3L1HA

Crystal structure of este5, was soaked by fecl3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 101
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1hA00
2R8BA 4X92A 3WL6A 2VAVA 2VJDA 1ZD2P 2JF0A 3H2HA 2XMCA 5AM3A 5AKEA 5AI5A 5E4JA 4OCZA 1SCQA 1VA4A 1DQZA 4IQ4A 3ZWQA 5JAOA 1G42A 3EBLA 1QIJA 3OTQA 2E3JA 1Y7HA 3C6BA 1LPSA 3H17A 4M0FA 3AJAA 3ESBA 4XJVA 4Y2PA 1E5TA 3I6ZA 3WK9A 1CRLA 1ACJA 5A62A 3D0KA 4FFWA 2WSLA 4PV7A 4J0IA 1XZLA 3F67A 2WJ4A 2FX5A 3FLAA 2ZYSA 3OM8A 1H23A 3C6ZA 1HL7A 1RP1A 3U0VA 5IVKA 4OB6A 1EB9A 1VZ3A 4LXIA 1YA8A 1CUWA 1HPLA 5JZ9A 4W1QA 4K6HA 2CBGA 1JU3A 2H9YA 4FBMA 1AZWA 3G9XA 1DT5A 3B5EA 2J3QA 2PBLA 2QJRA 4FBLA 1LPBB 1O6GA 4PSCA 2AJ8A 2VEOA 4RNCA 3STWA 3AZPA 4HXFB 3WQHA 1BN6A 5ALNA 3YASA 4MWTA 1MU0A 3W9BA 1B6GA 5HF8A 2BAGA 5ALKA 1AQLA 4OB8A 4BRZA 2B4KA 3AIMA 2G5TA 4EUSA 3IULA 3C45A 3B3QA 1CQZA 4C4ZA 1CUFA 1S8OA 5A6VA 3UMJA 1UK9A 2ZJ6A 1BEEA 2QTBA 2XMZA 3B12A 2PUJA 2HA5A 1NU6A 1SFRA 1FFCA 3PE6A 1QJ4A 3BE8A 1F0PA 4G5XA 3QPAA 4W63A 4W1PA 2XMDA 5FUMA 1UKBA 1AMNA 2BUCA 4FWBA 5FXMA 4FTWA 4C87A 2WIKA 3QYJA 2JBWA 3C8HA 4RPCA 4WY5A 5CT8A 2ZYHA 4Y2RA 5ALLA 2XUAA 4GECA 2Z8ZA 4DLNA 5BWCA 1W75A 1XLWA 1MTZA 1XRNA 4H7JA 1J07A 1GGVA 2DR0A 2HIHA 4NVRA 3R3XA 1IUOA 3HZOA 3DD5A 1XZDA 2WU3A 1QIMA 4IH9A 5T4EA 4EZIA 2WIGA 5AIBA 5LKAA 4X85A 2HL6A 1WCYA 4BP8A 2PSJA 4HXGA 3GELA 3HLKA 4FLEA 2DQZA 2GYUA 4BC1A 1TCCA 3ZPXA 1J2EA 4X71A 1QIHA 4HRYA 4DM7A 3H2JA 2WTNA 4KRXA 1TRHA 4L0CA 3SX4A 1GQRA 3R3UA 4E15A 1Z68A 3QPDA 1CUYA 3CN9A 3V1LA 4TGLA 1X2EA 3NUZA 3A2LA 5D3ZA 1ODTC 4AN0A 1CVLA 1XZJA 2ZJ7A 3CN7A 5E2IA 4AQDA 1XRPA 5JIBA 3FVTA 1QIKA 2OGZA 2PSDA 3FLBA 3SK0A 1NX9A 2V98A 3QMVA 3VVLA 4X7BA 3BF7A 1GXSA 1AGYA 3MVEA 5DNVA 4UBOA 4K6KA 5LZ2A 2XUFA 3JWEA 4OU5A 2B9VA 4A23A 3JW8A 4C4YA 2BGNA 5AHXA 5AM4A 2OQIA 2XUOA 3IUNA 3RK4A 1F0NA 3WJ2A 4YX9A 4QWMA 3TGLA 4EB0A 4AN1A 2XUPA 4FNMA 4KAFA 5DYYA 1YA4A 2Z5GA 2PUHA 1WB5A 3DDUA 5EI5A 1MPXA 1XRQA 1K8QA 3DOHA 2OCGA 5CH3A 3RKSA 1P0MA 2BFNA 1QTIA 2J3DA 4BAGA 3AINA 2BGRA 4J03A 4MQLA 3VXKA 4P92A 4MYSA 4X6UA 1K6EA 2CEKA 3WL8A 1ZOIA 1H2YA 5AM0A 1RWQA 5JANA 5EIHA 2DCMA 4Q1VA 3HABA 4U2CA 2XUKA 2JGEA 4LYEA 5IVIA 2WIDA 4KE7A 1DU4A 4H7KA 4QLAA 2CMFA 4H7HA 1MAHA 2JGFA 4G4IA 4YK7A 5JAUA 1W1IA 5ALYA 2VT6A 3BJRA 1CUSA 2JIDA 4V2IA 3KDAA 1EI9A 4GEGA 3QITA 1CUHA 1VJ5A 1HKHA 4LXHA 2XUHA 4CCYA 2RHWA 5HF6A 1ZGCA 3NWOA 4BTLA 1OXMA 1ISPA 3R40A 3DCNA 3DYIA 1ZD3A 3EQ8A 3STYA 2G5PA 2IX9A 5CXUA 5LZ4A 2ZYIA 1EK2A 1TQHA 5AKIA 2ACKA 3H0CA 4I19A 1D07A 2VJCA 4FDMA 4X94A 4CFSA 5ALJA 1CV2A 4QE3A 1ORVA 3ZLVA 4UBKA 1WM1A 5EGNA 1IUNA 2EDAA 4GW3A 5AKKA 2Z3WA 4EHBA 4EY7A 4IHAA 5C81A 2V97A 3HSSA 5JD5A 5ALDA 3W04A 3I1YA 5ALVA 5HK9A 3IIIA 1CFJA 2WU4A 4BATA 4L72A 4WFJA 4C4XA 5DYWA 4LHEA 4B83A 1YS1X 1HQDA 2WJ6A 3I28A 4H35A 3VVMA 1R1DA 3W05A 2VSQA 3S2ZA 2O2HA 3DYVA 5AKHA 2O2IA 1P0PA 3CXUA 2OCKA 2WUDA 4DMFA 3BDVA 4H7DA 3HI4A 3DEAA 2Z3ZA 1FJ2A 2JGKA 4X6YA 5F4ZA 1G5FA 4BE4A 1PFQA 2CUTA 1I6WA 2B61A 3OG9A 4J0CA 4JUIA 1P0IA 3QMWA 2C58A 5JD4A 1VXRA 1XLVA 4Q05A 4X3CA 2ZJFA 3STUA 1XRRA 1EK1A 3RM3A 3WIOA 3D3NA 1CUEA 4D9JA 5ALMA 1XLUA 4J7AA 1BEZA 5IKXA 2V9ZA 3RARA 4N5HX 2CJPA 5J3JA 1ZI9A 2C5FA 5A7GA 3C6XA 2HA0A 1QOZA 5BV7A 5K3BA 5LLSA 4IH1A 4P93A 1DINA 2WFLA 4QDOA 5FPQA 3DNMA 3FSGD 5ALFA 2PSFA 5ALGA 5JYCA 2VQ6A 3C8DA 2BUBA 1LGYA 2WHPA 1ZD4A 2DQYA 3A2MA 3LP5A 4QDZA 4U2GA 1Q83A 1UXOA 1YCDA 1Q0ZA 2WUEA 3FVRA 2QMQA 3HXKA 3QVMA 2G63A 4CG2A 1QE3A 1VE6A 3WK4A 3K6KA 3C43A 4RE5A 1BCRA 4ARAA 2C4HA 4B7ZA 2J4CA 1ZJ4A 4A16A 4CCYB 3V1NA 4BTVA 1YB7A 2OPHA 5JADA 5JALA 4MQMA 4JNCA 3FYUA 3S8YA 4B9EA 4KE8A 5K3EA 3WI7A 3KOOA 1ZJ5A 4PF1A 4QEKA 4AO6A 2OLEA 4AO8A 1SCKA 1U65A 1QZ3A 6YASA 4PSDA 4ZV7A 4C88A 3RLIA 3PFCA 5AH0A 2ZYRA 4TPKA 2OCLA 2XUGA 2HU7A 2QVBA 3U1TA 5EHXA 5HZGA 2GZSA 3F97A 1EA5A 4CG1A 3SC2A 5I7UA 5CH5A 3MUOA 2OXEA 3G0DA 3M3DA 3H18A 1KEZA 1CUIA 5FOQA 1IVYA 4GDMA 1EVEA 1UZAA 3PICA 3N2ZB 3QZUA 2WJ3A 4BYMA 1CUZA 1MX9A 3FSGA 1Y37A 2O7RA 5HF9A 4H7IA 2VF2A 5HKAA 4X00A 2PM8A 1GZ7A 5HCUA 1VLQA 4JYMA 1CUCA 1QO7A 3R0VA 4WDRA 1BS9A 4FKBA 3AILA 1G66A 1ZGBA 3FWHA 4RE6A 5I8PA 4BDTA 2W22A 3BDIA 4W1SA 5KREA 1DWOA 3VKFA 2BCEA 2WHQA 3STXA 3T52A 2WILA 4AX4A 4PW0A 2ROQA 1EVQA 2QRUA 4UHBA 2OCIA 5HF5A 4Q3LA 1LZLA 4AMZA 2YASA 3D4LA 4J0JA 1DX6A 4DIUA 3K2IA 2QUBA 5AK5A 5CT5A 1R9MA 1WB4A 3FOBA 1N1MA 4PQEA 2FJPA 5CXXA 1YASA 5IVHA 1CIJA 1GPKA 1FSSA 2CKMA 1YAJA 4H7EA 1FFAA 1CQWA 4EY4A 4KAJA 4F60A 3V48A 3G9UA 1L7QA 1BROA 4QDTA 4L3WA 5CH8A 2QZPA 2JGJA 4Y2JA 3WK5A 4M0EA 3N0TA 4PO3X 1YSCA 1ORWA 1WHTA 2WG1A 4BC0A 2GBFA 3TRDA 3E3AA 1GPNA 2HADA 1W6RA 4BAZA 5D3KA 1T2NA 3G02A 3TJMA 4U2BA 4Y9SA 5AKZA 4NMWA 2HU8A 4N8SA 1AURA 1VKHA 4CCWA 2CZQA 5AKYA 2IITA 1MX5A 2ECFA 5ALIA 1THGA 3C6YA 4WFKA 1EDDA 3GUUA 5CT4A 5CBKA 4PNZA 2XMRA 4GI1A 4BP9A 4GHWA 5KBYA 3QH4A 4AZ0A 4BE9A 2C7BA 1N5MA 5EHNA 5AOCA 5HK8A 4A5SA 5D6OA 4FNGA 4G4GA 1HBJA 1EXWA 3PI6A 3WA6A 1R4ZA 3WWCA 3PF9A 4OUKX 3H1AA 2I3DA 4LKOA 1U2EA 1WOMA 1BCSA 5ALXA 2DSNA 4S0XA 4GLBA 1THTA 1XZEA 4HXEB 2GBGA 5KWJA 1PV1A 3HRHA 2WUFA 3DL7A 4EA6A 2ZVDA 3I2IA 3QM1A 3H2IA 1IZ8A 1OILA 2HA7A 2PSEA 1J06A 3O4JA 5CRIA 3G7NA 2OG1A 1CUDA 4F5ZA 4B82A 4Y2QA 2X8BA 5E4YA 1DT3A 1U4NA 5C8VA 4OB7A 1XQWA 1JJFA 5T4HA 3FYTA 3FCYA 4CI9A 5K3AA 5AKGA 3DL4A 1BU8A 1TK3A 1CPYA 4GWLA 4OD0A 4EBBA 5K3FB 5FV4A 5AK3A 1DWPA 1BE0A 3IURA 3AIOA 3K9BA 5AIAA 1MX1A 3ICVA 4BRSA 3Q8WA 1SOMA 4MJ3A 3FYUC 4X6XA 4EY6A 3G0CA 4J3JA 5DWDA 4UHFA 4OYLA 2FJ0A 2WTMA 5HFNA 1C7IA 4DNPA 4UBLA 3WK6A 1TCBA 3G9ZA 3WLAA 3A70A 5AK4A 1OCEA 1BN7A 3F98A 4BB0A 5AP9A 1IUPA 4QDXA 4X97A 1N8SA 1ZI6A 1WPRA 3KWFA 1H22A 4C6HA 1QIFA 3IDAA 1HLGA 3H2KA 4P9NA 3C87A 3IVMA 1EX9A 4F21A 1YS2X 4UBMA 4QA9A 2HM7A 2ONCA 1R88A 1N5RA 3V1KA 1JT2A 1MN6A 4CIAA 4N8EA 3ZLTA 3UUFA 1EH5A 1EINA 3BF8A 4Y2UA 2XQGA 3DKRA 4KYVA 2HU5A 1KU6A 3FCXA 3W2TA 1E66A 4UBJA 4Z49A 2YYSA 2B20A 1SC9A 3O9MA 2JGMA 4PSUA 4AO7A 1F8UA 3EF3A 1TAHA 3GA7A 1TIBA 5FLKA 5ALHA 5DTIA 2QS9A 2DFPA 3IUQA 1GQSA 3I2HA 1HDEA 5HFAA 4Y2XA 1XZMA 1TKRA 5A71A 4N8DA 4DMHA 2RGUA 1RYYA 2IIVA 4LYDA 3WKBA 3G8YA 5HQ3B 4BDSA 2GBIA 3R3YA 2K2QB 5BWBA 1Y7IA 1A8QA 2XLBA 4C01A 2XQFA 1MNQA 4ZRDA 5A7FA 1W52X 1JJBA 3BXPA 5DTJA 2WG0A 4FLFA 5CT6A 1XZIA 4AZ3A 3WWEA 3F9CA 5C7YA 2ES4A 3R3VA 1A88A 5CTAA 4KEAA 4KRYA 4L9AA 5AM2A 1EDBA 4UHDA 4G8BA 1LPAB 1L7RA 2WG2A 3ED1A 2RAUA 3AUKA 4BCBA 3X3HA 4DYHA 5AM1A 1AC5A 2WIJA 2XB6A 5YASA 2C0PA 3O4HA 4MEAA 1ODCA 4XWGA 3ESCA 5FRDA 4G8CA 5IVDA 2AJBA 2XUJA 2XMSA 2AJCA 2AJLI 4U2EA 2WM2A 4WJLA 5AOBA 1E8NA 3FYUB 2BKLA 4J0KA 2C0QA 3WJ1A 4CG3A 1WB6A 2RI6A 1AUOA 4KACA 5DYTA 4OSEA 2QUAA 3IB3A 4G9EA 7YASA 1XZBA 4H77A 1ZI8A 4ARBA 4I4CA 4Y2YA 2WFMA 3T4UA 5LKRA 4G8DA 3O4GA 3EIOA 5ALTA 1U8EA 3C5VA 1QFMA 3FBWA 3MUNA 4W1RA 4MYDA 1QIEA 3ZLUA 1JFRA 1ZIYA 1GKKA 5ALZA 2PU5A 3QBJA 3W06A 1M33A 4X93A 1XZKA 4DSZA 5DNWA 5CT9A 1PJAA 1QIIA 2I3ZA 1CUUA 1DWQA 3D2CA 2QT9A 5AI8A 3D7RA 5FDFA 5DLPA 4FFVA 4UPDA 3R41A 5JZSA 5ALOA 3IUJA 4QDUA 5AK6A 4WFIA 1JJIA 1R3DA 3KD2A 3PDCA 3EQ9A 4DMCA 1DX4A 1QFSA 5AICA 4INZA 1CUGA 3STTA 4OYYA 3L1JA 4Q3KA 1FFDA 2HA2A 1BRTA 1UOPA 2PX6A 1JMYA 1XZGA 4YPVA 4BVJA 2W6CX 5AM5A 4ZWNA 2OQVA 2ORYA 5ALSA 3H2GA 3WL5A 3BIXA 4P08A 4G9GA 1GPLA 2XMQA 3H19A 2UZ0A 4LXGA 2JEYA 3EQ7A 3O4IA 4AMYA 1LBTA 1XRLA 5A2GA 3P2MA 2Y6UA 2PL5A 3I1IA 3OURA 5AJHA 3WZLA 2JGIA 1UK7A 3VJLA 2O7VA 5HKBA 3NOXA 1ZIXA 3BWXA 1CUXA 3L1HA 5LP1A 1LPMA 5ESRA 3ESDA 1QTRA 2H7YA 4QWWA 1G4HA 4TVKA 2X76A 4MXDA 4KE6A 1P0QA 2HA6A 4YASA 2PVSA 2VJBA 1UFOA 4FHZA 1UOOA 2Y2VA 3BJMA 5D7BA 2XT0A 5LIPA 2DHCA 3A6ZA 3KWJA 4E11A 4DTCA 3G9TA 5SYMA 1CR6A 2XMGA 2QXTA 2DHEA 4Y2SA 3GZJA 5CMLA 3FAKA 4WCVA 5JASA 5AI6A 1E89A 1XRMA 2AJDA 5LZ8A 1W4LA 2ZSIA 4HTAA 4KJXA 1LZKA 3WKDA 4X90A 4BVKA 4ZGBA 4F0JA 1JKMA 3LCRA 1USWA 2WHPB 3WL7A 5I9IA 1UKCA 2WLSA 4DNOA 1FFEA 3WA7A 2EDCA 3QMMA 3VDXA 2HA4A 4FOLA 2I78A 3WYNA 4ROTA 4ZV9A 2WFLB 4KAAA 4BCCA 1E8MA 5EHQA 4K6GA 4G4JA 4B84A 3LIIA 1H2ZA 2YXPX 4Q82A 3O95A 1H2XA 3OC0A 2XUQA 4U2DA 3WWOA 2VATA 5ALQA 1LNSA 3DS8A 3NGMA 3SWWA 1Q0RA 1B41A 4KE9A 3DJYA 5AI4A 4B9AA 5KWIA 5LYYA 5JARA 5AKLA 4DSAA 1QGED 1YAHA 4H18A 2PU7A 5BOVA 3GBSA 3L1IA 5AO9A 3G0IA 2HRRA 4BVLA 4DNQA 3GFFA 2Y1KA 4XX1A 3AFIA 5K3CA 5EIEA 3WYDA 4UFPA 4J0GA 2H7CA 1A7UA 1LLFA 2ACEA 2CB9A 3Q0TA 3VISA 2R11A 4UHHA 4DNFA 3W9UA 3DOIA 2YH2A 3WKEA 1J1IA 3H04A 2Z8XA 2XUDA 3F96A 2C5GA 3R3WA 5C8XA 1XKLA 4JYPA 3BIWA 1LPNA 3VJMA 4OPMA 1EDEA 2XDWA 1VOTA 4MEBA 5CURA 4O08A 4WY8A 3BL8A 3LS2A 2OGSA 2NW6A 1KU0A 2QR5A 5LZ7A 3KSRA 1MAAA 4B6GA 1XZHA 3G0BA 2WQZA 3KXPA 1WPXA 4C89A 5ALPA 4G1FA 4Y2TA 4KR0A 1A8SA 2WIFA 4B0PA 3AIKA 5FP0A 3ICWA 2EEPA 3M82A 4X95A 1GT6A 1TCAA 3ANTA 4BBZA 3GROA 5LZ5A 3DKKA 5ISMA 1W76A 3VJKA 2Y2UA 3WK8A 3I2KA 1DQYA 1XQYA 4UFOA 2XI4A 3C70A 4BAUA 4UHEA 3ZI7A 2XLCA 2XE4A 5EIAA 1CUVA 1E3QA 4UBIA 4GXNA 4E46A 1LPOA 1X2BA 1IZ7A 3JYHA 5T4FA 5AKJA 4B0OA 3IA2A 3M81A 4W9RA 5FPPA 4ITVA 1YR2A 4IH4A 3WZMA 2PKYX 3WMRA 1FFBA 5AKXA 3PUHA 2VJAA 3HC7A 4XVCA 1X70A 5EHZA 3ZV7A 3WWDA 1LBSA 4K2AA 1AX9A 1CLEA 4EY5A 2J4FA 5CW2A 1MJ5A 2HFKA 2WHRA 4ZREA 1MNAA 4HS9A 2QXUA 4NZZA 4XIIA 4UUQA 1C4XA 3O9VA 2I03A 4M0MA 3MGAA 3PFBA 1QONA 1XKTA 2HHAA 2VA9A 1O6FA 4GBGA 2OAGA 3HACA 1NU8A 5K5EA 1VZ2A 2JEZA 1EHYA 2VAXA 4CIBA 1ZD5A 3LLCA 5ALRA 1L7AA 5LZ9A 4Y2VA 1A8UA 1WHSA 3DLTA 2WKWA 2RHTA 4I3FA 2BUAA 1IMJA 4UFNA 4QZVA 3I6MA 1ACLA 1T4MA 4JH0A 2RONA 4JEIA 2WUGA 5AOAA 1UK8A 1JMKC 1VA5A 4ZI5A 1H2WA 1LPPA 1MO2A 4HAIA 3WKAA 1K5PA 3QPCA 2VTVA 2OGTA 5DNUA 3IUMA 1Q84A 3WIBA 5FKJA 2XQJA 3R3ZA 5DJ5A 2O2GA 2GYWA 2D5LA 1UT6A 3M83A 2XUIA 5K3FA 5ALWA 1QO9A 4B81A 4K5QA 1ODSA 1CUAA 4FLMA 3D2BA 1QIGA 2RIPA 1K4YA 4B80A 3LIPA 4Q34A 1UKAA 4QLOA 3TEJA 4WDQA 2H1IA 3F8SA 4UBNA 1E8DA 3WKCA 1ETHA 2WFZA 4DGQA 5JD6A 1XZFA 4BZZA 2Y6VA 5EFZA 2HFJA 3PF8A 3D2AA 4Q3OA 5JZBA 3AZOA 2XMBA 1K63A 3E0XA 1C7JA 5HQ3A 1EB8A 1XZAA 4J0DA 1CUBA 1GKLA 3G0GA 4QNNA 2ZSHA 4IO0A 2LIPA 4UHCA 3D5EA 5IH7A 3CCBA 4FMPA 2VT7A 2HA3A 3I2FA 3C5WP 3IBTA 3DQZA 3OOSA 4MWSA 4E14A 1UOQA 5ALEA 4X91A 1XQVA 1YB6A 4H0CA 4BCDA 4EY8A 1AKNA 1VXOA 2HDWA 2GYVA 1CUJA 2PSHA 5JAHA 3FLEA 3I6YA 1UK6A 3STVA 5JATA 3E4DA 5A7HA 4U2FA 4B85A 2AXEA 1R9NA 4ETWA 5AI0A 3D59A 4HRXA 5H3HA 1JU4A 3FNBA 1SCIA 2QM0A 1R50A 2D0DA 3V1MA 2QJWA 1CEXA 2HRQA 3O0DA 2GBCA 5ALUA 3AZQA 2P8SA 1XQXA 4N5IX 2H7XA 4H7FA 1F6WA 4J0HA 1QIDA 3ANSA 2XQIA 3OPMA 4RGYA 2QKYA 2QOEA 4DMKA 1ZICA 4NS4A 4ZXFA 2DHDA 4AXBA 1DTEA 5T4BA 5AI9A 3E1GA 3ESAA 3PUIA 1MT3A 1UWCA 4HVTA 2X5XA 1JI3A 4LIPD 1VE7A 1QLWA 4Y7DA 5JAPA 3ILSA 2G4LA 3HYSA 2XQKA 2V96A 3UUEA 3HEAA 2FUKA 5SYNA 2Q0XA 2OAEA 3CCCA 3I2GA 4HZGA 3V9AA 4BZWA 5K3DA 1XZCA 3H1BA 1XFDA 3A2NA 3I2JA 2JGLA 4AB1A 2PPLA 3WWPA 4OU4A 5E4TA 5C8ZA 3HJUA 3WK7A 2BJHA 2GZRA 1XROA
chains in the Genus database with same CATH superfamily
4K87A 4Q4AA 1F48A 4OA8A 5FWXA 2D00A 3D6HA 1GNPA 3GJZA 3MBKA 1Z5NA 4N7BA 4OQMA 4PRLA 1ES9A 3AXTA 3PSAA 4XB1A 2QPAA 2PLRA 2H00A 5F1KA 3SS7X 4OX9B 3VNVA 1E0SA 1H65A 2ZTLA 2E18A 3OFND 4ED9A 1SRRA 1USGA 4B79A 2ST1A 5I45A 3O7WA 3FI0A 1JG4A 4ALKA 1V3UA 3JQPA 5AI5A 3TDNA 1GGFA 3ICCA 1G98A 2AH5A 2P79A 2ZULA 3LW7A 3H5AA 4OCZA 3HH8A 4RJLA 5E4JA 4UTPA 1HG1A 1QLJA 1VA4A 4LZJA 1DQZA 3ZWQA 4AX8A 5C1BA 2JFOA 4NX2A 4Q00A 4DLVA 1WPGA 2Y1CA 3OQJA 4MW0A 2A0XA 3G23A 1PHPA 3OTQA 2C4TA 2E3JA 3HKBB 3Q87B 5FIUA 1T26A 1Y1RA 5IAEA 5K1ZA 3VU1A 3ZIDA 3VHRA 3B7PA 2ZRDA 4X84A 3Q7RA 3WFJA 3QVOA 3H17A 4QYIB 4UNIA 3ESBA 4B3HA 4BKQA 9ABPA 4XJVA 1UAAA 1ZQ1A 2OE2A 3RSLA 4B09A 2A9FA 3JAKA 3WNVA 1RYEA 1XCJA 3KL4A 3W1WA 1SH7A 4ZALA 4Q9HA 1BZYA 5FI0B 4XVUA 2HV9A 1W2WB 4TRMA 5B5SA 1I01A 3R76A 3OZGA 3I3SR 3EGEA 1ACJA 3QKTA 4K7JA 4U1RA 2CF5A 3ENWA 3MWEB 1U28A 1KIAA 2WSLA 3LQRA 5LD2C 2R8XA 1GFZA 1W93A 3BHJA 1T6ZA 2BWJA 1ZHHA 3H75A 1REQB 2FP4A 3H1GA 4NNOA 3SJ7A 1XZLA 4YUXA 4KNWA 3D3QA 3KUKA 3GXOA 6REQB 3AVXA 1SQGA 4HAOA 1JAIA 2OUKA 4HGRA 4HN4B 5DLEA 2B8JA 4R1NA 3T35A 3QVJA 1II8B 2P5YA 5U4XA 2ZYSA 3AYXB 4B8ZA 5J4LA 2IPOA 1NKSA 4O29A 5DI3B 4PX3A 4LZOA 1AUVA 1HE3A 3HKEB 4LSGA 3VDQA 2NN3C 4OVKA 4J9VA 2PFSA 1K3TA 2PUAA 4HDAA 3N6XA 4P80A 4UTZA 2GUWA 4ZJUA 3ZHOA 3U0VA 5U1PA 1F7UA 3RNOA 3OPYI 4OXNA 4RY8A 3PUVA 5IG2A 1GUFA 1EMDA 4HVCA 2RC6A 3GRVA 3FNGA 1EVYA 4Q18A 3MCTA 3RSHA 1PQPA 2HPAA 3IA7A 3VR1A 1HYEA 3C85A 2QVGA 1E79A 4FMDF 1VJ1A 1PJLA 1NONA 1CUWA 1ICIA 1YA8A 2ORVA 2YYZA 3GJ6A 1QF9A 1P9RA 1XDWA 2OGWA 3SYTA 2X4IA 3TO5A 1SBQA 1IULA 1IOLA 2CBGA 2HOQA 2JCGA 3G6WA 5TGZA 3G2LA 5T6BA 4E51A 3IPCA 2A5LA 2H9YA 5A04A 3OJLA 4ZHQF 3F74A 1DT5A 2AZXA 1T3ZA 4F45A 2J3QA 3NBKA 2IV7A 4ZHQA 1XK6A 4NE2A 3I6BA 1NXSA 1UEJA 1KFKB 1NQUA 4ZCLA 3G2PA 2EWMA 5TS2A 3EAGA 4WCFC 3MM4A 3P9XA 1DS6A 4YONB 4A0QA 3SYLA 2DBQA 1OBVA 4XVHA 4HXFB 1JYSA 2I7XA 2XOEA 4L08A 2Q6OA 1BN6A 4MZXA 2VVTA 5I5EA 2OBXA 1MU0A 4N1AA 4Q9NA 5B30A 3EGOA 1S2IA 3V55A 3QGMA 3W9BA 4EZEA 5LVAA 2QI9C 1NE2A 3TSZA 3U13A 1M2OA 4XQGA 4FDLA 5B12A 2BAGA 4LMAA 1Z36A 3ZQ6A 3ZWNA 4COKA 4ZYWA 4UXJA 5ALKA 4EL5A 4IMRA 3OPQA 4HRAA 1DO2A 3CNQS 1X7WA 3MJ4A 1DARA 1VG8A 2ZBFA 4PG7A 3P2JA 1GPBA 1CE8A 4F11A 1RIFA 4U7GA 3C45A 3EH2A 1KJ9A 1MB9A 4JI1B 3AF5A 3ZV6A 4MB0A 1T10A 3O6VA 4Q1DA 5EMMA 2GJAA 3IAEA 3FSEA 3LUGA 2PMKA 1WD7A 4IQGA 3JVDA 2H8GA 2JJQA 5I3CA 1R0LA 3R7SA 3SZ3A 2XMZA 3CBQA 3A1UA 3WYBA 3H4TA 5JZMA 1M6VB 1UBLS 1SN7A 1N6NA 4J4HA 2HA5A 1X1AA 2R8PA 3KTDA 4UTXA 3MT7A 4MO2A 3QPWA 1ANKA 4PC2A 5GOTA 2WQ6A 3BE8A 2V6FA 2FE1A 4QHTA 3EFOB 2ZTHA 1KOJA 1R6TA 4PAMA 4UDOA 3VR5D 1UMDA 3NKVA 4BO8A 5BV8A 1FB5A 2IZ1A 5G3YA 1JWLA 2IIBA 4PZDA 3IJEB 4UREA 2REQB 3L0IB 5H70A 3FOCA 4KO2S 4LYYA 1YBHA 4QOFA 3GF4A 3FKSD 1NP3A 3KTFA 4FTWA 5E7QA 3CF2A 1DUIA 5FUWA 2D1QA 2NO9A 2ZWAA 2BDEA 4CR7A 4G5SA 1JNYA 2FUNB 4ZZIA 3WY9A 1NRWA 1XGKA 1NKTA 3LPLA 2JBWA 2GASA 1N8KA 2Z2KA 3CF4G 1H6DA 4TSFD 2XWBF 5IJ9B 1NVBA 5F76A 1RVDA 1ZWLA 2H4JA 3BMOA 2ZI4A 2ZIUB 1JV2B 2Z8ZA 4UU8A 5CVCA 1C4KA 1T2VA 3C3CA 1FIUA 5BWCA 2FMHA 2OAP1 1W75A 4XR9A 3HGQA 4CIXA 5FEUA 4JLOA 2CDRA 4JVMA 4UAUA 1J07A 1FNSA 2JA1A 4KLRA 2DR0A 4QU9A 2HIHA 2VQ3A 4FK8A 5E1OA 2CN1A 3RYCA 2A3RA 3DD5A 2HEGA 4HLDA 3Q72A 4P34A 3GEHA 5CA0F 1AKMA 3LYHA 4BS9A 4EZIA 5JDIA 2EG5A 3QHQA 3VZPA 5FD8A 4F2WA 1Z4OA 2SICE 2HHCA 1C2TA 5BSTA 2HL6A 4BP8A 3KR9A 4IIVA 3ELWA 5HBGA 1EFDN 2Y99A 4HXGA 3LXMA 4JC4A 1VGRA 4XZ3A 4WI1A 1NJGA 1NMEA 3ND8A 4B46A 3HLKA 5BSHA 1NNLA 4OHPA 4XGKA 1AKUA 1JPNA 1Y0BA 2A1TS 1QG4A 3ZPXA 4CQMB 5D00A 4NC9A 1IXRC 2X0RA 1GGJA 2XTMA 4HNAB 2AW3A 4PC7A 5I6DA 2CMKA 2QTGA 2VQEB 1WEHA 1ZGAA 1Y6JA 3B52X 1VHJA 3FYDA 2ZIVB 2JJ1D 2ERCA 4HRYA 4UJ5A 3V2GA 3R0JA 3RNLA 4DDMA 2WTNA 5IAOA 2GCEA 2ZEJA 4YR7A 2PGXA 4RK6A 4HSEA 1VMIA 4DEXA 1S96A 4GWGA 5CEFA 2HLNA 3CZAA 3LHIA 3X1XA 1I6KA 4DUGA 5C1PA 1K7CA 3ENNA 4IUBS 4E15A 2ZUEA 1I1QB 1Z68A 3OLVA 4R0MA 1OVGA 4FFOA 1GPYA 1QH1B 2C2MA 1U02A 2IYVA 2H31A 4J91A 3TZCA 3F5QA 3RSSA 3V1LA 2RHDA 3CTPA 1G8KA 1RYZA 1SBTA 3NVKI 2XCSB 3RK1A 4WBNA 2GDJA 3SICE 1T0BA 5CX4A 3AETB 4LXYA 2RHOA 5DMHA 4AN0A 1XZJA 2LNDA 4H6PA 4NOMA 3CN7A 2F55A 2MYNA 2IXAA 2X8LA 2WJAA 3HB7A 4M6WA 1L7VC 1XRPA 3USCS 5CB4A 1GAXA 2VRCA 2TMDA 1LTKA 4UM5A 5KI6A 5JIBA 1E0DA 4TX1A 1QIKA 3WC4A 3LQ1A 3ORQA 1YQ9A 1R8QA 1QZUA 4QPNA 3VVLA 4X7BA 1YUMA 1GXSA 2EGGA 4YO8A 1Q19A 2Q29A 1E2LA 5JQGB 3GDWA 3A6PC 1SCNE 1AUQA 4IZOA 5I7RA 4BFLA 2P3QA 1I32A 4Q7KA 4M1YA 1CEYA 2UUOA 4NMMA 5BR8B 1PZGA 1S2NA 2OHJA 4A23A 5I4IA 4C4YA 1VKRA 4BNZA 4HWGA 2BOVA 2DR3A 1E2PA 1UOEA 1W8IA 2KBFA 3JD0A 5AM4A 2R6GA 1N0VC 5FA8A 5FUBA 3WSTA 4DRZA 4D9NA 5KNBD 2OQIA 2B21A 3J80A 2JDIA 2POCA 1R0WA 5HZMA 1MF7A 1TXGA 4YPOA 2XUOA 3L6OO 2XAAA 1RP7A 4GXTA 2P9BA 5DM2A 3RSGA 2GSWA 3HDYA 1F0NA 1KL7A 4U2KA 1QHFA 2VP4A 4QWMA 4PQGA 3TGLA 2HTFA 2NYAA 1G5HA 1MJHA 4QJ5A 2FEKA 1ZVJA 3CLSD 1Q14A 3INTA 4LDJA 1BD4A 2D3WA 2IU6A 4I1YA 1O96A 2KLHA 5DYYA 3QKUA 3KU4A 5LP6A 1NOJA 4LQCA 2QG9A 5K0LA 3UGTA 2O8FA 1JR3D 3EUAA 1D0SA 3S6JA 1A9XA 1WXWA 5E2BA 1BXZA 1K8QA 2VH5R 3MUEA 5G0VA 3CRRA 4AZSA 1OA0A 5DX1A 3DOHA 3ER8A 4JJAA 2QN1A 5CH3A 1CF2O 1M7BA 4G0WA 4BMPB 5AW3A 2BFNA 3LU1A 1XIVA 4IRUB 1NIPA 3FMPB 2GETA 2H59A 3CJRA 2FEOA 1L8QA 1P2UA 4UEWA 1SUDA 2BGRA 3I23A 5ERXA 5JT1A 1YHZA 4MYSA 1WULS 4P92A 3AW9A 2E4YA 2CEKA 3BK2A 4PZ9A 4J7XA 3WL8A 4ACAA 1FQWA 1ZOIA 3ETGA 1ACMA 1H2YA 1T5LA 4NMLA 3TIXB 4L5JA 2D5AA 3CJTA 1RWQA 4D3ZA 3B1FA 2ZXEA 1G5RA 4BYGA 2H1LA 1QV9A 4HH0A 4YMTA 1A4RA 1EJBA 4FKMA 3RRMA 3T5CA 1XKXA 1JAHA 2LDXA 1E1NA 3B9PA 3EVBA 3HZZA 2E1RA 1IXKA 4Y18A 2FW0A 4CNQA 5TJ9A 4X8OA 4NYMQ 2ZI9A 2PNFA 1BH2A 1NBOA 3I52A 1Y9AA 3RIGA 1FSFA 3U7EB 2HIMA 5JAUA 2FSPA 2HRBA 4G23A 1KZ7B 2V7WA 1GGEA 3O47A 4P4SA 1NYTA 4CCSA 4CE6A 2JIOA 4UOEA 1ZIDA 4HSGA 4M98A 4DAEA 1S02A 2IH4A 1F8YA 5BUCA 1EI9A 5ENDA 3AR8A 4RH1A 3QITA 4FHGA 4J0QA 3F3KA 5EQTA 5EQFA 5GADl 2C7QA 1O6BA 2Z04A 4I1PA 2OOSA 1PK9A 4P82A 5AXAA 4DREA 3WRXC 1ZSVA 2BFAA 4QUBA 1ZGCA 4A6XA 5FL7D 3UVEA 4XVRA 1OXMA 1X1EA 2YXEA 3ID6C 3I9FA 3PEFA 1G64A 2JFUA 3TKAA 4LJ8A 2D1FA 2DPHA 2DTEA 1CJBA 4Z5XA 4CM7A 4P98A 2IS2A 2G5PA 4HXYA 2WZQA 3KHUA 2IX9A 1DV2A 1QV7A 3H5VA 4XGQA 2NYUA 5EZSA 5CXUA 4ARSA 4Q4DA 2JLXA 1RRCA 2J33A 3S40A 2ZBQA 3EZ6A 2ZYIA 5ITZA 1KZ6A 1N7HA 2GX6A 1NWHA 1MJGA 2KBEA 2QTMA 3H0CA 3OIGA 4JL6A 4PYRA 3RUEA 4YJ2A 2PG3A 1RTTA 3Q11A 3QU2A 4Q37A 1A69A 1D07A 3NC0C 4LVCA 3DZCA 4QBIA 3AL0C 4LMBA 4UDYX 1T6NA 1W5BA 4WXHA 1CV2A 1E3SA 2UVQA 4JEMA 4PG6A 3RIHA 3X1MA 4P5PA 4B2LA 5HG0A 1K5HA 2ACWA 3ZLVA 3VA7A 4E3WA 1VCOA 1XXLA 4GE3A 2O06A 2XBUA 4IEIA 4LBWA 4Y9RA 4ON9A 1N5OX 4GW3A 4G0PA 1S6YA 2EHJA 1P60A 4QPCA 4LE0A 1XTUA 1F6BA 1OMOA 2IBMA 2EXXA 2RMKA 4TKUB 1Z4NA 3ZZ0A 4DV2B 1QPBA 1YBFA 1SOAA 1DE0A 3M4JA 4GC5A 4JKYA 4DS3A 3VOTA 1VPVA 4JODA 4WKCA 1UJ2A 1IN5A 4LGVA 4RHCA 4AMUA 4K0KB 3UM9A 4NU0A 3ZDXB 1OT3A 3V4OA 2AFIE 2XYVA 1O96B 5EWLB 4FU0A 4AKEA 2VS1A 4RS3A 1DIHA 4Y6OA 4HYTA 2HXYA 1C41A 1KEVA 3CO0S 5LA6B 1KJQA 3U7IA 5ALVA 5ESXA 5JWOA 1T1GA 1UP6A 2ZDQA 3KTAB 5JLAA 3AFMA 1ZXXA 2GK3A 2H2WA 3E3OA 5P21A 4BATA 4UEOA 2NZ8A 3DW3X 1V7QA 3K6SA 3DMDA 2Q99A 4G85A 1F8XA 3GVHA 2J59A 3LW8A 5E9AA 1RPTA 3OZIA 2A9QA 1KK2A 1CY2A 4JC5A 4GOKA 3SLGA 3VNAA 2W6NA 3EXHC 1HL3A 3TZBA 2FZCA 4WWHA 1BYUA 1YS1X 1B1AA 2IC5A 3I28A 4OY3A 2N47A 3MRXA 1UFKA 3SBDA 3VM6A 2W43A 1DFIA 1H2EA 3W05A 2VSQA 2B3DA 3S2ZA 4G4SP 1FS5A 1HK7A 4B35A 3LBFA 3K5WA 5AKHA 3PHGA 2XD4A 1FXWA 4H60A 5BR4A 5COQA 2OCKA 2NP6A 2OV3A 3BGOS 1SHKA 4JBWA 1XPOA 1HZJA 3THOA 5LQNA 3HI4A 3BHIA 3ZHBA 4X6YA 1E59A 1L5NA 1QPGA 5C53B 4KWIA 1NQXA 1UPXA 3GJ5A 3PGJA 1NZJA 1BXRA 1RPAA 4BNMA 2Y1OA 3ASVA 2FPWA 1RMTA 1Z4QA 4NPAA 4PPFA 5DGHA 2Z58A 2JLSA 4C7XA 4XX0A 3DUFA 3JQFC 3UGJA 4J29A 2JH8A 3DVQX 2QUJA 4I50A 4JT9A 1CQJA 1YRWA 4J0CA 4W7HA 4AYWA 1J2YA 3QMWA 2WE8A 2W2NA 2C58A 2CLIB 2JFZA 3DTYA 4YP5A 1RI4A 3HU3A 1OYOA 4PO9A 5JD4A 3VOSA 2SKDA 3OQMA 4K0RA 4F4DA 1EU1A 4PR0A 4IDQA 5JMTA 4X3CA 2ZJFA 2XGGA 1HZZC 1RWBA 5J9FA 1KEEA 2Q2VA 3OZDA 2QJFA 4CLOB 1KH1A 2X2EA 1A2KC 3BSYA 3H1EA 2ADMA 2VP6A 4D9KA 1Z83A 3QJYA 4FKZA 3F6BX 1EK1A 1Z82A 3VPGA 1XN1A 1R74A 3VC1A 2DE0X 1QE0A 1GL6A 1XA4A 1Z5GA 3OBIA 4TQAA 1B6RA 5JH7F 4QFDA 1NF9A 2JVKA 3PXDA 4BLUA 3GVCA 4M37A 3ZQJA 2RG7A 5KTNA 1IPHA 2F1OA 3MYRA 4DOMA 3T7SA 1A4XA 2OCAA 3GG2A 3MS4A 4I5GA 4J7AA 4XVQA 4YCLA 2Q8QA 3EVFA 1BTOA 3CINA 1K88A 3BK7A 1GNQA 1G21A 3KQLA 3PQ8A 3WGVA 4LFBB 3Q8XB 4EAQA 4C0JA 2BF4A 4QEZA 1DVRA 6ADHA 4NBTA 4ZDWA 2AMYA 2Q3LA 3QUTA 5H1YA 4CV3A 4DILA 1V5WA 3K0HA 2Q8NA 1XMQB 2J87A 5EZQA 4N3CA 3HXOA 3ZK9A 4J49A 3ZIAA 1T13A 3DR3A 3LCUA 1V16B 3A32A 7MHTA 3PNOA 1CFZA 3CSUA 1D6NA 1V45E 4FHDA 3GT3A 3CRMA 4CKEB 5GJCA 1II0A 1Y4UA 4WN3A 1H93A 1J5EB 1UC9A 3ZDEA 4X60A 2PANA 2L0XA 5HMMA 1Z8DA 4EKGA 4P54A 2RGRA 3PQ7A 4QT4A 5JDIC 1RWXA 4K6CA 2MYUA 3SY8A 3JR7A 1ISIA 3OOWA 4P93A 1E0KA 3E22A 1LDGA 1NA5A 4QDOA 4XI9A 5CJ2A 3FNRA 3S29A 1F60A 1TF2A 3DAHA 4AG6A 3KOYA 4ZVUA 1JE0A 4DLLA 1KTIA 1NOIA 3AU8A 2RHCA 2WYWA 3TRFA 2Z43A 3C8DA 1KMHA 3NTQA 2QNRA 2B1GA 5CA1B 4EW1A 4XD7D 1ZL2A 1HE8B 4EHKA 5A4AA 4DLBA 1JQ5A 4ZANA 5KAMA 1U6KA 3DEHA 3NTOA 4RVOA 5HUJA 4AKHA 4YAJA 2WHPA 4JXZA 4OQYA 3OPYA 2JJ8A 5T67A 4EG5A 2CXOA 4G1EB 3T1VA 3UPDA 2PZFA 1UXOA 3MQ4A 5IAGA 1T1EA 3DE6X 3U3DA 2WUEA 4DHWA 4NFLA 5EJ5A 5BYAA 1PQWA 2PUEA 3R5FA 2ZR0A 3HXKA 4GSLA 5DLDA 5REQA 3FOZA 3H65A 1WXFA 2G63A 3BPSA 4YB8A 5CAEB 3RYTC 4CG2A 1QE3A 1LA2A 1QYCA 1SPBS 3GJ7A 4HQKA 5EKTA 3WK4A 1JHOA 1U31A 3ECCA 3M9XA 3C43A 3H84A 3U7HB 4N6NA 1RW4A 2B8EA 1VDZA 2O8EA 3FKJA 1LK7A 1DB3A 5DDIP 1DJOA 2FSFA 2V7EA 5DHFA 4CCYB 3NYWA 3TGPA 5J1SB 2POQX 4F9FA 4EQZA 1CY6A 2GCOA 4RA6A 3S81A 3F3YA 4E21A 4UMFA 5F77A 3UFXA 4IMJB 5CHYA 4KE8A 1QAOA 1YZTA 4B6FA 5CCXA 4FEGA 1ZGGA 1M72A 3KRTA 2XCLA 5E6RA 1X7ZB 1UIRA 2L17A 2WJHA 3H5OA 2IYRA 4U8HA 5G3ZA 3S2YA 1AKEA 4L4XA 5AESA 1C0PA 2X3UA 3EDOA 3NBFA 4KDEA 4Z9BA 2BVNA 1R5NA 1D1SA 3TQSA 4AI6A 5IHXA 1I33A 2EHDA 1SUEA 1KP9A 4FYXA 4ZGGA 5EEGA 4JQOA 5FORA 1R4MB 1UJMA 3MSXA 4HQRA 5DE3A 3WGMA 2FY8A 1VRCA 2B7BA 3ES9A 4OMDA 5FHQA 3ICEA 3H0KA 2KX7A 4HZUA 1B76A 1P7CA 2LVBA 2IYEA 3H87A 1J23A 1D7AA 2ORIA 2RAFA 3WGTA 1PSZA 2NGRA 2QGNA 4QPDA 2X6QA 1DIBA 1SQ6A 2V58A 5AH0A 1H5QA 1SHZA 2OCLA 1UWKA 1XALA 2QVBA 3HO8A 4O2BA 5EHXA 2HV8A 5LP6B 1PV2A 1XWFA 3PFWO 1NQWA 2XKJE 3F97A 4LW8A 3HFRA 3K0EA 3R5KA 4MYTA 5KVQA 4J90A 1RYDA 3ROFA 3B1JA 3RYIB 1BCRB 1HE5A 1UKEA 4AF7A 4AIIA 3GDFA 5CH5A 1U7OA 3OECA 1NRJB 3MMNA 3P2YA 4I5IA 4BNYA 3OLYA 4OBWA 4YP7A 4E3ZA 3TXAA 1N5JA 5CNIA 1JFLA 1DOHA 5FTLA 1GVHA 2YJZA 3AB8A 4BBAA 1ZH8A 3AEZA 3UMFA 3R4CA 2Z9CA 4EGQA 3F6RA 5FOQA 1U7ZA 1OQAA 3KIPA 4LK3A 3GFTA 3TSCA 1O9GA 4CR8A 2PGLA 3OEED 4GDMA 4IIEA 1J1UA 1WL8A 4K6FA 3HJAA 4GKBA 3GK3A 3RAJA 1E4YA 2PR2A 2D2FA 3JQ8B 5C80A 1ZM2A 3V1UA 1TF7A 2PFGA 3N2IA 2R0QC 2CL0X 2BT4A 2B3TA 2P4QA 5CFZA 1Q7RA 1DV1A 3EA4A 5DRTA 4RIGA 3DOEA 4FNAA 5JS8A 4MQEA 1Q6YA 1UMCB 1RHMA 1F7VA 5SY6A 1YVDA 1RZUA 2YWBA 4Q24A 1P77A 4IDGA 4N5NA 5F51A 4BB5A 4QKQA 3ME5A 4Q4JA 5K99A 4C7OA 4ZK2A 1NW9B 3TOVA 5T5QA 3QSGA 2A92A 3PLRA 4HDOB 5JNSA 4ER5A 4G36A 1J9GA 1EWKA 5CUQA 2QJOA 2RHMA 1UPCA 3WRYC 3ZGLA 5E6SB 1CUCA 2VQSA 4OHCA 1RXCA 1QO7A 5EJFA 2J41A 4L1KA 3TRHA 4GNRA 2Q5QA 1JQEA 1UANA 2P9YA 4FN4A 4KWCA 1N6KA 2XAUA 2BN4A 4ALJA 1LS1A 2H63A 1UC8A 2YV5A 1WSWA 3D8TA 1VBMA 4NBNA 4RE6A 4ZVPA 5IDVA 3VYSB 1BJKA 2XRYA 3EOZA 4JXJA 4EFDA 3IJ5A 2W22A 2WSSD 4D3FA 4GMGA 5LQUA 1JJVA 1DWOA 4HD8A 1LS6A 1OX4A 1SUFA 3GOQA 4ABYA 4BFCA 1KAMA 4ILEA 4KR7A 2WHQA 4AD8A 1V2HE 2Q6TA 1KKUA 2IIQA 2WILA 4A15A 5K2OA 4ZVLA 3ITDA 2C77A 4PW0A 4RW0A 4NECA 4ZCTA 1X7HA 4WSOA 3IKLA 2RIRA 4BLRA 3H8VA 4OHFA 4ZYYA 1RYNA 2LCFA 1ITZA 3D6TB 4UHBA 2B82A 5HF5A 4Q3LA 4IW3B 2A2ZA 5K9ZA 2YASA 4P2BA 1V11B 4C9BA 2IP1A 1JHVA 2FLVA 1RYBA 2ZIGA 1U2TA 1E32A 3I5AA 4XUCA 2OZVA 4N76A 4FMCF 2YCBA 4CETA 1C5KA 1JZSA 2AMLA 3MF4A 3I9MA 3KJEA 3IE2A 4P0TA 4NFHA 3RIMA 2YMPA 2QE6A 3OZFA 3BMCA 1GZVA 2ZBUA 2SCUA 2Y0BA 1Y4AE 5ILOA 3BGDA 2E55A 4Q1FA 1CIJA 2QLBA 1CJKC 1R12A 1ZUWA 1DAPA 1KVQA 1ZM9A 1T5TA 2GOYA 4O2LA 5SY4A 3VTFA 1ZY2A 1NP6A 2PGNA 2FNAA 2A3NA 1EFLA 2DQ4A 2R48A 3FKQA 3L82B 4GNKA 5GMOA 3RUAA 4LZAA 2R1UA 3P2KA 1NG9A 1FA9A 2AZ4A 4MS3A 1KIFA 2NSLA 1L7QA 2R8OA 3DVAA 2CDBA 4KKVA 1BROA 2BFDB 2QZ4A 3HU1A 4QDTA 4L3WA 5CH8A 2VR1A 3S2IA 2QZPA 3RS4A 4Y2JA 2NZUG 2JANA 2DWCA 3GHHA 3N0TA 1LXCA 3KE9A 4H15A 4GPEA 4OJTA 5B2ZA 4N47A 4JC8A 3UJBA 1CZOA 4JI0B 1Y7TA 4C5CA 4CI0B 4MKIA 3B8EA 3H3JA 4BC0A 2GBFA 1M7GA 1A4IA 4FE7A 1QANA 3ZW7A 2I8LA 3GUHA 1DPGA 2OCXA 4NZYA 3V4SA 1LDMA 2HADA 2FLKA 3MINB 4EG7A 2OQ2A 3HNPA 2JBAB 5D3KA 3T7AA 3U5TA 2OZPA 4KGXA 3OLXA 3CVYA 5D86A 3TJMA 2C5SA 4J75A 3EXFA 4U2BA 3NHBA 2YFQA 5CNMA 2AT1A 3WL4A 1EUZA 3O3OB 4UMVA 4XEUA 1Y3CE 3R7LA 2O07A 1QUEA 3AUYA 4Q5IA 2H4ZA 4QQNA 3L6EA 1DIAA 2RH8A 3ZVMA 1L5SA 2GZ2A 3HRKA 2ZREA 3OSUA 1DBWA 2HU8A 1DBPA 3AV3A 3BBPA 4RDXA 1BJTA 1SZCA 1P2GA 5LFAA 2NUAB 4DR7B 4KIWA 4A2QA 3K72B 1M8JA 2HH9A 4PU0A 4EA8A 1IBCA 4I8XA 2YN4A 2IXGA 4WXEA 1C7EA 2OBNA 2FFHA 2PR7A 1JEAA 5DGCA 1F0KA 1NI5A 2XF2A 3KEMA 2F9MA 3KJXA 2DTXA 1OHHA 2IITA 1MX5A 5IBPA 4TV8B 1G8AA 1JECA 1XDDA 1QHYA 5FCDA 4BEBA 1BQ4A 1THGA 3EXEB 4NZNA 1EDDA 4YFVA 1J0BA 5FOSA 4UTNA 1PNRA 1NVVR 1Y8RA 1U4SA 1U0NA 1DC5A 1Z0KA 1Z4PX 4URUR 5CT4A 3RRZA 4PNZA 4B4DA 5CDSA 2I9KA 3L3BA 1KMMA 1KTVA 4GI1A 4TROA 4JYAB 1P9WA 3S1LA 2C7OA 3C3YA 1OUMA 2Q8PA 5KBYA 3BXXA 5LPNA 4TZ6A 4JBYA 4B4KA 4DKXA 1UWVA 2HMSA 2C7BA 3MD9A 1N5MA 3NZEA 3MJDA 4OBXA 4I4TF 4QTXA 4V0OA 2N1MA 3C7AA 2GM9A 2DPGA 5HK8A 2W8ZA 3MOIA 4FNGA 4LX8A 5IBQA 5F78A 3PI6A 3OQVA 1EFAA 2Q3JA 1E5XA 3ETNA 1XNQB 1FYVA 2NNLD 1RIIA 4I08A 3I5XA 4RSMA 1GL3A 2YWDA 4HWTA 1WRBA 1TKAA 2PZJA 5CNKA 4UTOA 3WB2A 5TPZA 1QYDA 5FWDA 4A82A 3QW2A 4OUKX 2F4VB 3Q3HA 1PL0A 3AUFA 5ICSA 2WD7B 3J7TA 4PYQA 5TPWA 3TXYA 3I8XA 3ZDFA 4X8HA 5ETJA 4BQQA 3KS9A 2ECOA 1FUIA 3SR0A 3ZW9A 4DYDA 5IC4A 1CS0A 4EAAA 2PRKA 1JDVA 1E60A 4DFDA 1K7YA 2DSTA 2I6TA 2M6SA 5FBVB 3IP9A 8GPBA 3NXSA 3A4TA 1NE7A 2H85A 3KOXA 2FR0A 3EEOA 2OK7A 3OCWA 5EP3A 1X9GA 2VZ8A 1K2VN 1KSJA 3C4QA 3MMZA 3F1KA 1OFTA 1Z47A 3HRHA 4PPQA 3DL7A 3WOHA 2NAFA 4EA6A 1QXSA 3T9FA 1IEQA 2V0CA 3R0QA 4H7PA 4PQYA 3GU3A 2ZVDA 4E1AA 3I2IA 3A3OA 2Q5OA 3H2IA 3QM1A 4CKBA 2YJTD 2GKSA 4Y6QA 1OILA 3KQPA 1N1GA 4KUGA 1H2FA 2PSEA 2YWRA 4XCVA 1J06A 1SWWA 2HCFA 4MKRA 4Q9JA 3O4JA 2CNKA 1VKZA 4U9HS 1TL7C 2B7LA 4CU2A 5JZ9A 4JB8A 1XP8A 2CXHA 3R0ZA 2N46A 2OTCA 3AM3A 4NICA 3HL0A 3NFRA 3BL6A 3Q4GA 1TNDA 4HP8A 2ZJ0A 4IVPA 2M6LA 4LS3A 3WICA 3I9V6 3ZGYA 1QP7A 3FZNA 1MD9A 1J97A 2EKLA 1AQYA 2OV4A 1C3VA 4Y30A 2GWRA 1B8VA 1N6LA 3AR4A 4RS4A 2JLVA 1N33B 1ZJ6A 1PFUA 2VNSA 4XWYA 3L1UA 2W2KA 1KQGA 1NLZA 3MS2A 2A4KA 4M1EA 3IEKA 4OB7A 5JBNA 3DZHA 1AUXA 1NR7A 3TLKA 3FNIA 3LZCA 1YJBA 2EZUA 4E2ZA 1TGVA 3FCYA 2O0JA 1DGQA 5K3AA 1LH0A 1U1IA 4V1CI 2NLOA 1BU8A 2UZIR 1TK3A 4H2DA 1U8XX 1CPYA 4C6TB 4LF7B 1KSGA 4RAQA 4GKKB 3OX1A 4BLVA 2AF4C 3M8KA 4FCVA 4EBBA 3V4RA 5K3FB 3T5PA 4WJKB 5FV4A 3VKVA 7GPBA 4KMRA 3GAFA 1HZZA 2FEAA 1FUUA 2Y1LA 3K16A 3W2EA 2PJRA 3JCZA 4ND6A 1BGWA 3UAXA 1IWOA 1ZONA 1QMPA 4NCKA 3K9BA 3PXGA 2PT9A 5CXQA 3K0BA 4EJ2A 1MX1A 1B8NA 4M9RA 1B2RA 3JAWA 2ZI3A 3MTGA 3OP1A 4JYCA 3NB0A 3IR7A 4MJ3A 2JAXA 1P1JA 1HFJA 3QG1A 4TMTA 3ZI0A 1KORA 1VM6A 4LNUB 1KY5A 1L3CA 2JI6A 3NHZA 3COPA 3FCUB 4EY6A 1E1RA 1NSFA 4R2IA 4D56A 4EVIA 3UMYA 2O19A 2M9MA 3LHFA 2O7SA 2VNHA 2QBYA 3CS3A 2OV6A 1D2CA 3MFYA 3PRJA 1YZGA 3R3JA 1OLOA 3TBKA 1R2QA 1KEKA 3CB4A 5FTMA 4DNPA 1PJ2A 3V4PB 5FAKA 4HZUB 5DBFA 3HS3A 1S2DA 1A9OA 4PHTA 5B4UA 3G1WA 1TCBA 2ODQA 2A14A 4O4JA 4DIKA 1W36B 3E7DA 1SIWA 2J46A 3THXA 4YFYA 5AP9A 3X1YA 3M1YA 1VB3A 4J4BA 3K70B 2O1EA 4QDXA 3V3TA 1C1DB 4UARA 1SKYB 1NLFA 4W9MC 2WKPA 1WPRA 1SVWA 3COWA 4H9GA 4B5LA 1GV0A 2DG2A 5CLIA 4C6HA 3K1JA 3DAOA 2PHZA 2QN8A 2X15A 3WVNA 3U40A 3IEIA 4ME6A 3QSYA 2BISA 1EPUA 4P9NA 3U3MA 3C87A 4C0QC 4ZCRA 1AQNA 1WA5A 3OKPA 3ZE7A 1J5PA 4M8SA 4PIPA 1PQ4A 5DNYB 1XTVA 1J00A 4UBMA 3QX9A 4YCDA 1BWQA 4CL0A 5EZYA 3CB2A 4ILKA 4G0NA 4RFSB 1N5RA 3RU3A 2IZ0A 2AL7A 5JCJA 4URYR 1ZK0A 2EP7A 2HCRA 4XIGS 4CIAA 4R5MA 4MVJP 5A02A 3OWHA 3NVMB 1W59A 5LNK1 4I99A 3PX7A 3KQKA 1NIJA 1CE8B 2O23A 4GGPA 3O2JA 5CB4F 4RCZA 4NENB 5NLLA 3LY9A 4EG1A 1E66A 3AV0B 2YW9A 1LVGA 1IU9A 4UBJA 4LDNA 4C2BA 2Q4TA 2YYSA 4Z49A 1YRAA 3ROKA 4DR2B 1T3GA 2IHBA 2IF2A 1BVHA 2R7LA 4GVPA 3SM9A 4EJSC 3ETHA 4QVGA 1AH2A 1I8TA 1E77A 1NI3A 2I6GA 4QRIA 5F1YA 1T0IA 1GNRA 4OIMA 3RRBA 1A5BB 1RHRA 2AF3C 2RGBA 2MSNA 4TL7A 1AXGA 2ZSFA 2ZIEA 3MJCA 1F8UA 3G9QA 4J0EA 1EFHA 2OEPA 1G55A 3TE6A 5FLKA 4LTNA 5C0OE 1LY1A 2G06A 2QS9A 3ZTYA 2H9AA 2GN8A 1SZDA 3DBLA 3MSCA 4QUJA 3E5MA 3T3EA 2C7PA 3ZD9A 3O8OB 4XYGA 3TCKA 4D6PA 5L3QA 3R5HA 5SZIA 2KJQA 1SD1A 4F5WA 1E9DA 5DK4A 4E0BA 3RSFA 3DXYA 1GG8A 4Y2XA 1F4PA 4GO1A 1EDOA 1RZ3A 3QWIA 1TKRA 3ZGNA 1EK0A 1LLUA 4N8DA 4F4CA 1FLVA 4V0QA 4ZICA 3O8DA 2VIIA 5DNCA 2NO7A 3U37A 2RGUA 4O8ZA 3PJRA 1MC5A 4K2HA 3QNWA 5EVCA 4C7KA 4LYDA 1G5QA 1YJ5A 3ZCUA 1UJ6A 3G8YA 5EGSA 1J2UA 3EH1A 2DY1A 3HB5X 3ILHA 3NM4A 1PAUA 3GLHA 5C8YF 5HQ3B 1ZWKA 5JAMA 2R4TA 3WYAA 4XWKA 1D9ZA 3LO8A 3VVBA 5EG5A 2H51A 5BWBA 2I1VB 4NULA 1ZVVA 4C01A 3COYA 4IS2A 1AK1A 1Q7TA 5BQXA 4JI8B 2XQFA 2XVZA 4YRTA 2F00A 1CXZA 1O4WA 2DM6A 3GGGA 4CM4A 1AT1A 3KUUA 3NETA 4RDHA 1W52X 2NTNA 1L8XA 4MKXA 3P0FA 1JJBA 3FPCA 2W6ID 1OLXB 1NHGA 1CQXA 4PBRA 1Y3HA 2NTYC 2FZWA 3D64A 3AXSA 3GWGA 4TOIA 1IY1A 3KT8A 4EPWA 2VK2A 5JVDA 4DCUA 5DNEA 3SXPA 1V9LA 4ALMA 5CT6A 4ZRMA 1NV8A 4A8PA 1XZIA 3DMYA 4WVFA 3WWEA 3REOA 5GIOE 2YOGA 1WY5A 2O0HA 2OO7A 1N2OA 4J16C 3UJPA 3KYBA 5LMNB 2J3MA 3R5XA 3PPWA 3RCBA 3COJA 2W2QA 5BVGB 1SCDA 1RKVA 2IYNA 4Y98A 5CTAA 2PNJA 1IDOA 2YZNA 1UDXA 1C0KA 1RZVA 2WHEA 2CVOA 3ZY4A 4UUAA 1S89A 8MHTA 1L9KA 4IWXA 1E1CB 3GLKA 2QTVA 2I6SA 4KHPB 2DBVO 2C82A 3AF4A 5AM2A 1IEXA 3UG6A 1EDBA 4KSBA 3B3FA 1JLHA 4L6CA 5DM0A 1LJ8A 2QW8A 3OU2A 4WKGA 1B73A 3KYCA 3HCAA 1C4WA 2DTDA 3KKPA 4G5YA 4R9NA 5BMVA 5AW4A 3JV7A 1Y8ZA 3L93A 5ERYA 4OQEA 2RBGA 3F90A 1NURA 2WG2A 4WKBA 5TSDA 4M7WA 3TW0A 3U5ZB 2ZRPA 2EERA 1DRUA 4MCIA 5KTKA 3AUKA 4K8RB 2G9RA 1FUKA 1R4NA 3KBBA 4QGBA 5ITSA 3WHKA 4GX2A 1D4OA 3WLKX 5F2NA 3N59A 1P7VA 4PFQA 3O8BA 1QP8A 3PYLA 4WXYB 3Q2KA 4DYHA 4K9PA 4PSVA 1L4NA 3C1TA 4ZXPA 3UAZA 3RTAA 2WV9A 4GMHA 2O14A 3WRXA 5IT4A 3KEQA 1GA1A 4KXUA 1MQ9A 1Z5UA 1ODCA 3RU7A 1Q0QA 3EFHA 1Z25A 1GNLA 5LA6F 4HQOA 1T29A 3H8JA 1ID8A 2J0EA 2O2CA 3SC6A 4XQ9A 2WV7A 1J09A 1Z6QA 2H1RA 2WUVA 4NXMB 1A9TA 1U0GA 2BZGA 3K6SB 3LF2A 2W42A 1IBMB 1AF7A 1SVIA 2AE1A 2AJLI 4FBGA 4JIMA 1B8OA 1W25A 3PFGA 2OSVA 3RRFA 5LXTB 1SG0A 3RS8A 1E8NA 3UMMA 4J0KA 2ZW9A 3IBCA 1CY1A 1KXJA 2RI6A 3MTEA 1XMJA 1SVNA 1ESMA 3GPCA 4GX1A 1C2YA 1UBFA 4QUKA 2P2YA 4HNTA 3ILVA 4RPJA 3OQIA 4DEYA 2GKGA 2I1QA 1ZIOA 2F3TA 3PPIA 4G9EA 3L7IA 5ALUA 1X14A 5FOVA 2CNNA 2IOHA 3RVLA 2QRJA 4ARBA 3K9WA 2J9RA 2EBUA 5JSYA 2D0PB 4OX9Y 2AKEA 3T4UA 5LKRA 3ELDA 4RCYA 1M6EX 3P9RA 3ER6A 4G0OA 4PQRA 1GN9A 5BSKA 3TRIA 2KI5A 3G88A 4CQJA 5B7NA 4RKRA 2F64A 4RVGA 1DLIA 3LE8A 5ALTA 4BKUA 2ZE7A 1KYWA 4B6RA 4CR6A 4TKVB 1K06A 5LBUA 4CMEA 2ZRAA 4QECA 2TECE 2ZJOA 3TAXA 2XNDA 3ZBQA 1LI5A 4W5RA 1NW6A 4WZAB 4IR7A 2C88A 4BKRA 2CVFA 5PNTA 1GKKA 3RI3A 4BJ3A 3ZUGA 4JOBA 2IUSA 1R5JA 2IZ6A 3GFPA 3IO5A 4X64B 4IGIA 3GJYA 3TTVA 1DJLA 2HT1A 3MFQA 1QCYA 3JQCA 1CNFA 2Q6IA 4D44A 1IK4A 2FTKE 2P2CA 4DSZA 5L45A 4LOAA 1FU4A 2ZVJA 2Z8YM 4PPYA 3FHLA 2WZCA 4M0DA 5KSZA 1SHJA 3OD5A 2QT9A 2PKWA 4YIHA 2QWXA 3HBNA 1JFFA 5DLPA 4C4OA 1W35A 2ZRNA 2H4FA 3JQGA 4MHSA 2EKBA 4FFVA 1CWUA 4QDJA 1O87A 5DBOA 1XVTA 2A8YA 1RBYA 4B6QA 2ZFUA 5JZSA 1YQTA 3L7JA 1IUKA 1KERA 2J0VA 5JMPA 4WFIA 4BJ1A 1GSHA 3SQDA 4ENVA 5A5DA 5IC6A 3TAUA 1ZD9A 2X3FA 1DTWB 3AL2A 4JLDA 4H0NA 1PG5A 4L2IB 1NSTA 5B58T 3LO5A 5TJHA 4PINA 1KY4A 3PDCA 4I1UA 4E6PA 1MAWA 4CKXA 2WD7A 4NV0A 3UAVA 4DMCA 4DTIA 1DX4A 3NGLA 1QFSA 1MZVA 4P6VF 1P5FA 5AICA 2COKA 2ZJ8A 2WVGA 4M0UA 3DZDA 3L4EA 2Q3DA 3L7MA 3STTA 1CJVC 2H2IA 1L7OA 1F17A 1LRKA 3FVQA 2EWWA 3CSDA 4CLOA 2FB9A 5CIYA 1NAIA 3H2YA 5GJBA 5LIRA 2HTEA 4MEJA 1VKJA 3EIWA 4LV8B 2CFOA 3LG2A 2ZXFA 4PWZA 1XZGA 4AY5A 3TX6A 1JHXA 5JCOC 1H1LA 2WAXA 3K0AA 4QUDA 2YHAA 3T9AA 1WZ2A 4HNQA 3NTVA 1WBBA 3JSXA 4HYQA 3SFVA 3KSUA 4YAWA 3ZTWA 4G81A 5BSVA 4K9SA 4DBZA 1YZVA 3DBOB 4H4EA 3EYAA 1DIOB 2BDUA 4CM9A 4EF6A 4KV7A 4PNHA 5DKFA 5ALSA 1V5EA 1OH8A 5AW1A 3VUEA 1GUBA 3RUDA 2A57A 3WLTA 4G9GA 1GPLA 2XMQA 5EUQB 5IXYA 2FK7A 2Z98A 4ZIRA 3P0RA 3H19A 4HGNA 3ZUPA 5M34A 4OREX 2FOIA 4JVOA 1NN0A 2HZBA 3SM3A 3LDUA 4EI9A 2LKCA 4AP6A 5B1EA 4EHFA 1PJTA 3KOWA 4YAOA 1RAAA 2X58A 2JEYA 3O4IA 3QA3E 5FFNA 3AJ9A 1BVYF 3UJCA 4AMYA 3GJTA 1P73A 1PG2A 1WCIA 2GNAA 6Q21A 1DZIA 1LBTA 1MQ8B 3KYJB 5A2GA 2R6HA 3P2MA 2HRDA 3F71A 3FYHA 3PR2B 2I6XA 4AKSA 5AJHA 3X0DA 3WZLA 2JI9A 2VDQB 4TXMA 1XHFA 1Z18A 2OESA 4I7EA 3RJZA 4PHHA 4OHWA 1ZIXA 4HPWA 1N2SA 2CZCA 4NCHA 1P8JA 3NJ8A 4YV7A 2JLUA 4WTOA 1GU0A 1B42A 4MUKA 4AKGA 3RREA 3W7VA 2G88A 1ZXBA 5J59A 5AD1A 4CKCA 3LH5A 4ZCMA 1M9NA 4MUJA 1MV8A 3FWNA 5HOEA 3DBIA 1EHCA 2IW1A 5DO9A 1V8OA 4PRZA 4RLSA 1DKOA 4KNVA 4D43A 4DCGA 3T7RA 3ESDA 3U31A 5JW6A 5I01A 4X5OA 4M3NA 3NAMA 4DUZB 2YRXA 3G2IA 1I1OA 2H7YA 4Q7JB 1H2AS 3PXEA 4E4YA 4DC9A 3DTTA 3TOXA 4QWWA 9LDBA 5CK5A 2FN3A 1S2MA 4LN1A 4TVKA 1AHIA 1BVRA 3DEZA 5DK6A 4AVYA 1U9IA 1M83A 2JHPA 2HPHA 5IW8A 3UN1A 4C7BA 2X2PA 2B35A 4JENA 1GZ3A 4KK3A 3FUTA 3M7IA 2HA6A 4UC0A 4PLWA 1J70A 4MULA 3LQYA 1ZN2A 4Z3KA 4AN4A 3ZDBA 1ML4A 5G2OA 2R65A 1KVRA 2VJBA 5B1IA 4OQXA 4G5OA 1JIUA 3HP1A 3LECA 4ZEOA 4F4FA 5KNLA 4KRFA 3RYFA 1NT4A 2P9JA 5D7BA 4EGFA 3D4NA 3T3OA 2Z2ZA 3SHQA 4C0AC 3DO8A 5HIIA 1D2HA 3FTCA 3KWJA 1UKZA 3V80A 3LUBA 3C48A 4CG3A 2CHQA 2ZIZA 3JU3A 4G26A 1JEJA 1Z5OA 2XITA 2XMGA 4HGQA 4DXDA 2XKKA 4LDRA 3MCVA 4RFVA 3N6VA 1I36A 1UFVA 4FINA 5CMLA 1GITA 3KB8A 5DX8A 221PA 4L8VA 3ZWXA 1YT5A 5JRZA 4D99A 3MQ2A 3NNDA 4WUTA 1MRSA 1FNBA 2GK7A 1YQGA 4CM6A 4IVQA 4A10A 5IJXA 3WOVA 3BZWA 4KJXA 1WD5A 1U5BA 4ZOLF 1X0XA 3WKDA 2BL4A 5KINB 1SXPA 4OYHA 1MV5A 2HUPA 2QVYX 1JKMA 1POWA 2M2IA 3VKGA 3LCRA 1Z07A 1VLMA 1YMVA 2XVMA 3WE7A 1KH2A 4FIDA 1UKCA 4NE7A 3T95A 3CVUA 2CXTA 5B6PA 4P4TA 3B3GA 1FFEA 3WA7A 2HIGA 2E5WA 6ABPA 2Q5JA 1U04A 4HR7A 4IJMA 3UPUA 4FOLA 2VF8A 2J5BA 3EEIA 3LY7A 4YJFB 2R4UA 1XU9A 3ZHYA 2WJJA 3P4YA 1QQ7A 2P6MA 3JWIA 1EIWA 3UKJA 4LJKA 4WL0A 4JLJA 4ZV9A 2ZDHA 3KQYA 5DLYA 3AVVA 2WFLB 5D3MB 4FJ0A 4CIVA 2R1TA 3OT4A 4EVSA 1B93A 1HWYA 4BCCA 5KO2A 3R2JA 1AQIA 2CHEA 4MJ7A 4G4JA 5EE0A 3LC7O 4XLZA 3DWEX 3LT2A 4OGLA 5ECGC 3O1JC 3ZCTA 4B34A 1H2ZA 1N5KA 4MJXA 4RIFA 1K98A 1YMUA 3ZNQA 2XUQA 1E1DA 1GNTA 4M87A 1E7SA 1JYFA 3MTDA 4R54A 1XCOA 3V8EA 4KQ6A 5ALQA 1JEYA 2WSBA 4KFUA 2N42A 4FGUA 3E7FA 2GJ4A 4IDHA 4C29A 5FLEX 5KIAA 4HFRA 4ZQIA 3SWWA 1Q0RA 3BBLA 3CF0A 4OP1A 1ZN8A 1NULA 2VHXA 2W90A 3F9RA 3NHYA 5KWIA 5LYYA 3DE1X 3DOFA 2CFIA 1ULBA 3LXRA 4PX2A 5JARA 1H2HA 2ZT8A 1RJEA 3EFOA 2B4TO 4RGBA 1XD2B 2PU7A 5BOVA 3RG2A 4FYKA 1TB4A 1O8CA 4G37A 3HNRA 3OQNA 1GCOA 5KYGA 4R8LA 5AO9A 2F43A 2Q2OA 4TLDA 5EE3A 2Z2JA 2QTHA 2QYOA 3CH7A 1MUUA 3GFFA 5E1DA 2XSZD 1UC5B 2C92A 5K09A 2FU5C 3ZIAD 2V3VA 1U7DA 2HO4A 4ZYUA 4DPKA 3WYDA 2EFJA 2AUMA 2VK1A 4J0GA 3UPTA 2BFCB 4RVCA 1QGZA 4HWPA 2OV8A 3AOEA 1QJCA 2R9VA 2WYIA 4ISBA 2DBZA 1KOLA 1XCLA 2P6PA 2QRQA 3DLPX 2B0CA 2AC4A 5FI1B 1NQ5A 2CB9A 2IZ7A 5JRJA 3LGXA 4MS1B 4R1QA 1EGQA 4LNAA 1IDN1 1PGOA 4N0EA 3W9UA 3PQ2A 1WQ3A 3NCTA 5C37A 2CSUA 2X8WA 1FVOA 5AJVB 3S28A 5FWYB 3O1HB 3P0EA 4CEHB 3CX6A 1RCUA 1J1IA 5FUXA 5F33A 2FRVA 3TD6A 3ZCXA 2JD1A 3N58A 4V2UA 4WINA 1ZUHA 1G9SA 3H3XA 1AQUA 4JA2A 2HR1A 1IN6A 3D1JA 4G5RA 4TKLA 1ELOA 3FFXA 3HWSA 5DT2A 1JH9A 1S1MA 3F2IA 1LJLA 4KK4A 3PNBA 4QGHA 2HQSA 3IOYA 1E7RA 4MITA 5IKOA 1WZCA 3KSMA 1CR0A 1W36D 5L3VA 2VN8A 3HUEA 3EZ9A 3BIWA 4HDNA 4ESHA 3KXDA 1HTWA 2FZGA 1FP4A 1TT5B 2XDWA 4QJ3A 3B6JA 1KR5A 3MINA 1JN0A 4GP6A 3UMGA 3HR8A 1S4QA 4MEBA 5CURA 3BL8A 2X2OA 1T5OA 3A1NA 5TXGA 1N57A 1U4OA 2OGSA 3PB3A 3W8FA 1FSZA 5H5JA 5K03A 1TM3E 4U7TB 3L1VA 1KU0A 5AXCA 3A2KA 4TRJA 3UWOA 4DJTA 5IHPA 1WBJB 1MOSA 1N2CB 2OCYC 3MN1A 2AQKA 2GZDA 4PZPA 4B6GA 3DAGA 4BY9E 1SUAA 3OMXA 1OI3A 3I6IA 1YFKA 1GN8A 2IHJA 4PVDA 2PGIA 1Y6RA 2V4MA 5JCZA 1KP2A 1R27A 4W8GA 1GPUA 5DBGA 2O6HA 4NZ9A 4B0PA 1FQOA 1BHJA 1M34A 4LYGA 3AIKA 1SD2A 3EVEA 1A4UA 1RLTA 2ZYVX 2Y27A 2UZ1A 1ZW1A 1TO1E 2XB9A 2AG0A 2X1VA 3M82A 3PSHA 4DRXA 3GYBA 2VL7A 2O8FB 2D0IA 5I51A 5K0GA 2VQFB 1V1JA 2OC4A 4HQFA 3DKKA 1PKEA 2B8NA 3UWDA 2G3YA 4AC9A 2IHVA 1R3UA 2HMYB 2L69A 3DT9A 3KHKA 3LT0A 4I5DA 1OFVA 4XIFA 1M54A 2HWUA 3MXOA 3FTQA 3X2EA 5IJZA 2F9LA 2OXTA 1NDHA 2LXNA 4WQMA 4XQCA 3WDLA 1CF4A 2GCNA 1VIYA 4HO1X 1XQYA 4D0GA 4UFOA 3IV7A 4F3KA 3EVDA 1OFIA 1RMYA 4GSYA 5EZ6B 3HDHA 3D31A 4OHZA 4NK5A 4EY3A 2JA2A 2XLCA 4RUKA 4P7GA 3CUKA 2VP5A 3RH0A 2EOAA 3E8XA 3EGXB 5C1OA 5CDTA 2ZBGA 3B60A 3L0SA 3VR4H 4IRXA 5EIAA 1QVWA 4EJ6A 2BONA 5TQ0A 3BRCA 1TYBE 5ILGA 3TTXA 2JIBA 5TY0A 4EELA 3JYNA 1IZ7A 2BBWA 1XZ8A 1KDTA 4HVLA 1JG2A 3EX7C 5E6UA 3RV3A 1NBWB 5ITWA 2R3SA 1RAHA 2WIBA 1RM0A 1OT5A 4RVHA 2IYTA 2EX4A 2PS0A 5JVDF 3DXXA 3ETCA 4DWWA 4B6OA 1O9HA 2IUFA 2C61A 3S7TA 1QBGA 1IY9A 1CS0B 3GC6A 5BQPA 2TS1A 1L9XA 1FFBA 3PUHA 2Y3IA 4KB5A 2GD0A 2VYND 2PA3A 1KAEA 2EBFX 4V39A 3TW8B 5BNIA 1FMFA 4GX0A 3IRVA 2HC9A 3N9IA 3T7EA 1X8JA 5EIOA 3ZV7A 1NBAA 1PT5A 1GUDA 3BIOA 4TSKA 3DXZA 5EZ5A 4A6EA 1L4KA 1NDQA 2JD0A 4CLDA 3O73A 4DG5A 1CLEA 2XDYA 4X65B 5CW2A 1JXMA 1MJ5A 2CXNA 5IJ9A 3HDVA 1GRNA 2FFAA 2YNMD 4JR2A 1S8AA 2YZKA 4HDCA 4RF5A 1N34B 1H9AA 2GK6A 4MV8A 5KNDA 3A9RA 2O7NA 1CB7A 1U7UA 1L7PA 1SY7A 1YI0A 2HGSA 2YY5A 4G24A 4N4AA 4RVFA 1I1NA 3E7PA 3GRUA 1IQUA 3DDZX 4WASA 5GV8A 3KHTA 1NPTO 1RRPA 1CG6A 4JSRA 2R66A 4U6QA 3RV4A 4BNDA 1XKTA 4XCXA 4Q3BA 5LOVA 1ABBA 2PUDA 3SQXA 3VAAA 5KCMA 2VA9A 2JL1A 1O6FA 4FZ5A 2Z56A 4IUDS 1MX3A 2OAGA 4HN2A 1XL0A 2PKRA 5K5EA 3MAJA 3R6GA 4KQJA 1TYCA 3HEBA 2G04A 2VAXA 3LYAA 2YOFA 1KJNA 3L6BA 4HAUA 4QGFA 1PR0A 3A6HA 5H68A 2X0FA 2VUSA 1Z35A 2DFDA 5A1TA 4KTTE 2MR6A 1OKKD 2HNKA 3KJFA 3NBUA 4I5FA 4BO0A 3DLTA 3JALB 3PC7A 4JT4A 2Q5IA 3URKA 2I65A 4I3FA 3HB9A 3NUQA 1A9RA 2BUAA 3OWXA 1IMJA 1WW3A 3KJQA 3ZV4A 4L02A 4AWXA 4LKRA 3WGLA 4K81B 2AYZA 2EAUA 3QE2A 4Y3UA 1WCXA 5KYKA 2G8NA 1Z26A 1ZRNA 2VDOB 3ACCA 2RONA 3K0FA 4JP5A 2GEJA 1ULTA 2RGXA 3OWOA 3AT1A 4E09A 3SGLA 3KHSA 4XD2A 2XCTB 2O50A 4OXRA 2EARA 3EULA 1E6LA 4KPGA 3UHFA 1JMKC 3SE7A 2IUYA 4J76A 3VSCA 1BMFA 2RB5A 2EFDB 3RVMA 3UXHA 4EHAA 2VHTA 1LPPA 1WDKA 4IDEA 1KE1A 5FEMA 4X63A 3RF7A 4C2AA 1E3WB 3EUFA 3WKAA 2ISCA 1D04A 2G28A 1RWOA 2P9TA 4HTFB 4QPZA 5AJWA 4LF4B 3VJRA 2UXBB 2IS1A 3IAS1 3S3TA 1QX4A 4MRMA 2VTVA 1NN3A 2H48A 3U17A 3I9OA 5DNUA 3AFOA 3SX2A 3IUMA 3JWJA 4PICA 3ABRB 4RZHA 2DFNA 4HEQA 5GM2A 5ES3A 5JD3A 3TJZA 3WAKA 5K8JB 2WRZA 4ZI7A 4MH0R 5CFLA 4B2IA 4KYUA 4MKZA 4TMVA 3L0YA 3HP4A 3VHLB 4BEVA 2P4SA 2AYXA 3P20A 1CJMA 4CDNA 2Z5FA 4MVJA 4E12A 3EPKA 1E98A 5ALWA 1P6XA 1VG0B 3D8SA 1RLOA 3OCJA 2XE6A 2JLRA 3QEOA 1E9BA 4MUIA 5C46F 4CDRA 5FPKA 1G5IA 4CN8A 1NJ6A 4FLMA 1N75A 2Q4RA 4LHXA 5J5VA 3S5UA 4HDMA 4HT3B 2A9RA 5BMVB 4U5QA 3ZWMA 2NSDA 5CLFA 1C8LA 1E2KA 4OXXA 3UMRA 2V6IA 5BYJA 3O1IC 3V7UA 2C3PA 1ESCA 4QUIA 3RC8A 1K4YA 1KI1A 4WOJA 1PJ3A 3M1IA 3OJOA 3MELA 1FJGB 4QRDA 4YCMA 1JG3A 1GG5A 3P9KA 1LSUA 4TZTA 1Z0ZA 3C7KA 5DVZA 1TA9A 5H80A 4D82A 2RE8A 1G2QA 4GUAA 4KFTA 1CDOA 3DSRA 2G6TA 3RC1A 1MBZA 4Z9XA 3M70A 4LJ4A 2WF8A 2YTZA 2BGMA 1VYVA 2I4TA 5B3JA 5TGDA 1EZ4A 4EUNA 2EV9A 5ITZB 1ZK2A 3S1AB 3N74A 1FDTA 4YP0A 1WCWA 4WESA 7ABPA 4DGQA 4OKIA 4DV7B 3E9DA 1UP7A 4M54A 4L7QA 5TMBA 4ASUA 1H8HA 2GB4A 4FGSA 4WLNA 1J22A 1C3JA 3FNFA 2Y6VA 3UK6A 2HFJA 3PF8A 3KELA 4Q9AA 3PD7A 3CQ9A 3I5UA 2XMBA 1Y3AA 4NL4H 3IEPA 5JI2E 3UGQA 2FDXA 3P5BA 1G18A 4ND8A 1H3NA 3F2VA 3RVDA 3UHAA 3O38A 1Z7WA 4EPVA 4BLTA 1QK3A 1GU1A 2IPLA 3QMPA 3O4RA 4AF8A 5MGBA 3T1OA 2LW7A 3SZGA 1U9ZA 3UXMA 3A4MA 4LOIA 1GKLA 4F56A 3E1SA 4G41A 1X7XB 4JX9A 4ZP1A 4B3SB 4ND8B 1BXGB 2X41A 16PKA 1UWLA 3G0GA 4RAOA 5KX5B 1SURA 1ZSNA 4QNNA 1N3BA 4IEEA 5BSUA 1SC4A 3HZHA 5CVEA 4ZT3A 1MB4A 1J8VA 2HJWA 1XV5A 2YV3A 4Y9DA 3G8AA 3CCBA 4S1TA 2IP2A 3PP8A 4EK9A 4RQUA 5KSYA 1GSAA 2E7ZA 3HVJA 4BO3A 5JPIA 2FVYA 2R8YA 3IBTA 1GZHB 4FYWA 5JSKA 5BVHB 1N9GB 4F93B 1IN1A 2LTAA 3R5JA 3D7SA 4ESEA 1OLSA 1I2CA 1SBNE 1WW8A 1NVGA 2QLNA 5DTEA 3GR6A 4E14A 1ZMXA 5TPZD 5JRDS 1JDPA 4LPSA 1OPRA 1HXHA 1YB6A 3H9QA 4MYHA 3IT0A 5FL7A 3TS1A 1UBJS 2AYYA 4NYIR 1T1SA 2ZJ3A 4EY8A 4LZNA 1VXOA 2N1BA 3Q2IA 4MQFB 1PP4A 5DMXA 4PCLA 2GYVA 5G1OA 4ZMSA 4KQGA 2YHIB 4JP2A 1PFGA 3S55A 5L51A 4X66B 5EA2A 5JAHA 4BGIA 2FEWB 3TD9A 1MABA 1RZRD 3MJEA 3STVA 4MUYA 4AMVA 3DC2A 4XEHA 3JTMA 3TB6A 4B87A 4LY3A 4WOBA 2C9ZA 2AJTA 5JWRA 5D1NA 5CIWA 3OICA 4KQXA 3EIHA 3E4DA 5A7HA 1W4CA 1FTSA 3CZRA 1BE8A 1YK0A 2ZRIA 4Q6WA 4U2FA 4G0VA 4GYKA 2UYGA 5TT1A 3OTHA 1R9NA 3NTXA 4ETWA 3S27A 4EMUA 1DJPA 1ADBA 2JIZD 2OBBA 1V2GA 4QOGA 1MB0A 3KE8A 4MB6A 4PS0A 4YMIA 5AI0A 3GWZA 5CJJA 5KWVA 4CEIB 2AI3A 2AVNA 2XA9A 4MQ4A 2O8CB 5H3HA 1PFYA 3NH9A 1IZ0A 5CX1B 1I7PA 1KVSA 2AOTA 4QX6A 2YBEA 5T6MA 2ZWMA 3H4IA 3LWDA 3O03A 1KAOA 2WF9A 4LHZA 3EXG1 5DV9A 2BP7A 3C3XA 5CA0B 3WV4A 2HBRA 2JFHA 3QX8A 4HH4A 4ONEA 3GRKA 2DWQA 1TI7A 4IJKA 1KMCA 2ZS9A 3E4CA 4BNKA 2LIVA 1V39A 3AY7A 3NP7A 1WTCA 5ULLA 3UBMA 2CV1A 1YE5A 1QF6A 3Q40A 4MUMA 5DM4A 2QX6A 3KP1A 3L92A 4UUNA 1OYVA 2HRQA 2YN2A 2OZLA 2PS3A 3DTVD 3HFSA 3O0DA 1IZYA 1K4KA 2MSWA 3HY4A 3I8OA 3AZQA 3PGA1 1TM2A 4M1WA 3UFXB 5F12A 4B45A 1C8KA 2HNBA 1E2MA 5IWAB 1EEHA 1V3VA 2ZATA 4KPUB 2H7XA 4K9OA 5FJIA 3DMNA 3T8YA 1F6WA 3SXUB 5BN4A 1R6XA 1Q7EA 3ZWVA 1QIDA 2F67A 3A37A 4YO7A 1Y42X 3WB1A 2XQIA 1MO4A 3LQQA 4EEKA 1OB2A 2PMCA 4RGQA 5LQSA 3EBPA 3JD1A 1XD9A 4ZCIA 4O4LA 4IP0A 4DMKA 3GUZA 2DHDA 2NQ8A 4AXBA 3C98A 2P2ZA 1YDGA 4NSNA 3W0LB 4RULA 4DEVA 1ZPDA 2QAGC 3QUQA 3H5RA 4BRWA 5L3SB 1K9VF 3Q7EA 1IQPA 1FDWA 3WBJA 4ZEVA 4BO1A 1SHLA 5HE8A 3AEUB 1ABFA 2X5XA 3T5DA 4LIPD 5JCPA 1C0LA