5JSYA

The 3d structure of the ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough at 1.04 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
GTLTGERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase, small subunit
publication title The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis.
pubmed doi rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Oxidoreductase
total genus 85
structure length 283
sequence length 283
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jsyA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jsyA02
4C3OB 1WULS 3MYRA 1H2RS 4GD3Q 1UBUS 4CI0B 3ZE9A 3UQYS 4UD2A 5A4MS 4URHA 5JT1A 3AYXB 1UBTS 4UCQA 1UBKS 5D51S 1YQ9A 4UD6A 4UCXA 4IUCS 4IUBS 1WUIS 1UBJS 4UPEA 5ADUS 1YRQA 1WUJS 4UQPA 3AYZB 1E3DA 4KL8S 1UBRS 1WUHS 1UBHS 5A4IS 1UBLS 3ZE8A 4KO3S 4U9HS 3USCS 3RGWS 1WUKS 4KO1S 5JSUA 3USES 5A4FS 4IUDS 5JSHA 3CUSA 1CC1S 4UQLA 4UE2A 5JRDS 2WPNA 4KN9S 1FRVA 5JSKA 3ZE6A 2FRVA 1UBOS 1H2AS 4U9IS 5JSYA 3H3XA 4TTTS 3CURA 4UCWA 4UEWA 4OMFG 4KO4S 4KO2S 4UE6A 3ZEAA 4UPVA 1YQWA 4UE3S 1UBMS 4UEQA 3ZE7A 1FRFS
chains in the Genus database with same CATH superfamily
2GNPA 4JUAA 4LCBA 2JJ1D 5F3RA 1C14A 3FSGD 2UKDA 3FI0A 5EVJA 5ALRA 2PA0A 1EXWA 3QE9Y 2ZRIA 1WKVA 4XUGB 1N6OA 4A16A 5EYPB 4D57A 3R0ZA 1F0PA 2H92A 5M3BA 3QEKA 1XSEA 3N2YA 5D5QA 2VPQA 2EW1A 4C7MA 4EFDA 3HKBB 3LWZA 2FF5A 2XQFA 1DWPA 3L2OB 4M9RA 5E0KB 2D5BA 3AVQA 3IP1A 2EGUA 2JD0A 3BF8A 4LVOA 1U1GA 4M83A 4DLBA 1BN6A 5DM60 3IILA 1LQUA 1DTWA 3HQ4O 4O33A 2WU1A 3CKKA 4ZIRA 3Q8MA 3I6IA 1K88A 2ZW9A 3RODA 4RHTA 1H23A 3RVMA 1FRNA 1XMPA 2DLNA 2IOQA 3P71T 1GSHA 3TQTA 4U3JB 3ZW8A 5K7SA 1R8SA 2YY6A 4B75A 1ORWA 5CB4F 5HQTA 2B83A 3Q3IA 1LKZA 1U63A 1WNTA 2DP4E 1E9AA 1A9ZA 2EG9A 2FLWA 4QYSA 2O3JA 1Z4NA 5JAMA 2NVOA 2NSDA 2XUGA 1UOEA 1X7ZA 3EC7A 1NNEA 3JQ8A 2HADA 2HQ1A 1JHDA 3BICA 2JW5A 1ETHA 1RWMA 1PT9A 2Q2OA 3SSOA 4BN4A 4YMHA 2WJWA 3I5XA 1IBLB 1QIHA 4NULA 1GYPA 1I0ZA 3G5LA 1P4AA 3KXLA 2F8TA 1PL8A 2AZTA 1FYDA 1RRFA 1VE9A 4QD3A 4FDMA 4ZHSA 3GLRA 4NCBA 4Y0VA 4KXVA 5BO5A 3BC1A 5JSFA 1SXJC 1CNFA 1MU0A 1W6RA 3U9SA 5CMLA 1KYZA 1ENYA 2WINI 4DLKA 1TW2A 3QKTA 4QGAA 1VCIA 4O2RA 1MA3A 2BGLA 1RMYA 3B12A 4N5LA 4R2HA 3RWOA 1VGVA 1XELA 4MGZR 4ATNA 1VIMA 4B2YA 3P0IA 3KBBA 3PR3A 4TZKA 4UNQA 2GF9A 2D13A 1FE8A 3WL5A 3GJRA 1I1NA 5FBRB 1LFDB 3QVVA 4DVJA 2PLRA 4M86A 3P9SA 1G5HA 4X3PA 2ACKA 4XQ0A 4EJ0A 1JNYA 4UREA 3ME5A 3AY3A 4FZVA 1IZ9A 3O82A 2WVHA 4LF4B 2FPUA 2FXVA 3EIQA 2B4RO 1CFJA 1DUVG 2H9YA 2RHCA 4ENUA 1W87A 3B6JA 2BI4A 1JTVA 5BVHB 4EY8A 3GOQA 3I23A 1Q7BA 3Q7IA 4TMWA 1Q84A 1JEQA 2ASEA 2LE0A 4JXJA 2BFMA 3AIMA 3O0DA 4GLJA 1JEAA 1Z33A 4W8HA 1FSGA 1XZBA 2DFTA 3BE6A 2RHHA 1U11A 5HJ7A 1JX6A 2PBLA 3CR8A 3M7IA 5ALFA 2Q0HA 1PWYE 3UATA 4WV3A 5REQA 1J0DA 4HXGA 3S2ZA 4Z4GA 2GAIA 1KJZA 2ANCA 2HF2A 4FHEA 5ER6A 4OUKX 3QK7A 3UUFA 2F1RA 1NX9A 3HADA 5FFFA 4E33A 1ECBA 1CR6A 1XCMA 3AV0B 4OQDA 1EH5A 4TUYB 3BILA 1JAXA 3DNMA 3TEJA 5KINB 1R2QA 1M34A 2DM6A 4UUOA 1IY0A 3EOZA 1WULS 3UCEA 2VXBA 3HB4X 4R68A 1Z7EA 3MTIA 3OE7D 2R48A 1RACA 3PPYA 4OJQA 3WNCA 5JAHA 3MQ2A 4BATA 3E8SA 4FJ0A 4FOPA 1HQKA 1DC6A 1PGJA 1P72A 3G5UA 1AV6A 3Q7SA 2PSDA 1OWNA 2HBZA 3Q40A 4KWIA 1HKUA 1Y1KE 2BGKA 2YJ6A 2H7CA 4CCAA 2EQAA 1PTKA 3GLIA 3TNJA 5ITWA 3L3BA 1IFXA 3AYXB 1G55A 4JC8A 5H80A 2O2JA 3OLXA 3ZV5A 4O08A 3W2GA 3VO9A 3JALB 3OLQA 3NHSA 2AC2A 4QASA 2CEKA 2PR2A 2GGSA 2AR7A 1USWA 4OM8A 3REQB 3V8MA 1MAHA 2D1YA 2HPZA 3I37X 2CLKB 3MGKA 3T8YA 2C7PA 5COQA 5G1PA 3OFKA 1O96B 1ZMXA 2Y1DA 5IBRA 3P2KA 2CXOA 3OMXA 4HDNB 1PGOA 4LZLA 4MVJD 3SHWA 4D4LA 2W6IA 4TLAA 5AVOA 1CQZA 3ESYA 5TQJA 3QPVA 3S40A 1PZHA 2PZLA 3OZXA 2X1LA 3MMPA 4K0KB 4EG7A 4P7JA 4ZGBA 3EGEA 1NN3A 4BUCA 2HPAA 1IEVA 3DVLA 3ZV6A 3ZD8A 2TMYA 1ESDA 1OVMA 4KH0A 1BU8A 4NLLA 2Y1FA 1MMFB 2R97A 2XMSA 4QGFA 4QHYA 1PLJA 4NABA 2Q49A 4N7MA 4YRLA 5CB0A 4NFSA 1DO8A 2PUEA 3O3CA 1DDOA 4G8JA 4URUR 4L85A 3DAYA 3CIOA 2M6KA 1U4SA 2V6GA 3N8HA 4PRLA 3PQ3A 4RU1A 3VR6A 3DT8A 3EYAA 4LZZA 5HP4A 4J7AA 4G86A 4W8OA 4KBGA 2L2QA 5EIBC 3SBEA 4D0RA 2XE7A 4ITRC 4INZA 2ZJZA 4MLCA 4MDYA 3NEJA 4DCCA 2BHRA 2P62A 4P98A 2FY8A 2BFBB 2VF2A 2ZJ1A 3GRCA 2ZREA 3NAMA 2C98A 4AXXA 3OQPA 3ADKA 3KK0A 3RC1A 1AQIA 1SN7A 1YA4A 4G6ZA 1NJ2A 1Q6ZA 3LSYA 1F1JA 1VL6A 2ODNA 2ZJ5A 3A7EA 4NYIR 2DC1A 5IDWA 1PKXA 1WQ1R 4JVNA 5D84A 1OTXA 2OYSA 1FLDA 1Q1ZA 3R0JA 2YWBA 2JJ1A 2LBPA 2OG2A 1UJBA 1I36A 1UQUA 2JGDB 3CNHA 3D5QA 3FSGA 3QHPA 5CNJA 2Y8EA 4YRZA 2QMQA 3DOCA 4DT1A 5GMOA 2MSNA 1S8AA 4ZQCB 4A3SA 1I2DA 5FLEX 1L7AA 2DWQA 2ZPUA 1NVMB 3TNYA 1W44A 4X8MA 3BMOB 5A0VA 4NCKA 4PSCA 4IXWA 2Z58A 3WA6A 3TR0A 1MNAA 1Y5RA 1UT5A 1ZD5A 2IE0A 1GUAA 1TZMA 2ZE5A 1UDAA 3DBRB 3E2MA 4KQKA 4BNZA 4BQNA 3AGPA 1TQ8A 1RYFA 1QAOA 4MEAA 3GVXA 3TQIA 3IAM6 3KOZA 3CVXA 4F60A 3NBZC 2QRNA 3SBDA 5JARA 5EN4A 1GSOA 4BB9A 2BM0A 3G1TA 4JZYA 1POXA 2WAOA 2WJYA 1QE5A 5HJEA 5L3QB 3ZOKA 2H9IA 3E9EA 4XWYA 3OUZA 3GA0A 5A62A 1FFAA 1N3YA 2XCRB 1EE1A 2XLCA 5E4YA 4MVJG 3DEFA 3EGWA 1ZVQA 5KYKA 4S04A 2Q9UA 1Z63A 1EMDA 4MO9A 1MG0A 5DYTA 4CETA 1RHJA 4N0EA 1EIZA 3L6EA 1TA4A 3DYIA 3LYUA 3N8NA 4FE3A 4Y1FA 3SXJA 4GL4A 5JIBA 1NXSA 4NYJQ 2NZXA 4ZTBA 2FA9A 1IXSB 3UMFA 1SCBA 1G291 3KVNA 4WXHA 3VFDA 3SHTA 5GQSA 1GGKA 1PNTA 1Z56C 4Y2GA 1QX3A 5TSDA 3K0FA 2PT7A 2FSIA 5F5XA 1VL1A 4H7KA 1DCMA 5IEBA 3WL8A 3F5DA 1XZGA 3SFTA 1X8XA 1Y1LA 1W5SA 2B69A 4H18A 2H2AA 3U7IA 1E2NA 1UCFA 2FQ1A 4ILEA 4I50A 1G6HA 3GJ4A 4WZBA 2NPFA 1NV9A 3JQGB 4JX9A 1FFXB 1R6UA 3CW2A 4GM4A 4XOUA 2RH4A 4D41A 2RE8A 2IF0A 3FW1A 3BWCA 3BBLA 4RMJA 4MJXA 2ZI9A 3TW8A 1V48A 1WUYA 3RIMA 1BMQA 3C3KA 2O48X 1HY3A 4U7GA 5FOSA 1ZY2A 1Z0SA 1E9SA 4X1OA 4ZAGA 3L49A 2QD2A 1AQUA 3TLBA 4LZNA 1EFPB 1R5JA 1V9SA 2QG6A 4CE6A 1HOTA 3OHSX 2ZIUB 3QU5A 2QVYX 3CZRA 3ESDA 4P4TA 4TS4A 3S2SA 4ZVLA 3FSJX 2ZIXB 4Z6KA 1OUMA 2XQVA 3AERA 3QFHA 4DJ5X 3HXOA 1L7DA 2HIGA 3I9KA 1DU4A 1GUDA 1PL7A 3QXHA 2C20A 2SICE 2X22A 4J0KA 4PM4A 5CM8B 1EWQA 5KQLA 1EINA 1YDWA 3BGDA 1PHRA 2GLUA 3T38A 4F4IA 2PWPA 1KAOA 3NX4A 2ZJAA 3BDVA 5WRFA 5KWIA 1Z37A 4I4IA 4F96A 4KLAA 2ACWA 4RVDA 2Q3FA 1SELA 1V26A 1P0PA 3KVVA 3T0IA 5KVAA 3THWB 1HT2E 3DDWA 1ZJ4A 5C3UA 4A1FA 1I6LA 4Q1DA 4PYJA 3WSTA 1AKEA 1J8DA 4BNUA 2Z8YA 3D8NA 4Q4JA 5KSWB 3PXAA 1CERA 2GEVA 4MGEA 2ZJ6A 1EFCA 1UANA 2JGIA 3IJ5A 3U37A 1NPYA 3D3EA 5EE5B 2HJRA 1W8DA 3LQQA 2IDJA 3F7MA 3I04M 1JA1A 2ZZNA 4CMCA 1PVDA 4E2YA 1AV7A 4IIGA 2DWCA 2CLOB 1S2GA 1OY1A 1MFPA 3PIIA 4D8VA 3T5BA 2PBZA 2A92A 3EODA 3AR2A 2WJJA 4JC5A 4RFSB 4UXIA 4M7WA 2BKLA 4RIHA 3UAGA 4F3RA 3JQFA 4HADA 4UHCA 5D6OA 1JR3D 1Q1BA 5FPYA 3T5TA 3FWNA 3L7LA 3TI7A 1HGXA 1MPTA 3VNRA 4R9UC 4CKCB 5A5DA 3FLBA 1LPAB 1CNEA 5ALZA 3RUDA 4XCXA 4AJJA 1CF4A 2AW5A 4D1YA 1J4AA 2HCBA 1YQWA 1P0QA 1N36B 2ZT6A 2I4OA 5E3JA 2YNMD 3FVVA 1WMBA 2JAXA 5FTNA 3LUPA 1DLIA 5KKAA 4EY7A 3U3KA 3CRNA 1ZQ1A 4MVJA 1D4ZA 4TRNA 1VM6A 4CR6A 1TKCA 3G2HA 3MJVA 1OHHD 5FTJA 1NW6A 1XMJA 2FEPA 1G4HA 2EL7A 4B80A 2PG3A 1MJNA 3GRVA 3E5MA 4KYIB 5KU7A 2GBLA 4PQGA 1XZEA 3FUUA 5A3VA 4F56A 4JI8B 3ILYA 3V1MA 4PO3X 4B6SA 2VNJA 1TKBA 1T26A 1SUIA 3MFQA 4BUZA 1MBZA 3ANXA 1GNLA 1PJ8A 3IQIX 2IYUA 1X14A 3N05A 4ME6A 2CJWA 1SVIA 3EPPA 1E0AA 3AXTA 5FBLB 3SVTA 3GV0A 3KWFA 1H1DA 1C1XB 2HBRA 4NBWA 3TLGB 5G41A 4CFZA 4EG6A 1TAHA 1Y4AE 4NR0A 1HTWA 3BB1A 3WKCA 5KQPA 3U7QA 4QXPA 1UR5A 4CMBA 2JI8A 3AY0A 3NDBB 2J5BA 5EE9A 3ELUA 2X6TA 3K05A 1LLDA 3K0HA 3Q2OA 1OI7A 4WK4B 3FPEA 1D4FA 1I6WA 2PUBA 4YQZA 1U0HC 3C5VA 2KI5A 5FYDA 5CHYA 2WAXA 2Q9CA 3CLSC 1KSGA 3D6MA 1FTQA 3HKEB 4A91A 5HYVA 1L4LA 4I55A 1Z6PA 2J7KA 1LSOA 4EHKA 4ZOQI 2CE2X 3O4HA 3SX2A 3FPAA 2HJGA 4QQFA 5TGTA 2I6TA 3I5UA 4OREX 3F1KA 3VQTA 1TA0A 2Z9DA 3ADCA 1BVUA 5J2UA 5BR7A 2J0QA 4NZMA 1Q12A 1XZHA 5JAOA 2H59A 1TVKA 4Z8YA 4Y7DA 2NU9B 1T3SA 3JD1A 1HE4A 1XZMA 2KWIA 2CXSA 3HWSA 3TM5A 3PDIA 1WW8A 5DWDA 1NJFA 3M1AA 3TQCA 4P4UA 2V7EA 1AN0A 3C1OA 4PC7A 3GN1A 5EJ7A 3NAZA 1YZVA 2ZYDA 4C2AA 4RZIA 5ES3A 5FA5A 2YASA 5KYTA 4L2IA 1E2DA 1MKYA 1E6KA 2DTDA 2SCUA 3C7DB 1UEJA 2HU2A 5JDIA 2FRDC 3GNTA 5JFOA 5BQOA 1NT2A 2YWFA 1B2RA 3L1IA 4GPTA 4PGFA 2H2HA 1FYWA 4E5SA 1GG5A 1GZ7A 5I7OA 1EJBA 2HC9A 2AEMA 3GUZA 1ULAA 5IC5A 4HGZA 1RLOA 1I2AA 3K1YA 3L0DA 5FA6A 2TMGA 4EA6A 4A5SA 5G2OA 2OZKA 4HYYA 1DADA 4BO3A 3EXIB 4RVOA 4RS4A 2OAEA 3URMA 3H1EA 1C0IA 1QFYA 2R1ZA 2C95A 4YRJA 2ODQA 3U4QB 3AEYA 3HLKA 3C14C 3PGJA 4WN9B 1HORA 5JBNA 3GXBA 4JSYA 2VJLA 3EDRA 1UJCA 3HO6A 1Z39A 4EUKA 2KBFA 4B2PA 4NZYA 3AWDA 3AF3A 4UBJA 1Q7RA 3P2JA 4GBMA 2Q7OE 3L7BA 4LNUB 3RTCA 4MB6A 3CG0A 1P7CA 3D3WA 3DAFA 4HVLA 3KALA 1ONBA 2Z56A 4H7PA 1TJNA 2ENWA 4V3CA 4B47A 5GONF 1LWOA 1Z4OA 2CBGA 3OOHA 4EI7A 1MX5A 5B58C 4AY3A 3VHQA 1MC8A 2G76A 1NBEA 2CFCA 1CFZA 2H52A 3R2JA 1DBRA 2WWIA 5AP9A 1KFCB 5GOTA 3V34A 3RUIA 1L4YA 1NW7A 5KYNA 3FDFA 3PI6A 2WU3A 2GERA 1CEQA 4FMCB 4UUPA 1AMOA 1WQ3A 3ETDA 3W9YA 1MJGM 4LJ4A 4HMOA 4N0QA 1JU4A 4AUKA 4D74A 1MRZA 3IOBA 2V65A 4HZUA 4P4LA 1EI9A 3UHJA 1JAZA 1QGDA 2OHXA 2QM8A 4UAGA 2XNJA 4EGSA 3QNMA 4K2AA 1R5BA 4RD3A 4A8JA 1GZ5A 3DAOA 3OSZA 5J40A 4RTRA 1LCIA 2YJNA 3MJ4A 1MAVA 2VKTA 3EVBA 3LUJA 4K26A 3UJAA 2G07A 3SG0A 3VX3A 2AKYA 1ULZA 1JFSA 4AROA 4FDTA 1SM4A 2AD1A 1A4IA 4HAYA 3WK4A 3AL0C 1P33A 2H4ZA 1Z15A 1F3OA 3ESQA 4YN3A 3NBFA 1F14A 4UUMA 3FCEA 1S0UA 1RHKA 2PRSA 2HOQA 2QVCA 2WICA 1RD4A 3DEYX 3P5SA 4WA8A 3D5EA 3QM1A 5DEOA 1V5WA 2IS4A 1KJ8A 4Q15A 3LKVA 4IVRA 3LKBA 4I3FA 5E7IA 1ZWLA 1WBDA 3TD2A 2ORED 2YV2A 4ZRNA 4CF5A 3BMQA 4PNPA 4Q0MA 4RHYA 4DM4A 1P1KA 2JHAA 3N3AC 2HDWA 4ARUA 2XXAB 5F7JA 5FPPA 1PEDA 2Q28A 4Y9TA 1AGYA 2ZSBA 3CUVA 3WYGA 1TEHA 4G1VA 1V3VA 4RQUA 5ENZA 3EK2A 4OQEA 3A9UA 4W1PA 2Z3ZA 2OCGA 3K73O 3KBOA 2PJDA 3CWQA 2FZWA 2HCJB 1QVZA 2X4LA 3C6KA 3LY5A 4GM0A 1TVMA 4RTQA 1BKSB 4Q37A 1DG9A 2FRXA 1JR3A 2E18A 2OLJA 3H9GA 4H6PA 5DWQA 3UH0A 4EQ6B 4DGSA 5CD9A 1FC0A 2D0OB 4ETIA 1GRNA 5FLXA 1T36B 3HP1A 5IFLA 1N6RA 2IC5A 4HFRA 4II2A 5ALMA 5T4FA 2P1RA 2PS1A 5DNDA 3SY8A 5KTMA 1HV8A 3EIOA 1DJOA 1VJ1A 1M2NA 4JQSA 4FYWA 2Y0BA 3C6MA 1KEVA 5IH7A 4RIEA 1O0BA 1F2UA 2N1BA 1LW6E 3PJDA 4FWBA 4LYJA 2M32A 1BQ3A 3DE4X 2XDQA 3FBTA 3MGBA 4RHFA 3WNDA 1O08A 4XGKA 3JRXA 2CYCA 3U3RA 4BEBA 2OUIA 3LMKA 1XRSB 1OHHA 4OFXA 1PI3A 3BFVA 3TBHA 4ND6A 5DN9A 3ZX4A 3EVTA 3CG4A 5AIBA 2NU7A 4OXXA 4R3UC 4WXYB 4YCSA 3DE5X 2HPVA 3OCXA 4MUBA 1W8IA 4XGIA 3MBOA 3FNRA 2VZ8A 4MQFB 1HSOA 4ENSA 3CY6A 5D3KA 3TSAA 4WXRA 1U7ZA 1XALA 1GR1A 2VDWB 5ECDA 1SQGA 1HNWB 5IJAA 1PLLA 3RVQA 2MYNA 2OCYC 3BCSA 3I05A 2VSNA 3O8LA 4J75A 4LDQA 2X6RA 4RENA 5CR9A 1H22A 4PYLA 1UJ4A 4FFVA 3SFVA 2EARA 3EWAA 1IE3A 2JGKA 5U1PA 3NHFA 1UPXA 2FZCA 4W6QA 5KOJA 3L40A 2AEEA 2HK9A 5IP5A 1M6VB 2JVJA 2PIDA 3EIWA 4NU6A 4RDHA 3BT7A 1BDBA 1F48A 1DI0A 3EMBA 2C78A 1JBKA 4MS3A 2OECA 2VEOA 2IHYA 2VZ0A 4XOIA 1MORA 3O7WA 5AICA 5KDDA 3ONNA 1EQAA 3BERA 3HXKA 4IG4A 5SY6A 1JALA 3K9FC 3MS4A 3QYPA 2DBVO 3AEKA 2GF0A 721PA 9LDTA 2ZIAA 4CFSA 2RHTA 3FDXA 1M6NA 2O23A 3E5RA 2PUFA 3MWLA 1KXJA 3V4SA 3EB9A 3N2GB 4U2GA 5KTKA 1NMEA 3DL7A 1V3UA 4JJ8A 1A2QA 2QMOA 3SS7X 1IZ0A 4PO8A 4B3HA 4A0RA 3GFGA 3MBIA 3TQSA 1U2PA 2BTQA 3PV0A 4DZRA 2JFFA 1JIUA 1UBSB 4I1RA 1XDBA 4NBNA 3AB8A 4OQXA 4CLXA 1F0YA 1XTTA 3EQ9A 4RIFA 4ZCPA 2DULA 1UJ2A 3BK7A 1Y0BA 3JYQA 4A0HA 3IJPA 3BJZA 4XD2A 1P60A 1VZ3A 4KWTA 3RWMB 4B7XA 1B8PA 2R8PA 3IDQA 3MWEB 3RBVA 4DTIA 4DW8A 3F9IA 1YB6A 1Z2PX 4XVRA 1LDYA 1H2WA 1HL7A 5SY4A 3UHPA 4EWLA 4BJ3A 2VJQA 2C4VA 4F86A 1KK3A 1ML3A 3PUIA 3R7SA 3VPHA 3HB7A 2ET6A 4C3VA 3KWMA 4B6JA 1Y81A 4EYKA 5CAEA 2PWAA 1W4ZA 3E05A 3GZNB 1MO4A 1WDTA 4LOJA 3WHPA 4BXOA 3CO5A 4C6TB 1TK2A 4P53A 2IIQA 5K0SA 4W1SA 1V45E 5JS1A 1ILWA 1LTQA 3DVSX 2Y1WA 4KC0A 3ROEA 2ZTLA 3PQCA 2H2FA 1WVMA 1D2GA 3EF0A 4NCXA 4H3VA 3O38A 3L0YA 2QPTA 4J1NA 4XJXA 1CJMA 3SF8B 2IVFA 4L9RA 5F73A 5ALPA 4BJ5A 3BWMA 2FG7C 2RGAA 4BVBA 4O5OA 4ZZ1A 2G9VA 4GI5A 1SZPA 3M70A 1GT91 2Q0QA 3IRUA 1Y1TA 2REQA 2QX9A 1R6XA 3MF4A 4GX2A 3AM5A 1O7JA 2GN8A 1RU3A 1C3EA 4QBTA 3FTDA 3U9TA 1SXQA 1EG7A 2EQBA 4F93B 2XR1A 2A0XA 2R1VA 1KOFA 3KWJA 1S8NA 3SOPA 1YZTA 2VATA 2CBXA 4X00A 1UMBB 2B82A 1I6MA 3HG7A 4DJJA 1TEXA 2R68A 3EEYA 1ORTA 3WNZA 4R31A 2EHJA 3OFJA 5PNTA 3BDIA 1ZRMA 3ENWA 2YZ2A 2J3EA 1Q7GA 4XPZA 4EMUA 1S02A 1XD2A 2KQUA 5EHQA 1FIUA 4EF6A 1SBZA 4G63A 1KI1A 5BW6B 1YB4A 4DLUA 3A2MA 3K9CA 4X7MA 5IU6A 2VQEB 3PA6A 2GM5A 4N5HX 3ZNPA 3F6BX 2XUHA 4MKFA 1ZUWA 5FWAA 1I2MA 3G88A 5COAA 4D3SA 3A9WA 4R98A 2VP3A 1J56A 2B36A 1A7JA 3P4YA 1VPDA 2WJGA 2O7NA 3LL7A 5CW2A 5ILOA 3P9NA 2PKYX 3I01M 4IV8A 4NV3A 3T3MB 3AP1A 5FFMA 5DZSA 3ROTA 5AVVA 2ZT8A 4ZQGA 3S7TA 4BWVA 1JDSA 2BKEA 2HBYA 1KDVA 3BQMB 4DQVA 1VA4A 4JBYA 4DEVA 5ALQA 1UZAA 5T8KC 3WKBA 1KGDA 4DADA 1TJYA 4GIBA 4NU5A 1J42A 2WD9A 1PJ4A 2SNIE 2X9NA 4K86A 4AWBA 3EXFB 3LNTA 3K1AB 4A2QA 4CTNA 3V8RA 4LV8B 1NXWA 5HF8A 2IGTA 3WYDA 3DF9A 4FIZA 4AF8A 1F38A 1PU2A 1VGRA 1NGSA 1OXSC 1QG4A 1RPAA 2I6FA 2NYAA 1VCMA 3AHIA 4UCXA 3PNQA 4RY9A 4UZFA 4QQRA 3TLYA 1MD9A 3UCFA 1X80B 2IITA 5LP6C 1KH1A 1B4DA 1WW2A 4IO1A 3H16A 3EXHB 3BWBA 4QBHA 3S3TA 2CFRA 2A0YA 4AAYA 3V6LA 4MUIA 4Z54A 1X94A 2QTRA 3VVCA 4P3NA 4Z9FA 4ZVVA 3P2IA 4RNCA 5JZOA 1H65A 3QEJA 2VS1A 4DFDA 3M3DA 3AYZB 1BMTA 4BZPA 5JS6A 1PVVA 1NR1A 2H65A 1LPNA 2DQ4A 3ANSA 3CU5A 4IHAA 1R8JA 4IMIB 4DDKA 1WP9A 1EUZA 4N9QA 1WMAA 1H0HA 1ZVKA 1BHQ1 2NU6A 3VNUA 4IZOA 2HGSA 3UBTA 3MQ4A 2UYHA 1YBVA 4GP7A 1FEZA 1ZBDA 2IPLA 4J2HA 5NULA 5C3MA 4XUEA 4RTJA 3DT9A 4JKOA 1X1BA 4V2UA 2MSEB 1KJJA 3HR8A 2VDNB 1V8PA 1P7YA 3H1TA 5JXHA 1JIJA 1J06A 1G0OA 2XITA 5DDIP 1OZAA 1BXGA 2Y9PB 5KNDD 1G7SA 4NS4A 5DHFA 1XN4A 3VAZA 4QJ3A 5EA2A 1RM0A 4M0DA 2GJSA 1CDOA 2FW9A 4L02A 2NO6A 3ZN2A 4ARZB 2HCFA 5EXTA 1SQFA 1WKCA 5BOVA 3OLYA 3T9EA 2G70A 1DRWA 1XQYA 2OAGA 3MWGA 4FZJA 4IDNA 1FU8A 4Z2AA 4YQYA 1XU9A 2RAVA 4JGGA 4N4AA 4BQIA 5A3RA 1U9JA 3L06A 5IN5A 2A9KA 3INYA 2ZUWA 4BN5A 1V96A 3AFNA 2B37A 2R7KA 3LG2A 4ZIRB 1FYVA 3A4LA 3AT1A 2ESRA 2X2EA 4UNIA 2HMUA 3FYSA 3LT0A 4CKWB 1I7DA 1KYVA 4L73A 4LJ7A 4MR9B 4UBLA 1TO1E 1W36B 1GAQA 3E8XA 1SG0A 3IPRA 1K4KA 1YH3A 1M0SA 1OBCA 2QNIA 3QXGA 5LA6A 4EI8A 2IS2A 2VTBA 4Z4EA 1KMHA 2AS0A 4D96A 2PUJA 2X0KA 3A9VA 3TL6A 5CEJA 5FR2A 4ZQEA 3S8MA 3TRHA 3EUAA 1VJ0A 5IZCC 4ZU1X 1XFAA 2CCKA 3BXOA 3DBHA 1NSFA 4JEHA 2YRFA 4CKZA 3JZAA 3V1LA 5JANA 3HCEA 3GGSA 2JANA 1V95A 1XAGA 2PWBA 4HATA 1ODTC 3B52X 3JQPA 1E7MA 1XHEA 4QYWA 1P91A 1PZGA 2V9PA 1FUKA 3EGDA 3G8CA 4K3UA 2V1UA 3A9SA 1U7OA 1U0SY 1NJ5A 4U7HA 3RE1A 1P31A 2AK2A 4HEHA 1UBGA 3AHGA 1BSVA 2HFJA 2JKYA 3S55A 1K5HA 1BOOA 2Y0CA 2OHJA 4EKYA 4BNIA 4U7DA 4WK2B 4YRRA 3ETGA 2I7VA 1XD8A 3HZRA 3DP9A 1FUIA 1AQLA 4QDUA 5EMHA 5I8PA 4JJIA 4U8GA 2XYQA 5B7PA 1YUBA 4G5QA 2UZ1B 4JX8A 2QRMA 2B99A 4ZO9A 5DTRA 1K8ZB 4JL5A 3HCCA 5CURA 3JD4A 4HD8A 4AZTA 1DKQA 4UBIA 1QLHA 2WIFA 4CQLB 4AFNA 4EATA 1DZIA 5TF0A 3QY9A 5JRJA 2WD8A 1UBJS 3H05A 3WZMA 1GITA 2AR0A 5DNYB 4FQ7A 3ASVA 4AK9A 4P3XA 1UP4A 4X60A 4BFWA 1MVLA 3ZUGA 4H60A 4NCHA 4BMXA 1M8JA 1VRCA 4BNGA 4HRAA 4ZYTA 3CNNA 1KZ6A 2BRUC 2RB4A 5FLYA 1N0VC 3QX3A 3PQ7A 3OX1A 3V8PA 2RONA 4QE3A 1F7VA 3TFWA 4UTNA 1Y4ZA 3FJOA 3E1GA 4ZHQA 1IHOA 2P5UA 4ACBA 4X54A 3UAOA 4PXAA 3UV7A 5BQFA 2EFCB 1W4RA 2RAUA 1IMOA 1XTUA 1KSJA 2AZMA 2F43B 1V4BA 4JL8A 2OYCA 5G40A 1NNI1 1J9ZA 1CP2A 1JW9B 3G9XA 4PRZA 4AZSA 2I6QA 4ZZ0A 1CX9B 3DSRA 2AD5A 4YPVA 1JDJA 3V4PB 3NHBA 4PHTA 1NC3A 4TXHA 3VU9A 1N75A 3PC2A 3B60A 2ZZKA 2ALJA 2O2XA 5IAGA 4UM8B 3COVA 4LOKA 5BQ5A 3TJZA 2Q1WA 4P4GA 1FFDA 4JKIA 4BFXA 1E4YA 3HBNA 4I9GA 3JQ7B 2O8EB 4N12A 4ARAA 3VVBA 4ALKA 4Q9JA 4DR1B 4Q4AB 5AKYA 4AS1A 1V16A 2ARKA 3E2IA 1PEYA 3WQQA 1Z5GA 1G21B 4HF7A 2Q5CA 3ODPA 4HQKA 2RC5A 3D8TA 3VU8A 2WP8J 4EZIA 1NFRA 1PS8A 1IB0A 3NGLA 3VPSA 3AVTA 2BV3A 3QUQA 5IMBA 1QMPA 4G41A 2UUBB 1CRWG 2W90A 4UMFA 3IAAA 1NVDA 5K3DA 3IR5A 5CDFA 5EIWA 3T7JA 4DEYA 2GTHA 1YI8A 4RYDA 3HCOA 4PQFA 1G4AE 1L5RA 1DCFA 2JCSA 1FDRA 4NJOA 4LJRA 4FHDA 2GK6A 1O6FA 5FWXA 2NXNA 2FGKA 2PFKA 1EEHA 1U81A 2GYWA 2GHQA 2HDNB 4UM7A 5FNZA 3DMPA 5AJVB 1GUYA 3M9XA 3B8HA 3M6LA 1DC8A 4HDAA 4OPMA 3WRXC 4YCMA 1NY5A 4M9CA 4PGGA 4IJVA 5DM2A 3V46A 4B4DA 2IYQA 1Y8CA 1Z28A 1EHYA 1S8FA 5TS2A 2PT9A 3AO0B 3EZ6A 4M1QA 1GTMA 2C7GA 4XIYA 4MDHA 4E5NA 2B4QA 5EQJB 3EJWA 4QOSA 2FW1A 3U60B 1ZX1A 5E9JA 5F77A 5K3OA 3AEUB 4YVFA 1JEJA 2ISQA 2QRVA 5DB4A 5HIAA 1J1ZA 3K7EA 3OZFA 1UT6A 3CJTA 4XWOA 1WZUA 1VL5A 2UUOA 1QQ5A 2V5AA 4PG7A 2MINA 4DSNA 5A02A 4M0CA 4B8YA 4GGOA 1K0FA 3KQOA 3I4CA 1EUYA 2QN9A 1M2VB 5I9MA 5DBEX 4YV1A 1NVVR 1J25A 2AFIB 4U4AA 3L6UA 3QE2A 1XHLA 3NWJA 1QFMA 3WXBA 5GZ1A 2B6NA 4JSTA 1TLFA 4TOIA 1HYHA 4GPEA 3WK6A 4A2PA 4XTCS 4YJGA 4D4IA 4QYIB 4HNAA 1F8UA 1GQRA 2V6FA 4HUTA 3E7XA 3WG9A 1J0AA 4WCVA 3WLIA 2VJOA 4OYRA 4QRHA 3W9SA 2FMKA 2HWWA 4LI0A 3MIIA 2AJ8A 3ZCVA 4XEUA 1U0BB 1F17A 1NMZA 2BF7A 4QPNA 1X2EA 5IJXA 2LTAA 2XWQA 5MN4A 3QIVA 1WPQA 2IYSA 2ON6A 3WFZA 1QNLA 3DFKA 3DLBA 1HTTA 2WT9A 3CTMA 1QQAA 1ACLA 2N46A 1YSCA 4IYRA 3SE0A 4C4AA 5BNIA 3KTAA 2YJGA 4KWCA 4TKVB 4M1TA 2V4ZA 3ONDA 1TT5A 3RRMA 4CWAA 3AVOA 4E88A 5KYXB 5IT4A 3WLEA 2R8YA 3QLTA 3GYBA 4I7EA 1A9PA 1CU1A 2EJWA 4D8YA 2KJQA 4B1FA 2BP7B 5CYPA 4MTLA 5AK6A 2X8WA 4Q5IA 3OQBA 4IDAA 4BASA 1WOMA 3GLSA 1BS2A 2P9BA 3UBMA 3GLGB 1XJ0A 2WJZB 2GDZA 3AW8A 3O83A 4JLPA 4AJ1A 1FYFA 4ZI7A 1Q0QA 1C3OA 4MWZA 4D6YA 1GU7A 1Z6YA 1RHUA 1THZA 1YIDA 4MGHA 3FFAA 3QUTA 1KERA 1YFZA 2JLAA 2ST1A 3IKJA 3WKEA 2I4IA 2H3EA 1N5MA 3G59A 5C80A 3EQ6A 3H7IA 3SVLA 4I8XA 2XRFA 5CVCA 2IXTA 1FP7A 3BAZA 2ID7A 4Y9UA 2GQ0A 3DUWA 4W5TA 2HHCA 2DG2A 3OJWA 2LCQA 4Q3DA 2H63A 4CV2A 3OTGA 1KF0A 1SRRA 4LVCA 2ZSFA 4BUJA 2DWUA 1OX5A 3LC2O 4GLOA 4WOKA 1CNMA 5BV7A 1UODA 4LE0A 1KNQA 3TQQA 4RPJA 3R9XB 1GLNA 4C7OA 3ZIUA 5K6AC 3FOWA 1SHUX 1OYVA 3HJNA 3OEED 5A2GA 2WAMA 2X7XA 4IGAA 4KKXB 3D7MA 5AHRA 2H4JA 3SYMA 1ZVJA 4RKQA 3RYFB 4RMNA 4M9ZA 1F4LA 1RQ7A 1UJ5A 1K6EA 2C58A 3C43A 3N8GA 1PV1A 2IT1A 2OVBA 2BAGA 1C1DB 3I5YA 1CB7A 3T7RA 2F1IA 5G0VA 1ADBA 4R8VA 2BOVA 1DOAA 2OA0A 5IK2D 4BPBA 5K0CA 5JH7A 3LUGA 4CIWA 1F1BA 4RKWA 4L76A 1SOVA 1QPGA 3IXQA 4LHEA 4QFDA 3AEQB 1WDMA 4QTXA 3MT0A 1K6IA 1UDBA 2BGWA 2F7SA 3ZCSA 1TQHA 3MELA 4OYLA 1S7GA 1ZUHA 5SV2A 4C6SA 3HR7A 4IIJA 4XD7D 3RI3A 1LLQA 1U0TA 4H08A 5FYQA 1CUIA 1QHGA 5JZMA 2ZJ0A 2A35A 2WWGA 4EY5A 2JJYA 3H4IA 4TMKA 5IKEA 4J3NA 4F9EA 4OSOA 5K0LA 4D9IA 1UH5A 1UK6A 4KGDA 5DGHA 5T6MA 3SDSA 4DLTA 4BO7A 1CUUA 3DF7A 3MMNA 3KKKA 5AKGA 1E1LA 1LS1A 2PNFA 1ISGA 2I0FA 4KZKA 2OBFA 5TEWA 3UG7A 4P0PB 4B3XA 2PQMA 2OFFA 1JYEA 1WUIS 3LDGA 1NSTA 5B6JA 4P22A 1WWKA 1C30B 3I8SA 3OIWA 1EAYA 1WLYA 3GEIA 4PU0A 1V1RA 1C81A 1YI0A 5BR8B 4BAZA 3OT1B 4CVNA 3PGVA 4PLCA 4D9BA 1RM3A 2OD9A 4TQUS 1W52X 4HH0A 3PVZA 3RSZA 3HBMA 3Q9LA 3QU2A 4O8ZA 2EWVA 1CQIB 4N3GA 4ZXFA 1FS4A 2GETA 4LOAA 2WG0A 8ABPA 3DM5A 3EWNA 4EI9A 4PHHA 2EHDA 1VE1A 3OZUA 3F8WA 5IVDA 1Z17A 1JEYB 1W0JA 4AZ0A 1DC4A 4DF3A 1KVUA 4JJEA 4HX2A 2VHTA 2B2NA 3LQFA 4EO7A 1GZSA 1G8FA 1WTCA 2YWXA 1H6CA 3O8OB 4LXTA 2FDRA 3VR5D 2PUAA 4URVR 3RC3A 1QYRA 3WWCA 4CL2A 3U6KA 1XQ9A 3R5KA 4XSHA 5BYBA 4PSVA 5CDGA 5IT5A 3SHQA 4JUDX 1XP8A 3H5LA 4BO1A 5EHXA 4KPEC 1II0A 4OTZA 1Y3IA 2XYRA 1F9AA 1M6HA 3ZVKA 3UYLA 2NVUB 3IOEA 2C4KA 1W76A 2OD2A 2Q99A 3QJ5A 3REGA 5IBPA 4NYIQ 1SK9A 3TZHA 5BN5A 2FR0A 3TDKA 3KL4A 2I9PA 5K8IA 2V55B 3MG9A 2J5RA 4CTJA 4NESA 1KO1A 2GKOA 2WK1A 1Z7YA 1NP3A 3BQ9A 4JHLA 1JHRA 1QVWA 2JA2A 3FJ1A 4Q1VA 3PGA1 2XW6A 4XWWA 4KOEC 5B12A 1QV7A 3IQXA 3NWOA 1U0NA 1IEWA 2FRVA 2OCAA 2BM8A 2GN2A 3HJUA 3IUPA 4Z3OA 3SDBA 4V1CI 1Y5MA 3FNEA 3T61A 1AGXA 1RVV1 3T1TA 4IW3B 2BFCA 5AI0A 3CXRA 2P2YA 4D82A 3MUEA 9LDBA 4CLOB 2W6QA 3DEHA 1KO7A 3PYMA 1IPHA 1G20B 2JKVA 2BFEB 2V8OA 4I4TA 2PVPA 3R7LA 3DB2A 4P0QB 4XH9B 3G2IA 3GG9A 2JLYA 1PT5A 5DNCA 3NONA 2JLXA 1NI4B 4YP7A 3RKRA 4OFZA 4UBMA 4TS9A 5SYMA 2DLDA 1KQPA 5L6LB 4DPKA 3GVHA 3UFXB 2P5YA 5KO2A 3T3GA 2YFQA 3I64A 4U7PB 3GDGA 4K9PA 4NENB 4CT0A 1CJSA 5JROA 1JAYA 3SVZA 3T1QA 4DCUA 4MJ3A 4I5GA 3MD9A 4M8KA 2E87A 4BFVA 3GAZA 2JB9A 4CU5A 5A06A 2D0PB 5BNFA 1B8OA 5BYJA 2F55A 3M49A 7GPBA 4IX1A 4ZAYA 4ZYVA 3G2LA 5J2UF 3RIEA 1IULA 1ELOA 3G8YA 1TD1A 5I3CA 3I45A 2CHUA 3N0TA 1S2OA 4ESVA 1AUQA 3KAKA 3IEVA 2G6BA 2PEZA 3OKFA 4F04A 2YUIA 2QQGA 5LKAA 1NAIA 2Z5GA 2W2PA 2CMKA 4Q9HA 3ZH2A 1ZNQO 3WOHA 4AMVA 4ZFNA 1I94B 1L8QA 2QLFA 2UZ3A 3MCWA 3FLEA 2GCPA 1HZZA 3ZBPA 1PW5A 3V7YA 2CLHB 1P1FA 4RJKA 1A95A 1EDBA 1QZZA 1Z13A 2R6FA 1QUEA 2ROQA 1II9A 3D4NA 4HCJA 1NMSA 3IVCA 5HMMA 3GD5A 2XWSA 2C9BA 5H70A 3X2SA 2HJHA 2G6TA 3G13A 3NLLA 4K9KA 5CNMA 5K3EA 5AVSA 4OLHA 4JR2A 1XMQB 4NMWA 4RV5A 1GT6A 4XQEA 1H3NA 3EIEA 4DA6A 5CCXA 4GZ5A 1XLTC 3CEMA 3Q8WA 4DSZA 4F0JA 2I7DA 2OD7A 3IV6A 1LPPA 3K9HA 4GL2A 4BFZA 3PDHA 1CUBA 3JSAA 1IJBA 1R15A 2NV6A 2R4QA 4EO9A 2FN9A 3JRNA 3HH8A 4IEIA 2GR9A 1Y3AA 4HN9A 4TVOA 3EVZA 4P5PA 4B85A 4CMIA 1UPFA 4C7XA 4YBRA 3SQLA 2PUWA 1L4EA 1QVAA 1J2RA 1QZ3A 3AB7A 4KXWA 5KX5B 3EHEA 1VHJA 2DH6A 5KTSA 2JBWA 4JS0A 4XAQA 3PXDA 2CK3A 2BF4A 4P0TA 3DW1X 5EERA 1G64A 3OZTA 4GBED 3M4JA 1IZ8A 4WBNA 1JRLA 2C57A 1JFTA 1VCNA 4GDFA 2P2NA 4GMGA 2RHMA 2UV8A 5BW8A 3GEHA 4QPPA 2XGGA 1MIOB 4UQLA 2OY0A 1RAHA 4LJLA 4HAVA 5IK2A 1MQSA 1P18A 3C70A 4FUQA 4C4YA 4AT1A 3FHCB 4X41A 2YN2A 3C3PA 4E2FA 5KKNB 5D6NA 1P0MA 1JLHA 4QWMA 4ZA2A 2VRCD 3ZV4A 3G17A 3ZX5A 3W06A 4YUAA 3T5PA 5E8RA 1KAMA 4Z7JA 1KOLA 3OMWA 4R1TA 1EK1A 4U9IS 4XD7A 5BW5A 2F4VB 4U39A 4G1CA 2GHTA 1ZJYA 4MNTA 4Y8VA 3P19A 1W5TA 1XLVA 3Q98A 4PPFA 4QVKA 1ICIA 2GA9A 1E7QA 1WY5A 2O52A 3LX5A 3CHYA 5C31A 2I29A 1ZD1A 2XZDA 2Z2JA 5BRNA 2C8VA 3FZGA 4WH0A 1NQVA 2F00A 1VYUA 2HJWA 1GQSA 1C80A 3O47A 2AG8A 4IPTA 5EIBD 4MDEA 4ZYYA 4HNTA 1J1UA 5BMVB 1YDHA 4NECA 2YW9A 4Q1FA 3T41A 1AUPA 1C7FA 1T8RA 3GC6A 4MP8A 4BGUA 4ZCTA 4LFAB 3V7WA 3L0IB 4OK6A 3UGKA 4F3CA 1RCFA 1WD5A 4MRAA 1XLUA 5EHZA 3T5DA 2ZR8A 4I99A 1L7MA 2ZT5A 3DMTA 1EZZA 1C8VB 2G9QA 2QV7A 3QUCA 5EG5A 1GA6A 1I4LD 3F5FA 3JYLA 5FUYA 5AM1A 1QM5A 2HRDA 5A3SA 1A9XA 3FHOA 5AW5A 3HC7A 3WKDA 1TCCA 1UBKS 2PSJA 2GSDA 4IDEA 3HY3A 3QNUA 3TZLA 2O8NA 3KE9A 3FRHA 4ND8A 1T5TA 3E9ZA 2IS1A 1XZFA 3K9WA 2QSJA 3LT1A 5CK5A 4YC7A 1MG5A 3CH4B 5TPWA 5KQRA 4YT8A 4WCFA 4NYMR 3TL2A 2C8LA 3CVJA 5H9VA 5HIMA 2H3HA 2J3DA 3UG6A 2G1PA 1P2TA 3ZIDA 3VR5A 2GNOA 4L4RA 4C0JA 4DCMA 3SAJA 5ADUS 1KY3A 3UY4A 1T2AA 1LVHA 5T64A 1G8SA 2VR1A 1GQQA 1WAMA 5HILA 1BCRB 4LVNA 4HV4A 3IKLA 1EX7A 4B71A 5TE9A 5MN6A 3PEWA 2V03A 3JWPA 3CX3A 3HDGA 1XDDA 2FSVC 4RD0A 1BW9A 2J33A 4FK8A 2V7TA 3I9V1 2QRZA 1P0FA 2QAGB 5L45A 3B1VA 5E1OA 5TQ0B 4DTCA 3OP4A 3PC7A 4PCLA 4Y2JA 3ZPXA 2H4FA 3T9DA 1JGTA 5JCXA 3BX1A 5JCZA 2FWMX 3COZA 2JCGA 3HY4A 3QEMA 2FOXA 5EZSA 1EIWA 5HFNA 4HAIA 2XPCA 4Z8XA 4ESOA 1C29B 1E1NA 1E6MA 1I13A 4GR9A 3MK31 4LGYA 5AKJA 1T2VA 2ABWA 5LOVA 3UOAB 3UMMA 3LHSA 3LP5A 4BMSA 3BCRA 1OIWA 1I4TD 5CJ2A 5JALA 1V5IA 2CJPA 2VZLA 3GRFA 4P4NA 4CUKA 4LOIA 4JJ6A 4CV3A 4KIFA 4QOFA 4B35A 3OEYA 3M82A 2DECA 2JA1A 5FHRA 4ZRDA 4R5MA 3BRSA 1KORA 1CS4C 3QEOA 4W9NA 4B09A 3FOFC 5LQAA 4CL8A 5HSGA 2BGIA 2ZKIA 4M6WA 4WLVA 1V2GA 1XTBA 3ETEA 4M0KA 2JLZA 1MF7A 1Y3DE 4MWEA 5EHIA 3SYNA 4CM8B 1CLEA 3HJGA 3TPFA 3L05A 5FH9A 2XZOA 3HM9A 5D7BA 3FPSA 3IVMA 3OTQA 5AJUA 3T5MA 4N8SA 3PNKA 3B1JA 4QODA 3ILVA 1ZR2A 4GHWA 3KJIA 1Q44A 2ZSIA 4N0PA 4P2BA 5JTUA 1JVSA 3VR0A 1D2NA 2IYYA 4N6GA 1J5EB 3MTBA 2J46A 3KS9A 4RH3A 3ZHYA 1IVSA 2UZIR 1E59A 1ML4A 3NEYA 3TZBA 2CV1A 2HF7A 1HF3A 1Z6GA 3U1TA 5AFSA 4ARCA 2V0NA 3QF4A 1XZJA 2PCLA 2O1EA 5DNEA 4EJFA 5H4GA 7REQB 4DMGA 5LYJA 3BXGA 3VR1A 2PRIA 2YR0A 3N6VA 4Z0TA 3KIPA 3RSGA 3ZCXA 5C7OO 1Q3KA 3R7WB 4OMFG 2RGYA 1I10A 1U3UA 3AZOA 3NFRA 4KO4S 4BKMA 4LBZA 3CNLA 1GR0A 3VGJA 3AI7A 1OFGA 4GECA 5F9FA 2GA8A 1KI6B 3P2OA 3A3KA 4F71A 2R8OA 2APJA 3KQQA 3ZE7A 1PWXA 4TGLA 5DHAA 1XZPA 2C3PA 4WZAB 3W2EA 3AB3A 4IF4A 2C5EA 3A27A 2JVIA 4L9SA 5CHEA 3KEMA 3L6CA 3V6MA 3R23A 1UBUS 1WV1A 3L84A 5L7TA 4WXEA 4BBPA 5U4XA 5BT9A 4D3FA 4OV6B 1ISSA 3UWKA 5ABPA 5AO9A 4P84A 1QOZA 2CBZA 2WYIA 3MN1A 2YXDA 4M8LA 4YPFA 1COWD 1RW4A 4DCSA 1HFJA 1KHHA 3B3GA 4MV7A 1FFHA 3UOGA 1KTVA 1FQKA 3KDAA 3K53A 5J63A 1JDPA 1KBOA 3WRYA 2W9XA 4FJ1A 5FI5A 1A82A 1RQXA 5AKLA 4D9KA 5KYYB 2HA5A 5HF5A 3WYFA 2PLNA 2RGCA 4J4HA 2F3SA 1G5RA 1LSUA 1YRWA 2EWMA 3M5CA 2IZ5A 1ZCFA 2F6RA 1U0EA 1FTWA 4FCTA 4HS9A 2VWHA 1ATZA 1RI1A 1T5SA 2C29D 3PLNA 5FOXA 5DX1A 2JGNA 3CT4A 3P9YA 2QTFA 3OF3A 4IF6A 2VXCA 3USZA 4NBUA 4YI3A 2W71A 4GW3A 1XTVA 2OKCA 1BTOA 5D01A 1W581 3GNLA 5IF3A 2XVXA 3Q7RA 5JY1A 1SIOA 5GGYA 4AW9A 2QUIA 3NHYA 4U0KA 5ALDA 3STWA 8GPBA 1FW6A 3H9CA 3AKCA 2X8JA 4O4LF 1JTEA 4OX9B 4CEIB 4JBLA 4FMBB 1EFUA 3B1FA 1U3TA 3WLJA 1G6OA 1IRIA 1A88A 3W2IA 3FTPA 2PXCA 2GBGA 2X15A 2ATCA 2QTMA 5L3VA 3GEMA 4LY0A 4PIPA 4DJDC 1T35A 5FAKA 5JMTA 1T3HA 4Y6RA 2NO4A 4WE3A 3DTNA 3TTVA 1IN6A 2FFAA 2VRCA 3OTHA 2VTDA 2OCPA 5FEMA 1DGQA 5E2IA 4BO6A 1INLA 2IH2A 4J94A 3R5HA 1LX7A 1OV4A 3VC7A 4QZVA 5JQGB 3MTQA 4DHEA 3IL2A 3O1LA 1EB8A 4FEEA 1E2EA 4UTZA 3M2PA 1LWNA 2I7TA 1GRVA 2N3ZA 1QH8A 2QRGA 2J4CA 3ZWQA 5DLPA 1LY1A 1UMCA 3DUFA 2IIPA 1XDUA 3OZGA 4EG0A 2AMYA 5LMCA 1YO6A 2AOTB 3KV1A 5IH3A 1Y9EA 4MKHA 4AX8A 3PHJA 2EZTA 3L7KA 2POQX 3LVFO 3PF9A 4JFRA 5BRJA 1NNUA 1B0UA 3LBYA 3V2GA 4MW0A 3DQPA 2WF7A 2VA8A 2VHXA 5EIXA 2D1FA 3HY6A 1H5NA 2WF5A 4ETWA 4V38A 1P9WA 1LLUA 3B2EA 5F2KA 2NUPB 2H2GA 4FMPA 4CLEA 4X1YB 1DPGA 2COKA 2FPSA 2DKOA 2QTVA 4HMQA 2PX2A 5F12A 2DCUA 4NV1A 3RYCA 1JIXA 2W6JD 2V0GA 3QXSA 4MPTA 5EXXA 3AJAA 3FBGA 3NM6B 3Q3JB 2WHRA 1UM9A 2V8BA 1IRXA 1GFIA 2VHZA 3A1DA 2Z2IA 3KUDA 3RJZA 4KI0A 2WDZA 5C8VA 2R6AA 2VJYA 5CXXA 4AJEA 4W5OA 2O5VA 3R6TA 4R8MA 4JYMA 4F6RB 1V11A 4BX3A 3PX7A 3TDNA 4JVMA 1Z45A 3X2EA 4BMOB 1EFTA 1OMOA 4AZWA 4DY6A 2Y1GA 5HKBA 1Q50A 2ATEA 3ZV3A 4F2PA 4ECAA 3FYDA 1YC2A 3O93A 1HM5A 1RI4A 1Y4UA 1OI2A 1NQ5A 1X38A 2YUTA 3LPMA 2RGGA 3QMMA 5FDFA 2WAYA 2XAAA 3GUCA 2K4MA 3LA6A 5YASA 1G6Q1 2XMRA 3SOZA 4IOJA 1J70A 1Z18A 2C99A 1JU9A 3ZLBA 5TLSA 2J5QA 4URHA 3PL1A 1UZNA 2GD6A 1YB2A 3D4LA 4F4DA 9GPBA 1RXVA 2VQDA 2Z6VA 2PAFA 1FJHA 3LKZA 2P4UA 3MSXA 3NOQA 2WIJA 4R0VA 4BYGA 2DPGA 4HPWA 4S2EA 5EKUA 1B43A 1RNLA 3JQ9C 3O4FA 4LRYA 1K2WA 3SC3A 5BOSA 3ZDAA 1SWVA 3HEMA 3TVDA 2AMFA 2XKBA 1I4DD 2GKSA 2JFNA 1VSQA 3NJ8A 3THSA 5B36A 2WHXA 4YECA 2BFFA 4N9WA 4DMMA 2D3WA 2IPNA 4QO7A 4WLOA 4IDOA 3GY0A 2O3UA 4J0HA 4BV9A 4ROSA 5B6PA 5D3QA 3TXYA 1T25A 2ZE7A 5IKMA 2XTNA 1AM4D 1P6QA 4DNXA 4ZVPA 2ZIVB 4RESA 2BGMA 3A8TA 2ERYA 2R1UA 3PHCA 1V6SA 1HE8B 2ZRCA 1RBZA 4FHGA 4KAFA 5DK4A 4C7BA 1C1YA 4OVKA 4F72A 3IPLA 1N34B 1FQJA 3I4LA 4I5FA 4CTMA 4OL9A 3PXEA 3DCYA 5ALKA 4KMRA 4IXMA 3UT5A 2J4FA 1T2EA 1QCCA 2EX1A 3QGMA 4E6PA 1H4VB 3TUZC 1CXZA 5KOYA 1C4KA 1PTJA 4NMMA 2ZAMA 4KNVA 3VNBA 1J33A 4FNAA 4GE3A 4OHPA 1NU6A 3TD6A 3VSBA 4WNAA 3SJBA 1WJGA 4QOGA 3VPAA 2JASA 2YFYA 3NFYA 3GEGA 4LW8A 4P5EA 2AJBA 3RIHA 2KHZA 4YJHB 1PZFA 1W5FA 3DFZA 3RS8A 4A4DA 4AU1A 3CQ9A 3T12A 3FNHA 3L6OO 1L7OA 2R6DA 4WWHA 1QDUA 4CLRB 4PAGA 4LMBA 3BFKA 4GI2A 4KREA 3UJNA 3FGPA 1OQAA 2QW0X 5ALLA 4I9HA 2VDRB 2XYHA 4M1SA 4AMBA 4J0JA 4KQCA 1Y5LA 5EYPA 3GLHE 3CVYA 4ZEMA 4M89A 1O57A 3SX0A 4X66B 2GXUA 2MR5A 1RQLA 2COEA 3HCWA 1Y6QA 2P77A 3ZDEA 5IJ9B 2GRAA 2JAWA 1LW7A 3I8OA 4B7CA 1A5BB 1TDJA 2GX6A 4KGVA 2VPYA 4D8TA 3HKBA 1G7TA 1V8OA 1NQWA 7MHTA 1PJBA 1M8PA 2I33A 2PJZA 2RSLA 2ZKLA 3ASYA 3ZJ5A 2QUBA 4D98A 1BDHA 2C5GA 4ZO8A 4Q4DA 4JI6B 2QGZA 3VR2D 1CKEA 2H5EA 4ISBA 5HEKA 4TV8B 2ILVA 2QD5A 3D6FA 3QV2A 3RVLA 5K1ZA 4RETA 3TJRA 1QRDA 1W6UA 2BR5A 3K35A 4U3JA 2OBMA 4XLZA 5CH8A 1QK5A 3TOZA 3HUFA 4R8RA 3L1KA 5K4GA 2OGTA 3BFJA 3AKYA 5IHPA 1ZIXA 4RKEA 1TM1E 2PO7A 4QDXA 2HBQA 1D1PA 2Y05A 1K75A 2BBTA 1FX0B 1H5QA 1GVHA 3H2JA 3G02A 3RRYA 2CFTA 4X6YA 4ZK2A 1FOEB 2ZRPA 3IVXA 4RPIA 1IY9A 2P3LA 2O0MA 2AOWA 2OV4A 3C3CA 2NT3A 2GN1A 2ZP1A 2WIBA 4YAJA 1IPFA 4K28A 5IM4F 4G01B 3H5WA 3TIVA 4Q3KA 4J43A 4PLYA 3WK9A 3GCWA 4E07A 2V4MA 4M36A 1A1VA 2LIVA 5CYFA 3GROA 4QU8A 5THKA 3U3MA 1R0KA 2ZCJA 2IPMA 1XQ6A 1E1QD 2XDAA 3RRNA 1P2BA 2V7UA 2AMLA 3LE8A 4B0OA 4DNFA 1APBA 2ECPA 3N7TA 3DL4A 1NVUQ 4URXR 4M46A 1TUEA 1QR6A 6NULA 3BZUA 3SR3A 1FP2A 3PJGA 2Q6VA 2O0JA 5EIHA 2W8BB 1NVXQ 4M76B 3D8BA 2PUCA 1JHUA 2TMKA 3FRIA 3H42B 4O2BB 1C0PA 5DHPA 4OGKA 4XB1A 4D8XA 5LYYA 1CZUA 3KYIB 1P7VA 3PNSA 5C8YB 2BPOA 3N2NA 5JMPA 1U7XA 2HSZA 2Q3BA 5BUZA 5JJIA 3F71A 1N5LA 2VBGA 1RAIA 3B7GA 3BB4A 5DW3A 5EXEA 2CDCA 3I1JA 3DWFA 1E18A 1T3GA 1URPA 2HU8A 1S2DA 3HU2A 5DT9A 1Z5UA 1ZCAA 3KKQA 3WLSA 5BVHA 4YDQA 2BSQA 4HQ6A 5JY6A 2X76A 3RVSA 1GNPA 3LCUA 3IE2A 1CR4A 3QX7A 5JJKA 1A8UA 3F73A 3HKDB 3I09A 5I9BA 1SVKA 4P38A 3I9OA 4I6EA 2GB4A 4KX3A 4RSHA 2JGEA 1DHTA 1CEEA 3ZVLA 2XIJA 2ZIFA 4OCZA 1HEIA 3D59A 3D0RA 4YCCA 1DKUA 1S3FA 3F46A 1E5QA 4RMGA 2H5JA 2BSAA 1CQXA 3PFFA 1TZBA 1EM6A 4H7DA 2C2XA 1R0BA 3HJBA 3K15A 2YVUA 4IDQA 4TUYA 1Z0IA 4M1OA 1RKBA 4P3OA 1R0WA 2F59A 2XUQA 1RJ9B 1OILA 2J59A 5AHWA 1QOPB 5F76A 4CG2A 1ZL2A 2VPWA 3O8DA 1NYQA 2XE6A 5BV1A 1JL3A 1YR6A 2I8AA 3ACBA 3HWWA 3KOYA 4HNSA 5A0FA 1L8AA 3QOFA 1EG2A 2PVSA 2B61A 5LDGA 3I2FA 1A8IA 5J5CA 4BE4A 2ZBQA 1TZ2A 4UM5A 1N5OX 3A36A 5JJLA 1T2FA 1XD9A 4HUQB 2RHRA 2XA9A 1JS1X 1V5EA 3J7TA 4QUBA 3KT0A 4RGYA 3BXEA 4A8HA 2JNWA 3LBFA 1HNZB 3I6ZA 3AI3A 2WVJA 3LVQE 1JPNA 3JALA 4DXAA 3U19A 4KR0A 4A6EA 4YASA 1L5MA 4XTRA 3CXUA 4TLCA 1SUSA 1M0TA 4CKXA 2FVYA 3QVLA 3REQA 1RLMA 4GKJB 2ORVA 1DAFA 3IVAA 2D2XA 1CT9A 2I3ZA 3EUWA 3EH2A 1SY7A 3V2IA 1K86A 1O96A 3PWSA 1KVSA 4CMEC 1USKA 2C03A 4HDNA 4MCAA 3RR2A 5J5AA 1QORA 2ZBPA 3VISA 5A7FA 1QLJA 3A58B 2BHSA 1KYIA 3Q7QA 4WNYA 2DT5A 4F2GA 4QC2A 3GBSA 3HBJA 1IYZA 2O20A 1ZS9A 3TLZA 4H1TA 1FSSA 4ZREA 4ASUD 2IIVA 3ZK8A 3CLKA 4U0JA 1DAIA 2PSHA 1SFRA 1U28A 3DPSA 5BWOA 2R5WA 1SUAA 2WY2D 3LUDA 3CVUA 4M7PA 5DNVA 2G9NA 2WUDA 3BAFA 2R60A 4GPBA 4PZZA 1H2RS 3RT1A 5HTOA 3VBEA 1A69A 5A3QA 1R4NB 4O4JB 5AH0A 1WXFA 3ITEA 4JA2A 3ZE9A 5IF9A 4E5KA 1PVOA 2VIIA 3L18A 4RWZA 3EFEA 4KQ1A 1VLJA 1RRKA 1S2LA 3PFBA 4JJ4A 2OB2A 4QOIA 4UULA 3NGMA 1UC4B 4ZCSA 3U81A 3IEMA 4QYXA 4LHWA 1GA1A 3PJEA 4ND7A 3ZD6A 4D3YA 3EPKA 3Q3GE 3EOBI 3GW8A 4HNVA 5HXAA 1TK3A 2BFBA 3AP3A 2XBMA 1HYGA 3DMYA 5HKAA 3W04A 2PXXA 1KS2A 2CDBA 2GTPA 1XTSA 3ZU2A 1Y1QA 4G0MA 1YS9A 3JQAB 2CXNA 3S6JA 4E1VA 3ANNA 1NI3A 4KFSA 3EZLA 5CT9A 1WMFA 3EYWA 5AR1A 1ZJ6A 1I5RA 2JGDA 4C4SA 3HFJA 2P91A 3D3QA 1GV0A 1JIVA 3VJRA 1QYWA 5LLSA 1V37A 3BYZA 1QIFA 1YQUA 3W1WA 1NVTA 4YJ2F 5K3FB 3WZLA 4G89A 4YRIA 1RLTA 2P67A 2E89A 3GFVA 1FU7A 1Z06A 4OB6A 3PTZA 4M7OA 5JJCA 4R83A 2QSYA 3FM9A 4O63O 1GKYA 5FBKA 4EZEA 1RRMA 3BMOA 1GRCA 4AN1A 1X13A 3WMFA 7MDHA 3L7CA 4TWIA 3FF1A 4WVFA 3TCNA 3EZYA 5EKXA 4DLZA 2WMOB 3NXSA 1JTFA 3OPNA 1G5PA 1Q0RA 3DBRA 3PP8A 5IG2A 2C82A 1JJIA 3MB5A 5FBHA 3TMAA 3VR2A 4TQ9A 4FVTA 2Z0MA 2ZTVA 5TY0A 4ITVA 2XBUA 1L5OA 4MR8B 5D87A 1NIJA 5EP3A 4EJSB 4N5DA 4ZVKA 2GN6A 3GA7A 2ZAYA 4LYGA 4OF4A 1HE5A 2FW0A 5L3QA 5BMOA 2YMQA 1E2PA 2DUWA 1T4CB 5LLTA 1N32B 4MV4A 4UZEA 1P9NA 1E61A 3ED1A 3BXFA 3KV3O 3R9IA 2ZWPA 1R5NA 1IH8A 1A7KA 4K5QA 1YB1A 5EFZA 1R37A 4KR9A 3KELA 2A7XA 2W2QA 3BJMA 4G2NA 4BWGA 5A4FS 5A7GA 3DDUA 1YS4A 1II8B 4FI3F 3VNVA 3TTYA 1RSZA 3IPXA 3EZGA 3Q87B 2OV8A 4I1IA 5SYAA 2NOAA 4Q1CA 4C06A 1A1SA 1FW8A 1AGPA 5FPKA 1A96A 3ZWOA 1RWXA 2FH5B 3CN7A 4WECA 5CXQA 2C77A 4L5IA 1L4FA 3E23A 1QYXA 4EUHA 1E1QA 1F6BA 1FNCA 2QB5A 4JR0A 4TL7A 3OE1A 4J29A 3UK6A 1WBBA 2XTZA 5TARA 3QQPA 3D9QX 2PMCA 3DDNA 1Q1QA 3V8BA 2WR8A 3JQGA 4J9VA 1FFXA 1U8UA 5JI2E 1NLYA 2GCOB 1HKHA 4HO1X 2HA3A 4JLJA 3LXMA 3HYLA 2XT6A 1G3RA 1QBKC 1TU0A 2OAP1 1TYDE 1K8QA 1TIKA 1ZU5A 4PE5B 2AFIE 2GF2A 5C5CA 1UBMS 4OIMA 3UMYA 1DRJA 1TMKA 1EFPA 5LNK6 4BNVA 2D2VA 4HEQA 4IJQA 3EULA 3GRKA 3V4RA 2ZIXA 5HNKA 1L3BA 2C83A 1RPZA 2FZKA 3DLAA 1OZHA 3R5XA 3SLKA 5LPNA 1NRIA 2QK4A 1SUDA 2P0YA 3IERA 3GWZA 1N2CE 3MJEA 1O97D 2ZI4A 3IMGA 3ZWXA 4KN8A 5K8UA 2PUDA 1XHFA 1HLFA 4OQ4A 1N1MA 1EE9A 4RZXA 4TLEA 2VP6A 5B4TA 3KT6A 1KS9A 3WY9A 3DDSA 1ZIYA 1NUQA 5IC6A 1G3QA 5MN5A 1AS2A 2GBFA 4O2LA 3TX2A 3THWA 4DUGD 1ZH2A 4B32A 4H4DA 2H29A 3NTQA 4BAGA 1JT2A 4Q3EA 4IDFA 4QDKA 1NUTA 4DV6B 2B1QA 1DCTA 2R8BA 4YDSA 1ULHA 1NNLA 1YR9A 2GD2A 4RVNA 1BN7A 1QDEA 3A1TA 4R7TA 5I9TA 1MB9A 1NVVQ 3KYDB 3ND7A 4Y2UA 3DE1X 2PZMA 2GZSA 2QJTA 4BE9A 4F5DA 4ZGGA 1IN8A 3GPBA 3MVEA 2IP1A 3KT3A 2WJHA 4O1MA 4UU7A 2JHGA 5A5EA 5F7XA 3R6WA 1PWZA 4U2CA 1LBEA 1UBEA 3IQFA 3PVCA 1R64A 2XMZA 3BHJA 3C98A 4HSEA 4RTMA 2RBGA 1N0HA 1D2EA 4PC3A 4E2XA 4LMRA 3D2CA 4RFSA 3R76A 4D9GA 2ZUFA 1E3MA 3A6KA 4RZ2A 1JLSA 4FMDF 4NU8X 1GJRA 3AESB 1YZUA 3ZKAA 4CKCA 1SCIA 2NLOA 4U6NA 2HMYB 2JI6A 4H7JA 2VSXA 4JSRA 2XY4A 5TF4A 3NM5A 1YGPA 3OFND 4NG4A 5LB4A 5KKCA 2BDUA 3HHEA 4H1HA 3MD0A 1U6JA 1UZMA 2EFJA 2K2WA 1VSUA 3FR8A 3PYLA 1XLWA 1G8MA 2F3TA 3LKDA 4M1ZA 2MYPA 2PJRA 2Q5JA 3I83A 4B3IA 3ZI7A 2OP1A 3C3BA 1J2EA 3DDOA 3KTDA 3MLEA 4FGZA 4PNZA 3FB4A 4EA9A 2VAMA 4P34A 2XQGA 5LXTB 4ALJA 1PKEA 1YA6A 3NAQA 4PBRA 2FSSA 4LMAA 2P0AA 4HI0E 3H3JA 2DPYA 4QM6A 4B33A 4LECA 4HH3C 2NYRA 1SXHA 1VBFA 4NBTA 2Y68A 2FFRA 3O2QB 3VPDA 3W6UA 3ICWA 1KO4A 3ZK9A 1YA8A 4ZCQA 3ILXA 5H3HA 4D8UA 1RAEA 2AN3A 4R1OA 4X85A 2B2CA 1DAHA 1FS6A 1NBMD 1CZKA 1WDKA 2CDAA 2NSLA 4BECA 5CTAA 3OI7A 1NBOA 3E3MA 4JLOA 1ILEA 3EARA 1JSZA 2C4WA 3C5HA 1ZRSA 1C1XA 2VL7A 3NVMB 1B8UA 3K5IA 3QG5A 3QLJA 2TYSB 4RCYA 1KKMA 3SJZA 4RJTA 4IHQA 5TPZD 1V7ZA 2AFHE 3V7NA 2WWTA 1XTJA 4TV9F 3J80A 3CF4G 5F1YA 3ICEA 3OLCX 5DHRA 4YONB 2DKNA 1DT5A 4EPTA 2AV6A 1RI3A 3BWYA 5J47A 3IHLA 1UQTA 2HRBA 2FCRA 2WWXA 3DWGA 1JVNA 4YIHA 2JCXA 2A0KA 2C5AA 3HKEA 2PWZA 4AWAA 1LEHA 3PB3A 1QVVA 4YAWA 4PZLA 4TZTA 1WCWA 1GAEO 3AY7A 4HH1A 3FHJA 4R2MA 4ZO4A 1V1JA 4RQTA 3QG1A 1ZM3A 1YCGA 4NVRA 1TW3A 1NG1A 3ELWA 4EHFA 2OBNA 2H4WA 4E11A 2NU9A 2HF9A 3Q0EA 4DA8A 5FTMA 3X1JA 1RMTA 3MMSA 1BWSA 5BQXA 1IHUA 3LBHA 3ZHBA 3R8FA 4OQFA 4TXNA 4FINA 2CVHA 2I22A 4QL3A 2QTTA 2RH5A 4QUIA 5JC8A 3T5CA 1RJWA 3TIXB 2LD4A 5EHNA 2FP4B 3R4CA 3QKWA 3OQMA 3VSCA 3S8YA 5E2AA 1KBQA 4A15A 4HVCA 5KNBD 4K03A 2BMAA 4OA5A 5CK4A 3GR6A 2IHVA 3D8HA 2P1ZA 2V4UA 2Z04A 3K6RA 3OA2A 2SKEA 2VHVA 5EP1A 1FMLA 2BZGA 2EKLA 1T4GA 3C24A 3MAGA 3R6LA 4MW9A 4PG5A 5CB4B 5CDTA 2NO0A 3IOCA 1NKVA 3Q9SA 1D04A 4F9FA 5GWXA 1IM2A 3EXIA 5TT1A 4NAUA 1IUOA 3QVJA 1XXHE 4IIDA 3H83A 4GKKB 3C85A 2QM3A 2ZIEA 3MCAA 5B1YA 1VG1A 3ACCA 3C7CB 3ABOB 1FYXA 3RH0A 2JFGA 3U4QA 2XCLA 3KQVA 3KAJA 4WESB 4WN9A 4Y2XA 5DXJA 3TRIA 3U40A 2GKGA 1FBTA 3A10A 1TQ6A 3A6ZA 1DFIA 4S1PA 4BP8A 1WZ2A 3AINA 1RQRA 5AD1A 4GRAA 4Z5XA 5JEEA 1FNBA 4CN8A 5JISA 4FUTA 5A4IS 4LNUA 7AT1A 2P2LA 4ZT3A 3LP6A 3NZEA 1L2TA 4YWHA 4WJZA 4YCJA 1LDMA 1RRCA 1NNSA 2OBYA 1B15A 1X3LA 1PS9A 2JI9A 1AXEA 3ROGA 1PX0A 2RJNA 4YXWD 2W58A 2Q1UA 1PJCA 2ZATA 4WIAA 3SC4A 1I2BA 2C5FA 4O4HF 1NXOA 4LRSB 1US8B 3H2SA 5ENVA 2EOAA 2K7ZA 3EISA 3LLCA 2V54A 4NDAA 3RUHA 4FNOA 3UMVA 4ZDKA 2NM0A 2IXFA 1SU7A 3BF7A 2BLLA 3GDHA 3SQWA 2I4MA 1IONA 2W2KB 1CDZA 1CY4A 4XJSA 5ALJA 5AW2A 3PQ6A 1FBNA 3C1TA 1GNVA 4PG6A 5B3LA 2ZETA 3ADDA 4J0EA 3KYBA 2QW1A 4L0CA 4MW2A 3H5AA 3ZGLA 1JHVA 1XU4A 3NC0C 4WKNA 4RK6A 4DXHA 1JXOA 4F6CA 2DBYA 2QTNA 3DXXA 4PWZA 1SBTA 1PQPA 1L5SA 4BEJA 4QFMA 5B6IA 4XQ9A 1VI6A 4BKUA 4YHBA 3U13A 1B74A 4NH4A 3A11A 1EFAA 3KXDA 5I4BA 1OLUB 5IASA 4HLNA 2O8CB 3W9BA 2X1VA 4N5NA 1GHTA 2IYLD 3CF4A 5KQMA 1V43A 1NN0A 3DXYA 4KUGA 3UAZA 5JMWA 2FFQA 4LXGA 2WHYA 4NX2A 4R2WA 1Z07A 2L0XA 4F85A 1G8GA 2CD9A 2GMWA 3HK2A 1U5CA 1P17A 3DG9A 3E9CA 4L9WA 4DUGA 2VT3A 1UOOA 3HABA 2MMGA 3PR1A 5HBRA 1KYTA 2NQ8A 3H5NA 4D3DA 4W63A 4PN7A 1IG3A 1FSPA 2PLWA 4GVPA 1NWHA 2QXUA 1BFDA 1KR2A 2XZTA 3E7DA 4R9RA 3SZMA 4EJSC 2XXAA 4RM3A 4MKXA 4AN4A 2YC2C 1WHTB 3OOYA 5DXFA 4IHJF 1AC5A 2MT9A 3F90A 1LI4A 2VYND 3I1FA 4QU0A 1XRLA 3TZEA 4C3OB 2AMVA 4MP6A 5JZ9A 1HT3A 4H3KB 1OPXA 4R41A 2NTYC 1KFKB 1Z8NA 4KVAA 4CI0B 3LOPA 5BSWA 3LZCA 3WDKA 2WWWA 5HIJA 5E4JA 4MB0A 2VH2A 4IR7A 4LDNA 4EF5A 3O2NA 3JPWA 3PZBA 4MGKR 4PRYA 1HTBA 2VTEA 4EQ6A 1QP4A 2QXTA 2ZYAA 4BHTA 4QELA 4C78A 3BM5A 2ZI7A 1T36A 4IQ4A 4G4SP 5I7UA 2LV8A 3OFNA 2PZBA 3LL4A 2NTJA 3KPWA 3OU7A 3D2BA 4PAMA 1H94A 3A05A 2HHJA 4RF4A 4GI1A 2QP3A 2Q9BA 3EMVA 5F51A 3FSEA 3W90A 1PP4A 1SQSA 3GNSA 3WGVA 4OHOA 3E22B 5JTTA 1A9SA 3FJYA 3COSA 4GWKA 1E5DA 4KSYA 2E5LB 3GLFB 3QBEA 3HB0A 3RARA 3VO1A 1E62A 5BSFA 1SJ9A 3O9MA 2J6CA 4QWWA 3FKQA 1NOKA 4GSKA 4XJTA 1ULSA 5HF9A 4TKZA 1XX6A 3K96A 4X8LA 4PF1A 4D02A 4RD6A 1KBZA 3TG2A 2CDRA 1Z5VA 5HIKA 2HXSA 2H0RA 5SZKB 1E1DA 5HWSA 3KB8A 3LO8A 3EQZA 4MQFA 2EKDA 3RUCA 4IVPA 2CE7A 3OZEA 1MAWA 2X0IA 3JQFC 3OWOA 1SOUA 4PTYA 3UJPA 2VDWA 4UJ3A 3UXEA 5DHUA 4A26A 1R27A 5HZMA 1ZEMA 3BJIC 3EFOB 2PD6A 4J4BA 2Q4TA 2FEOA 1IXYA 2QRUA 1SCKA 3R7BA 1U2GA 1C9NA 2JLQA 1I7SB 2VDPB 3BWEA 1W49A 4DE5A 2CSXA 4DIKA 1NDQA 5ICFA 1Y6JA 4JP5A 4R51A 3KE8A 2H7XA 2XVMA 5KJEA 5TPZA 4F2WA 2LXNA 4LBVA 1M6VA 2Z43A 2J0UB 3OJ0A 1FRQA 2XEDA 2OVFA 5AVXA 3RASA 3IV9A 4JJAA 2IIBA 2QN8A 3GFRA 1OR8A 1NT4A 1ZXXA 3IIIA 1IMJA 4FXPA 3L6RA 3CF0A 2ZK7A 4UVGA 2JFPA 1W36D 3K8ZA 5CCEA 3ES9A 4RD4A 3TIFA 3ZDCA 5EJ4A 3DHNA 3QPAA 3MJFA 5LSAA 3N2GA 1Z5ZA 2J8ZA 3UV3A 3BIFA 2H4YA 4D4KA 4DREA 4ESHA 2AGVA 2QRLA 3DH0A 5L7YA 1U7UA 3OZVA 1SU8A 1WXHA 2C2BA 2JFBA 1V71A 4REMA 4AO6A 5IARA 2ZU0C 1UWKA 1F3LA 1CR0A 2H2IA 2PKQO 3PX2A 3RRJA 3WIBA 2DEUA 4BP3A 4X6LA 1QG2A 3RHSA 4YLYA 4PQEA 1NXXA 2B7CA 2IHJA 3ESXA 2H48A 2ZROA 4H15A 5ANRB 2C42A 3T3OA 3WGKA 3DZKA 1L3IA 4FCWA 4GOLD 1EFKA 1ENOA 2HJ9A 3CVOA 1DJPA 3MWEA 5A7HA 1SEPA 1C9KA 2FK8A 3AGQA 1CF2O 1XPJA 4H17A 3K31A 4OBBA 4RJ2A 3TMYA 5KPDA 1VHDA 2DUMA 4UBNA 3AF0A 2CSUA 5KNBA 2GZDA 2WYVA 1PEKE 1YCDA 2GZ2A 4KWHA 1UINA 5DSXA 3WAJA 5CA1F 1HUQA 2JIBA 2GBIA 3AX6A 1EVIA 1GA4A 1KO5A 1RLIA 2VSFA 4A0QA 1GNTA 4QXQA 2PLFA 4ZAZA 4R16A 3PQFA 4BY9E 3GZNA 4AF7A 2FPIB 2IJGX 5GJBA 4P9NA 3CLTD 4J2OA 4DQLA 4C6TA 4MHTA 2B0CA 3INNA 5H3CA 1SZJG 3DA8A 4Q34A 5JWOA 1CZRA 2L19A 3GCDA 1AQNA 2I71A 4QXRA 4YXFA 1O8CA 4QSHA 3LQ1A 4LK2A 4NBVA 5TVGA 4J1QA 4INAA 1VB5A 2QTAA 2VPXA 3K72B 3ZHSA 2H1IA 2PGOA 3I2HA 4RLQA 3L8DA 3D7SA 3HBLA 4HPXB 1R9JA 3SF8A 3UJ9A 3EDCA 3ZHQA 2XI4A 3O4VA 4DAOA 2CJYA 4BMDA 2PX0A 3JARB 1M6YA 2W70A 1YFLA 1ST3A 2VPPA 5JDIC 4YXWA 4G1BA 5EQFA 2P69A 4NYMQ 3K2IA 3LPDA 4DIFA 4N6OA 4J1TA 4FR2A 3O94A 3MJTA 5LZ4A 2HSGA 1Y34E 4BVAA 2WKRA 5J4LA 2HW8A 1SHLA 2L42A 1G60A 3Q7TA 4WCDA 3K1JA 2Z5VA 3WBFA 2PS9A 3DBLB 3NANA 4BGDA 3TG8A 1UMBA 1IXRC 2VCEA 4HQ0A 3M6VA 1BA2A 1CY7A 2AYYA 3EASA 1QRAA 1X7WB 3ZGOA 4F3YA 1WUHS 2WWRA 4X6UA 1NF3A 3C6XA 2XUDA 4TZ0A 5FNVB 1SKBA 4KBYA 1P5FA 1UZUA 4X9XA 1CG6A 1OX4B 5DOZA 2BI7A 2REBA 4JVOA 1XQ1A 4F8YA 4C0KA 1LGYA 3TW4A 2AMJA 1XTRA 1H69A 3T7TA 5EI5A 1Z5WA 3OKCA 4NI5A 4RHUA 1Y9AA 3NM4A 1SEVA 1PYGA 1E20A 1Q57A 1WHSB 2GD0A 1TUBA 3LXXA 5AW0A 4K6CA 2QZZA 2FOLA 3PC4A 4HPJB 2XA1A 4BB5A 4G65A 1NJGA 3CVWA 5BSRA 4Q4HB 4KXMA 2PA3A 1MDFA 4M22A 3W8DA 2PUGA 1KL7A 1ECLA 3BE5A 2EL9A 2EFYA 3HCAA 4L3VA 2DLCX 3T34A 2AEJA 2MHCA 4GPIB 4K6OA 4QICA 1AO3A 1F12A 1YBAA 2J3HA 3EXFA 4HAWA 2VYNA 3K1AA 3DQQA 1VZ2A 3VOSA 2F3UA 4NAVA 1PSDA 3HI4A 4HWPA 4KGZA 4WZAE 5ALXA 4FIDA 3WFIA 2IOHA 2RMKA 3KCNA 3O84A 4B7AA 1L4KA 3RHZA 2HA6A 5P21A 1W29A 4A8JC 2EX0A 1BXRB 1SC9A 1U6KA 2YRXA 3FVRA 2BEUB 2VF5X 4GM1A 3SZUA 2J0EA 1X80A 2PEYA 4GI3A 5IDYA 1L8XA 3EXHA 4ZVTA 4AP5A 4EYSA 4OQLA 2O1XA 5TMEA 2QN3A 3I76A 1RIFA 1YAHA 2WNIA 3UICA 4MJLA 1CZOA 4MICA 1TJ4A 2QKYA 5FUVA 3PLAE 2IRWA 1J21A 5BSHA 1GXSB 4MA5A 1ISFA 2E55A 2A7QA 4AD8A 2DWOA 4EKNB 3FPCA 4UPVA 4PFKA 2YXNA 2NU8B 4Y2QA 5LBIA 3P0RA 3DPUA 5EJ2A 3GT7A 3RFCA 1Q0UA 1Y7HA 4B81A 1M7HA 3FYCA 1CB0A 1G8JA 1AF7A 1ADYA 3F8TA 2P68A 4H6VA 4LTDA 2J9FB 1XC7A 3JZFA 2ISCA 2HIAA 4TX1A 1K9SA 5FWYB 1P77A 4G1FA 1QE0A 3TYXA 1F5SA 1KQFA 4FBMA 3G2PA 4Z0PA 4N47A 1KDPA 2HLDD 3ETJA 4DLSA 3E9RA 4JUCA 5A4MS 1M8KA 2EBFX 2WV9A 3IPCA 3ZQJA 3TKAA 3RFUA 1XVUA 1QAMA 2VYQA 4BB6A 5AI8A 5ENDA 2BH2A 1YD7A 3QUSA 5FEUA 4II7A 4MUGA 4UEJA 1TCVA 4ARZA 4NHEA 3SEZA 4W1RA 1GPUA 1A2OA 1I0LA 2ZYWX 3LI2A 4ACAA 4ARSA 2AT1A 3VPGA 2K6GA 1A8QA 4NC9A 4QJBA 2YNMC 1GCIA 4MUJA 4QPJC 1ZICA 3BBPA 4I81A 4EFKA 2Z08A 5KOIA 5LQCA 3A6PC 2R87A 3IP5A 3L6DA 4JAVC 4QGGA 2GHRA 2CXXA 2PY6A 2XUKA 3OT5A 3AEZA 1DTSA 3NYRA 5EJIA 3VV2A 4ZJPA 3GXOA 1RP1A 1MX3A 4WA7A 2AI2A 2NWQA 3H1AA 1XCGB 3A6EA 1ORIA 2C5SA 2Q2QA 3ITKA 4OGFA 5F64A 4COKA 4Q7KA 1YOVB 5AVRA 4EUSA 1R50A 1VLLA 5D00A 2NIPA 4CKWA 2X9VA 2A0WA 3PITA 4YT5A 4MR9A 1MH1A 4WNIA 5KB3A 4PZEA 2Z1NA 5I7WA 1C9EA 1YGYA 2C1ZA 3B1KA 2G8NA 3HN6A 5FBQB 3UJHA 2GPAA 3H0EA 3PWZA 3LF2A 2BCGY 2IYPA 2FUG1 4FLEA 4KIJA 3ZQUA 3GRUA 4U5QA 2FPGB 4IIXA 2WSIA 1FYEA 2E6UX 3HVUA 4ITUA 5HVNA 3MWKA 1QJ4A 2G7ZA 2I1WA 3KKOA 1Z0AA 3A31A 4DCJA 4DOMA 3PCXA 3QLVA 4F9TA 3AVVA 1A0OA 1IJFA 1BZYA 1TU3A 3ZQKA 1B00A 1DAOA 3IC5A 4JP1A 4LE2A 4ER0A 2IEBA 3ESZA 3HCDA 4GPZA 3TRFA 4BNXA 2ZB3A 3PXCX 5M04A 3SJAA 4Z51A 1E8MA 5CNKA 4RH1A 3OQ6A 3SIXA 4OXYA 1GAJA 1XWFA 2R6JA 2V1XA 3C15C 4Z49A 4YMLA 1JYFA 1EAMA 4MUMA 2ZBVA 3F7OA 3T1VA 3FPFA 2QR5A 1VHLA 4N5IX 4QPCA 3KLBA 2AL7A 3BD9A 3G6KA 2QZ9A 4F1KA 4E51A 2RHGB 3FYUB 3RC9A 5JDCA 3HVJA 1YQXA 2UZ1A 4IRUB 1DBIA 4ZAFA 5JAPA 4O3MA 1SCUB 1WSWA 4E12A 5HZKA 4HP8A 3EIFA 1RLJA 3LOUA 2QN7A 1QNFA 4BX8A 4KR7A 3B1YA 1J5PA 1N7GA 4HVTA 4CQLA 3JCZA 4DPMA 1DMSA 3UNXA 4HLCA 5KSOA 1DJQA 5IJZA 3PFWO 2P30A 3EY9A 5GIOE 3QVSA 4UHBA 2Y0PA 4D5GA 1LK0A 5TC4A 1KDRA 1SWWA 3K09C 3HXPA 1OGJA 2JFZA 3N2ZB 3ZXYA 4OY3A 4R0MA 4H9GA