5JSYA

The 3d structure of the ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough at 1.04 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
GTLTGERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase, small subunit
publication title The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis.
pubmed doi rcsb
source organism Desulfovibrio vulgaris str. hildenborough
total genus 85
structure length 283
sequence length 283
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jsyA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jsyA02
1UBKS 4TTTS 5JSYA 1UBUS 1YQ9A 4OMFG 3CURA 4UD2A 4CI0B 3ZE6A 5JSKA 1CC1S 4URHA 3CUSA 1UBMS 1E3DA 1WUJS 4UPEA 1WUHS 4IUDS 4UD6A 1UBRS 4UCWA 4GD3Q 4U9HS 4KO2S 3ZE9A 5A4FS 5A4MS 4UE2A 4KO1S 2FRVA 3AYXB 3ZEAA 2WPNA 1UBTS 4KO3S 4UE6A 3ZE8A 4UQLA 5JT1A 3H3XA 4UE3S 1YQWA 1UBHS 1H2RS 1H2AS 4UCQA 4IUBS 4UEWA 3UQYS 5D51S 1WULS 3RGWS 5JSUA 1FRVA 1WUIS 4KN9S 4UPVA 3MYRA 1YRQA 5ADUS 3AYZB 1WUKS 4C3OB 5JSHA 3ZE7A 4UCXA 4IUCS 1FRFS 4UQPA 1UBOS 3USES 4UEQA 4KO4S 1UBJS 1UBLS 3USCS 5A4IS 4KL8S 5JRDS 4U9IS
chains in the Genus database with same CATH superfamily
3KLPX 4JB8A 1YD7A 2LIVA 1ORTA 2AUTA 2H1RA 2Q7XA 3LY7A 1C9MA 4L3WA 2IT1A 2CWWA 2QRZA 1ZM2A 5SZIA 1EG7A 1RLJA 2REXB 2Y93A 2NU7B 3FVRA 4KAAA 4OL0A 3TRKA 2Z5FA 3LUGA 3A1NA 1R0CA 3ASUA 5KC8A 1GTMA 1VIAA 3OD5A 4BFWA 3GGDA 4NCKA 2C5HA 3B2NA 4RWZA 2J6CA 4TRRA 4UDXX 4E7PA 3QX3A 2JIBA 3UVEA 1P17A 1N2HA 3F2IA 4BGEA 3W6OA 3LBFA 1GTVA 2P30A 5T5QA 3S6JA 2G67A 2CNNA 3MA0A 4PLPA 1IZ0A 1Y1LA 1DJLA 1ZHFA 3HACA 1L7EA 3UAVA 2GBGA 2QJTA 1Q1NA 3W2FA 3WS7A 1Y1SA 4BCCA 2XB2A 2J6HA 5B1HA 3TEMA 1L4LA 1DIBA 2Q0XA 2ZSUA 1XF9A 2D59A 1UPTA 2DR0A 2PJDA 4IDFA 4PNHA 2ZI4A 3EVTA 3HBFA 4KE6A 4LC9A 5HQJA 3ZKAA 1T9GR 1DLIA 3HDYA 4MI1A 3FYCA 3WTBA 4UXJA 1JWLA 2EFEB 3H97A 3C8MA 1RWQA 4HNHA 1LX7A 1ZUNA 3MTBA 4XH9B 4DLBA 5KJ6A 5B64A 1OTYA 4REQB 3TZBA 3DLCA 3KSRA 4FD3A 4RTQA 1E7MA 4MGYR 1KOLA 3U4MA 2Q6KA 1X6VA 3EMDA 2WJIA 4JHLA 5B2EA 2RFLA 4F0JA 1U0LA 4JP2A 4MUBA 2JCGA 3EGDA 2QL7A 3JU3A 4YNBA 1XPJA 4H7IA 1AK1A 3K71B 4Z4EA 1H6AA 2PS0A 1H85A 2Y1KA 1SB8A 2QP3A 4HQFA 2WWRA 3WHLA 2BMEA 2GK6A 3DE2X 5AQEA 1R6BX 4Q34A 2TYSB 3PT9A 1WNTA 3DMHA 3KT0A 4Y9SA 2ZUEA 5TGTA 2IZ1A 2P6OA 5HJ7A 1DKOA 2ZRFA 4V0RA 2R8BA 1YDGA 1XE3A 2BZSA 2HI0A 4PC3A 3WKAA 1FMJA 4QYIB 3FNBA 4CM4A 3SBEA 2QR2A 3FHTA 4DT1B 2QVZX 2XCIA 4RZIA 5AICA 2XDWA 4FU0A 3H04A 1SK8A 3HI4A 4JR0A 4MR9A 4MP6A 4DLZA 2H9YA 4ZYLA 3OSUA 4KNWA 4BMSA 3LSTA 5CIWA 1AA9A 3OWOA 4RZ2A 4A2CA 4CMHA 4YV7A 3DZDA 1PWZA 2BEUA 3MCUA 3JAWB 3EZ2A 3JQ7B 4KI7A 3H2ZA 2AG8A 2QJFA 3IQIX 4MLDA 4JYBA 2ZUFA 4L76A 3I4FA 3K1YA 4LI0A 1JF8A 1JSCA 4JMLA 3LDAA 1ZEJA 4ZEWA 5JYEA 1QCYA 2YJ6A 4KTVE 1Z4KA 4UUMA 2ZBVA 3IP5A 1RAEA 3BHIA 1EYZA 5AKXA 3KOWA 4KQIA 1CY6A 1SVWA 2RAVA 5T3YA 4EB3A 3C6ZA 1WQ3A 3KJNA 4ENTA 3W79A 2VA8A 1E2QA 4YAUA 3DAHA 3HVUA 2J32A 3ZZ0A 1E5QA 1R15A 1AKMA 1AQUA 1GAQA 3A6FA 3SJAA 3DMRA 4CEHA 4NJEA 4WL0A 2ZUWA 4MS4A 3VR5D 3W06A 3PSAA 5LD2C 3QVOA 2F1KA 4YI3A 2R84A 3KPJA 1J06A 4AUMA 1A8SA 1U81A 1Z4QA 3DH0A 4OA8A 4W8HA 4WVLA 4BFLA 4CXMA 3LLMA 3WLJA 1OBVA 1RVV1 1FYEA 3LL7A 4XD7D 2DQ4A 2W8BB 4K9PA 3VKUA 4D9KA 1MEJA 4G36A 3KQLA 2JB9A 1E6UA 1SQGA 2GD1O 4UUPA 4O4JA 2H18A 4PC2A 4WI1A 2JEZA 2YIVX 1ZU4A 5IJZA 2WP8J 3IVCA 2WF9A 2Y27A 3PQFA 3A9UA 1P5ZB 4BNDA 3PDWA 4FGWA 3IA2A 2E21A 2CWDA 1Z4LA 2OE2A 3WXMA 3TH5A 3EMKA 4RPGA 1DX6A 1MGOA 2HUPA 1E6LA 2INGX 2Z5LA 4YJHA 4HH1A 1ACLA 1BXGB 3FLAA 4K86A 3N2ZB 2FSUA 5FF9A 1Q0HA 5KOHA 2BHTA 1FMCA 2FQ1A 2C94A 3IBGA 5F21A 2Q0HA 1NN3A 2ONZA 3HFRA 3NHUA 3PSHA 4QQ8A 4F9TA 2C2BA 1CUUA 2JLQA 3FKJA 4Y2TA 3CMMA 3EB9A 4M1WA 1HNZB 4ZYXA 1IXYA 1HFWA 2AS0A 3E48A 1P1HA 1R4MB 1YNSA 3QE2A 3TTYA 4DQUA 5KQMA 5EJ4A 4C06A 1DRJA 2AFHB 3SXUB 4FSDA 4M7PA 5LKAA 1C3OA 3IODA 1VB5A 4TV9A 1UDCA 3ZWMA 2J4DA 5EE5B 3T7JA 5K45A 2FF7A 2JJ2A 5BMVF 1M9NA 3L49A 3PUKA 3UICA 4JXZA 5FKJA 1OI2A 2XY4A 4L8WB 2XB4A 2QLMA 2ZKIA 3ZXUB 2IGBA 3CW9A 1E4EA 1E0SA 5B1EA 1NRWA 1O97D 5K0GA 1T3SA 3OEEA 1TVMA 4AZTA 4HEJA 1Z4PX 2HLDA 4REOA 3V8PA 2QJOA 3A2LA 3EEQA 1JXOA 3FTFA 4WRRA 3EFOB 4WNIA 4GUAA 3FIUA 4RA6A 3UCEA 2IPOA 4FEEA 5TJ9A 1DPFA 4ENUA 5MN6A 3UQYS 4FLMA 1D7OA 3DHWC 1YCFA 1CY4A 3EWIA 4O63O 5TMBA 4R9UC 3L84A 2O7NA 4HUJA 4MSUA 2CVOA 1QK3A 4RENA 2ZJ0A 3ESZA 2Z43A 1E9RA 3O2NA 5FXMA 5TQJA 2O8NA 4KR6A 3PXGA 4TWIA 1BQ3A 1YB4A 2EBFX 5ALDA 5LOVA 2QVCA 4G9EA 1I2ZA 3W6UA 3GLGB 2CDAA 1FQWA 2J3EA 3FTDA 1M2WA 4JXKA 2C9MA 1GPKA 3Q1LA 4EF5A 3T06B 4C0WA 5FD8A 4FFDA 4PCLA 4PHTA 3EIQA 3AJAA 3EN0A 4KQFA 2JLVA 3MJRA 3ON5A 3X1YA 5FL7D 3GUVA 3VDQA 3CZ4A 5HCNA 4Q7LA 3ZPXA 2APJA 5EXDA 3DA8A 4RO0A 2O59A 3DDHA 4MRVA 2EG9A 3KRTA 4Q7KA 1KIAA 1Z5ZA 1UKBA 3L6UA 2IQIA 4FSXA 2NPOA 2ILVA 4UQPA 1FNDA 1UL1X 1NU6A 4FK8A 3GZTB 4MW5A 3V9PA 2Z8XA 5A02A 1NXQA 3CBGA 5HFNA 3NAQA 2HIHA 5FLXA 2W58A 1Q1EA 2HJSA 3NGXA 4EDFA 4WCVA 5HIJA 1MO3A 3BVPA 1EI9A 4DQVA 1MNQA 3ZHSA 1NVKA 1DAEA 2JCVA 1T8YA 3M6IA 1AA6A 1P0MA 4HAVA 3E27A 3G6WA 3SJUA 2VIIA 3ZWBA 4KDRA 5JMPA 3B1WA 4E1VA 3CO0S 4FGKA 1NOJA 1CJUC 3UW3A 3K6KA 4RFLA 3TW6A 3K2IA 1H4TA 1ZIOA 4XR4A 1U2ZA 5DI9A 2VCHA 4FFPA 2H5JA 1G8GA 1MENA 1E3DA 3B3JA 4IUYA 1AY0A 1USKA 2NUAB 2V1UA 1XFAA 1CXZA 1E2GA 3LUDA 3OP4A 1XWFA 1EK6A 4FYHA 4JEIA 4LV5B 1JSLA 3HVKA 5ELLA 3W7BA 1TM1E 5IJ9B 5AH0A 1M83A 2IGTA 3ETNA 3Q7EA 4FCCA 2AKAB 1AQLA 1T3ZA 2H3EA 1JFFB 5H68A 2M6LA 5C8YF 5F78A 3SHFA 2F2TA 3JQ8B 4BXOA 5AW3A 4P4GA 1DGQA 2NPIA 5EA2A 3OUUA 1JEQA 3BGSA 1L7DA 1BHJA 3UMMA 2LZ0A 1ZVJA 1MD9A 2GD6A 3RT9A 1NQUA 1QKKA 1ADYA 1XMVA 3KSDO 1O94A 4ZV9A 5KYYA 3BE4A 3OQMA 4DNFA 3FRHA 5CXXA 3DF7A 1SXJA 2QYTA 4UU1A 3RU9A 3TD2A 1QZTA 3N05A 4P81A 4BVKA 2F90A 4WERA 2X2EA 2Z2XA 1IAVA 1UMKA 1Y3DE 2PZEA 3QI7A 4IL5A 2AMFA 4NCXA 5TNXA 4DNOA 2W22A 1TA4A 2YC4C 2PRZA 1WXIA 2NT3A 1QO0A 3V2HA 3M5CA 3A28A 3NETA 4TZKA 1A5BB 4WTOA 3RSCA 3W7AA 4DAOA 1JEEA 5I8WA 1GJRA 3K9FC 3NORA 4A16A 2A9VA 3TKYA 2XJ9A 3BGOS 2OC9A 1T1RA 2I3GA 2ZUSA 3JSAA 4F9FA 4C04A 3KZMA 4CG2A 2EKLA 3GLHE 3F1LA 3A04A 1PWHA 3LE8A 3MUNA 5FUQA 1WPGA 1W47A 1EFVB 2C1ZA 1G5TA 3EGXB 1ONOA 2V96A 4HVCA 1XA4A 1GUFA 5J9FA 3B78A 2XDQB 3KWMA 2FN3A 1LK7A 1KFCB 2Y1XA 4GBJA 4K26A 4YAFA 3K2BA 4H7PA 3VA7A 2Y0EA 1DAPA 4N3GA 3ILHA 3P2OA 3QE4A 5F23A 1OYWA 4F2DA 2B7BA 3HLTA 4JBLA 5DYIA 2RONA 4JLOA 2GXSA 5LKRA 4ND1A 1IN4A 1FVXA 5E8JA 3W9YA 3UAYA 3NTLA 4ZOCA 2REQB 3LM8A 1C3LA 1E32A 1T25A 3DBLB 4TMTA 3DBIA 4B34A 4O4HB 1JZQA 1T2CA 2ZE6A 2QRMA 1WSDA 4JJIA 1SCKA 4R4JA 3L8CA 4Z0HO 2SECE 3QA9A 4IHJA 2YV3A 2H00A 2PD4A 3OE7A 1UOQA 4JQYA 4R41A 1E2UA 4D96A 2QTFA 1BX1A 1E4YA 1O94C 2XGOA 2YY6A 3VU9B 4KMMA 1YRBA 1SXJC 4G8DA 4JSTA 3ND9A 3ZHCA 5LJIA 1E0AA 4ROTA 2DPGA 3TKLA 4II2A 1N2GA 3BL8A 4RQUA 5ERXA 1KRXA 3LYAA 2GZRA 1K4KA 2IYOA 3LPAA 4HS9A 3TIXB 4DJTA 3QX7A 5ENZA 2Q8NA 2ZI3A 1QIGA 2JL1A 4W63A 1LS1A 1R8XA 4GS5A 1VHWA 3RVBA 5KQRA 1Y63A 2G7MC 2Q8QA 1HTTA 1UOOA 2XYVA 3BD6A 4BNUA 4ZVLA 5FTKA 4CKXA 3G9ZA 2FLVA 4UM9B 1YTLA 2V7PA 1Q0RA 2F55A 3ZDCA 2JRLA 2YZGA 4TWRA 3RKUA 4F11A 1P5FA 1VL2A 3EF0A 1J5XA 3AI7A 4KPFC 4NZMA 4FLEA 1NULA 1KETA 4JJGA 1G63A 4C08A 3WLQA 4IDPA 4X1IB 1TF5A 4WCDA 3PR2B 4QDKA 1Z7BA 2E3JA 1MC1A 4XAQA 3G68A 5MFPA 1JXMA 4BO2A 3AIIA 4ENRA 3KSZO 4UCWA 4TL6A 3THRA 3KAQA 2BEWB 4N48A 3LF2A 1ATIA 2D4AA 3EBPA 4Y7DA 4RHXA 2JFYA 3OMXA 1RXEA 2ZJYA 3BE8A 1TU4A 3O8OA 3T4UA 4A26A 3CCCA 5LA6B 1W36B 4LRQA 4XEHA 5D3MA 2ATCA 1DEOA 2BMVA 1YRHA 3LW7A 4QPJC 1WA5A 2FWPA 3MS2A 6Q21A 4ZREA 5FPTA 1CY2A 5TXGA 4JI7B 4ZU6X 3ZJYA 3U3ZA 1RLOA 1T29A 5I9TA 2V5VA 3E03A 4J03A 4F3RA 2UYGA 2H8KA 3QG5A 1W0JD 2NAPA 3EW9A 1J21A 2XNKA 2JGDA 3SC2A 1X7XB 3D7KA 3GUUA 2C42A 2CVQA 2PX0A 4C3UA 2D8AA 1PL0A 2VUSA 2XSZA 2ZPAA 1E64A 4HD8A 4OBEA 5ERYA 3GNLA 2IEZA 5GM2A 2LXNA 4GLJA 4AMUA 1FDWA 1QGDA 3TQRA 3WL3A 2I33A 4RTRA 1J2TA 1QFJA 2X1HA 4X6UA 3JQGB 2ZJFA 1SXHA 1UR5A 4BJ3A 1EM8A 4GWLA 1NBMD 5LNK1 5ERGB 1QP7A 4C14A 2PBRA 4WK6A 4OP3A 3IEXA 2WTUA 4JC0A 3TX6A 1VYVA 1FMLA 1I2BA 1SCNE 1YMQA 1QONA 1N8SA 2HA4A 2J5BA 3Q41A 4O5AA 4ZK6A 4GMGA 4GR5A 3T61A 4Q18A 4MV1A 4JJ6A 4PS1A 1L5LA 2RMKA 2ZTUA 1RPAA 2B82A 4V24A 3RFVA 5IWAB 1XZBA 3L7NA 4D0LB 4ZOEA 3TXAA 3EDCA 1P5RA 5AW7A 2UUAB 2G72A 1OPXA 1AC5A 1H2WA 2HD4A 4RHTA 2OHVA 3QU2A 1N6PA 3C1OA 3CPEA 4EL0A 2IUYA 4CLOA 4K6MA 1T5SA 1N2EA 1D04A 2DCMA 2J3IA 4I1VA 4HWSA 4M3NA 4RH0A 4M88A 4XLTA 2E6UX 3HA2A 1IH8A 5D5QA 4IDGA 1YZNA 1Z0IA 5FNZA 1L5QA 1WHTB 2Z2JA 3R3HA 4J9VA 2QZPA 3L1VA 3MSXA 3I34X 4FUQA 4UEQA 4ZVNA 3ZXSA 4TZ0A 1K5PA 1HLDA 1QNLA 4IQ0A 4EHAA 4EPYA 2VCYA 5L95A 4AN0A 1JLMA 5KNDH 1PUIA 4AK9A 5DNEA 3A4VA 3F4BA 3I5UA 2WHEA 3GRVA 4MQ4A 4MW9A 1L7MA 2DZDA 3CVWA 3ASZA 4DQKA 3T3EA 1L4FA 4MITA 3I61A 3NASA 5ARCA 3ZBUA 3PTZA 1CQXA 1CY0A 3EEOA 1HE5A 4C0KA 1X1EA 1XVAA 1VJ5A 2G17A 3NHSA 4DB2A 4F5ZA 1NAIA 4H4CA 1NIJA 1SG9A 3ROFA 5G53C 1EJ6A 3CUSA 1KZHA 1EFRA 4QGGA 4QUAA 1GPH1 2X8JB 3FFTA 4NNOA 4F2HA 4ZCTA 5AQ1A 3IB6A 5L3SA 1IG0A 2PZKA 3GEGA 2ADMA 2P4EA 4B3SB 2PV7A 2C7QA 4L75A 1WSBA 4FFWA 5C31A 4EPVA 3ENVA 5BV2P 2RB5A 1YUBA 4KN5A 4M7RA 3GA5A 3KQKA 1U0OC 1XRMA 3FVTA 5THKA 3A32A 2CNDA 4X20B 4TTQA 5CFPA 4AVYA 4P4SB 5K0LA 2Z58A 3U37A 3KZXA 4QELA 3D6AA 3NHFA 4P6VF 2CJXA 4OHMA 1SIWA 4MGIR 3Q9NA 5BN4B 3F5FA 3HG7A 2BGMA 3AEKA 1T3HA 3HB5X 4OMCA 4U6QA 2Z6QA 2JLSA 4M1EA 5KNCH 1NPDA 1OROA 2R8RA 4KV7A 3M6AA 3A0UA 3S1LA 3NHAA 5BVGB 3ZY5A 3HM9A 2PKQP 1T1GA 3TW8B 4Y9RA 3WOHA 4AFNA 2I7DA 1KJ9A 5ELMA 1HE1C 5EKSA 2CE2X 1FFCA 1RWOA 2P9HA 4QBKA 4HT3B 3ADOA 5JC1A 4X1YB 3DO6A 2ZXUA 1PEAA 1WLYA 4CE6A 2MSEB 1T24A 2VNKA 1CPYA 4FIDA 3KNZA 2E4ZA 4Q3NA 5KTRA 2ZYGA 3HKBB 4KH1A 2OYRA 5JFTA 4B6QA 5KX5B 2PGNA 1W0KA 4TRNA 2P2DA 2G9UA 2WJPA 2G0NA 3MEQA 4G2TA 2M98A 4PEVA 4YAKA 5DCLA 4TROA 4R1OA 4I50F 2IU0A 1KF0A 2PZLA 5ILQA 2J3DA 3GRRA 2OMEA 4P3NA 3D59A 1IHOA 4IEEA 3ZU2A 5CBPA 3KQNA 2IW1A 3E7FA 1XPOA 3U7EB 4G8JA 2A5FA 3MWKA 1J1UA 1XBTA 4A8JA 1FBTA 3DKPA 2XCUA 1RKUA 4JLVA 4MPJA 4D6XA 3BICA 3NHLA 1F38A 1NXTA 1GUYA 1X8KA 1KZ9A 1EUDA 1R50A 3KB2A 1SIBE 5LUAA 3TI7A 3GHYA 1YB7A 3OTIA 3T5TA 5IVHA 1K4MA 3NQ41 1XNHA 2VH1A 4W9MC 4Q3AA 2RARA 1MG0A 1PHPA 3BAZA 4LJ5A 4GRDA 4U0KA 3FHOA 5F98A 1P74A 1T0PA 1YO6A 4RK7A 4B33A 4QBGB 1E4VA 3SN6A 5LXTB 2ESRA 2X40A 2O8EB 1ZK4A 2ZETA 3PXDA 1UP4A 3HADA 3OLZA 4GLOA 3AIKA 4CKWA 1WHSB 3HEBA 1RS0A 1MX3A 4IXNA 2FEAA 3M5DA 2WC1A 4BEVA 3BRSA 1EBUA 1RJDA 2C5GA 3FPAA 1OLXA 4HEA1 4WAUA 2Y8EA 3FTPA 4NBWA 4AF8A 3UMYA 3FCXA 3DE3X 4L5YA 1DZIA 5BQXA 3WY9A 5JNUA 2Z4TA 3ITNA 4XB6B 1Y1RA 4S35A 2VRBA 4M9UA 5FUBA 1TCVA 2VP6A 1N5JA 2G0AA 3RIHA 4I6EA 1G18A 1OZFA 1NMSA 2BT4A 1IZ9A 2FX2A 2XUHA 5KREA 3CNOA 4RTNA 4LZJA 4RZUA 1KKLA 4X8HA 3P9KA 4U3JA 1A9TA 1Z82A 2FPGA 3COVA 3H2JA 5CLFA 4MR8B 2WT9A 4ALLA 3BSYA 3HBAA 1PG5A 4M8KA 4YMTA 4MS3A 4DXAA 1IFXA 5TF4A 3LUHA 4TS4A 3GCXA 1V8ZA 2AYZA 4R05A 1PVOA 3U9SA 2VP3A 2WHRA 1R4ZA 1YC5A 4HQRA 5EWLB 1GSIA 3NIBA 4EEXA 1Q0LA 3AVTA 3DV9A 1QX4A 3DOEA 4JC8A 3RUPA 2YN0A 1OMOA 4KK3A 5JQGA 1Q7GA 2PRKA 4GOXA 2GEFA 3C4VA 2XR1A 4JYPA 1LKZA 2VTVA 3NG1A 1FTQA 4Z1MD 5AUOB 3PTAA 4DG5A 3ZLJA 1GUAA 1TK9A 1G20A 4EKIA 2BEJA 2AN5A 2GWRA 3TLEA 2YJ4A 3R8CA 2AD5A 3C3DA 4W1RA 5BR8B 2GO1A 1J8YF 3T7CA 1PP4A 3KBOA 1NONA 1W8IA 4KXFB 1XEXB 1IUPA 3S28A 4IAOA 3VPCA 3ANLA 3QQPA 4G41A 4IQFA 5GVRA 1NKVA 4BYMA 2VAMA 3T3GA 4ZHSA 2ZBEA 5JNVA 1S3GA 1YMVA 2CUNA 5HE9A 2HQRA 3WKCA 3THXA 4ISCA 2H1VA 1UEJA 1Z06A 1X80B 2B21A 4MIYA 5T6MA 4EI9A 1DU4A 1V5IA 5JRZA 5HKKA 3THYA 4S0XA 1DWOA 1YS6A 5KNLA 2QRLA 4PAWA 2BZ0A 2R1VB 2HSWA 3QF4A 4QGHA 4CCSA 2ETXA 1AIPA 1VLHA 3LC1O 3PHCA 2GM4A 1RYBA 2OR3A 3H16A 4JGIA 1JR6A 2G04A 4M9QA 3C1AA 1XZAA 3RVOA 2XRFA 3W1WA 5FWXB 2LE0A 1YRYE 3CUWA 5DN6A 3KCQA 4BEJA 4DQDA 4MCAA 5TMPA 3JRNA 2C95A 4L50A 2OD7A 4F46A 4PQYA 1GDTA 4B83A 5JAMA 4FQ7A 3EQ7A 3SSOA 4EMBA 4K6CA 4EYOA 4IDNA 3A6HA 2EFYA 1KI7A 3AF1A 4TLAA 4L74A 2QTBA 5KUTA 2CJWA 1E0DA 4YAJA 4N76A 5HS4A 1M7GA 2OK8A 1N4AA 4L7VA 3ND5A 1T36B 3DEIA 3FSGD 4KXUA 3EWAA 5CMLA 5A0FA 2YCBA 3EIHA 1JTFA 1D6JA 1P2SA 1RI2A 2FFJA 5EE9A 2P3SA 2OQ2A 4HADA 5B4UA 2ZT5A 5EINA 3SC6A 2EP5A 2R5WA 3R20A 4QDZA 2J9FA 2GMWA 5DASA 3GPLA 3LLCA 3FGNA 4OFBA 1ZJWA 1DAGA 3FN4A 4DV4B 1C80A 2A7XA 2ZR0A 3GFRA 4CT0A 4URXR 4F56A 5KAMA 4CWAA 3RVLA 2X8WA 3PVCA 3KJXA 1RW4A 1WZUA 2GBIA 2XAAA 3DVSX 1PWEA 3CNBA 2HWXA 4ZZIA 1XTKA 1RAAA 2MSKA 2VAWA 3CLTC 3FTCA 5ALSA 2QU7A 2ZE5A 4DCUA 2ZXFA 4HVAA 4LGVA 2D0IA 3USCS 3QPAA 3QYPA 1FYXA 1Z33A 3ZWVA 2F3TA 2RGRA 4PO9A 2A5LA 5C5EA 1GFWA 2WIDA 1NBOA 1MT0A 5TGZA 4CNQA 4EP1A 4IZOA 4PAQA 1L5KA 1QNFA 4JJ8A 4QYSA 2OXIA 4YYEA 1NXXA 2HM7A 2PGXA 2O8DB 3PVSA 4HRAA 5TEWA 1JHDA 5F1YA 3GGSA 5E6RB 1IMJA 1B7GO 5AHXA 3ZDRA 4ZRMA 1EK1A 2ZWAA 1ZK2A 2WEKA 1RHKA 2NYUA 1CUAA 3FCSB 4H7DA 3VH2A 2J33A 3JQAB 3WP1B 1OILA 4QUJA 5GADl 2QX7A 4OYHA 2HQSA 3HWRA 1Z3CA 3I64A 1N6RA 4IO0A 1Q21A 2GVNA 3SEAA 5AHKA 4Z7QB 4B3RB 2O2XA 3PDIB 5FUVA 1NXWA 3X43A 1U0BB 4JJZA 5K3DA 5IAOA 2O1XA 2BI7A 2CUTA 2Z1NA 3HDHA 2ZAIA 3R7FA 4CMGA 3DZBA 4F71A 4R2XA 4KX3A 1WP4A 5J2UA 1ISRA 2DKOA 4FD2A 4OQEA 4Y18A 3UBMA 4HMOA 4TVKA 2PX8A 1CJBA 1W52X 3VR2A 4F2GA 3KKOA 4OI4A 3ONFA 4OSOA 1BFKA 1K6IA 3L7IA 4Z2YA 4LOIA 2ZSKA 2NTJA 5C34B 3OVMA 1K5GA 1MN6A 1USWA 2BFEB 2WFMA 1OA0A 4OJKA 5FNVA 4ZOLB 2YL2A 2RKBA 3NANA 3Q0IA 4GX2A 4DR7B 1XN4A 4EW3A 3AYXB 4O4JF 3UUWA 4GZMA 5C8YB 3L0ZA 1EMDA 3ZUGA 2DR2A 3U3RA 3KB6A 3MWGA 1HORA 4LECA 3SBXA 3TQOA 1A8IA 1C0PA 2OMKA 3PF9A 1WMBA 4NZ9A 4P3KA 4TXLA 3V48A 3AUAA 4OIMA 4WT7A 1U9IC 3EF1A 3EC2A 3FUCA 1F9AA 3HL0A 5IKPA 3DUFA 4UNNA 4UTZA 1NJ8A 5GV7A 5TPWA 3ROXA 4P0PB 2QG9A 3E81A 1JDBC 3WGLA 1LC3A 2GZ2A 3DL0A 1JFVA 2YRWA 4K0RA 4P2BA 4MTCA 2ZRHA 2B61A 2XCRB 4QQNA 1L9KA 1FQJA 2I7CA 3AY7A 1TFRA 2CL7X 4EZBA 1INLA 3A6KA 3PUZA 2DU8A 4JXJA 5HQ3B 1FXWA 1K7CA 2AQHA 4I1YA 2VHXA 3I58A 1SC3A 4RBNA 1QC5B 5F73A 3IVMA 3WNZA 1LBSA 2QE6A 3RTEA 4BU1A 1QUFA 2QF7A 3PB3A 3DF9A 3GBPA 5KTOA 1N8KA 4TV9F 4RU1A 2VXCA 4YV1A 1RWMA 1BYUA 4YXWA 4J0EA 2GI4A 4L78A 5FV7A 1LH0A 3RRNA 1X1AA 1Q50A 2WVGA 3L0CA 4JYMA 5JNTA 2V7BA 4K6KA 3IEMA 2XRZA 3FPHA 2GCIA 4EAQA 1YT5A 3AG5A 3QVGA 4JBGA 3H9GA 2VR1A 2OV6A 4QFDA 1BVHA 1ZIYA 1Z47A 1ZW1A 1SVUA 3DDOA 1GFZA 5F7OA 4MB6A 4OJYA 2PSJA 5BSMA 3VKFA 2WILA 1G38A 2EXXA 4WK2B 4AN4A 2VUHB 4ER0A 2BMFA 3DWEX 2PL3A 4Z2AA 4CM9D 3IT3A 1Z39A 3Q2IA 2F7SA 1U1EA 1OX4A 5DX0A 1Y37A 2PS3A 4I4TA 2FFHA 1ZCJA 2FCRA 4WXEA 2VL7A 4QHTA 4QT4A 1LLCA 2HEGA 4MRMB 3R9XB 4O2AA 1J0DA 4HWKA 2OCPA 4F5DA 1YL6A 1RAIA 3C48A 5FRDA 2V3CC 3FWHA 1KHHA 4G89A 5LOVF 1S2NA 4OHBA 1NC1A 3DKKA 4ROSA 4ZYVA 2A8YA 4RPHA 1WKCA 2GLUA 3SVTA 1D2NA 2TRSB 4ID9A 2Q1XA 3F5DA 5JASA 4KXNA 4N5MA 3NHMA 2P9GA 2G63A 4Q5IA 5JLAA 4OLBA 4J90A 1GLVA 3TINA 4QL3A 1GCOA 2AEMA 2H1WA 2D74A 4N65A 2V7EA 3RC7A 2CV2A 2NPFA 2AGVA 4XE5A 3EWNA 2DEUA 3QNWA 1ESCA 1VP9A 5ILOA 5EMNA 4P92A 2BC9A 4C0HA 1KQFA 2GZAA 4ZZ0A 3G2QA 1X2EA 4ARZA 4RMHA 1CEXA 3B3GA 3TN7A 3BX1A 1KMHA 3DFFA 1FNMA 1ANKA 1M2VB 3NWEA 3ED1A 2I3AA 1ZRNA 1CUGA 5GONA 3MNFA 4UDOA 3DDCA 4FE3A 1CNMA 3OEED 3O90A 4PC7A 5EY5B 1TF2A 1YBFA 1PZXA 2HLDD 3KOMA 5K3FB 4XGKA 4JYZA 5GV8A 4W5WA 3UMVA 2F1RA 3C97A 4NBRA 3TBHA 3CZMA 4DDHA 3R6GA 1YBHA 3SQOA 1XAGA 1OYVA 3FTQA 3BCSA 3WRYA 4GQAA 1LW6E 2ZRCA 5F7JA 2Y1LA 3B12A 2WRZA 4G1FA 4ZHQF 4CQNA 3GEBA 1AKNA 4K2AA 1I9CA 4FGUA 3NV9A 4EO4A 5D1HA 2BFFA 4L8YA 2PSDA 1V16B 4FCWA 1SC1A 3DJFA 5K4HA 4L8GA 9MHTA 1Z28A 4GGMX 1RXCA 2VQSA 5FAXA 5TQ2A 3RREA 4ZO9A 1UXHA 3RYFB 3TR5A 4ZCRA 2C3PA 4XYGA 1HG1A 3OZBA 2FQXA 3AP3A 4OJNA 3GDWA 3K0SA 4BQRA 2YFYA 3CPSA 2G83A 4QRDA 2VJKA 5DK6A 5J1TB 3ECAA 1WNFA 2L19A 3O2QB 3TBKA 4BNTA 5IK2D 1GPNA 1M34A 2GARA 1AK2A 4KDEA 3R5XA 4M1MA 3UHPA 3O7WA 4INZA 2HJHA 1V96A 5DRYA 4GDMA 3VHXA 2GNOA 2QUHA 1UT5A 1ORDA 4OOEA 1G6Q1 4MUEA 4RTOA 3FMPB 3QPDA 5IULC 3EVNA 3GJ5A 3JYOA 3BTUA 4H1HA 4IQGA 4Q1AA 4R1LA 5DBOA 4EZIA 5AK0A 1NR7A 5I8PA 1UAAA 1UKVY 4WY5A 1XTVA 4GU5A 4G63A 1P6XA 3AH8A 3OM0A 2W2XA 5K0JA 2E7ZA 1TZCA 2I7TA 4NNPA 1KGDA 1NT2A 1UPCA 2HBYA 4J7CA 2BP7B 4DYVA 4OPMA 4G5OA 4F6CA 2VWQA 4AZSA 5IZ4A 3C1UA 1H3NA 2M2IA 4JOBA 1NTRA 4M89A 4UHJA 3TG8A 1JNXX 2YYYA 2ZDGA 1YH3A 5B2FA 4KKXB 1JIXA 4UC0A 1M10A 3JR7A 4NDNE 5BW5A 3K31A 3M4YA 3OZVA 2V7WA 3IO3A 2ZRNA 1QLJA 4LYEA 3CLVA 1QZXA 1UJBA 4NCHA 1UDRA 3W9BA 1NVMB 1ML4A 1E5DA 3AFMA 3NX4A 2FPLA 1KVUA 1VA4A 3QY0A 1BMFA 3PQ6A 1CF9A 1EDOA 1NAHA 2ZSFA 3D7NA 1XELA 1QKJA 2D0PB 1RM0A 3PFCA 1FFEA 3KFXA 4WN9B 4PNPA 4E4TA 5CLJA 5MF6A 2QRVA 4ARCA 1B2RA 1JQBA 3BXZA 2J30A 1BA2A 1EQAA 3G13A 3BH6A 3RTCA 3WK7A 4DM4A 1EWVA 1Y42X 2RHBA 3P4YA 1LBEA 3ZWQA 1ESMA 5G0TA 3NKVA 2KMLA 2MJLA 3WGZA 3NH9A 2BDEA 3RAEC 3N59A 2H1HA 2EBWA 2X7JA 3JSXA 4P58A 4CIWA 5KYGA 1KAOA 4AUKA 4DZTA 1QGUA 3OCXA 4D9GA 4RVHA 2NG1A 2DY1A 3C6XA 4R16A 3ZDXB 5A04A 2AFIB 2VDPB 2YWHA 1MP0A 4QPDA 2Q5IA 1C29B 2FLKA 4Q21A 2Q3HA 3EY4A 1YJBA 4P33A 4NEHB 5H83A 2FE1A 2EQBA 2YXNA 1JBQA 1U3VA 1Q1ZA 5E9QA 1S7GA 3DC2A 4IGKA 1SXJD 2GKOA 2B9VA 1UPBA 2DFTA 1GPUA 2NV2B 1VSVA 2O3SA 3GGCA 2IEBA 4HYYA 3L7KA 4KZPA 1M6VA 4M6WA 1Q7EA 2AZMA 3BE5A 5CAEA 5LDHA 2P3QA 1PT5A 2X9GA 2AV6A 2RAUA 3T6KA 1ODFA 4YVFA 3G2MA 2X1LA 4IV5A 3RS4A 2HHHB 1QO0D 2XIJA 2OBFA 1O0BA 1G16A 3VZCA 2VDVE 2FJ0A 3L7DA 1CR1A 1VGQA 2AE1A 1NDQA 3E1GA 4BDSA 3U3JA 3COZA 2YXPX 4LWQA 1CS4C 2F48A 3LCVB 1KYIA 1UJMA 1I33A 2HU2A 2O20A 3NHKA 3QM1A 5FOXA 5IEJA 1GA1A 4BB9A 4P0QB 3JZMA 5KYWA 3HVRA 4TSFA 4IGIA 2IK8A 1YQQA 1WXGA 1JLLB 4YTEA 2IYVA 3GJXC 4MEAA 1HQCA 1LLUA 3I01M 1TT7A 1X1DA 4IBOA 4OP1A 4FYKA 4A92A 4B6RA 2P2LA 3GNQA 3RROA 1TA0A 5M3BA 4CMBA 5SZJA 2YKGA 4PR0A 2QR5A 3BSSA 1S5PA 4K9RA 4LF7B 2JATA 3AVVA 3EH1A 1DQSA 1Y3HA 2FR8A 1XCMA 1EVKA 3F7TA 1U5BA 3QWIA 4NPAA 4DIOA 1P75A 1AF4A 5F7ZA 3D8RA 4N0PA 4OUDB 4HI0E 2KLHA 2OCIA 3VR3A 3H1FA 4E5MA 4HNUA 2O0LA 2X9LA 3MD0A 3B1JA 4KSBA 1SBCA 4GUDA 3N0TA 4RY8A 3AY0A 2IYYA 3R8FA 2RGGA 4PLZA 1XTQA 2J07A 1Y3FE 2PAAA 3OOHA 2EJVA 4YYZA 1OXVA 1IM5A 3FPJA 2YOFA 4FFBA 4MV9A 3BA6A 2J0EA 1JHYA 1PFGA 4P32A 3UW1A 1XLUA 1YCGA 2HPVA 3NHJA 3T0FA 6LDHA 1HYEA 4F7WA 1FSSA 3L7LA 5LMNB 4LZLA 3KKQA 3L7AA 1LC0A 1RDFA 1E0KA 2WDPA 4E11A 1DC5A 2EYUA 2FMIA 2X9QA 1E2DA 4HGYA 2QW1A 3CUTA 3IUMA 3FOWA 1OIWA 3QLVA 2CCJA 5AJWA 5E4TA 4F85A 2PNJA 1X1RA 2C4NA 5ILGA 1ZG3A 2E0IA 3M81A 5CA1F 5BSGA 1OVGA 5SYAA 4AKTA 4LSZA 4OV6B 4IVRA 1KZGB 1I32A 2NZ2A 4B9EA 1ZNQO 2P6MA 3C3MA 2R6DA 3ELWA 3WO0A 5JAOA 3EPKA 1N5RA 1XTIA 3T5AA 5FBVB 3K6RA 2J31A 1QO7A 3L79A 1UOEA 4TQGA 4OHWA 5JR3A 2BGKA 5DNAA 1GM5A 4HMPA 2H1OA 4HVLA 3OF2A 3RQIA 4PFSA 4AJJA 2UUPA 5A4DA 5T64A 3SJZA 2D00A 3EY9A 3NKFA 4EQ6B 4EG4A 7ADHA 4GICA 4JGGA 1ZGGA 1CC1S 3COSA 3L8FA 4W1PA 3WL6A 5M04A 3COJA 4YRZA 2VPXA 1XZHA 2JI9A 2X86A 2FR8C 3BRWD 3IAS6 4MNTA 4ZAZA 4OAPA 4JJKA 3O83A 3R77A 2WM2A 4A8HA 3OJLA 3JS5A 3O75A 3OFSA 3WGUA 5EWJA 1J56A 1TD9A 1WSWA 2FSIA 2BTQB 3ODGA 3TUIC 1GRRA 4GYWA 5T41A 1MAVA 2GUWA 2WTEA 4EX7A 3HYCA 1RIIA 1WDWB 3PNPA 6REQA 5HKOA 3UKJA 2WK1A 3WO1A 4CIXA 4NI5A 3PC2A 1BCRB 3I6ZA 3TGPA 3RAGA 4A0HA 4DJEC 2GZMA 5F64A 4GPEA 4AQDA 4HNTA 1X9IA 3EQZA 3RVJA 1U7WA 2RBKA 3UFXB 4CCAA 3RBXA 3V6LA 2FZKA 2W6JA 5DSXA 1SEVA 3KQQA 4ZRDA 3WB2A 5EIEA 4KFCA 4XQ9A 4C7KA 1B1AA 4RJTA 2V54A 5FI5A 2B7LA 2BY4A 3QLVC 3FB1A 3OQ6A 4R2LA 3OTOB 4QRIA 3L0OA 2PX5A 3ZW8A 8ADHA 2XA1A 2JK1A 4I99A 2RAPA 5COQA 3U3DA 2ZTHA 3TQIA 3VYRB 1DQYA 2OOKA 1S2DA 3IV7A 4XUEA 1A50B 5JT1A 4CEIB 1WTAA 4YJ3A 3T12A 5FOQA 3QKSA 2GAOA 4LBWA 1R1DA 1REQB 4RTKA 2GN0A 1ADJA 3GRZA 4LMRA 3D2CA 4GOJA 1I51A 3C70A 1DFHA 2EATA 4Q03A 1RYZA 3ZQJA 4TKLA 4ZYZA 3RW9A 2VTDA 3AM4A 1OLOA 4P8RA 1R3DA 4WZAA 4A2PA 5F3DA 3IAEA 3ANXA 1FXUA 2JVIA 4YJKA 4DQLA 4D2IA 2AF3C 2AR0A 3FR7A 2LKDA 3BMNB 4E07A 3C3XA 3CEAA 5P8WA 3D3QA 4J6EA 4WINA 1XFDA 4XOIA 2GD2A 2Q28A 2XH8A 4YMSA 1E60A 4M99A 5CM9C 3GEHA 5EQTA 1V5GA 3ULKA 3WIBA 4GVLA 1WDMA 2WSSA 2YVAA 4LF8B 1E9DA 1E1MA 2ZT8A 4FYJA 2BM1A 4JUCA 3RFXA 3RG8A 2GXQA 4IRUB 1Z0DA 4H7HA 1XO1A 4H59A 3EVEA 3MWDA 2FEMA 2VJCA 4OKNA 3EGVA 4WESA 4ZDJA 2YBEA 3PGMA 1G5PA 4OJQA 2Z9DA 4JI3B 1RZUA 2C99A 4ZICA 1M2HA 2R66A 4EG1A 4MW1A 3CNQS 4LRWA 1XVTA 1Y6QA 1TFUA 3O03A 2WJHA 2IHZA 3NT2A 4NBUA 5IARA 2EZ8A 4KUEA 2C8JA 3OG9A 4TTAA 4I8IA 3SSNA 3GRAA 4XARA 4O0MA 3X0DA 2ZWIA 3VKGA 4XA8A 1BWQA 1EXNA 4UCFA 2FPUA 2ZQZA 4Z8XA 2E6KA 1Z5NA 5KSZA 4N9QA 5CW2A 2FTKE 2FUCA 3SS7X 4ARUA 2HJWA 3M4NA 4LOHA 1D6SA 3GLVA 4F2WA 1P1IA 1PWXA 2XNJA 4JP3A 6AT1A 3S2IA 2PUHA 4ZQIA 4OYRA 5FLEX 4BLOA 4JDPA 2VPTA 2C03A 3E9CA 4QJ5A 2IUUA 1SZPA 2ZZNA 4UZSA 4KAJA 1SQ5A 1QGZA 2DHQA 5DIZA 3V1NA 5FT9A 1ZD2P 2BGLA 4AURA 5I9NA 1T34A 2I2BA 3PFKA 1SM4A 4Q19A 1O96A 2OCXA 2AIRA 2Z8YA 1W46A 2H9IA 4X24A 4DR1B 1OH5A 2I6QA 1J70A 1I13A 1U6KA 3MINB 4EABA 1SG6A 2FPPB 3O9ZA 3UANA 1I6KA 2Y1EA 3UXHA 4DQXA 2D1QA 2XBMA 4IG4A 2I2CA 1XPUA 5IT0A 3I4CA 3SX2A 1U94A 3LHIA 1N2BA 2XD9A 3SZUA 4HDKB 3U7JA 2BUCA 1TO1E 3FUTA 1GITA 3G23A 1OGYA 3SM3A 5IAEA 4TYMA 3ORQA 4NQRA 3TNFA 3JRXA 2WIBA 621PA 4J0FA 2ENUA 2HY7A 2W6MA 4RC9A 4RFSB 4RDXA 3GEIA 5CFLA 4X3PA 1TTPB 3FPGA 3PXCX 4GXNA 1NQTA 1J7KA 1SIUA 2IBMA 2HPZA 1FXSA 2VPYA 3LOQA 2FUKA 2JLUA 2A94A 3IUNA 1MR3F 3HVIA 3QVKA 2BONA 5EJAA 3SX0A 3B13B 2XXAB 4PW0A 3ABOB 3EXAA 2H2DA 1HY3A 1RQRA 1P2BA 5EEHA 2OZLB 2IZ7A 3H5TA 1ZPDA 1AGXA 1D1PA 1Q6YA 1NBIA 3CLRC 3LX6A 2ACVA 2FSHA 1CZNA 1VBKA 3OKCA 4HFJA 5F3WB 2QIPA 2QNRA 3M9XA 2P9YA 4IFTA 2PD3A 3ILVA 2C5BA 2AR7A 1VYHA 1WKVA 2NTVA 2QIOA 2QV7A 3A3NA 4FW9A 4RORA 1U90A 2X4GA 1JG6A 4QA9A 3I2GA 4YRJA 3RABA 3V4OA 4KQ6A 3FCYA 3UG7A 1YI0A 2JHAA 3MGBA 1BWRA 1RWNA 2PKRA 2P9JA 1XDSA 1N1MA 5JPDA 1DIOB 3CR8A 3CXRA 2O14A 3QIVA 3TX2A 3A6EA 2XMRA 2R4TA 3KJHA 1ZNWA 2CJPA 2WSYB 2RDMA 1OX5A 5HUHA 2H6EA 3LNTA 5JZSA 1BE1A 1HYHA 1H93A 2A1TS 4R1NA 5H16A 2I8CA 5JBQA 1NW9B 3HJGA 5KTYA 5AJUA 4Y30A 3WDMA 5HBGA 1PJ3A 4BNLA 4YALA 3FWKA 3H8WA 3LC0A 1G64A 5LQSA 3UNXA 4CIBA 1N57A 1XC7A 3CH6A 3GAFA 3GRPA 5JTTA 4DVGA 4H18A 2E1PA 1DAOA 1A2OA 4N7JA 1G21A 5CHEA 5BW8A 3UJBA 5EKXA 1BYIA 5CJ2A 4CKCB 1R66A 1W25A 5HF9A 4JLMA 5A1TA 3OAAD 5BO5A 2J09A 4L9AA 3KM0A 3G02A 4LZNA 4GFDA 1V2GA 4PR3A 4ESVA 4F93B 1J0AA 2H4ZA 3E22A 3AJ8A 3B3AA 1HLFA 2QL9A 2XKAA 3CN9A 5BR1A 3PQ2A 2QJWA 4KFUA 1SPXA 1Z88A 2I4NA 2JNWA 2PD6A 2FEOA 2YWEA 2ZSJA 2IWRA 2HAEA 2E4VA 2QQ5A 2H11A 4B0OA 3CFYA 2ISQA 1Z08A 5DCYA 5K01A 1XPRA 3ZE0B 3QSYA 2PCJA 3V2UA 2OY0A 1WMFA 3EVFA 3HUTA 3N2NA 3QEAZ 1LEHA 4JEMA 1Z4OA 1HI9A 4NRDA 3VVLA 2JFVA 2YR0A 1YQ9A 1U7PA 4G09A 4RWEA 5LMCA 4AP9A 5LZ4A 1A72A 5JD4A 1BW9B 1XEWX 3C2QA 4DA7A 3FDZB 1E66A 3RB8A 1YRWA 2D2EA 4DREA 4IEIA 3TVYA 3MBOA 1DRKA 3JYLA 2O5CA 1Q2UA 2VK8A 4BMZA 3CJTA 4G07A 1DIHA 3NHPA 5FBQB 4U2CA 1EHCA 2NU8B 4LRUA 3CLTD 4D80A 5IBPA 3ZUPA 1D8TA 1C8VB 1QIIA 3LHDA 3BTSA 3QXCA 1TJ4A 1II9A 2J3QA 2XQGA 5HKKD 3C3BA 1IB6A 4ND8B 1T2UA 3N0VA 3V33A 3MCZA 3AEXA 1SU6A 5JSFA 4LHZA 1VBNA 3U13A 2HF2A 2PMFA 3H84A 1Z36A 1V45E 2WYVA 2Z30A 3C16C 2PL5A 4WD3A 2NXCA 3ZGOA 4DIDA 3VR4H 1P80A 2VAVA 2XXBA 1KO8A 2CYCA 4FQ5A 1IK6A 4P4TA 4RY0A 4EHNA 221PA 5HCUA 3VSAA 1B8PA 2Q5OA 2VDOB 4R0NA 1QCDA 5G0UA 4OI1A 3R1IA 4EY8A 4JASB 4RIIA 1TUGA 3ZOZA 2VSNA 4YJFA 2CB0A 2F1OA 4E2XA 4EH1A 3S5JA 2PT9A 2EZ4A 1KQPA 2REBA 3DBHA 2BCEA 3IUPA 4KXQA 3SSMA 4IJKA 2J7KA 4E1BA 1OFUX 1F9EA 1LWOA 1NR5A 4MV3A 5JW6A 1GQRA 1SCUB 4IKEA 1WZ2A 5FP0A 5J2UF 3JD2A 3VH1A 4ENPA 1ZL0A 4RK6A 3PJRA 3RASA 2OVBA 2GJ9A 3M6MD 1W1WA 1JDVA 3WWEA 4QFBA 2BFBB 4F4HA 5IHXA 3UB4A 3FGPA 3UT5A 5CH3A 5TARA 4JD5A 5JJBA 1G5QA 5JS7A 4LFBB 3ZXYA 3ZCVA 4TMWA 3AP1A 4MAFA 3G5AA 2WJ6A 3SQWA 4FDVA 2A0KA 2PKXA 3AEQA 5FNVF 5GINE 4JJ7A 1YFLA 5C3UA 1H23A 3MCAA 3VV2A 5GGXA 3IE1A 3UIEA 1XK7A 4ZZ3A 2H2GA 4DAEA 3PHJA 3K0FA 2YW9A 3D3JA 3FAKA 1EFHA 1U2QA 3BMQA 3AR3A 3K4PA 1NLFA 1EVZA 4D6YA 2PR2A 3RLFA 1BRMA 3B53X 3DGFC 4OKSA 2FQWA 1WVGA 4ON9A 3P0RA 1CZHA 2FZ4A 4R2WA 3EAFA 2P7HA 1M1UA 1P8AA 3LY9A 3QEMA 1EFDN 4LTNA 4L28A 3Q8LA 3FFWA 3KX2A 3IP6A 5LP6B 2P78A 4RFVA 2PEYA 2YVQA 1W5AA 4KVFA 3JAKA 5LQRA 1OU0A 1AURA 4ESHA 1P0CA 1FXWF 1ZC4A 4QWWA 3RRZA 1RI3A 4XJXA 3ITEA 3VSBA 3GV0A 4JAVC 1OZAA 2WD8A 4LHYA 3I9MA 2ACWA 3SICE 1WZCA 1CRQA 2ET6A 4P0TA 2J0UA 1FK8A 3P0EA 4BNMA 1OFVA 4KUGA 1DINA 1BS9A 3A3KA 4RJJA 2NIPA 3HPRA 3I32A 3GRFA 4OBWA 4BVBA 1OFHA 3O1IC 3WI7A 3WA6A 3G3EA 1XDZA 4TSKA 2FEKA 3VNSA 4WKNA 1DG9A 1Y9EA 2QRNA 4NU0A 3A9SA 2Q1YA 2PKYX 4V02A 4EYEA 4XWWA 2M6RA 3PA6A 4Y0AA 1EUCA 4HJRA 1I6WA 2KI5A 2ZI7A 2JF0A 4R01A 2H4YA 2ZK7A 3C74A 1GQOA 1QYXA 3TS1A 2GO7A 2IVFA 2K4MA 3G1UA 1H1TA 1XTBA 3CLSC 4NMXB 3RHSA 1G4HA 3KUDA 2Q3FA 5L4SA 5J1SB 3LQ2A 4I4TF 3GJRA 3UQZA 1XKQA 3EZ7A 4KWEA 4LHSA 3PEWA 1UCFA 3D6VA 4WKPA 1I3LA 5DW0A 4KO2S 3E2MA 4O33A 5CVVA 4CQMD 2YRFA 2X42A 5K0CA 4O2AF 1P2FA 3HZRA 4HQLA 4OBXA 5EZYB 1LRKA 2WYHA 1KR5A 2ECQA 4BE9A 2C92A 3TR0A 4ZAVA 2NQ8A 3EFBA 1JFLA 4JLAA 1RHQA 4P08A 4WN3A 3GN2A 2QI9C 3CZPA 4G26A 5AK6A 2Q5LA 2PGIA 3RUAA 1I30A 4FQ8A 3P20A 4CM5A 5JI2E 2FSSA 2YJGA 4NAVA 4D74A 5DVZA 1GCGA 2B83A 5F3RA 4QTUB 4BQPA 2WE7A 3TOVA 3T54A 3AY6A 2OGTA 3D7MA 4U7GA 3ZE8A 1A8UA 5CLHA 1VHLA 2VQDA 3VPFA 3DMFA 4TLLB 1GL3A 3L7YA 2QTCA 3KHTA 3G82C 4KREA 8ABPA 4AIIA 1ZH4A 4HAIA 4DR3B 5DHFA 1RXUA 2ZRBA 3N6VA 3U40A 5BOSB 3EXEA 3IL2A 4BJ6A 3ZLTA 1QVAA 4DA0A 4ZI7F 3ER6A 3Q9UA 5LZ9A 4DC1A 4ZJYA 3KLBA 4GF5A 3F67A 3WRWA 1EX9A 5D5PA 5FOVA 4QGFA 2BGNA 2G1AA 4X71A 3OCJA 5BR7A 2RGXA 1V8FA 2CF6A 2P62A 3RVKA 1VG8A 1R6DA 4DEYA 4FOLA 2BI8A 5GONF 1T9ZA 3A7EA 4N5LA 3ZIAA 5CXUA 4Z6KA 1M2NA 1YF3A 3O4JA 2Z95A 4KN9S 3GP3A 2HJGA 1NW4A 2Z4SA 3AHCA 4NU6A 5FA6A 2C5EA 4QUKA 4RJLA 3CH5A 1RXVA 1Z6QA 1F51E 3OPYA 2DQYA 3HY4A 2ZULA 1PGPA 5CT6A 4W5NA 3WFJA 2Y3IA 3ACCA 1QH8B 2I2DA 4BAUA 3QX9A 3T7SA 4EGQA 4XM2A 1AH2A 2QX4A 1SVOA 5FTWA 1K2WA 1EUZA 4KXWA 1Y9AA 4IF6A 1E69A 2PLNA 3BTVA 1P9LA 1Z0AA 4Q1FA 5BYAA 4XDYA 4FXOA 3JW8A 3TLCA 3F7OA 3F47A 1H05A 4J0DA 4LRYA 5IVDA 3VDRA 4WH0A 3R23A 1TLFA 4HHEA 4A1FA 4DJFC 2D7DA 1E2JA 2JC3A 3EQ8A 4FILA 5EFOA 1SVLA 1DJQA 3MOIA 3PPWA 4I46A 1B1CA 1TM5E 1G5HA 2XNSA 1HUQA 1GT6A 4FOPA 4GP6A 4LXTA 4MLPA 4MWSA 3PUXA 3TOZA 4Q37A 3WK5A 1BWSA 4RDHA 4EGFA 4IIBA 3REQB 1CR6A 3D0KA 2V3WA 3G8AA 4Y9TA 1OBHA 4FDUA 5EWMB 4DPKA 2QB5A 3K8OE 2PX6A 5I3ZA 4XKJA 4BNWA 1F6WA 2OB2A 3GP5A 3OIUA 1R6VA 4BQQA 4CR8A 3MJDA 2VDJA 3HV2A 4MKRA 5KNBA 1OWMA 4KOEC 4B2PA 4NX2A 1FPMA 2IZZA 2XDAA 3K0HA 1DPGA 1ZMXA 3N7TA 1XL1A 4RELA 7ABPA 4GVXA 4DMMA 4RY9A 2N1BA 3FMVA 2UU9B 1S2GA 4C03A 3TPFA 4O2LA 4X95A 1F5SA 1VJ1A 1FFBA 4YECA 1L4EA 2O48X 3P2KA 2JI4A 3LI2A 4AY4A 2EX0A 1Y5LA 3UHAA 1BMDA 5TIIA 3TSWA 1EP2B 3JTEA 4PXSA 1IN6A 3STHA 1FUEA 2ADOA 4J6FA 5IS2A 2C2ZA 2GPNA 1NT4A 3BJEA 4NEGA 2AC7A 5C1PA 2QDKA 3II6X 5CB8A 4CEHB 3U4QB 4A03A 1FMTA 2B4QA 2EKQA 1N2CA 1QF9A 4ND7A 4ECAA 4D0GA 3MTJA 4Q82A 4XI9A 4GAEA 2WFLB 1UK8A 4HFRA 3G6KA 2C7OA 4HGRA 1LLDA 3BIWA 2I2FA 4J0JA 3PFNA 3WJ2A 4B3CA 3Q85A 4YRGA 4BGDA 3K2QA 1S96A 5FTLA 5EZSA 3THSA 2QRKA 3AUSA 3MPOA 4MS1B 3VPXA 4TQAA 5KHOC 3UOWA 2VJOA 4QUBA 3RTDA 1F8UA 2XT0A 1AS3A 2XZTA 2R11A 3FBGA 1U63A 3KZKA 3RARA 1HMYA 1XZPA 4OOFA 3UGTA 3WK9A 4JU9A 2WWFA 3WWCA 2FJPA 3PFIA 2H5EA 3WQSB 4CF6A 2D5CA 5JWRA 1NMXA 1P7ZA 2LIPA 2ZAYA 3FUWA 1FU7A 5BSKA 1BDHA 1X7WA 3ORRA 4J2HA 1ZI8A 2E37A 1ND5A 2FW1A 1BSVA 1CDEA 2BKUA 4I1IA 3E9RA 3NZEA 4QTYA 3DVAA 4RULA 3TNYA 1DC4A 5GJWC 2HEIA 4GPD1 4WNAA 3RHZA 2XF8A 4JN6B 3ZCXA 2ZCVA 4NE9A 3BH7A 4NPCA 2FXIA 4X7BA 5CEFA 1C5KA 5BVHA 1K1EA 2QTGA 2VHZA 4RHFA 4C9BA 1ZR2A 3M4JA 5F1OA 4KR0A 1QH1B 4AY6A 1ZCBA 2VQ3A 3FDJA 3N2EA 4XUDA 2QYSA 1H8HA 2HA6A 3N2KA 2ZREA 2OP1A 2ZRJA 1UT8A 1H6DA 2OB1A 4H7JA 3C41J 4UNSA 3SVZA 3CPHA 2B8WA 3NDBB 1TQ8A 1C1YA 3W8EA 2JH3A 1FFAA 2PRYA 4LCBA 3DM5A 4BFZA 5JO0A 1P73A 4P53A 5CK4A 5DGHA 4PYLA 3U3MA 4BUCA 1DUSA 5IDWA 4DKJA 3SYNA 2Z6AA 1CR0A 3AVUA 3PK0A 4XUGB 2JEYA 3MHTA 5H7XA 2Q0SA 2EBUA 3QXJA 1WDLA 3ABRB 4LC0A 4C1BA 4NZZA 2Q3EA 1A7KA 3GEMA 2IPXA 3PJDA 1CQIA 4RACA 2YV1A 3Q4GA 2FP4A 3VPBA 1E2HA 4RPJA 3EAQA 1L8OA 1LK5A 3KE8A 1IM8A 4XVHA 4EMSA 1VM6A 3R5FA 1AGRA 4I5DA 4GRAA 1GU1A 4BZPA 3NNSA 4EL5A 3N3BC 3S0JA 2UV8A 3JALA 4NBVA 3LIPA 3X2EA 2B69A 1AZTA 1G0OA 4JOSA 3CVOA 4MJLA 2HCFA 5DNWA 3NBXX 1A98A 3H2BA 3GROA 1I7LA 4AJLA 2PMEA 3OQVA 4MEJA 2IYWA 2YVUA 2JJ1D 3Q6MA 4JJAA 4NYMQ 1RWVA 3HBJA 1C0IA 2MINA 3C3WA 4FHEA 1UDAA 3W7VA 3C7CB 4MP3A 4U9HS 3R6LA 5FTMA 3T5CA 3TLMA 5CJJA 5G4KA 5IFKA 4QQRA 2OXRA 1D5WA 1X74A 2XITA 3D8SA 5BP7A 2RHGB 5KPJA 2WM3A 3Q9SA 1HM5A 3TIVA 1YJCA 4NBSA 3STWA 2J4FA 1MDFA 2M9MA 4BLQA 4L8FA 1QRRA 2Q5CA 3NYWA 2HFJA 3PD1A 4LS3A 3PC3A 4MRRA 2V8BA 4KX5A 5HK8A 2OO3A 4DMKA 3H1AA 2PT6A 1ZSVA 2NU7A 5CPFA 2BYTA 1L5WA 4V0OA 3HFGA 2WAMA 1M1ZA 3K0CA 4KQ1A 1YB2A 4GWKA 3UT6A 2HQ1A 1BOFA 4C7BA 2OLEA 2XT6A 5IYZB 3M1AA 3B38A 4G0PA 1SVIA 2I66A 4LXGA 3MQ2A 1FEZA 4WXRA 4IXWA 3D3WA 1DBWA 2FRXA 2JKYA 2AYYA 3HGQA 4LNUB 2O1SA 4XGIA 1OXTA 3K1AB 5FEMA 1T10A 5TPZA 2O3TA 3OIYA 2NZJA 2WIKA 1SBYA 5CM2Z 1O0CA 3REGA 1VIMA 1NVUQ 2XWBF 4KIFA 4D4IA 1OVMA 2W6CX 3BF8A 1Z6ZA 2QD3A 4CGYA 1MB9A 4K3VA 1YK0A 3K20A 5DSZA 3QU5A 3D5EA 3H9CA 1AKUA 3I42A 1YRAA 3MC1A 1K4YA 4MKXA 5T4FA 1XHLA 4JC4A 4N41A 5FQOA 4BO3A 5MHTA 1Z7WA 5HF6A 4ZARA 3ZK8A 3SWWA 2QLNA 3H9JA 1WUIS 4EA8A 2QMOA 3LLUA 4P9NA 4REQA 1K6MA 4HTAA 5FBZA 3ORFA 4EY7A 3F9RA 5K2MA 3SZLA 4PGFA 5LB4A 3BMOB 4L51A 1FYVA 2BELA 1E1QA 1R16A 2IODA 5DGTA 2ZB8A 1RQNA 4LY6A 2QN1A 3P2MA 1R74A 3KCNA 4EA7A 1IONA 1KARA 2GHRA 3MTDA 3G0CA 3I6IA 3ZBTA 4P1ZA 1G21E 1TKRA 5FWYB 3FPFA 5AVTA 2W48A 4ND3A 1UFVA 2PLRA 2PWZA 2JFWA 4L07A 1XMOB 4MQMA 4M8SA 1NZDA 1E63A 4NIMA 3O8LA 3Q8WA 2ZYHA 4MI3A 5EPOA 4LOAA 4WOJA 2W2OA 2FMHA 2X76A 3SGLA 2DBVO 1EFTA 4QYIA 2I2XB 3NC1C 4Z9XA 5B1IA 5BN3A 2R44A 4RKQA 1CUJA 4KLAA 4DT1A 1IQPA 1YU6A 4XZ3A 4RTSA 2DLNA 1YC2A 3PI7A 2BGIA 2DUJA 1Q6ZA 1AUPA 1RYFA 3PE4A 2OAP1 1YZTA 3R0XA 3DDNA 3ZX4A 4BO6A 5JARA 5F9FA 1U2SA 4M2LA 4HZGA 5E4YA 5A3JA 3HJAA 3HSKA 4PBTA 1GAEO 5KQPA 2A7QA 1H4VB 2BUAA 2ANCA 5HVNA 2H1IA 4PX9A 3JAWA 1GXSA 2ODEA 3JQ7A 3OZCA 3PDHA 4BBJA 4L73A 4NZOA 3D2AA 4RM3A 2FPOA 3HSSA 4EA6A 4YCSA 4KXVA 1W0CA 1KQNA 1G5RA 4B2YA 1Z12A 1OC2A 3V1LA 5FO1A 5J2TF 3X44A 1ZH8A 3U7HB 4LGCA 2HRDA 5C81A 2E4UA 1DEHA 2ZWOA 3OQBA 3AW8A 3W5HA 3WJAA 1P9WA 1R9JA 2W6JD 2FK7A 1SCQA 3PA8A 1UJ4A 4YCMA 5JXIA 3IDOA 1OI7A 4CMKA 5D87A 4NYIQ 4UUBA 2CFSA 1UC4B 3I0ZA 2AE2A 2JFHA 3RS5A 3UK0A 2YJNA 3CINA 1UFQA 3QUAA 3TFQA 2O07A 1HDGO 1E3WB 5SY9A 1WB6A 2H92A 3B70A 2WYOA 2R5FA 1T3TA 3W6ZA 1PT8A 3SIRA 4CTKA 3M7IA 1GGJA 1WSAA 2W8BA 2R8EA 4KSYA 5U4XA 4F97A 1M2KA 4HBZA 4TTJA 3TWOA 4CCWA 4XFDA 2WPNA 3ME5A 2OFOA 1Q7BA 4FKMA 3PDCA 4OHXA 3JQRA 3NXSA 3ZQ4A 2OHXA 4B32A 5KSYA 3UK1A 3RTGA 2XCOA 2E49A 4DILA 1L5HB 3HO6A 1B00A 5JUWA 4DUGA 1USVA 2ZS9A 3B8EA 3RU7A 1OH7A 1SBHA 2P9TA 3N74A 1BXGA 1VLZA 2X4DA 2PJUA 4H60A 3D54D 5KVAA 4QUEA 2FQQA 2DUWA 2F59A 1NW7A 2GN8A 3JYPA 1Y5MA 1WCYA 3E6AA 1XJCA 2P8SA 3H5LA 5JD5A 4GX0A 1HV8A 1NDHA 1PJLA 2WSSD 5E1MA 3WB1A 4YP6A 4L3VA 4IHAA 5CT5A 3WTCA 5EZQA 3JQBC 1COZA 2B2XA 4AYWA 2Y2UA 3H5AA 4RMJA 4ZVMA 4U7JA 5EJEA 1R4MA 1JG2A 3VDMA 2ZQ5A 2D1RA 4Z9BA 3R7BA 3NHZA 3FNHA 3SXUA 3I09A 2AQKA 4OHFA 4DCPA 1C7QA 3RV4A 4I9FA 3TCKA 3N8HA 3IUSA 3O9MA 3PRJA 4DCGA 3DT8A 4MGHA 5AXAA 3C3AA 3PXBA 1FP4B 3EISA 1E1RD 3V8MA 3WLRA 4BNKA 1WMDA 1XKXA 4RJKA 3DE1X 5CH8A 2XE8A 3AI1A 3EJWA 4M7OA 2GT1A 4LDJA 1KPGA 1SQFA 3GBSA 2FH5B 3VI3B 2POCA 1NQ5A 3L5OA 2DT5A 4PLVA 2X23A 1VPTA 3L0PA 1JR2A 4IYRA 5AKKA 3OM1A 3L04A 4HN2A 1O57A 1GGKA 5EESA 3E05A 3K9LA 3JZFA 4QXRA 2RBGA 4TWJA 4D4JA 3H5IA 4H3HB 3VNRA 3I53A 3E9QA 3DYBA 3AF2A 3EFOA 1ZOPA 3CH4B 1JQ5A 2XCTB 3PXAA 1PCXA 1I3CA 2OQIA 2AEJA 1KU6A 4FN4A 4QUDA 4U7TB 4Y2HA 5JMWA 1DIAA 2WSLA 3WXBA 3CZAA 5A4IS 4NESA 4GYJA 1J25A 2YY5A 3QLJA 4I2VA 5MN5A 3OPYI 4QASA 3C45A 5CYOA 3T5DA 121PA 2EF1A 4NOJA 4FGSA 2BSAA 2IYAA 5B58T 3WHPA 1IAQA 3GLGA 3FJ1A 5HTKA 1JR3A 2VYVA 2AL7A 4QIHA 4RLHA 3D4BA 4DCJA 3UWOA 1KJ8A 1SIOA 1Y48E 2G88A 4NNJA 1UWKA 5C1DA 4L85A 5C7LO 5JJ5A 1T9BA 4FPXA 4D9FA 3MWJA 5EYPB 2UXDB 4LZZA 1CULC 3O3OB 3NWBA 5AFSA 3IUBA 3ZK7A 4RTPA 1DX4A 2CN1A 2X14A 4LSWA 4D4GA 2ZXEA 3ZGYA 4NQZA 2WMOB 3OO0A 3ISVA 3STUA 2GTIA 4EMTA 4R1MA 2PZAA 1UBCA 4FFOA 1L6RA 4QTXA 1ZRMA 3P5SA 1WS6A 1XZGA 4LOLA 4YP9A 3EH2A 1OJLA 4C7VA 1T3GA 3RVDA 3OIFA 1G9SA 2PV0A 5CRIA 2H52A 2FMUA 2G9QA 4M9RA 2CXTA 3ZNNA 4KACA 4I4LA 2WI8A 3ICEA 3P32A 1JH9A 2ZR7A 2YJ3A 4PFKA 5BRAA 1WDTA 2VRNA 4MPTA 2NVBA 1H22A 4EECA 2ZIUB 4B6FA 4OXIA 5FBKA 3A3PA 3QVWA 3OCVA 2G4CA 1A9SA 5HKBA 5CT8A 4FOTA 2ARKA 4Y1GA 2YHUA 4RHYA 2W0SA 4MI9A 1V7CA 2NUAA 3N87A 3PFHA 1H6BA 1VKOA 1CUDA 1QYCA 1KAHA 4GI1A 1TNDA 2FR0A 1K6XA 3CA8A 1BO6A 3GLFE 5BR4A 4ZODA 5AM4A 2DG2A 4IZHA 5IJ9A 4NE7A 1JS1X 4NL4H 3WLIA 1O87A 1A5TA 3B20A 3FMFA 3FOFC 1MC8A 3VU0A 1UK9A 4HCJA 4URFA 1ADFA 1JFFA 3O94A 4PYQA 3NVMB 3JQ8A 5JWHA 1JDPA 4RESA 3NAZA 4C89A 4C0QC 2D1FA 3BDAA 4J0IA 1ZAYA 5FOTA 4AJ4A 4EHIA 1V7PC 4HH4A 3W04A 1ACJA 4LPSA 4Z4QA 3QOWA 2YUTA 521PA 1PX0A 3I04M 1BDJA 1G5FA 3IUQA 3QLTA 1DWPA 2HK7A 4WKGA 2WIGA 5M2QA 1G5IA 2MWMA 2AOWA 1ZLXA 3VVMA 3SR4A 3FDFA 5B3KA 3FOCA 3NYQA 4B81A 4BOYA 3NC0C 1OW3B 3G2HA 2N3ZA 1EFAA 3GK3A 3WNQA 1PGQA 4C3OB 2BHNA 4GE0A 4NV1A 3ABIA 1PW7A 3QFCA 3RSZA 5DNVA 1YS9A 1SC4A 1BEEA 5DT9A 4Q7EA 2WFAA 1MVLA 3MCVA 2DWQA 5B7NA 3KQUA 3I3OA 5IMSA 3IAXA 4ZEXA 2ZUCA 1XZFA 2F67A 5BRNA 1GQFA 3FFXA 3CE6A 3U4HA 3ZU6A 3T5MA 2WV7A 2YC2C 2ECOA 4BEWA 4TWAA 2RSLA 3ANYB 4MARA 1QIHA 3ZXXA 3RT7A 4C30A 2AFVA 4FMDB 4A23A 1IULA 3EUAA 5JHHB 4PYRA 3IJ5A 3EGXA 3LKZA 4ZJUA 1FSZA 1GVNB 3TCXB 5SICE 2ZI6A 1BKDR 3PYMA 5BUQA 2J5XA 3QYJA 4G5FA 5T4EA 1TD1A 3HHPA 3MWEB 1U02A 2XDQA 3ENNA 2HK6A 3L6CA 3F6BX 5TX7A 2VRCD 3C7KA 1QZ3A 1A69A 3G9TA 4IV0A 1GVHA 1KZ1A 1WWKA 1YDMA 2EU8A 3GIDA 2WF7A 3W34A 3WV4A 1L1RA 2IZOA 1C7EA 3RHTA 4HX5A 2C0QA 1ZM9A 4WLOA 1FVHA 3FHCB 1DEKA 1TM7E 1R8JA 2REQA 3GPIA 4JS0A 2QI9F 3DBLA 3R7LA 3LA6A 4O4HA 1UMCB 2FUEA 4J49A 1FTGA 4Y3UA 1ZD5A 3CU5A 4L4RA 4X0EA 5CA0B 5F4BA 4D46A 4H6PA 4L08A 4A6DA 4CKWB 3BWDD 1GPBA 1XCPA 3QKTA 5EP4A 3ZZMA 3CCFA 4B2LA 3ZVMA 2ZJAA 1JPNA 3FGZA 3LRTA 1QPZA 3N6RA 1OLXB 4N5HX 1XZKA 2VCEA 4DCSA 5C4MA 3QNMA 1UOPA 2FPSA 5K6TA 3UPUA 3ZX5A 1GEEA 3PJGA 3OFKA 4QDOA 3WQHA 4YY3B 3R44A 8MHTA 3F71A 4Q93A 1JUDA 2ODTX 1U2DA 3WWZA 3P5BA 5J4YA 1JDSA 5IHPA 1N2XA 4I9NA 1TDJA 1E3SA 5KVQA 2B1QA 3KO8A 3QE9Y 4GSKA 4DLYA 5B7QA 2YXBA 4Y9DA 2BFDB 2XJ4A 3GLSA 4BNGA 5IN5A 1P4RA 4EUHA 4NOKA 5JOQA 1J0BA 1ACMA 4ARBA 1UPAA 5CGQB 1ICIA 1VRVA 1KMQA 5JEEA 1VPVA 5F9HA 3GCZA 2P69A 2SKDA 5COAA 5JMTA 3KOYA 3GGGA 3LKDA 4LDRA 4X1IA 4X90A 5AO9A 3K0BA 3MGKA 4CL3A 5FCDA 2AXNA 2P5YA 4O4IB 1C2YA 4UMFA 1QO9A 2AXPA 1CLUA 3AI2A 3DFZA 2HLHA 1OV4A 1Z6PA 3GDFA 3ND6A 1SZDA 2BEWA 3GAAA 4OHVA 1WCV1 4BNXA 4UEWA 2NP6A 2AVNA 4QU0A 3B6IA 4AO8A 1OGJA 5LDGA 4Q9NA 1KI3A 2RE8A 4AF7A 1AKEA 4PFJA 1TMGE 3V4PB 2WNIA 2WHQA 3TTTA 4WZBB 1YQUA 3K7EA 3RAFC 1I2AA 3MT7A 3NUZA 3BK7A 1JBEA 1XKTA 1YONA 1XX6A 3EVBA 4B4WA 3GLIB 2OFXA 1H5NA 1ZMBA 1K06A 2IA5A 2Z2IA 1DT5A 3IIEA 5KIAA 4JV5B 1RP1A 1X7XA 3I62A 1KOJA 3IS3A 5BT9A 3OX2A 4LE2A 5BYBA 3ZWKA 3QEBZ 4X94A 4OXRA 2QZ9A 3OZTA 2FFBA 4HNSA 4PZLA 1TTHA 3CUYA 4YLEA 4E32A 5LQDA 4X61A 5AVXA 3S81A 3UUFA 3WLNA 1U2DC 3NM4A 1DBPA 2L82A 3KOOA 1XZNA 1FF9A 4MVYA 1IZ7A 2FSPA 3HTXA 3I0NA 4LV8B 1VJRA 1LQTA 3AI3A 4RD3A 1GWNA 1VMKA 5TF0A 4ZVKA 2EL7A 1AXEA 1YULA 2P9EA 1VJTA 3D6FA 4QE3A 3P9XA 4DSUA 3QU9A 1YR2A 4Q3LA 1SOVA 1EX1A 3KL4A 1GTG1 3ODPA 5AVQA 1O95A 5JZBA 3DOIA 1OASA 1QIKA 1T5DX 2X58A 1DEAA 4X45A 1FDSA 2HXSA 2I22A 2RD2A 5CIYA 1R12A 3O82A 1FFXA 1A7AA 2GGSA 2IPAB 4PPYA 4D8WA 4URUR 2ZPUA 3JR3A 3HMKA 1LJ8A 3V6MA 4ND5A 5K3AA 3ZNQA 1CUHA 4YQEA 3GMTA 5FLYA 7MDHA 1E7RA 3FZQA 3WLOA 2E5WA 2VHEA 1E7SA 1GR0A 1ZLYA 2PQ6A 3JRWA 4RSMA 2XB9A 4TMXA 3V1KA 4X97A 2MTBA 1ECGA 4TL9A 3I5XA 3WYEA 2BSXA 4QGAA 5JVDA 1IK4A 1W36C 3PU6A 3R41A 4XWYA 4BNFA 5IANA 1DAIA 1K7YA 4KQKA 2QZ4A 3A06A 1WUHS 3D3EA 1GD1O 3FAZA 1WHTA 4BASA 5IX8A 5IXJA 4J7UA 2XX3A 4QPZA 2FGJA 3B9BA 1AF7A 1PSZA 4P93A 2IC5A 4JLUA 3KWFA 1IUOA 2Z57A 5GZ1A 3FPKA 4Y0NA 1R0XA 4FKZA 1CZKA 1KZ6A 3UA3A 1M6WA 3BC1A 4OHYA 2C54A 3FWYA 2IXEA 3QHAA 4F4FA 4Z49A 5GGYA 1DV2A 3IJPA 4PLFA 1NW5A 4YLYA 4H31A 1ZJYA 3HUFA 1ZL2A 2HBZA 1F8YA 2P6NA 2I5PO 1IOWA 4RGBA 3ZWAA 1LBTA 1AZLA 4HH0A 3W5CA 1H0SA 1TYCA 4MVWA 2QSJA 2X8JA 1WY5A 1CJVC 1O6GA 4J1QA 4OQMA 3E9MA 4X85A 2GK4A 3AR6A 4R1PA 4RV9A 4WEQA 3I30X 3O4FA 4OK3A 3CR7A 1O95C 2QTRA 4V0SA 1X38A 3ZIAD 2EP8A 3IEPA 1EQUA 2Q45A 1RTKA 1PZGA 3MLEA 3TSOA 5KB3A 1KWGA 1TTTA 2ZBGA 5TVGA 4MHOA 4AZ3B 1G2QA 4C5AA 4X20A 1GUZA 2IUFA 3I52A 3KQTA 5DW3A 4FB5A 3H5RA 4L7QA 3A11A 4HFMA 3EZGA 4P4SA 4ASUA 4TT8A 4PX5A 2GHQA 4EPRA 1VL6A 3DAFA 4NAUA 3MB5A 3VPSA 4X00A 2H8GA 3FCAA 1UM9B 5BN4A 3IR6A 3GFQA 3LMKA 2PT5A 3ZY2A 2ILTA 3D8NA 4B7UA 1CEEA 3K92A 2XGGA 2GILA 2ZB7A 3FE2A 3K0EA 4KRXA 2AQ8A 5AW5A 5BVGA 4AX8A 1NNUA 5AOAA 1E98A 1IN8A 2BUBA 3N7UA 3TW8A 3ND8A 3C7AA 3LG2A 4P31A 1GNRA 1QE3A 1VLMA 3QVLA 1TC2A 4XSHA 3VAYA 4JWTA 3AUTA 2DXIA 1LPSA 1I4TD 2ISSD 3A27A 4L4XA 4X1YA 1RNLA 1QFXA 3M5PA 1A9XB 1XD9A 3OESA 4KIUA 3PIDA 4M53A 2J8ZA 4RZQA 4TTIA 1L7VC 3VNAA 1DS6A 4ZDWA 1N0VC 4C7OB 3HKBA 3TW0A 4I5IA 1A8PA 4CQMB 5KX5A 3WFZA 2UUOA 4CV1A 1YFKA 4HB0A 3G5LA 2GESA 3O91A 1TA9A 3DT9A 4B74A 5KNDA 1DSSG 1G2OA 4Z0PA 4ESEA 2UUCB 4ND6A 4D26A 4HN9A 4KFTA 2ORIA 3KHUA 4QODA 3SC3A 3T41A 1Z6AA 4XWGA 4KR2A 1LWNA 1YV9A 4AZVA 3O9VA 3NWPA 1UPUA 4AM8A 4HS4A 1ZIPA 6CHYA 3T9CA 2GVDC 5JZ9A 3FCCA 1IBRA 4ZZ1A 4R1QA 1QDUA 3RJ5A 2HU5A 4C5BA 4JB2A 5DV9A 5GMOA 4F06A 1Y1TA 2VDKB 3C14C 4WUTA 4JBIA 4ZO6A 5K1ZA 5K3SA 3PD0A 2DLCX 4RL4A 5KKNB 2Q5JA 5HIKA 4GC5A 5JY1A 2O8EA 1HE3A 4C2UA 2WKSA 1DKNA 3SDZA 4EM6A 1WHSA 1K7XB 3B1XA 1CW2B 2GEBA 4Z0TA 4I5FA 2VT3A 4CIDA 1Y7TA 2ZJ1A 3EDQA 5EUBA 1EXWA 4BVAA 5I9LA 4QTZA 2UVDA 3HUEA 1VE9A 1QOQB 2PX2A 4ZT3A 4CNBA 4DWJA 2W2PA 5F33A 1MLDA 2RH8A 1CJSA 1E58A 4KRFA 4A10A 1BDBA 2C00A 3A2NA 4DM3A 3MYYA 2WE8A 4OQXA 3MQFA 4KSCA 4LUCA 3R74A 1L5GB 5KNCA 1OX4B 1E7YA 3M3HA 3HYLA 2W00A 4GI7A 3HXLA 4L0CA 3I2KA 1COWA 3GR6A 3K6JA 3WC4A 3DFUA 5HCIA 5IH7A 2UYOA 1VECA 2WYUA 5IKEA 1VJCA 1XMSA 2CHVA 2QE7A 2WSMA 2X6QA 3LT4A 3O8CA 1HQDA 4JVMA 4PY2A 2UYHA 4RIEA 5EWLA 4NCIA 2ODPA 5GP1A 3GDHA 5H0IA 2V6IA 3EF3A 1H66A 1CP2A 5L3QB 4A15A 3AMVA 3E7DA 3GB9A 2COUA 1RSZA 4J1TA 1LPMA 4KYTA 3WLTA 1MX1A 1M0TA 2EF0A 4G1CA 3WLHA 3ZY3A 1C1DB 1Y4AE 2P0EA 4OG2A 5HIMA 2J0VA 1PAUA 1SUEA 1UK7A 3BJZA 3DCJA 1KK1A 3SQLA 4IKPA 1H2AS 1QK5A 1S89A 3IPCA 1M7HA 5AKJA 1DLJA 4F1JA 1YASA 4R8VA 4EUKA 1IY8A 2ZG6A 3OMWA 1ZH6A 5GJVC 1XEXA 1CS0B 4E3WA 1GTJ1 3FYUC 2OUKA 1IY2A 4XM0A 3HCBA 3I3SR 1ONPA 1MRNA 5DTMA 4DBLE 5AI6A 4ARZB 2AFHE 2Y0BA 3GNTA 3AR9A 1ZN8A 1EUQA 1Z0SA 3KOXA 4D43A 5LIRA 2AHOA 4M9XA 1UKYA 4FIZA 1VB3A 3MOGA 5C80A 1Z13A 4BJ1A 2N47A 4R8MA 4CTOA 4IIJF 4AJEA 3W3AH 1XU9A 2FB9A 5ADUS 1NJFA 2R7LA 2ZUUA 1WPQA 2R1VA 2YBDA 2QD4A 1OHHA 2A4KA 2WAYA 5FI0B 2R79A 5IU6A 1U98A 2GQ0A 1Z6GA 5JFOA 5EGNA 1G4AE 3IEIA 1SU7A 4HDCA 4QU9A 1MH9A 1CG6A 5FWXA 2WIAA 2QRJA 3KTOA 3N7AA 1D8AA 1ZD8A 5D6OA 4RLSA 1RI1A 4FINA 1YL7A 2WJJA 3ND7A 3AJ9A 1VMDA 3D6JA 3CTMA 3K8QA 4U5XA 4XDZA 1VRWA 3JQFA 1HSOA 5AI9A 3F3SA 2XECA 5CG2A 4AKSA 2RG7A 1KVRA 1MT3A 4DRYA 2A92A 3ZHRA 2HMYB 1ULBA 5BSUA 1LJLA 4RVCA 1C1XB 3ZH2A 1NR1A 1CFZA 2ODBA 3DONA 4J1TC 3U31A 4ZYWA 1T36A 3QWAA 4PYMA 3TOCA 5IZCA 4QM7A 1ENYA 2G9RA 3OA0A 4FJ2A 4MLZA 4X60A 4DADA 4GBGA 5IM5A 3JXEA 4PHHA 4DLNA 2GVZC 3UAXA 4DLAA 5CDSA 3GLGE 2XTZA 1U1DA 1YCHA 3PITA 3ICOA 2PYIA 2IP2A 4TUYB 5H8WA 4XWKA 4BP1A 5L3VA 1HTWA 3PVZA 1N5OX 4KPEC 1FNCA 1GTZA 1GQ2A 1Y3IA 2RCYA 3L1HA 2C59A 2PG3A 1GKUB 4QPCA 4UVDA 3RS7A 2P5UA 3BZWA 5KI6A 2AKEA 2IBSA 3OX3A 4BMOB 5AKLA 3V4FA 5EE0A 2ZW9A 4KYIB 4F4CA 1QQBA 1MBZA 4IGEA 4IIUA 3H17A 2XVMA 1V8OA 4YLGA 2GPWA 1PNRA 1RCUA 4KWTA 4GPZA 1T0UA 3ZVNA 3BBPA 2EHDA 3D6UA 2A0WA 2XOXA 2BAGA 1E96A 2GA9A 3H2IA 1F6DA 3PIRA 4II3A 2DYKA 4CQLB 1TM4E 3I92A 1BJKA 2HPAA 4PZDA 4BFYA 2NMVA 3IDQA 5IDQA 2O8DA 1I36A 2CXUA 4JOQA 1YB6A 2GPYA 5E6RA 3E9DA 2R6R1 3OPVA 1Q1GA 5J63A 5TPZD 3RNOA 1N5MA 3SLKA 3ST7A 4C0AC 1XGKA 3TMKA 3T7TA 4AS3A 4UTPA 4G9GA 1PDVA 4H4EA 3JQAA 1Q84A 5EPEA 2C2OA 3RI3A 4L9SA 1TM2A 2CUZA 4QYMA 3CF4A 2QRVB 3PLRA 3JQFC 4RSGA 3CG4A 1JIIA 3U5TA 2BTEA 3PDIA 3RAJA 2ISCA 1A9YA 2XB8A 4WLEA 5FULA 5TS2A 3UXEA 3TGLA 3H3FA 1CIVA 1RRFA 2F43B 4ENQA 5IZCC 1L5SA 3MJFA 1J07A 3W78A 3WGHA 1TKBA 1PLLA 1CERA 5BV8A 2WZCA 5KTKA 1GLGA 2RJNA 3OIGA 3B5JA 1IBLB 1E1QD 1OYOA 4Q9HA 5ALLA 5PGMA 4JJEA 3UWKA 2F4VB 2BFEA 4RTMA 1JBKA 4LVOA 1BIFA 4ZOLA 3GRUA 2R8YA 5ALNA 1T6YA 3LUPA 4GQBA 3OBIA 3FHJA 4OXQA 4A2WA 1SBIA 2ZGVA 1CQJB 3C0KA 1MHTA 3AVPA 2DVMA 5FO0A 2OCAA 1NI3A 2QRUA 3OX1A 4QXOA 4YPFA 5IVIA 5JNLA 5KEIA 1Z8HA 1DC6A 4BZQA 2PR7A 4GI2A 3EIEA 5AK5A 3VC2A 3G0HA 2NNWB 2WZQA 3ICPA 4UAGA 3W8FA 4CGZA 3T7RA 3PUVA 2H08A 2PLWA 2YVLA 2ZUBA 3OJCA 1F0NA 2UZ1B 1XIVA 2WVHA 3GF4A 5K09A 1Y6GA 1F5NA 4PCAA 3S70A 3V4ZA 2IP1A 2YICA 4UBMA 2CL0X 2GDZA 3N8GA 3C6BA 4L5JA 5CTJA 3K09A 5FBHA 1VRCA 3EXFB 4MINA 1DJPA 2JFOA 2QTLA 5HQ3A 4ZPJA 4L5AA 1QC5A 2I2WA 2V74B 4ND4A 3LTNC 4Q7MB 5KOJB 1OA1A 3DR5A 1KERA 4EUNA 2J9RA 2LCFA 1C4XA 2IL1A 4NY1A 3OLXA 4GEGA 3RJTA 3DAPA 4FZ5A 4S12A 3VPAA 4Z86A 2PY6A 1ODKA 1KEUA 2EARA 5KS2A 2PXHA 3GVCA 2P4UA 1FTWA 5ER6A 1WW3A 1LDGA 2J9ZB 2XMBA 1BX3A 3RF6A