3L1HA

Crystal structure of este5, was soaked by fecl3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 101
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1hA00
5EIEA 2CZQA 3I2GA 3QYJA 4G8DA 2WFLB 1YB7A 3OURA 3C6ZA 4ZI5A 3VVLA 4A16A 1QOZA 4ROTA 2AJBA 5AKHA 3HI4A 3HRHA 3WIOA 3RLIA 5JANA 2H7CA 3D59A 3MUNA 1VLQA 5EIHA 2JIDA 1LPPA 5BWBA 2B20A 4EY5A 3C6XA 1OILA 2OAGA 5I8PA 2XUKA 1ZGBA 1I6WA 3I1YA 4UHFA 3N0TA 1FFBA 4X6YA 2QMQA 5AI6A 1LPMA 5EHQA 5ALWA 5LZ5A 2CB9A 3DYVA 1WCYA 4LXHA 1TRHA 5AK5A 4W9RA 1VZ3A 5DYWA 1B41A 1LBTA 4U2BA 3G7NA 2WHQA 5HKBA 3AZOA 4OCZA 1SCQA 3E1GA 2PM8A 2RHWA 5HZGA 4CCYA 4Y2JA 2WJ6A 4Y2RA 5HF6A 4INZA 1B6GA 1KU6A 1ZICA 1XQVA 3C6BA 1F8UA 4H7IA 3V48A 2XUAA 1HBJA 3H2KA 4H18A 1RYYA 3T4UA 3AIKA 4UHBA 3PUHA 3QM1A 5KWJA 3M83A 4KRXA 4FNGA 3ANTA 5HK8A 4JEIA 2JGJA 4PQEA 4AX4A 5IKXA 2PPLA 5DTJA 5JATA 2XQFA 4DSAA 5BOVA 5AO9A 1YCDA 3W05A 1W75A 1LZKA 1JI3A 1C7JA 2QM0A 3JYHA 1K63A 1EB9A 5HF5A 5AM3A 2J4FA 1U4NA 1EVQA 2JF0A 4BCDA 4KAJA 2HU7A 3AIOA 2G4LA 3FBWA 3P2MA 4BB0A 3UUFA 4H7KA 1A88A 1K5PA 5D7BA 4CG2A 4QDUA 1HKHA 4IH4A 1ZI6A 1CUXA 3U1TA 5FPPA 1YAHA 3I6YA 1GPLA 3W06A 3NUZA 3SX4A 1KU0A 5EGNA 1CR6A 2ONCA 4ARBA 3DQZA 4OPMA 3H2GA 4U2CA 5JAHA 2VQ6A 5LIPA 1USWA 3EBLA 1CUBA 4Q3KA 3WQHA 2WILA 5AKIA 1CIJA 3WKAA 2C4HA 1QIJA 4BAZA 4P08A 1R88A 4QWMA 5LZ8A 2ZVDA 1HL7A 1MT3A 3G0BA 2G63A 2CKMA 1ZIXA 4S0XA 3FYUC 4EY8A 4LKOA 1AQLA 3FVRA 2QVBA 4JH0A 4G4IA 4H7FA 1BROA 5ALUA 1LGYA 4FLFA 1ZD2P 1AX9A 3DKRA 4IH9A 4YK7A 1LPNA 4J0JA 4DNQA 1OXMA 3M3DA 4UBNA 3QPCA 4X6XA 1BCSA 2FJ0A 3L1HA 4B6GA 2QJRA 4PSUA 1LNSA 4DNFA 1BU8A 3OC0A 5ESRA 3DDUA 4MWTA 4UBIA 1R50A 2WUEA 3H2HA 4CCYB 4WDQA 2ZJFA 2PSHA 5BV7A 3K9BA 1R4ZA 1YA8A 1UKBA 2GYWA 3IUMA 4X85A 2XMGA 1YA4A 1XZIA 4QEKA 5K3BA 3FLBA 4TGLA 3WK8A 5JAOA 4A23A 5AKKA 1MTZA 1CUEA 1JT2A 3ED1A 4MYSA 4P9NA 4JUIA 3NWOA 1SFRA 5AKXA 1XLVA 3GUUA 4Y2QA 5T4HA 3WYNA 3DCNA 3MUOA 2WTNA 3A2MA 2VF2A 1QO9A 4DGQA 4U2DA 3WKEA 5ALOA 4HXEB 1G66A 3I2FA 1WB6A 1A8QA 4QDZA 2V9ZA 4HTAA 2XQJA 3QZUA 5ALFA 4PW0A 2HIHA 2DHCA 5AKYA 7YASA 4X00A 5JZBA 1AUOA 1G4HA 1GPNA 4OUKX 2OCGA 4WY8A 3PE6A 5CT9A 3LS2A 4H35A 2J4CA 3WA7A 5AI5A 1K8QA 4OU4A 3WWDA 4PSCA 3SC2A 2BUCA 5DTIA 1ETHA 3E4DA 2VATA 2HRQA 3DL7A 4WCVA 4Q05A 4Y2YA 3O4HA 2FUKA 3V1LA 2Y1KA 1EHYA 1CUHA 5LLSA 1CPYA 1UK6A 2EEPA 4H7HA 1E8DA 5C7YA 1E8MA 4OB7A 5JD6A 1UK7A 4H0CA 1H2YA 4EUSA 4AN1A 2IITA 1ACJA 3S2ZA 1BRTA 2C58A 3ESCA 4H7DA 1ODSA 3V1KA 3F96A 4ZRDA 5ALVA 2DHEA 1WB5A 4ZV7A 4Y2TA 4BVKA 1YS1X 3WA6A 1ZIYA 4WFKA 5DYYA 3O9VA 5AK6A 1NX9A 4L0CA 4Q34A 2ES4A 4F5ZA 2Z8XA 1QIEA 2VJBA 4KACA 4W1QA 4MEBA 1O6GA 3PUIA 4E14A 1VE7A 3BDIA 3I2HA 4AO8A 2HU8A 3FCXA 5K3AA 2BGNA 3WYDA 1LPOA 3IURA 4FBLA 4YASA 2CMFA 2YASA 5CXUA 2GBCA 5K5EA 4FFVA 3G0IA 3DOIA 2XUDA 1MX9A 1W6RA 1AMNA 2JGFA 4D9JA 3AJAA 2GYUA 1W76A 4FNMA 5HF9A 1LZLA 5T4EA 2W22A 3F8SA 1CQWA 5AOAA 2AJCA 1CVLA 1QTRA 2JGKA 4BYMA 4DNOA 2BFNA 1QGED 3ZV7A 2ORYA 4PF1A 3BF7A 1LPBB 5D6OA 1H23A 5DLPA 5A71A 3B5EA 3PDCA 2ZYHA 2VJCA 1ACLA 2G5PA 1MPXA 4DIUA 1Y7IA 3H04A 3QPDA 3WK5A 2H7YA 4KE6A 2XLCA 3R0VA 4K6HA 4XX1A 4K2AA 3H0CA 3VJKA 3STTA 3MGAA 4Y9SA 1G5FA 2DQYA 2OAEA 4B81A 4W63A 4BAGA 3O0DA 3R3ZA 3TEJA 5E4YA 1XZDA 1CUWA 2HA6A 4M0MA 5AIAA 1QIGA 4HS9A 1N5MA 3I2JA 4G9GA 4G8CA 3G9TA 4Y2XA 4X92A 4E15A 2QJWA 3M82A 3ZI7A 4TPKA 3H2IA 1YS2X 1JMKC 4CI9A 2XMDA 2BUAA 1XZGA 5CT6A 4RNCA 3BWXA 4QE3A 3ICWA 2QS9A 1CUSA 4GXNA 1MNQA 2OQVA 5KREA 4EB0A 4I3FA 3NGMA 1THTA 1XZCA 4J0HA 3A70A 4F0JA 2PKYX 3LIPA 5E4TA 3PFCA 4M0FA 2VAXA 4UHDA 4FWBA 2QR5A 2PSDA 3H17A 1P0PA 1SC9A 5A62A 4K6KA 2DHDA 4X90A 4Y7DA 4LXGA 4X3CA 4QDTA 1EA5A 3M81A 4JYPA 4DLNA 2QTBA 4N5IX 4BP8A 4Y2UA 3U0VA 2FX5A 4LYDA 4HZGA 3W04A 4K6GA 1ZGCA 3LLCA 4KE8A 2HA5A 3VVMA 5AKZA 3STWA 4UBJA 4PSDA 1JFRA 4C4XA 1XRRA 4EZIA 2DR0A 4B9AA 5AM5A 1BEEA 4UFPA 5KBYA 2X76A 2DFPA 4FDMA 5HFAA 3C5VA 1MJ5A 1ISPA 4EBBA 3UUEA 2JBWA 4BTLA 5AH0A 5AK3A 3ICVA 4GECA 4FMPA 4QLOA 1U8EA 5E4JA 4UFOA 4IQ4A 2HHAA 3KOOA 5A7FA 2GYVA 2XUJA 2XMZA 2O2GA 4DSZA 5AKGA 2WJ3A 4BZWA 3K2IA 3TJMA 4BZZA 4Q82A 3D5EA 5ALQA 1XRMA 1QO7A 1QE3A 5LP1A 2OCKA 5LZ2A 2HA3A 1WM1A 1JJBA 5EHNA 4C87A 2OQIA 2EDAA 1A7UA 2Q0XA 1EVEA 5CURA 2XUOA 1UFOA 3EIOA 1G42A 2DCMA 1W52X 3BE8A 1ZJ4A 4AO6A 4IHAA 2WG1A 1N5RA 2E3JA 4OYLA 1K4YA 3QH4A 4G5XA 4WJLA 5ISMA 4OD0A 4UBOA 5ALEA 3IUQA 2QRUA 5AM4A 3E3AA 4X71A 4EY4A 2Z8ZA 3D7RA 5CT5A 1BS9A 1Q0ZA 4I4CA 5E2IA 3GA7A 4RE6A 3FLEA 3R3YA 2XMQA 1WOMA 4RE5A 1Y7HA 5JAUA 2OGTA 3HC7A 3RK4A 5JADA 5HK9A 2RI6A 3TGLA 3BIXA 1MU0A 2ROQA 3WMRA 1CUUA 3CCCA 1FFDA 3EF3A 2XMRA 1MN6A 4J7AA 1R9MA 2WJ4A 3WK7A 1DU4A 5DWDA 4C89A 2I3ZA 4AMYA 2WIKA 1VXOA 5CH5A 4BRZA 3FYUA 2O2IA 2WUGA 1AGYA 4KYVA 2VA9A 5C8ZA 2Y2UA 2NW6A 4X95A 1AZWA 4ETWA 3E0XA 5ALKA 3UMJA 1R9NA 3F9CA 1PFQA 5LZ7A 5CH8A 3FSGA 5ALJA 2ACKA 3R3VA 5AKEA 2HL6A 1DX6A 1JJIA 3WL8A 1FSSA 3QVMA 1XZMA 4P92A 3IUNA 3KWFA 2WIJA 2X8BA 1LPSA 4UPDA 3L1IA 2PU7A 1ZD5A 1UK9A 1X70A 1E89A 1XRNA 3CN9A 3D2CA 3FWHA 1TAHA 1Q84A 4UBMA 5ALYA 2BCEA 1OCEA 3D0KA 2AXEA 4MEAA 3STUA 2HU5A 5DNUA 2RAUA 1X2EA 2CUTA 1TK3A 2XLBA 4X94A 5F4ZA 1AURA 1J2EA 1DINA 3I2IA 2PX6A 1GKKA 3W9BA 2XMCA 2XMBA 5ALPA 5ALIA 1DTEA 1TIBA 1WHTA 1A8SA 1P0IA 1N8SA 4DNPA 5FP0A 2YYSA 3AZQA 1K6EA 4BBZA 3LCRA 1CRLA 4MQMA 1JU4A 4V2IA 3DJYA 1WPXA 2BAGA 6YASA 2WFMA 1EH5A 1IZ7A 1J1IA 2XT0A 3K6KA 4U2GA 3WK9A 2CJPA 2R11A 4C4YA 1CFJA 4FBMA 4HXGA 5FKJA 4YPVA 2JEYA 3HXKA 3IBTA 4O08A 5AM1A 4QLAA 3VJMA 2JEZA 1N1MA 4KRYA 5FLKA 2AJDA 2PVSA 3FVTA 3HLKA 4Q1VA 5ALSA 3OPMA 1XZKA 5CRIA 2C7BA 3EQ8A 5ALXA 5A7HA 1MNAA 1XKTA 1CEXA 1L7AA 2WQZA 3OM8A 2XQGA 5ALRA 4L9AA 4AQDA 1ZOIA 3ZWQA 1FFCA 1JKMA 2XE4A 3MVEA 5I9IA 1EK1A 1XZHA 4UHHA 1UXOA 4OB6A 2JGIA 3IUJA 5A7GA 4AZ3A 2I78A 4CIAA 1MX5A 4UHCA 3HZOA 1YB6A 1XQXA 4KR0A 3NOXA 4U2EA 2C5FA 2XB6A 1Q83A 4Y2SA 3PF9A 3R41A 5D3ZA 3CCBA 2K2QB 5EHXA 5ALTA 3BDVA 4W1PA 2B4KA 2Z3WA 3H1AA 4B80A 4N8EA 1ORWA 1ZI9A 1UT6A 1EX9A 2VTVA 3C8HA 5JASA 4NVRA 3KD2A 3FYUB 3GZJA 5HFNA 1DQZA 1NU6A 4EY7A 4DMFA 1HLGA 1VE6A 3S8YA 3AINA 3WWOA 1FJ2A 4B82A 2QUAA 3FCYA 4RPCA 2GBIA 1CUIA 5AKLA 4ZWNA 5DNVA 3V1MA 1WPRA 2HA7A 3FSGD 5FDFA 5SYMA 4K5QA 3HABA 3WJ2A 2VJDA 2WTMA 3BL8A 5H3HA 2C5GA 4Q3LA 3QBJA 4LIPD 3STVA 3WZMA 1EXWA 3WKCA 4AXBA 4ZXFA 2R8BA 4UBKA 1WB4A 2FJPA 4BRSA 3JW8A 1QZ3A 3A2LA 5LZ9A 4YX9A 3WJ1A 3C6YA 3DNMA 1XZLA 2XUFA 4X6UA 4J0DA 1TCCA 1E3QA 2EDCA 1SCKA 4X7BA 4J0CA 5AKJA 1R3DA 4KE7A 3WKDA 3DYIA 1JU3A 5AI9A 4BC0A 4C4ZA 2JGEA 5A2GA 4AO7A 1XZAA 4LYEA 4QNNA 3FAKA 4BDTA 4QWWA 1QIMA 2H1IA 3DS8A 3AZPA 3KDAA 2D5LA 1BCRA 3EQ7A 3T52A 4CG3A 2GZRA 1EK2A 2ECFA 2O7RA 2PSEA 4XJVA 2XUPA 3O95A 4AMZA 3G0DA 1QIHA 2XDWA 1ZD4A 4Y2PA 1UOQA 1Z68A 1HQDA 4BVLA 2IIVA 1QTIA 5FRDA 4C6HA 2PUHA 5FOQA 1EI9A 2IX9A 2Y6UA 5AI8A 4B83A 3WL6A 3QMWA 2VSQA 3DLTA 1CQZA 1GQRA 1MO2A 5EFZA 4BCBA 3O4IA 5JALA 3H2JA 4W1RA 4MXDA 2I03A 1DQYA 4ZV9A 1ZI8A 4MWSA 3IIIA 5CT8A 4QA9A 3VXKA 4X91A 3FNBA 4N5HX 4B0OA 3G0CA 4OSEA 1XRQA 4PV7A 4E46A 4OU5A 1CLEA 2OGSA 4P93A 3BJRA 4L72A 2X5XA 3ZLTA 3ANSA 2WM2A 2RONA 2XUHA 1QFSA 5LKAA 1VKHA 1CUCA 3FYTA 4FFWA 2GZSA 2OCIA 5CW2A 4G4JA 3ESAA 2Y2VA 2OGZA 4QDXA 5JZ9A 1QIDA 2G5TA 1QIIA 2QKYA 1CUDA 4CFSA 4QZVA 4LHEA 1IMJA 2HRRA 5FPQA 5CBKA 3B3QA 2BGRA 4X93A 1VXRA 2WIFA 3H18A 4XWGA 1J07A 2CEKA 1E8NA 4OB8A 1PV1A 3QMVA 2WU3A 4JYMA 2WLSA 4NZZA 1WHSA 1ZD3A 5CH3A 5JD5A 4WY5A 1XLWA 4DYHA 5AM0A 1UOPA 3F67A 4G8BA 3HSSA 3BIWA 3H19A 3GROA 1P0MA 2AJ8A 3GELA 2WFZA 5AK4A 5JZSA 2ZJ7A 5A6VA 2VT6A 5LZ4A 3ESDA 2V97A 1HPLA 3I2KA 4M0EA 1QLWA 1XROA 5ALMA 3GFFA 1TKRA 1RWQA 3W9UA 2W6CX 5DJ5A 1VZ2A 3I1IA 2WIDA 4N8SA 1FFAA 1MAAA 1UKCA 2ZYSA 4BE4A 3AILA 1E5TA 1H2ZA 4HVTA 3FLAA 2WSLA 3A2NA 5KWIA 2DQZA 2PBLA 2XI4A 2HFKA 2VAVA 1XZJA 5DNWA 1YSCA 3JWEA 3TRDA 3ZLVA 4BDSA 1L7RA 4EA6A 2PL5A 4WFIA 1EDEA 5DYTA 5HKAA 1VOTA 2BKLA 2JGLA 4HRYA 5EI5A 3HACA 1T2NA 5HCUA 3I28A 4KAFA 1VA5A 4UHEA 5CTAA 3STXA 3R3WA 4UFNA 1BN7A 1QFMA 3SWWA 4GI1A 1ODTC 2O7VA 2VJAA 4RGYA 1CUVA 5CXXA 4UBLA 4GDMA 1S8OA 2YH2A 4FLEA 4XVCA 4FKBA 5AJHA 5K3DA 3L1JA 4GLBA 5JAPA 2ZYIA 3C43A 5ALHA 3ZPXA 4NS4A 2HFJA 1UZAA 4MQLA 3OG9A 4B7ZA 2PSJA 1UOOA 2HA4A 4W1SA 4AN0A 3DL4A 5EHZA 3WI7A 1CUJA 5AI4A 1D07A 3D4LA 3FOBA 2ZSHA 5AP9A 5K3EA 2QT9A 2QXUA 4C88A 4MYDA 5AHXA 4GEGA 3OTQA 3SK0A 3G9UA 1H2WA 4CIBA 2PUJA 4TVKA 1BN6A 1THGA 2QOEA 4NMWA 2H7XA 2WUDA 2OCLA 3O9MA 3OOSA 4G1FA 4HRXA 4BATA 5CT4A 2I3DA 4KJXA 3WK4A 3F98A 2C0PA 2XMSA 1GKLA 1LPAB 2WU4A 1UKAA 4PO3X 5AOCA 4DMCA 3G9ZA 2OG1A 1XLUA 1CV2A 1MAHA 1LBSA 5JIBA 1XRLA 3BJMA 4BTVA 2LIPA 5EIAA 3RARA 3G02A 3CN7A 2WHPA 1FFEA 1XQWA 1F0NA 1H22A 2DSNA 4Z49A 5BWCA 3HYSA 3KXPA 3WIBA 1XZEA 4BAUA 2WIGA 4KE9A 3A6ZA 2HDWA 4G4GA 5AI0A 5K3CA 1C4XA 1XZBA 2GBFA 2Z3ZA 3AIMA 2B9VA 3DEAA 3DKKA 3WWCA 4OYYA 3R3UA 4XIIA 4JNCA 3Q0TA 1KEZA 1AKNA 1Q0RA 5ALLA 4J0IA 5SYNA 3VDXA 5K3FA 4B9EA 4HAIA 4B85A 2HADA 2HM7A 1GPKA 5JARA 4PNZA 4AZ0A 3W2TA 5CMLA 1CUFA 3PFBA 1ODCA 3WZLA 2YXPX 1IVYA 1M33A 2WUFA 4BVJA 1L7QA 4G9EA 5HQ3A 4ZGBA 1EDDA 5FV4A 2H9YA 1SCIA 4WFJA 5T4FA 2WKWA 4C01A 1UWCA 4U2FA 5ALZA 4N8DA 5AICA 1F6WA 3AUKA 5AM2A 4WDRA 2UZ0A 1QONA 1RP1A 3LIIA 4I19A 3ZLUA 4HXFB 3KSRA 4Q3OA 1JMYA 1T4MA 4FOLA 2VT7A 2PSFA 3IULA 1R1DA 1MX1A 4MJ3A 3PI6A 3LP5A 3HJUA 2ACEA 1O6FA 2WG0A 3BF8A 1IUPA 3WWEA 3WWPA 5JYCA 4CG1A 5ALGA 2XUQA 1UK8A 1TCBA 3N2ZB 1E66A 2V98A 3D3NA 3R40A 4DTCA 4E11A 4CCWA 2RHTA 1XQYA 4KAAA 4EY6A 1DT5A 3C87A 3V1NA 2JGMA 3BXPA 2QZPA 3ESBA 1GT6A 4ZREA 3C45A 1EDBA 3IA2A 2VEOA 4H77A 1J06A 3G0GA 1CUYA 2XQIA 2XUGA 1YASA 4B0PA 4UUQA 2V96A 3RM3A 1A8UA 1QIKA 2GBGA 1QJ4A 4GW3A 4GWLA 2WFLA 3VJLA 1IUOA 3RKSA 1SOMA 2BUBA 5J3JA 3STYA 3C8DA 3DOHA 3DD5A 4KEAA 3AFIA 1YR2A 2B61A 2WHPB 3WL7A 3PICA 1CUZA 1XRPA 1LLFA 4GHWA 4DM7A 2CBGA 2Y6VA 5FXMA 1ZJ5A 1GXSA 2QXTA 5I7UA 1DT3A 3C70A 2XQKA 3ILSA 2OXEA 4EHBA 1TQHA 3I6MA 5IVKA 1GGVA 5IVDA 2XUIA 2Z5GA 1ORVA 3D2AA 1DWOA 3IVMA 2AJLI 1CUGA 4H7EA 4IO0A 4L3WA 5LYYA 1HDEA 3QMMA 1GZ7A 1AC5A 2HA2A 1Y37A 1EINA 2RGUA 4QDOA 5AOBA 4BE9A 1DX4A 1IZ8A 5K3FB 5C8XA 5IVHA 2C0QA 4J0KA 3YASA 3WL5A 5ALNA 5YASA 3VISA 4H7JA 4LXIA 1BE0A 4J0GA 5T4BA 4F60A 4BC1A 5HQ3B 2HA0A 1GQSA 1XZFA 1VA4A 3C5WP 1W1IA 3B12A 4J3JA 2ZJ6A 1QIFA 2OLEA 3O4JA 4IH1A 4B84A 3Q8WA 3PF8A 2RIPA 2D0DA 1DWPA 5IVIA 4GBGA 3WLAA 4FTWA 3QITA 5IH7A 3WK6A 2ZSIA 5JD4A 1P0QA 1F0PA 5FUMA 5LKRA 3VKFA 3EQ9A 4X97A 2QUBA 1U2EA 1YAJA 4F21A 4J03A 3I6ZA 3H1BA 5C81A 4FLMA 4DMHA 1BEZA 2P8SA 4A5SA 3KWJA 1TCAA 5C8VA 1DWQA 1PJAA 3IB3A 1C7IA 5AIBA 1VJ5A 5D3KA 1XFDA 4ITVA 3O4GA 4DMKA 3V9AA 3R3XA 5ALDA 1W4LA 3X3HA 1EB8A 3HEAA 2O2HA 1X2BA 4FHZA 1NU8A 1U65A 2OPHA 3GBSA 2J3QA 3F97A 2ZYRA 1JJFA 2PU5A 1XKLA 3D2BA 3G8YA 1IUNA 2BJHA 3IDAA 4BP9A 4BCCA 3QPAA 4Y2VA 2WHRA 5HF8A 2J3DA 1H2XA 3CXUA 4ARAA 3G9XA 4AB1A 3WKBA 1CUAA 2WG2A
chains in the Genus database with same CATH superfamily
1PHRA 1OA1A 1OPXA 1T8TA 3CXRA 1FTYA 3WRXA 1CHDA 5JROA 4G8DA 4HZUA 4KN5A 4B4DA 3C3XA 2BELA 2UV8A 1ZNQO 3KOZA 3QU5A 5GTDA 3OURA 1XLTA 1S4MA 4ZEVA 3HUDA 1FZQA 1PZMA 1X74A 5LDHA 1YQDA 4OTZA 4D8YA 2P4QA 4DC1A 1NLUA 2XXAB 3IUEA 1AH2A 1L3CA 2ODQA 3OCWA 3HI4A 1E2NA 5AKHA 4C0BA 1M34E 1N8NA 1Z0IA 2H2GA 3WNZA 3RLIA 3WRYC 3H5AA 1B4DA 2H8GA 3QFRA 2DUUA 1RWKA 4KZPA 3QBEA 2QROA 2YWJA 3BMNB 3KFXA 4RELA 4F9TA 2QAJA 4BUCA 3PBKA 2NSHA 4UUMA 4AWBA 3ABIA 4HFJA 1M76A 5DZSA 5D5HA 2GTPA 2HWUA 4NABA 4QODA 1TRKA 1DO2A 2OM2A 3BH6A 4I14A 4D0SA 2AOTB 3N28A 4Q02A 2JIDA 4FGSA 3VNVA 1PFKA 5AXAA 1IPHA 2VLBA 4GLOA 2II6A 5TV2A 1E64A 4YIHA 3WS7A 1QJCA 3V4RA 1Q0TA 1V5IA 1VFNA 4CPDA 2Z0MA 3DG9A 4DPKA 3CKKA 2W98A 2XUKA 2VXOA 1ZGBA 4URUR 3I1YA 3N0TA 4BGEA 1KGDA 1SM4A 2VHWA 3OCUA 3RUPA 4BGIA 3IH5A 2ZT6A 3KEFA 4C78A 2PXAA 1THZA 1LPMA 3BDAA 4CR7A 2FOIA 5DCYA 4ZKDA 5C80A 1YC5A 2C2YA 5I7OA 1L9XA 2BF4A 4DV4B 4L4RA 5AK5A 3BGSA 3II6X 3L7IA 3ILVA 3KOUA 5H4HA 5DYWA 1B41A 4U2BA 5JRJA 4LI3X 2G82A 3IXQA 1TECE 4OCZA 1ILWA 4RACA 3KZCA 2PM8A 2RHWA 2VH1A 3AEUA 3L6CA 3TZBA 4OG2A 4YQEA 1U28C 4RVDA 1E2MA 5ECYA 4F5WA 3JQEA 5KTTA 2YW2A 5C31A 1DBPA 1CF9A 1H9BA 4TKVB 4U7WA 3WOVA 4F71A 1F6DA 4U3JB 4CCYA 4WK4B 3BTUA 5T5QA 1P1JA 4AY3A 5HS4A 5HF6A 3JPWA 3AOEA 5IKEA 3N07A 4NYJQ 3AOEC 4INZA 1B6GA 2I7XA 1ULAA 3LL4A 3ND8A 3EQ2A 1FEZA 1KU6A 4MGYR 5GJVC 4DV5B 3QNUA 5HMLA 4NXNB 3AM1A 1VLLA 5C5CA 3TD2A 3C6BA 4A3SA 1SD5A 1MC8A 2JJ2D 4H7IA 1LDGA 3GWZA 3V48A 4RF5A 3FOZA 2HPZA 2DRIA 1ATZA 1NTRA 1YJBA 2NVOA 4FGLA 3TTUA 2B69A 1BMFD 3UAWA 1KP2A 3NAMA 5DX1A 5H5JA 1TLTA 1C7RA 2XAAA 5CFNA 2X9GA 3KAKA 1KAOA 1FSPA 5DYGA 4MRMA 4E13A 2OSVA 5I4BA 3FMIA 3PXBA 2JATA 3NDRA 4B6OA 3BIOA 2Q3EA 2AN3A 3HVJA 3PA8A 3IDSA 2AH5A 3SHFA 1Y9ZA 3CEJA 3U48A 4AX4A 4IF4A 2Q9CA 4ZP1A 2VUIB 1PJTA 3D6UA 3MLEA 2EWMA 4INAA 4ALKA 2GA9A 2MDTA 5AO9A 4D9KA 5CR9A 3HYTA 1KRHA 2AE2A 4OHZA 4XCXA 3W05A 4TWRA 5TIIA 1YF3A 3LX8A 1JI3A 2FSHA 3ELBA 3USES 2PUGA 2GZHA 3VZRA 3QEAZ 1UJ2A 4R84A 4DJ5X 2ZYTX 3VU9A 3MTIA 3FNEA 2E21A 4CODB 1NF8A 2XCRB 5BT8A 1X9HA 3QQ5A 5DP1A 1OXBB 1K0FA 2J4FA 2RSLA 4FN5A 2Z2KA 2ZETA 1T36B 3RPEA 3UA3A 1USIA 2H2WA 2H5JA 4Z4GA 2W8ZA 4JLKA 2HNAA 3UCFA 4YAOA 3IP8A 5KNCD 1L5VA 3O4VA 3QOWA 1A4UA 2Z5VA 4B6FA 2RB4A 4EKNB 5BQOA 2JF0A 4ZQHA 4BCDA 2VOJA 4RPHA 2IH5A 4C21A 4REQA 4FHDA 2ZWOA 3GMIA 4FJ0A 5EPOA 1Y63A 3GBVA 3LT5A 5HRCA 2ZUEA 2G4LA 3SBXA 3H5RA 4IIDA 1W85B 3R7AA 4BNFA 2GN1A 1EU1A 3NC4A 4JZYA 3VR4H 2VKTA 1JHMA 3HVIA 4R1TA 2ZEJA 3RV3A 4CVNA 1K5PA 1E1QA 2P27A 4MAFA 1H94A 1L4HA 1DXOA 1R18A 2C61A 5C8YB 1H2AS 1GFSA 4H6WA 2OZVA 4LGYA 1TUEA 4IXMA 1ODFA 1IONA 3A1EA 3CO5A 3COPA 1GQYA 1UFKA 3K09A 3K09C 3NS7A 3JYPA 3HP4A 2C3YA 3PTZA 4RVSA 4Y1GA 3IQHX 1KNQA 2AMJA 4UQPA 1FUYB 3B1YA 3OICA 1C80A 2IXBA 3I6YA 5AK0A 4ZC8A 4BV2A 4E5NA 3FPGA 3NUZA 5DN6D 1FUKA 5DM2A 1JHYA 1L8OA 1ST3A 1JVBA 4EFDA 1DJNA 3E9CA 4PXAA 1CR6A 3JV7A 1Z6XA 1RRKA 4ARBA 4MOWA 1KEKA 3W90A 4D3YA 3SGLA 2UYCA 1U9IA 4LDQA 4WOKA 5EE0A 3LOQA 3ZTTA 3GLRA 1UPUA 4R6XA 1WB9A 3CX4A 3RVKA 3NT2A 1P9WA 3EBLA 4INJA 3LH5A 4DIMA 4QJ3A 1P91A 3BMOA 1IY8A 1SKQA 3KZKA 5JZMA 1VM6A 2JLZA 5CYOA 4UQLA 2YCBA 3LD9A 5T6BA 3WQHA 1J99A 4OI2A 4MVJD 1M3SA 1X42A 1SCBA 3VZQA 5B7NA 3DBHB 5B4VA 4PG6A 3NVAA 2G1AA 4F92B 3K16A 1YTLA 3MTBA 5C5EA 2F1IA 2P9EA 3QE4A 2AFIE 4PGGA 2C4HA 3WKAA 2AN5A 4XAQA 2NNWB 4YECA 4DSTA 3UZUA 5JJBA 3HYLA 3IBCA 4UHJA 3T9EA 2BZGA 4TXMA 4P08A 2J0VA 3QVTA 3R6GA 4Z8YA 4J0QA 4KPFC 1HNNA 1E4VA 3FHOA 4JLVA 4LUCA 1ZM9A 1OV4A 4E5PA 1QCZA 1U2SA 3BTOA 2EGGA 1QMPA 3KVNA 3WLHA 3ZXYA 3TTWA 1BVHA 3ON5A 1Z3CA 1SC3A 4FYHA 4PLVA 3K70D 4EY8A 3QHQA 1MKYA 3R4VA 4OI0A 1HDOA 4LDNA 1U4SA 4H1UA 5LLTA 1NDQA 3TSAA 2QVBA 1YRWA 4V24A 3UMGA 4DIDA 3UQYS 3V2GA 4AKIA 4AAYA 2GASA 4BMXA 1KI6B 1TB4A 3GHYA 2XA9A 2DFVA 4RMGA 5LYJB 1G7SA 1XCOA 4D9MA 1T9ZA 2VJMA 1UZUA 3ELUA 2CXOA 1GJRA 1DXYA 4OQMA 2DEUA 3AVWA 1KDTA 4LC0A 3NUGA 3EEOA 4JDUA 3I1JA 4CHGA 3CLUD 3HWX1 3NAZA 4HN9A 3RE1A 4RK6A 3UVEA 4DNXA 2IOYA 3GRZA 2QTWB 3B5IA 4XIGS 4J0JA 1JEDA 5E1OA 1JPVA 1AKMA 1CJKC 2NVUB 3WLKX 2XBMA 1XZQA 5KQMA 1FDRA 1XF1A 5KDDA 1C3XA 4UBNA 4HGOA 5CLFA 4HWSA 1ZJWA 2Y1LA 1BCSA 5K1ZA 4EG7A 1D03A 2GD1O 3GN1A 1XZ8A 4D82A 3LFHA 5BW5A 1T5LA 4ERXA 1PVOA 2C9ZA 1GNSA 2LCQA 3TLZA 1Q0SA 1TM5E 2YXDA 3MRTA 1LNSA 1XTRA 1MABB 5AD1A 2ZANA 4HLDA 1DPFA 5JVDB 2J6CA 4FCWA 1C2TA 3HYNA 3LT0A 3TLBA 1QGUB 3KR0A 3CZ9A 5U4QA 3SI7A 4WDQA 1QQ7A 2GCOA 1DZ3A 2PSHA 4CMKA 2PYZA 5IRCD 1R00A 2JAQA 5JCZA 2Q2WA 4YRSA 4H3VA 2VPWA 4X85A 1H3NA 1XZIA 1OLXB 1P2GA 1YVUA 3AJDA 3P2OA 4FCCA 4QEKA 4TGLA 4UD6A 3SM3A 3WK8A 4C76A 1NVDA 2R6CA 2ZSDA 5ARBA 3VHXB 5JAOA 1I6KA 4I4TA 1J2RA 2RGWA 1MTZA 3O2JA 3TL6A 1CUEA 1W73A 5F1YA 3T38A 3SN6A 4DUYB 2MYNA 3A28A 4CKZA 1RQ7A 2P9FA 3JQGB 3L0PA 2GJSA 3LUCA 4O2LA 3MILA 1TTQB 1UAGA 3DAGA 1SFRA 3MYRA 3NWOA 2JD1A 1LA2A 3OF2A 3A9VA 3OQIB 4PC7A 2Y0BA 5EN4A 3GUUA 4LF6B 2P0YA 3EHEA 2CD9A 3K32A 3MUOA 1W8IA 3QOFA 4FMDF 3MJHA 3ZNPA 4IEIA 1JS1X 4X6LA 4NLLA 3ZV6A 4PZEA 5JXIA 3M5WA 2PMDA 3QRWA 3K9FC 2IS2A 4XUGB 5IJ9B 1SIOA 3M6WA 1D1QA 2FY8A 4WE3A 1QF7A 2GQ0A 3OAAD 1G66A 2JPDA 1MT0A 4TYPA 1CR4A 5TB5A 4DADA 5MFPA 3T4XA 2D8AA 1ISMA 3NHRA 1OXVA 2FX2A 3NUQA 5JPDA 1W4ZA 5BOSB 3UJ8A 1QE0A 1XXLA 3QUBA 1W93A 1A97A 4RXMA 4XIYA 3W5IA 1H0KA 4F6CA 4NBTA 2Y0EA 4BEBA 3UW1A 1M2KA 1T91A 4BVBA 3IKVA 5AKYA 4YEDA 4OSOA 3SOZA 2HPHA 2NSDA 3PCTA 2LIVA 4RD1A 4MA5A 1P6UA 3VYRB 4IIJA 3DOFA 1F0KA 3ILXA 3CLKA 3AXTA 1YBFA 2GPSA 2ZWAA 1AUOA 1TZ2A 2QR2A 4RK5A 3JYQA 2NUTA 1KEUA 4OUKX 1S6YA 1KJJA 1XV5A 3PE6A 5CT9A 1OKKD 1E1QD 1X1TA 1X8LA 4H35A 1G41A 3DGEC 4E5SA 4G1CA 5TQ0B 3AJRA 3GLIB 5AI5A 1QH0A 3TAUA 1CEQA 2GZAA 3X43A 4BVFA 2HRZA 4PSCA 2BGIA 4GAEA 3UJBA 2VQSA 2IHYA 3EGWA 5DTIA 1ESMA 4K8OA 5EXEA 3QKSA 2VSYA 4US1R 5BMVA 1WS6A 3QOYA 1ECPA 2JS7A 1QTNA 4WCVA 1FP4A 4Q05A 5LBIA 3GLFB 3RU2A 3O4HA 1QU3A 5TJ9A 1DUIA 3MMPA 2Y1KA 1EHYA 1H6DA 1RI4A 5G41A 3V1LA 1UCFA 2BT4A 3SSAA 2BHLA 2PZLA 3H9GA 1RS0A 2DE0X 3NR2A 1V3VA 4IY1A 1LJUA 3OEYA 1SU7A 2I6QA 3DAOA 5EWJB 1FU4A 4EJSA 1C1YA 3A7DA 4IJQA 2VHEA 1E8DA 4FSDA 2SBTA 4L28A 3SYNA 3Q4GA 4DWOA 1DKUA 4ZVSA 1UK7A 3I37X 4UZEA 2ZCVA 1WMAA 1RHRA 1XVIA 4FFBB 2W2NA 4QOIA 4RL4A 4RCYA 4BN5A 1JDTA 4EUSA 1ZWLA 3BA6A 4H17A 2BR4A 521PA 1DJPA 2H06A 3H87A 4KL8S 4ONEA 1PUIA 4JUDX 4HRAA 5K0ZA 3MLBA 3NFRA 1XTPA 1YDEA 4GFDA 1BRTA 4ABTA 3TZCA 5IBCA 1WTCA 2RD2A 4A1FA 2IOQA 1NVBA 4HVAA 1L7PA 4YRQA 4QEZA 5TPZD 2ZYAA 3QSYA 2H48A 4CM9A 4FUTA 4F9GA 5HP4A 2A1UB 2HCTA 3AW9A 4CUKA 2BFEB 4ZGGA 4LXYA 4Z9XA 4N0DA 2EVWX 1QGOA 4JC4A 4OJYA 1WB5A 3AQ4A 2EKDA 4BVKA 4D4MA 2CNBA 4WZZA 3HDVA 4TMVA 3RFFA 5CIQA 4P32A 3UM9A 4WFKA 5HJ5A 5UKDA 4MPDA 2P7IA 5F3RA 4M86A 1RWNA 3PFNA 3IKMB 3BWVA 1UH5A 3TOSA 4U7HA 4YFVA 3Q1KA 3DPIA 2AYZA 2CLHB 2VSNA 2ES4A 1DV1A 1BGVA 3TOZA 3ESQA 1HORA 5A6SA 3O2SB 3NYRA 3OMLA 3FRIA 4J90A 3ZWVA 1G8HA 5FORA 4KACA 2X0NA 4GZ6A 5KYUA 5DHPA 3A1UA 4WFQA 2ZJ4A 2WOOA 1W87A 1S2DA 3IO5A 5F5NA 2E4UA 1CS0A 2XRZA 4PX2A 2H54A 4DABA 1UBFA 4P2GA 2P9GA 3IBSA 3KSUA 2DETA 2DJ5A 3IHWA 1FK8A 4FGKA 4F5EA 5K9ZA 1UZMA 4JLDA 4ROSA 1SUDA 4INOA 4IGKA 4WXHA 5K3AA 4FYVA 1LPOA 2OXFA 5AR1A 4CF6A 3LG2A 1JQBA 4MW1A 1RHMA 1CVIA 4GMHA 2CMFA 3T5TA 5BRJA 1S9HA 3E8MA 1F14A 1G8MA 2C9BA 3KUKA 2CL6X 3UMVA 1QR2A 3OIGA 1L4BA 1XP5A 1DJOA 3EPPA 1A7KA 1P60A 1ZESA 2H51A 4RFSA 3RU3A 5K5EA 3P8ZA 2HUNA 4KXVA 3EPKA 1MX9A 3TGWA 3L5OA 4UULA 3UYKA 2IV7A 2HRDA 2O5VA 4MCHA 4D9JA 2YWXA 4ZZ3A 1GTSA 5EEGA 2L19A 2MR5A 4HNSA 1X7XB 2ZUFA 2WJYA 4FNMA 2DH5A 2B5WA 3LBHA 1RWOA 1NN0A 4UU0A 4ZVTA 2AN1A 3VR5A 3F8SA 4JU9A 5F9FA 5AHOA 1CQWA 1W4CA 1EPUA 3D8SA 3DYBA 2SKEA 2ECOA 1BA2A 2IBMA 2FPLA 1VPVA 4KHZA 2PV0A 4D96A 1RVV1 1QTRA 3CPSA 1BMTA 2J9FB 1CQPA 3BRWD 3W5HA 4DNOA 5K0GA 3PQ6A 2GYYA 2RBGA 1GDHA 3K05A 4J3FA 3WMEA 1JIQA 1ZNWA 1C8BA 4JKYA 1MIHA 1M74A 3MFQA 4X64B 1N6RA 1QGED 3GPCA 4I50B 2W83A 4PNEA 2JFYA 2VDNB 5ENDA 4HG2A 4UM8B 1PJZA 1RI5A 1W6UA 4LN1A 3CX7A 1OF1A 5DLPA 4DLLA 4ES6A 4QOEA 5CGZA 5HMMA 4CV3A 2F59A 1QK3A 1Y7IA 1YCFA 2CF5A 4L5YA 4MYCA 4PRZA 2FQWA 4G0PA 3DWFA 1HSOA 4LRSB 2CFSA 4B34A 1Q2UA 4C7BA 2X86A 1OQAA 1W88B 4XGQA 3PB3A 1QORA 5CPBA 4WERA 1X9GA 4PZ0A 2XLCA 5AHWA 4HMPA 3DLIA 5GZ6A 2ERXA 4NFLA 2QRMA 3ROMA 2C04A 4PCUA 4PLWA 3CZPA 5H1YA 1QSGA 1NBIA 3AETB 4HLNA 4K2AA 4I6GA 4XX1A 3HSKA 4P0PB 1SU8A 2PZMA 2LCFA 1RACA 3H0CA 2IS1A 2EWWA 5EUCA 3LF1A 4D7AA 4FB5A 2PXXA 1C7FA 1G5FA 2OA0A 3J80A 8ADHA 1NHGA 1E7RA 5DTEA 4BAGA 4MJLA 1DFHA 4OAOA 3OJWA 3TEJA 4CJXA 4IAOA 4IXDA 1MAUA 2B1RA 4MJ7A 1Z38A 1Q0UA 3KL4A 2X9NA 4R40A 2EGUA 5E4YA 5J4YA 3AIIA 5KVSA 3L8FA 5ICFA 3U56A 1T25A 4OQLA 1Y3DE 2B0JA 1P8JA 2C92A 4I08A 2LZ0A 2QRQA 4M8SA 5HIAA 4I46A 5FI1B 1P4RA 1GUYA 1E2QA 5AOVA 4LJ9A 1W0CA 4KOEC 1SNYA 3L43A 3QBTA 4D6YA 3N6XA 4DIFA 1ZU4A 2HSJA 4BZPA 2AF4C 2NU8B 4E2YA 4G8CA 2E48A 3JRNA 3PFWO 1FUUA 2QY9A 4UEOA 4PZPA 4Y2XA 1UKEA 3ISJA 3K6RA 1W5TA 5B3JC 5ICGA 4YJ2A 3W5VA 2R6HA 2J59A 2H92A 2DY0A 2HBYA 3BXOA 3MFYA 3RR2A 1Z29A 3UT5A 3Q6MA 3U4IA 3NH6A 2PRYA 4TOIA 4ZICA 5AQ1A 4TPKA 4AF8A 1NGSA 1ID8A 4B4UA 3UN1A 4TXNA 2FG5A 1YR1A 2ZR0A 1ZQ1A 2J3HA 3R23A 1QHXA 1D0SA 2ZBPA 4YAWA 5DGDA 4CI9A 2AOVA 3OZRA 4DSOA 1VJ1A 4IIFA 4X3PA 2N0SA 3DWIA 4HT3B 4LJ8A 1SKYE 2DM6A 2Y99A 3UMRA 1CQJB 1DRVA 3QE3A 3VA7A 1FTWA 2NUBA 1Z0SA 1FRZA 1JW9B 5A4KA 4HHEA 1DEAA 1RNLA 3ZGLA 1JA1A 1JLKA 3D8RA 5L3SA 1F6BA 4U9UA 4AW9A 2YOGA 1EGAA 3AH8A 4M7RA 1NURA 2DWUA 1R12A 2R68A 4ASUD 1BD4A 2OV1A 3JSXA 4GXNA 4KRGA 1AK9A 3PQ3A 3DOOA 4HQNA 4MWOA 5HJ2A 3UWMA 5DTRA 5KREA 1W36C 1LTKA 2Y8EA 3HBMA 3UJ9A 1V7ZA 2WJVA 2ZRJA 4ALLA 1Y6JA 2A4KA 3EOAI 4XM1A 5DSTA 3NM4A 3S7ZA 2F17A 4G5SA 1WWKA 2AR9A 6NULA 1ITZA 2PQ6A 2OTCA 4OP3A 2G40A 4K6FA 1FDIA 3S68A 4Q47A 3SYRA 2CLMB 1WOYA 4X54A 5KYWA 2Q5OA 3HWWA 4RV9A 4RJIA 1M1XB 4J0HA 4QO7A 1PBNA 1L6IA 2I1WA 2P35A 3SEAA 2CJWA 4XTRA 2PKYX 8AT1A 3T3OA 4BO4A 1N1EA 2OBMA 3QVOA 4TZTA 2PH1A 3PLRA 3GG9A 1U6KA 3PENA 1Z8DA 1MRNA 5FWYB 4TYQA 5E4TA 3DZ8A 4I9NA 5EJ5A 3PFCA 3FOEC 4M0FA 4YI5A 2AHOA 2RGRA 1PQUA 5CM8B 4JKIA 3ZX5A 5CG2A 4NFHA 3FIUA 2QR5A 2YV5A 3B3JA 2BP7B 4BS9A 3ZH9B 1DE0A 4DPMA 2GCIA 1ULTA 3KUXA 4MDYA 1SC9A 3ACDA 3E48A 3P9XA 5A62A 2XNKA 3KJIA 4ME6A 5AHKA 1N6IA 2DHDA 3AY6A 3AWIA 3EPLA 4Y7DA 1YXMA 2X8WA 4LXGA 4EHLA 4EPXA 4QDTA 3TRHA 1Z5ZA 1EA5A 1EFUA 4Q4AB 2JI7A 3HCDA 3IQZA 4RD3A 4LV6A 4N5IX 4BP8A 2FG7C 2XXBA 4WBXC 1QRUA 4LV5B 1E1YA 1U1GA 2G71A 4TSFA 3U0VA 4EUEA 2FX5A 3RHSA 4PAMA 1G20A 4LYDA 3T9BA 3OEHA 3LO5A 4KXUA 4GDFA 1CX9B 1M2HA 3FOAA 5KQPA 1C7ZA 1ZGCA 2CHVA 3LLCA 1OIWA 4FPXA 3R7WB 2JH9A 4EJ6A 5IT9A 5EZ5A 1MIOB 2VG8A 4PSDA 5D51S 2XGJA 5DISB 4QTTB 1EP1B 2PX2A 4YALA 5KOJB 5JD3A 2DFNA 4RY0A 2QTGA 1C8VB 3KVOA 1WMEA 3F5MA 3GLVA 4MA0A 4EKIA 2FCRA 4XWKA 1DKPA 4RO0A 2XOXA 3BE4A 2JGDB 2IH4A 5EQFA 1GFZA 3B51X 1O94C 1BEEA 2QT1A 1Z82A 3F6YA 1U8ZA 5HS6A 3VR5D 5K7SA 3P0EA 2VK4A 3N2KB 4PQFA 2C2HA 5FYDA 1K4KA 1ESEA 1ZO8A 3OCVA 5GONF 3AHDA 3DFIA 1PE0A 2CDCA 2CWDA 1WUHS 2R85A 2NWQA 3B53X 3GCZA 3AFMA 4TL9A 2DFPA 2WU0A 1K7CA 1DBWA 2CMGA 1Z4NA 1A8PA 1WL8A 2IEGA 2QRPA 2Y3IA 3DBVO 1ISPA 1KMIY 1RWVA 4IJWA 3UB4A 4V0ME 1QYWA 1WIWA 4NFYA 4A2PA 3DXZA 3F9IA 2C7VA 3RWMB 3UUEA 3Q7SA 1D1SA 1XYGA 4R8KA 4D97A 2ZXUA 3ICVA 5B7QA 4GECA 3DWEX 3LPDA 1HEIA 2I9KA 4QLOA 2GESA 5IANA 4W5RA 1ZM7A 4C6TB 1QK4A 3JQCA 5HQTA 2HHAA 1MCZA 3KOOA 3NEPX 4LPKA 5G1NA 3T0FA 1BU5A 4YJHA 1IXYA 3DBLB 3LW8A 1ML4A 5CNKA 1SEPA 5IKOA 2NM0A 5IEBA 3FBGA 2UVDA 4DVJA 2G36A 5EE9A 2O2GA 5I7RA 2FWNA 1R6DA 4DDWA 2OCAA 2OWDA 2ENUA 5AKGA 2WJ3A 3D2LA 2PGXA 4G6ZA 3K2IA 1RPTA 3D3JA 5T3YA 3PNSA 4W7HA 1JF8A 3KNZA 4RPGA 3TJMA 1E1CB 1M7GA 1ZRNA 2XIJA 4L5AA 4UDXX 1J9EA 4BZZA 2VBCA 2LRHA 5B5SA 3HWSA 4NOKA 1WW8A 4Q0MA 4DLAA 4FYYA 3ONEA 2ZE7A 3ZCVA 4YAKA 4BUJA 5LP1A 2OCKA 2XSZD 3FDIA 1E79D 3ER6A 1NNLA 4ZCTA 3C85A 3W8FA 4CQJA 2R8XA 2FGJA 4D5EA 1V6SA 1I5EA 1P9LA 2VDPB 2LKDA 2XWQA 3E22A 3RC2A 2M32A 5D5PA 5KHAA 4DCOA 3FTEA 4R9UC 2AQIA 5DLDA 4B44A 4QGHA 2Q5HA 3MWYW 4D4KA 2V1XA 5E0KB 4TLDA 1KHHA 1OAAA 1J0CA 3GJRA 3Q6NA 4BNUA 1U1FA 1UM9A 1JHOA 1KVTA 1NBME 1L3IA 3INYA 1A7UA 4KYIB 4S35A 4EA6A 5K20A 1EFDN 2PGLA 4NPHA 2PUVA 5LBTA 4A2WA 4AP6A 5GPBA 5A9RA 1LK5A 4JQSA 4W8OA 4DRZA 2P79A 1ODLA 2PA0A 2QW8A 3TIIA 4TSKA 4D8TA 5EJGA 3IO3A 4RQTA 5CXSA 2NO9A 4AZWA 1N33B 2VC2B 1PUJA 3BFXA 2D1SA 4BMYA 1G42A 1JBEA 3FSJX 1GR0A 3Q3VA 4QARA 3R5JA 4DKJA 3PNVA 1PNVA 1ADBA 2FR8A 4NU0A 4CL8A 5AUPB 2DXIA 2FR8C 3PSAA 3EASA 3HWRA 1X7YB 5DNEA 2ZRGA 2M6KA 4DA8A 5E7JA 1G3UA 2BTOA 4YS6A 2FR0A 4OYLA 3WDKA 3QEBZ 4G5XA 4WJLA 3MRXA 4ZXPA 5ISMA 1IATA 4M1OA 4OJNA 5ALEA 1JZTA 3U3MA 2B2CA 1BFUA 2I55A 2O0KA 3DTVA 5AM4A 3CNHA 3K73O 2KYRA 3DGFC 5E6SB 2YWBA 3SIPA 2PWPA 5KSOA 1M54A 1PVVA 2EAUA 4NZNA 1DQSA 3ZZ1A 2TMGA 1JAYA 3U4CA 1ZH2A 2Z8ZA 3CH6A 5IF3A 2VEDA 1O58A 5CT5A 5FUVA 1JPJA 3U1VA 3TIXB 3ZTYA 5E2IA 5BVGB 4PPGA 4YJGB 5ERYA 4CUZA 3LBAA 3FLEA 3H9UA 3RUCA 1Q11A 3NBUA 2CXHA 3R3YA 3N86A 1WEKA 4X1IB 1IBCA 2XMQA 2HQBA 2HIMA 5F2KA 4RE5A 1OVGA 4QNMA 1T6YA 1JQLB 2OR3A 5SZIA 2IYUA 5TT0A 1I8TA 2OGTA 4AS2A 3N1UA 1IAQA 3K3PA 4YDSA 4BUZA 2EFJA 3VSAA 1BG6A 3T5MA 3FGPA 1XDDA 5U4XA 2VJQA 3VPFA 1BHSA 3QEMA 1CC1S 1F2DA 1XMVA 1P44A 3HN7A 4L8GA 2CXRA 4PY2A 3E53A 2ZBVA 3RNOA 2ROQA 1YV9A 3EISA 3ZHOA 4DYDA 1CUUA 2Y93A 1ZS9A 3G8AA 3G2PA 3MXOA 4WN9A 1YR6A 1EFCA 3DEJA 4R9RA 1NVTA 1PWXA 2ZDHA 1THMA 3EF3A 2XMRA 4OMCA 4TWIA 3FOWA 1J4AA 2PZBA 3LUFA 2ZR7A 3ANXA 3V1YA 4TZ0A 2OP0A 4J7AA 3PFGA 3PC6A 2ONZA 1TJ5A 4J43A 1X3LA 4DQUA 2WJ4A 3EH2A 2LBPA 4MUIA 3UOAB 1PT5A 2YVQA 4DMLA 5BXYA 5ICSA 5G0UA 1K0UA 3QENA 2DPHA 4N40A 4NZ9A 5DGCA 4QECA 4KP7A 4UEQA 4AMYA 4QUAA 1GADO 4V1CI 3JD2A 2NZWA 4V3CA 4BXOB 2J31A 3H16A 2AT1A 2BEVA 2BFDA 2FMUA 5G4KA 1NKTA 4YRPA 5PNTA 5KCZA 1H42A 5KNCH 3KHSA 1S2GA 3WGTA 3RIYA 4BRZA 4KPGA 1AGYA 2IY7A 3E27A 3OZXA 3DVQX 4DR4B 2J6BA 2CFTA 1UMKA 1P73A 2RJ3A 5JSUA 3DE6X 4GBED 2RBEA 2NW6A 2FI1A 2OFXA 3BPSA 2I0FA 1XDSA 3CUSA 4LXXA 4BMZA 3IP7A 4GKVA 4C1BA 5LOVF 3DV0A 5DNAA 3WGHA 1HSZA 1SVWA 4X95A 3BN3A 4A36A 2BIFA 3C8UA 4DV1B 3E0XA 1WCWA 3UMJA 5EZQA 1F4VA 3F9CA 1PFQA 3JCZA 4PC1A 4TSFD 5T64A 5CIYA 1Z47A 3VJRA 3V8QA 1TF2A 3B5JA 3B52X 1RIFA 2Q4TA 1DUVG 4X45A 4LVOA 1U2DC 2SCUA 3CSDA 3OY2A 2ZBEA 1RRGA 3PHIA 1GA1A 4R54A 3WL8A 5C5IA 3DR5A 3MJFA 3TNYA 3U4QA 1KO1A 2W6JA 4DDVA 5CFQA 5I4CA 5DX0A 4RKRA 3QF4A 3GEIA 1IRXA 4H6VA 3S40A 1RKVA 5IDQA 4FDTA 1VLZA 1L4UA 5I47A 4R1MA 1SIBE 2RFLA 4R6WA 2DR3A 3RDPA 3RUDA 3T7IA 4OH1A 4JVOA 3VH2A 1N4DA 1P1HA 2YJ5A 1OBVA 3L4BA 1AZTA 4LBWA 4D4LA 4EY3A 4RVCA 5EINA 4UBMA 5ADWA 4PZLA 5WRFA 3VTFA 4FDUA 1V8ZA 3D0KA 3EQ6A 1GLNA 3SQWA 2D2VA 2H4XA 4MEAA 3KT0A 2OBYA 4LJ4A 3HB0A 4HWRA 4PCVA 2E7ZA 3R7BA 4PAGA 4EHIA 1YZLA 3MJDA 4HDMA 2CUTA 4CI0B 5FTLA 3W5SA 1KZGB 4TN1A 3WTCA 4X94A 4X8OA 1AURA 2ENWA 2P7HA 3BRCA 4C6RA 3C41J 1JVNA 2X0JA 2WVGA 3EFEA 2RGXA 1UEXC 2QTTA 2R5NA 5DIFA 2Z2JA 1GT91 1ZXLA 4LWOA 4CKCA 5TEWA 2JLVA 1WULS 3W9BA 2YQ5A 1PGNA 5BURA 3TMKA 2XMBA 3GFTA 5ALPA 5ALIA 1DTEA 3COWA 1QLJA 5KC9A 3ZJTA 1RJEA 1ESZA 2NU9A 2B1QA 3AUFA 4R2JA 4Q4HB 5CHEA 1JFVA 1N8SA 1JFFA 5JLAA 1PGQA 5T67A 1I32A 1Z0UA 3E9YA 4OHWA 4NENA 5BV2P 1CRLA 1FLVA 1OZFA 2BWJA 3FWYA 1U8UA 1WU7A 4MCJA 1U7WA 1PR3A 1P29A 5FL7A 4DILA 5HZMA 3IOYA 4LQ4A 3N58A 1VHLA 2ZK7A 3VDQA 5JTTA 1JU4A 3AV0B 6ADHA 3GVIA 1IBLB 1AS0A 2QLTA 1XKXA 5SYAA 4JI6B 4GP6A 2R1TB 1WPXA 3W5CA 1RPZA 1LH0A 3KQYA 1NPTO 1ISHA 1IZ7A 1EXNA 1FQKA 2A9QA 2VDVE 2GH1A 4J0FA 1XPJA 1BHQ1 4Q9KA 1J1IA 2XT0A 4GXQA 1MC1A 3K6KA 3T0IA 1BRMA 1BJTA 1Z35A 4K3VA 1GV1A 3O8CA 3WK9A 2R11A 1RR6A 2PX8A 3OECA 4ZOLB 4JFAA 2H5LA 4FBMA 3Q7IA 2CFCA 5FF9A 5FQOA 4D9GA 2P6OA 1I2MA 4LHXA 4ND1A 3WLJA 4YPVA 1N77A 2YJ4A 4DQDA 4CLRA 3HXKA 4P3KA 1UANA 5AW6A 2AF3C 4E09A 2QVGA 2BEUA 4X65B 3N2IA 3D81A 2OLJA 3ODPA 3EVEA 1CRPA 1T1EA 1Z0KA 5K0SA 1K8RA 3GOHA 2DQKA 2F90A 3PGJA 3IBFA 4GXRA 4KQMA 4RH3A 4BFZA 4KC0A 2FFHA 4UTZA 3G2MA 2QY6A 3WHIA 2PVSA 4QTYA 5BV0A 1DC3A 3HLKA 3NOQA 5IS2A 2HPVA 3PL5A 1TJPB 5CRIA 2I3BA 4B5LA 1WXFA 2X4LA 2AFVA 4UUAA 4HMOA 1PEYA 1IQRA 1Z22A 1ZC4A 1OLUB 3BH0A 3FZEA 4MRRA 5EJMA 5FCDA 4UU8A 4ZYTA 5A4AA 3ZDDA 4KBFA 4MZDA 5T8KA 3RS5A 5A7HA 1Z7GA 2NZVG 2IE8A 4O59O 4QUJA 2FW7A 1MNAA 4YUVA 5DNYB 1RMYA 3A4NA 2GK4A 3EVCA 5FI3A 5SZJA 5GADl 2IEDA 5ALRA 3QV2A 1GUZA 4S1PA 2OB2A 1JEQA 4OY3A 1I94B 3I9MA 2I6FA 4AQDA 1ZH8A 4JU8A 1FFCA 1JKMA 2XE4A 2CLDX 2P6MA 3C7AA 1KSHA 2Q3LA 3A9SA 3RS9A 1F38A 1MB0A 4JLJA 3WNDA 4ZHQF 1E32A 1Y6RA 3D3WA 3D4BA 4QDKA 4U7FA 2ZUDA 2EIXA 3N2GA 3BYZA 5JJLA 1U0JA 1M5TA 2HYDA 1GSIA 4IKOA 4A6XA 2PR2A 3DZKA 4OV6B 1UXOA 3TLYA 4LOLA 4MPRA 1OX4B 3TCXB 1TPYA 1F8FA 2NZUG 5LFAA 2Y66A 4Z4FA 2FW1A 4AZ3A 4HVCA 2WK1A 2GILA 4RA6B 4PIVA 3TI7A 2AN4A 4NARA 5F7OA 1TU3A 3N75A 4JY7A 3WLFA 4AMUA 5HTKA 4B1FA 2YFKA 4X84A 4QKQA 2XYRA 3AM4A 4MW5A 3AVOA 2YWDA 2DB3A 2I66A 2DC1A 2C5FA 2XB6A 3OCCA 3F74A 1E3DA 2AW5A 2FPXA 3LXXA 4Y2SA 1EFPA 4DLUA 3LVQE 3KO8A 1XX6A 4IXTA 3L6BA 1KYIA 5AQEA 1XUOA 2Y1FA 4JJGA 2HBRA 1NRXA 2OZLB 5EHXA 1BS1A 3B13B 3BA1A 4KITB 1GAEO 2NVWA 1DEKA 2NPIA 1KI1A 1X80B 1I7LA 3DDWA 1QUFA 3T5DA 5CXQA 3EXG1 1ZISA 1PR0A 4CDNA 2HOQA 3D31A 5C4MA 1RLJA 2Z3WA 3AJ9A 3KKKA 1GNRA 5EERA 3N0WA 4N8EA 4NP6A 2ZPAA 1FS5A 4AG5A 4TS1A 5KI6A 4ISBA 1G5TA 1ZI9A 2QBYB 1EX9A 4RHEA 1KYZA 2A5GA 3KSMA 3M2PA 4G85A 5E2BA 3TFWA 4MUEA 3OPYI 1FRNA 2VTBA 4PZZA 3W5JA 4QVIA 2AXPA 5DLYA 1RHUA 1XK6A 5ULLA 5FWDA 2P6RA 4ZYXA 2DWPA 3LP8A 1RXUA 3EW9A 4EAQA 3ADPA 1SUEA 5HFNA 1J7JA 2QUJA 4RV4A 4EY7A 3QVSA 4XYMA 2FP4B 1Q1NA 2HQOA 3E3OA 1N75A 4FYWA 2MMCA 5KJEA 3SC4A 5F9MA 3LFTA 1AUXA 4RPKA 1N34B 4XFDA 4BLWA 3OM1A 2VDKB 4GOXA 3FKQA 3B9QA 4TS4A 3CNLA 3RRXA 4MP3A 3X2SA 2IV3A 1TLFA 1GIAA 5EEHA 1SZDA 3ZWOA 4DF3A 4CCSA 3V1MA 4IOKA 2PNFA 4LF8B 3KWLA 1D4AA 1H4SA 2PCJA 2ID8A 3KUDA 4M22A 3NP7A 3P4YA 3BFJA 3IT1A 5F9HA 4N0QA 4LW8A 4BMSA 1FTNA 1H85A 4OGLA 2VCHA 2AI2A 2D06A 2FFAA 3B3GA 2G08A 2RDMA 3CNQS 2ZYVX 5EP1A 1O7JA 5HG0A 1TYEB 4TVOA 1Y82A 1OZAA 2FPGA 1LVUA 1ZVJA 1LX6A 2V8OA 1RWMA 2Q2QA 2QTRA 3AOGA 3K72B 3MWFA 4UNPA 3W5UA 1Z2AA 4GQBA 4RW0A 3DEIA 1XEXA 3H5NA 1R10A 3ORSA 2JIZA 4Q3LA 3FCEA 4XEHA 3CHYA 4XGKA 3AEXA 4YRTA 3VHRA 1EXWA 5C51B 2ORED 4U9HS 1CERA 2C9OA 1SXJD 2Q50A 4LNUB 4REOA 4WNIA 4ZXFA 1PG5A 1B74A 3EIUA 3R5XA 4LOKA 2Q3BA 4UBKA 4JI5B 2H18A 4R3NA 3EDOA 4DCNA 4KAXA 3JW8A 4YMVA 5H70A 3Q41A 1DQPA 4NPCA 1LFDB 4HX5A 1SVSA 4HNGA 1Z18A 3WJ1A 3HJCA 4YX9A 3C6YA 4NCBA 5B6IA 4CIXA 1YS7A 3OP1A 1BJKA 5B30A 5C9ZA 1CTQA 1HQYE 3AERA 4UCWA 3QKRB 4HQKA 4W9NC 4YONB 5J63A 3NDIA 1E3QA 4E5VA 4NV0A 4D92A 5HGXA 5FAKA 1LLDA 4EB6B 1GUAA 3K8OE 3RGGA 3PFFA 1K5HA 4PVCA 1XSEA 2ZTUA 1FP1D 2ANCA 1KQNA 1E3TA 1Q1AA 4M0LA 3K0FA 2HR1A 4B2LA 2I2XB 1BWPA 1R3DA 2X6QA 5ICEA 5KTNA 4FHEA 1JU3A 1KYYA 3ABZA 2Q4DA 4N18A 1S89A 3IPXA 3O8QB 4RQBA 4C4ZA 4QNNA 3WLRA 5KJCA 1GGFA 3OFNA 1H69A 2CNOA 3AHIA 3ORQA 4EPWA 5IFKA 1QU2A 2ZIGA 4OQXA 3WYCA 4C0XA 5CAEA 3KE9A 5AVRA 4K6CA 1KPIA 4PGAA 4C03A 3OX4A 4IJ5A 1MB2A 1Q7TA 3HYCA 1NW4A 3IOEA 1NVAA 3WQQA 1W0KA 1ZA1A 4EW3A 2GB4A 4ALIA 1N8KA 4RKFA 5AYVA 4YT8A 1DPGA 1DAEA 3O1JC 2Y92A 3KQPA 3SJUA 2CV0A 1UMBB 1H1LA 1EFVB 2GTIA 3PTLA 3F6BX 2XKJE 3HM2A 2GLUA 3L6EA 1EK2A 4K9PA 1USGA 4NYJR 4JI1B 4D9NA 2X1HA 1YVRA 3IXLA 4MRSA 5K6AC 3EA0A 4AY4A 3TW8A 4DPLA 5FT9A 2BFBA 4MVJI 4EVQA 2BSQA 2GM9A 4FDAA 4UJ3A 1F8GA 1CB7A 1KDRA 3MJSA 2PRZA 4PU0A 2ZBFA 2QI9F 2R62A 4XJVA 2AS0A 2CDBA 2A0FA 3EZFA 3LOPA 4G1EB 4IYJA 4KVAA 2ISQA 5JDCC 3O3NB 2C84A 2J0SA 3LDFA 4IIBA 4KPUA 4B3HA 2FKAA 2XYVA 3EG9B 3G0DA 1AGNA 1QIHA 3RBVA 5C8YF 3U4MA 4LGCA 4LTNA 1WMDA 2PRSA 1DIHA 5H8WA 1QRDA 1Z2EA 3JQ8B 3IP9A 1JE1A 2QMZA 2BKUA 2PIAA 3L7JA 2XNDA 1G2QA 5FRDA 3LCCA 2PUHA 4C6HA 2JZCA 5BSEA 3WBFA 2ZRHA 2PUFA 1UJ4A 3WBJA 3GI1A 1V1RB 2DR2A 2NSYA 5BQFA 2ZUBA 3FMOB 4JN6B 2Y6UA 4R2XA 3TVDA 2EJTA 2IC5A 2FCAA 4M83A 4ARSA 4JLBA 3ZW9A 3QMWA 4OGKA 2IYOA 5A3SA 3DLTA 3IP5A 4P33A 2KLBA 3ZE1B 5BSTA 2UUAB 1X1DA 1CQZA 1GQRA 2VA8A 2HIAA 2WB4A 4BNIA 1ENYA 3DHEA 2GNAA 2I9PA 2WABA 4TMZA 4W1RA 2WHEA 4IDGA 2AHRA 3OO1A 5U1PA 1I4EB 1R15A 2QM3A 5A3VA 1HKUA 2H1LA 2I03A 3VPXA 3L1KA 1U0BB 4EA7A 3FRJA 1SQ6A 1MF7A 3LZ6A 3OJLA 4NJOA 4EFLA 3GLGB 3DEKA 4HL6A 4WXPA 4PRKA 2GN2A 1FXUA 3NDBB 1PNOA 3F1LA 4BLQA 1NR7A 2ZU0C 3KU1A 4BMPB 1JJAA 2ICAA 2HRBA 2X2FA 2EJUA 4OOEA 4HDQB 1I2CA 3PDUA 3KQUA 4A92A 4N5HX 3TZLA 3D6JA 4DJAA 4BKRA 1JSZA 1SOAA 2BFPA 4FS8A 4B0OA 5FUQA 1JIXA 5JYDA 2EFEB 1RLOA 1I3LA 4R1PA 3VPBA 4O3FA 4ZEXA 1Y8RB 1F5NA 3DZFA 4HNHA 1T9CA 4PV7A 3IEMA 2D13A 5M04A 2P9ZA 4G8JA 1E9CA 4WEOA 4OU5A 3I83A 2QENA 1BXRB 2B2NA 1ZEJA 2FRVA 2C7OA 5DHSA 2FR1A 4ER7A 1HE5A 2CYCA 3ZLTA 5F21A 1Z13A 3ANSA 1SWVA 3RODA 3EBPA 2YIMA 2B4AA 4ZDWA 2ZRBA 3BHMA 4N48A 5HR5A 5LYJF 1C9NA 5KNLA 5TXGA 3FWPA 3R6DA 3FYTA 2OEPA 1KVUA 1I33A 3FCSB 4FFWA 5D00A 3WMFA 3GA5A 3E4CA 3BKWA 2DPLA 1W44A 3ETJA 4TTAA 2Y2VA 5DK6A 4CT4B 4J7UA 5JZ9A 1QIDA 2G5TA 3CUKA 2QKYA 1R5OA 2VYFA 4W7IA 5ELLA 2JLQA 1UJCA 1P2TA 4QZVA 1MXHA 1C3OB 2HRRA 4BO6A 1MHPA 2ZGVA 1J8QA 2WIFA 1MJGM 3DMDA 4XWGA 3QUAA 1DC4A 3TR0A 3P9NA 3PYXA 5CYFA 5JS6A 2BI7A 4FFSA 1PV1A 2IE0A 1HO3A 1W46A 2HJGA 2VBFA 2WU3A 2YWGA 2ZB3A 3QI2A 5EUMA 2P8JA 3I0ZA 4AECA 3UNXA 4D9HA 4WY5A 1E6CA 1LV8A 1PDOA 5G3ZA 1VL2A 1EUCA 5CA0A 5F5LA 3OJEA 3IVRA 3L7KA 4BLSA 3PRHA 1QAQA 2EKZA 4MRAA 3FTDA 2V4ZA 3H5IA 3HSSA 1DMRA 1T4BA 4ZU6X 2YVLA 2JIZD 3CEAA 3ES9A 2VDWB 1MJFA 1O0BA 1VLJA 1PTKA 1ESNA 2C78A 4K05A 3WQBA 5BUSA 2VT6A 1J9GA 4IRXA 2Q0QA 4P80A 5CDFA 1E7QA 4A6EA 1TEZA 3C3CA 3LP6A 4U9IS 5I5EA 1IOLA 3D5QA 4C5BA 2OFFA 4MB6A 1NLFA 3EZGA 4UARA 2PMWB 4G97A 4UTPA 1FNCA 2FZ4A 4GUAA 4Y3UA 4CM7A 1CYDA 3E7XA 4XB1A 1R9GA 3ANLA 1GRVA 5KAPA 1DDOA 1I3OA 1X1BA 1HFKA 3I2KA 4M0EA 5BNIA 4UVHA 1QLWA 1XROA 2Z6AA 2IHZA 3IR6A 4Q00A 4TL8A 4WA8A 4C08A 1DQNA 3DHVA 4LDAA 4OP1A 5ARCA 2DPYA 2NUAB 2V6JA 1U02A 4Z3OA 4EATA 3BGVA 2V55B 2XT6A 3IBYA 4PYKA 3W9UA 2W6CX 2QRHA 4FE4A 4MH0R 1KAHA 3NRBA 4UMVA 3QG1A 3I72A 3JQBA 1UBUS 4QJIA 1HGXA 3JQBC 4N8SA 4PANA 2PUEA 5BN3B 1EX6A 1XP8A 2L0XA 2ZRFA 2YMPA 5AXBA 4AWXA 1E5TA 2G8LA 2O2CA 4GSKA 1C0PA 1Z62A 3OFND 4PWYA 4BLRA 4BNZA 2H6EA 4JI2B 5GONA 2WSLA 1VBKA 3KR9A 4B7AA 5CFOA 1U0GA 2QTVA 1P5ZB 1AQYA 1JHRA 1S01A 3QELA 4IYRA 5IZCA 4NBUA 4KR9A 2VAVA 3OPYB 3TFOA 1EIWA 1XZJA 2Y67A 2WRZA 1H8HD 5JISA 5CD1A 1JEJA 2NP7A 1W0KD 4I36A 3JWEA 3TRDA 3CONA 3GX1A 1S8NA 4DCSA 4TXLA 4KOAA 4R3UC 2B7CA 2AQ8A 3LY9A 2OCDA 4N03A 3VH3A 4Z9YA 4Y6LA 1TO2E 2Z2IA 4Y98A 3V32A 1TM7E 2PL5A 1K97A 1Q50A 3KV3O 5DYTA 4AZTA 1M8JA 3SDZA 1ORDA 3GNSA 3UWDA 2MT9A 5HE8A 3THRA 1K5DA 2BKLA 2D1YA 2VAMA 1VIYA 1EM8B 2NYVA 2X7JA 1G7CA 3E58A 5HCUA 3U37A 1P7CA 4R8RA 1NQUA 2QN1A 4OQYA 3Q0EA 2A86A 5FOTA 3GJ0A 4YRMA 3E5MA 1K68A 2BR3A 4DJFC 1LSJA 1S5PA 3KJQA 1BN7A 3CLTC 5LXTA 4FYPA 2YJ3A 1LRKA 1U3GA 3MUFA 5EQDA 5INTA 3V4ZA 2VQFB 2EZ8A 3B3FA 3NWEA 4GI1A 5H83A 1EAMA 2O7VA 4RTLA 2VJAA 1ZM3A 3DULA 1ISGA 2JRLA 2WSMA 9GPBA 1CUVA 4YO8A 1FUIA 2FRXA 3R5TA 5IT5A 5JT1A 2YRXA 3KG2A 3K96A 2GAAA 1FOEB 2YWFA 3GD5A 3WGKA 3SICE 2GUWA 3NHKA 2HEIA 4UE3S 3VR5H 2YH2A 4LI0A 3TX6A 2EGHA 1Z4LA 1I6LA 1ZHFA 2ZAYA 1OMOA 4KO8A 1HNWB 3BE6A 4CHTA 2DF8A 5JAPA 2W11A 3BCUA 4MDHA 3C43A 2W2MA 2IYQA 4G63A 3ZWDA 3HB7A 4DEYA 5KTRA 2V6GA 1RZRD 4NS4A 3AFOA 2JC3A 4J1TC 1PR6A 4B7ZA 1S96A 1TVEA 5JEEA 1T5BA 3JQ6A 4EGSA 3KQNA 2BI8A 4J16A 4IFIA 3ZZUA 8ATCA 1ULHA 2JFGA 2BGWA 3L8EA 2VT2A 3I05A 4Q7MB 3DL4A 2BDEA 2PDAA 2ZI5A 3WI7A 3FTPA 1ZXBA 2ZTSA 2FLKA 1GGJA 1RKQA 4IDPA 3FOBA 3UK2A 3DH0A 1HM5A 4KBYA 4M9SA 4ZAVA 4LHWA 5LUAA 1Y8AA 2QT9A 2VS1A 4DY4A 1DIOB 2VJKA 4B6SA 1UBJS 1RLMA 4C88A 4Q3NA 3CS3A 1Z5PA 1C7EA 1OIXA 3M6MD 3U4HA 4ENTA 3K2EA 1DG9A 3L6OO 4LJSA 4FSHA 4NAVA 4BNKA 4LGVA 3QE0A 1H2WA 4Q1BA 1Y5IA 4FFMA 4NWIA 3W7BA 4QJBA 1Z4JA 5TF4A 3KV1A 2B36A 3RVPA 1JFSA 3AF6A 2XRYA 2AWNA 1Z0FA 1G0OA 1QVZA 3OIFA 4NMWA 5FB3A 1BIFA 2OCLA 4Q3BA 4WW0A 3L7YA 4JKOA 3RI3A 3FFAA 4QGAA 3NFYA 4IZHA 4MTLA 1CRWG 2A0WA 1NMXA 4LTDA 1KSJA 1B7GO 13PKA 4GM4A 3GLIE 1QZUA 4HRXA 2YCLA 2GBLA 1URPA 3K9GA 3VZPA 5HA5A 5TS3A 3A6KA 3AESB 4CM4A 5F2OA 4AF7A 4U4AA 4G1BA 4Z9AA 1FSGA 3GP8A 2R751 4HDKB 4N3NA 3D0QA 1UKAA 3K9QO 3L02A 1YUMA 4EEKA 1AHHA 3R8XA 2IJGX 1EDOA 4ZK6A 2G9RA 2WE8A 2WF6A 4TTPA 3S1AA 4BTVA 3GL9A 1FF9A 3FVWA 4M8KA 4FEEA 3STHA 1DIGA 4L02A 3RARA 2J9ZB 1I4OA 3CN7A 2JCBA 3AI2A 1ACMA 1YZKA 2J9YB 4CIYA 3WSVA 4NBWA 4L85A 1ORRA 3JS5A 2P11A 4O25A 2DSNA 3ZHZA 2ZQ5A 1C50A 2GKGA 4ILEA 4BNHA 5LMZA 2OCYC 3U7HB 1RVDA 3M9XA 5DGXA 5HPYB 3TJRA 2XE6A 3F7OA 3H6GA 3TLEA 4L95C 3RKRA 4MAMA 1WHSB 3MA0A 5F76A 3E61A 1T4DA 2WIGA 1EFRD 3KT8A 3BWYA 3WHPA 2QGZA 4K9SA 3AHHA 3CLSC 4TRJA 3VU0A 2GN6A 4RH1A 2PG3A 1DLJA 3HUEA 1A69A 5A4DA 1QH9A 4IJKA 5IXJA 2UVPA 2ZRQA 3AIMA 5FTWA 1DJMA 2AVDA 1L8LA 3B6JA 1HK7A 1Z07A 4OYYA 3R3UA 4YJDA 2O2YA 5CLLA 4N01A 4EQ6A 1KJWA 3FR7A 3TOXA 4WCFA 1T4CA 4JNCA 5L9AA 2PMKA 4WCFC 2CBXA 2K2WA 3INRA 2OORC 4OSPA 1I4WA 1JDVA 1QUEA 3IEIA 4U8HA 1RHKA 2W2KA 3NU1A 1ZIOA 4C2AA 4E33A 1SU4A 1H5UA 4BMDA 2OO5C 2OCPA 1QVRA 1MB3A 3DEYX 5J9FA 1Q1EA 4I50F 5BN4B 3VDXA 3ND9A 2C0CA 3RJMA 3IIMA 2J45A 2PFSA 4B85A 1YMVA 3K6SA 3NBMA 4WTOA 2VXYA 3VOSA 1NNUA 2ORVA 1GPKA 1S2NA 4F93B 5JARA 1B8PA 4R3WA 2MINA 2L17A 1G16A 4AZ0A 3AV3A 1T1SA 2G9ZA 4OI4A 2Q4OA 4HYYA 1QV6A 4IDOA 2R7NA 3PFBA 4I81A 5ED4A 3WZLA 3FJYA 2YXPX 3B1VA 2R60A 1IVYA 1YB5A 1NOIA 4XZ3A 1OX5A 5LMUB 4M0UA 4BVJA 1I4LD 1L7QA 1MEJA 1HUQA 1WDKA 1NAIA 2P9HA 2W90A 3L1UA 3OT1A 4IIGA 1SRQA 4ZZ1A 1U9YA 2W7TA 3K4HA 4AMGA 1NNI1 2A9KA 4ZQCB 3CISA 4FYXA 3CJTA 2TMKA 4Y30A 3RS3A 3UV7A 5FV4A 2WU1A 2JLUA 2B3DA 2IUEA 1PX2A 4A2CA 3V80A 1JUDA 2CXXA 2GX6A 1O08A 1B0PA 1V48A 2N46A 1LDBA 2PGIA 2WKWA 3ONFA 4Z3DA 5AVYA 4C01A 3GO4A 5FHRA 3HCOA 4O0MA 2GFHA 3PPVA 1RC8A 5J2TB 4KJZA 5KU7A 1O5IA 2AOUB 3I5AA 4CLHA 5LDGA 4OHBA 1XA0A 2QQEA 1L4NA 5AM2A 1G8AA 2ECPA 3LPLA 4KNWA 3CRNA 1Z5NA 3PEEA 1YJXA 2E4YA 3K15A 4QGGA 2IGBA 2P9JA 2UZ0A 2P1RA 1PLLA 2XA2A 1XPOA 2PRKA 3CF2A 2GXUA 3LIIA 3MN1A 3OIDA 1KMHA 4CUJA 2VF4X 1M6VB 4XRRA 5M29A 4S1VA 1BEUB 5AXDA 4HXFB 4DJEC 2YKGA 1IZ9A 1ZKMA 2PRJA 2FZEA 3P2JA 2GKSA 2RIRA 3B9BA 4JC0A 1ZCBA 1EBUA 2JHCA 2PR7A 1WMSA 2SKCA 4WOJA 2O7NA 4BV3A 4D80A 7MHTA 4QNRA 2GHRA 4EHHA 4OQQA 5ILQA 4LY6A 1II0A 4AY2A 3U3OA 1J8FA 1OYYA 1T4MA 2H3HA 3TXYA 1QK5A 3GLQA 3I73A 3U0BA 4M9RA 3TIGA 3GNLA 3PI6A 4S24A 4M7WA 1SOVA 4B75A 4G0WA 4LVUA 1VG0B 2C3UA 2ACEA 1Y48E 4MSUA 2FXVA 2ACVA 3A32A 2QP9X 4QICA 1IUPA 3DOEA 2TRSB 1BX3A 1PTJC 3CBQA 4TT3D 1NMZA 3NV7A 5ALGA 3QEKA 2XUQA 1QHEA 3L0CA 3PD7A 4A8HA 5LQMA 3FM9A 1RM4A 3RASA 1NW9B 3D3NA 4V0SA 2X3FA 3SYLA 3RUAA 1SQ0A 3DBIA 3IV9A 3MLAA 1N9GA 1V9SA 2R48A 3ESZA 3F9RA 4D9FA 1MR3F 4CCWA 5LL6P 1M2VA 2AX4A 3MINB 2DLCX 2RHTA 2AG8A 5CM2Z 4ARVA 4IWNA 1M6NA 2JLYA 3V97A 1UZLA 4NCKA 2H5IA 2QJTA 2CN1A 4GMGA 1XVUA 3QIVA 1DT5A 3LX5A 2GXQA 3OLZA 3C87A 3DW3X 3NBFA 5KSZA 4EEZA 3THWB 2BY4A 4JI4B 5DU2A 4O2BF 2JGMA 2RGCA 3PE4A 4ANFA 2O8NA 3DBRB 4YY3B 3O94A 4D5GA 3BHNA 3JASA 2X4IA 2X1MA 1KFCB 2J0EA 2VO1A 2YIVX 1K3TA 1XMPA 4L74A 5EIOA 4ZHQA 2YBDA 1HTBA 3SF0A 4B7UA 1Z4MA 4NS1A 2AXNA 3RHFA 5BYAA 4B3TB 3E2IA 1ZU5A 1GSAA 4BFTA 3KFLA 1L5FA 4FGJA 2B98A 1QX4A 5F4BA 3RVMA 1YBVA 4NK4A 1EX1A 4I9FA 1LNQA 3PUZA 3TZQA 3G2IA 4F86A 4PR0A 1A4IA 1Y34E 1J8DA 1R0LA 1S1CA 5BQ5A 4B0PA 4UUOA 5KX5B 3RM3A 3COZA 1RJWA 1FNMA 2RHOA 3Q2IA 4FEAA 4X0EA 3N8GA 2HSDA 4N4AA 4WZBE 1LKZA 3L8DA 4QG7A 3RO7A 3ZX4A 2E5LB 4BNGA 1MH1A 2QSJA 4YCCA 4DBLE 1RC0A 3PZBA 4ND5A 3ZI0A 4RGQA 5AVVA 4NMHA 1FA9A 3W2IA 4A1OA 5THKA 3U9SA 4ZHSA 1VIAA 3STYA 1P6QA 5D2CA 3Q9UA 1E2LA 1SUFA 2XXAA 1U2PA 2X6TA 2R7AA 4UUPA 4AKSA 3LQKA 3DOHA 5LM3A 1CJUC 4I6EA 3D1LA 2ASEA 4LCJA 2VVTA 3U7QB 5JECA 4HQOA 4YCAA 2B61A 3BMNA 3KZVA 3OJ0A 2WHPB 3LBFA 3LQFA 3SVZA 3PICA 1CUZA 2C59A 2QQ5A 2YXNA 1CNFA 1LLFA 4FC7A 4GHWA 3TDMA 4DM7A 2GAFA 4PVDA 5FXMA 3A27A 2YHAA 3SZGA 4LZWA 1ZJ5A 2CXUA 3H1PA 2AOTA 1XTTA 2CE7A 3LPCA 2BFCB 1XCPA 2VDUE 3QXXA 4KV7A 1ZOLA 2YNMA 2IYTA 3ND6A 3ILSA 1Z6ZA 2X5OA 4FDLA 4TL7A 1UC9A 3HPRA 3HPQA 4IMIB 4YAJA 2X58A 1VMAA 8LDHA 2BFFB 1ISIA 1BXGB 1ORVA 3GCXA 4QPDA 5J47A 1TO1E 3IVGA 3ENWA 1CZNA 4I3GA 2P30A 4OMFG 4CMGA 1CUGA 3SCZA 4BVHA 3KUUA 3O93A 3ZG6A 5JOQA 1I7SB 2IYPA 3Q3EA 1VJGA 2K5UA 4BBJA 3UW3A 1PAUA 2BSAA 1WDTA 3WB2A 2HA2A 2WMOB 1EINA 1IN6A 4QDOA 1HEYA 3H9QA 2JIRA 4HAWA 1V5GA 4ZYZA 3IERA 1DX4A 4HB0A 4J0KA 3KEQA 4JBNA 4OXRA 4UOQA 4F8JA 1WZIA 5BW6B 1BMQA 1Z15A 5B1YA 4GSLA 3GLKA 5YASA 2HQRA 2J09A 5EESA 4F6RA 1P7VA 3FBTA 3VISA 4AC9A 1SQ5A 4BMCA 5DEIA 2D2XA 1D2AA 4TKVA 3EAQA 4U3JA 5C7LO 4B3FX 1ZUIA 4WESB 3VMMA 4OLFA 3WGMA 5HIJA 3WLPA 4F60A 5I9BA 1ECBA 1GHTA 2BC9A 2ZKIA 2J46A 4WRRA 4BC1A 1DOAA 2IODA 4M0KA 2WM3A 1LY1A 3H6HA 2QTLA 3GNTA 5CFZA 3ICQB 3RAEC 5D3QA 1CJSA 1EFTA 3E3LA 3FYCA 4BOYA 4PLZA 3Q7RA 1P4AA 4YCMA 1QFJA 3VSEA 3GEBA 2X3YA 1QF9A 1GTL1 2XNCA 3JX9A 3T1QA 1YGPA 3A6FA 4RYDA 4B84A 3Q8WA 2PWAA 4P2BA 4DG9A 3ESXA 4UAJA 4EECA 5KSWB 1L7BA 1JDUA 1PI3A 4KH1A 2GDJA 3PF8A 5H3LA 4ZJPA 5EP4A 2AK2A 3QU7A 3KPUA 4UQOA 1MDFA 3FW1A 3M4NA 5AVKA 2L2QA 2D1RA 4GBGA 2KW5A 4BNLA 5DGIA 3OT5A 3MF4A 1ONOA 4HQLA 3T99A 4RGVA 3UMSA 4LWPA 1B93A 1JG2A 1HE2A 5EYPB 1GPBA 3B9RA 3B78A 4QELA 2I7DA 1OWPA 3C3MA 4EL5A 1J0AA 1AQJA 5JCOC 3A6JA 1PRYA 2GMWA 4EEXA 1KGSA 2IHNA 1QGZA 2CXTA 5LKRA 3H5OA 2QP3A 2QLFA 1DS6A 3EQ9A 1E2UA 3FD8A 2WPDA 4KYUA 4O1MA 4X97A 2AGVA 5JH7B 4GEKA 4HYEA 1U2EA 3CWZA 4D9BA 4EHNA 2C03A 2P3SA 2ZDGA 4R51A 4Z4EA 4CF3A 1T36A 2HUPA 2ZUUA 3L8HA 4KR6A 4ZOCA 1GEEA 1P39A 2ZT7A 3Q7TA 4NNOA 1Z4OA 1GDTA 3OFKA 4KXYA 3T8YA 5I4IA 1XL1A 4ZO8A 4XYGA 2L42A 3N05A 3HCAA 2WSSA 2ZIAA 5KTKA 3KDPA 2OM6A 3BKXA 1Z5GA 3Q3JB 4PO9A 3ELDA 3HR7A 5REQB 3TLCA 5KKCA 2Y77A 4UTVA 1G5RA 4RORA 3RS0A 3KKNA 3KWJA 3S27A 2H2AA 1TCAA 3SHQA 4ER6A 1DWQA 4PXSA 3IB3A 1X9IA 4OX9Y 1K27A 1ZNZA 2NUPB 1W85A 2QX7A 2VI5A 1Z28A 3AR7A 3GJXC 1R6VA 1QC5B 4KQWA 4ZEMA 5IU6A 1W59A 1YCGA 3BWDD 5I9LA 2DOKA 4N5LA 4DMKA 1ENPA 3O03A 4LCBA 3IEVA 3R3XA 2J6HA 4DM4A 1FVOA 1S3SA