3L1HA

Crystal structure of este5, was soaked by fecl3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
total genus 101
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1hA00
3D0KA 1X2BA 4WDRA 2OCIA 3I1IA 3QYJA 2XT0A 5A62A 1F8UA 5JAOA 3HRHA 1FFBA 4HRYA 4UHDA 1E8DA 4DYHA 3FVRA 5HFNA 1P0MA 4PNZA 4ARBA 5EIEA 3VJLA 4W9RA 3NUZA 4AN0A 3M83A 1ZOIA 2XMRA 1UK6A 1LPNA 3F8SA 2VAXA 2ES4A 3R3UA 1UKBA 4K2AA 5DJ5A 3G02A 3KXPA 5LZ4A 5LZ9A 1MX9A 4CCYA 5CURA 1MT3A 2H7CA 3S8YA 3R3XA 3HI4A 1XROA 3MUOA 5LKAA 3ILSA 5HCUA 3EQ8A 1X2EA 2JGJA 4EUSA 2V97A 5AI6A 2HRQA 1LPOA 5HKBA 3R3ZA 5AK4A 2XMZA 4OD0A 1QGED 3R3VA 2PBLA 1TCCA 4CIAA 1UKCA 1XLVA 2WLSA 3DKRA 4E11A 3M3DA 2VQ6A 2O2HA 3IBTA 1EDDA 2JGKA 1HKHA 2ZYIA 3B3QA 3IB3A 2XQFA 1O6FA 1UOQA 2V96A 3SWWA 4EY5A 3STWA 1W76A 1FJ2A 2LIPA 2Z5GA 5HQ3B 5JIBA 4FOLA 5ALUA 3V48A 1Y7HA 3STVA 1AQLA 1CPYA 5FXMA 3F98A 2BJHA 2WHPB 3QM1A 5JASA 4FLFA 1F0NA 1XZEA 2XMGA 4KE8A 4JYPA 2WFMA 3OPMA 3V1KA 2OG1A 3AIKA 5ISMA 4AB1A 3YASA 1B6GA 1DT3A 1AMNA 3C70A 5I9IA 3LCRA 4OB7A 1JU3A 3X3HA 4E14A 2XUJA 5ALJA 1G42A 4ZV9A 3UUEA 2XUDA 2GBGA 4QZVA 4DNOA 4JNCA 3I2GA 4AMZA 3CCBA 1XRQA 3WK7A 4Y2JA 5EGNA 3SC2A 3C6ZA 5JAUA 1WM1A 3A70A 3IULA 1K5PA 4Y7DA 1JI3A 2OQIA 2J3DA 4N8SA 3D2BA 3DKKA 4PSDA 1G66A 3L1IA 5EI5A 1MX5A 2PPLA 4I3FA 1E3QA 4F21A 5BWCA 1EB8A 4WY5A 3QH4A 5JARA 1ZICA 4A23A 2JEYA 2QTBA 2AJCA 4E15A 4MXDA 3TJMA 4ZGBA 1UZAA 3FLAA 2VJBA 4C4XA 5ALPA 1QTRA 4B85A 4JUIA 4WFKA 2BUBA 4FBMA 3WIOA 3DL4A 5AM2A 5H3HA 1CUJA 4K6KA 4OPMA 3DOIA 4P93A 5AJHA 5ALNA 3ESBA 4BB0A 2HHAA 4MWSA 4CI9A 2QS9A 3EF3A 3G9XA 5AM1A 4ZRDA 3FSGA 2JGEA 2WQZA 4BP9A 1F0PA 4OU5A 4GEGA 5FLKA 2BFNA 1R1DA 4OCZA 4HZGA 5C81A 5AK6A 2PSFA 5AKYA 2WU4A 2FUKA 3BJRA 4DMHA 2FJPA 1YCDA 1MTZA 4UBNA 3HLKA 3W04A 3IUJA 4G9GA 3VVLA 3WZLA 1BCRA 1QFMA 4C87A 4J7AA 3H2GA 5JZSA 3H1AA 3C45A 2HU5A 2WIFA 4IH4A 4DMCA 3W06A 1U4NA 1VOTA 1VZ3A 1WB5A 2VF2A 3KD2A 3JW8A 2VAVA 3I2HA 2J4CA 3PFBA 3FYUB 4FDMA 1BEZA 1QIMA 4FBLA 2XMCA 1H23A 4YK7A 2C0QA 1I6WA 3FCYA 1HL7A 3GA7A 5JYCA 4BP8A 4CG2A 3VDXA 3PF8A 2WFZA 2RHTA 5LZ8A 4NS4A 3ZWQA 5DYTA 4KAFA 3WMRA 4X00A 4PQEA 4RE5A 2WUGA 1TQHA 3C6BA 1GQSA 1G5FA 1YASA 4LXIA 3DDUA 5JD6A 4Y2YA 1R88A 4NMWA 4V2IA 1W52X 2HL6A 3G8YA 3BJMA 4WDQA 4ZXFA 5AOBA 1T4MA 4MJ3A 4QDXA 1Q83A 3R3YA 4LHEA 4UFPA 1IUPA 2PSJA 1H2YA 3IUQA 2WUFA 3DLTA 2JBWA 4E46A 1JMYA 1QLWA 3IUMA 4G4GA 2HADA 1Q0RA 1NU6A 4OU4A 3QPDA 3EIOA 3FYTA 3RK4A 3PUHA 2OGSA 5ALFA 2AJDA 4YX9A 3C87A 5ALYA 4OYYA 4WY8A 2ORYA 2WG1A 2EDCA 1GPNA 5JANA 2HIHA 4Y2PA 3WJ1A 5AK5A 4RNCA 1GT6A 1YSCA 3WIBA 2HFJA 2DQYA 3I6MA 1LPMA 1FFEA 2XUHA 1XZDA 4EB0A 5F4ZA 2NW6A 7YASA 1DU4A 3V1LA 2WIJA 4AZ0A 2CBGA 3G9ZA 4HRXA 1XQVA 3ANSA 5AO9A 4LKOA 1NU8A 1ZD5A 2CJPA 3G0BA 2I78A 3S2ZA 2AJLI 2JGIA 1N8SA 2E3JA 4CG3A 3STXA 3K6KA 1CUWA 4EHBA 3CN7A 2OGZA 4Q05A 2VA9A 3DNMA 2DSNA 1OXMA 1X70A 3M81A 3D4LA 1E89A 2X5XA 1MO2A 3PFCA 2WJ3A 3WYNA 2C5FA 5A71A 5C8VA 1ZI9A 1PJAA 1U8EA 4FTWA 2CUTA 3DEAA 1TRHA 2ZSHA 3C8HA 4UUQA 4BZZA 2BUCA 5K3DA 2WG0A 4PSUA 1ACJA 4I4CA 3RARA 4J0JA 4B83A 4Q82A 4UFOA 2RHWA 4H35A 3FWHA 5ALDA 3IA2A 1DX6A 5AKGA 2OAGA 2CZQA 5IKXA 4LYEA 3H18A 5K3FA 4U2BA 3STYA 5FPQA 2YH2A 3AZPA 3AJAA 3FSGD 4FFVA 2UZ0A 2GYUA 5ESRA 3EQ7A 5KWIA 3KDAA 1LPPA 2HRRA 3DS8A 5CTAA 2YYSA 4H7FA 2AJ8A 3UUFA 2WUEA 5DWDA 3IDAA 5ALZA 1L7QA 4H7EA 3DL7A 5CH8A 1AC5A 4QDTA 3WL7A 2B4KA 5A2GA 3G0GA 4KACA 1EX9A 3KWFA 3U1TA 4L3WA 4OB6A 4M0EA 1QTIA 2QVBA 4QE3A 2CKMA 4K6GA 3GROA 5ALGA 1CVLA 3STUA 2DQZA 5CXXA 1YB6A 5T4FA 1ZD2P 1E5TA 3BIWA 1JU4A 2ACEA 1XZJA 1LBSA 1IUOA 5T4EA 3RM3A 2EDAA 1YA4A 4Y9SA 5LZ5A 3AUKA 2WM2A 5AOCA 3K9BA 4H7JA 1XZBA 3E0XA 3GFFA 5AM4A 3WA6A 1JJFA 1EHYA 3NOXA 3IIIA 4DNPA 3R0VA 1XZAA 3PI6A 1AZWA 2Q0XA 3O4HA 2GBFA 1H2ZA 2H9YA 4X6UA 5AP9A 2D0DA 3A6ZA 3TRDA 2OCLA 2ZYHA 4K6HA 5LZ2A 3ICVA 2XUIA 1ZJ4A 4U2GA 1CEXA 5KWJA 3LP5A 3O9MA 4G1FA 5AHXA 1S8OA 1BN7A 2X8BA 3H04A 1EDBA 4Y2RA 1Z68A 2XQKA 5ALRA 2OCGA 5CW2A 1EK2A 2B20A 3LIPA 5AI8A 4X92A 4MYDA 3I6ZA 5AI0A 5A7HA 1VLQA 4EBBA 4OSEA 4G5XA 1YB7A 1ZD3A 5FV4A 3ICWA 5CRIA 2HA2A 2WIDA 3I6YA 1QIEA 5IVKA 4BAGA 2XE4A 4IO0A 1PV1A 1YAHA 4INZA 2VTVA 2OLEA 1FFAA 1QFSA 2BCEA 1EB9A 1EH5A 3R40A 1FSSA 4Q3LA 1DWQA 1CR6A 4X97A 4FHZA 1N5RA 2WJ4A 4BRZA 5BV7A 3WL5A 1ISPA 5E4TA 1QIDA 4CCWA 2PUJA 3AIMA 5HFAA 5K3AA 5IVHA 1MPXA 1CUAA 5AKLA 1UOOA 4J0DA 2VJCA 1R50A 5AKZA 4JYMA 5SYNA 2WG2A 4B6GA 2FJ0A 4W1QA 5AKEA 5BOVA 4ARAA 1YS1X 3WQHA 3G7NA 5YASA 5IVDA 2QXUA 1K4YA 1WB6A 1BU8A 3C6XA 2JIDA 1W4LA 2V9ZA 3MVEA 1TKRA 3CXUA 3I2IA 3NGMA 1EK1A 2ECFA 3IUNA 3KWJA 2QXTA 4J0HA 3OG9A 5LIPA 2FX5A 2VT6A 1P0IA 1AKNA 4UFNA 4TVKA 5CT8A 2GYVA 4QDOA 2XMSA 2I3ZA 2JGLA 2XMQA 2RONA 3JWEA 3K2IA 4RGYA 4J0CA 1SC9A 1IZ7A 4C6HA 4W1PA 1XZKA 4EA6A 3B5EA 1EINA 2YXPX 4G9EA 4AO7A 4LXGA 1XZLA 4GHWA 1LPAB 3D2CA 1MAHA 4DM7A 4JH0A 2K2QB 3M82A 4XX1A 2CB9A 2QZPA 5CMLA 3PDCA 4X6XA 1LZLA 4XVCA 3ZPXA 2H7XA 2C58A 1HDEA 5CBKA 4WFIA 4X6YA 1JJBA 4DGQA 2QR5A 1QIGA 5AK3A 5JZ9A 4ZREA 3BIXA 3IVMA 4G4IA 4UHCA 4X90A 2QMQA 5DYYA 3A2MA 3CN9A 3ANTA 3L1JA 1UKAA 1UK9A 1UOPA 4QEKA 3FVTA 5EHQA 2WIGA 2W6CX 3D2AA 4GXNA 5CT5A 5A7FA 4W1RA 5JD5A 4M0MA 4BE4A 4H18A 1A8SA 1T2NA 1QIJA 5ALTA 3D3NA 1B41A 4B84A 1W75A 4GECA 2H7YA 5JATA 2XUAA 4W1SA 4D9JA 5FUMA 1RP1A 1BCSA 2QUBA 4P08A 3W05A 5KBYA 5FOQA 4QNNA 2WFLB 1GZ7A 4KE9A 1DWPA 3OOSA 4X71A 1YA8A 4UHBA 2I03A 3O4JA 4GLBA 4CIBA 1WHSA 5ALHA 1D07A 2ZJ7A 1ZIXA 2BGRA 4B80A 5A7GA 3N2ZB 5DNUA 1W6RA 1QIKA 1XQWA 5I7UA 4UHFA 1UWCA 4Q34A 1BN6A 5AM3A 2DHDA 2PU5A 3W9BA 5J3JA 1QIHA 4QLOA 2P8SA 1U2EA 3O4IA 1ODTC 4MQLA 3C43A 1XLUA 2PKYX 5FP0A 4C01A 4HXEB 3WL6A 1SCQA 4UBMA 2ROQA 1ZGBA 4BATA 4ROTA 5ALMA 5AM0A 4CCYB 4YPVA 1YAJA 3BDIA 3WLAA 1ORWA 3I2KA 5AI4A 5AH0A 4J0KA 1YR2A 2Z8ZA 1WB4A 4BCBA 1CUDA 4DNFA 3OC0A 4MEBA 5E2IA 1VXOA 2WSLA 1R3DA 1VXRA 1K6EA 5HF8A 5EHNA 2XUFA 5I8PA 4XIIA 4EY8A 5HK8A 1C4XA 1XZCA 3O9VA 1LGYA 1LZKA 2WTNA 4AO8A 2QKYA 1ZIYA 2G4LA 4PW0A 4X85A 2ZYSA 1EDEA 5AKKA 3FOBA 1XRPA 4HVTA 5AKXA 3I2FA 1CQZA 3O0DA 2PSEA 3A2LA 3UMJA 3I1YA 5C8XA 2G5TA 2HU7A 4BDTA 4GWLA 4X3CA 1UK7A 3FBWA 1ZJ5A 4S0XA 3ED1A 4HS9A 3VXKA 1EXWA 2XUKA 5DTIA 4MEAA 3FYUC 3VISA 3A2NA 3F97A 4DSAA 1SCKA 3WZMA 4MWTA 4Q3KA 1QONA 1XLWA 1THTA 1XKLA 1XFDA 3V9AA 2C7BA 4FLEA 4RE6A 3V1MA 1Y7IA 5CH3A 5HQ3A 1E8NA 1RWQA 4H7IA 1P0PA 4J0IA 2XDWA 2OXEA 2IIVA 2WU3A 2WHPA 1TCAA 4GDMA 3G0DA 4BAZA 5CXUA 3AILA 1GXSA 3HEAA 4DLNA 4PV7A 1XZMA 5DYWA 1Q84A 5FKJA 4OB8A 5HZGA 1VE7A 4H7DA 3H0CA 4X93A 2R11A 1LLFA 2OCKA 1VJ5A 5K3BA 1J07A 4KRXA 1DINA 4QWWA 4F60A 4ITVA 1J1IA 1GPLA 4MYSA 2RAUA 5K3CA 1BEEA 4HAIA 3V1NA 2DR0A 2B9VA 1QIIA 1QIFA 3PICA 4U2EA 2PL5A 1H22A 2Y2UA 3DD5A 2QT9A 2AJBA 3RLIA 4KAJA 2RIPA 4B81A 4BBZA 1BROA 2QM0A 1OILA 5JD4A 4B82A 4X91A 4W63A 1N5MA 1FFDA 3E4DA 2QUAA 2WUDA 4J3JA 1BRTA 3ESDA 1K63A 3QMMA 4U2DA 1USWA 1GKLA 4QA9A 2J3QA 1CUBA 2EEPA 1WCYA 2WIKA 2ZVDA 1JT2A 3BF7A 5LP1A 3C6YA 2QJRA 4F0JA 3D59A 1HBJA 1CUFA 4KE6A 2HA5A 2QJWA 1XZIA 3WK9A 2ZSIA 3H2HA 1P0QA 1DTEA 2Y6UA 4BVLA 1XZGA 1E66A 4UBOA 4Y2TA 3ZLTA 2XLCA 4DNQA 4NZZA 5EFZA 1LPSA 4Y2VA 4X95A 1CRLA 1GPKA 4H7KA 4GW3A 4BC0A 1LBTA 3O4GA 5E4YA 5ALVA 4BRSA 4FFWA 4N5IX 1Q0ZA 4XJVA 4EY4A 5D3ZA 4DSZA 3WYDA 1JJIA 3QPCA 3VJKA 3HACA 4AXBA 3QZUA 4N5HX 5DNWA 1WPXA 1CUIA 1JFRA 3E3AA 2WTMA 5IH7A 2PSHA 3KOOA 1MNQA 3WJ2A 1MU0A 1CUUA 3LIIA 4A16A 4KE7A 3FAKA 3FYUA 1CIJA 2WKWA 4P9NA 1O6GA 4U2CA 4UHHA 5ALEA 1CV2A 3STTA 1A8QA 4C89A 3D5EA 1N1MA 3GELA 3G0CA 1M33A 2V98A 1UK8A 4ETWA 1JMKC 2B61A 2HA3A 5CT9A 5HF5A 3BF8A 2O2IA 1VKHA 4H7HA 3GUUA 3FNBA 4FKBA 2XMBA 3FLBA 4G4JA 3WWDA 3P2MA 2CEKA 4K5QA 3F67A 2Z3WA 3SK0A 3PF9A 3DQZA 4BAUA 2JEZA 4F5ZA 4DTCA 3IURA 2XQJA 4IH1A 4TPKA 2GZSA 4IQ4A 3VVMA 3DCNA 4H0CA 4KAAA 3EQ9A 3AFIA 5C7YA 1KU6A 2RI6A 1W1IA 2I3DA 1TIBA 1XRLA 4LYDA 3T52A 1MNAA 2JF0A 1R4ZA 3QVMA 2VATA 3CCCA 2XUGA 3PUIA 3WKDA 1CUGA 5AIBA 3ESAA 1WHTA 2GYWA 2HA4A 5ALKA 4C88A 3Q0TA 4QWMA 3Q8WA 1QZ3A 3WK6A 3C5WP 4YASA 3QITA 4QDZA 1CUVA 1ETHA 1A7UA 1IVYA 1H2WA 2XMDA 5JAHA 4BZWA 3HZOA 5C8ZA 5EHZA 1RYYA 1R9NA 1QO9A 1G4HA 1HLGA 1AX9A 2PUHA 2XB6A 3WL8A 2Z8XA 1CUCA 3ESCA 1VE6A 1ZI6A 1ZD4A 3WWOA 4Z49A 1IMJA 2BUAA 1XKTA 2XUQA 4EY6A 2O7RA 1J06A 2HA6A 4BTVA 1KEZA 4DMFA 1L7AA 5K3EA 5HF9A 1XRRA 5FDFA 2QOEA 1JKMA 2OPHA 4AQDA 2O7VA 3WWCA 1UXOA 5K3FB 5CH5A 4GBGA 2AXEA 4BE9A 1YS2X 5LKRA 2HFKA 1KU0A 4FNMA 4BDSA 5BWBA 1MAAA 4BCCA 2ACKA 4Q1VA 1XQYA 3AIOA 3TEJA 1OCEA 3C5VA 3MUNA 5D7BA 3WKAA 1A88A 3OM8A 1BE0A 5JZBA 3WK8A 3PE6A 2C4HA 3FLEA 4PO3X 4B9AA 1DQYA 3H2IA 4EZIA 3TGLA 2PX6A 4G8CA 2Z3ZA 4J03A 1DWOA 2DFPA 1CUEA 2CMFA 2DHCA 1TCBA 2WHRA 4HTAA 1DQZA 4HXFB 2XUOA 1WPRA 4JEIA 1Y37A 5HKAA 4MQMA 4Y2SA 2X76A 2HDWA 2GZRA 1L7RA 2C0PA 3H2JA 1C7JA 5ALSA 3BDVA 2JGMA 3G0IA 4AZ3A 1LNSA 4FMPA 2VJDA 3W2TA 4KEAA 4HXGA 1WOMA 3HJUA 3E1GA 3R3WA 1CFJA 1VA4A 2WJ6A 1U65A 2PU7A 2BGNA 4B7ZA 2HA0A 1CUSA 3BWXA 1ODCA 3WK4A 4J0GA 4L0CA 5AKHA 4BVKA 1TK3A 1SOMA 2OGTA 5D6OA 2HA7A 3QBJA 1EVEA 2PM8A 5ALQA 4WJLA 5AM5A 2VT7A 4IH9A 3U0VA 2PVSA 1GGVA 4UBIA 4IHAA 5T4HA 1E8MA 4WCVA 3ZLVA 3SX4A 2ZYRA 5E4JA 4N8DA 3D7RA 1ZI8A 4NVRA 5EHXA 1QO7A 3W9UA 5D3KA 4L9AA 4LIPD 2BKLA 5ALWA 5FRDA 5KREA 1XZHA 5CT4A 1VA5A 5CT6A 1J2EA 2PSDA 4TGLA 3QMWA 3N0TA 1EI9A 3HC7A 3G9UA 1MN6A 4BCDA 2XQGA 4UBKA 5FPPA 3DYVA 3R41A 3OURA 1ZGCA 3ZV7A 3ZLUA 3QMVA 1GKKA 5ALLA 5JAPA 1DT5A 2XUPA 3WKCA 3WA7A 5AI5A 4RPCA 1IUNA 2ZJFA 3AINA 2YASA 1PFQA 1AGYA 5K5EA 3I28A 1F6WA 3WKBA 4ZI5A 4EY7A 4ZWNA 4QDUA 3FCXA 3G9TA 2ONCA 1R9MA 2D5LA 5HK9A 4ZV7A 4UHEA 3BE8A 3DOHA 4L72A 1QOZA 6YASA 4QLAA 1AURA 3HSSA 3DYIA 5A6VA 5EIHA 3BXPA 5AIAA 2R8BA 1GQRA 1LPBB 4BC1A 5DLPA 1NX9A 3KSRA 1UT6A 4KYVA 1CUZA 2Y2VA 1HQDA 2BAGA 1XRMA 3JYHA 4N8EA 5AKIA 4BVJA 2QRUA 4Y2XA 3WKEA 4B0OA 1CUYA 2VSQA 4H77A 1QE3A 1THGA 4XWGA 2IITA 1AUOA 2OAEA 2RGUA 2DHEA 4AX4A 1CLEA 3H2KA 2Y6VA 4B9EA 1A8UA 3MGAA 2ZJ6A 2VJAA 4LXHA 4KRYA 1MX1A 4M0FA 4G8BA 3GBSA 2Y1KA 1VZ2A 4X94A 5JADA 4AMYA 3BL8A 3F9CA 4KJXA 1MJ5A 3AZQA 4UPDA 3OTQA 2DCMA 5AOAA 3O95A 4DMKA 5AICA 5AKJA 4PSCA 4FLMA 2JGFA 4CG1A 4Y2UA 2W22A 3HABA 2WILA 3WI7A 4GI1A 1DX4A 5DNVA 4KR0A 1CUXA 4FNGA 5IVIA 2C5GA 3NWOA 2GBIA 3QPAA 1TAHA 1EA5A 1SFRA 2GBCA 1XRNA 4C4ZA 3HYSA 1H2XA 5SYMA 1CUHA 3H1BA 1ORVA 2H1IA 3AZOA 5LLSA 1UFOA 1CQWA 1XQXA 3B12A 2OQVA 2O2GA 5EIAA 5LYYA 4CFSA 1HPLA 1FFCA 4PF1A 4AO6A 3I2JA 5LZ7A 2J4FA 3LS2A 4FWBA 4G8DA 2XI4A 5JALA 3LLCA 2HM7A 2VEOA 3WK5A 4WFJA 5ALXA 3GZJA 4DIUA 4UBLA 1XZFA 4X7BA 4OYLA 1C7IA 3C8DA 2WHQA 3T4UA 2G63A 1EVQA 2XQIA 3HXKA 1BS9A 4O08A 5ALOA 3ZI7A 3WWPA 3RKSA 3L1HA 3VKFA 3WWEA 4A5SA 1ODSA 4U2FA 4AN1A 2HU8A 1SCIA 5HF6A 4OUKX 3VJMA 3F96A 5AI9A 3EBLA 5ALIA 5DTJA 3H19A 5T4BA 1IZ8A 2WFLA 4Q3OA 2XLBA 2IX9A 4UBJA 1K8QA 3H17A 1ACLA 2G5PA 4BTLA 4BYMA 1QJ4A 4C4YA 4B0PA 4Y2QA 3DJYA 4P92A 4I19A
chains in the Genus database with same CATH superfamily
4Z54A 4B3TB 3TM5A 3AQIA 3H11A 4GQIA 4Z3KA 1C3LA 1XJCA 1GG9A 2I29A 3ZE2B 2EP5A 4DDVA 1VRCA 3HNPA 3D0KA 1X2BA 5I7VA 2OCIA 1JQ5A 2GAFA 4J4TA 1TUIA 1Z0UA 1U28A 1UBUS 3M6XA 5CLIA 2P1DA 3SJUA 1OYOA 2EBHX 4TWRA 3BEOA 2ILVA 2WVGA 4MR7A 3MCTA 3PUKA 5KVVA 1T2FA 2Q41A 3R77A 1IU9A 4MOWA 5A0VA 4UHDA 4MCJA 2H06A 4G25A 4AZWA 4B7UA 3MCZA 5A2QA 2BP7B 3VJLA 5E7QA 3IJ5A 4WOKA 2WJVA 4YJGA 3WGJA 3N8HA 1A9PA 2D5CA 2JCVA 3OPYA 2A8YA 3EDQA 2PE5A 5HYVA 1EJBA 4G8JA 1PT9A 1H0HA 4YI3A 3ZCXA 5HKOA 3ZUPA 4R8KA 5L95A 1VL8A 4HNRA 2CNLA 1JZSA 4QOJA 2FSIA 2IF2A 2NVWA 2QMHA 1NRIA 1TM7E 2XMRA 1R8JA 1YT5A 3DE5X 3IEPA 3MTAA 3OMLA 4PRKA 4RKYA 1T9HA 3MTEA 4K2AA 1UKBA 3FPGA 3RS9A 5C7LO 1N25A 2IYSA 4RMGA 5LQRA 1MX9A 3BKXA 3L8GA 4TTRA 3QF7A 5HGJA 4GKVA 1GNPA 2K87A 3GG9A 4G4SP 2BN4A 3JY6A 4ZVQA 1MABA 1NQUA 1W34A 1W4AA 2FF7A 5EXXA 3WGLA 4B7AA 2YXEA 3BSWA 5J4YA 1Y4SA 3EQ2A 2OORA 4JJAA 2BFEA 2QPTA 4QVGA 2R1TB 5LKAA 3O26A 1H5NA 2DETA 3KR1A 3LK6A 1R4MA 1V11A 4QOHA 2JGJA 1RWOA 1YC2A 1IQPA 2PHZA 2PMFA 2QAGC 2X0RA 2YN2A 5G1OA 4YPFA 4MB0A 2V97A 4MMYB 3JQAA 2HRQA 1RP7A 3F3SA 4ZAGA 1PJQA 1E9EA 4K0KB 1RWPA 3OJFA 3PTZA 1X3LA 3KYDB 1TECE 3L07A 4HH4A 4IKEA 4DIKA 4KUEA 3NEPX 1QFZA 2ODPA 2P3SA 3PL1A 1ZMRA 5GGXA 5C9ZA 3O0TA 1KHHA 3VHLB 2IJGX 1U1IA 4CTMA 4TKMA 4JI5B 1OXSC 3DKRA 3CZAA 2YQ5A 5EWLA 4F2GA 2PTGA 3HL0A 3L7BA 4IMIB 4KLZA 1Q1EA 3ASUA 4PZEA 3D6AA 2BI4A 1AF7A 4KQCA 2O2HA 4G65A 4Z8XA 4BNJA 1UKEA 4RANA 2V3VA 4R40A 3I05A 5KAMA 3SS7X 3E3MA 4Z7OB 2HJGA 4IIDA 3KB2A 5BSUA 2P67A 2V96A 3H97A 1KFJB 2GPYA 3QX7A 4RL4A 2V4MA 1HFJA 2FZGA 2Z04A 4KVAA 5E8JA 4CM6A 4L9WA 2D54A 2XIQA 4MLCA 5E7MA 2E55A 2LIPA 1M9NA 5HQ3B 3UVEA 1IMOA 3QNUA 5KWSA 3V8NA 2ZYUX 2F3PA 3B9QA 2JLYA 5F52A 4G0VA 3SZRA 4B6PA 2HTEA 4V24A 5ALUA 5B58C 2FR8A 3IELA 5EJ5A 2D1RA 4F46A 4TTSA 1Y7HA 3U4DA 1SK8A 4JA2A 1Y89A 1CJKC 2JAWA 3QKRA 2B8TA 3WGKA 1CPYA 1GDTA 3ELYA 1G3QA 5COQA 3MW8A 3QM1A 5JWHA 5JASA 2JLZA 1T8WA 1DRWA 1F0NA 1KP3A 4Q9KA 1XZEA 4H17A 4BKUA 1G2IA 3O8CA 3RSSA 3VSEA 1X7XA 1RBZA 3LQYA 3P9CA 5IAJA 3TSYA 3H1FA 3AR4A 4MVJI 3V2HA 3V8RA 4DJDC 3KZVA 4RENA 3P0HA 2G9NA 1Z8FA 2AN5A 2PKRA 4AB1A 3ABQB 1MVNA 1QHFA 1W6UA 3GEMA 4GDFA 3ENQA 2CNWA 4R1MA 1XPUA 4C6SA 3OTOB 1AMNA 2VAMA 4WL0A 4CTOA 1ZN7A 2GDJA 2PUBA 5HCIA 3IGFA 1ONSA 2ESRA 4CT0A 5I9IA 3DHVA 4PPGA 1RI3A 4OB7A 3KJIA 3AF0A 1N5LA 4HAOA 4BVAA 2RI0A 3DFUA 1WKVA 5MGNA 4PX2A 1N5DA 4D9BA 3GVHA 3Q85A 1WUTA 1CG6A 1P31A 3OSUA 2FPLA 3NAQA 3PYLA 2A3NA 3GN1A 1VCMA 1PN3A 3A05A 4M0UA 3UPDA 1OBFO 3DV9A 2IHNA 4K9LA 5CVUA 3NM5A 2C3OA 1PUJA 1TVKA 1E9DA 4KDEA 4IDPA 2RHBA 1TAGA 2PS9A 4V0QA 4OLAA 3CCBA 3TQRA 1F3LA 3EWIA 2AFVA 1Y3IA 1RI1A 3D8TA 2QZZA 2J9ZB 3VH1A 3WK7A 3SC2A 2JLXA 3NUGA 2HMYB 1A5SB 4XQGA 5LU8A 1UMDA 2OYCA 4V0RA 2JHAA 4BFSA 4Z1OA 2UV8A 3B3JA 1JSZA 3L49A 1JI3A 3JQQA 2NT3A 3QEJA 3AR8A 4Y7DA 3SEZA 3SS9X 4DSNA 3OKCA 3DE3X 2ZUSA 4JL8A 1K6MA 1KF0A 4C08A 4YFYA 4K6FA 2PUGA 1QH9A 1GYRA 3RSZA 3JYNA 3D2BA 5CFOA 2C2YA 4DLAA 2Y0BA 1Q92A 5EI5A 5H0IA 1TMKA 4DWWA 5KOJB 3RYIA 2CNKA 1E3QA 4N9QA 5D87A 1SWWA 4DY4A 3IPAA 2GD6A 3OLCX 1K92A 1EQUA 1Y6ZA 4M9XA 1EP9A 2JIBA 4WN3A 5KOIA 4CM8A 3HU2A 1LFAA 3ABIA 3HDHA 4IUCS 1X7WA 3MJTA 5HIMA 3AR9A 4DSUA 2I4IA 3O92A 3MTBA 4PAMA 4GPEA 2IIQA 1R0LA 5I8WA 1BMTA 4GMDA 1V37A 3AP3A 3O8BA 3ODPA 1AGRA 1ONNA 3GYGA 3EOBI 5JAMA 3ICQB 4MXDA 4K6CA 4BMOB 3TJMA 4ZGBA 1K97A 3GU3A 1ULZA 2C61A 2VUSA 2ZRMA 1RT9A 2P3LA 2VJBA 1NI3A 3ANXA 2GPNA 3BB4A 4NU8X 4Q37A 4R2XA 2C29D 3E9CA 4C4XA 1QTRA 2FSSA 3GUZA 4BX3A 4GLOA 2VCHA 2BUBA 1YZ3A 4TKLA 3HU1A 5J63A 1CETA 2E4YA 2O0HA 4R4JA 2NP7A 3FFWA 1IZ0A 4JLKA 3I8XA 4HYYA 3Q6IA 4NEQA 4K6KA 2OBLA 2X6RA 3DOIA 3NETA 3D7MA 1G8GA 3SKYA 1MV5A 3KO8A 1XDDA 5ALNA 1J99A 1SBNE 2GCEA 1UZNA 3LI2A 1BH6A 1PQPA 2HCTA 2JAXA 2QTVA 2H59A 4CI9A 3UICA 2QS9A 4KO4S 4MYUA 4I08A 4WLFA 4YV1A 2DFKB 2YJ4A 3DEYX 1E96A 3E2MA 4LRQA 1JTVA 2CMHA 1UFRA 3LUBA 2EERA 4L73A 3HM9A 2JIQA 2NXWA 3ROFA 4M2LA 1U3FA 2MMCA 3EARA 3FSGA 3QVJA 4JXXA 1QHEA 2JGEA 2WQZA 5KNCH 2VDWA 2JASA 1Z73A 5FLXA 1GYQA 2XZLA 3DOEA 2VT3A 3COPA 3HPQA 2ECQA 4L76A 3EIXA 1R1DA 3ABRB 4OXNA 2FLWA 2DLDA 1KL7A 4W5WA 2R8RA 3OZCA 1YHZA 1D9ZA 5AK6A 3WIDA 1BQ4A 2HIAA 2XF8A 4KUHA 2O8EB 1T0HB 1TW3A 2DUNA 1M0TA 1I4TD 3CG4A 1XG5A 5AKYA 2WU4A 1GLVA 1GCUA 5EJGA 4LFBB 2QROA 2A1TS 3U39A 1R15A 3CX6A 4JCOA 3PNSA 3BZBA 1YKSA 2YVQA 3IBCA 3OBIA 1UJCA 1XA3A 5DMXA 2V45A 3NZEA 3S8MA 3KQNA 1QVZA 4KH0A 3H8JA 4GRIA 4X41A 4FHFA 3THSA 2BI8A 3BT7A 3HCAA 2A9JA 4LXQA 3SJBA 3ZBQA 2Z8YA 2VCEA 4KREA 1P44A 3GJXC 4S35A 4FM9A 4LEIA 3QKTA 5EJEA 4OQDA 3AI2A 1FS6A 2J5BA 1QFMA 3Q3VA 2CV1A 2RGRA 5M04A 1SAYA 1Z17A 2I2FA 1AK2A 1X13A 1ZNXA 3H2GA 3N8GA 5KKAA 4N6NA 2IV3A 5JZSA 5FWDA 2O5VA 4JP2A 3VU3A 1T9DA 3ETEA 1PR9A 4IH4A 1I3NA 4G23A 3UMFA 4DMCA 4MW2A 5FQNA 1VOTA 3GFQA 5A9SA 2OBNA 4N1AA 2IHZA 1KSJA 3GLVA 3LY8A 1L5QA 3R20A 3KD2A 3KFXA 1FTWA 4R5MA 2V7UA 3VI3B 3EZ2A 1ZAYA 1IM2A 3JXEA 3JW8A 3L82B 4A8JA 3I2HA 1SBIA 3TS1A 2PMBA 3EPPA 3DZIA 3Q7QA 3AL0C 3I83A 2G88A 1ZN8A 3KCNA 1QO0D 2ILTA 1AB6A 3OZBA 4FDMA 1PJ2A 4P3NA 1KWGA 3QBTA 1P3DA 2V6MA 3GMTA 5I8ZA 5BORA 4EWLA 2VHEA 1QIMA 1FPQA 3HWX1 3TZBA 3L5KA 2CDNA 3IESA 4FBLA 2XMCA 1H23A 1K6IA 4JZKA 4HWOA 4YK7A 2C0QA 4B75A 1TEXA 1ECCA 4WH0A 5E7IA 4BRUA 1RKXA 4C7XA 4YRBA 2AG0A 4Q19A 1E6UA 2R8EA 2OHFA 3O8OA 4GICA 5CPFA 5U4QA 1TMOA 1L5KA 2FKNA 3SZOA 4AT1A 2BE7A 2ODWA 2AKAB 4HEHA 2O8BA 2I7CA 1B73A 4WN9A 4XB6B 1UXHA 1PF7E 4G63A 4OP2A 2D06A 3VR2A 4NBTA 4AYTA 2AF3C 2ZGVA 1F17A 1K2WA 1NDHA 1G7SA 5FHRA 4KQ9A 4ZYXA 1SIUA 3KHUA 1FS5A 2IXAA 2OKCA 4N4AA 5KDDA 2FE1A 2DRIA 4X00A 2QGZA 4Q9LA 2OCYC 2EFDB 1V1RA 2WUGA 1GZVA 3MOGA 3NWEA 3HFJA 4R1UA 4DJ5X 5JCPA 4KV9A 4BQQA 4YGXB 4PZCA 3FTCA 2FSVC 4FYXA 2L18A 2O2DA 2IL1A 3OE7A 4X45A 4Y6LA 1QK3A 2EYQA 2V9PA 1XTBA 3CT4A 2PQ0A 3ESXA 3PZBA 1KAHA 3QK7A 1HY3A 1Z33A 4D80A 1JYSA 2G70A 3PC6A 3RR2A 4DLPA 3QYAA 1D04A 1ADJA 1XP8A 1W52X 3Q40A 2L82A 2NO6A 1TEZA 1OYYA 2NXNA 1ZESA 5EZYB 3RC1A 3G8YA 3K9WA 4G85A 3HR8A 2WUVA 1L7OA 2FMUA 3BJMA 1UBCA 2QF7A 3MAJA 5ELLA 2O8DB 3BVPA 2J85A 3FTPA 4J1QA 1PEDA 4BV9A 4Q24A 5EZ5A 4ZXFA 3EASA 5AOBA 1GUYA 1T4MA 3FUWA 4KLCA 4PFKA 1DC7A 1R8QA 3NAZA 1IN4A 1Z0DA 3FIUA 3R3YA 1D6SA 4D9GA 2WF7A 3HSYA 2J6HA 2JFPA 2CFCA 2VIIA 2QDXA 1H2YA 3DKIA 1E2PA 2WAOA 3NH6A 5E0OA 3RS2A 1G1AA 1W5TA 2ZJ5A 1EGVB 1PS0A 1JMYA 1QLWA 2XDQB 2HF2A 3IUMA 3NV9A 2J3JA 5IXSA 2W2OA 3EMDA 4BU0A 1RYNA 2UVDA 3EIOA 1Z12A 2JJ2D 4HHEA 5CLGA 2CLEB 4WT7A 5AK0A 3A1DA 4GR5A 3S3TA 2Y92A 3TVYA 3RFTA 3CLVA 1YF3A 4W7IA 2PY6A 1KGSA 4KOAA 3ZCPA 3BWMA 1V5FA 1M2EA 4QGHA 4ALKA 3C87A 1IBMB 1JBQA 4CMIA 4YQFA 4OBWA 1RWNA 3ZS9A 4EB8A 1YJXA 4HPXB 4WY8A 1KORA 1SA0B 2WG1A 4HG2A 5I7AA 4OX9Y 3F46A 4N0DA 2QA5A 3GVCA 3LPLA 1DBPA 4LC9A 2YZMA 3JATA 5CX1A 2ZCUA 2IYYA 2C1EA 3ZHUA 3IAHA 2FF5A 4I2VA 4OOFA 4R2WA 4RNCA 3AR7A 1RBMA 2JH3A 1RE1A 4E7OA 3LOQA 5CGQB 3JSXA 2HTFA 1USGA 4LPSA 1W73A 2HJHA 1KI3A 2XUHA 1DAGA 1W2WB 3SQWA 1QRTA 3PGMA 4ZU6X 1YUNA 4GLFA 2AHOA 5F3RA 5BR4A 5AW3A 2P9TA 3Q3CA 2WIJA 3FLMA 3Q1LA 4MIEA 3V7FA 4R7GA 4HRXA 1FLVA 1XQVA 1TTHA 3M1AA 4H1UA 5A4MS 2DTDA 3GUCA 1NU8A 2VP6A 4MIKA 1EIWA 2DSTA 3PGKA 2CJPA 1OPXA 2I78A 4KFUA 4YCAA 3S2ZA 2AJLI 2XHEA 2P40A 3VO1A 4AX8A 2XYHA 4AS1A 3N2KB 3OZDA 4G01B 2IEZA 1HDIA 4ZQHA 4M0KA 2E3JA 4MMZB 3SR4A 3HJGA 3Q1KA 4RHEA 3TVDA 4B17A 4C5AA 4B43A 1CUWA 2W6ZA 2JKVA 4ZTBA 3T7IA 4CKEB 1BWSA 4DOMA 3CN7A 4EHBA 3OIDA 5LQJA 2PYZA 2J30A 3QFSA 2VA9A 4YN3A 3ENZA 3B2NA 2QTRA 5B1YA 4DG8A 2WI8A 3AGQA 1W94A 3DE2X 4RZSA 5LXTA 1DEAA 4D5GA 4YNBA 4JT2A 3JAKA 1OAAA 4D9IA 1PD1A 1LCIA 3H05A 3L8MA 4WKNA 2QX4A 4F93B 1TKBA 4B3FX 1R6VA 1Z3CA 4JLPA 1U8EA 5HE9A 1PJ4A 4TTVA 2HPAA 4DRYA 3GZNA 2OBFA 1WZ2A 3COJA 3V4RA 4ZK2A 2BFFB 5JI2E 1Z88A 4ZCPA 1RQPA 1VJDA 3HMQA 2ZSHA 4RQAA 5K09A 4BIIA 4XWAA 3VPXA 3ET5A 3W3ZB 1AA6A 3VR5D 2UYYA 2OV6A 1D9XA 1WD5A 3Q88A 2WG0A 2W6MA 4N41A 3H2ZA 3BYZA 1PBNA 2PN1A 4KIWA 3BL5A 3RARA 4YHBA 1EUDB 3HHPA 1DELA 3L6BA 1QPGA 2OLKA 3L0IB 3LQ2A 3OPVA 1EFDN 4Q82A 4RH0A 5EGSA 1YVUA 1IONA 2MTBA 2I2DA 2OG2A 1F4LA 2REBA 3BD6A 3EAGA 3IQXA 1ZRHA 4H35A 4IEEA 3K8YA 3RFVA 1RCUA 3IA2A 5DWVA 3VZRA 1MAVA 1DX6A 2MOKA 4P58A 5EY5B 5KNBD 3EEQA 4X7MA 1W7AA 4Z2AA 1RMQA 2RGXA 3FYHA 5J58A 3EGXA 4M9ZA 5DNDA 5JCJA 2QM3A 1NLYA 4N5DA 4RD6A 1RWMA 1ZY2A 2CD7A 4U2BA 1U0FA 2P4HX 2QX7A 2IX3A 2YH2A 1OV4A 2WT4A 3AZPA 4YJ3F 1TKCA 1I80A 1X42A 2FUG6 1J1UA 1OZ0A 2JK1A 2GYUA 4JGGA 5EUQB 3CNHA 3S44A 1NVDA 2JI7A 5CNJA 1LPPA 5CTAA 4JB0A 1FUIA 5JNTA 3U4QB 2XTJA 4BE7B 3GD5A 4XCXA 1I1NA 1ZAKA 3T9DA 4BLOA 3DLHA 1U0BB 4Q12A 3WGZA 1JQDA 3RBXA 1O3YA 4R81A 3UUFA 3AM1A 2VVTA 1RYBA 5C35A 4YXWD 4BRWA 1Y5IA 3LO8A 1YO6A 3DW3X 2GERA 4RLHA 1L7QA 1WJGA 3QEKA 3RK0A 4H7EA 1JEQB 2DC1A 2YJGA 1FXSA 4NMXB 3T34A 1LD3A 4OHCA 3TE6A 2Q3EA 1E1CA 4MH0R 4QXPA 4FE7A 1BGXT 3R9KA 2WPDA 2HO4A 4CDNA 5MFZA 4D4GA 4DARA 1AC5A 3L7IA 1YQXA 4O33A 4GT1A 4TLLB 3G0GA 5A2GA 3PJRA 3NEJA 4Q9HA 2FRDC 2CEAA 3PUZA 4O4HA 5F35A 2A5LA 1REQB 2ALJA 3RCBA 2P5UA 1L1RA 3X44A 2VHTA 1G2PA 4M0EA 1JAYA 1QTIA 5AW2A 1ZUD1 2IKSA 3LBFA 4K6GA 2DLNA 3WRYC 4A2PA 2P6NA 4J91A 1WQ3A 5L3QA 3NATA 2ZWOA 3F7TA 3UPUA 1DO8A 2QNBA 3IMCA 1CVLA 4RF5A 1I94B 1VGRA 4X1IA 1P1HA 5IP5A 2J3HA 2DQZA 3EUAA 4ALLA 3KZOA 3R0JA 5K01A 1VL2A 1ZD2P 4H9GA 2E4UA 1HYEA 4O1IA 4XYLA 1WUJS 1W36D 3OJWA 2OFWA 1ADBA 2BEUA 4JUDX 3VPHA 1E61A 4CNQA 1IUOA 2QSYA 2QI9F 3ICPA 2XNDD 1FX0A 3ILXA 1B00A 2FSVA 2FW1A 2OAQ1 1WL8A 2WWIA 5J43A 1F12A 4R2IA 2FUNB 2GEVA 1B6RA 2WM2A 4O0MA 1D09A 3U7QB 4O29A 1ZOOA 1MB3A 4J1TA 4TXJA 3LX5A 5LDDC 1VCOA 3GFFA 5AM4A 5JNSA 4RJKA 3AHDA 3IIIA 4J8PA 1QVRA 3E53A 3CYFA 1GPBA 2I6QA 2HBYA 1KYIA 3L7YA 5CITA 4IGIA 4Q9IA 5KINB 2B1JA 2BGTA 1KJZA 2ZIZA 3EUFA 3GW8A 2J48A 3QE3A 2O1WA 2GBFA 1Z8DA 2A0WA 3MTGA 1DLIA 1WW2A 1CQJB 4NYJR 2EJUA 4L7VA 4KFSA 2SCUB 3IT2A 3N7UA 4X6UA 3CEAA 3RVDA 4EPXA 1YI0A 3DL0A 3UJ3X 3TRDA 1GCAA 4GKKB 3CLRC 2ETXA 3AJDA 3AEKB 4U5QA 4CKCB 2R44A 4GD3Q 1GKIA 1V1MB 2F2TA 4YRQA 3K16A 3QA9A 5HJ2A 6Q21A 2QBYA 4EVSA 3P4XA 1A9QA 1R18A 2QZ9A 1ZHFA 4LNUB 4I5DA 4MA4A 1CEXA 1ZRNA 2NUPA 3ZR4B 5EWJA 4DKJA 2IY7A 5IBPA 3FZNA 3GQBA 2B0JA 3K4QA 4G1FA 4YMHA 1VJ1A 1H2FA 1TLTA 4CETA 1JMVA 1PLKA 1Z2EA 1BN7A 3DFIA 3H04A 3LECA 1FYFA 4LBVA 1R0XA 4TOIA 4ZAXA 1EDBA 3SFZA 3W5JA 4CNBA 4N12A 1X8XA 2FUEA 3T7CA 5L7WA 3W4KA 4JUBA 1SHTX 1E4EB 1JX6A 1T35A 1H1LA 3CM0A 4HLNA 3K70D 1TB4A 2QN3A 3CONA 1NGSA 3PNQA 1GTRA 1NY5A 1QGAA 4OM8A 3B7PA 4ZT6A 4MYDA 3TR5A 3I6ZA 4FYIA 2AE1A 3TF5A 4RZ3A 1JV2B 1ULHA 1MH9A 5AI0A 4HUTA 5HR5A 1IOVA 1MIOB 1OI4A 2I6UA 4P33A 1SZJG 4W5NA 4G5XA 4OSEA 2F8LA 1S2DA 4FMCF 4ACAA 1UR5A 1ZD3A 4U7FA 2O19A 2COEA 4I7EA 4RHFA 1RM0A 2ATCA 2REQB 4EYSA 2H07A 2QRMA 2R8OA 4O3FA 3V4PB 3T5PA 5CRIA 4TROA 2UVPB 1QIEA 1O95C 3M4ZA 4CI0B 2ODAA 4IO0A 5HDQA 5ENZA 1P17A 3TIGA 1TTQB 2VTVA 4OK6A 2B9EA 4F3CA 3V1UA 4DJFC 2BHTA 3TB6A 1BW9B 1OWPA 4OXIA 1C3XA 2PIAA 3LQFA 5K0FA 5CFMA 3ABZA 3UCEA 1EKXA 4FMDB 1RFLA 1YE5A 3A3PA 3UXEA 4ZTUB 4MI1A 1V9SA 3F74A 1W25A 3RVKA 4DLZA 2FG7C 4F97A 3HLYA 4AY5A 1UP6A 4K9OA 4B4UA 1EFRA 1V2GA 4NBUA 4X97A 1U2RA 2ZR0A 1WZUA 4C29A 4EHDA 5J47A 1ISPA 1BX0A 4OHUA 2D8AA 4G2TA 4RETA 5E4TA 1SZDA 4BEVA 5KHLB 2ZPAA 4CMCA 4DC9A 2WP8J 3WQQA 3AIMA 3MIZA 3P4UA 2XDYA 3FUVA 4P4SB 2QIPA 3R7NA 1M6HA 1SC3A 4HNAB 4OHWA 5D00A 1SXJD 1UC9A 3GJ8A 3S6JA 7ABPA 2IS6A 1UOOA 3ET4A 5P8WA 2DLCX 1TYCA 2Y1XA 3A37A 3A6DA 5B37A 3VDRA 5LPNA 4RTJA 4LYYA 2YBDA 4URWR 3K35A 5ARCA 4AJJA 5HQTA 1M1ZA 1Y6QA 2WQ7A 1CULC 3A31A 5GGYA 4DCJA 5KVCA 5ECWA 4GI5A 2BEKA 3PFNA 1T10A 4P34A 1LV8A 4PLYA 3ZJ5A 4HDCA 4JA0A 1WIWA 1NXWA 4KJZA 2UDPA 2ZROA 4Z9AA 5GMOA 5SY6A 2Y68A 4PCAA 5TMEA 3SPXA 2ZUFA 4CRWB 2VBIA 1PNQA 3FJYA 3RC2A 1OT5A 4ARAA 2E2WA 1N2BA 1AQJA 3VOSA 3MIIA 2FQYA 4S2UA 4EVIA 3ZJTA 1JVBA 5U9CA 2C7VA 1VPTA 1BU8A 1SUFA 2W2QA 4LDQA 2WKSA 4HFJA 4QPNA 1MGOA 1WZEA 1AXEA 2JIDA 3C6XA 4H3VA 3URMA 4PHGA 3WLPA 1WLYA 4G5RA 2ZB2A 3VHQA 1EK1A 3KVRA 3WYEA 3KWJA 5GADl 3CY6A 3K8ZA 1UMBA 2OM2A 3C24A 3COSA 1X1RA 4EARA 4NRDA 1QVVA 2OTCA 3H4IA 4J0HA 3WNZA 4FHDA 5ICGA 1KH2A 3OG9A 3JVEA 2DE0X 2PZKA 3ZXIA 1OT3A 1QG4A 2OHHA 1N6LA 2VT6A 1ODKA 3F3KA 2R87A 4ZHQF 2C4TA 2QMEA 1ZOSA 5FBVB 1L5MA 4PANA 1K8YB 2H5JA 5KSOA 5CT8A 1FW8A 2ZBUA 1ZN9A 5AFSA 1DEHA 3AF6A 3NANA 4EKGA 2BH2A 3VTZA 2G7ZA 1GARA 2BFCA 2X7XA 4MINA 4RVFA 3F71A 5JNVA 3G3EA 5G3ZA 2FP4A 4QT0A 2YMPA 4I8DA 2H5EA 4MV4A 3AF1A 3JWEA 3ENVA 4FSHA 4IQGA 3RSLA 4PIMA 3UWKA 3WDKA 2FE4A 1TYEB 5HMMA 3K0EA 4EI7A 1IZ7A 3F2VA 1GSHA 3I0NA 2B1RA 1NVWQ 2VO1A 1KO4A 4I55A 2XITA 5CNMA 2KYRA 4JX9A 1OOEA 2WSMA 3EZ7A 2ZE8A 4F2PA 2IH2A 2V7PA 4BNVA 1C9NA 3B5EA 4UM9B 1EINA 1EVJA 1PJ3A 1CF9A 2FRDA 4LMAA 1YDHA 4G9EA 2XWBF 4PC7A 2ZRLA 1D6MA 1KVSA 2BPOA 4LDZA 4OHPA 4U8HA 1G2QA 4DLYA 5HRUA 2YCBA 1ECBA 4CF4A 1L5VA 1J5XA 1MAHA 1OTXA 1Y8RB 3M6FA 1DL5A 4JH0A 4XX1A 3UQZA 3ESYA 4EL0A 5LVAA 3EYWA 3VUFA 5FUXA 1ZNYA 4DC0A 1H42A 2NTYC 3PDCA 3U09A 5GPBA 3ROGA 4DUYB 1JG6A 4X6XA 2ETVA 1UP7A 2V7XA 3AH8A 3IQGX 4OUDB 4CMIB 1ZK3A 2PBFA 4KPGA 4DCOA 4WCFB 1ELOA 2IIBA 4JR2A 4TMKA 2HRBA 1LZLA 4BMCA 1KAMA 4OQLA 4ARUA 1BZYA 1WXGA 5JJLA 1FDUA 3FPSA 5ICSA 5KNDH 1HDEA 1PGNA 1JJAA 4NZYA 4WFIA 4X6YA 3VR6A 4EUFA 1FLAA 3PQ7A 3QNWA 4ND6A 4ZMRA 4W6QA 5DBIA 3F7OA 5IG2A 2V7BA 2O0LA 3BGOS 1AO3A 3FTNA 1QQ5A 3OQ1A 4H4EA 5EUBA 1C1DA 3X1DA 1GAEO 5B3JA 4LJLA 4NTZA 3NOOA 3PGVA 4G41A 4YCSA 1Z82A 5TNXA 1XHEA 1HOXA 1I0ZA 1ZD9A 2R8PA 2J3IA 3A2MA 3CN9A 3K7EA 1F06A 3Q15C 4QXMA 4AXXA 1E7QA 4Z3DA 4BFYA 4C3VA 2Q3FA 4RPIA 2C7PA 3CEPB 5EHQA 4MW9A 3JD0A 5CVEA 4CT5A 2WEKA 3HN2A 5GOTA 2OSBA 3O7WA 4MUIA 2HPHA 1SXJC 1E6MA 1PJCA 4FC7A 3OEHA 3V6MA 4KO1S 3WLMA 3OIFA 3R5HA 4IKPA 5DV9A 1PFKA 5CT5A 1T1IA 3WRVA 2RH4A 1B2LA 3C4QA 3F1LA 4GPBA 4KGZA 4PZZA 3T06B 2I22A 1G3IA 3FPKA 2FCRA 5GY7A 3MINB 4IM7A 1H8ED 2OWDA 3OLQA 4WXRA 4BFVA 3C3EA 4F7DA 2EZ8A 2XCSB 2OZLA 1PUXA 2O2YA 3GLKA 4HF7A 2CUZA 3GAFA 5CEFA 4LZPA 1CZHA 5EJAA 3TZCA 4YC7A 2XXJA 3QEBZ 1ZL2A 1W75A 1GKUB 2FEXA 4NYMQ 4P5PA 4U1RA 3RUCA 2I0FA 3DV2A 1JXAA 3GT0A 1PR6A 1WTCA 2FY8A 3PVZA 4RKWA 3K9NA 1SK9A 4HB2A 3RBVA 1EBFA 4GXQA 3FI0A 1KAOA 3H6GA 1GPUA 3O8QA 3QVOA 1QYWA 3U3DA 1MOPA 1DJPA 2QQGA 4CM9A 1TEVA 4P08A 2AXPA 3DUFB 1HZZC 3T5BA 3U44A 2I99A 4CGZA 1UEXC 4J7UA 4X0EA 3L7NA 3N0XA 3ZOKA 4PGGA 3C7DB 4MCHA 4UE6A 2XA2A 4Y9TA 1GZ7A 4HXYA 3CSUA 1DWPA 4BFLA 3BKWA 2X14A 4WECA 4DAEA 2WD9A 1QHYA 2RBEA 4NENB 1Y3DE 3E9QA 3I39X 1WHSA 5BQFA 2O59A 3SF8B 4HP8A 2QLTA 3DMFA 3GCWA 1SN7A 1XTIA 2COKA 1RQRA 1Z26A 3TMYA 1C30A 1M1XB 4M1QA 1ZCBA 1ZIXA 4X20A 1JTFA 3TRJA 3UH1A 2IA5A 2WLTA 3LFHA 4NL4H 3DBHB 5F1PA 1XEAA 4B80A 4EYGA 4EM6A 3LH5A 3N2ZB 3HCFA 4QAQA 1UDAA 2VNKA 5CLHA 3H11B 4KLRA 5LYJA 4AQYB 4LC1A 1BD4A 3U3JA 2YFQA 1YFLA 1XQWA 1S5PA 3JZMA 4QSHA 4XX0A 1BX1A 3BREA 1R16A 3OU7A 1CC1S 4R9RA 2C4MA 4X8OA 4XB1A 5AM3A 1A8IA 1FJGB 4DNXA 3W9BA 5LMCA 4KXQA 4RJJA 3FPLA 5FOVA 2P8SA 4F7WA 3B48A 2JL1A 3L7JA 3CZ5A 4F86A 1K68A 5JFGA 1BMDA 4P84A 3MLEA 2UZAA 2ZJ0A 3C43A 2C57A 3KLOA 1HXHA 4R8RA 4YJGB 1UM9A 5FP0A 1VHTA 2H52A 5GV8A 1UBOS 3EX7C 2B92A 4ESOA 3IPRA 2ZJAA 3WGNA 2WYVA 5C1DA 4FZRA 2FWMX 1ZH4A 1ZGBA 1ZSYA 2JDID 1OF1A 2GILA 2X0NA 4R3WA 1Q3HA 4WK6A 1QF9A 2R4TA 5E9JA 4ZU3A 1GNSA 4MGZR 1T6YA 4HGYA 1MPTA 2BMWA 2YXBA 4MMXB 4ZANA 4ROTA 4WA8A 4ALMA 2RJ3A 4E2FA 4AULA 3IMEA 4DV3B 4C3UA 1KYWA 3RS3A 1W35A 3M70A 1GFWA 3VGPA 1MABB 2LW7A 4JQZA 4BNUA 3M6WA 1ULUA 3GNQA 4HNTA 3HBNA 4HGRA 2BFEB 1WB4A 4DEXA 2W43A 4NFLA 2XWPA 3CF4G 4OI2A 4JLBA 4BUCA 4D8YA 1R4MB 1V11B 2VC2B 3CLHA 3FPAA 4MEBA 1FBNA 1F6BA 2WVAA 3SEFA 3NW9A 5LDGA 3LVQE 1I5OA 3JQAB 1ZIDA 3RSCA 4LY9A 1W0KA 3HKDA 4GXTA 4RMHA 3DQPA 4C5CA 4D8UA 3B78A 4IVPA 4TKVB 2MINB 2Q4EA 4DM3A 1C8VB 4KLNA 5BYBA 1CZOA 1G8FA 2ODEA 4BTEA 2XUFA 3SBEA 5LFAA 4XIIA 5KIAA 3VR1A 3UC5A 2I2CA 4EY8A 5HK8A 3DAGA 4B8ZA 3EQZA 1DJMA 4ZD6A 3CPJB 4B4WA 5CUQA 2YVAA 3P4YA 1HORA 5DGHA 3OAAD 1EE2A 3QTTA 3D6HA 7ADHA 4ZGGA 5EWLB 4D0GA 5IF3A 1R3UA 4UNPA 3BSYA 1OIXA 2A0UA 1ZIYA 2DTXA 1F20A 2EVWX 3A1TA 3I6QA 1SHLA 2W37A 4URUR 1Z4KA 1GG5A 2PJZA 2Q2WA 1QHGA 3TRIA 1SUPA 3M6LA 1MO6A 4LY6A 4MIOA 3H8WA 3I2FA 3RVQA 3RC3A 5IT0A 4F8EA 1GNQA 4LZAA 4D98A 2OHXA 2PRJA 1MAUA 4CMGA 1HKUA 3DMNA 3A2LA 1HNZB 3RUDA 1CCWA 4HNSA 1B8UA 3R5XA 1ECPA 4TM7A 1GG8A 5CJ2A 4ZEOA 1AO0A 1P2GA 2PWAA 2RMKA 3C48A 1TCUA 3M5WA 4MDYA 1FUEA 3O90A 3UMJA 1DIAA 2NO1A 3UK7A 3I1YA 4AJ1A 2A1UA 3N28A 4IOJA 4V03A 1R4NB 1UJBA 2V59A 3UJ8A 5JDIC 2WNSA 1LBIA 2A7XA 1PSWA 2EP8A 2V54A 1A7KA 1KNXA 4UEQA 3WY9A 1DCKA 3FNRA 4G5QA 3H5RA 3U9TA 4BQIA 2XGJA 3QKRB 1L7PA 1TEHA 3DLCA 1F2TB 4QNMA 2AWOA 3ECAA 3VVCA 5L7TA 2NO0A 2PPVA 3LLMA 2AFIE 1EXWA 2B99A 2WYHA 2PLRA 3C3WA 4JWTA 4XWYA 5GJWC 3KTFA 5ICMA 2RKOA 3KV3O 3VISA 3P9QA 4RTKA 3FOFC 3CJRA 3TQHA 4DV5B 1DZIA 1YDEA 3F97A 3GGJA 1ONOA 1SCKA 2OLJA 2VF7A 3OA0A 2RB4A 2RHMA 4L8FA 4RPKA 1C3VA 1II9A 1YQUA 1UDRA 3KXIA 4LVOA 5LQSA 4EYEA 1JAIA 1DLJA 3DZBA 3IO3A 1UT5A 1JAHA 1RC0A 3A1WA 1XNJA 3PXGA 3J81k 2P30A 3KUXA 4LZLA 4WZAA 1KEWA 1NZFA 4NOMA 2H9AA 3A1EA 1DX9A 1Z6PA 2R1VB 4G9BA 4XGRA 4YY3B 1Y7IA 4KDFA 2ZDQA 1SKYE 2GVZC 3DE1X 3IKVA 3ROZA 4DZRA 4DV7B 1MOSA 1D2HA 4EO4A 4J3NA 2IU3A 1H2EA 2FOLA 3O82A 1T6ZA 2A3RA 3GT4A 1KEVA 3ONWA 2BZ1A 1JEDA 1P0PA 4LWOA 3BCSA 1N6NA 1P33A 4IJKA 5CP8A 5TEVA 3PX3A 4D3FA 5A5VA 5JSZA 2GCGA 3RFCA 1O94A 3OCVA 4BLSA 2WHPA 1KOLA 3SC2B 4LDRA 4GDMA 2FMKA 2OSVA 3C3AA 1GCIA 3VPFA 4C4RA 3ZDCA 3PQ3A 1UMDB 4BAZA 2JH8A 4EG3A 3CRQA 2KLBA 2AOTA 2GBLC 2JJMA 1FSFA 4ZRNA 1TF5A 4EMBA 3BOSA 3EXHC 3VTAA 3HU5A 3FZEA 3DLIA 1I6KA 2JAOA 3E27A 1GFZA 4R83A 1XXHE 5HDBB 1XD9A 2HZBA 4F3YA 4DA6A 4WWHA 4GOJA 4OB8A 3WDSA 1GQ2A 2W2TA 4AM8A 1NL3A 2JBAA 3AR2A 5E1MA 3UOAB 1VE7A 1H1DA 3RYIB 3K5IA 3QVKA 1AHIA 2J9GA 3EIEA 1U7XA 5IEBA 1GNLA 4K46A 4PGAA 5C0OE 4C14A 2I33A 5FUWA 3N0WA 4TQAA 3IUSA 4CM8B 4F3RA 1N77A 3SHOA 1RVV1 1MOQA 4RZHA 5HW0A 5JC8A 1R27A 2GN4A 2BMDA 3JTMA 1EE1A 2BGMA 2E6KA 1SQGA 4OYRA 3GJ3A 1YKGA 2ZBRA 4RQTA 4G56A 3DKVA 3C0KA 5K0GA 4CPDA 1JP7A 1U6JA 1Z5OA 3WLTA 1CEYA 3AHCA 4JBWA 4TRJA 3MWEA 3ZCSA 4ENRA 2PZJA 3NV7A 2B4RO 2DKNA 3NR2A 1RHKA 4YDSA 1A1SA 3WL3A 1KJNA 1GQOA 1I2BA 2O3QA 2JKYA 3GXBA 3PJFA 4QWWA 5G0WA 4LYJA 2FNAA 4OLFA 4F60A 3MELA 1IUKA 2YKGA 3ND5A 1HDYA 1LI7A 3ZU2A 2UXDB 1NOJA 3OX3A 5DHSA 2G17A 3F6PA 4YMTA 4KL8S 1WP9A 2XV1A 1M72A 3ONFA 4HWPA 5EEHA 5K3CA 3HBAA 2X23A 1BEEA 3EGWA 1DRJA 4I4NA 1UT8A 4LJ5A 1UAGA 1XYVA 5J2TB 4LYFA 4RK6A 1VGVA 1F2DA 2AZTA 2DR0A 1NMQA 3ER6A 3FF1A 1O89A 3N2IA 4PPFA 3UJBA 5CR9A 4ZYVA 2CT8A 5DOZA 4IF6A 1QIFA 3PICA 3UC9A 3UT0A 1S0UA 2FN3A 4ZZ3A 3DD5A 5IH3A 3WNQA 4EA9A 3HO1A 1GPMA 3EH1A 2YOHA 2VDWB 5KOYA 3OZEA 2Z58A 3EXG1 4KB5A 3RHFA 1P7WA 2HQBA 1T8RA 4OATA 3RU2A 2PMWB 1NLUA 2FAXA 421PA 4QT4A 4F4FA 4MP8A 1E3SA 2XKBA 4HTFB 3BXEA 2GPJA 2MSCB 2IHKA 5BSHA 4EG8A 3BK1A 4I9GA 5EZYF 3HNOA 2CXTA 2G1KA 5T64A 3U13A 4UTNA 2FZ4A 2GA9A 2PH5A 3OFVA 4OI1A 4FCVA 3RFFA 4NAUA 3VNSA 3RUEA 3WLRA 3GLRA 3I5XA 4LRUA 2VXYA 4UVDA 5IVPA 2QUAA 4L02A 3UAVA 3PK0A 1AH2A 3OTIA 1R6AA 1K63A 1O54A 3QMMA 5JSQA 1UKZA 3KQYA 3WAKA 3NEAA 1POWA 1AQ6A 3BH6A 4LS3A 5E2BA 3EC2A 1Y3FE 2Z6UA 4DCVA 1USWA 1KC1A 1NP7A 4IHJF 1JR3A 4AJIA 1B0ZA 4FNAA 4B5LA 1YMVA 4YUYA 4L5BA 4ZCSA 1L8OA 3VZCA 1WCYA 2H11A 5LDHA 2ZVDA 2BDEA 1GUZA 1MFZA 3C6YA 4PYKA 5ES3A 2QJRA 2QAGB 5L4SA 1GV1A 2EU8A 2CCJA 5BNZA 5DH9A 5FPYA 1UDBA 2AC7A 3IIMA 4JUAA 3A28A 4KQIA 3PFKA 3CISA 3H2HA 4UQPA 4Y2GA 4A7PA 5K8JB 5EE0A 1GTSA 1XZGA 4RIGA 1OZHA 4QRIA 3UW3A 2X86A 4QM6A 1K5GA 2B7CA 2IGTA 4L28A 5A4FS 2FHPA 3ZLTA 2BEVB 1ZNZA 3MTIA 3CR3C 3PQDA 3KOUA 3V1YA 4EUKA 4UMEA 4YIHA 1F5NA 4NZZA 1ZVQA 4BFCA 3PD1A 4EFMA 3E9MA 3ZD6A 3DOUA 3FDZA 4Y2VA 4PLTA 3WL4A 2DWQA 2EQAA 1C80A 3CNOA 1CRLA 4OVKA 1H4QA 2B3TA 3D8HA 1N2IA 3SAJA 4GW3A 3UBMA 3FVVA 1ZR4A 1M7HA 4JT9A 3U7EB 4IW3B 4CMHA 2Q0QA 1LBTA 3HLTA 5E4YA 3HDYA 3QUCA 2X5JO 1CHDA 1FDSA 3K9FC 1SO8A 4E0BA 2O8BB 3C1TA 4EY4A 4WN9B 5D3ZA 5F77A 3DMHA 4FX2A 2UVQA 3WYDA 4ISBA 1YBFA 4JK3A 3RQIA 4D42A 5L8VA 3QXXA 5JAIA 5TQ0B 3CSDA 4O4LF 5LP6F 2N75A 4PTZA 3QZUA 4HDQB 1X1QA 1XALA 4MKGA 5DCWA 5FOSA 2BFPA 3TLGA 3FOAA 4JI0B 2WTMA 3NBUA 1PQWA 4YVFA 1T1EA 2POCA 5SZHB 1TFUA 4UTRA 4FILA 5A5FA 4QHSA 1AF4A 5DULA 1I7LA 1P6UA 3C6QA 4YH1A 5LUBA 3AVUA 5H4HA 2FCAA 1CUUA 3MTQA 2IU4A 3ZE0B 1K7YA 1R6XA 5FPHA 1LRKA 3NLLA 3B3AA 2DR2A 3E5MA 3INRA 1D2AA 4P38A 2BFBB 5JSYA 3RHTA 13PKA 3LU1A 3WQSB 2IGBA 3LT0A 1ZHOA 4Z4IA 1KQNA 2FFRA 1CIJA 1SVLA 1Z9BA 4MULA 2P90A 1C2TA 3JASB 1VSBA 4YIKA 3TTVA 5IPFA 1FUUA 4NDNE 1I3MA 4UHHA 4QYIA 2YXDA 3STTA 1A8QA 3NIGB 4A91A 3O2JA 4C89A 3NHJA 2VHWA 2P0YA 4MQ4A 4LFCB 3JSAA 5CDSA 5L51A 3KNZA 1AU9A 3BZWA 3G0CA 3IAS1 3Q9SA 4UM8B 3TR6A 4JITA 2V98A 3KQSA 3I61A 1M1NA 2PRKA 2FPXA 2FMIA 1KQ3A 2H1CA 4R7TA 2AC4A 4DMLA 1CY7A 1JMKC 1G5TA 4FI3C 5LWQA 1SUAA 4J7XA 4QTYA 4JSYA 4WNIA 5JXWA 5BNIA 4MLDA 5IAOA 2C8LA 1UPAA 2O20A 2AXQA 3PP8A 1YIOA 3SHVA 3R3JA 4BX0A 3VHXA 1DUSA 1XF9A 3OETA 1LSOA 5IS2A 1VCIA 3JQRA 2V58A 3ASZA 4FK8A 2JHGA 1B23P 2OZKA 2XCUA 1UXIA 3T3MB 4P36A 2PX2A 4FKBA 4JKIA 4PLWA 1US8A 1Z0KA 3AKCA 4JXJA 3F67A 2Z3WA 5DXFA 2AIRA 3ML1A 2CVPA 3OEWA 4O25A 1T5IA 1B1CA 3RTCA 1NKVA 3LUDA 2P2CA 4CZ2A 1GVHA 2ZSDA 1WULS 1CZLA 1K7EB 1M76A 1P1BA 1QMPA 2IXGA 2XQJA 3BWCA 3GWGA 4IUBS 5KHAA 2GZSA 4PSAA 1LLCA 4BX9A 3VU8A 1FFXB 1WUKS 3LBHA 4H0CA 5B4TA 5CVVA 3JATB 1KEKA 2E89A 7AT1A 2XYPA 2H0QA 1KMNA 1KKMA 2HJSA 2NNLD 3AFIA 2I7DA 1QRUA 1M2WA 2ZXUA 4WKOA 2R6JA 1KU6A 2RI6A 2VXBA 8MHTA 1LS1A 3R1IA 4EJFA 5CB6A 1AS3A 4AY3A 4LN1A 3N2NA 4DLBA 1P2VA 5CIYA 1VJTA 4B47A 3KJEA 4X1KA 4AROA 4PVCA 3EA4A 3F4BA 2QSJA 2PMDA 3T52A 3WX0A 3E15A 5ILQA 4M98A 2JF0A 3CZ9A 1WMBA 3OWXA 2J9XB 5ITZB 2OHIA 4NH4A 1A4UA 2VATA 4FWTA 2ZT6A 3PUIA 1P61B 2LCQA 2J45A 2YMMA 3R74A 3CUWA 3I8OA 3KVVA 3P9ZA 3SP1A 3CF6R 1IWOA 4MRMA 2VFAA 3WKDA 3IYLW 4GPIB 2W0SA 4D2IA 2NU9A 3HNRA 4KZKA 5E6SA 3TW8A 2KQUA 3CW2A 3OZIA 1O97C 1VIYA 2I8AA 1UFQA 1VHQA 4YAGA 3DTVD 3CKKA 2HKIA 4KXXA 4LDPA 3WP1B 4QJ4A 4UTPA 1M67A 4D26A 1V7QA 1CKEA 3UG6A 1W581 3ED5A 4FFSA 4MUAA 3CUYA 1OI2A 3DPUA 4HYQA 4MWEA 4Z6KA 4H6PA 5DBHX 2AYYA 4BECA 5LXTB 2XOXA 4M7WA 3G8BA 5DSXA 4E6PA 1CUVA 1ETHA 1T15A 2W2LA 3JAKB 3JR3A 3T95A 2WDPA 4LTDA 3FH0A 1PTJC 1KIAA 2IY8A 3KKLA 3L06A 2WYUA 3QFHA 4O2AA 4TMTA 5EHZA 2JAHA 3F6CA 5GZ6A 5E3HA 4MQ5A 1G4HA 3LCUA 3PQ2A 1IQUA 3PGXA 1HLGA 4Y0NA 2HN9A 1Z0ZA 2C95A 1Y3HA 3GZNB 4TLEA 4ZCMA 4NMHA 3WL8A 1X7HA 2WJAA 5K8VA 3U3XA 3AEUB 2AQ8A 2LBPA 3ESCA 3HJCA 1ZD4A 1ZD8A 1HNNA 1KARA 4Z49A 3DP7A 2GN1A 2G09A 2GN0A 5BURA 5KQGA 4GPD1 1WE2A 4QO8A 2BUAA 2JI6A 4X84A 4XQ9A 1XKTA 2XUQA 2VHXA 3PL5A 4B48A 1Y5MA 4P86A 4QQRA 3L8ZA 4JXZA 1DKRA 1VPDA 1Y63A 2HA6A 2ZTVA 3G2QA 4BTVA 4PLVA 4D8WA 4GZ5A 2YIDA 3EVFA 3PRYA 2NP6A 2GO1A 2ZPUA 3BD9A 1L7AA 2HUNA 3F9IA 3C1AA 5LWHA 1NUSA 1KJJA 3A27A 2VDJA 2XXBA 5BWNA 1JKMA 3T61A 3GUVA 1ENYA 4KODA 5M3BA 4RMIA 3BJZA 4Q1DA 4W9MC 5JU6A 3EHDA 2A78A 3MJRA 3NJ4A 1UXOA 5HE8A 4MVYA 5CH5A 1JF8A 2QX9A 4LWQA 3ZY2A 5CFQA 1GU7A 2VTDA 2AXEA 4LJ6A 1P4RA 2FWNA 2A94A 1YS2X 3MG9A 3ND9A 4N65A 3NHMA 4NI5A 3IAM1 4HDSB 4R0VA 2AG5A 4NC9A 2A9FA 3N8DA 4NYJQ 4CUJA 4R0NA 3T3EA 1XV5A 2K5UA 2Y93A 3VOBA 5LKRA 2MT9A 2HNBA 5EKSA 1OFUX 1SY7A 3OKPA 2BL4A 1GSIA 3PQ8A 4JVNA 2RBKA 2FV8A 4CBVA 4BCCA 6AT1A 4YA6A 3K8OE 4G84A 1L8AA 4JLJA 5A4DA 1JAXA 4MVJF 4AVYA 5DM60 2GFHA 5JNWA 1ZVKA 3PBKA 2VT2A 3CZCA 4Q1VA 3NYQA 3SZUA 1F7VA 3RPEA 4L95C 1U1EA 3TEJA 1RPNA 3MUNA 1E1CB 3WKAA 3NOVA 3PCRB 1YQWA 3OM8A 3IEIA 4LI3X 2CW5A 1I5RA 2NUBA 5DI3A 4P98A 1HQYE 4ND8B 2X4LA 3ZLBA 4BO3A 3CE6A 1VL5A 3PE6A 1C9KA 3PXBA 4UZSA 4Q66C 4B6QA 1OMOA 1B0UA 3KJGA 4PQFA 4XTRA 4OBBA 1ZX1A 4QX6A 4B3GA 4DB2A 1QLJA 2OV3A 4WQMA 4BO0A 4ZRMA 4CV2A 3EEYA 4HJRA 1Y7PA 3INGA 3EVGA 2LVBA 2QN1A 1VPEA 3H2IA 2C3UA 4EZIA 3BWYA 1WVIA 1XD8A 3S99A 1XD2B 4V1CI 4NMMA 5HM8A 4MA0A 1X38A 3AFHA 2VPIA 3VX4A 3KEQA 2CXHA 1V1JA 1U0JA 3MWKA 5F12A 5L3QB 2QYTA 1DHTA 4F4DA 1IVSA 3FDJA 4HN4B 3ZGVA 4EF5A 2ZBVA 3FPBA 2F1HA 5KTNA 4L15A 5HS4A 1H5QA 2WE8A 3C3KA 1Q14A 2OCPA 2G8NA 3FSRA 3MWJA 4LOIA 3V7WA 4EA7A 4EF6A 4LF9B 2XUOA 4A03A 1WPRA 3T5TA 2BRUC 3PA6A 1T3HA 4WK4B 5DNCA 1YXMA 1PVOA 2HDWA 4S1TA 3RF6A 1TDJA 3W4JA 1T0IA 1FX0B 4JLVA 1T34A 2HSEA 2PCJA 3OT1A 5J2UB 4LQLA 1Y3CE 2WPNA 4X24A 3TWOA 5AQ1A 1M7BA 3GOHA 3KFLA 4OGWA 1S7GA 2WE7A 3JQ8A 4NOLA 4TM8A 4DQKA 4OAPA 1T9AA 5C53B 4CV3A 1XWWA 4YROA 5HXAA 4RORA 1XZNA 5KTTA 2QYSA 3KSDO 5DIFA 3DQQA 4JEMA 4ZOLF 2R4UA 1G8JA 3MFYA 2IELA 3VGJA 2ZVJA 3H2SA 1P5RA 5EPUA 1O4WA 4ER7A 1E6LA 4G2NA 4BNYA 1ADYA 3U48A 3SVZA 4WNCA 1GQYA 4H31A 2QTGA 3IBSA 4KEAA 4RLQA 4YRRA 5FWXA 1SCNE 3W2TA 6NULA 1CEEA 4QPDA 4QECA 3GH1A 4YRDA 5HEKA 3RD5A 3SM9A 4BO1A 5EOVA 3LA8A 5FR1A 4H7PA 3HJUA 1U98A 4L08A 2IEDA 4I1VA 1JR6A 4FGJA 1K5DA 4IVNA 1O5TA 2QMYA 3LC2O 5IDYA 3U7JA 5BMVA 1T91A 4E12A 3GP3A 2PU7A 2QBYB 1ARZA 4AECA 3VPCA 3RYHA 2A1IA 2VJPA 5C1BA 3LM8A 5CA0F 2VYCA 3TW6A 1CP3A 2YWDA 3CXRA 3ZTWA 5JAZA 5JJBA 1WU7A 2I6XA 4F5DA 2NUPB 3WP0A 1HMPA 1Z07A 3MJEA 5EWJB 1WXIA 1UADA 4IDDA 1SVIA 2HHLA 1QAMA 3KOYA 3VZQA 4BQPA 1S01A 2FWBA 1Y48E 1TK3A 4BNDA 3HXPA 5F1KA 3OUZA 3UF0A 2O3TA 4YONB 3QX9A 1DAIA 2ZRGA 3RUIA 4OM7A 5AM5A 4FEYA 1GNTA 3IP5A 2CXOA 4FW8A 5ULLA 2QRPA 1G0NA 4ZDJA 3K0SA 3ZJYA 2PFKA 4ZCQA 1FFGA 2QMOA 4F1WA 3RGWS 4TYQA 1MOZA 3K9QO 3FRJA 4JC5A 4OLBA 4F12A 1OYVA 1GGVA 3GPBA 4UBIA 3QGMA 3AEXA 3STHA 4L74A 3UHAA 4M55A 1E8MA 4NV3A 4QO7A 1A96A 2OHJA 3I30X 1TD1A 1ETUA 1XLTC 1QCDA 4CCSA 2PUDA 1W9MA 5JXJA 2XSZA 5GZ1A 2Q8QA 5E4JA 4N8DA 3G82C 4DR1B 1II8A 9LDTA 4M1ZA 3M2TA 1P1FA 4UATA 1SQSA 1E2KA 2C2HA 5EHXA 4HEJA 3WYAA 1JZQA 3C3BA 3W9UA 3OPXA 2O8VA 1C7ZA 4AAYA 4D96A 3A1NA 1U2DC 5HGXA 4MAAA 3M4NA 1T3GA 2BKLA 4D8VA 1MO3A 4EYKA 1KDTA 4TV8F 1BDHA 1XZHA 3AOEA 5CT4A 3WGHA 3H16A 1X9HA 2P9HA 3RRYA 2C7QA 2H2HA 1J2EA 5I4BA 3C7KA 5G53C 4TGLA 1MDBA 1IJEA 3SMVA 1WA5A 1K3FA 4AP6A 2O5CA 1LU9A 3ZNPA 4UOQA 3BSSA 1C1HA 4KITB 2XQGA 4IDOA 1V6SA 4I9NA 4DDWA 1RRGA 2CMGA 1XQ1A 5GONA 3OURA 4IR7A 5IM5A 4KPUB 3K6RA 1Z13A 1WMSA 4Q00A 3HN7A 5BT8A 3LUJA 2Q45A 3KAKA 1L5HB 2VQ3A 4UCFA 4CM4B 3QMVA 5C52B 2DEUA 2Q3MA 1L1FA 2PMKA 4MVJH 2C04A 3LPDA 1UPTA 2NSLA 5DEOA 5IBRA 4AKEA 2OE2A 4K26A 2I1QA 2W4MA 5E95A 1S02A 4UHJA 5CB4A 2P6PA 3CIFA 1DXHA 3ROMA 2XUPA 1VHLA 3LHIA 4EGSA 1FMTA 2BKXA 3M33A 3AR3A 1B26A 3VSDA 1JHVA 5JHHB 5K45A 1E2MA 1R6TA 2B3DA 2IYRA 4ZAFA 4X9XA 1O9HA 2ZJFA 1W8IA 2BFOA 4NBKA 1E18A 5FBQB 5K3SA 3LX6A 1AGYA 2IVZA 3BUSA 4QFCA 4WNAA 4BS9A 3EB9A 5G4KB 3OP1A 4GF5A 3I28A 3IVRA 1WMDA 4WKCA 3KPWA 2J6IA 3T9AA 4YP5A 3AEZA 2G8LA 1XCBA 4G26A 4MUHA 3FCXA 5B6PA 2QVXX 2VYND 3WHIA 3G9TA 4OHXA 1F4PA 1MC8A 2CF5A 2ONCA 2WM3A 1KI7A 2X2PA 4L75A 2LP4Y 2F17A 3R6TA 4OIMA 2AE2A 1ADCA 4PLGA 3JAMA 1UINA 4H4CA 3C3JA 5B6JA 2JJ1D 3Q8KA 2BFWA 1KYYA 2YVKA 1YZUA 4UHEA 5AJZA 3FN4A 1SG6A 3ISJA 1SCAA 2HK6A 1PYGA 1TX4B 3HSSA 1H6BA 1M75A 3BAZA 4BO7A 3ERCA 5KU1A 4KWCA 5EIHA 3R7BA 3BXPA 1JFLA 1IAVA 4UMFA 4AY2A 3TX6A 2BCGY 3HVIA 3P94A 2TMDA 1Y4AE 4YTEA 2WVHA 3H9BA 2GK6A 3D3KA 1JQJC 2JGNA 4ZVRA 4BB6A 4OI0A 1X80B 3QVGA 1JDZA 4MGEA 3Q7EA 1HTTA 4KYVA 1MRSA 2NSHA 3MQFA 5H3CA 4NX2A 3P2OA 2P79A 1V3VA 3K09A 4I50F 3KT8A 1MB0A 1AUQA 2ZYTX 4N8EA 3RWOA 2GXAA 2QRUA 4W5RA 2P65A 2R2AA 4Y2XA 1K9VF 4QQFA 4BLQA 3NAGA 3VVBA 1YZQA 1CUYA 2VSQA 1OBCA 3D5QA 1WVMA 3EK2A 3PQ4A 4I55B 4IYJA 1IIBA 3FUCA 4XWGA 2EHDA 1YQ9A 1JKIA 2IITA 2ZPTX 4OJQA 4CKXA 3M4YA 4NOJA 3L4JA 4RABA 1LV7A 1F0KA 4M1SA 5DM2A 1HG1A 1Z29A 3H2KA 4DZTA 2NYVA 3EXFB 3KAQA 4FB4A 2ZSFA 1XMJA 4MV9A 4KXLA 1IRXA 4INOA 2O8FA 2ODTX 3H13A 1B74A 3W2GA 4DBVO 1TNDA 1VP3A 3ZZUA 2VEDA 2IOHA 4JU9A 2B8EA 5ETJA 3CWQA 4PN7A 2CV0A 3AEQA 4P1ZA 3REQA 4QPZA 4DLLA 1NBMD 3OH8A 4KRYA 4JR1A 1HTWA 4F3NA 1JDJA 2EV9A 1MX1A 4M0FA 1LVGA 3OLYA 2C92A 3FDFA 1PSZA 3BWBA 3Q6MA 4H27A 4U7WA 3UHOA 4RSMA 2F4VB 1I30A 3DSRA 3SOZA 2AR9A 3GBSA 2ZBGA 4A0HA 5DGDA 2ONYA 2AQHA 2VLBA 3AW9A 1IE3A 3HO6A 3J7AC 3W34A 1E9BA 3BL8A 5TF0A 4KJXA 3SOPA 1WS6A 4UU0A 1E5DA 3IT0A 4A10A 3HADA 4EPRA 1QH1B 1V8OA 1M1YE 1JXMA 1T1GA 2GPTA 3O73A 4FYMA 4UPDA 2H18A 5AOAA 4RBNA 3JPWA 3EGVA 1R8XA 4DMKA 2QV7A 5AICA 4GO1A 4PSCA 1LW6E 3GXOA 4UQOA 1C1DB 3E9EA 1YFKA 1Y4DE 2JGFA 3SI7A 1NXTA 5B1HA 1TMGE 4LV6A 4BP1A 4YJ2F 5A0FA 4B3BA 1ILEA 1GOTA 5FTLA 4RQBA 2JKZA 3VYUB 3WI7A 2V7GA 4YAOA 4Q02A 2WABA 3KC2A 3KQWA 4NYIR 2PL1A 5IJ9A 3WGYA 4NECA 2R66A 3CZPA 4INPA 1RLJA 4CL2A 2ZWPA 5C3UA 5EN4A 4F9EA 1W0CA 1Q11A 1L3BA 1YRBA 2OMEA 2GZ1A 2WTBA 2R7AA 2ZRPA 1GTMA 1KH3A 1RYMA 2HXYA 3IOCA 3KJZA 2C5GA 3KPVA 1ZH2A 4MYTA 4UAVA 3VPSA 4DW8A 4IILA 5LL6P 3KB8A 5LJLA 3QPAA 4JIGA 5AUOB 1C0KA 5EIBC 3K05A 1FL9A 3ONEA 4MCAA 4U5XA 4C7OB 3MN1A 1QGZA 3AUJB 2GR9A 3A8TA 1N2CE 3Q5GA 3HYSA 2J31A 1H2XA 2HSJA 1R66A 3ZD8A 1PGPA 2HXSA 3GI1A 2ZR9A 3ON5A 5AJYA 1J5PA 1ORVA 1CY1A 2WOOA 2ZJZA 3GDHA 1P2UA 2D1TA 3A9SA 1I4DD 1RNLA 2EBWA 4WOPA 4Q4HA 1UPUA 4XB2A 3ZWWA 4YDHB 1UFOA 1QFXA 1TYZA 1PFVA 5FLYA 2QX8A 4WMLA 1J33A 2D8MA 4FQ5A 4J16A 4JENA 4QBKA 5DBEX 1K3UB 4BGVA 1X1BA 5IZ4A 1XQXA 4YP7A 4KIGA 2VN8A 3O94A 1GWNA 4P5DA 2OQVA 3OJ0A 8AT1A 2GF0A 5D5PA 1QQAA 1DDGA 3CUEF 4MUGA 2QG4A 5DGTA 4DR6B 2VZ8A 1FFCA 4NE2A 2D2XA 4DEVA 1VLLA 3U44B 2OHOA 3M7IA 1AE1A 1NJGA 2BKEA 1NJ8A 3LS2A 2Z2KA 4MWOA 5I4IA 3CBQA 3NXKA 2HJ9A 4G8DA 1FLDA 3L4SO 4QTTB 5GVSA 5J1SB 1K66A 2XI4A 3RG2A 4BO8A 1ODJA 2PWPA 1Q57A 4IZIA 4FYWA 4J4HA 4XFJA 3WK5A 3P9RA 4I9HA 1KMHA 3MK31 2XBUA 1RXUA 3GCZA 1RADA 4AZ3B 1U1GA 1B4DA 1Z4IA 3FGOA 3D31A 4AF7A 1XZFA 4D4JA 1Z28A 5B2FA 4OYLA 3ZWYA 3SLKA 1E5VA 1C30B 3GBPA 1PK8A 3C8DA 1Z06A 2XNJA 4YS6A 1TE2A 3W5DA 1KVQA 4E08A 4PAWA 1G64A 2AOVA 3BMCB 3MJHA 4DADA 1V25A 5LYJB 1Y0BA 2OB1A 2QQFA 3IOBA 5C1IA 1XCJA 2FZLA 2GJ8A 2I4NA 1S9DA 2JFWA 4FSDA 5DPMA 3S7TA 2E9SA 1KYZA 2ZDGA 5H83A 3UM9A 3VKFA 4A5SA 2WAAA 1OBOA 4AN1A 5JEDA 4GG1A 2G67A 3F96A 5AI9A 5EKDA 2FSFA 2QVGA 2R47A 3ER8A 2R79A 1KPIA 3K0AA 3LC7O 3QA3E 2NVUB 3SKXA 4M83A 2RCYA 3VPDA 2PUCA 2P9YA 1YB4A 5CG1A 2WIBA 3GCGA 4WY2A 1N92A 4E5UA 1YU9A