOVA 1FP6A 3B1YA 3HPRA 3KUUA 5FB3A 5H3LA 1HRDA 1CU1A 4DC9A 4OH7A 3M9XA 3MXTA 3MWYW 2C9OA 1JE0A 4K88A 1MNQA 2EIHA 4CUKA 3BQ9A 4G8DA 3OEHD 5E1BA 2Q9AA 3BWVA 4Q4AB 3VR4H 1J7JA 1UT8A 1QHXA 3OO1A 5E6SA 3UB3A 5A9TA 1BW9B 3GNQA 4EUEA 4YV1A 4IHAA 4ZYVA 6AT1A 5K8CA 2Q7XA 1NOJA 2XRZA 1I5RA 1B0AA 2X9VA 3BIFA 5H68A 5BMVB 3LD9A 3HYRA 1XTZA 2P11A 3TR6A 4U4AA 4B2IA 2WA2A 3F8TA 3R0VA 4AIIA 4GDMA 1KIFA 4CQNA 4KMMA 1QU2A 3JQPA 1EHIA 3ZDDA 3M33A 4PLZA 3TBFA 1SZPA 1TUIA 1UBFA 4FJ1A 3C6YA 1EQUA 3AQ4A 1QAOA 1NYRA 5B58C 3CH5A 3AHDA 4ILKA 3DZIA 1QPZA 1FNMA 1ODIA 1ZI9A 3FYUA 1PSWA 1VJCA 2CL7X 4XD2A 5TNXA 3FPLA 2P2DA 1HYGA 3Q8XB 4MS1B 3W1WA 1J8MF 4DUGA 3TMYA 2PG3A 1SHJA 1FSFA 5BWOA 1BXRA 4EPYA 2P75A 1SPXA 3U4HA 2WJGA 4KMSA 4ZALA 2WNHA 3T3PB 2J3EA 4Y6LA 4Q16A 4EI8A 4UBMA 4QE3A 1QUFA 1Z5ZA 2BFBB 5CNKA 2FWRA 2HIHA 1ZP6A 1JLLA 1G6OA 3TIFA 2QQ5A 3K1AB 1GQ2A 1OBOA 1RYZA 3VUEA 4J0DA 1U7ZA 1O9GA 2IXFA 2PD4A 4GOND 2PPVA 3BICA 4IDCA 4KBFA 4PZAA 3KS9A 4JI7B 1F48A 1FBTA 1NATA 2KLHA 1U2RA 3PXEA 3QMPA 4D1YA 5ITZA 1T8PA 3V8RA 5LXTB 4R1PA 1ZD8A 4UTPA 1KH2A 2WMYA 4H7PA 2WAMA 3G0CA 1IFXA 2OCPA 1G4AE 4ZT5A 2CSXA 2FHSA 4FZ5A 5KX5F 1GCUA 2AN1A 3C5WP 4TKUA 4Z4CA 3AZPA 1VHQA 2AWOA 2R97A 4B3JA 2FMKA 2WTMA 3OPVA 1ZZGA 2E6UX 1NBWB 3EZ6A 4LZWA 4ROSA 3JQEA 1OHHD 4K6GA 4LSZA 1U1EA 3BGWA 2XTJA 2R0QC 1FQKA 1MOQA 4BHTA 1KQFA 1XRSB 1DJPA 2JH3A 2RC5A 5BR8B 4NNJA 3UATA 3CONA 2WFZA 5TS2A 2G5PA 1GDDA 2B2NA 3C5EA 3JVVA 2GD2A 5E9WA 4RHYA 4DTIA 1Y7LA 3QTBA 1M6VB 4GX0A 1XCBA 1Z4OA 4JB2A 1U2SA 1X1CA 1Q0PA 3R7AA 3T9FA 3V2GA 1NWCA 2POQX 4RXUA 3O1JC 4V0ME 5BVGB 1GAXA 1N32B 2DM6A 1C80A 5CUQA 1SVOA 2FPXA 4TTQA 1GL6A 2ZSIA 3LOQA 2QX4A 3FA2A 4X90A 1A96A 3K1YA 2C0CA 3BM5A 5IWAB 1H23A 1RI1A 2Q5HA 3BJIC 1LPMA 1DB3A 3F5QA 5F51A 2DU8A 1SG6A 1UEXC 1C29B 2ICAA 3W9YA 5REQA 4JT4A 4DG9A 1VIVA 2ZJBA 2G8NA 4FGKA 4NH0A 3KXLA 1OGYA 5BNWA 4B32A 3MLEA 1J9GA 2I71A 2V4ZA 5ETJA 3OOYA 2QL7A 1T3GA 4CMCA 2YV1A 2PQ0A 2QMEA 4FYYA 3DMDA 1D5CA 4JX9A 1IRIA 2PY6A 5K6TA 5KMGB 2FRDC 1R88A 3WBBA 3EZNA 4YRZA 3C87A 4IMIB 5L6LB 3JV7A 3OICA 4HQKA 1UAGA 1BTOA 3A4NA 1C1YA 1RHUA 1TYEB 3KUDA 4ICIA 2DJIA 2Z2KA 4M1OA 4QXAA 2X9NA 4BFTA 1QX3A 1HEYA 1KXZA 4Q48A 3GNSA 1U8TA 3F5DA 4HQ6A 2RGXA 1WEKA 3D9QX 3HLYA 3QFHA 4YC7A 2RAFA 2OWEA 4L76A 2X0IA 3GCDA 4UPDA 4N3NA 4LRWA 1JX6A 4WZBE 2B2CA 4Q3AA 4QUKA 4UE6A 4D8WA 4K03A 2VK1A 4MRRA 1NVTA 2C2MA 3BE6A 3FOAA 2V7VA 4MP8A 3ZQKA 3CSSA 5KX5B 4M1TA 1ZN7A 1FYFA 1JUDA 3D1JA 1A3CA 2WQZA 2RAVA 2D59A 3A27A 3IXMA 1NP6A 1RRGA 4Q93A 2HZ7A 3GROA 3IT3A 4U7JA 3V3TA 4CKWA 4PQRA 2FDRA 2XA2A 1JIUA 1M9NA 1F6DA 4KTTE 4BFVA 4RIGA 1EDEA 4DDTA 1UMCA 2YNMC 4N8DA 1EJ0A 1ULSA 3WLKX 2ZPAA 3KJQA 5IK2A 1HGXA 5TSDA 3RYFB 4CG3A 1JIQA 4OJMX 2YXEA 3E5MA 4CM8A 5JH7F 3K8YA 3HN6A 3JVUA 1TVKA 1N0UA 1N57A 3FFAA 1CQJB 3SP1A 3TFQA 4FYIA 1G4HA 2JJ1A 9GPBA 1P31A 2IYAA 5BSTA 5JSFA 3RS9A 3B3AA 4WNIA 4Z5XA 1RYMA 5GZ1A 5JAHA 1NY5A 5AW9A 3GPBA 4EUNA 2G5CA 4NZOA 1N3YA 3D0OA 4RPIA 1FDVA 4OG2A 2FJPA 3SKXA 3QKUA 1DVRA 2J3MA 2P68A 3LO5A 5JQGF 1F2TA 1G18A 3LVRE 5MHTA 1J2UA 2GPNA 4CEHA 4Z4IA 1J5EB 4IJUA 3ZDEA 3TM5A 2GZRA 3WIVA 3UBMA 3L6CA 2ZSHA 3DMRA 2R8ZA 3EPHA 1JQEA 1S0UA 4XIFA 2O8BA 2H4JA 1DWQA 1L4EA 3EVFA 4G0ZA 4BNNA 3NHSA 3CV3A 3KAPA 3LLSA 2F9LA 1T9KA 4B7UA 1QBGA 1KSGA 3QFRA 3FZNA 1VZ2A 1B16A 1CY7A 1LRLA 3TX6A 1KF0A 3D6HA 4I1UA 3R3ZA 2FP4A 4NYIQ 1Y4DE 1J5XA 4FNGA 1JIKA 3LF2A 4NMWA 1WUIS 3L9XA 3O31A 5SYAA 2B1QA 4QPCA 2PRJA 3C4VA 2PWBA 1YJQA 2I6QA 3LL7A 4ZO4A 4E5DA 1NVGA 1MXHA 3PKZA 4W63A 1NYQA 4X65B 3M6LA 1DKUA 1UK8A 1R27A 4DVGA 4DYHA 1F8UA 3DBRA 1W36D 2P9CA 3N3AC 4UNPA 7MDHA 1O5IA 5AM1A 4HYYA 3LLCA 3L3BA 4BPRA 3EGWA 3AX6A 4DIDA 2HK6A 1ATIA 3A6JA 3NUZA 4LDPA 4C4XA 5AUOB 5AHKA 1YOVB 5BT9A 4M9ZA 2EFYA 1F5NA 1MW9X 4EVQA 2QAGA 1FNNA 2R8RA 2AE2A 2QVLA 5IBQA 3ES9A 3LBFA 3HXLA 1AK9A 4GVXA 1E1QD 4KFTA 3Q40A 1YBMA 1SURA 1I3MA 3FCCA 1U0EA 1T0BA 3HB1A 3SIRA 4CLOA 4LMPA 1K7YA 4H17A 4QSHA 1CQXA 5TXGA 4CL2A 5TF0A 2P6OA 2Q6LA 4C0QC 4RY8A 2K7FA 5EAIA 3PNSA 4FGJA 1GPJA 2ZYSA 4W5HA 2H00A 2H1IA 2GBLA 1RE0A 3GJ0A 4PX5A 3ZKAA 3O0TA 5EWJB 3TNYA 3DMHA 1PNOA 3CKKA 2EW2A 1JVNA 3VSEA 2NZ2A 1TYDE 1L7QA 3A3OA 4MNTA 1MRZA 1QYDA 1O5TA 1USGA 3OO0A 5IJ9A 2J33A 2O7NA 2IE0A 5EJ2A 3QFCA 2KS6A 3VJKA 4GH5A 4GAEA 1NUTA 3QFFA 4LDZA 4EJ2A 2Y77A 1EZ1A 4A8TA 4NENB 3F71A 3DOUA 2GD6A 2ZR9A 3GR6A 4IH9A 5K3CA 3NDRA 2C78A 4D74A 1SHUX 4BNKA 5C9ZA 2DETA 1RVV1 4CQMA 2DYKA 1HFEL 1XF9A 2ZR8A 4ZVOA 5J2TF 4KDEA 1ZJ5A 4WN9B 4QU0A 4YV7A 1RJEA 1SOMA 4FZJA 4OQYA 3WMGA 2ZWIA 3PQCA 3PB3A 2JIOA 2DHQA 4RK1A 4X9XA 3HCCA 1ZD1A 2QGNA 1C9JA 3A58B 2QD2A 1SD2A 1LBHA 1RRKA 3T9EA 3VYUB 1JRLA 5A2QA 4Q4JB 4DGQA 2JGDB 2Q3EA 3M1LA 3OIUA 4E14A 1E98A 2ZTSA 1M3SA 4CIVA 1KOJA 1MAWA 1WABA 2OV2A 2XTMA 3LJKA 2IUSA 4KGXA 5BT8A 5K8JB 5FI0B 2CVOA 1JF8A 4JFRA 3NHRA 1YQGA 5JCZA 3AFHA 4BRUA 1G17A 3P5SA 2DQSA 5CK5A 3SZLA 5E95A 3C5CA 4M7WA 4UW9A 3PR2B 5ILOA 1A9XB 1YUMA 4FNMA 1OPXA 2YW9A 4POAA 1IJBA 4HN9A 2X6QA 3S2YA 1I30A 5TS3A 1TUEA 2GK6A 3BERA 1JTEA 3GP5A 2PGIA 2FSFA 3LZ6A 4EGJA 1TO2E 2JIZA 2OQRA 2QSZA 2X9QA 2VJPA 2E7ZA 1SBNE 1FMLA 3FSGA 3LDGA 1EK6A 1W2WB 3HDJA 1LBIA 3GLIA 2PJZA 4EJFA 5HUJA 2ZM5A 4G4IA 5ELXA 2LD4A 4QVGA 2DR0A 4BMOB 1ZCBA 2GQ0A 1PW5A 821PA 4E0BA 4HAZA 2R44A 4QDZA 1RKVA 4FYPA 3K15A 5HBGA 3RVQA 3QMWA 2F1JA 1WIWA 4JBYA 3KQHA 4JBXA 4UTZA 1BA3A 3AXTA 4MIKA 1Z6XA 3TLGB 3RU2A 4P92A 4HLQB 3EIEA 5CW2A 3KG2A 4MVJP 2VJMB 4II2A 4I9UA 1E9AA 3OZEA 2LXNA 3ZWMA 3Q3VA 2D2FA 2A14A 5LMUB 4G89A 4JWKA 3UB2A 2ROQA 1YJCA 4UU8A 4ZT7A 4EQ6B 4Y2QA 2C7GA 4AUEA 4HI0E 1B8UA 5TT1A 1ZX1A 1A82A 4PHHA 3CWZA 3GIWA 5CYPA 1QP4A 5J2TB 1KI3A 2QLMA 4L1KA 4MQEA 4RPGA 2VLBA 3PXCX 4UZEA 4I3HA 3ZHXA 1S5PA 1KDPA 1N6KA 3KC2A 4REMA 4HVLA 2BCEA 1DSSG 3T9BA 1MX3A 2VHTA 1TGYA 2HDNB 2BJHA 3K6SB 4NKRA 1P2FA 4D44A 4OD0A 4Y2XA 5JXHA 3KLBA 3AESB 3ZGVA 3EZ2A 3FXAA 1DUSA 4FJ2A 3EXG2 4GWLA 5HXAA 5IJ0B 5ED4A 2PUHA 1U4OA 2WFLA 1EFLA 1NSFA 2XZOA 4LY0A 4EKNB 3DXZA 3DOEA 3ZWVA 2QXTA 1UK7A 3OKAA 2VTKA 3CB2A 1DMRA 3AJDA 3LWBA 3LUPA 3RH0A 3U7QA 4ZIRB 5JT1A 2C7QA 3UAOA 4D8VA 5BN3B 2OSVA 1CB7A 2V8OA 3R09A 2VR1A 4UCFA 1T91A 1U2GC 1BEZA 4BLPA 4WBXC 5F7OA 2IHYA 2AXNA 5EJ5A 2WM3A 3WL5A 1QF6A 3DVAA 4L5CA 3UH1A 4EJSC 2UVPA 4NICA 3PG5A 2YJNA 5L3SB 1Q0LA 5CEJA 1Y81A 5AVSA 1CVLA 3PVCA 3C1TA 3KUCA 4OQQA 3PT5A 3BFJA 3AIIA 1NBIA 5FADA 1BH2A 4HGYA 1CJTC 1U1DA 4FT4A 5ALVA 1RXWA 2ODPA 1QIDA 4I8XA 1L4FA 5EZQA 3VDMA 4CZ2A 1N36B 2Y93A 4DADA 4ZJPA 2BSXA 1JFFB 3IDSA 3PHGA 1F8GA 1ZH2A 2ILTA 3CNNA 3F0TA 3H2KA 3VOTA 4NJOA 1UR5A 1IQPA 1IULA 1Y3AA 3G2PA 3KJFA 5EXXA 5H02A 3WSWA 2D2VA 3TOVA 3QPAA 2G9ZA 4KSBA 1P73A 2VHCA 5E3HA 1ZMRA 1PT5A 4MQBA 3TB6A 2PD6A 1H2WA 3ASUA 1GSIA 2ZB3A 1OT5A 5JBIA 1JT2A 2GF9A 1H8ED 4BC1A 3TJMA 2QJFA 4HDRB 1L8AA 5HBRA 3G82C 5EXSA 1RPTA 2C9CA 3I58A 3IR7A 5EHGA 5EJEA 3KL4A 5JNLA 3AJ8A 4YRJA 3WWCA 3H5NA 2HA5A 2ZK7A 4N5LA 4OA5A 1BWQA 1LVUA 5HQ3A 3OQ6A 4MJXA 3CWCA 1DU4A 3NHFA 5TC4A 1WMDA 3N75A 3PX7A 2HMUA 1QDUA 2KYRA 2XODA 3GAFA 3BMOA 2XWJI 1GRVA 2Z83A 1T6BY 3CX6A 1JXOA 3HKEA 3LI2A 4H4CA 3DPIA 4UREA 4OJNA 4XVCA 5KTKA 4NQZA 2Q28A 5T8KA 2VHYA 5EIBC 3WLFA 2AN4A 3TL6A 5ES4B 3RC9A 2YMMA 1JU4A 3K0AB 2X41A 3WLLA 3TUZC 2GO7A 4KIJA 4EIWA 4J3FA 3GVPA 3D8UA 1OXBB 1KAOA 2B6HA 3D6JA 4C3OB 3ZUGA 4RTOA 1KRXA 2C7RA 2WKWA 3O2QB 1HWYA 1KK0A 1QH8A 4JLNA 3TLEA 3TKYA 5DMXA 5BV2P 1IQ0A 1RWOA 3PT9A 4CV1A 2O7VA 4BNWA 1PLJA 5DLDA 2IPXA 4JZYA 2FW9A 4RD3A 4B1FA 3HVIA 5IN4A 1GTRA 4OLBA 1TCBA 4C4AA 3WQHA 2PE5A 3TQRA 2ONKA 3UGTA 5K8IA 3OEWA 3R0XA 4X20B 3N2LA 4QUAA 3AVWA 5B6PA 3DE5X 2PKXA 1RCUA 4XLTA 1ZHHA 4PN3A 1FS4A 1TQHA 2PXHA 5IM5A 3THWB 3CF6R 3QLVA 3N8KA 1BMTA 4Y2GA 2FX2A 4MKZA 3PI6A 4YRQA 1EG2A 1Q1BA 2MU1A 1FNCA 1HT3A 1RAEA 2IPOA 2WSBA 5ALTA 3IDAA 4JKIA 5DTJA 4EHAA 5AVXA 4BJ6A 3KD3A 2PX0A 1JJFA 1J97A 2PD3A 5IKMA 4ZKDA 4PFKA 4GP9A 2QLFA 3WDLA 4YI3A 1Q1ZA 1Y8RA 2XUAA 1SXQA 1OH7A 4OHRA 1AHIA 4IVPA 2AJDA 3PR1A 2H9YA 3IKTA 3SQXA 3WKBA 1P0FA 2NZUG 2UZ1B 1NSTA 4DARA 4XWYA 1UK6A 2OQ2A 2QVCA 1LVHA 4RE5A 2I29A 1SXIA 2XADA 4MQMA 2GHTA 1V3VA 2WJJA 4P7GA 5DIFA 4RW0A 1NX9A 4UEKA 1KVQA 2JFNA 5FFFA 4ME6A 5J4VA 1PNRA 3OWOA 4KRGA 1JPJA 1K7SN 1W9HA 2PUVA 2AYYA 1O94C 1PKEA 3GUVA 4OHFA 2BFOA 3SZOA 1PRYA 4ZOQI 2NMVA 1QB7A 2QTHA 1YE3A 2RHDA 3H5LA 5CRIA 4NCBA 5C3MA 2LW7A 4YP5A 1A2BA 3KKMA 4L3VA 5JALA 3CNOA 2GZ3A 4QVIA 2GPJA 5AI5A 1B6TA 3MJFA 1XZBA 3ET4A 3THSA 5KKCA 2VP2A 5E38A 1AG9A 1GADO 4KI7A 1FDRA 1CJVC 1ODLA 2HSZA 3OJEA 5FYQA 4EDFA 2QRZA 1XZEA 5L3QA 4RHCA 1DEOA 5KTSA 4DWWA 4DF3A 1P4HA 3UMFA 1RLIA 1CUYA 1NOIA 5ICFA 5BYBA 3SX4A 5HG0A 2C2WA 5FOTA 3LYLA 2ADOA 1BKSB 2GJ8A 5AR1A 5IAGA 1Y8AA 3Q9SA 2F67A 2RAUA 4ER0A 1XCGB 5F21A 5IKXA 3ZJVA 1CRQA 1F1JA 2E48A 2FW8A 2LTAA 4U8HA 4DC0A 3K9WA 2RIPA 1Z0UA 1QIJA 4LE0A 3THXA 1MT0A 1TIPA 1W85B 3EIWA 4F72A 2HCTA 4EZEA 3FD8A 1AC5A 4YJ2A 3PSAA 3CZ5A 3B2QA 1CY6A 1MNAA 1YDWA 1M6HA 1U4NA 3M6AA 3PC8A 5IF3A 2X2OA 2WUWE 3EY9A 1Y5NA 2JLCA 3D02A 2QM3A 4MVJH 3TEFA 5ITSA 2RH9B 1G3QA 2O5EA 2WWXA 1AQNA 1P9LA 1K6MA 1QV9A 1TQ2A 5EYPB 3NVAA 2JFHA 4PSCA 5K4HA 5KWJA 1G2IA 4JX8A 2WMNB 1O8BA 2C5FA 2Q07A 2SNIE 1PFQA 3GAAA 2ZWAA 1VBMA 5DHUA 4TVKA 3ROXA 3QHAA 2CDCA 4MV8A 2QTVB 1A72A 3V6MA 3VZPA 2WUEA 3EDMA 4HRVA 4R6WA 2OE2A 2HWXA 3B48A 2XEXA 3F67A 3NHJA 3OAAD 4QXMA 4XDZA 4YWJA 2CLDX 2ST1A 1HLFA 2O2IA 3RS0A 3EXIB 1CDOA 1N2XA 3LNTA 3WOVA 2VT6A 5JECA 3CSUA 1LX7A 3N8HA 3BRCA 2VBFA 4FX2A 1US8A 4BFLA 3DQZA 3PQFA 4F96A 1E3EA 3KEOA 3ONWA 4DXAA 4RZUA 1NSYA 4OJKA 3P32A 5ULLA 3TLKA 2B78A 1E61A 1AU9A 1VG0B 3K0BA 1XZJA 5COQA 3TSYA 5IUNC 1P80A 2B35A 2CCJA 3VX3A 4C1BA 3OIDA 1F9AA 1FRNA 4EITA 5C7LO 4FFWA 1SB9A 1ODJA 4QEZA 4CIYA 4P82A 5EJAA 2PJDA 4HFJA 2OR3A 4PX9A 2E87A 4IJVA 2V59A 5I4IA 4JLOA 2WI8A 1WY5A 3SC3A 1RYNA 2NLOA 2QNBA 1RYEA 1LLDA 1VL0A 4OOEA 4NCAA 1JW9B 4UTXA 3SLKA 1KOFA 4YCMA 3DOJA 3ENNA 1FNDA 3EG5A 4Z1MA 3WIDA 4DRYA 4CKEA 3NETA 4TRRA 1XJQA 3SIXA 3NATA 4E3WA 1R3UA 2GH1A 4G0QA 3SXJA 4A8JA 3ZCVA 1H2EA 2J6BA 3KR0A 3C43A 1W0JA 4L0MA 3VSBA 3EPKA 4WCFC 2WM9B 4K46A 3KB8A 2V03A 4BZPA 4EX7A 3C3BA 2MCFA 3B6KA 1H9CA 3W2EA 4XJTA 1FYWA 1JQAA 5CB4A 1Z5UA 4NZYA 3KZVA 4BFWA 2JLQA 3IUSA 2BTOA 1P29A 3L7MA 4UARA 2YZMA 3GEEA 1GJRA 1DXOA 3OH8A 5LFAA 3B6IA 4ZO6A 2QLTA 4C7OA 1HPLA 2WIJA 3DS8A 3PGMA 5BUQA 3UPTA 5A06A 1SCNE 3I04M 3F47A 4V0KA 3KDPA 1AGNA 3KKLA 2X13A 3KT6A 3OA2A 4INJA 1L5LA 4EMSA 3L7DA 4EVRA 5A4IS 3ICOA 4JUIA 4NBWA 2HNAA 2GERA 3RUAA 4BVLA 3R9WA 3ZV4A 2WUGA 4KIWA 4ZI3A 1T0HB 5HZMA 4XGRA 4OBWA 4DQUA 1GUYA 3S1AB 2ZRHA 5K3OA 1RVDA 3FAZA 4F4HA 3BWMA 3ZI4A 4ZICA 2AGVA 4C5CA 3I45A 5AVOA 3UMRA 1GPLA 1LDGA 1VJTA 1M8GA 3C3AA 3MXOA 1KO5A 4MYDA 3NM6B 2DQ4A 3H83A 4REOA 4YRSA 4B71A 2YMPA 5AVYA 1RAAA 1QLJA 2UAGA 3DT9A 3O75A 4IFEA 4MP3A 5KOIA 2V7EA 1B73A 4HGZA 2QTNA 3GRCA 3VKFA 1SPBS 2LV8A 5GM2A 1QVWA 4XVRA 3HGTA 1XL0A 3I0NA 3SF8A 2WABA 2C0QA 3RG2A 1U31A 1GZ4A 1JQLB 4QWWA 4ESEA 1TM2A 2C7OA 1H0SA 4B87A 3MAJA 3K4PA 4GOLD 2IUTA 4RMNA 5GQSA 3RSZA 4EGFA 5JTUA 2LGJA 2DQYA 4L75A 5BSUA 3GFPA 1PP4A 2D4AA 2HGSA 2Q99A 5IP5A 2WVJA 3NTRA 2JEOA 2XV1A 1JHOA 4KQWA 3W2HA 4QFDA 3C6KA 5JHHB 1MP0A 4HR7A 3KPUA 3QHQA 3WXMA 3CUUA 3V1NA 3U26A 1HQDA 2ERCA 4PGHA 1GNPA 4WBNA 4Y2JA 2XDQA 5H3HA 2XOKD 1PS8A 3AFMA 2FSUA 2XDYA 4H6WA 4NP6A 2OESA 4ZC8A 2DY0A 4NPHA 3KQQA 1UJ6A 2Q8PA 2CK3A 4OL0A 4BX2A 2QB5A 4MI9A 2AJTA 5EVJA 4F97A 1SCKA 1E2KA 3ETEA 3VPAA 5JBQA 4O02B 1WXXA 1RLJA 2AXEA 4G0OA 5ALZA 1NQOA 1DOAA 4HEA6 1MO5A 4EA8A 4UTVA 3DLBA 5AJWA 3J80A 1GTMA 2X6RA 3IESA 1KRHA 3R3JA 4YI5A 4DM7A 1ID8A 3L4BC 1Q0ZA 2W2NA 3D7LA 3VYRB 4RKYA 4FYWA 1V95A 1YE8A 3O1HB 2N1BA 1VJ5A 3GRVA 1GTVA 4GW3A 4M98A 3TIVA 3LC1O 2EFDB 1D2NA 4FXPA 5FI5A 3TMKA 5ALSA 3M4NA 3OKFA 3F7OA 2OWDA 2GN0A 4XWKA 2W6JA 3Q3HA 3H8WA 3ZWBA 5BQXA 2Q21A 2D1YA 2W8ZA 3LY5A 1RFLA 2P35A 3MTBA 1UOPA 4RTRA 4CM7A 1IJFA 4EUHA 3N9IA 1NVKA 2DFTA 1W0KA 2XXAA 4DQLA 4BTLA 1CHNA 2E5WA 4JSYA 3BMQB 3SJUA 1MMFB 2Q2QA 2JBAA 3F6EX 1TAUA 2ADFA 2X0RA 1T1RA 4G1BA 5DASA 3WB0A 4AS3A 2YICA 3HPQA 4Q4HB 1ZLYA 2G04A 4UHHA 4F91B 2OBNA 5JIBA 4ZQEA 1ZN8A 4OB8A 1IY1A 4NCXA 1D1QA 5CLGA 2BTQA 4TQGA 2IOHA 2QG6A 4H3HB 4JLJA 5CMLA 1SOAA 3GJXC 3DF7A 4YRKA 1V45E 2PS9A 4D0NA 1E3WB 2BSAA 4DMKA 1F2DA 4PG4A 4EA6A 4OJYA 1SA0B 1U2DC 3BHMA 3QI7A 4EF4A 1NJGA 4PIVA 3UV6A 4J0KA 5H4HA 1M10A 3LA6A 2MYUA 5FOVA 3L2OB 4CQLB 1ZJYA 2JGKA 1DQSA 1U98A 3DAOA 3RV3A 4A8PA 5JV5A 3G5LA 2CT8A 4IL5A 4LBVA 4EECA 3IMEA 1KI4A 1RZVA 4KH1A 1QQ5A 5J23A 1NJ1A 2Q1UA 3QBVA 4B3GA 1DJMA 2YRWA 3BGVA 1ULAA 3RVPA 2Y8EA 2OCBA 4QX6A 1A4XA 5MFPA 3E18A 4WWHA 1L4YA 5BXYA 1ZI6A 4IXWA 1X13A 3HBMA 4AJ9A 1L5FA 5GPBA 4KPGA 4L8YA 1WNFA 4YP0A 3VVMA 2GPYA 5BYAA 3DZGA 2WLSA 1DKMA 1FTNA 3MD0A 4G5FA 2JS7A 3TLJA 4KPUA 2DWUA 3ER9A 2F55A 1KFKB 5TDHA 3A1EA 2QZZA 4B7CA 4KK3A 3N6XA 2QQFA 3O92A 4CVNA 3CX3A 2IZOA 2O5RA 4KV9A 1Q0RA 1FFBA 1OAOC 4IFTA 1BDIA 2QPTA 4P54A 3H7AA 4JLBA 1O03A 3K16A 3U62A 4R81A 1KNXA 3HYTA 3CF4A 3DGEC 1FE8A 4LE1A 4JB3A 5CG1A 3HCDA 3TW4A 4Z8XA 1WW8A 3H16A 4BDSA 3EZYA 1GAWA 2XNJA 4B9AA 2UUBB 1C1DA 2IUEA 4F9EA 1DC4A 2Q6VA 2Z8YA 4M9UA 4PO8A 5CNIA 4HNAB 5M7EA 1ZM2A 2DAPA 4NU6A 4RK7A 4HC4A 1G9SA 2NVUA 1TJ3A 3FWNA 1ISIA 3D5QA 2RK4A 2H3HA 1ZD4A 2V3VA 3AR2A 4GZ3A 2YHSA 5EJ6A 1MJGA 2R6ZA 5BV1A 2XUIA 4M46A 1J99A 4LXTA 4KWIA 3QUTA 4I5GA 4XD7D 4XJXA 3FCUB 2W6QA 1NT4A 3MTGA 4OXXA 4KX3A 3TH5A 5FEMA 3P9QA 2IZZA 5IJXA 4O08A 4JS0A 4DYDA 4HWOA 1MJGM 2ZXUA 2E49A 1Z7GA 1RDFA 1T9CA 5IVDA 3FUUA 1DCFA 1M1YA 5L7WA 1YXMA 2B82A 2VYFA 1JG1A 4LJ7A 4F9FA 2XVYA 1IY2A 1Q91A 4JOQA 4Q5IA 5I9MA 5IHPA 3ME5A 1REQB 1NZJA 3W78A 2FK7A 1QKKA 3HNOA 3MA0A 1GXSA 1UPXA 1UM9B 2IVZA 3MBIA 3OZIA 4HDKB 5DYWA 4KVFA 5KOYA 4G9GA 1DKPA 3E58A 4WA7A 1DQPA 3N8IA 4NOKA 1Z83A 2O3UA 2ZYIA 1PG2A 4HHEA 4MZDA 3VFDA 1Y7PA 3HXMA 1W1IA 1BMQA 1LEHA 1GQQA 2JFQA 2OZLB 1KJWA 3C6QA 3HA2A 2D1TA 4MMXB 4DDUA 5C53B 3IA7A 1NBAA 2VKTA 1H8HD 6ADHA 1USIA 3V4PB 3T3NA 2O3TA 5AW0A 1QMPA 3KBOA 1WZ2A 4G1UC 1AE1A 2P0AA 4HDNA 5AJZA 5JJLA 1YC2A 1GPWB 1SQSA 4BBAA 1E0DA 1FY2A 5KDLA 4ZFNA 3C85A 2XCUA 3LPCA 4IH1A 2JLUA 3WB1A 2NSLA 3ONFA 4E3ZA 1CY4A 2C1ZA 1ZICA 3P9KA 3Q41A 3EW9A 4X84A 1E92A 1BAPA 1B0PA 5JZSA 4LA4A 3ZD6A 3TZQA 1T4MA 3WBKA 4LSGA 5DOZA 3RADC 3BTOA 3KJIA 3DD5A 3DNMA 1TMGE 4AZWA 3WYEA 1I14A 4A2CA 5ED0A 1SEVA 5G0SA 4AIRA 1V2HE 5C37A 1KBZA 2WV7A 4X8MA 2I9KA 3FAKA 3R9IA 5K03A 3EC2A 5JOQA 1ISMA 4IV8A 2XUFA 3QEMA 2NZWA 2J7PA 5HJ7A 4LEIA 2ZW9A 2ODTX 5GOTA 2AQHA 2LPMA 1UK9A 4H0CA 4BGVA 2QBYB 4DTCA 2PX6A 2FVYA 4IQFA 5IUKC 4M6WB 3O90A 3THYA 1G6HA 4PC7A 1HSZA 4DR1B 3NNDA 3F49S 5KWSA 3D6TB 2XF8A 1Q95A 4UHJA 1NVWQ 2GM4A 1VPDA 2HA0A 2QW8A 2RFLA 4J90A 4R51A 5BN5B 4OXNA 5DX8A 3LUJA 5HPYB 1YQUA 3SR3A 1TF2A 1UWLA 1VL1A 1E2BA 5LA6A 3D2AA 1TLLA 1U5CA 1ENPA 1XE3A 2UZ3A 3IX7A 1UP7A 1M1ZA 2YWFA 3D64A 4FYKA 3WHKA 4TTRA 1YDEA 5KOHB 1EGQA 1GG9A 3F6PA 2XKAA 4M1ZA 2QUIA 1Z15A 4PLCA 2QN3A 3GLGE 4Z3DA 1H3NA 4U7GA 1OD6A 4X1KA 2HF9A 3GLUA 3MUEA 4EP1A 2XCQA 4J43A 4BXOB 3L1HA 3EAQA 4DPLA 1QIMA 1RQLA 1CS0B 1XZKA 4C4OA 1U7PA 2QE7D 3GLHA 1ZG3A 1KPIA 3MK31 2CVHA 3RYTC 1D2CA 2X58A 3DBHA 2JZNA 3N2NA 4H77A 1JR4A 4EO9A 4RA6A 5C80A 5CFQA 4WLNA 5AW1A 5E9QA 3WIEA 1Z62A 1AQJA 3MHTA 3DA8A 2G83A 3R7WB 5CD9A 3AILA 5KYXA 3VVBA 1DTSA 3RJTA 1VJRA 1N33B 1LDMA 1SHZA 2CXRA 3DONA 2CBZA 3WK4A 1X19A 3UA3A 3CPSA 3JYLA 2ZJZA 2DVMA 5LM3A 1YBHA 3X2EA 2H4WA 3A6DA 3NASA 2GFQA 4KYTA 1DX4A 3EGDA 6Q21A 4LDNA 1LQUA 1U6IA 2XCSB 4L4SA 3F73A 3PBKA 1OTHA 3Q9LA 1P4AA 2QYOA 2UZIR 2VNHA 4MWTA 1IMOA 1RXIA 4NZ9A 3UYKA 2AG6A 2BE9A 4G4SP 5KJ6A 1EBUA 1PVOA 2P90A 3I9JA 4MUKA 1E2MA 2ETXA 5B2ZA 3O9VA 2VP6A 3MM4A 4UUMA 5LQRA 3EYWA 4C4SA 1TT5B 3I32A 2NU6B 2IZ0A 2ZAYA 3LDHA 4C43A 4CKZA 3H9EO 5TPWA 2GBIA 4KN9S 3WLNA 1VJDA 1ODCA 2V7GA 3FWKA 2RGNC 2W4QA 4I36A 4RSGA 5H9WA 4M8SA 1KXJA 2Q3HA 3RO7A 1VE3A 1NM5C 5FUMA 3MCZA 4JJGA 3LXUX 4JC4A 3RIHA 2GD0A 2XZDA 3RC8A 1DC6A 4D4HA 1FSGA 2YMQA 4NVRA 1NQAO 4QGBA 4XGKA 3ZBTA 1OFTA 3PJEA 1JP7A 3FRJA 1VDZA 4YRRA 3KPJA 2FFRA 1NY6A 1K06A 5L8VA 1ZNWA 1NNI1 1RZUA 3ITKA 4P5DA 1QORA 1UZUA 1FVHA 2QRUA 3MMNA 1Z8HA 1OZFA 4BCDA 2GCPA 4G23A 1XK7A 3GZ4A 1ETHA 1X42A 3GZNA 1VLMA 5KYVA 3DDCA 3UK1A 4RENA 5DM60 1GV0A 5KTRA 1EXDA 5DT9A 2WOJA 3DHYA 1QOPB 3LIPA 1HKUA 1I3OA 2C5BA 1O6CA 3CURA 3H9UA 3LPLA 2JIMA 3KKOA 1N5MA 3QRWA 3OU6A 4XCXA 1T8UA 4BASA 1K9VF 1MC1A 1YQTA 3V8QA 4DREA 3EEOA 1CDEA 1GN8A 1PJ8A 4QM7A 5K99A 5IM4A 5CB0A 4I6EA 4K1LA 1RJ9B 4DB4A 1ONPA 2FEOA 3LS2A 3ANMA 3JQGA 1UXHA 3I62A 2ERYA 1OT3A 1QFYA 1U9IC 3EEYA 2GAOA 3IOMA 3MS7A 2VA9A 4HKTA 3IBTA 1BMFD 2JEYA 4QQ8A 1RM4A 1W5TA 3GDFA 3DMYA 2Q1SA 3ZIAD 4PXSA 4ND8B 3NTXA 4MGHA 4BNHA 1F51E 3EVCA 3D6FA 4FNAA 3PQ7A 4DEVA 5HNKA 4DV2B 4DZRA 3TBHA 5KC8A 1ZUWA 4UBOA 2F8SA 4IIDA 3DEHA 5AOAA 1URPA 4DLSA 3HVRA 4PV7A 2QN7A 3AKZA 3HJHA 3KJGA 4OGWA 1SO8A 4KP7A 4C21A 3IQGX 5ECDA 5F1YA 1PGQA 2YQ5A 4OUKX 4UFOA 1DAPA 4BX8A 1WL8A 3JD4A 1WXDA 5LUBA 4M88A 2OB1A 4PLGA 4ZAYA 1L5OA 2NPIA 1WXWA 3EMKA 3GJYA 4ITRC 3EHDA 3SXPA 3AEKA 5C1PA 5CDHA 4UQOA 2FGJA 3A9SA 3ILHA 1MOPA 1Y98A 4D8TA 2CHEA 4RWZA 2R00C 3Q8WA 2E5FA 6YASA 1YRQA 5FWYA 3G6WA 3VPCA 4DMLA 4OHVA 1EM8B 3OZDA 4K40A 1CY2A 3D81A 1OB2A 3MWEA 5E8RA 3RTBA 1NMXA 2OO3A 2A0UA 2PZJA 3RIXA 4DPKA 1DS6A 3GJ6A 3W5UA 2FE1A 5IH3A 5JSHA 2JFVA 3ROPA 1U2DA 4FM9A 4ED9A 3CEPB 4I9HA 2AC7A 3G0BA 4M0DA 1ZQ1A 2ZROA 2CL5A 1XAIA 1KHTA 4UJ5A 3WBJA 3QLEA 1PZHA 3CLRD 4P36A 4YASA 3V55A 4RKFA 3OCCA 3LGAA 1UBCA 1QQ7A 1MIOB 2YWDA 2HK8A 1ZNQO 1LK0A 1VBFA 2ZRPA 3M89A 3HYNA 4GZ6A 5HE9A 5JCJD 1R8SA 1AKWA 2I8AA 3TPZA 4AKHA 1CQWA 1J8FA 2DPMA 4J91A 1KE1A 1CERA 1DCKA 1GY8A 2QW0X 2J9FB 3E84A 1Y9JA 3AP1A 3FBTA 3NJ4A 3DBOB 4GP7A 4IVRA 3RD5A 1J9ZA 5DULA 4HAOA 3K70B 4YJDA 3JWHA 3TAXA 2P7IA 1ZR2A 3JD2A 1L7VC 3KB6A 4LHXA 3KZXA 2PSHA 1R50A 2B3TA 2IUYA 3PFBA 3PUJA 3VISA 1EB9A 2JG3A 2Q29A 3LRTA 3WL7A 2ZWVA 3AT1A 3IUBA 4K9MA 4C0BA 2JBWA 5I7EA 2PM8A 2FB9A 1N34B 4N39A 3ZR4B 4X1YB 4M37A 2A0KA 3USZA 1K92A 4WX2B 4KOEC 1ZVQA 3BA6A 3V33A 1EEHA 4D3DA 4CEJB 5DHRA 1VIAA 3ZJTA 5EC8A 3B3QA 4HEA1 2J46A 3VZCA 1GGVA 2KJQA 1KYWA 5EPOA 1M2JA 1V4VA 3ETHA 4D6XA 2HR1A 2QDXA 2GF2A 2HJWA 1W34A 5DXFA 2HRQA 2WHPA 4N6NA 4AF7A 4JDUA 1ADYA 4DIMA 1JDUA 3T3IA 2CWWA 1GP2A 2HWUA 3H65A 1OBCA 2NT3A 4G65A 1LBTA 4JN6B 4AROA 5LBTA 3QVXA 2OLKA 2FRXA 2D7CA 3HBJA 5ALGA 4RKWA 4YCNA 2ZB7A 2ZJ5A 3NHLA 4URFA 1G3MA 4PCVA 5TLSA 3RFXA 3ZV7A 1MCZA 4HDCA 1M0WA 1XVAA 3U4GA 4S24A 5H70A 3WA6A 1BE8A 2YXPX 1R00A 2IHVA 2G17A 2DH5A 4IHQA 3NYWA 1G41A 4I8IA 1FFWA 1NU8A 3KYIB 4TUYA 3EGXB 1R0WA 1IUPA 3EVEA 1C3OA 2QUZA 4W8HA 5HK8A 2A1IA 2B9EA 2LWIA 1UBGA 4EDHA 1PK7A 4J7CA 3SICE 4FKBA 3RM3A 3FKSA 2WR8A 3SBDA 5E3JA 3T7IA 4YRAA 3FMIA 1ZRMA 2IU0A 3RW9A 3L7BA 1HZJA 1RYFA 1JXMA 2BISA 5I7HA 3HCWA 2FEMA 3AP3A 1KAQA 3EMDA 5E1OA 2B1JA 3D0KA 1WX1A 2NGRA 4C6SA 2OYSA 4UEJA 4X44A 2AUMA 3TOXA 5FBVB 4P3NA 2YV4A 1QFJA 5HSGA 4N49A 3E9QA 1M1XB 1RPNA 3S28A 3GJQA 4XRGA 2F8LA 3KZOA 1BWSA 3EQ2A 2DKFA 4HX9A 1ZCZA 4ZU3A 4CMHA 1CEXA 5BUSA 1KKLA 4PLWA 5TEVA 2JA2A 4BO9A 2HHHB 4OGGA 3MGCA 3EIFA 5KKAA 3IEXA 4EUFA 1KS2A 2YH2A 4LC0A 4P4UA 1YT5A 4MICA 1WB9A 1T8WA 1IUOA 3GW8A 3PI7A 4EHFA 1E0AA 2PU7A 5K09A 3PFIA 4A36A 4BNTA 4YLYA 1UKZA 4JB0A 5DNAA 3QU2A 3HDYA 3E3LA 3B5EA 3EAFA 3OHSX 4NDAA 5JRZA 1WXEA 2VQDA 1EZZA 3NRJA 4PR3A 1KAEA 2B8TA 4PCAA 4QGSA 3SM3A 3L82B 3FHCB 1XRQA 3IV6A 4ZEMA 1T6XA 2SHKA 1DIBA 2W58A 1ID1A 1EBFA 2G4LA 4MUHA 4O4HF 2SKDA 3LT5A 1HQKA 1Z4IA 2P2CA 3L79A 5IYZF 4C06A 5IS2A 1I4WA 1QPBA 1AY0A 1TT7A 2GNPA 2HJRA 5LWQA 3LECA 2ZIGA 5FUVA 5C4IA 2BW0A 4OREX 1F4LA 1PWEA 1V3QE 1BA2A 1YI1A 4OMCA 4YBZA 4AJ2A 1Y6GA 3NVKI 1F8XA 1JPNA 2FSSA 3E1KA 2ZIAA 3K8ZA 1N25A 4MI3A 1PS9A 3UKOA 4YX9A 5SY6A 1BQ4A 1WETA 4H1WA 1Y6ZA 3WP1B 4YROA 4L3OA 4RLFA 1E79D 1EX6A 1ODTC 1OUMA 2POCA 4NV1A 3ZCUA 3OT1B 4BNMA 1VTKA 4HLNA 2Z56A 2W2MA 4N5IX 1VMIA 2R8EA 3PE6A 3RFUA 3BBLA 1E7RA 1GPKA 1OV6A 1RU3A 1XVLA 2I2CA 4J16A 3ZHSA 3T3EA 3I2HA 2ZITA 4CRWB 1G7RA 1PNQA 1E9DA 4NESA 2P3OA 4CQJA 3ESRA 5JS7A 2Q4BA 4P80A 2R6GA 3DTTA 2XMCA 1DQYA 1SM4A 4FMCF 5T64A 1Q6ZA 2QJTA 2YWRA 2O14A 1S8AA 4QHSA 4BVEA 3NXKA 1J0BA 3LWDA 2XUKA 1A8PA 5GGYA 4KITB 5J2UF 1LPSA 5HFAA 5DTRA 5LMZA 5IC5A 2A9PA 4OQDA 3ROTA 1Q21A 5J63A 4FYMA 4QYXA 3D6VA 2NACA 2HA7A 2I6GA 4Z0TA 4C0KA 1X6VA 2Y3IA 3RAEC 3QQPA 3EEBA 1WZUA 4O2BB 1KDYA 2X0EA 1RNLA 1G8FA