5JSYA

The 3d structure of the ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough at 1.04 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
GTLTGERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis.
pubmed doi rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase, small subunit
total genus 85
structure length 283
sequence length 283
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jsyA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jsyA02
5JT1A 4KO4S 4KO2S 1FRVA 5JSYA 1CC1S 1YRQA 5A4IS 1UBOS 1WULS 1WUIS 4OMFG 4UQLA 5ADUS 5JSHA 1WUHS 1WUJS 3H3XA 4IUBS 4KN9S 4UPVA 4UQPA 5D51S 3ZE9A 4CI0B 1UBMS 1WUKS 1UBHS 3UQYS 2FRVA 4UPEA 3USCS 4UD2A 5JRDS 4IUCS 1E3DA 5JSUA 4UCQA 3CURA 4U9HS 1UBUS 4UE6A 4URHA 4KL8S 4UEQA 2WPNA 5A4FS 3ZE6A 4UE2A 3MYRA 4IUDS 4UCWA 1UBKS 1UBLS 3ZEAA 4C3OB 1H2RS 3CUSA 5JSKA 1UBJS 3ZE7A 1UBRS 4UEWA 4U9IS 5A4MS 3RGWS 4TTTS 3AYZB 3AYXB 4GD3Q 4UCXA 1FRFS 3ZE8A 4KO1S 4UD6A 3USES 1H2AS 1YQ9A 1UBTS 4KO3S 4UE3S 1YQWA
chains in the Genus database with same CATH superfamily
3KV3O 4B79A 3OSUA 3ZVLA 1WZNA 3KD3A 2ZPUA 2FWAA 4DDVA 1WXQA 3INGA 3LX8A 4M0UA 4OATA 2QXTA 4N5NA 3I5UA 1B0PA 1GPAA 1WCYA 2W2VA 3QVSA 4L0DA 1D4FA 2OMEA 3NTOA 2FEMA 3NVKI 4WCFA 3RYTC 3I5YA 4N41A 3MINA 4G81A 2PIAA 2QQFA 2YWRA 4ZO9A 4BEVA 3VHXA 2ZTVA 5DN9A 4PIMA 2PJDA 3BG5A 4HUJA 4M9SA 4N7MA 3STVA 3WHIA 4D8WA 2VWQA 4DM3A 4QG3A 2W93A 3COPA 3SC3A 1ZU4A 2Q4OA 4PZUA 3DPIA 1V11B 3HJFA 2ABWA 2I1WA 5KYWB 1M0SA 2IUFA 3JQAD 3WWOA 5LWHA 4NFLA 4C7XA 4E07A 4CKCA 3LO8A 3H5NA 3QI7A 2Q2NA 4ZC1A 1R9JA 2OLEA 2IUTA 1GV0A 1BKYA 2WD7B 2ZQ5A 2OOSA 1ETHA 1VGRA 3SS9X 3O90A 2RD2A 1PGJA 1IUKA 3VC7A 1RQPA 1HDEA 2V6GA 2XE6A 3L7AA 2CBGA 3NLLA 4HCJA 3W05A 3LBNA 1HYQA 2II6A 1N33B 3CU5A 3GEIA 1G20A 2C9CA 4MRVA 5BYBA 2V74B 3I5XA 5F78A 2O2IA 4WN3A 1C7EA 1QHFA 2HUPA 1IZ8A 1VE1A 7MHTA 4KRYA 2ORYA 1ULHA 4CTJA 3NCHA 3HL0A 4IBOA 2W2TA 3QJGA 1GZ4A 4GE3A 3QEOA 5THKA 1EE1A 1JHMA 1IRXA 1KEUA 4RMIA 4XX0A 2OO5C 1E7SA 1WCIB 1ZD2P 4F85A 1LRLA 1WKVA 4C7MA 1YD7A 4Q3KA 1QAQA 4CPDA 4M0DA 3ZW7A 3DBRA 4MZDA 1T3TA 5JADA 5DU2A 1FU8A 3JYLA 3HRHA 3PVSA 4BLSA 1OFGA 4M0CA 5AVOA 1BIFA 2M6RA 1E69A 1NC3A 1DPFA 2YHSA 1V95A 4UTOA 3V6LA 1VRWA 4H2DA 2Z8YA 3D0RA 2NZ2A 1XMVA 4J07A 4Q4DA 3SNHA 3PQ6A 1PR1A 2X42A 3ZHOA 1VYTA 4LSZA 2W2PA 2WSMA 5CVTA 2FF7A 3OG9A 2FY8A 3Q9LA 4IH9A 1JG7A 1XLVA 1NNSA 2ZB3A 2XNHA 1KF0A 4JXXA 1VI6A 5EJAA 2ILTA 3QP9A 5DCYA 4DZZA 2ZPTX 3BMQA 5JVDA 3HB4X 3R9XB 3JPWA 3MFQA 2A0WA 3LCJA 4QDUA 4XYLA 3L0CA 1JDZA 3T7IA 2ZRFA 5D87A 3TQIA 4HRVA 4ZV7A 1XQYA 2ZSKA 1DKPA 2QMEA 2PKYX 4IJVA 2GCEA 4XYMA 2H54A 2X9LA 1W88A 2H4XA 2HA0A 3IP7A 2GO1A 4BLUA 3MHTA 2QDKA 2MMCA 2H8GA 3U39A 2YYYA 4NS4A 2J0UB 5DGCA 1ZNQO 2WVAA 3FZQA 4M76B 2BI7A 2B98A 3O74A 4F5ZA 2WB4A 4M7WA 2A9QA 4IEFB 4MUAA 2FX5A 2R6JA 4QRDA 4RAOA 3FKQA 3NAZA 4EECA 3PF9A 4OHKA 5JW6A 1SG9A 3VNVA 3C8ZA 1I1HA 2QMQA 2XIQA 1Y48E 3MEQA 3OZUA 4EFMA 2IU0A 3RH0A 1ZGZA 1B23P 1XU9A 4C9BA 4GPD1 1KEWA 4PIPA 4GX1A 5SYAA 5CA0F 2ZATA 3D0QA 3VISA 1K4KA 2H3HA 4CKWA 3BXPA 2DR3A 3ACDA 4GUDA 3AI2A 4RABA 3VR6A 4RFVA 2IU6A 1GADO 1FYEA 1QVZA 3M6IA 4DNXA 2R1VA 3KTDA 3G8BA 5CVDA 1Z4NA 4YJGB 3JQAB 1HR0B 3QW4B 2V0GA 2H2DA 4FFMA 3U3JA 4FEAA 1U1EA 2MYUA 1D0VA 4UU7A 4YXFA 3ESRA 4FEEA 3QBVA 1WJGA 2GFQA 3F3SA 2X9QA 1Z0ZA 3PZRA 4MQFB 2HDNB 5FHQA 3IEVA 2GK4A 4GLFA 5CCBA 3QWHA 1OLXB 1JIIA 1Z4QA 1GGVA 1JQEA 1Z88A 5LQAA 1IN4A 3K0KA 3PEUA 3QF4A 2WY2D 3RT7A 2FPOA 4S0ZA 3EH1A 3SJZA 3TFOA 1NBHA 5A5FA 4CLXA 3DOJA 221PA 4YDQA 1ULUA 3AESA 3OPQA 4LZOA 4ZOLF 3WK8A 1T0UA 4D7AA 1R37A 3B7WA 4HT3B 3DUFA 3K70D 1FFXA 3TTTA 2PX6A 4OYHA 3CVYA 1JLLA 1SBNE 1KIMA 2ZSFA 1OTYA 2Q8NA 3MAAC 4ZYTA 1CRPA 1SC3A 4AJ1A 1GRQA 1P4HA 2BJWA 5I01A 1JA1A 1TA9A 2CYCA 2OCLA 4M8KA 1UBJS 3MQ4A 5JPDA 3OICA 1QQTA 1QHSA 4QWMA 3I92A 1X1BA 5DTIA 1QOQB 4WESB 3ZNPA 1ADJA 1CUHA 2JNWA 3D7LA 5JXJA 4F46A 3BXXA 3JYNA 3HN7A 2VHJA 2PXCA 2Y9MB 2LTAA 1DU4A 2ZXEA 3OZGA 2Y05A 3WDKA 5KQLA 4L7VA 5KYGA 1WDWB 4XPIA 4E12A 4X90A 1FLVA 1OV6A 1JR3E 4IFIA 2V98A 3V2HA 2BKEA 1AHPA 2NVUA 3DDSA 1YRYE 3GCWA 5H9WA 1P0QA 1HTBA 1FJ2A 1HDZA 4HFJA 4YJ3B 4BPBA 1RR6A 1V1MB 5LDHA 1U0BB 5FBRB 2X0EA 1JYFA 1MFPA 4ZQCB 2PZGA 2VLBA 4C29A 1YVPA 3ZDXB 4AQDA 4E5UA 2J7PD 2VJMA 2ZDHA 2F9LA 4HH1A 2P9TA 1AUXA 5CW1A 4DADA 4WOCA 3DTNA 4C89A 1XQWA 2V8OA 1N77A 2ZIXB 3MCZA 4QOHA 2XGJA 5B55A 1R0CA 2Y6VA 5KYYA 2XMZA 1WDTA 4K3VA 3CXUA 2YXNA 3LCCA 2I4OA 3BFKA 1C9JA 4B82A 4KDFA 4J0DA 4RLQA 5AW8A 2ON6A 2DHQA 3O38A 6GPBA 5ECWA 4QIHA 4TWZA 4O5OA 1PZXA 1KBOA 1M5RA 3EZ2A 1TVCA 3GNLA 4CEIA 4CLOB 4BLPA 3EEBA 2VBIA 4NJOA 2DHEA 1V6SA 1YZQA 2OVBA 4IOJA 3PNPA 1GQQA 4OAQA 4GM1A 4K88A 3DE4X 4L6IA 5DN6A 3TB4A 2BAGA 4GOND 1F8UA 1DO8A 2CDNA 2YUIA 3GEDA 4EA7A 4F9TA 3GLQA 3KTOA 1JR4A 1NN3A 2CNWA 3HUUA 1MW9X 4JODA 3NWPA 4IHAA 3LDHA 2OUIA 2HLNA 5IANA 1MO4A 1P7PA 3AL3A 2YBDA 3G2MA 4YH1A 2G7ZA 3RWBA 1PJCA 4DOMA 8MHTA 1G2QA 3W1EA 1L4NA 5AOCA 3R7DA 4OQQA 3NHKA 3KAKA 1EDDA 2XGMA 3FUWA 4HDQB 4D9JA 1ZW1A 4KGVA 1RHUA 3NT4A 1MNQA 2YQZA 3HKCB 1EK6A 3HPRA 5TEWA 4BNIA 4PR3A 3ZVNA 1SU8A 4AF6A 4KMMA 5IYZF 3BKXA 3AZPA 2HA3A 1ZYUA 3RYIA 1K4MA 2IY9A 3LECA 4JI6B 3F90A 2MYTA 1V4BA 1ESZA 2XRMA 3HDTA 2R2AA 4KITB 2RGGA 5I7SA 2QL5A 5JMPA 1ABBA 1A9ZA 1P1BA 1CB7A 1GNVA 1OGIA 1CDDA 5IAJA 4TQUS 1XTZA 3SLGA 1EAYA 1QOZA 5EUMA 5D2CA 3V5NA 3NTXA 2W22A 3UG6A 1T6YA 4ZQHA 3H4IA 4FCVA 1WX1A 4ZQFA 4UREA 5DT2A 1JQLB 1X1RA 2GD6A 4GX0A 4OHUA 2SKCA 4WMLA 3ZY3A 1PBNA 2B6HA 3O8DA 1AB5A 5JZOA 4PWZA 4HXEB 3GDFA 3MLBA 2LCIA 1TZMA 3WGKA 4LY9A 3FVRA 5JLJA 1JR3A 5KYTA 4KQGA 4DCTA 1P1CA 3IOMA 2BVNA 2PGJA 3T06B 4FMDB 3I28A 3RS5A 2GN6A 4LVOA 1ZWLA 4CMBA 2VXOA 1GSHA 1YA4A 1YQEA 2YJ3A 3GN2A 1BHSA 3ZIDA 1TCAA 1Z4JA 1UOEA 1TTQB 2Q45A 4XXHA 3VR0A 4ZEVA 3S28A 1P80A 4MW0A 4YMHA 5JT1A 5E7IA 2NZ8A 1OFUX 3H04A 1ZI8A 3ODGA 4BLRA 1DQNA 4E5KA 3DT9A 2C31A 4L74A 2QTBA 3OFKA 1RYBA 5HA5A 1KEKA 4Q7LA 2QD1A 4QC2A 2CJWA 1G7SA 3AY0A 3ETHA 5CK5A 3DDWA 3V4OA 3KSAC 1E18A 3PLRA 4X8OA 4F2PA 2V1UA 5IDWA 4DQ0A 2VDWB 3AJEA 1DAGA 2ZTUA 5DP2A 4EPWA 1JV2B 3O8LA 1L9XA 3EFOA 4YRIA 1VE5A 4GP7A 1P9NA 1TI7A 4EG1A 3VHXB 4R8KA 4RQAA 3ANSA 1WXHA 3TG8A 5D86A 4TGLA 5ANRB 1J2UA 1SVLA 1YGYA 3IFSA 3DT6A 2O1WA 2NPIA 4IIUA 3CKLA 2FGKA 2JJ2D 2JPDA 2CHEA 4KMSA 1UMCB 2CLKB 3IR6A 4QPPA 2Q1XA 4Z1OA 1SC1A 5JATA 5JMWA 3AK4A 3ZE2B 3W3AH 2XUGA 4YEDA 1EUZA 3BORA 3UBMA 4PVDA 4QPDA 3S29A 3F46A 1W9MA 2J4FA 5JSHA 5FTJA 2C7VA 1ZK3A 3NGLA 2P1ZA 4LA4A 1OZ0A 5DK4A 2AN1A 2XMBA 2W2LA 2FW8A 3ESBA 4PQGA 3KTAB 3BHNA 1B8PA 3RRXA 3ADOA 1KQOA 4MB0A 2IC5A 3PQ5A 4FTWA 4AZ0A 1MRZA 1VCHA 2X2EA 1C1YA 5H68A 4AY3A 4LF6B 3H5AA 3W5JA 2NUBA 1NG1A 1NPYA 5HKAA 1VSTA 1YNOA 4LQCA 5AICA 1JEDA 2Y99A 2DWUA 5ADWA 4XWTA 4R3NA 4CL8A 4BBZA 4CR8A 4ZXFA 2HTEA 3CQ9A 1ZA2A 5A71A 4YLEA 4EKNB 1P7CA 1CUDA 4ALNA 1SC6A 5TGTA 1L2TA 5WRFA 2HZ7A 4MVJD 1TU0A 1N2GA 4NFHA 4TT3A 1QC5A 4O08A 1HEUA 1YJQA 2XXBA 4S1OA 4PLYA 1H4TA 2C3UA 2VDUE 3KU1A 4OD0A 4RO0A 4C7JA 1RIFA 4Z4IA 1KMMA 1TEXA 1A9OA 4QJ5A 4B73A 3MJHA 4G9BA 2QPLA 5BN3A 4ZVVA 3ZJYA 1Z36A 1YDEA 3FSGD 4V1CI 3H5TA 1RJEA 4RLHA 1EFDN 1U81A 4B6RA 3HUEA 3OC6A 1L5ZA 2QS9A 2XDQA 3G5MA 2B7BA 3GPCA 4NG5A 3QZUA 4EHLA 4RJTA 4KTTE 4IQ4A 4KYIB 3ZDCA 1NVFA 2JGLA 5HS6A 4OXNA 3G9UA 1C7IA 4DNOA 4R7ZA 5BVHB 1AA6A 3MTQA 1LPSA 3M5CA 4GQIA 4O4HA 3GLIA 3DBHA 4PZCA 1TO1E 2PWPA 2V7WA 4YY3B 3T0GA 1J70A 4WWHA 4DUGA 3VR6H 4BKMA 4RETA 3MWKA 4V1CA 2EFHB 1C1XB 1EMDA 4FKBA 1C7ZA 1U9ZA 1TQDA 3JARB 2J32A 3UUEA 1XALA 3EG9A 2CSUA 2C4WA 1IY8A 2RB5A 4BVEA 3RAGA 3VA7A 5BR8B 4IJKA 3H1FA 4WZZA 5DGXA 1HEYA 1P9WA 5FYQA 3NJ4A 4X8MA 1VSBA 2OKGA 3GDWA 2JBAB 4JJEA 3ZU3A 2WV7A 4F2HA 3OZAA 1Z6ZA 3IPAA 3DMDA 2IXEA 2X8JA 1L4MA 2ANBA 3P0HA 1KJQA 3AIOA 4WY8A 3N6VA 1Z37A 3QX8A 1PI3A 1XQ9A 5CYFA 4W5HA 4E51A 1K7SN 1UOQA 3TSOA 2F3TA 1ZJJA 4CFZA 2ODBA 4NY1A 3G0OA 1PBTA 2AZTA 3HFGA 5ENZA 4ZJPA 1SN7A 3A1TA 2CXQA 2PY6A 2OORA 3DC7A 1N2SA 2SECE 2L17A 2X2FA 3IDQA 3MMPA 3AUJB 4AIIA 4E31A 1JG2A 1DKQA 1QK3A 3LC0A 4MV8A 5ABPA 5K0ZA 1FUUA 5KTTA 3TPFA 4KBGA 5DXJA 4EGFA 3WK6A 5KJFA 5AM4A 1DSSG 3Q1LA 3QBTA 5TPWA 2B6NA 3U9TA 3HVRA 2W2QA 2I7DA 1N7HA 2Q4EA 1A04A 4UMFA 3UW3A 3F0TA 1RHJA 2WT9A 5EP1A 2JFNA 1EX9A 3ER9A 1NVBA 1UFQA 1FVHA 5I7FA 2BH2A 2DTDA 3OQIA 3BGSA 4L15A 1R0BA 2SCUA 1XTKA 1KE2A 3S1AB 4JI2B 2I3DA 1OLXA 3Q8XB 4DLWA 1XTPA 1T5HX 1WUYA 4BCCA 5ALFA 3DOEA 2BFBB 3GJTA 4XR4A 1K3FA 3U3ZA 3FSJX 2AK2A 3FDZA 1DEHA 2QKYA 3RG2A 3TIGA 5E2AA 2AXQA 4WKCA 2IPMA 4QUAA 1YR3A 5I9IA 4RH0A 2J1LA 3FYTA 3FHCB 4GMFA 721PA 2C4HA 1TZKA 2ZRQA 3FNFA 3HVJA 4ZAWA 1EJ6A 1EVJA 4QOEA 4QUDA 1VDZA 2HRQA 2J9YB 4RA6A 3MFYA 4NEGA 4DWWA 3OU7A 1P5FA 1ZK4A 1H4VB 2FQ1A 2Q5IA 2P0AA 1ACLA 1DX6A 3QPBA 3ZH2A 3GZJA 2EZTA 1L5HA 2LXNA 4MPJA 4RGBA 1B93A 1DKRA 3BE4A 4Y1GA 1JXQA 2OBFA 2W2MA 2WJZB 4FR0A 4L9AA 4QFBA 5KB3A 1J5XA 5CJJA 4YMIA 2FZLA 5T6MA 3PR1A 5ITSA 3NOQA 3ONVA 5L3QA 2J5XA 3IA7A 4LVCA 1ZGCA 5LN1A 4I55A 3I30X 5K0CA 1C3OA 1CP3A 1EZ1A 1MJNA 1USWA 2BR4A 2VWPA 2PD4A 4JZYA 3ZIUA 4YRCA 5BVGB 2OUKA 3CN7A 1SXGA 3A1EA 5D7BA 1OAKA 1SCUA 4EUEA 3W34A 5JCOA 4U2EA 3S0JA 2VOEA 3L18A 1OXKB 1PYDA 4RVUA 3WZMA 4HUTA 3DBRB 2WJYA 2O19A 1YR1A 3DB2A 3RUIA 3FMFA 3FR8A 4UTXA 2B8NA 2G80A 4IG4A 3E2PA 1S3SA 3PFFA 3MCWA 4WXHA 1DCKA 1JDBB 3T5AA 5KINB 4KGXA 3SPXA 1Q7TA 3BGOS 1OWLA 4JVOA 3TI7A 1NU6A 3W0LB 2BF4A 2FPSA 4HQKA 1QQAA 3S8EA 2PT5A 1E4EA 3LY5A 2PGDA 4UTRA 3UC9A 4B3MB 3RARA 3JWJA 1GZ3A 1XZHA 3WV4A 4AFNA 2MDTA 3CIFA 4L8FA 4ZT5A 4FGSA 3ILXA 3HXPA 4LV5B 5BSEA 2GN8A 2OEPA 5BWMA 4DSUA 5IEBA 4EY6A 4R71A 2B4RO 4OOEA 2V6FA 2VAVA 1K8ZB 1B0UA 5HUHA 1M3SA 3DB1A 4HGNA 1C14A 5HCIA 3ZY6A 3EVGA 4JQOA 3VYRB 4U5XA 4XTRA 2E87A 2CL0X 2E1PA 1DWQA 2DX7A 5DWDA 4ZDIA 2HIGA 3EXAA 4UUNA 2I7VA 3IXLA 4XM1A 1E1CA 3PVCA 3SSAA 2VDLB 1GGEA 1ZCBA 4X85A 3QU2A 4OHWA 4BO0A 2HMWA 1Z07A 2XHZA 5JPIA 1I7LA 3REOA 3I0ZA 3O2JA 2X0FA 3HKCA 4BJHB 4MDEA 2FJPA 1J09A 1IU9A 2EHJA 3IP5A 3K8OE 1TJNA 2RGWA 4H08A 4KL8S 5K2MA 1LPPA 4BEWA 1CDZA 1D1SA 1YS9A 1CUWA 2EJCA 2GAOA 1XFDA 1SUFA 2G82A 2H2HA 3C85A 3RYHA 3RVSA 5B4UA 3PEYA 4GRIA 3OJLA 3F1LA 1G8HA 2RAUA 1M8PA 2J3HA 2WIJA 3D59A 3O3NB 3OLQA 1AQUA 4WN9B 1ADCA 5E6UB 3EZNA 3A3KA 2FWMX 2EKLA 1LNQA 2WQ6A 4YUWA 1VTKA 4LEIA 2OPHA 1NX6A 1W4CA 4NPHA 4F4HA 3FHTA 3H0CA 3QLVA 1OF1A 3EB9A 4LDRA 2HFJA 5TVKA 5HF8A 4ISCA 2IV7A 5EXDA 1TIKA 3C45A 2GMWA 3SZGA 1QIDA 2PUJA 4YASA 3NASA 2XT9A 3L8ZA 3OOJA 2ZRNA 4RZUA 4B6SA 3AF4A 5C7IO 4YRTA 2R8YA 3D6UA 1ZZGA 5LA6F 2UZ1A 3IP8A 1R88A 3DQQA 3OZIA 3RS9A 2DFKB 2NV2B 4MPDA 4FJ2A 1Z4IA 2J5BA 1Y5LA 2HHLA 3GN1A 5HIAA 1YQTA 4Q0MA 4NBVA 3H2YA 5D85A 4B7AA 1B8OA 2I1VB 3DBVO 3FPGA 2GF9A 2IY7A 3L0SA 3DD1A 4DNPA 1UKVY 1Z4KA 3N0VA 2EW8A 4F84A 4A8JC 1A2OA 4UBKA 3NQ41 3ZDFA 4A8TA 3HWX1 5JQGF 2HRZA 4MI6A 1NLUA 1Q21A 3EGWA 4XQCA 1PK7A 5D3ZA 2GF0A 4YO7A 4CNQA 1PAUA 1QIMA 4BQFA 5B4VA 3A37A 3CVVA 4Q4CA 2LD4A 4MWZA 1R5JA 1RAEA 2WA1A 2NQTA 1UMDB 4IHKA 3T9EA 2JCGA 1JQJC 3UOWA 3B38A 1L1FA 1WMEA 3W7VA 4AWBA 3VFDA 4NQZA 4GR9A 4IJQA 4M1OA 1J21A 1PEDA 4RKQA 3EYAA 3MTDA 3TZKA 1O6CA 2PG3A 2HXGA 4V38A 3KDAA 5JD5A 1TA0A 3IJRA 4WXRA 2O20A 2VZLA 4RXMA 3AUAA 4R16A 1IDN1 3ZKWB 2FTKE 1TCCA 1FFYA 2IYQA 1SQ0A 1ZAYA 5SICE 4J0CA 1Y4DE 3A10A 1NE2A 4IGEA 4DCVA 2AXPA 2F43A 2VYQA 2OCAA 1BW9A 4TKVA 3HCOA 2PU5A 5I4KA 4N3GA 1KBQA 4DV2B 4IV5A 3DYVA 1SQ6A 3H11B 5FV7A 1W4RA 2OPBA 4LJ6A 3FI9A 4MYRA 2Z4TA 3RC2A 3WLLA 3DFUA 3K5PA 2FPKA 1NJ5A 4PYJA 1JIQA 5M2QA 4ZPXA 2QUJA 1ZN2A 3ID6C 5EFZA 3TQHA 1KYXA 4B74A 3LQ4A 2R8OA 1O0SA 3E23A 2D2FA 4ES6A 2FQYA 5HQ3B 3B6ZA 5JWRA 3BFVA 1QF9A 3E7PA 4PLZA 1VBNA 4LOAA 1RP7A 4OMUA 3GFPA 4CEIB 3OA0A 4CGZA 4Y2UA 2IYAA 4XOIA 4BO2A 1KP3A 3C1OA 3GLTA 3KKEA 3OX1A 4DHWA 4EAQA 4GMXA 1UPXA 1DZ3A 4QKQA 3KKNA 2IPAB 1BE1A 2X4GA 3K20A 2BWJA 4ETMA 1W5EA 2JA1A 1PT7A 4JR1A 4KLAA 3L8MA 3ZHZA 3PNQA 3SVZA 4NCNA 2VJYA 5KDOA 4MUFA 4P4NA 3K05A 5I6DA 5FX2A 2IBTA 3FWNA 3TIFA 1O6BA 1P1RA 4O2AF 4F8EA 4F4CA 1CQPA 2O9JA 5P21A 3D4IA 3NALA 4M2LA 4BO7A 1SKAA 1HPLA 3DBHB 4LDNA 3A9UA 1M6VB 3OTHA 4BMOB 3TNFA 2VRCA 3DLCA 3OU6A 4BEJA 3LOUA 1FXWA 4IZ6A 5DEIA 2ZBVA 4U7FA 5TDHA 1ENYA 4LGYA 1T5BA 1F7UA 2PCJA 2R62A 3G0GA 3OM9A 4GRAA 3EQ6A 3VX3A 1ITZA 3T1NA 5FUQA 3A7EA 5F23A 5HM6A 2VHZA 1V7QA 5REQA 3WYGA 3MBOA 1WCXA 1AZLA 3CFYA 1ODIA 3LX6A 3E5HA 4LDJA 3OWHA 5ALHA 1CVIA 2FG6C 3OFNA 5L8VA 1XMPA 3U31A 3ELWA 2I4LA 5AHXA 2OO3A 2QW1A 4EO9A 4PANA 2ONZA 5FLEX 1F48A 2IW1A 2JKZA 2P3LA 3FPLA 3E7WA 3K8YA 3OLVA 4JBYA 1M2WA 4FI3C 4Z2YA 5C8DA 1G8AA 4Q3CA 4ENVA 1QIJA 4R6WA 3PFNA 1RPTA 1XDZA 3TBHA 3W9SA 4BFWA 1P17A 3EIUA 3ZDEA 3ZD8A 5EUCA 1CR1A 2OGZA 2VT6A 2XKKA 4C88A 2Z6QA 3QFSA 1POXA 2ILVA 4AJEA 1AN9A 1JALA 1R4NB 4EM6A 4IJUA 5AT1A 2OT3B 1I8TA 3L1JA 4GPAA 3ZI0A 1CEYA 2WIKA 4YV1A 2XTAA 2O0HA 1ZX1A 3ZXUB 4RHEA 1YDHA 4I9HA 1ZZEA 2HMYB 1V25A 5IG2A 3KFLA 4UD6A 3UMGA 2WT8A 1RI1A 3H1TA 3NHFA 3UK0A 1K5DA 2FK8A 4DMKA 1JFVA 1FRVA 2J87A 1LDMA 1VE7A 2Y1FA 1FMJA 4W9NC 4KEAA 4B6OA 1GTJ1 1RI3A 1S89A 3DCYA 1YFZA 1PWZA 3IKJA 1F0YA 5CT6A 5ECGC 2BEWA 3TL6A 3AC0A 2VHTA 2PDAA 2ZCJA 4DJAA 9GPBA 3JQGA 3CN9A 4UNRA 1I80A 5ICGA 4G86A 2GJKA 1XXHE 2ZZNA 4MH0R 3NR2A 3URKA 4FLFA 4ZI3A 1MO3A 1SQGA 5CLHA 3EDMA 4UHBA 2SICE 3D7MA 5B12A 4C3UA 4LKRA 4LY0A 1EFRA 3DE6X 4KQ2A 3G79A 3NBXX 3TAUA 1HM5A 3FRIA 3I53A 1LPNA 4WTOA 5A4IS 1OIWA 2I4IA 3TG2A 2O2DA 2JDIA 2HA7A 4FYIA 4BNFA 3C3XA 3GLHB 4C30A 4QPCA 5EGNA 4BX3A 1SA0B 4XX0B 3KYCB 2BC9A 5DVZA 3LS2A 5DT9A 5KUTA 2QLNA 4JVNA 4NTZA 3GFBA 4V0SA 3KU4A 3TJRA 2Y3IA 2WKPA 4JBNA 4PYKA 4ANFA 5CBPA 3EZYA 3GX1A 3DAOA 1N9GA 1RM5A 2WVHA 2ZXFA 3BQNB 4WA8A 5ED4A 1GKLA 1VG9B 4BS9A 5C8ZA 2QW0X 1HDIA 1JIKA 2YH2A 1RYEA 2F48A 4Z53A 5DCUA 2ZS9A 4I3HA 2QSUA 4EUFA 1USVA 5EJ8A 1RKQA 4DV5B 4MPTA 3BH7A 4DHEA 1NLZA 3QOXA 2RFLA 1OB2A 3AW9A 2QL7A 4V0OA 4X20B 3ZE6A 3QKUA 3L01A 1T0BA 4FFNA 3D43A 4DUPA 3TZQA 1JIUA 2WU8A 3X1JA 2D3TA 1FW8A 2VKTA 4UTZA 5AH0A 4ZZ2A 2B34A 3QEAZ 1BROA 3QY0A 2GA9A 2HOQA 2DWCA 4P3XA 4XIFA 5B2FA 2OHGA 1TYEB 1UBFA 5G4KB 4E5VA 3IXQA 5ALTA 4LHYA 4MQEB 3GT3A 3JR3A 1XUOA 2BONA 3PT9A 4IH4A 1OLUB 1MJFA 1FNBA 4HFMA 4N54A 1ISJA 4GPTA 4AF7A 2ZQZA 3GLGE 3PICA 4D6PA 1LSUA 1SOWA 1ZP6A 1XJWA 2X15A 1MDFA 4PNPA 3THXB 1M2OB 4D25A 1UJ2A 1PTJC 1W19A 4PCAA 5JSZB 1MZPA 5DI3A 3K9HA 3GK3A 4BFVA 4G4GA 2IPXA 2VJBA 1LU9A 4UCWA 3OQNA 2XXAA 4L76A 1JU3A 4U5QA 3R0QA 1RHMA 3CNEA 4KW7A 3GEGA 5BMVF 1QF6A 3T5PA 5A9RA 2Q5EA 1AK9A 3LO5A 5YASA 4R98A 3ANNA 3HJBA 3AGQA 1NJ1A 1GQFA 4YN3A 4WVFA 2XDWA 4Q1FA 4YJGA 4BFZA 2GNPA 3NHMA 1FRQA 2GPNA 3WIDA 4AP9A 4DCCA 3DWFA 4MLZA 3PI7A 3D5QA 5EZQA 2HPHA 3I1FA 4PF1A 1Y80A 2C57A 2QU7A 3JCZA 6YASA 5MFZA 3HQ4O 1D1TA 1OW3B 5D00A 1E1RD 1EK5A 3INTA 3M89A 4GXTA 2ADFA 1Z6PA 4PYLA 1WY7A 3U37A 1QK4A 1THGA 1IIRA 3FOFC 1PT6A 4G1CA 4OQPA 1O03A 3VPAA 1PFYA 3NP9A 1CFJA 2VZ8A 1XD2A 1XNQB 4S1VA 1UQUA 1DAMA 3RC9A 1KZ7B 3KPYA 1UUFA 3HSKA 3VH4A 5KPJA 3S2ZA 1P45A 3P96A 3ZBQA 4URYR 3IRVA 2AMJA 4D0RA 2ZREA 3DL2A 3QITA 1U0OC 3D8NA 1N32B 2WZDA 3KKPA 2A14A 2P8SA 2VQ6A 3CURA 3QE0A 4NABA 2GD1O 3PRHA 4TWAA 2IYOA 5SYNA 3ZD9A 4DIBA 4IWYA 4FWTA 2JVKA 2P5YA 2A1TR 2HBYA 3UFXA 3CPJB 1EFHA 4CMIA 4MQ6A 2C78A 3FGPA 1N0IA 1DINA 2LWIA 2OFOA 1JEEA 3E3AA 1ZMXA 1RRPA 1WMSA 4PG6A 1SC4A 4GGPA 3I3OA 1WP9A 1BKSB 1Z8NA 4GFDA 4CG3A 3SFZA 4C7VA 4XUCA 2W6OA 3RRFA 4X94A 1HBJA 1TQ2A 4KK3A 4CM3A 1G59A 1KZ6A 4REMA 1DIBA 2QENA 2FK7A 2NTEA 4K0RA 1YMUA 3FHJA 4LSGA 3L92A 4H77A 4BDTA 2R1TB 1W5SA 2X0JA 1G9SA 3OE7A 1GVHA 1P1IA 2IOYA 4FK8A 4H17A 2V9CA 5IT0A 1VP3A 4JI4B 4C7KA 5B36A 1KS2A 3T7RA 1HK7A 5DXFA 3BD8A 4AW9A 5FUMA 2JH3A 5KYYB 5HDBB 2DKNA 1T9BA 5IKMA 4G1UC 1FIUA 1QKIA 3C3JA 2X6TA 4TYNA 2N3ZA 3AEKB 1AT1A 3DTYA 3GZNA 3RSGA 3ZGYA 5B57C 3CLRD 2O0KA 5TGDA 1M66A 3OEHD 2XYQA 3RUCA 3IH5A 5B4TA 1IAQA 5KSZA 1BFDA 3H3FA 1S8OA 1OE0A 2ID4A 2BUBA 3VNQA 3MCVA 3NHZA 3O73A 1F2UA 3K94A 3PGJA 2FX3A 3GMDA 4KVGA 3RM3A 3WR5A 4MYCA 3E9YA 3MUEA 4GZ5A 1VYVA 1X87A 4NCHA 2VQSA 3D0KA 3H87A 3FTCA 5AJZA 4ZAXA 3S44A 2Y76A 2A78A 3ZCTA 4B44A 4I66A 1KK3A 1X80A 1E2HA 4DBVO 1W46A 4OGWA 1BE6A 4AL4A 1SMKA 1WTCA 4HPJB 4MCIA 4HGQA 4RJLA 4RKRA 4CUZA 2QL9A 2DBRA 3EY4A 3OTQA 5I5EA 2OR3A 3FRHA 2VR1A 3DA8A 4G1MB 5K3AA 2OZLA 1I33A 1S7CA 2JCVA 1VHLA 1L3IA 1M8FA 4L22A 1V45E 2EFCB 1TFRA 2W6MA 4G1VA 1Z7YA 1XHEA 2JEYA 2P2LA 4YLGA 4YPOA 3CISA 3SQLA 2X3YA 5KQGA 5LNK1 1GCIA 3QSGA 1YKSA 2XZPA 3ZZ1A 3X1DA 2C5HA 4PPYA 5MN6A 4D98A 3N0RA 4LJSA 5FOSA 5GIOE 4HQNA 3BTOA 2Q29A 3KJHA 3NKFA 4GLJA 5DDIP 2K5UA 1DAEA 2I67A 5SZJA 4DF3A 4BE4A 1NRIA 2RHOA 4EYEA 3RIXA 1NL3A 2XNCA 4AM8A 3WYAA 5COQA 1TO2E 4FC6A 3FFWA 1IJEA 2NXWA 4B4VA 4JLNA 3CZ4A 1L7DA 4Z3OA 3AP3A 4EJ2A 3L7YA 1GJRA 2KQUA 2WI8A 2YNMA 1U7HA 2F00A 1YWGO 4L8VA 2D4HA 1TUEA 4R84A 5JZMA 2PSJA 3ICWA 3RLIA 3UB2A 3VRHA 4MV5A 2R1UA 1CE8A 1SB9A 4PSDA 4DA0A 1U8EA 2WZBA 3G6WA 1JFTA 4GPZA 5AP9A 1PX2A 4JDPA 4MZXA 1CUVA 3GFOA 4F2GA 3RS4A 3T3OA 4GOMD 1IUPA 4C0AC 1JFSA 3R7WA 4F1JA 4NECA 2W4IA 2V5UA 2YV2A 3SJUA 4DR7B 1QG2A 1Q1ZA 3ZX4A 3WWEA 1R5NA 4RY8A 3TW4A 2Z8ZA 5EIXA 2C2YA 1QJ4A 1COZA 4D82A 1R4ZA 4LBWA 1NNUA 2R6FA 3GF4A 3WLOA 4BWVA 3H9CA 4MEJA 1QYVA 2AJLI 2PSDA 4L8YA 2JL1A 1JRLA 2CLFB 4KXVA 1L3CA 2RMKA 5ESXA 2JJQA 3EXHB 4R0MA 4EY8A 4RE6A 1GP2A 1OD6A 1RKUA 4FEGA 2MYPA 5ERXA 1CY6A 1QV7A 1N7IA 5EVJA 4ITVA 1UMDA 2I9KA 2E6KA 3EWIA 2C95A 1QQBA 4MCJA 1AK2A 2MSLA 4JUFA 2CCJA 4O59O 3U4QA 3DGFC 1BWQA 2BEWB 2JEOA 2P9EA 3LCUA 2NZYA 2I1QA 1QE5A 3OY7A 3OTIA 1WMDA 4N0EA 4DLLA 1C7FA 1E1YA 2HA2A 4QTZA 3CRQA 2JFVA 3REQB 5FI0B 3EEFA 1NRJB 3KB6A 3LP5A 1U9YA 1H2RS 1QX4A 2NU9B 1X0XA 2BF7A 4FQ7A 1H23A 1M83A 2L0XA 4YMVA 1U8FO 3ONWA 4U6NA 1QB8A 2MINA 2A5DA 4KAJA 3IALA 5AKIA 4NDNE 4WFJA 2NVWA 4IDEA 2XCOA 1C4OA 2C3OA 2XOKD 2BEUB 3CGGA 4B85A 1KO4A 1VFNA 4DSAA 5JBIA 1OOEA 3PJRA 1MC4A 2PO5A 4ZVUA 4QVGA 3O0TA 2XYHA 2GT1A 4O2AA 4L7QA 3UTDA 1IXKA 1ECJA 1DAKA 1J9EA 1QHEA 4TTRA 2PPVA 4K2AA 1TEVA 1I2DA 2R5WA 3HJRA 4G01B 1RP1A 5JD6A 1IEVA 1KDOA 2PKWA 1LVHA 3FZNA 3WDMA 4EKEA 4KUGA 3IX7A 3KWJA 1JQ5A 1NF9A 2GM3A 2MYNA 1QC5B 3MCAA 4CKZA 5MGNA 4LISA 1WOMA 3B1KA 3I3SR 3DZKA 4RLSA 2XCQA 1YT5A 4EB6B 4QTYA 4EGAA 5LSAA 1R0SA 1ABEA 3JQBC 3JVVA 1E5DA 3C7TA 1AB6A 2ZE8A 3IVMA 3MWFA 4PG8A 4IQGA 5G0VA 3ZV3A 1FDUA 3RHFA 3L82B 5ALEA 4EARA 5GAJA 1QSGA 3CH6A 4II2A 3KRTA 4FC7A 3K32A 3SYRA 4ZAFA 3L0YA 1DVRA 1K9SA 4ZVNA 5BYAA 1GFWA 5G1NA 4JHXA 4Y67A 1LQ2A 2O2GA 4D3DA 4F3TA 2C3MA 2R5NA 1PJTA 4IF6A 4JD5A 4ILEA 4MLDA 4NG4A 4XDYA 3LC7O 3TD9A 1ZXXA 3WO0A 1CS0B 1ID1A 4DIUA 1AGRA 5BNTA 1GNTA 5IXYA 2P2CA 5HXAA 5AR1A 3IUSA 4P2GA 2FR0A 2XD4A 2BGJA 4X20A 2ZRAA 4Y9RA 3VU8A 3P9XA 1IN6A 2RJ3A 4MUBA 3IV6A 4PAGA 3I1IA 1P75A 2IX9A 4LVNA 3TUJC 2AXEA 4KDRA 2B92A 4LXHA 4ZCSA 5H02A 2AMLA 3GGDA 5THXA 4V1CB 2IFTA 5A4DA 5JZVA 5LXTB 3A6EA 1T2AA 3A6DA 1M1XB 3JARA 4QX6A 4RX1A 3USES 4GX5A 2AOWA 3RSOA 5AO9A 2OHOA 3CR3C 2NO9A 4C08A 3IMCA 4M1EA 3ZK8A 2K4MA 1K08A 4E08A 3BWYA 4NOJA 1C2YA 3ASVA 3AOGA 3JVIA 1KO5A 4FJ1A 4UM9B 4MW6A 3HG7A 4CN8A 2PFGA 4O2BB 1WMAA 4HMQA 4Q18A 3LPDA 4JSYA 4BB6A 5KX5B 5IVKA 1QZTA 5K6TA 3AM1A 5FPKA 3GP3A 3HA5A 2B0CA 1KI6A 4ZVQA 3SHVA 1KK2A 1HXHA 5A2QA 2XKBA 5KYVA 1CQXA 3RSZA 3PYXA 5C0OE 4E94A 4OHCA 1XV5A 3C48A 1E1MA 1NLFA 1RXIA 4Q4AA 4X8HA 2UXBB 2W8ZA 1KJ9A 1RJ9B 2YYAA 3URMA 2P4SA 3ZJUA 2AVNA 4N3AA 4AS2A 5B6PA 1TMOA 5E8JA 5JQGA 2FW1A 3BIOA 3FF4A 3R7SA 5HUJA 4E14A 2PJUA 5JEEA 1R18A 4JDUA 5E1DA 4N76A 1YK1A 3QPCA 3HLKA 1Y1TA 2YFQA 4MOWA 3HGTA 4PFKA 5CB4A 2EWVA 2Q9UA 3KSMA 4Z4FA 4HV4A 1NBWB 2VRCD 4A8JB 3WIOA 2BPOA 3AI3A 4HWPA 4NCKA 3WB1A 1N2JA 1GQ2A 3ETGA 4D0SA 5KOHA 1SZCA 4MDYA 5E2BA 3UHJA 1TAHA 2KHZA 4EK9A 3WV5A 5IABA 3H3JA 3OE1A 1U02A 2UUPA 5EINA 3LPCA 4KO8A 1E7YA 1REQB 4P4UA 2ZR8A 3TUZC 4L9RA 4CE6A 1EX1A 5IT5A 4UZSA 4A0FA 1U6JA 2VL7A 4HDSB 4JWTA 2NACA 4ZCQA 4LYAA 5BQOA 4B48A 4QGAA 4FMDF 3I2GA 3ZVKA 1VA5A 4DLAA 1M10A 4WFIA 2GZAA 4GLBA 1JWLA 1KI3A 3VKWA 5FULA 4UOZA 5EFOA 4DV0B 2X5NA 3MS2A 2RSLA 2ZIZA 1EUCB 1P4SA 1AKMA 1KORA 3M8KA 3PFCA 1LDGA 2MTBA 3EVEA 4TS1A 4R8LA 1W2GA 4ARIA 4M55A 1I7PA 2VNAA 4LNUB 4BN5A 4C21A 4ZVPA 4Y18A 3ZGXA 1U7PA 3KD2A 3ZVRA 2AG5A 1JHXA 3RVDA 2ZEJA 5IC4A 2ZM5A 2P8JA 1XDSA 4OK6A 3KK0A 3AKDA 2SKDA 1CLEA 1NBAA 3IGFA 3USZA 4GDMA 2HLHA 2ORVA 1DFHA 3J7TA 4CQNA 2AZMA 2I6UA 1YR8A 1E3QA 4IDDA 5L4NA 1CZUA 4ID3A 2EX1A 2QRVA 4EUSA 2CNLA 2A7QA 2ZIVB 2X8AA 3NPMA 4L5AA 3EAGA 4NJMB 5ADVA 5A3SA 4OQEA 3GLVA 3UIEA 2Q5JA 1LY1A 1P6QA 3KG2A 4WCDA 5DNWA 1YI8A 1W29A 5B1HA 1RWVA 3L4BA 1DC7A 2C8KA 4FKZA 2D1TA 4GHWA 4U7JA 2HR1A 4Q7JB 3R9IA 4JZKA 1M7HA 3OLZA 1I3NA 1Z34A 5CH5A 2OK8A 3AEKA 3GZNB 2NSYA 2I6TA 3CEHA 4C0SA 3D3WA 4KPUB 5JARA 3IRUA 1RDFA 1RLUA 1Z75A 3DE7X 3VMFA 4RSMA 1ZGJA 2Q21A 4D9FA 4DWVA 3K0SA 1TYDE 1YH3A 3IAM1 3DEKA 2P75A 3N2GA 3Q7EA 4WK0B 5TEVA 1BS1A 3ZH9B 4DKXA 3EVBA 1US8A 2PKEA 2PL3A 1WUJS 3OFSA 4N48A 2HREA 3WIBA 1C1HA 4HFRA 3SJBA 3CS3A 4B81A 1UFOA 4S04A 5IKPA 1ZC4A 2CUZA 4HWTA 5E9QA 2A2ZA 5AKHA 2C2ZA 1XX6A 2PT6A 3QKSB 5JY6A 1RZRA 3CO0S 1DT3A 4QXRA 1IIBA 2EGHA 4RHYA 1JT2A 4RMNA 4WJZA 4MQEA 2ECFA 2PGXA 3OP4A 5JXIA 1EVYA 3CLRC 1X1DA 4MIOA 3AY6A 2OY0A 2Y77A 4O4IF 4YP0A 4ENUA 3EZ7A 5DHRA 1IWOA 4QRHA 3IBFA 1NV9A 5IK2A 4D4IA 5KOJB 1YJBA 3EVTA 3F96A 3AVXA 2XLBA 3KL2A 2D5LA 1ETUA 1M2OA 1VPTA 3CF0A 4XB2A 3PTLA 1JMKC 5CIWA 1ACJA 1ESMA 1GG9A 3JRNA 4YYEA 1U5AA 2FKNA 2FVYA 2DFNA 1EXDA 1D5WA 2BFFB 4WERA 1PWEA 3R8FA 3G9XA 1ZM4A 2QIPA 3OIVA 4HAVA 1V5EA 1Q3KA 3QKIA 3I1YA 4P81A 4ZCPA 1HA3A 1O54A 4N9QA 5DRYA 4M22A 2ZUSA 2NZXA 1ZCJA 2A33A 2Q1TA 3ZIAA 1P4JA 4O5AA 2Q1YA 1POWA 4R31A 4Z0NA 1GPLA 3O9ZA 4KIJA 3MSXA 2CXXA 2QF7A 3K92A 3LQQA 3MWDA 3HB7A 3QVVA 3I5AA 2GPYA 3A1DA 4UM7A 4OH1A 4DJEC 1LW7A 5CA1A 3L7MA 4G1FA 2DHDA 2F7SA 2VP4A 3C5EA 1VJ1A 3GELA 1RE0A 2ZZKA 3RQIA 4I2NA 3TQFA 5C46F 4ENSA 4CM8B 1X9IA 5LYJB 1KOLA 4LYJA 1ZUD1 5K6RA 3CPHA 2P7HA 1DPGA 1I94B 4D96A 1E62A 2HO5A 4RZ2A 5CHYA 4ZCMA 3IT1A 1K98A 1NATA 4RH1A 5BQ3A 1YIOA 4C2TA 5DBIA 1MNAA 1GPYA 1U4NA 4YAKA 1Z6GA 1ZH2A 1J25A 1Y0BA 1BWPA 2F6RA 2WSBA 3B82A 3E7FA 3FCEA 4PGGA 2XUKA 3ZZTA 2EBHX 1KS9A 1ZQ1A 1BA2A 3FVVA 4FOLA 2G08A 2ACWA 1A27A 1CJMA 1N6NA 1XD2B 2I8LA 3E9NA 1HV8A 3P2YA 4KN8A 1DRJA 3ZPXA 1RI2A 4MAMA 1M33A 5TPZD 3FAKA 1I51A 5ELMA 1JKJA 2P1RA 2LDXA 2OC9A 3SLKA 3EXHA 2CFCA 3IAHA 3OPVA 4RTLA 5IUJC 3RS2A 1HDXA 1T4BA 2IYTA 4JMPA 2HCTA 1K3UB 1DBRA 1L0BA 1QQ5A 4M1ZA 4B4UA 4CIDA 4WKPA 5HZHA 1QCDA 2O2JA 3KWFA 1LLUA 1H8ED 4IXTA 1ZM2A 5LR6A 3JZDA 4M89A 1R4MA 3VNBA 3BUSA 1XRJA 3AQIA 2P9FA 3DSRA 1QRRA 4KX3A 3GROA 1KOJA 2B36A 3PGA1 1UIMA 3QRWA 4OJTA 5KYKA 1EM8B 2VI5A 4Q5IA 1SIWA 6NULA 4B9AA 3RJMA 2EGGA 2AF4C 1W0KA 1EK1A 4CTNA 4CDRA 2HFKA 3K4HA 4IJMA 3LLSA 1YTUA 4O4LF 4ERNA 4RMHA 1A5AB 3LSYA 3LUCA 4ARUA 4IIJF 1RWOA 2V5VA 3LIIA 4P6VF 4KR3A 3K0BA 1KYWA 4NR0A 3ME5A 1A4RA 3N8DA 3AUFA 3DFFA 3WGIA 4PSUA 5SYMA 1SQFA 1QDEA 1WB4A 2AFHB 2VDNB 3PUJA 5HQ3A 3AXSA 5G1PA 4BNTA 2BSXA 3ET4A 1GO2A 2QMYA 1G6KA 2O3UA 3PNMA 2NVBA 5FD8A 4J6FA 4BRSA 2IYPA 4C3ZA 3UB4A 1BS9A 1DTEA 1ARZA 1GNQA 4GUAA 5IF9A 4P34A 1MB2A 1R64A 2WU4A 1F0KA 5FPYA 3EPPA 3KXIA 4HLNA 4ZOBA 3UJ3X 4MIEA 4K9RA 2QGZA 3AJDA 4DQKA 1KY2A 3TMAA 4EATA 4ECAA 4ZCTA 1OY1A 1Z25A 2Y0BA 1JG1A 4UPVA 2B21A 2QTTA 3T0FA 4DMHA 4HH3C 3NNDA 4O0LA 4I5IA 3TTXA 5TE9A 4L3WA 3TVTA 3PE6A 1XN1A 2Z2YA 3E1KA 2POQX 4GO1A 5A5EA 2VZ9A 5K8CA 1W7AA 4FB5A 1H4SA 2D7CA 3KE8A 1PEAA 2C5FA 3IVGA 3NEYA 3H6KA 2R84A 3VJMA 3NYRA 4Q05A 4HAZA 1G8FA 3EDQA 4ZANA 4AKSA 4QTUB 1P19A 1DV2A 1GUFA 3GJRA 3QFFA 2CNOA 3UAGA 3WLSA 1GQSA 2DHCA 2ENWA 3DDHA 3EXHC 3PT5A 2H1VA 3TB6A 1A7JA 4YA6A 5HK9A 1XK7A 3JD3A 2Z1NA 4RVSA 2GS9A 4FFDA 1UZLA 1KJJA 1RYDA 3IPLA 2CUKA 3N0XA 4R8SA 2P90A 3F5QA 3LC1O 4ZO8A 4M49A 4PAWA 5E6SB 1XTJA 1O87A 2YINC 4D4MA 4G5FA 1E3DA 1SG0A 5FNVB 1W4AA 1KDPA 4H6XA 3T3NA 2QIOA 3QE9Y 2P3SA 2VPZA 1UBNA 1NIPA 3Q0IA 4YWHA 2OFFA 1QP0A 1KVRA 2XBMA 1DUVG 2NP6A 2G4CA 3BZWA 1PHRA 1QU2A 4QPZA 1VJGA 2WM8A 4B6JA 1H1LA 4ZJUA 1HE5A 4CR6A 2EKDA 4EO4A 1SBZA 4AT1A 1H2EA 1E94E 2LIPA 1K2WA 3B1WA 4PRYA 4XUDA 1VRVA 1DT5A 2JHPA 1QGDA 4L4RA 4Q66C 2C2KA 1XDWA 4GXRA 5FLYA 4ZI7A 5KOIA 4NI5A 1PG2A 1N6LA 3EHEA 4RA9A 3AUTA 4MQ4A 4UC0A 1I9GA 1T6XA 3DEAA 5CGQB 2O8CB 1DBWA 4DCPA 1CHNA 5GQSA 5DYYA 3PXEA 2QRGA 5EE5B 2O3JA 1YJ5A 2ZDQA 2I2DA 3GNQA 1XWFA 2D5IA 4Y9DA 4B45A 4XWWA 1RRFA 3C97A 3RLFA 1KXZA 3JSAA 4XARA 4H7HA 1Q7RA 4LV6A 3TZ6A 2QE7D 4IZHA 1ZS9A 4ZAZA 1G2IA 1Y5IA 1SEVA 4IKPA 5ES3A 1YUMA 2XNSA 4UNIA 4TV9F 4PGHA 2YRXA 1V47A 3KSRA 3OZDA 5AYVA 4EFNA 2XZTA 5CDSA 2FDRA 2AW3A 4UKDA 2VP5A 2VQDA 3E82A 4LMRA 1MQ9A 4WCVA 3TLZA 3TOSA 3BCUA 5KKCA 3QSYA 4RIFA 1H3NA 1SVWA 4TKUA 2HPAA 2QAGC 3OAAA 3N0WA 4R1SA 2EJWA 2IITA 2DRIA 3W8RA 1WTAA 3DDCA 2BCEA 5LP6B 1SXJB 4J91A 3TDKA 3BL5A 3H9BA 1QIEA 1Z6TA 2NVOA 2PEYA 2C4KA 2H11A 1ZXLA 3I37X 3LBHA 3MOIA 4MKIA 2IXDA 3EW7A 3L8CA 4FDLA 1KVTA 2RE8A 2ET6A 3F4LA 3GUHA 3H42B 5DRTA 4OSEA 3SQNA 3GLIE 1VQ1A 4XD7A 2COKA 3TNJA 2XF8A 5FAKA 5JE8A 3AB7A 4JGGA 4YUZA 4RCYA 4E7OA 1C9YA 2QA5A 2D0PB 1P3DA 3DHNA 3P2MA 3ZU6A 2R6DA 3WAJA 3IP3A 3F98A 1PG0A 3RKUA 1X42A 3EEIA 2WTAA 2I71A 1FLNA 2FFBA 2FEAA 1QCCA 2AZ4A 2QM7A 5IBCA 3D81A 1F0PA 2Y0DA 4HXFB 1PQ4A 4M9QA 4EB6A 4FBGA 1WPGA 3T54A 3FPJA 3JQRA 1BVYF 5E1BA 5C2JB 3ZWMA 3P7MA 5E1MA 2R87A 1CPYA 5CT9A 5G0WA 1U2QA 1UKCA 3OX3A 3RV3A 1LJ8A 5H3CA 4QSHA 3BH6A 1GSIA 3WLNA 5CCEA 1A7KA 3DHVA 1L5YA 3CWQA 1C8VB 4GS5A 3BWVA 4MRSA 2O8NA 3KZMA 1DQZA 1F1BA 1SURA 1JJBA 1YQWA 2DR0A 2JD2A 4A82A 3GLUA 4U2GA 1IC6A 2C5AA 4CTOA 3BWXA 3WGTA 3CCBA 1JHVA 5CCXA 3T5DA 5JO9A 3OT5A 4IXMA 3FROA 2FSGA 3O21A 5FBHA 2IA5A 2NSHA 4BWYA 2H07A 4ZK2A 4FUTA 4YO8A 2VDOB 1WD5A 1XXLA 2DF8A 1J00A 3PIRA 3KVNA 2G1JA 1UDCA 3B20A 4HP8A 5AUNB 2O3QA 3FETA 1ZFNA 5DOZA 3WDLA 3FKJA 4LS3A 2P4HX 2GNAA 1LQUA 2ONCA 4RD6A 4EJ6A 2RGXA 2JJMA 2FPLA 1YJAA 1EFVB 4FOTA 4CG0A 1HLPA 2ADOA 1I6WA 2QN2A 4U3JB 5DE3A 3O03A 1T25A 2DEUA 2FPPA 2IZ0A 2D0IA 1KDRA 3MK31 1TK2A 3OE5A 5AVQA 1TVKB 2CXRA 2ZYVX 3DVAA 3NH6A 1QPGA 4UE3S 2CUTA 3FVWA 4XGNA 5EA2A 3ST7A 1ZPDA 3AWDA 2W2LD 3S2IA 5CYPA 1KDZA 3QF7A 2AE1A 4P3PA 5KX5F 2LKCA 1PLKA 4ZYLA 5AK6A 3UT5A 1KI6B 1YQDA 1FMLA 1KMIY 4ITRC 5AM2A 2OV8A 4JP1A 3IEXA 2QK4A 3QLVC 3SYTA 2BFFA 1U3DA 4Q4AB 3C7DB 2C4VA 1EDZA 1U2ZA 3NVMB 3R0JA 4TVBA 1J9ZA 2YZ2A 4LZAA 4YPFA 4HC4A 4L0CA 1XZDA 1Q15A 3CTPA 2BI4A 3V8RA 1UOOA 4R2HA 1UCFA 1XVUA 2CHQA 1EHYA 1WOYA 4GVPA 4MQLA 4ON9A 5DM60 2LW7A 4BNVA 4BP8A 1GVNB 3A4NA 2P79A 4HDCA 5FUWA 2R1VB 5IH3A 1MVLA 3GT0A 3LRXA 4A4DA 3GUVA 1BGVA 4Q15A 5F5NA 5CDYA 3OTOB 3DZHA 1QE3A 1L3BA 3DJYA 1MRNA 4RVDA 1J1UA 2JIDA 2HSJA 1TJ3A 2YY5A 4FFPA 4I4TA 2P2DA 3JQ7A 3QX7A 1MO5A 2Z30A 4HL6A 5AKXA 3SQWA 1Z0KA 2B99A 4ER3A 3E4DA 5CB0A 2JANA 3KB2A 3LT0A 1NN1A 2Z09A 4D74A 1YJCA 3Q2OA 2IVFA 1XZKA 3Q0EA 1N92A 3BH0A 4W63A 4ALJA 5TY0A 2B8WA 3JU3A 3A3PA 1ULZA 1F6WA 4J03A 3ZWDA 3U5TA 2UXCB 4FGZA 3ZWYA 3D1JA 2Y1XA 2O7RA 4DIMA 2C7BA 1H6DA 1CY8A 2ZT6A 5IAOA 1GG8A 1ML3A 2JEZA 4M8NE 3W3AD 5A4AA 1BA3A 1JJIA 1FP7A 1Q1BA 1RS0A 5AW4A 4AMUA 4YP9A 1SU4A 4CCSA 2OORC 4FYHA 1ZUHA 1FPQA 2ERYA 3PR3A 4LRWA 2QR3A 3SEZA 2P9JA 3T38A 2PNFA 5JDIA 1Y8QB 3FNGA 3PRJA 1WPQA 1YBAA 4LWZA 4ZARA 4NZZA 4UUOA 4ZVSA 3GVXA 1B15A 3UJ7A 2ZYIA 5DHSA 4MW7A 4X8LA 2JFBA 4QRIA 5B3AA 1IQRA 4YB8A 2RB4A 4U00A 4MTCA 5L3SA 4JLPA 1MTOA 4Q7EA 3ZN2A 1R3UA 3GAMA 3OQPA 1Q0QA 4FFVA 1NWCA 1Y3DE 3V4LA 2FRXA 4JLSA 1YRAA 2FZWA 2J6BA 1OMOA 2QRVB 3O84A 2INGX 4FKMA 3DOCA 3EPKA 4GDFA 2AOXA 2BJVA 3H9GA 2HSZA 3M3PA 4P35A 4D2IA 5C80A 3D7KA 3QLUC 3CZQA 1TVMA 1FVXA 1S3IA 4J4TA 4YRKA 5EUBA 5ALWA 4G41A 5BMVB 4F4JA 1FP4A 4G84A 3G13A 3EASA 3TLAA 2ID9A 2C9MA 3N5CA 4LOLA 4Q1EA 5LWQA 2DHRA 1CX9B 1E7MA 2X3UA 4ZT4A 3CUTA 1IHPA 1QR2A 4GBGA 5GADl 4H18A 5T4HA 3DE2X 1L5NA 3DV0A 4L07A 2BTQB 1G5TA 2WJVA 3W5HA 1GQYA 2LGJA 2CJXA 4FEYA 1A77A 1G0OA 1L7QA 1DIRA 2XYGA 2ZUWA 3L77A 2J3MA 4RKWA 3X1YA 4BGUA 4MAFA 2VUTA 1NYQA 1L5QA 1W36C 5F76A 1U1IA 2HDOA 1US8B 2XRZA 5E1OA 4PGFA 4LJAA 5BSTA 4DCGA 1SB8A 3GGOA 3ZV4A 5IRCD 3RS0A 3F4KA 2DCUA 4K6OA 1X80B 4DDTA 4YR7A 2IS1A 3KUXA 1O6ZA 1TJPB 3QKSA 3JXEA 4YBZA 3U4DA 4CMHA 3U44A 4LOIA 3I52A 2O59A 2Z8XA 2JHGA 1W88B 4OA5A 5AM5A 1WB5A 1QNFA 2OZLB 1T1EA 4HI0E 3E5MA 5BSMA 3MG9A 3ND7A 1Y7LA 4GZ6A 4UJ3A 1RPAA 1N6HA 4JOSA 3RVOA 2GXUA 4YHHB 1G17A 2VDMB 4QODA 5CX1A 3I62A 1LZLA 4B40A 4K9SA 3P9CA 4M9CA 3T1YB 1CQJA 1P74A 5ILOA 3OLXA 5F3RA 5KKAA 1OKKA 1O9BA 3PNLA 2I4MA 1ENOA 1H66A 1ND6A 2ZRPA 3GZ4A 4WQMA 4CKEA 1ZA1A 3LQ2A 3CNHA 5H4GA 3NJRA 1PHPA 2BDEA 3HB0A 2WJ4A 2GERA 5D6NA 1JHOA 5CK4A 1CUCA 5L95A 1W30A 3O1HB 1FFHA 1Y3FE 3H97A 4YI5A 2WWTA 1FPMA 1V4VA 2B83A 4K28A 5EJ9A 2IEBA 1FDRA 1GUDA 1VLQA 2X0RA 1SAYA 4A6DA 4CM7A 2OYCA 2TYSB 1HT0A 1CYEA 2YHBA 1Z35A 3NO4A 3V8NA 5HTOA 4D79A 5ALDA 2HT6A 4EA6A 3O5AA 2JS7A 4J0EA 4QOSA 4YDRA 4Y0VA 1F9AA 4REQB 1E6EA 2ZKLA 3JQPA 3K9FC 1RZRD 1VZ3A 3C6XA 1EBBA 4WEQA 3KS9A 4C87A 5ARDA 2V7XA 4PZYA 4EYKA 1NI5A 2P41A 3DG9A 1JXMA 2HF9A 2ZK7A 4RYDA 1BN7A 5EE3A 4ZALA 2O4UX 4JBXA 4BJ6A 1J2RA 4D80A 5HUQA 2JLQA 3ICOA 4P1ZA 4N4AA 4A73A 2Q4RA 4JKOA 1E9FA 4Q6BA 1RBMA 1GXSA 2RGBA 5DYIA 4CQLB 4RK0A 1K89A 2AN3A 5A9TA 2X5KO 1DBIA 4EMSA 2CJWB 2XT0A 3A6ZA 2CDRA 5F73A 1F17A 5CPBA 1TL7C 3OP1A 4Y1RA 3S68A 1JKJB 5LQDA 1BXRA 1JR3D 1T2CA 2BFAA 5LZ8A 2XDYA 4D42A 1P72A 3EFOB 2OQRA 2BZ1A 2H1HA 2PX0A 2WR8A 3FDXA 3IMKA 4KVZA 4N1AA 4QL3A 4MI3A 4R7TA 4RADA 3L7BA 4Q16A 5AK4A 4PLWA 3DCNA 4BE7B 1J49A 1SWVA 4XOUA 2DBYA 3I2JA 3S2SA 1XU4A 4QM7A 2G6BA 3D3KA 5JIBA 3Q98A 1I5EA 5JQWA 1B26A 3D4BA 3U81A 2PZJA 2OXIA 1HG1A 5FKJA 4BP3A 2A30A 4CCWA 4DCMA 1QPZA 1ESEA 3RS8A 2FHPA 4Q93A 3EARA 1YMQA 4Y0AA 5K8LA 4QBHA 3A36A 3I39X 4XQ0A 1QKKA 3V7FA 2QD5A 5EIBD 3L1KA 4TLDA 1L5MA 2A0FA 1U63A 1KAOA 1S9HA 3GHHA 2VBCA 5GOTA 4J0QA 2XRFA 5IKXA 1CEQA 1V71A 4EHIA 4RVOA 4LDQA 4RVGA 4B3IA 4KCGA 2VJAA 2XSZD 3OH8A 5J4LA 4HX5A 2FW0A 2O2YA 3RUEA 2J3LA 5IJZA 4JNKA 3FMPB 1PL6A 1M34E 2BCJQ 2OECA 2REOA 3E9RA 4P80A 1U0LA 2O05A 3KKOA 2GUWA 4HX9A 3WS7A 5M34A 3PLAE 4WH0A 3WFZA 2AFHA 1ZESA 1E3TA 2BI8A 2EU8A 4Y2QA 3EEOA 2IYZA 1ZJWA 3Q88A 1TLFA 5I8ZA 3P19A 3UJNA 4V0NA 4IR7A 4JYBA 3RANA 4HRAA 1NHWA 2RHBA 3JRXA 4IYJA 1R7RA 2NO6A 4D81A 3BE8A 1HEIA 1YOVB 1FUIA 2NO7A 2ZSJA 3CNOA 2CEKA 3OCWA 3OBIA 4OUKX 3U80A 4BY9E 4DB2A 2POCA 2CF6A 3JYPA 2BIFA 3K5WA 1WB6A 1PWHA 2IT1A 1SCJA 2UDPA 1SKUA 4TWBA 2AI2A 4LFCB 5BV7A 2Q5HA 4U9IS 4CN9A 5JI3E 5FEUA 1Z17A 3R0ZA 4ER0A 5U1PA 4JI8B 1EQUA 1XWWA 3EW9A 1U7UA 3LZDA 4HS4A 4MHOA 3KKLA 2QAJA 1CK4A 2OP0A 4UDOA 5DNEA 3KEOA 1IHDA 3HGMA 3LYLA 3HU5A 1KH1A 1Q1AA 3LK6A 4OM7A 3B60A 4M87A 4XI9A 3AI1A 2FPWA 1B41A 2J3EA 5E95A 1G5RA 2W43A 2IDZA 2PH7A 4HKTA 4M88A 4NHOA 3UTCA 3O4IA 4TLEA 1U0TA 4DLVA 1OH7A 1D4OA 4G0MA 3TPZA 1VJDA 2V7GA 1X7YB 1DQPA 2Q07A 4BX2A 3UGJA 4ODIA 1JQ3A 1JWAB 2O3SA 3RJZA 3EEQA 4C4XA 3E22A 4BJ1A 5KWVA 2HSDA 2VWHA 2R7AA 2R6ZA 4J1NA 2G70A 5AW9A 3ZCPA 1GTMA 1VG8A 1C4XA 3U16A 4AQ7A 3VKFA 3VOTA 2JCYA 2RHWA 3AI7A 4BN4A 2ZQYA 2NSDA 1TVKA 3QTLA 1RRKA 3ZNOA 4GRDA 4AC9A 2J3IA 5EJEA 2AG0A 2JFXA 2XB4A 1PV1A 2PS3A 3CWZA 3EXFA 4FBMA 3OT4A 2XH8A 2J6IA 3SKYA 4UQLA 1M2KA 2D54A 4FSXA 1GIAA 1S4MA 2WPDD 4DNQA 4ZVLA 3W8DA 4AY2A 2CHGA 1D1QA 1RT9A 3TEJA 1NVMB 1E2LA 4BLOA 4ME6A 2G40A 4O1IA 2H1RA 2YZKA 1PFVA 2J0SA 1AUOA 4DABA 1KTVA 1OI3A 3UK7A 4MW5A 2A3NA 2WSIA 3OPNA 4KQIA 2VJKA 1QG0A 4MX8A 5AI4A 5EMJA 3TR6A 4GYYA 3LPLA 5JXGA 3QIAA 2ROQA 3L8DA 2AV6A 2GFHA 3CV3A 3GP5A 2C92A 2FE4A 2OWDA 1J8QA 3D7NA 3IIEA 4ZU6X 4YRPA 1FF9A 2ZG6A 3VAZA 4JJ6A 4CIVA 2X5XA 5C3UA 1ACMA 2AJCA 4OKNA 2NO1A 3JQ7B 1V1JA 5CLQA 4YRRA 3RYCB 4MVYA 2P2NA 3VO1A 1NQOA 3D64A 4N6OA 5CX4A 8LDHA 1QQ6A 5E7JA 2UUAB 1VRCA 1V0JA 1I7NA 4WBNF 2EKPA 1TQHA 3BMCA 2Y1LA 2H52A 3MOSA 3T34A 3V8EA 3U2QA 1REQA 1NURA 5K9ZA 1GSOA 5KYXB 3CSUA 4XJXA 4QATA 2W6JD 1XCBA 1YZFA 2L19A 1HH4A 1A9TA 1NBIA 2OG1A 2QLFA 4KQ1A 3S4YA 2F4VB 4PGAA 5K05A 3ZY2A 3AKEA 4XWOA 4CKCB 4NIMA 4KFCA 3GARA 5KPDA 4XLLA 3QUSA 1R8QA 4GQAA 4IDPA 3PX2A 1C4KA 4P4SA 3NAQA 1Z73A 4FHGA 2PV7A 4RJKA 3GRKA 1PZMA 1YL6A 1EFTA 3D3EA 3EZXA 2OA0A 3RD5A 1WXIA 1NUQA 1YNSA 1DKNA 1ZJ5A 2A1TS 4Y2XA 3W1WA 3ZDQA 1HI9A 2WJPA 4AN4A 4ZCRA 5IJ0B 1GCAA 4LNAA 5ENDA 1SOUA 2RI6A 3IMGA 4HAOA 3KZOA 3KDPA 4H9GA 2Q9BA 3NYWA 1U0JA 2AI3A 4ZZ1A 3PGXA 1T91A 3H84A 4HH0A 1UBEA 1CHDA 5F77A 3C16C 4PQRA 4CV3A 2XI4A 2VF5X 3N7TA 1R6XA 1P2BA 1XEWY 1WR8A 3AJ9A 1C3JA 4IUDS 1TTPB 4YRQA 1WXDA 3DZBA 5L3SB 2GPWA 3IT3A 2Y2VA 4YRJA 1P7WA 3I2KA 4BOYA 4K86A 4QPNA 4MJ7A 2ATCA 5SZIA 4YP7A 4NJMA 1UWKA 4L85A 2ZB7A 4G9EA 3OZSA 4KO2S 3RV4A 1JHUA 3DONA 4LRSB 3UJAA 5HR5A 3P4YA 1N2EA 2C8LA 4PEVA 2E82A 1U0NA 2DR2A 1FNNA 3AY7A 4LI0A 1EVKA 1I9CA 1KDYA 4QAJA 4LJ9A 4H1WA 4WKNA 2BMVA 1WF6A 4NMLA 4EPXA 1ZSYA 1IQ0A 3FUTA 4GWLA 2WUEA 4QDKA 4RANA 2IXTA 2BP7A 1NY5A 3O3OB 1MX3A 3E05A 5BW6B 3HY6A 5LZ2A 3Q8LA 3T8YA 3CZCA 3DV0B 1SHUX 3N2GB 4WPGA 1N6IA 4IS3A 1TAUA 5C4MA 1ZGHA 3GPLA 1ZD9A 3FYHA 2G5CA 5IKEA 4TS4A 2F1RA 4LMBA 2ZKIA 1NQWA 1TD9A 1PUIA 5BVHA 3GLSA 2AJ8A 2XNDA 1PNQA 3E81A 4KYTA 4BL5A 4BO4A 4BVFA 5MN4A 1X15A 2GBCA 4TTQA 2PUGA 3RC8A 4R01A 4UMDA 1E7RA 1W4LA 5A6VA 2UZ0A 1KPIA 4LY6A 3SC6A 1FQWA 2Z6VA 3JALA 3OLYA 4Q7KA 3U7FB 4INOA 2PUVA 3WMRA 3U44B 1LBEA 3TO5A 3GEBA 2HHJA 5SZKB 4ZO6A 3H19A 3DGEC 3ML1A 4DAOA 5C32A 1O6GA 2M6LA 3T7EA 4GH5A 5HOQA 2YDXA 1EB9A 5EEHA 4O33A 4KQFA 3U40A 1E3EA 2MSWA 5CVVA 2JFQA 1ELOA 4MHTA 2SBTA 4JJ8A 1AMNA 3DXYA 3BRSA 1SCDA 4TZTA 8ADHA 1CZOA 2P5SA 3SDSA 1V7ZA 2WM3A 1R15A 3AFOA 1P9LA 1BVRA 5C18A 4EKIA 2IYWA 3ZJ5A 3NXKA 2ZRJA 4D0GA 4Z8XA 2ZYSA 4LJ4A 1Q7BA 2V9PA 5JD4A 1YAJA 5TMEA 3OKFA 1AMUA 5HG0A 5ELXA 1PR2A 2DWOA 3RSCA 4DIDA 3IEMA 2XCLA 4G4JA 3FYDA 3H7AA 1M6YA 5IAEA 3G9ZA 2UZ3A 4KXWA 4ZD6A 5A02A 1IN1A 2W00A 2PCLA 1EPUA 2B61A 1Q0ZA 1TU3A 5COBA 4JYCA 4UAGA 5EJ6A 1WG8A 5LD2B 5E38A 1PFWA 4UVHA 1RZVA 1UOPA 1Y7TA 2QRUA 4FWIB 3AHGA 3ZLBA 1JVBA 1MO6A 2BFEB 1P31A 1L5LA 4RORA 2Q0HA 4QZVA 3JYHA 5LKRA 1DRWA 3PRYA 5KQRA 1OTHA 2FPMA 2ZYUX 3OUTA 5AVXA 2H9YA 2YFKA 1PJ3A 3I23A 4JN6B 2G25A 3OQBA 1PUXA 2C4NA 2AN4A 4P84A 1IH8A 2GBFA 3AKCA 3TLJA 2I8AA 3W90A 4W7IA 2ZFUA 4B3TB 4WCFC 1XZFA 1TXGA 3IAS6 1HFWA 1OROA 3ONDA 4FXPA 1WZCA 2WTBA 2QB5A 3BHIA 2WTNA 1GXSB 4PCLA 3BRQA 3G2LA 4OI2A 3KL4A 4OBBA 4P22A 4MK4A 3QI2A 1HKHA 1VE6A 4Q6WA 2TRSB 2WRZA 3A14A 4CV0A 1QVVA 2WVGA 2P65A 3AVPA 4HRYA 3SAJA 4ZYWA 2OWEA 3E9MA 2IXBA 4URUR 1MEJA 3RJ9A 3IKTA 1ZY2A 5EXSA 4A0HA 3CHYA 1N2CA 2BISA 4FSHA 1ZDMA 4R5HA 2ZRIA 2ZWOA 4GGMX 1VIMA 4PAMA 5FB3A 2WM9B 3ZBUA 2AR0A 3L41A 1OJ7A 3ZUPA 5E4YA 1VJRA 3VR6D 3I12A 5CG2A 1S3GA 4GI2A 1Q77A 1L4YA 2IYSA 2IELA 2IBMA 3CX6A 4P54A 2GDJA 4I3FA 4RESA 5B3JA 3WFJA 5MFPA 3K09A 4TMFA 1CY1A 1XPUA 2F43B 1ZSVA 2L69A 1R0LA 2P9QA 3IAAA 2YZ7A 4R1PA 1GAQA 4TPKA 4PZZA 4FYVA 4NMHA 1TAGA 2ECKA 1DBSA 1DO2A 1TYBE 3OX2A 5K45A 2CXUA 4MRRA 1LUAA 3HEAA 4OFZA 3G2HA 5D1NA 1E1KA 1H1DA 1IG3A 4HR7A 2LUOA 2DLNA 3P27A 4AMZA 2X3FA 4IIDA 4KYVA 1U2GC 4EG5A 2ZIUB 3KVRA 3WB2A 2O4CA 2WHPB 1NLYA 4X6YA 1H2ZA 2XUFA 1KFJB 2JJ2A 3A9WA 3SCZA 5KYUA 4BAZA 2F8LA 1MQSA 2HBRA 1I4WA 2VA8A 3AG6A 5IHPA 5FIUA 3ZWOA 5LZ5A 1KP9A 3TXYA 3EMDA 4J8PA 5E4FA 3UQZA 2CB0A 4FE7A 4WY5A 4AF8A 3CUUA 2O8CA 4EABA 2ZUEA 1KAQA 3LAWA 4K1XA 1H8EA 4EUNA 5LZ7A 2QNBA 1OU4A 4QU5A 3I9NA 4MRPA 2AD5A 2BBWA 2IDMA 4YGYA 1DC6A 1I2BA 1KFEB 5K0FA 3NNNA 4B83A 3ND5A 4GP9A 4BLTA 5K2OA 2WJIA 2B94A 4JBHA 5LU9A 3RHTA 1MQ8B 3AF1A 3OIWA 2Z95A 1ISMA 2X13A 2EKZA 1UP7A 3AG5A 3L4SO 1LF5A 4B5KA 4YWJA 2RI0A 4MVJP 5LQJA 4ZOEA 3VR5H 2YFHA 1DAIA 2BR5A 2QTFA 3B5JA 1PJ2A 1KAMA 3G0BA 3WOHA 4L28A 2BGIA 2IK8A 2BW0A 4KXUA 4EHNA 4TYQA 1MT3A 4FFBB 2ZVDA 5IAGA 5LQSA 3IIIA 2LRHA 4B31A 1Q50A 2BBTA 3B3GA 3NUZA 4NFYA 4JEUA 3TLCA 4XIYA 4BU1A 2O8EA 2BGNA 3WDSA 4S1NA 1XL0A 2DJIA 2QSJA 3L6RA 1Z62A 4EMTA 1R0RE 1XKXA 3OE7D 3EXFB 3WGGA 1JI0A 3W5AA 4GKAA 5D51S 5BSHA 1EUQA 2YVAA 5LYYA 3NUGA 3O92A 4QJ3A 1NBEA 1ORIA 3DD5A 3PHGA 4OGKA 1HFEL 4LXUA 3ORRA 1AN0A 3IIMA 4AK9A 4PTYA 1EDEA 5ALMA 4JOQA 5AOBA 5K3CA 4B7ZA 5CVUA 1J42A 1X7ZA 2H85A 1B14A 2QROA 2LZ0A 2N1MA 2XVAA 2G5GX 1QGED 4GOXA 4M60A 2GHQA 2FW7A 1L8QA 3PEEA 3ZEAA 2Q8QA 2WF6A 4H6VA 1YIDA 3IE0A 3VZPA 1UBTS 1F6DA 3NGXA 1C29B 1ZMRA 2ZS8A 3E4CA 1WVMA 2G17A 4UDXX 1QO0A 1NJSA 1P4AA 2D2EA 1DOAA 3DEFA 4F6LA 1IY1A 4XVUA 1RFGE 5IDYA 2ZAOA 1G6Q1 1T5OA 3Q87B 2YVQA 3LIPA 2XUAA 1APBA 2Z4RA 3DO8A 1NXVA 3VJKA 2CFSA 1OH5A 1QYCA 2R79A 3BMCB 2QRPA 1NXWA 2HQOA 4G37A 5A62A 4HAWA 2EYQA 3Q9SA 1UJNA 4QO7A 4QG7A 2IODA 5GVRA 5IJXA 3BXEA 1NXSA 5EXEA 2XNDD 3I9V1 4MUKA 4MQMA 4RYLA 4TXLA 2WV9A 1ILWA 2XE7A 2OGSA 4PO1A 1CY4A 4P4SB 3UEOA 1UP4A 1MBZA 3VYSB 4FDUA 5TNXA 1YRQA 2AA3A 3L7JA 4DZTA 3KFXA 1M74A 3EPJA 1X13A 2A9OA 3R9KA 1BO6A 1P1KA 1G21E 5HIMA 4DSNA 6CHYA 4RM3A 4KFRA 1IN5A 2BGKA 1S5PA 3BILA 3X3HA 3NC4A 1P9RA 1U8ZA 4UBMA 1V3TA 5J2TB 2OBYA 4G67A 3U0BA 5FXMA 2XMPA 4CIXA 2J33A 2CD7A 2EW1A 3I9KA 1ES9A 4C3VA 4DLZA 3KYCA 3U7GA 2JI4A 5LLDA 1OC2A 2JAQA 4IYRA 1EUYA 3RRYA 2RH5A 3ZHCA 4LF8B 3FBTA 4G0UA 1MLDA 2AC2A 4RF2A 3WLIA 2QQEA 1M2JA 1N9GB 1AVTA 1NYRA 3VMMA 2RDMA 1IBLB 3C3EA 4FM9A 2ASVA 1P3JA 2HHAA 3F7MA 3K6SB 4JYPA 3MTGA 4JB3A 1Q92A 1YOVA 1QH1A 2A0UA 4MI9A 4QBKA 2XQVA 4D57A 4DV3B 3A4VA 4UUMA 3DFKA 4R2WA 1QFJA 1UQRA 2J4CA 3COWA 4X3CA 1KQNA 1SU7A 4KR6A 1NONA 2BGLA 5BQPA 5AVYA 4L0MA 2J5KA 1TKBA 1QRAA 3FAZA 4BUZA 1HNWB 3IV9A 5HJ2A 3NDIA 2J9FB 2VXYA 3E7XA 5DOVA 1X14A 1MC5A 3RYFB 2C9DA 4Z4EA 1C9KA 1DUIA 1H9BA 3IHWA 3S2YA 4UPDA 2HXSA 2GEDA 3Q2KA 4ND5A 3TW0A 3SX4A 3B1JA 3PFHA 4PC7A 4COKA 4YAJA 1GCOA 3HDJA 5BRNA 3UWKA 2XITA 3T5CA 2NQ8A 3H7IA 1PGOA 1ONOA 5CT5A 3L43A 1KPGA 1E1LA 3B3QA 2KSQA 4GPBA 3NJ8A 4FS3A 5ALVA 3K0FA 1TUIA 2A9VA 2FF5A 1W9HA 4REOA 4YCLA 3KV1A 1R6DA 4I1VA 2Z2IA 4LXIA 3QEBZ 5FO0A 1XLTA 4EKGA 1KZ1A 4F7WA 3FTEA 5REQB 1MOPA 4NU6A 4J16C 1YDFA 3C0KA 4ZMRA 3MJSA 5DFAA 3W6NA 3GA0A 3THXA 2IHJA 5CM8B 2DQYA 3FW1A 4NV0A 4B33A 4YRZA 4DR1B 4JLDA 4EITA 1T5SA 4N5DA 5J3JA 3SHFA 3QTBA 3E8MA 5B5SA 5JXWA 1XMXA 4XDZA 4JWKA 3WZLA 4J7XA 3UV6A 1JHYA 4I14A 2GLTA 2FU5C 4NBNA 1CW2B 2YJTD 4DDMA 4HATA 4KK4A 2OBNA 2XF2A 5AJYA 1BMFA 2YMQA 4XIJA 3HKBB 3IJ5A 3PIIA 3UMFA 1AV6A 2DOKA 3PHJA 5LZ4A 1BD4A 1H0RA 1GGMA 4R0NA 3CZMA 5F35A 1HYBA 2WSSD 5T41A 4U7GA 3C7CB 4MYHA 3DMPA 4X60A 3IAEA 3R5JA 3AV3A 3UATA 3ROTA 4OXRA 3SM3A 3IQFA 1U8XX 2SCUB 2FV8A 3S1AA 3OHMA 5JASA 1VKHA 2ID8A 4WZBE 2IV2X 3DMYA 3W6UA 2WAYA 3JPYA 4RIIA 4AZTA 2KBFA 5DLEA 3W1VA 4M7PA 1K5GA 3HUDA 4JXJA 3W2TA 1WU7A 1KI1A 3SD7A 1GLNA 3W2FA 5LPNA 5JJLA 1EJ0A 2XY4A 1LKZA 1E6CA 4EYOA 3O7WA 3K73O 1NF3A 1X92A 1ZN9A 1IEXA 2BY4A 1JLSA 2FN9A 3GOHA 3I32A 4OG2A 3S1SA 4HWGA 1HT3A 2GXAA 2IYLD 3CMCO 2AF3C 3HPQA 4OLBA 2H4FA 4PLGA 2AT1A 1NP3A 1Z08A 6PFKA 1YCHA 1ECFA 1U8AA 3A2MA 1RU3A 3I8OA 1X8LA 4JJZA 1QHYA 2IYNA 4US1R 1UC4B 2H00A 1PS8A 2DBZA 1G3MA 3DF7A 3GO4A 3CJQA 4I6JA 4A15A 1JEYA 1WM1A 1DHTA 3NZEA 4PQFA 4OLHA 1SVUA 2H0QA 3PHCA 2OESA 1MOQA 2B2CA 2MMGA 2WT4A 1PDOA 2QVZX 5FOQA 4ABTA 1N2CB 4JMLA 1II9A 5JLAA 2OAP1 2FQWA 1QHGA 2Q41A 4JC4A 3ZTYA 5HZMA 3U1BA 1IMOA 1FNDA 4LMPA 1P7ZA 1AUQA 4BGVA 2HW8A 4MVJG 1RWNA 2NAFA 3C6BA 4JCOA 4H7PA 3I76A 4WLFA 3FUCA 4KXFB 4AS3A 5DX1A 1EDBA 3KR2A 4D4JA 3NATA 2R751 1SA0A 1N0UA 4N0MA 5KOJA 3L1UA 3BWMA 4D6YA 1V8FA 3QJ5A 3SYMA 1G19A 1RQGA 5FQOA 4AJ2A 4BKOA 3GVIA 2QAGB 2JGAA 4TLBA 2D5CA 5ICSA 4NQRA 5B3JC 2I3BA 2E6UX 2Q4TA 2BTEA 2XUQA 3IP9A 4IOLA 3N59A 4Q4HB 4KREA 4YJ2F 4QELA 4RHTA 1LBSA 3MJCA 1G5QA 3KYDB 1XHLA 5FI1B 2A5GA 2Q6LA 4JLOA 1Z0IA 3WHLA 2IHTA 3HABA 2BTQA 2FOXA 2XBUA 5FR1A 3WXBA 4RK6A 3N2IA 3DKKA 2AH5A 5EIBC 4L5CA 3VR5A 4GI7A 3MVEA 3SZLA 3KYJB 4PS0A 4NMWA 4HLQB 4LPKA 3U3OA 2IUYA 4KR0A 5HRUA 1Y3CE 4AU1A 4HQOA 2FEKA 4M8IA 5B1YA 2GEFA 4JJIA 1B6SA 2VK1A 4R4JA 3CPEA 2NG1A 1N1MA 3ITKA 3DLTA 3FWKA 3FNRA 3RFTA 4CI9A 3C5VA 3A8TA 2XAUA 4MVJM 1V41E 4L50A 4DV1B 3R3WA 1SVIA 4KE7A 4RD0A 4EZBA 2GPAA 4F7DA 4HN2A 4HBGA 2GJ8A 1W5AA 2P3OA 1ISFA 4MJ3A 4YT8A 1NOJA 3PC2A 2FFAA 3O8CA 2DETA 1ZI9A 5GONF 1VL6A 4RAQA 3CY6A 4DTIA 2J41A 1U0EA 1N1EA 1HMYA 2HB6A 2FPIB 3E15A 3VAAA 4KJXA 2BM0A 1KNQA 3GVCA 1VKRA 4CZ2A 1D4ZA 4FFRA 3WL7A 1QGOA 3DKPA 2J30A 2H17A 3CCFA 3DXZA 4P0TA 4AZSA 3I45A 2A4MA 2YZNA 4TSFD 1AMOA 4WLEA 1K66A 1Y8RB 3ZOKA 3H1AA 1KWKA 3KALA 3GB9A 1L1EA 2BHLA 3R75A 3QPVA 3QWAA 4M9RA 2G5PA 2RCYA 4DE5A 2XADA 1DJPA 4NH0A 2EARA 1CY0A 1Y9ZA 2XQKA 1FXUA 3DLIA 3R20A 4QNNA 1JAYA 2BFPA 1A4UA 5F1OA 1D7AA 4HJRA 4IIJA 4YT5A 1E0KA 1W2WB 1XE3A 3IKVA 4OHXA 3DEZA 1JJFA 4ZT7A 4H6PA 1E9CA 4US0R 1K8RA 2XUPA 4I1PA 5IT4A 5LC1A 3GFRA 4G5SA 4ACBA 1X7ZB 2YQ4A 3C43A 1IB0A 1PJQA 4KAFA 5DO9A 5G40A 5L3VA 1YVEI 3UF0A 3INYA 5MGBA 4DM4A 4OAOA 3Q0TA 4DCSA 5G2OA 2YJNA 1U4SA 5A9SB 1WQ4A 3WK5A 1ZQ9A 2VLIA 5GGXA 1SBYA 3IESA 1QTRA 1ZU5A 1OHHD 2W0SA 2VYCA 2QZ4A 1M2FA 2RHJA 3EA5A 4BFXA 4DQXA 5DYGA 1AQJA 1MRSA 2OCKA 1Y6FA 3RNLA 2H5EA 1VKJA 4C2AA 4B3GA 1FX1A 2C88A 5GJBA 3TTUA 3EBPA 4BFUA 2X1MA 2ZYDA 4J4BA 3Q7TA 1CUSA 2W5UA 2P91A 1OH6A 1JIXA 1YB1A 3S8YA 1UBLS 4ETWA 4HN9A 4RTKA 2PX2A 4CDNA 5GM2A 2R8BA 5ALYA 5JNWA 1AURA 5JXHA 2NYUA 5AVTA 3GMIA 2H5LA 3Q5EA 2YW9A 4XLZA 1QWSA 3UZUA 3R9XA 2E49A 4ZVMA 5EKXA 2PANA 3GIDA 4D3YA 1YR7A 4RZXA 3TSZA 2HKIA