3L1HA

Crystal structure of este5, was soaked by fecl3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
294
Chain Sequence
b'MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
total genus 101
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1hA00
1GPNA 4BB0A 3L1HA 3AUKA 4X6XA 5HQ3B 4MQMA 2QXTA 3V1KA 1AGYA 3AINA 1QGED 2GZSA 2QKYA 2XMGA 2H7CA 4FBLA 4DYHA 4KE9A 4QE3A 5D7BA 4QLAA 1VA4A 3H2HA 3FWHA 4HXGA 1E66A 4OU5A 1H2XA 1LZKA 1ZGBA 3PFCA 3ANSA 3WYNA 4X91A 3E3AA 2BCEA 3ZPXA 1K8QA 1YB7A 2ORYA 2R8BA 3C8DA 1E89A 1GZ7A 5AKXA 3LS2A 1YB6A 4EUSA 5KWJA 3A6ZA 4WDRA 2QJWA 1EVQA 1QIIA 5JZSA 2PSFA 4WY5A 4N8EA 4W1SA 1OILA 3GA7A 4H7EA 3DEAA 2WG1A 2WIGA 1NU8A 4LHEA 5AM3A 2XUQA 1LLFA 4OSEA 4FMPA 4AMYA 4KE7A 3KOOA 1MTZA 1L7RA 1N5MA 5AH0A 1XRRA 5BWCA 4PSCA 5DYTA 1EI9A 4LYEA 5ALUA 1VXOA 4S0XA 4UBNA 3PF8A 1W76A 4F0JA 4M0EA 1MO2A 2JBWA 1F6WA 1B41A 4I4CA 1PV1A 2ZJFA 3IBTA 2E3JA 2JGEA 3G0DA 2HDWA 2RAUA 3STTA 1GGVA 4DNPA 4Y2PA 3G0IA 1X2BA 3K6KA 5LZ2A 2VEOA 2VJBA 4X97A 3WK6A 2C7BA 3IUJA 2VJAA 5ALOA 3WK7A 2XUAA 1CQZA 1ETHA 2GBFA 3ZWQA 1YA4A 4W1PA 4FLEA 2CB9A 4LXIA 4NVRA 1CUVA 2BKLA 5CXXA 4C87A 3FYUB 4PV7A 2Z8ZA 1QIMA 5DTIA 4UBLA 4ZI5A 2WLSA 3IVMA 3WWEA 4AQDA 2VTVA 4I3FA 7YASA 1CUSA 1LGYA 5CRIA 3SK0A 2PUHA 4U2DA 3S2ZA 1YAJA 3OC0A 1J1IA 2ROQA 2HIHA 1UZAA 5AKIA 4BE4A 5A2GA 3D5EA 1EB9A 4XX1A 1QIJA 5ALQA 2B61A 1IZ7A 5AI0A 2G63A 4O08A 5EHXA 5CH3A 3AFIA 4GI1A 1SCIA 2XQFA 2DQYA 5D3KA 1DU4A 4HTAA 1H22A 3RARA 1XZAA 1N1MA 1LBTA 5F4ZA 1IUOA 5A6VA 4GW3A 1J06A 1E5TA 5FV4A 1FSSA 4C89A 4CCYB 2EDCA 3HXKA 3D2AA 4CG3A 2RI6A 4N5HX 1JU4A 2WU3A 4TPKA 4E15A 2IITA 4EZIA 1CFJA 4JNCA 3SX4A 2OCGA 1XZIA 2I3ZA 1IMJA 1CUBA 2ES4A 1ORVA 1QIFA 1NX9A 4QDUA 1AQLA 3OM8A 5LLSA 3BIWA 3C8HA 1YS1X 1EVEA 3W9UA 2I3DA 4AZ0A 4DNFA 4QDOA 3ICWA 4OU4A 2GBIA 2WHPA 2IIVA 3H2KA 1AURA 4KRYA 5HCUA 3DOIA 4MYDA 2HA6A 4H7IA 4IH1A 4Q34A 1ZI8A 4BZWA 4HRXA 2Y6VA 3C6XA 2HL6A 1CUGA 1THGA 1U4NA 2EDAA 4U2CA 2CZQA 2HA2A 4K6HA 2ZYHA 3PUHA 1QIGA 3FYUC 3I2JA 3WJ2A 5ALKA 1I6WA 1WB6A 4PW0A 2VAXA 5ALLA 3I2HA 4U2GA 2PSHA 3R3ZA 3WK8A 1FFCA 3DYVA 4IH9A 2YH2A 5CT6A 2XMBA 3EQ7A 4B85A 1MAAA 4MEBA 1Q84A 2RHWA 4G5XA 3D3NA 4C88A 2XUDA 1K5PA 2CJPA 5BWBA 3C70A 1DT5A 3C6YA 5CBKA 2PPLA 4X7BA 4QNNA 3MGAA 1OXMA 4DSZA 3B12A 4C01A 1FFBA 5ALGA 4MYSA 1TAHA 3D7RA 5AKZA 4KAJA 5LZ8A 2OQVA 5HFNA 3PF9A 5A62A 4QDXA 3DJYA 4AO7A 4QA9A 5K5EA 3D0KA 4NS4A 2GYUA 1GQSA 5D3ZA 1MX1A 1IUPA 1U2EA 1K4YA 1THTA 4FBMA 4W63A 4KR0A 1GXSA 3ILSA 1XFDA 3BF7A 5AKGA 3QPCA 1VKHA 5AK4A 4OB8A 4IHAA 4P9NA 3D2BA 3STXA 2CBGA 4G9EA 4I19A 5FDFA 4X95A 3IIIA 2HU7A 2C5GA 1XZEA 4BC1A 2HHAA 5JANA 1QTIA 1NU6A 3O4IA 3F9CA 5T4BA 3F8SA 3F96A 2D0DA 1LNSA 1T2NA 4LXGA 2WG2A 4YK7A 4DMFA 2HA0A 4DMHA 1MPXA 1YSCA 4H7JA 1Z68A 4N8DA 3R40A 1W1IA 5AICA 3AZPA 3ZLUA 1P0MA 5DYWA 5JZ9A 3W04A 3Q8WA 4Y2QA 4EY6A 4U2BA 4FLMA 4B6GA 5LKRA 4G8BA 1HKHA 2WM2A 4GDMA 2QTBA 4E14A 2CMFA 2O7RA 5AKHA 1WHSA 1GPKA 1AX9A 3MUOA 3TGLA 3LCRA 4H7DA 1XQXA 2QM0A 1TCAA 5J3JA 5FPQA 3VKFA 5FXMA 1QO9A 4KJXA 2QVBA 4KYVA 4BVJA 2VT7A 1QJ4A 1AC5A 1TCCA 3PE6A 5K3BA 4JUIA 4OUKX 4UBIA 4ZGBA 2QOEA 4UUQA 1SC9A 3DD5A 5ALXA 3NWOA 3OOSA 4DLNA 3E4DA 4OYLA 1JJBA 4B9AA 4X3CA 2DQZA 3FYTA 2G5TA 5C7YA 2WIJA 4BDTA 1ZD4A 2XMZA 3GZJA 4KACA 1CUEA 1W6RA 1EDDA 4Q1VA 1N5RA 3I28A 1L7QA 2PL5A 1DX6A 4B0OA 3CN9A 1DX4A 1WHTA 2QJRA 2HA3A 2XUGA 3UUEA 1XLVA 2AJCA 4IO0A 4J3JA 4F21A 1P0QA 2VF2A 5CW2A 4J0GA 1XZFA 3STUA 5JALA 1DQZA 4X6UA 4ETWA 1BN6A 1O6FA 3F98A 4NZZA 2JEZA 3RLIA 1CUAA 5KBYA 5A7GA 2XMQA 4QWMA 4DTCA 2WUDA 4X94A 5IH7A 3QZUA 3N2ZB 5AJHA 2OCLA 5CTAA 1CUDA 4K6KA 4DMCA 4UHFA 3G0BA 3K2IA 2AJBA 2C0PA 1YASA 5ALEA 5BOVA 1UFOA 4QEKA 3I2FA 5FPPA 1UT6A 1XRPA 1EXWA 5HQ3A 1QONA 5AKYA 4CIBA 4X6YA 3TRDA 3WIBA 1XRQA 4WFIA 1AKNA 1XZKA 2VJDA 3GUUA 3H1AA 3LP5A 4PO3X 4EY5A 1SFRA 1W4LA 3DS8A 2R11A 2XMSA 2XUJA 1CLEA 1VZ3A 2DHDA 2EEPA 4J0KA 3WWCA 3WWOA 3JW8A 1HL7A 5ALZA 1K6EA 1FFAA 5ALHA 2Y1KA 4M0MA 1X70A 4W9RA 3QM1A 3SC2A 4LYDA 3WKEA 5JAHA 1S8OA 2I03A 5ALSA 1ZJ4A 1GQRA 4J0IA 1KEZA 5SYMA 2WHRA 5EIHA 3QVMA 1WPXA 5EHZA 1LBSA 3WI7A 5E4TA 1N8SA 3CCCA 1XZLA 2JGKA 5I8PA 2WUFA 3C87A 4BAZA 1CUFA 1VXRA 3CXUA 1VLQA 4L72A 3STVA 5DWDA 2J3QA 3D4LA 2XMDA 5JD5A 2ZJ6A 5ALNA 3WL5A 2WQZA 3ICVA 2ZYIA 3KDAA 4BTLA 1HLGA 1VE7A 2CEKA 4HXEB 2IX9A 4QDTA 3I1IA 4AMZA 3I6YA 2BGNA 3LIPA 3JYHA 1XZDA 3WKDA 3STWA 3F67A 2D5LA 3G0GA 3HABA 3S8YA 1LPBB 5ALFA 1OCEA 3EF3A 5ALVA 5AIBA 4MWTA 4J0JA 1XRMA 2W22A 3MUNA 4Y2RA 1CR6A 4XVCA 2BUCA 4JEIA 3RK4A 2BGRA 5ALDA 2JGJA 3IUMA 4H7HA 1W75A 4BBZA 4UBOA 1CUUA 1LPNA 3AZOA 4H7FA 4TGLA 3CN7A 4WY8A 4QDZA 4RE5A 3QITA 1C4XA 2QUAA 2XUIA 2RHTA 2QXUA 3ZV7A 1KU6A 1O6GA 3KWFA 3X3HA 4KRXA 1U8EA 5AK5A 5DNWA 2XT0A 4X92A 4Z49A 3ED1A 5I9IA 3V9AA 4EB0A 5HF5A 2DCMA 5LIPA 2HM7A 4C6HA 1CUYA 4G4JA 1EK1A 3P2MA 1MNAA 2HFKA 3IB3A 5DLPA 1A88A 4DNOA 4B9EA 5JZBA 5JYCA 1UK8A 2WILA 5C81A 3WKCA 1G4HA 3VXKA 2JIDA 4H35A 1HQDA 4KE6A 1TRHA 1VOTA 1VA5A 1ZGCA 1D07A 4G9GA 3V1MA 2HU5A 5HZGA 3H2GA 1F0NA 4ARAA 1W52X 4DGQA 2GZRA 3AZQA 1QFSA 1QZ3A 1UOQA 4DNQA 3KWJA 2Z8XA 1USWA 3LIIA 1G5FA 3RM3A 3QBJA 4BP8A 1EHYA 1UKAA 4QWWA 3L1JA 5A7FA 1DT3A 4D9JA 3O4GA 2O2GA 1QTRA 5EHQA 1R9MA 3PUIA 3QMVA 3M3DA 3WL6A 1BN7A 5KREA 1TCBA 3FLAA 4K6GA 3U1TA 1GT6A 1A8SA 4UFOA 4ARBA 3V1LA 2BUBA 3BDVA 1ODTC 4GWLA 3T52A 5LZ4A 4QZVA 4HXFB 1GKLA 5AM4A 3FAKA 1LPMA 5CT8A 3HACA 2FJPA 2WJ3A 4F60A 1YS2X 1PFQA 2WTNA 1UKCA 1JJFA 3UMJA 4X93A 4OPMA 4UBKA 2ZJ7A 5AM1A 3RKSA 4Q3OA 3OURA 4FNMA 1RP1A 4Y2VA 1F8UA 5AI5A 3C45A 2XQJA 3DOHA 3PI6A 5K3AA 5FRDA 1CVLA 2B9VA 2JGFA 1JKMA 1TKRA 1KU0A 2QZPA 2H7YA 1Q0ZA 2PU7A 4UHEA 3DL4A 3FLEA 4Y9SA 3G9ZA 4FTWA 2Y2VA 4DSAA 4WCVA 4G8CA 2BAGA 4NMWA 5I7UA 4FDMA 4Y7DA 3I6MA 5C8ZA 5AI6A 1XQWA 3C6ZA 2HU8A 2XQGA 4ZREA 2DSNA 3AIMA 1E8DA 3MVEA 5AKJA 1XZBA 2ZYRA 1AUOA 1DWOA 1JI3A 4BRSA 2OGTA 4FFWA 5IVHA 2NW6A 1PJAA 4GEGA 3D2CA 2DFPA 4Y2XA 4BCDA 3UUFA 1QOZA 1XROA 3CCBA 2WU4A 2WIKA 3YASA 4GBGA 4EY8A 5DNVA 3DQZA 5CT9A 1X2EA 4BAGA 2PKYX 2H9YA 2PX6A 1WB4A 4UHHA 1LPSA 1JJIA 2Z3ZA 5EFZA 1CPYA 3IUQA 1QFMA 2QS9A 1UXOA 1BRTA 5AP9A 2AJDA 4J0DA 3WK9A 1DQYA 3H04A 2XE4A 2X8BA 3TJMA 2PSEA 3OTQA 3A2LA 4KAFA 3WWDA 3H2JA 3ZI7A 3D59A 4V2IA 4E11A 4ZRDA 2JF0A 3DDUA 4A16A 3IURA 5H3HA 1CV2A 2BFNA 1C7JA 2GBGA 2ZVDA 5T4HA 3VVLA 1ZIXA 1FFDA 4KAAA 5FKJA 1EDBA 3DL7A 2WJ4A 4HAIA 3FYUA 1BCRA 3WWPA 4JYMA 1EK2A 1CUCA 5E4YA 1XLUA 1QO7A 2GYVA 1FFEA 3O9MA 5JASA 1BCSA 1ODCA 4BCCA 2WHQA 4PF1A 3QMWA 1E3QA 1JMKC 2H1IA 1UK9A 3WYDA 1R50A 2Z3WA 3IA2A 3WJ1A 4J0CA 5A7HA 2ACEA 2QR5A 1YA8A 3FCYA 4AX4A 3DYIA 1E8NA 4FLFA 1QIDA 4Y2SA 3FOBA 4XIIA 4HS9A 5HK9A 2YASA 2PVSA 4MJ3A 5HF9A 1DTEA 4CIAA 1F0PA 3W05A 5C8VA 2C58A 1H2ZA 4LIPD 5LZ7A 1P0IA 3R3UA 3HLKA 3W9BA 3G02A 4WDQA 1AMNA 2PU5A 2WJ6A 4EY7A 1QIKA 1QIHA 2WTMA 3O4JA 3C6BA 4G4GA 4CI9A 1UOOA 1T4MA 4H7KA 1ZI9A 2W6CX 5JADA 2WKWA 4E46A 2OQIA 2OPHA 5ALIA 4UHDA 4GLBA 5E2IA 1XLWA 2HA7A 3R3VA 4BVKA 3BJMA 1E8MA 2PSDA 3IULA 1BE0A 2XUFA 3I2IA 4RE6A 2RONA 4LXHA 4P08A 1UK6A 2XUOA 4BAUA 5AI4A 3WZMA 4B81A 5ESRA 4X71A 2BJHA 1XZJA 4U2EA 4OB7A 1RYYA 3WL8A 2K2QB 3H19A 5AO9A 4BE9A 2OAEA 4PSDA 4XJVA 5ISMA 3EQ8A 3ANTA 4GXNA 4AO8A 2FJ0A 1K63A 5HKAA 1Q83A 3GELA 3G7NA 3IUNA 1FJ2A 4AZ3A 2I78A 4C4YA 3A2MA 4C4ZA 3BF8A 1UOPA 1XZGA 3K9BA 4G4IA 1CUZA 2HA5A 3FVTA 1CRLA 4U2FA 4HZGA 2DR0A 4DIUA 4HRYA 2C5FA 1MAHA 4IQ4A 1LZLA 1LPOA 4UHBA 4YPVA 4RPCA 1ZD3A 5EHNA 4WJLA 3HSSA 3C5WP 4RNCA 2QT9A 1EDEA 2QMQA 3BL8A 3HJUA 3BIXA 1ZI6A 3EBLA 2VAVA 4B80A 4CG1A 2HADA 3I1YA 2OLEA 1XZCA 3EQ9A 3R0VA 3HRHA 3WK4A 5A71A 1JMYA 4BVLA 1CIJA 3WQHA 3V48A 4FWBA 4B0PA 4ZV7A 5E4JA 3DKRA 5AK3A 4BC0A 1HBJA 5ALTA 2XUPA 2C0QA 1BEZA 4B84A 2XQIA 4TVKA 1DWPA 2VJCA 2WUGA 5T4EA 4J0HA 2VQ6A 4Y2YA 4UFNA 1CUIA 1R1DA 4UPDA 3DLTA 5DYYA 5IVIA 4J7AA 5LP1A 5EI5A 2FUKA 5AOAA 5AM0A 1L7AA 1ZOIA 2VSQA 1HDEA 1A7UA 2RGUA 2Z5GA 2HRQA 1H23A 1ZIYA 4ZV9A 6YASA 1XQVA 3G0CA 1Y7IA 4CCYA 4Y2TA 4EBBA 2V96A 4B82A 2P8SA 4Y2JA 1TQHA 2BUAA 4FNGA 3PFBA 2WIFA 3JWEA 4BTVA 1JFRA 2GBCA 5HKBA 5AKEA 2DHCA 1JU3A 4Q3KA 2OXEA 4N5IX 3WL7A 1R4ZA 5DNUA 3R41A 2OCIA 5EGNA 2XUHA 1BS9A 2X5XA 1RWQA 3WKAA 3QH4A 3DKKA 5ALYA 3A70A 3DNMA 3M81A 3HEAA 2G4LA 3VISA 4BDSA 1H2WA 3NUZA 4BYMA 3FSGD 1WPRA 1HPLA 3ESAA 5LZ9A 1WB5A 1C7IA 5K3DA 5FP0A 5AI8A 3G8YA 4BP9A 2OG1A 1LPAB 5CT4A 3VJLA 3I2GA 4PSUA 4A5SA 4X85A 1ODSA 2XI4A 5T4FA 2V98A 1ZJ5A 1SCQA 2RIPA 2DHEA 4AB1A 4BATA 3R3XA 1ZD2P 4F5ZA 3BDIA 5DJ5A 3GFFA 3BE8A 2OCKA 5IVKA 3KD2A 2OAGA 4AN1A 5ALRA 3BXPA 5JARA 1B6GA 1VZ2A 1J2EA 4FOLA 4YX9A 5JAUA 4P92A 3GROA 3BWXA 2XUKA 3GBSA 5BV7A 4HVTA 2WSLA 3F97A 1SOMA 1LPPA 2J4FA 2HFJA 1UKBA 2ECFA 3HYSA 3FNBA 1JT2A 2O2IA 2HRRA 3Q0TA 3AIKA 3VDXA 4WFKA 5LKAA 5ALMA 5K3FB 3H17A 4MXDA 5FOQA 4GECA 5CT5A 5CH5A 2GYWA 1DINA 2CUTA 1QIEA 4Y2UA 5YASA 2B4KA 4L3WA 3WZLA 4Q82A 1EA5A 4UBJA 3ZLTA 1VE6A 3LLCA 5ALJA 3BJRA 3C5VA 2Y6UA 3G9XA 2XB6A 2JGIA 1IUNA 4ROTA 2XMRA 4OB6A 3HZOA 4Q3LA 3O95A 3EIOA 5K3CA 1G66A 2XDWA 3VJKA 1VJ5A 1ACLA 2WIDA 5AM5A 5AKKA 2YXPX 3OPMA 1MN6A 4L0CA 3ESCA 1CUWA 3QPAA 3KXPA 5AI9A 1AZWA 5K3FA 2FX5A 1YR2A 2JGMA 2WUEA 2G5PA 3WA6A 3AILA 5KWIA 3FCXA 4OYYA 5AKLA 3G9TA 2Q0XA 3H18A 1XKLA 4K5QA 1A8QA 2VT6A 3R3YA 1Y37A 1MX9A 2C4HA 1CQWA 1BEEA 4OCZA 4BZZA 1YAHA 4H77A 1WCYA 2ONCA 3NGMA 5CXUA 3TEJA 1XKTA 5K3EA 4JH0A 3QPDA 2CKMA 2PSJA 1EINA 3H2IA 4H0CA 2AXEA 2ZYSA 4ZWNA 3ZLVA 2O7VA 4EA6A 4UBMA 1UWCA 5JD6A 3ESDA 4CFSA 1Q0RA 5HFAA 3E1GA 3WKBA 3WK5A 2JEYA 4G8DA 3O4HA 3QMMA 3QYJA 4UFPA 2Y2UA 4FHZA 4G1FA 1DWQA 2WFLB 5JAPA 1M33A 4UHCA 1SCKA 2UZ0A 4MQLA 2OGZA 3NOXA 3IDAA 3DCNA 2ZSIA 4QLOA 2WHPB 4OD0A 2QUBA 5IVDA 3WA7A 2X76A 4C4XA 1R88A 2ZSHA 3ESBA 3U0VA 4FFVA 3FSGA 4KEAA 5HK8A 4WFJA 2QRUA 3STYA 1Y7HA 1H2YA 1TIBA 1EB8A 5FLKA 4MWSA 2V97A 1MJ5A 2WFMA 5CURA 5C8XA 2AJ8A 2XLBA 1CEXA 5D6OA 1GKKA 4IH4A 2WFZA 4XWGA 4FKBA 4JYPA 1EX9A 4DM7A 4YASA 2B20A 4RGYA 3H0CA 4W1QA 1R9NA 4B7ZA 4AXBA 3HC7A 3T4UA 4AN0A 1TK3A 1IVYA 3AIOA 1ACJA 2WG0A 3VVMA 5HF8A 2OGSA 4K2AA 1MX5A 3R3WA 4CG2A 4GHWA 1WM1A 3W06A 1ISPA 5LZ5A 2ACKA 1MT3A 5ALPA 4AO6A 4P93A 4J03A 5JAOA 1CUXA 2AJLI 2JGLA 3WLAA 4ZXFA 1XZMA 3WMRA 1XRLA 2V9ZA 1ORWA 4MEAA 3E0XA 5ALWA 5DTJA 4X90A 4DMKA 2LIPA 4EHBA 1XQYA 2XQKA 3M82A 1R3DA 4X00A 5JATA 2PUJA 4BCBA 4PQEA 1MU0A 5IKXA 5EIEA 4W1RA 2XLCA 3PICA 3HI4A 3L1IA 3H1BA 4L9AA 5CMLA 2YYSA 1UK7A 3AJAA 4H18A 3N0TA 1A8UA 5CH8A 3B5EA 4INZA 3O0DA 1P0PA 4A23A 3W2TA 1G42A 1YCDA 4LKOA 5HF6A 3WIOA 3I2KA 3A2NA 3KSRA 3FLBA 3M83A 5AHXA 2PM8A 1XZHA 2VA9A 3FVRA 4N8SA 3C43A 1XRNA 1U65A 4BRZA 3FBWA 1ZICA 2H7XA 1J07A 3B3QA 1QLWA 4KE8A 2J3DA 4CCWA 5JD4A 2PBLA 3O9VA 3OG9A 4M0FA 3V1NA 1BU8A 4Q05A 5AK6A 3PDCA 2O2HA 1CUHA 3G9UA 5FUMA 1GPLA 1BROA 1QE3A 5AOCA 2WFLA 2J4CA 1CUJA 2XMCA 5AOBA 5LYYA 4ITVA 5JIBA 2HA4A 4B83A 1ZD5A 3VJMA 1IZ8A 1WOMA 2VATA 5AIAA 4PNZA 1MNQA 3SWWA 3I6ZA 1EH5A 5AM2A 5EIAA 4EY4A 5SYNA
chains in the Genus database with same CATH superfamily
1QYWA 4KU4A 1MKYA 1KFCB 3O8QA 3CJRA 3QFFA 1YHNA 1E58A 5C3MA 1R5OA 3DV0B 2KLHA 1TX4B 4ZICA 4MINA 1ZWKA 3U4MA 5HZMA 2GVZC 1QUEA 2YVAA 4HDKA 4RESA 3KFVA 5D1HA 1AGYA 1JQKA 4RH0A 3HYRA 4LZOA 5EIBC 1BKYA 2QKYA 3JQ6A 3SQOA 1WV1A 3TZBA 2H7CA 3W9SA 4CLXA 3PC4A 3IOMA 2FRVA 4YT2A 4UMVA 2G07A 4KE9A 4QE3A 3EN0A 5D7BA 2WAYA 4MPDA 1VA4A 2E4WA 3H2HA 2OSBA 3FWHA 1AB5A 4GZMA 4XPZA 1QQ5A 2I2DA 2QD2A 2HF2A 1A76A 1DBIA 1ZGBA 2ADFA 2VSXA 3PFCA 3WLJA 3H5TA 4FMDF 3SPXA 3TPZA 3WYNA 4X91A 3E3AA 3L0YA 4QBGB 3FE2A 3CEJA 3QLEA 1M10A 1K8QA 1RWMA 2GF9A 2ORYA 2VLIA 3VR3D 2A9QA 4AG6A 4IIGA 3IXQA 2REBA 4FFNA 4IXWA 4WZAA 2J0EA 3HO6A 2XT9A 3T4XA 1YQTA 5AKXA 5F77A 2AD5A 3DXXA 1S2LA 1B1AA 2AGVA 4N7RA 3Q9NA 1GPJA 4PX9A 4M53A 3AR8A 3A10A 4NATA 1T8SA 1S2DA 1ZS9A 1LWOA 5F2OA 5J5AA 3W78A 5DIZA 3IVRA 4CLOB 3N0XA 1ND6A 4ME6A 1HE8B 2CDRA 1EVQA 4EJSB 3WGIA 5IAKA 1QIIA 3OFVA 1TEVA 2AZ4A 1L5NA 2GN1A 4O2RA 4LS3A 4WY5A 4GKAA 2TMGA 4OP2A 1NR7A 4AWBA 4YCDA 1LDBA 1P1CA 4LZNA 3CB2A 3EWNA 1XN1A 2O23A 4MUXA 3L49A 4K81B 3UB4A 2EIHA 2V45A 4M4SA 3G2KA 5FOUA 1DIRA 4BVHA 1CJBA 1W0JA 4FMPA 3VPCA 4YUVA 3THXA 3HEBA 1L7RA 5AH0A 5MGNA 2NPFA 4RM2A 3UY4A 4ILKA 3MJRA 1IEVA 3VAAA 1DV1A 4LYEA 4E2ZA 2WNHA 3FWKA 3H6HA 2H4WA 3HXOA 3URMA 4UBNA 4NEQA 3TB6A 3PF8A 1C30A 2C2GA 4IKOA 4XB6B 2FG6C 5JH7B 1P9LA 4F3TA 2IOQA 1HSOA 1ID1A 1AXRA 2PWZA 1GDDA 4OSOA 4QYSA 1UPAA 1WX1A 3MMPA 3E7DA 1PYDA 3HJGA 1VJCA 3BHNA 2X2FA 1UKYA 521PA 3A36A 1Y1PA 2ZJFA 3P9IA 2QL6A 5CYFA 1F8GA 4ZO9A 4Z7QB 2FETA 4DV0B 2NLOA 3WHKA 2VK4A 2IPNA 4IIYA 4QO8A 2P9QA 3STTA 2QTNA 1GGVA 1KQFA 2ZJ8A 3CPEA 4L6CA 4LCJA 3G5UA 4OBEA 4K6CA 2GXQA 3JQ8B 1GPDG 4Y2PA 3UGQA 3X1DA 2PPVA 4BKMA 2WT9A 3VZDA 4UM7A 2F59A 4X97A 5KI6A 2A67A 2AYYA 1YT5A 2VJAA 2WAXA 1YRQA 3AF4A 3JQAD 5TC4A 3WK7A 5KSWB 3HB0A 1Q91A 3IEIA 1A69A 1CQZA 2W98A 2IZ0A 2PNFA 3BCHA 3NRJA 4AT1A 4HFMA 2C5HA 2QHXA 4CEIA 1FJXA 1XMJA 4WT7A 2A9KA 4YJ2B 2VP0A 4DC1A 3IAFA 5HZHA 3S55A 1IWPB 4M9ZA 4NHEA 4KREA 1XWIA 4YI5A 1H0KA 3O8DA 1BMQA 3K2QA 3GXOA 3PUVA 2P4EA 1CUVA 1U2SA 4MVXA 4XAQA 2FSVC 2GBPA 5EERA 5K2MA 3U56A 3N6VA 2CE2X 1B76A 2PD3A 2EJTA 5AXCA 3QJGA 3L7LA 4ZI5A 4MVJE 5BO5A 1G3QA 3ABOB 1U3UA 2OCAA 5H83A 5FTJA 5B58T 2VTVA 5AVYA 4PGAA 2LKDA 4NYJR 2R8RA 3OZIA 4QNRA 4I3FA 4RZHA 1GYPA 4IWXA 3I9V1 1FFGA 2AQ8A 3U44B 1L5YA 5I4BA 4XSGA 1TK2A 3MB5A 3EPHA 2NZ2A 2AF3C 1IK6A 3S2ZA 3PS9A 4B3JA 2XBMA 3OC0A 3FPHA 1PWZA 4EB6B 2REXB 5K6AC 1USKA 3NDBB 3D6NB 2FVYA 4FONA 4ZVNA 2K87A 2AFIA 2D1YA 2OGUA 2GN2A 2JJYA 2ROQA 2WPNA 2C04A 2EYUA 3CF0A 3KE9A 5EUMA 4ZVMA 4DYDA 4OGLA 4FYKA 5A4AA 4X65B 4BNUA 1LB1B 1O4VA 1KDRA 1A5ZA 2XPCA 4FYMA 3U13A 1EUQA 3R9WA 4ENPA 4UXHA 1F5SA 2PQ0A 2QLLA 3EIHA 3P4YA 1JDZA 3A27A 5TT0A 4ZO8A 1OIVA 1KGDA 1IZ7A 2QU7A 1H8EA 1W581 2JVIA 3VI4B 1UJBA 4M8IA 5CH3A 4CE6A 1AMUA 2AOUA 5EC8A 3RFXA 1W36B 3AFIA 4LNHA 4TZKA 2ET6A 3TVDA 1SCIA 1T36B 1P1KA 2BGWA 1ICIA 2IYQA 3SN6A 3H42B 1S2OA 4ER3A 4EKNB 4LGMA 4U7TB 2DWUA 4OHZA 3NBMA 1SK8A 2YY7A 3L7AA 2PFSA 1LRKA 5CFNA 2B82A 3TRHA 5THQA 4HTAA 4ML3A 1N0HA 4ZT2A 2PKXA 3IUBA 2GJSA 1EBBA 4LVCA 2IYTA 2Q6TA 4RY9A 1QFJA 2DH5A 2ZRLA 1X9IA 1I4WA 4ER0A 1NP6A 2ZUSA 3QPBA 3R5XA 3QUQA 4ZAYA 1VCHA 2RK6A 1GQ2A 3OP1A 1FSSA 2XHZA 1G7TA 2PEZA 5CIYA 4MI9A 4BX3A 3E9ZA 4FIDA 2PMFA 3FZQA 1Y98A 3LF2A 2NG1A 4CCYB 3GLGA 4KQKA 2NUTA 1FS6A 1JEJA 3RKUA 4D9KA 1KMHA 1O95C 1COZA 3D2AA 2GFHA 3EFHA 3V2UA 2EZTA 1FNBA 3SKVA 3TTVA 2ZSJA 2F2TA 4NP6A 1R0YA 1KIAA 1AE1A 3NAZA 4N5HX 2WT4A 2NWQA 4L78A 2JFUA 2WU3A 3H9EO 5A9SB 1HX7A 4TPKA 2ZT6A 2NYRA 3M9LA 4E15A 1UBRS 3D8HA 1ZJYA 2WBLC 3KQYA 1MIOB 2OZPA 4PPNA 1P7WA 1FRVA 1OFIA 2QF7A 3QHAA 5I9MA 3SX4A 1M2NA 1SG9A 1ZK4A 2W2NA 2ES4A 2PT6A 4ZVVA 4MUHA 4DDMA 3B1XA 4GOOD 1IPFA 1IHUA 4OH7A 3JZMA 4DV4B 3AESA 2OCYC 4XPIB 5BQOA 5SZJA 5CB4A 1R8YA 3QTLA 1AQLA 4H16A 5LLSA 4CEIB 1WCXA 4REQA 5FQOA 2J3EA 3K96A 3RH0A 3WRYA 1WZEA 5COQA 3RSCA 1JDBB 4GUAA 4KQ6A 3TIGA 2OKCA 1H1DA 5TJHA 4DIMA 2R7LA 1L1QA 4AZ0A 4DNFA 2WJWA 3H8SA 3JSXA 5CFLA 2JJ1A 2WHPA 3FVVA 1EZ4A 5ADVA 2IIVA 2RK3A 4CKZA 4OQZA 5JFTA 2PO7A 2P2NA 3IQIX 1FDTA 1AURA 4RA9A 4AK9A 1OB5A 2VHYA 4MYDA 1P2FA 4N3BA 3KK0A 2Z58A 4LSMA 2YFYA 3PYXA 1I6KA 2QMYA 4N9WA 4D8WA 4Q34A 4H9GA 4HRXA 4BZWA 3C6XA 2HL6A 3QVKA 1ZAKA 1HE3A 1NE7A 1U4NA 3QU7A 1C2TA 3UJ7A 4C21A 4HDOB 3K1JA 3UQZA 4TS4A 1GDHA 4DG8A 5IN5A 4C3ZA 2EKZA 1FDIA 5CB8A 1CJKC 3M70A 3S2FA 2F55A 1SELA 2JS7A 1E2FA 2G0NA 4WA8A 2W2TA 3ER6A 3LYHA 5CA0A 3TTWA 4U8GA 4Q1BA 4MI1A 3CF2A 1FDUA 1CR1A 3NDRA 1OF1A 1MIOA 3H9BA 4YLGA 3U80A 4XQCA 5AVZA 4KQHA 2QENA 3PYMA 3WGTA 4OKSA 2H4XA 1GITA 3FUCA 1N6LA 2C78A 3TPFA 1D7AA 2BVNA 1T1SA 4U2GA 2QUKA 2WSBA 3CX7A 4F5EA 1L7OA 1U3WA 2FEOA 2MTBA 3KQVA 3KCQA 4YPFA 1O6ZA 2QRQA 2X77A 4QXQA 4C3VA 3SHFA 3OJ0A 2VCYA 3BDAA 1LSUA 2H5EA 3ESYA 3QTBA 4EG4A 1A8HA 1TT7A 1TD9A 1RPNA 1ZM2A 4GNKA 2AUTA 2A57A 2FG7C 2JA2A 3R6GA 2FE1A 4CU5A 3TWOA 3NLLA 1YZQA 1CZHA 3GEBA 4FQ5A 1FYXA 1PFGA 2FW6A 4B3IA 5BVHB 4JITA 1CS4C 4FJ0A 2QVGA 4L3VA 3BA6A 1QFXA 2ZM5A 5ESWA 4PAQA 5DLQC 1CZOA 3KVNA 1E3SA 1PS0A 2VNJA 4MS3B 3JD4A 5DTMA 6NULA 2QIOA 3RK0A 1R5JA 4BL5A 3FI0A 3GFVA 5CA1A 2PIDA 1AHPA 2QD5A 4ITRC 4W6ZA 5HOEA 5AXAA 3C14C 3GF4A 4GOXA 2H2IA 4YIKA 5EXXA 4EHLA 1QHIA 2CL5A 4U7JA 2FEKA 4CF6A 3SIRA 3KAQA 4J2OA 4ARIA 3I37X 3RBAA 1YZGA 2DBRA 4RDCA 4FDAA 1T5LA 1TZMA 3DAFA 4F71A 4DUZB 2H4HA 1X92A 2R8OA 3MT7A 4L4RA 3B5IA 4URYR 2OBFA 3PK0A 4F2PA 2NV6A 4DSZA 1ITZA 4QOJA 3EGCA 4GMKA 3IOBA 3ZS9A 3B12A 3T61A 5KOIA 3T7CA 3U6BA 2Q99A 3OIVA 4E1AA 1QSGA 1E2LA 1GNQA 2EOAA 2KWIA 2UVPB 5AKZA 3NIBA 4GZ5A 1L4MA 4KAJA 2VO1A 2JVJA 1QFZA 2L0XA 3G49A 3T5BA 4EUHA 2NACA 3QIAA 4N9QA 4AJNA 4QDXA 3RRFA 2H17A 3PGJA 3KUKA 3KU4A 4K05A 4IDBA 4FR5A 1UXJA 2GD0A 2DFKB 3COPA 1D1SA 3KUXA 4I46A 4L5JA 3ABQB 5JW6A 2H0AA 1E79D 1QS0A 4XZ3A 3W4IA 2PX8A 5BN1A 3U26A 1XKQA 3PENA 5KDOA 4KQJA 4NS4A 4K9SA 1VYVA 3DPUA 1Q0SA 5D2CA 3B6EA 1GQSA 1HDGO 1VIYA 1MZPA 1XTSA 1EUZA 5CA1B 3HO1A 3UFBA 5E3HA 5FI0B 5C3UA 5DNYB 2WD7A 4N76A 3BJIC 3PNKA 2D1TA 3RC3A 4HL6A 4ENTA 1LCIA 2X5NA 4L0MA 4O2AA 1PQUA 4U7HA 4YMIA 1ZOOA 1MJGA 2TRSB 3A6LA 3SVZA 1YOVA 3U9TA 1SXPA 5IT5A 2AQHA 2CF5A 3EGOA 4X61A 2X58A 2MINB 2XGMA 3OA0A 3LBIA 4WZBA 4OB8A 5AQ1A 4IHAA 2ZYUX 4P9NA 5GJWC 3PKIA 2C7QA 1C7FA 5HFJA 2Y67A 1JE1A 2CBGA 3ENKA 5DEOA 4Z1MA 4L6AA 1EK5A 1ZGAA 2QLTA 1SU8A 5F21A 3VR6H 3AR4A 2VOEA 3D4PA 4MCJA 3U7FB 5JPDA 4ZIRA 1RKBA 4HEA6 4O4HF 4LMAA 2J5QA 4XD2A 3WLRA 3IP7A 3HLYA 2HU7A 3SLRA 1T1RA 2Y9MB 2G77B 1P9WA 2A5YB 2FFJA 4JL8A 2PYDA 2Y3IA 4JROA 4KLNA 1PGQA 3MIIA 3R1IA 1W46A 3MT9A 5FR2A 3PEYA 2FQXA 2ZRGA 1ES9A 1PT9A 2WJHA 2GK4A 1TAGA 3SEFA 4BMXA 3O4IA 1AQYA 4HDRB 4MK4A 4EHAA 2YNMD 2PH1A 5EYPA 2FDXA 3F8SA 1OX6A 1JSZA 4LHWA 5LWHA 3V7WA 3WLPA 2F8SA 4W5NA 1LNSA 2ZCUA 2AYZA 5F51A 1SXIA 2O4CA 1JEYB 1NYRA 3T3GA 4W5TA 2VPQA 3KALA 3RCBA 2XB4A 2AVNA 3M6VA 5IEJA 5HILA 3UBMA 2HUNA 1JEQA 4DMFA 2X7XA 3FW1A 3CH4B 1OFUX 2BKVA 3AL2A 4MAFA 4KL8S 3DJFA 4PY2A 3FHLA 1VPLA 2CV0A 2CLLB 3DVSX 2IYEA 3I32A 4QTTB 5CHEA 2WMOB 3I62A 1EGHA 1YSCA 1Q0QA 2Z9CA 3O1IC 4H7JA 4IIDA 4RHYA 5J2TA 4GD3Q 4D6PA 1ZZGA 1IZYA 1L5OA 2F64A 1BJKA 3L1VA 5KOJA 2PX4A 4BNYA 1HT0A 1W1IA 4DQKA 2H2FA 2P69A 2R6DA 5AICA 5K8VA 1NW9B 2ZVPX 2HOQA 3KO8A 4B3XA 4BP1A 1T25A 4ER5A 1JHQA 3W04A 3FYSA 3PL1A 2F9MA 2QSUA 3V8PA 4Y2QA 1FDSA 2Z6VA 2XF8A 4KZPA 3NNSA 4JLOA 1IPEA 4AUMA 1MDFA 4B6GA 1B26A 4EG8A 1ST2A 1HI9A 3WOHA 1X14A 3ERCA 5E0OA 3LY5A 4ARCA 1M6NA 2AXPA 1E9BA 1UIMA 2PK3A 4YUYA 2O7RA 5KHAA 4R1MA 5IU6A 1WUJS 1LDEA 4PCAA 1F38A 1WHSA 1YBHA 2F67A 2BKXA 5G0SA 3VNAA 5KNDH 1F7UA 1E7YA 2BBWA 1GTL1 3JQBA 2HX1A 4ZO6A 3UUWA 1VCIA 4D3ZA 2RGCA 1A72A 3B78A 3TGLA 4H7DA 4Q9NA 1GLVA 1HGXA 1ANKA 1N2BA 3OP4A 5TEWA 3TOXA 3ZE0B 3A1SA 5IXJA 5J3JA 2QBYB 4OLAA 1H4VB 1KFJB 1MUUA 4LOIA 3JS5A 2JASA 3EQZA 5D51S 3VKFA 2CD7A 4DY6A 4ZI2A 5JYDA 3H9GA 3JYOA 4FK8A 5K03A 2VWGA 3LUJA 4R2IA 4CM7A 4ENVA 3T8YA 5KPJA 2ZATA 3NTLA 4HFRA 3K9GA 4BVJA 1D4OA 7GPBA 1KJQA 4LZLA 3UGTA 2YL2A 3B1ZA 4O4HA 4AJJA 3MRTA 5CVVA 5BN4A 5K8UA 3I0MA 2ACVA 3QXSA 2WUWE 2IK8A 3PE6A 3F6SA 4DC0A 5LOVF 4JUIA 2CDAA 4UBIA 2X9NA 4UUQA 1SC9A 5DNDA 3DNPA 4WEQA 5ALXA 2REQA 3G2OA 3OOSA 3U3KA 4YRGA 4NJEA 3K09C 3E4DA 3T1HB 3B6ZA 3MELA 5ERYA 3GT0A 3NHBA 3IKJA 4QAJA 5LDGA 4E2FA 2H4ZA 3ZJVA 3QSGA 3VR2A 1VPTA 1BFKA 5CLHA 1FUYB 2D7JA 3FYTA 3NDPA 1ZU4A 1MQ9A 3AGPA 1Q0UA 1X1EA 3W5UA 1Z4QA 5C7YA 5J4KA 1N5LA 4KOEC 5DYIA 2QVCA 2XGJA 2IUSA 3GFRA 2Y71A 1VLLA 3PFFA 3VHXB 1IB0A 2R1TA 3FRJA 1E4EA 4XGQA 3PRYA 1HNWB 1SCBA 2WPDD 4Z9BA 1P1JA 4Q9DA 3R3JA 4IVRA 5HIMA 4II3A 4RFSA 1N5RA 1OBHA 3PDHA 4ZI3A 1D4ZA 5HG0A 5IPFA 4CLRA 1ULHA 3N6XA 3KOMA 1TLLA 3EXEA 3ZU3A 1U3GA 2Z2YA 1LDNA 2PKEA 4A3SA 2ZB8A 1DX4A 1WHTA 2X5JO 2WINI 4GYWA 4YGYA 3QSYA 2O8EA 4I8DA 2IHZA 2C99A 4CRWB 3W4JA 3JYPA 1T0PA 2YZ7A 2I2XB 1L5GB 3ZXSA 3CVVA 3AFHA 1D2RA 3CUWA 2AJCA 1QH8B 5K51A 4DR1B 4KQEA 3AM1A 1E98A 3LPAA 2DYKA 2QMUA 5FPKA 4BMZA 3NBUA 1E2MA 1XZFA 4GT1A 2BKUA 3WLOA 4D3FA 1XVUA 2WAMA 3A9WA 4EHJA 4X44A 3LT5A 4MV4A 5K0CA 5SZIA 4TYNA 2CLFB 4NZZA 1L7VC 2G5GX 1N6OA 2ZRAA 1MC5A 5TDHA 3RLIA 4ETWA 4ZK6A 1CUAA 5CA1F 2BDUA 3D3JA 1W93A 1FU7A 1UBFA 1WXXA 4IIJF 5E6UB 5A7GA 1NJ5A 1FSFA 1KFBB 2NZXA 3BGOS 3E22B 4LQDA 1PWYE 2NQ2C 3A4MA 2GB4A 3P45A 4OI1A 1RYDA 2FX2A 2G09A 1DKPA 3FDZA 4LTNA 1Y7TA 4O4LF 1R5BA 3H2YA 3IHKA 3SDSA 4B3DA 1A2OA 4GQIA 2JIZD 3N2ZB 5TXGA 5BOSA 5AJHA 2EBUA 1YR6A 1LBQA 1P7YA 1MG0A 2NUPB 1IATA 3IT0A 3ZNOA 4KXLA 5CTAA 1FNSA 1JAZA 1FW8A 5TS2A 1UBUS 1XA0A 1CUDA 1Z39A 4I1YA 4UHFA 2X0FA 4DMCA 1DELA 2BF7A 3B89A 2XYHA 1H8ED 3V7FA 4RD4A 5JSFA 1OFHA 4MV1A 5KQLA 2PBFA 4HQRA 1IMOA 1JG2A 1UFOA 1YJCA 2HI0A 2WA1A 4W8HA 5C35A 4OBBA 4RPHA 1UT6A 2IW3A 5FPPA 2G28A 4C4SA 4F96A 5A1TA 2GD6A 5IT4A 2HGZA 2Z2XA 4BYGA 4Z9YA 5HQ3A 2VEDA 1XBTA 4N3CA 4IILA 1ZSYA 4X6YA 3RV4A 3CNHA 1J0BA 1UMBA 2NU7B 4FFDA 4WFIA 2HCTA 1H0RA 1O9HA 2QRVA 3A37A 2Z1DA 3I0NA 4R3NA 4UNSA 4JOCA 2V7TA 5KTRA 1G8MA 2VJDA 2MYPA 5G0WA 1NP7A 2J3JA 5M5BA 5MN4A 5K0BA 5LUBA 2DCUA 4JEHA 1YR1A 2HSGA 5E9QA 3U40A 1AXEA 1A5SB 4EY5A 5ES4B 1SC1A 1R8JA 2VK2A 1NXVA 4ISCA 2EJCA 3KAJA 3BIJA 5ITVA 2R11A 3BKXA 2XUJA 4IIVA 4FYPA 4TVOA 1CLEA 3HXMA 1J5PA 5BN3B 4J0KA 2A9RA 3FFBA 2R751 1IAVA 2QDXA 3I2YX 4II7A 1SMKA 3SBEA 3SKXA 1T2FA 4QIHA 1L7MA 3T1OA 5HKKA 2BGJA 2YN2A 3F46A 3KHTA 4IDHA 2BDEA 3Q3GE 2NQ8A 4Y0AA 2BKAA 3RODA 4QTYA 5B1EA 7REQA 3N8KA 2R86A 4LGYA 3IP9A 5I7OA 5ALHA 4V0MA 1Z6PA 4UVGA 1P1HA 3IILA 3MJ4A 1DAPA 1FBNA 1M6YA 1RI5A 2HHCA 2NAPA 1BW9B 1NA5A 1X70A 3OQHA 3S5JA 4ABYA 4AS2A 4URUR 3QLUA 3HN7A 2WKPA 3K1AA 4HH1A 5EE5B 3EW9A 5FHRA 3UHJA 4YV2A 1JDUA 1GP2A 4RTPA 2AD1A 5IJWA 2B8JA 1S8OA 2B4RO 4JXJA 1RD4A 2I03A 1M1NB 4ZCRA 1PJ3A 3WMWA 1NASA 1LK7A 4D9BA 1EIZA 4NICA 3HJTA 5ALSA 2ZZKA 5F23A 4FZ5A 1TUEA 3L8GA 1S7GA 1H0SA 3HHEA 4G5FA 5BV2P 1WBBA 2B30A 5JQWA 1RAAA 4I1IA 2QAJA 5SYMA 4CZ2A 3UA3A 1YJAA 4JZYA 4CNQA 3PLAE 5EIHA 3RABA 4MW0A 5L4SA 2Q9BA 3T4PA 3P32A 5EHZA 1CETA 3PKZA 1Z0AA 3EIWA 1KZ6A 1Z6AA 2GTPA 3KZCA 4FHFA 5TARA 5GZ3A 2Q4DA 4PLZA 5EP2A 4FNOA 2NPIA 1SB8A 1LBSA 1PF7E 5E4TA 1QZZA 3LCVB 5I8PA 3UHFA 1T36A 5AW8A 2A8YA 1CQPA 4BAZA 3N0WA 3F73A 3BSWA 3FGPA 3CXUA 3AF3A 1ZCZA 2B2XA 2VNSA 4KOAA 4S35A 2SCUB 2HRDA 4MQ4A 5DH9A 2P2DA 1H85A 2V4UA 3PXDA 4Z8XA 1GPH1 1ODLA 2AOVA 3ZBTA 5AVVA 2J3QA 5JD5A 1ZVMA 2JC3A 4TV9F 3QBDA 3QYAA 3K9WA 5ALNA 1CE8B 2I29A 1JJ7A 2D5AA 1GEGA 4OI0A 1C5KA 1BGXT 2CDBA 1FUIA 1PU2A 5LQJA 1SQ5A 1HLGA 3D7NA 4WN3A 3IEVA 3OZ7A 4XVHA 4KBYA 2WUVA 3HJBA 2VQSA 4NX2A 4ZU3A 2IX9A 4ETMA 3I1IA 1RXEA 2IHUA 5ILOA 2QUJA 5LBIA 2ILVA 1X0XA 1ADCA 3I6YA 3PCTA 2XNJA 3A0RB 3K2BA 1N7JA 1Z0JA 1MQSA 2NO7A 3LIPA 1EU1A 2OFOA 3K4PA 3QE3A 4JMLA 4PC3A 4YT5A 2JFFA 4E2WA 2SKDA 2YHBA 5JNTA 2I9KA 1BD4A 5M29A 5IVPA 4O2BA 5DM2A 2VP2A 3OFND 5IUKC 3S8YA 5J9FA 4IPTA 5ALFA 5ALVA 5DLDA 1WA5A 3NHMA 2XSZA 3AEZA 4JOQA 4J76A 4Y2RA 2H85A 3T6KA 1KYTA 4JEIA 4CM1A 1VM6A 4Q4JB 3RK4A 2VHVA 3T1NA 1RABA 3GDGA 5I7VA 3OZEA 1UEJA 1HMYA 3LVBA 3QVWA 4QKQA 4QUBA 5EZYB 1Q77A 3IUYA 1W75A 5DHPA 1U7UA 1ICEA 4BBZA 1U90A 3C4QA 4R3UC 4UBOA 4V03A 2FCRA 2LCQA 4BMPB 3MMSA 3BORA 4JCCA 2K7ZA 4DQLA 2I6UA 4H7FA 3KZXA 5DCUA 5U4QA 3MHTA 2FJUA 1T5HX 1YB5A 1L4EA 1RXCA 2FTKE 2LV8A 1U0TA 2PDAA 4IOJA 1XI2A 2FW8A 4ZARA 1KJ8A 4RE5A 4Q18A 5FB3A 3QITA 2ODEA 3E27A 3UH1A 4PLYA 3F3YA 1H4TA 4MJLA 1BRMA 2QXUA 4LX0A 3ZV7A 1KU6A 2VH5R 3ESXA 4EYEA 2O3QA 3QU9A 3FZEA 1U1GA 4GP9A 1KDYA 3BE5A 3KWFA 1KP9A 5K0LA 3Q6NA 4PC1A 2EHJA 4GS5A 2RMKA 2BFBA 1KPGA 2ZR7A 1K89A 4JU8A 4PQRA 2Y93A 4X7RA 1YVEI 3K8YA 3RQSA 3S2UA 1XXLA 4X92A 2EP8A 3HDYA 4HQNA 5FFMA 3ZGZA 4MI6A 2GJ8A 1YCGA 3JASA 2GPJA 4BWVA 4B73A 5KTNA 4EB0A 1Z7EA 3V4PB 5JJLA 3QVGA 4TRJA 1BQ3A 4G23A 1Z56C 1AVTA 1FXSA 2CXSA 4ZDKA 3B9PA 1V5IA 2QG4A 3DLIA 3FB4A 3GWZA 1GO2A 4MVJG 3UMFA 3TF5A 3N6RA 1ZIPA 4UMDA 3F9RA 5FEMA 5CIWA 1JHVA 2JNWA 3VO8A 3VSAA 1LRJA 1Q1AA 5G41A 3AUFA 1TZBA 3B60A 4R9UC 1T15A 3MLBA 2GHRA 3DT8A 3PPYA 4HAXA 5J40A 4EABA 4D3YA 1J9ZA 3DHNA 3PD1A 2DPLA 2VHEA 1G6OA 3WJ7A 4B45A 3CLRD 4AROA 5LBUA 4KXVA 4HTFA 1X19A 4R7GA 4PONA 1PYGA 2PS9A 4RTLA 2KX7A 5BV0A 2B94A 4O2BF 2QSYA 1I7QB 1UFQA 3LSTA 8OHMA 2I2FA 1MEEA 3SS9X 1IVNA 4MYRA 3SQMA 1IL0A 4Q1DA 4HNSA 1JSXA 3NR2A 1D6SA 5C81A 4RMIA 1HQKA 1HG1A 1RXSA 4RXTA 4YXFA 3V2HA 2C5SA 5KOHB 4OFXA 1KYWA 1KARA 2X0NA 5DDIP 5DK6A 3IP5A 1G4HA 2PMBA 2WP0A 3TGPA 2ZANA 1DBQA 1PFUA 2RJ3A 1ZOPA 3FNEA 3K9LA 4OI2A 3DVAB 3LPCA 4EVIA 2XDYA 1HQDA 1E5VA 3D8SA 1T4DA 2I6SA 1HWYA 3CA8A 2H00A 1ZUNB 2ID7A 3WWZA 1ZVKA 3COVA 3ZV5A 4ZI7A 1UQUA 1VA5A 1ZGCA 3HCDA 4F7DA 4ASUD 3IJ5A 4MAAA 3SF8A 5C7IO 5L53A 1K88A 5B3LA 2J48A 1HF3A 3QE0A 2CMDA 1RBZA 2MSWA 3OBBA 1AKUA 3G1WA 4I50A 2FN9A 3TQIA 4ARAA 2DB3A 3SSAA 3EK2A 1UBLS 5FBWB 1AQJA 2GZRA 3GCWA 3AZQA 4UZEA 5EKTA 3RJ9A 1P75A 4FPXA 4BNXA 1QFSA 4CXMA 2HSEA 1QZ3A 3ZOKA 1QHSA 1UOQA 1T9HA 4Y1FA 3Q0EA 5FBRB 1PWHA 3R24A 3G1TA 1I3NA 4QHYA 3H16A 2RB4A 4D4JA 4B2YA 2WJJA 3LIIA 1N6RA 4RKEA 3FG9A 4A15A 3MLAA 2HR1A 3LQ1A 3NRBA 1CNFA 3AI1A 4IDPA 3BX1A 3QBJA 4TKVB 2FAXA 4P3XA 2OXCA 2JJ8A 3L8MA 1UKAA 2DMRA 2VPIA 3G8DA 1Y1QA 3L1JA 3ZJTA 3UMSA 4M6WA 4HV4A 2XR1A 1J6UA 2JFVA 3ZHUA 4BB6A 5L7YA 2OB1A 2RIRA 1NVKA 2GS9A 4US0R 5HNKA 4AJOA 2DKOA 3T35A 1XTPA 3C3PA 3VKVA 3IERA 1N0VC 5IWAB 4EYOA 5EXDA 1EP9A 1PJ8A 2WJAA 3GRUA 4XA8A 1V7ZA 2WKSA 4G67A 5KREA 3O84A 5DMHA 1K8RA 3FLAA 3D3KA 3CZ4A 2JFXA 1ZXLA 3UB3A 3IKLA 5I47A 2K5UA 1P3JA 1YI8A 4F3RA 2EFGA 3V1LA 2BUBA 3BDVA 4P5EA 1URPA 1NUTA 3KQNA 4LECA 3M4YA 2YNMA 1EWYA 2ZE7A 3M7IA 4HUJA 1NIPA 1XMOB 3MJCA 1TF5A 3UW3A 1MC1A 2IP4A 4EHHA 1G6KA 1QG2A 2EFHB 1Q95A 2ZJBA 2YCBA 3GPDG 4YTEA 1YVRA 4KHPB 3OF2A 2LZ0A 4A92A 5BWNA 4QTZA 3F1KA 3ZZNA 1V2HE 4FUTA 4BNNA 1QNLA 1D09A 3CF6R 5AM4A 2HEIA 1UMKA 1L4KA 5CT8A 4B3MB 2ZKLA 3VR2D 3HACA 2WJ3A 5JSZA 1KYIA 1RPTA 3BBLA 2Q5FA 3SYRA 4L95C 4TT3A 1UKCA 2BJVA 2WDZA 1QUFA 1WW3A 4XJTA 4AWAA 3QUBA 1DAIA 4X93A 3SYNA 4KQIA 1JIUA 3RHTA 5IK2D 2LNDA 2AZMA 1U0JA 1QM5A 4Q3OA 3JRNA 2BFAA 1I1HA 3ZV6A 3OURA 3ZDDA 4RANA 1E2JA 1NQOA 2HXGA 1SHJA 4N0MA 1SHZA 4NFSA 4FC6A 2BT4A 2KS6A 2X4GA 3CMMA 4J1TA 3TQRA 1MHTA 3S2GA 1HY3A 4G1MB 3OPYA 4MZXA 1EE1A 3PE4A 2INGX 5ITWA 2FP3A 2WYHA 5E7MA 1DCMA 1I8TA 1RM5A 2YXDA 2B9VA 5AT1A 3TLGB 1QANA 2P79A 1SHLA 2RBGA 1JKMA 3EVTA 1KZGB 4FMBB 1G9XA 3K05A 4IHKA 4KAXA 3WC4A 3ZW7A 3S70A 4KK4A 1Z0FA 4MKXA 2JAWA 2EBWA 4Q9KA 5EQDA 5IKOA 3RS0A 4EJ2A 2XEXA 4FCTA 4S1WA 3U3ZA 1Q0ZA 4C2TA 5IM4A 4UHEA 5JAQA 2A33A 2YBDA 4FYYA 2GRUA 3MGBA 1PKXA 1OT5A 4Y9SA 3G9ZA 4UU0A 4PZLA 4Y1RB 1E4VA 1M7GA 1PVDA 2PKQO 4KVZA 4L7VA 4TLDA 4D26A 3SR4A 4HP8A 1JECA 4XTRA 3B51X 2Q2WA 4OL9A 2GCOA 4QTUB 2X13A 4M7RA 2A14A 4FDMA 3UJNA 4YHHB 3I64A 5AI6A 4KIGA 1XQWA 1BHO1 3H1TA 4HWOA 4W4TA 5JNWA 3TRKA 4RJTA 3F5QA 5JXHA 5AR1A 3P2IA 4UZSA 1AM4D 2DSNA 4H6PA 3PNVA 1HQCA 3U3MA 2OD9A 1E8DA 2J09A 4EGFA 3HH8A 1NVVR 5IDVA 3ORHA 3JYNA 4JIMA 4Y9TA 4K1LA 3O4RA 5AKJA 1KI1A 1F8YA 1DG9A 1D4AA 2B4YA 4GUDA 2WVAA 1GLGA 2BFOA 1VI5A 2JLAA 3EC2A 3ZXXA 4AJHA 1O1YA 2D1QA 3LZDA 4RACA 5J59A 4MQEB 3BERA 3M5CA 1WKBA 1WE2A 3R6WA 4GEGA 1O95A 3CONA 4S24A 1VSBA 4FCWA 5A1JA 1JFVA 1H94A 3WYBA 4UNNA 5DGTA 3KSMA 1QGZA 4GBGA 5BSRA 3S1AA 3SOZA 4ENSA 3WLMA 5BWLA 4TVSA 1FXWA 4WESA 3K3PA 3KJXA 2CJFA 2AKAB 3SJ7A 3VMMA 3BXEA 4BVKA 3FTEA 4BN4A 1DBRA 4YFYA 3SX0A 1J2UA 5IF9A 2H9YA 1RCTE 1MRNA 3MJVA 4GC9A 3TJRA 4B32A 2XIJA 1E1KA 4FR2A 5KYXA 1QMPA 1UBEA 2I4MA 5IJXA 1CB0A 1CPYA 2QUIA 1XD2B 1P0CA 2PT5A 3DONA 4HBGA 5BYBA 3VHXA 2J0UA 3C8ZA 3CG4A 1F2UB 2EX1A 1G8PA 3GFOA 3LCMA 1TMOA 3GDFA 1OLUA 4IS3A 2AJDA 2XAAA 4O2AF 3ROZA 4BUCA 3H04A 4JLUA 1NVMB 1XAGA 4O4JA 3HK2A 2O2SA 1OLXA 2XE4A 2X8BA 1G21B 3O7MA 1DADA 1I7SB 1W2HA 4BUZA 2NXWA 4EVQA 3OTQA 1HYHA 4Z3DA 2J3HA 4JY7A 4KAFA 1JPUA 2BSXA 3I53A 4GR4A 3A4IA 3VFDA 4PHCA 3ZI7A 2J67A 4EUEA 4UNIA 3D59A 3QG5A 4HLNA 3WBFA 3DO5A 3GLUA 2JF0A 4DBZA 3WGLA 1OR8A 3IURA 1ONBA 4HWSA 1XCLA 3BEDA 1CS0B 2JANA 5ED0A 5H3HA 5LB2A 3VU0A 3ANLA 4AZVA 1KK0A 4TWAA 4OHBA 1C7JA 3QU2A 3P5BA 4M0LA 4L8GA 1EJBA 3VVLA 4B6PA 1YFLA 3DHVA 5HYVA 1FB5A 4R1LA 1CY6A 1FFDA 3FPBA 3ONNA 2FWRA 4ZQGA 2C7RA 2XECA 5AVQA 3OZFA 1X1BA 2BM0A 3KX2A 1RYZA 1G3MA 1YGYA 2UU9B 5F5NA 2F43B 3W7VA 2X0KA 1N8NA 2KW5A 2WJYA 4JUFA 1UDRA 1YOVB 1Z9BA 2AH5A 5H4HA 3WWPA 5CLFA 1ST3A 3RADC 1SG6A 3H05A 3KQTA 4NBRA 3U9SA 1WUTA 1XLUA 3IDZA 1Z36A 1KERA 2GYVA 3ETCA 3IPRA 3O9MA 2VXOA 1OTXA 3DLCA 3VAZA 4HMPA 1K3UB 1BCSA 3W34A 1ODCA 4BCCA 1RLIA 4I4TF 4CMIA 5BNIA 2Q1WA 3VZCA 2BN4A 3NCHA 3L40A 1PR2A 4CQLB 3HJFA 4RHTA 3WNBA 3WYDA 4YV0A 2XNDA 1R50A 2AFHB 1YK1A 4RPIA 3JAWA 5EAIA 5A5FA 3RC9A 2PCLA 4G5HA 4J0CA 1MW8X 2H9IA 1DO0A 2CKDA 5HQJA 3Q2KA 3KYDA 4A91A 1NNUA 1CQJB 1PT6A 1YULA 3MWKA 2BR4A 2QR5A 4G89A 4L8VA 4MMXB 5DHSA 3R8CA 3L0ZA 3SNHA 3FCYA 2PGAA 2QNIA 3L41A 2BE9A 2ZAIA 4JBHA 4PYLA 4MVJI 1E8NA 1ZD9A 2GH1A 1X7YB 3TW0A 5A5VA 5FBZA 1V26A 3SQDA 1NC1A 2V3CC 4NECA 1OBVA 2PUBA 5CX1A 2YASA 5ECGC 3I5AA 3LKDA 3W5BA 5B1SA 5D01A 2HSWA 3EDYA 3FOFC 2C4UA 1DTEA 2JFNA 1NLMA 3FNIA 2J30A 2GZ1A 4CQJA 1F0PA 3W05A 5K3OA 4LV6A 1W19A 1LLDA 5E2AA 5GIOE 4J0EA 1TKAA 4BNKA 2ZAGA 4U6QA 4HN4B 1TPZA 4LIPD 4AY3A 4JWKA 1KI8A 4AZWA 1E7QA 4O5AA 5ELXA 2FK7A 2CCJA 2JH9A 1U9JA 2ZBQA 3O74A 1WP4A 4YJ3F 3GLQA 1OI7A 1TQ4A 1ZGJA 4OHVA 5BMVB 3O75A 4WDQA 2UZ1B 3HCWA 1BS1A 3VAYA 1JYSA 2WJ6A 1E99A 1JFTA 5DXAA 4LC0A 1B15A 1TAQA 3SXUA 1XPJA 1TKCA 3NATA 4O2LA 4OQLA 3U17A 1W47A 3O4JA 4MSUA 2CVQA 2O0JA 4G4GA 1VE5A 2XYVA 2JH8A 2Z4SA 1CHNA 3HWRA 3PE3A 1J24A 4K6FA 4WW0A 1UOOA 3NJRA 2R8YA 1H1TA 4JX9A 4U8HA 3HR8A 3JQ8A 3KUUA 3L9XA 4XJSA 3PGMA 4GMGA 4RD2A 3SY8A 2A92A 5AVTA 3GZ4A 2J9YB 2WKWA 4QOEA 5B1HA 4MITA 3GPCA 5ALIA 2E4YA 3NRCA 4PLWA 2V6JA 3ZHYA 4EF6A 4M0CA 3K6SB 3KM0A 3NTRA 9GPBA 2CVPA 3IOCA 3U0BA 4CU2A 2DQ4A 1PGNA 3UWPA 3Q2IA 1PLLA 2X8AA 4ZHSA 1XU4A 1ZX1A 4UJ3A 1S2GA 2FUG6 4NZNA 1L3CA 1ZN2A 1YVPA 3KPJA 1QHYA 1X7WB 2KSQA 2HJ9A 5LL6P 2WYWA 3ILVA 3FLMA 1P2GA 5BOSB 4O4HB 4CVNA 4TRRA 4YMVA 2DBQA 4CL2A 4BQPA 2VSYA 3VPFA 3HVUA 4BV8A 2G88A 2UXBB 4JLSA 1ONPA 3U7EB 4EJ6A 4C03A 1B8OA 1NY6A 4DBLC 1SQSA 5CDGA 3TBHA 1U8UA 3HR7A 4LXHA 1CNEA 1B16A 2MDTA 3HB1A 4JUAA 2ZB3A 1HRDA 1E3WA 3DSRA 1C7ZA 4G3XA 4N12A 2Q3CA 3HSYA 4K9PA 3ZV4A 4B81A 3ZEIA 2H2GA 1U99A 2QQFA 2FGJA 1DO2A 2O07A 3CLSC 1E20A 3VYTB 1Q19A 3WL8A 1R5NA 2X23A 3A4NA 5DGDA 4OM7A 3RANA 5IT9A 2ZBRA 4QRHA 1HDYA 3S68A 3WBBA 2MYUA 1X80B 1H93A 5E1MA 4NDZA 4R5MA 4F72A 2FN3A 2L69A 4YIHA 1PJBA 2J9FA 1NURA 1Z0IA 2OAEA 1UWVA 4FHGA 4ETNA 1T1GA 4PSDA 4TLCA 4WNIA 2CHUA 3GJZA 3DDZX 1P5ZB 2TECE 4DR7B 5ISMA 2VUTA 1MB9A 4Q6BA 1W34A 1ZDMA 3ANTA 4D8VA 3OX1A 3D7LA 3F2IA 3LUGA 2GNOA 4PVDA 3DCIA 3UH0A 4Z4IA 4X94A 1E2KA 1PYOA 3MJFA 5CAEB 4RTMA 4B7AA 1Q83A 2G70A 4RKRA 5LQUA 5F5XA 1AKWA 4MJXA 2B36A 4M7OA 2O1EA 2EFDB 1PR1A 1I7NA 2SKCA 3FA2A 4YMLA 1O87A 5FD8A 5TVKA 3IUNA 1TLFA 4I5IA 3DWGA 1V1MA 4YEDA 5M3BA 4AZ3A 2FWAA 2O8NA 1DC3A 1UJ2A 3A2MA 4FGSA 3GGCA 3S40A 1Z5OA 3BF8A 1LF5A 4MIEA 4DXAA 4CMJA 3I45A 4RD3A 5BUSA 2QT0A 4I1VA 2VK8A 4I0WB 3DBHB 3CLHA 4U5XA 3RPEA 4B2IA 4AF6A 1RBMA 1O57A 3HY3A 4AJ9A 3UHAA 1R0KA 4IWYA 4YAJA 3O26A 4DIUA 4RFLA 5B64A 2ONYA 3T3IA 3CNEA 3PKJA 4HRYA 2C2KA 3AUJB 3F8WA 4IQ4A 1OY1A 3ONWA 1N0IA 5BW6B 1M1UA 5D7NA 3CVJA 2ZITA 4ND4A 3W5SA 4JL5A 2J9FB 3PHBE 4AJ1A 2KB0A 1UQTA 1E3JA 3MFYA 4YPVA 4YY3B 5AVJA 1Q22A 1BMFA 1ZD3A 3CYFA 2GEKA 4IZ6A 5T3UA 1OA1A 3EGXB 5J23A 1G7SA 1KSFX 3PJEA 1ZINA 2CDCA 4YUWA 2YWGA 5EHNA 2BIFA 1Z2EA 3F71A 5F76A 5KWEA 1E4EB 1TJ5A 1T5TA 2HDOA 1T1EA 1ZMBA 3HWWA 1FRZA 2YX1A 2Q7XA 4RZUA 4Y98A 5EJFA 1C14A 2H6EA 3A04A 1RI4A 3NX4A 5HMLA 3NI2A 1NXQA 3OKAA 4JT4A 4RJ2A 5A4JA 4QOIA 5JCJD 3EBLA 4FWTA 1JXMA 4BXOB 1N3YA 3KLOA 3VV3A 1RC1A 4PS1A 4RPJA 2ZWAA 1EFVA 2HADA 3A3OA 2JA1A 3H7AA 3EH1A 3T95A 3D6TB 4S1VA 2HO5A 4MA5A 3LVQE 3U4HA 5EJ4A 3EEOA 1Y6QA 3RSSA 4UD6A 1U02A 1U8TA 1X7WA 3A6HA 1P91A 1PUJA 3MJDA 1XMQB 3EOZA 3NC1C 3TSAA 3V7YA 2G40A 3Q41A 4W5WA 4YAWA 2O48X 2XVAA 3OUUA 1E59A 4HQ0A 2QNBA 4ZRMA 3FTPA 1Z88A 1GV0A 2E7ZA 2A59A 4KN8A 2JAOA 3F90A 1JMYA 4UAUA 1CIJA 1LTKA 1UM8A 2PMEA 4R6XA 2HIMA 4OV6B 4ZV7A 2O20A 3ZLBA 4NMLA 4QUHA 1T8RA 1WLSA 1ZRNA 5E3IA 1OU4A 3C4VA 2UZ3A 1XJWA 1A9YA 1BEZA 2LWIA 2AZTA 2HWKA 3ER9A 1US8A 3TI7A 4B84A 4JGIA 1JQEA 1JFFB 4MIKA 1H2BA 3RSFA 2VYNA 3KZKA 1T2AA 3KKKA 2AC2A 4DT1A 3AVVA 2FFQA 1JAIA 1MORA 1RMYA 1ADFA 1QNFA 2ZIUB 3GLVA 2VQ6A 1KVUA 4Y2YA 1U3TA 3SYKA 3KVVA 4J90A 1BX1A 3A25A 1CUIA 2GESA 2VDWA 2WJVA 2XNCA 2C94A 1B6SA 3G8AA 4AKHA 4J4BA 1IZ0A 2Z1NA 4LTDA 3WGYA 4COKA 3HRKA 2FZGA 5BVGB 3UOWA 3C7AA 4U7PB 1KDVA 3RIYA 1ZOIA 1PSWA 1HDEA 2RGUA 2JL1A 2Z5GA 2ZDQA 3DG9A 1E2EA 2BLLA 4YJHB 5EMHA 1G291 1B3RA 5C1DA 2ISSD 1P4AA 1A9ZA 2VTEA 1ISIA 3IV9A 3WGKA 4YRMA 2ANBA 2DBYA 5IMBA 4DAOA 5JJCA 2RHJA 3A9TA 4FB5A 4M36A 4KLRA 4DPLA 1KWGA 5C5CA 5C1PA 4U0JA 4IYJA 1NW5A 5CJPA 1WTAA 1EMDA 1XQVA 2AMVA 3LT4A 4LDRA 2AZXA 1BGWA 4CCYA 4HNQA 4WI1A 2PQMA 3EGWA 2WM9B 1LDMA 2FX3A 2QVXX 5IUNC 5KU1A 1AMOA 4BP3A 2VQ3A 3I9OA 2BI7A 2P8SA 4U2KA 3MTIA 1X7XA 2F7SA 3S2YA 1CZNA 1NVDA 2WSSD 2RGNA 3PFBA 1JFFA 1OX5A 1TEHA 3IESA 5LUAA 5FAXA 1SPXA 2BCGY 1VYUA 3AEQA 1P9RA 4N7BA 3HYNA 4UEQA 1PJRA 1JYEA 4WCDA 1M75A 1JDBC 4Q3KA 3IE0A 2OXEA 3N5KA 4N5IX 1CZRA 1R4ZA 3KAPA 2GCGA 3KVRA 1N92A 4WD3A 2IV2X 4TN1A 3WLIA 2F62A 1YJBA 4G36A 3TZQA 2FF7A 3OMLA 4EHIA 5KDLA 1PJTA 2VHWA 1RM4A 5FWDA 4UEOA 3WKAA 4MVJP 1WXGA 2F4VB 1T4CB 3QH4A 1R15A 3IP3A 1CSEE 1G20E 2LXNA 1JSRA 2X6RA 3DNMA 4QUAA 2WKRA 3M81A 1V25A 2G4LA 4BDSA 4P3PA 3W2HA 2OHXA 2YJTD 3EQ6A 3GPIA 3VM6A 3PGXA 4Z86A 2I8CA 4BYMA 4UOZA 3I23A 5FL7D 4BU1A 1XEAA 3GLTA 2OXRA 1PNVA 3AHCA 3IVCA 4CFYA 4KIFA 2P6UA 4MW7A 4ZXPA 4LJ8A 2Y76A 3I04A 2GM3A 5L4LA 5BP7A 4WINA 3W5DA 3FFWA 2CE7A 1VPDA 2VKTA 2WAAA 4MPTA 3TQCA 2QRPA 5CD9A 2R7KA 5KU7A 3AO0B 1JBEA 1E9CA 2HCFA 2A4KA 3N2KA 1GCOA 1N3LA 1QR2A 3I2GA 2PL3A 5JS8A 1XB2A 3HNOA 4WK4B 5CA0B 4EO9A 4OHPA 3NXSA 4H3SA 4LRSB 2MINA 4ND5A 3LUHA 2BP7A 3H0KA 2A58A 1N2OA 4WLFA 2TMDA 4M1TA 5H81A 2DSTA 5JTTA 3EIFA 3G8BA 1N1GA 4DLUA 2QIPA 5E7IA 2P0YA 3UANA 2ZBFA 4CQMA 5FNZA 1ZXXA 3R3XA 3UWMA 4HPJB 5FPHA 4C2BA 1ONOA 3GGDA 2GRAA 4ZT6A 2V5VA 3BDIA 4F5ZA 3OFKA 4XXHA 2VYVA 4RLFA 2O8FB 3BE8A 4LYAA 4RTKA 2TS1A 1YQDA 2VZ8A 3WQSB 4MDYA 3KD2A 4FOOA 1DWUA 5LA6B 2GASA 3ZUPA 3U19A 4NBWA 2OAGA 4AN1A 3SZ3A 4O4LB 4IAOA 4E33A 1B6GA 1JNXX 2OOKA 5C7LO 2AYXA 1L4GA 2HMYB 1ADGA 3AFMA 4QGAA 1UDAA 1BKSB 2F9FA 1ZJJA 2Q5JA 2ZRQA 3BWXA 3CZAA 3LNTA 3PSAA 4YP6A 3VZRA 5JC1A 1O6CA 3GBSA 3SEAA 2ZS8A 5LNK1 3ONVA 2YIVX 4L85A 1KFEB 1LK0A 3BFKA 2B25A 5CDYA 3BILA 2IUYA 3FYDA 2FPIB 3F97A 4DKJA 2Y9PB 4G85A 3TBKA 4DL9A 1T13A 5IKPA 1XJCA 2J4FA 2YMLA 5JE8A 1FQKA 5SY6A 3CEPB 4Z4FA 2AHOA 1TEZA 4CMEC 5IBRA 3UK2A 1JT2A 2AMJA 4A2CA 4BLUA 5BW8A 1YACA 3OBIA 1IDN1 2NUAB 1W4ZA 4J1SA 8LDHA 3MD0A 3AIKA 3FHOA 4WLUA 5D5QA 1EWQA 1NQUA 2P75A 2N47A 4TMXA 3TTUA 5KB3A 4DLKA 1JQDA 4G81A 3H17A 3NWPA 4CM4B 2HREA 4L2IA 1JTVA 2C61A 1J0DA 4FOSA 1QC5B 5T8KA 4DS3A 2IZ5A 2TYSB 1G7CA 2XNDD 1SOAA 2DT5A 2MSLA 4GECA 4TQGA 1A5TA 4YP7A 5CH5A 5C4MA 3PGLA 4BBPA 2COKA 1N3IA 4MUFA 1UBSB 3HWX1 2QX7A 4LOAA 2B1IA 4NQZA 1N2SA 2HDNB 2H2HA 2F1RA 1KY2A 1RRKA 1SH7A 2DJ5A 2XCLA 3AR2A 1E6WA 3B1WA 4O8CA 2ORVA 1SVIA 4HQOA 1VE6A 1KMQA 3AC0A 1OZAA 1GCIA 3IEUA 3LLCA 4FFMA 5HWSA 3RU7A 2OG2A 2YINC 3B6KA 3H99A 1QV6A 2NTYC 2NZ8A 3G9XA 2JGIA 3R7SA 3OU6A 1ZUNA 1ZH2A 2MJLA 3GRCA 3IXMA 4AKSA 3LNCA 1JVBA 4ROTA 3TLYA 3W5JA 3B6JA 4BRWA 1KH1A 8ABPA 2LP4Y 4O4JF 5BQFA 3U7RA 4DWWA 3BHJA 1BWSA 2HK9A 4S1TA 3PUZA 3JQ7B 4GOMD 4ND1A 1C8LA 2VIIA 3PNMA 4OB6A 4AY5A 4CI0B 2C2XA 1CEQA 4M8LA 4Q3LA 4JUCA 3WB0A 5DSTA 4BNVA 5BPHA 4WAUA 2AFIE 2D2VA 3AV3A 3I12A 2EBHX 3OJFA 4XX0B 4DCTA 4RQBA 2IW1A 3UKJA 2GZMA 4O0LA 5ECDA 5JNLA 4J4TA 4RHCA 3RHFA 2N1MA 3ELWA 2NSDA 3OPMA 1CBUA 1XEWY 5C8YB 4AYWA 3QPAA 3LJKA 5AI9A 1VTKA 2IPXA 2WF5A 1M2OB 3HGMA 1DRVA 3QU5A 5BUCA 4QM7A 4D5GA 2AEFA 2XB8A 3JXEA 4ZZ1A 2BFPA 5EKUA 2VR1A 3RS2A 3L8FA 4M8KA 3L01A 3VYWA 2RH9B 2YYYA 4PG8A 2VQEB 4NNJA 3LY7A 4KKVA 4YMTA 4N0QA 5DFAA 4CT4B 2IOFA 4OLHA 2Q6KA 3NOQA 4N82A 5BN5B 3R7DA 4BMSA 3LP6A 3K72B 2JGMA 3WISA 2G5PA 2J31A 3ZGYA 3ZXIA 4I1UA 1KNQA 4BO8A 4EO7A 2EW1A 4G1VA 5LB4A 3H5OA 1I94B 1EQ2A 1XL1A 3R7WA 1U81A 1GRVA 2YJ5A 4FGKA 1TM7E 2GN0A 3JWHA 1U3VA 4DLAA 1FRQA 5B4UA 2Q0XA 3FF1A 2EZ4A 4YONB 1NM5A 4TMZA 5G0VA 4K9OA 1IZ9A 4Z53A 1TFRA 3DDOA 6GPBA 1XAJA 1Z37A 2Y27A 4G1BA 3HS3A 2DF8A 3PX3A 4P0PB 3ADDA 9LDBA 2O8EB 4QHTA 2RKBA 3HHPA 3UJ8A 4DC9A 4QDKA 4PLVA 3R3YA 1MX9A 1PQPA 3ZR4B 1X7ZA 3GD7A 1VHJA 2E87A 3O1LA 4QUJA 4D98A 3A58B 5CFOA 1T0HB 5KNBH 1KRXA 4KDRA 1WCYA 4FGJA 5KQSA 1TL7C 1ZNZA 2D0OB 4NCJA 1U8ZA 4LXTA 1R4NA 3TEJA 5CXUA 2BELA 1MVNA 5K3EA 3BGDA 1I7DA 2FXIA 3P2OA 4M1MA 9ATCA 3OTHA 3B70A 3W3AH 4AWXA 1OH5A 2OGWA 4H0CA 5FADA 2VJMB 2IEBA 3NTOA 4D56A 1L9XA 2Z6QA 4ZAXA 1LBHA 4X0EA 3KS9A 2I7DA 3WICA 2AXEA 4GSLA 3WHLA 3PWTA 5L7WA 3QX8A 4OJMX 1C3XA 3LP8A 1S3IA 3GDHA 2GMWA 3SJCA 2D5CA 3MYYA 3E3NA 2QPTA 4J4HA 4F12A 3DXZA 5T7BA 1D2NA 4CBVA 1DJPA 1KR5A 2GD1O 4KN5A 1NYLA 3AEYA 3UYKA 4MS3A 4CFSA 3E1GA 1H3NA 3K0HA 3WK5A 2X40A 3G2IA 3WMXA 4G8DA 1JKIA 2VZLA 3D7SA 5E95A 4NY1A 1MQAA 4DEYA 3S3TA 2Z5VA 1Y48E 5IAEA 2XY4A 4CR6A 1OXKB 4UTNA 1Y6RA 3W6OA 1M33A 4TTAA 2GCPA 1QGUB 1U0SY 2IQIA 5AWFC 2JLXA 2W6NA 3ACDA 5KNDD 4TZ6A 2R65A 4XWKA 5K01A 1SCKA 1WABA 2UZ0A 4AYTA 2JBHA 4R1SA 2VSFA 2ZKIA 4WNAB 3LXUX 2V1XA 3AI2A 3VR5H 2OO7A 3RREA 1BWPA 4US2R 2BJWA 2OTCA 5JYBA 4UUAA 3IDAA 3H9JA 2Q4EA 3DCNA 4DABA 3D3WA 4JB3A 3NHAA 4KB5A 5AW1A 2OZEA 1NF9A 1SBCA 3ENWA 3GWGA 2X76A 5JS2A 1NQAO 4NXNB 3CH6A 3AJRA 3IGFA 1I4TD 4C4XA 4DLPA 4E3WA 1WQ4A 2XWQA 3ST7A 2YQZA 4MUKA 2D74A 1CKEA 1TU4A 3RYIA 2RGYA 1KEUA 2R6GA 3TLJA 4KEAA 1MJHA 1EXNA 2F1HA 2A5LA 3G17A 5HK8A 3DOUA 4X8OA 4ERNA 1A98A 4RS4A 3RS5A 2YC2C 3O8QB 1W5EA 1L4YA 2GM5A 4PX2A 1H6AA 2QRUA 2G8LA 4HWKA 2I4OA 4IJMA 2B34A 5A4MS 3KR2A 2F3UA 3H8WA 2LUOA 3SHWA 3RVMA 3KQPA 3BMCB 1MH9A 3QGMA 1QX4A 5EKSA 1GZUA 2ETXA 4ZKEA 1I2AA 3OEHA 4PZEA 3TX6A 3ZH9B 2RGXA 3ZZ0A 3LBAA 1C41A 1ZOSA 2NU8B 5AVSA 1ZIOA 2WFMA 5E6RA 3ZTYA 3BL6A 3ZHRA 5CBPB 5C8XA 3G82C 1DPGA 4U39A 1VYTA 4NCBA 3PCRB 2PG3A 3D4NA 1CEXA 2BR5A 4P81A 3EISA 4IH4A 4XWGA 1NDUA 2Z2IA 4JYPA 1EX9A 3V00A 1KS2A 1NDQA 1F5NA 2FFBA 5B3KA 3AFOA 2AOTA 3FWYA 2YUTA 3NOOA 3DB2A 4GSKA 5EJIA 3ZH2A 3WO0A 2EVWX 1XMVA 3I9LA 4DRZA 4EPTA 3JARA 4B7ZA 4AXBA 3ZGXA 2V0GA 3LK6A 2N46A 6REQB 4MW1A 1XYGA 4RTSA 4IVNA 3T15A 2E4AA 1ATIA 3SYLA 3LT1A 1I30A 1ACJA 2LVBA 3VVMA 3FOWA 3HFRA 4CG0A 1GTZA 5HF8A 4NU0A 3FCEA 3KZMA 1MX5A 3O1JC 3LLVA 3S29A 1XTZA 2W42A 3H3XA 2IZ1A 4MQFB 2FZWA 4N47A 4L5IA 4LF7B 3IMEA 3O38A 1I3LA 4GXQA 1XE3A 1OX4B 2HIGA 3UNXA 4CG2A 4DV6B 3LVRE 3A6JA 4E07A 2CL6X 3FDZB 3L6OO 2IBSA 1YZ3A 1NC3A 1AG9A 3KT6A 3LT0A 3E9RA 4C0BA 4M1SA 1HE2A 2ZI3A 2W6JD 3WZ2A 4MUGA 1E69A 4L1KA 5AXBA 1YQUA 2VFAA 4P93A 3BHMA 3HXQA 4R01A 4KNYA 2BHLA 3GIWA 3BMXA 4NZ9A 1E5LA 2HPZA 5DI3B 5BSEA 5JRZA 4Y9RA 1D2AA 4XGKA 3KEGA 1YDFA 3U3RA 2NP6A 4HX2A 3SLGA 2OCXA 5IN4A 2GSDA 3HJCA 4IZHA 1SKMA 4ACAA 1MXFA 3IV6A 4PWYA 3K0BA 3UMCA 3VO9A 2IOYA 2V9ZA 3N53A 2QR3A 4PXYA 5I4KA 4YRPA 1GTG1 1WMDA 1L5MA 3LU1A 2IE0A 2JKVA 1EFTA 1HNXB 4NAHA 3LOPA 3THSA 4O25A 1VL0A 2PAAA 4Q4AB 3VVCA 2ZBPA 4DIEA 4PIVA 4DMKA 2LIPA 2VJLA 4EHBA 4P3KA 4R83A 3IFSA 1SC6A 3PNYA 2WKQA 1DE0A 4G5QA 3RNOA 4XM0A 3M82A 1PJ4A 4RVDA 1P5RA 3EULA 3B8EA 4GM4A 4I9HA 3U9LA 3PFWO 5BRJA 4TQAA 4EW3A 4PN3A 1D04A 1X1AA 1MU0A 1ND5A 3VU9A 5KVAA 4R1PA 4A8JB 2PZBA 4II2A 4W1RA 5EIEA 3PD7A 4DIFA 3PICA 4MUYA 2YYSA 1QFYA 2DLCX 1RLTA 3V46A 3DZGA 3D4IA 2GA8A 2WSSA 4OFZA 1C0KA 2I62A 4H18A 1H8HD 4BFWA 4ND7A 2HPHA 2SBTA 3HCBA 2V0CA 1IONA 2PH3A 2QLMA 1CQIA 3LUAA 1N33B 2CLIB 3IUEA 4LK3A 4E4RA 5LP6B 1FE8A 1P0PA 5DTRA 4TMTA 3FTQA 4JOSA 4K6OA 2FPOA 2D2IA 3KVYA 3HCFA 1OUMA 4YACA 1I13A 3KKMA 4M83A 4WVLA 2VAMA 4GR5A 4LKOA 1SUAA 2H2DA 3LDGA 3WIOA 1GWNA 2VYND 3I2KA 3LX4A 3OLQA 4B31A 2FRDC 5F7XA 3NALA 3M6IA 3M83A 4N5NA 4PZYA 3O2SB 1Y1TA 4CF4A 2OZLB 5A3JA 1I7PA 3MN1A 2DUMA 3N87A 4MKFA 4N8SA 3C43A 3CW8X 4O4IB 4BHTA 2HLNA 4YCNA 2DWPA 2JJ2D 3CO0S 3GJSA 3P9PA 1NF2A 2D0PB 3OE5A 4PRZA 4TM8A 3PJDA 4BQIA 1IY1A 4R41A 4COOA 2QTMA 4BLQA 3HB4X 4UUPA 4YJGA 1ACMA 2WV9A 3GNQA 2EJUA 4U6NA 3CUUA 2X0IA 3D5QA 1P9NA 4TV9B 2QN2A 1A7AA 1P74A 1J07A 4UDYX 5C37A 1QLWA 3MWJA 3L6EA 1EWVA 1VIVA 1G16A 4JEMA 4MIYA 1X8KA 5D6NA 1P3Y1 1IQRA 1O5TA 3WNQA 1G6HA 2QK4A 1JUDA 4IGAA 1WP9A 5JD4A 2E5WA 3PHCA 1E9RA 1SKAA 3KBBA 3TB4A 3NGLA 4R9RA 2IPAB 1UXKA 4YCBA 4KXYA 1TQ6A 4KO3S 4DWJA 3EZLA 5EUCA 3HZHA 4HAZA 4Z9XA 1NR1A 5K9ZA 3NETA 5IXYA 4BXOA 2NO6A 5TQ0A 3GJ6A 4CLDA 2JIQA 3C1TA 1QH8A 5JNRA 3U5ZB 1XTTA 1MH1A 3AL3A 5AK6A 5HJ2A 1WXFA 2PUEA 1NMEA 3HA3A 3PDCA 2YZGA 4IDGA 3ZHBA 1Y3DE 4PRYA 3WRWA 4MR9A 4TLLB 4DQVA 3BQ9A 4DW8A 1YK0A 3V8MA 1CUHA 1Y34E 1ZVQA 2WB2A 1P4HA 1E2UA 3UW1A 4LJ4A 2PFKA 5FBVB 4QELA 1WW8A 1KJNA 4UE2A 1NZJA 4C30A 2OWDA 5KS2A 4RWEA 1DQRA 3QE2A 5LYYA 5DGIA 3H6GA 3BHIA