5JSYA

The 3d structure of the ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough at 1.04 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
283
structure length
283
Chain Sequence
b'GTLTGERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase, small subunit
publication title The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis.
pubmed doi rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Oxidoreductase
total genus 85
structure length 283
sequence length 283
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jsyA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jsyA02
3AYXB 3ZE7A 4UE2A 4CI0B 1WUIS 5ADUS 4UE3S 3ZE9A 1H2AS 4UPVA 3ZE8A 4IUDS 3CURA 3AYZB 1UBHS 3USES 4GD3Q 1WUHS 2FRVA 5A4IS 1UBTS 4KO4S 4UCQA 1CC1S 4UEQA 4UCWA 4U9HS 1WUKS 3ZE6A 1YRQA 4C3OB 5JRDS 4UEWA 5JSHA 4TTTS 1UBKS 1UBLS 4IUBS 1UBJS 3USCS 1H2RS 1WULS 4IUCS 4U9IS 5JT1A 1YQWA 3UQYS 4OMFG 4KO3S 4KO2S 4UQPA 3ZEAA 4KO1S 3RGWS 4UE6A 1FRFS 1UBRS 5A4FS 3MYRA 1UBOS 3CUSA 4UCXA 5JSKA 1WUJS 5JSYA 4KL8S 3H3XA 5A4MS 1UBMS 4UD6A 1UBUS 4UQLA 1FRVA 4KN9S 4URHA 5D51S 5JSUA 2WPNA 1E3DA 1YQ9A 4UPEA 4UD2A
chains in the Genus database with same CATH superfamily
3T06B 3ZIDA 2WWVD 4Z4CA 2AKEA 4K28A 3L6RA 4GECA 2FZLA 3SE7A 5IVKA 5NLLA 2DHRA 1LUAA 3H75A 3HH8A 2TRSB 5IJZA 3DPIA 1T4GA 4I99A 1PL8A 2EGHA 2VXOA 5DIFA 3UA4A 2FN3A 2PRZA 2Q0QA 1TX4B 2NVOA 3PNQA 1KDOA 1QVZA 3P9NA 5LA6F 1N75A 1X7XA 3WGUA 5IEJA 3FRJA 2ZRGA 3VH3A 2HT1A 1TQHA 3CURA 4R8KA 2IYVA 1JHPA 3V34A 4LJ6A 1ZSVA 4OFXA 1AV6A 5EMJA 5JFGA 3LX6A 5CFOA 5DBOA 4FC6A 4Z3DA 1N0HA 4KSYA 2QVZX 9LDTA 4LYYA 5KHOC 5B2ZA 4I5IA 3K92A 1KSJA 3TAUA 3SNKA 4HV4A 5AK5A 1TMKA 2PDAA 1OR8A 2BE7A 2R7LA 3NG1A 5BV1A 3ZJTA 1P2BA 4WOJA 1Z6XA 4Z1MD 1H4TA 2QEQA 3M6XA 1IRIA 2FLWA 4RPKA 2P6RA 4MO9A 2GN9A 5EJ6A 1YRHA 1QO9A 2HJSA 2WFLA 3B3FA 2H2IA 5AKLA 5BSRA 4J7AA 4LY0A 1QYDA 2ZJ8A 3H7AA 1EIZA 1QYVA 3A6FA 3UK7A 3ZDRA 4JJ6A 1UDCA 4DR6B 4Y6SA 1MJGM 5CITA 1VYVA 2H11A 2GETA 4FMCB 1HQYE 4CEIB 1DAPA 3H19A 4XWGA 2OWEA 4IXDA 2WNSA 4LZZA 1JNXX 4YJGA 2B34A 1WV0A 2JEOA 4G86A 3QW4B 4CHTA 5KTNA 1GPLA 4DMHA 1T6ZA 2ATXA 3RAPR 3T5DA 1KVRA 2XJ4A 4X7RA 4LDQA 4MYRA 5SY4A 1ULBA 1DRJA 1UBLS 4TWZA 2HA5A 4QYMA 4U7FA 5EPEA 1PYGA 1VJ5A 1XAJA 2OD7A 4H0NA 3SLKA 3NASA 4PBRA 1T4MA 4XW2A 4CUZA 3TKYA 3H9CA 1R9GA 3PFIA 1GG8A 4GX0A 2P90A 4RV4A 2NVUB 4KXFB 5IS2A 4P33A 1T4CB 3SYTA 3O26A 2FZVA 4DOMA 3TLGA 5MGBA 1NR1A 4RVUA 2WVJA 121PA 2ATCA 3DYVA 3PE6A 4QWWA 3GCZA 1JPJA 2QG6A 4MRRA 3A0UA 4B85A 4DKXA 2YQ4A 3E5MA 4KQ2A 4GYKA 3JQFC 4WACA 1PJRA 1UK9A 1M6HA 3ZHSA 4A3SA 4TVSA 1E2BA 4U6NA 2Q6IA 3ZI7A 5KX5F 3U4QA 3JYNA 1Y5MA 5H02A 3R6WA 4QGGA 1PQYA 1OI2A 2VTBA 3DFMA 5IASA 3CUUA 1QWSA 1Z13A 2EXXA 1RP7A 1ZD8A 1NDQA 1UKVY 1EM6A 1UP4A 2B0CA 3NBAA 3R7SA 1P33A 4S05A 1VI5A 4IILA 1YR8A 4QDOA 5BN4A 1F4VA 2AMVA 2KQUA 3HEMA 3MUOA 2BGWA 2B3TA 4RTKA 2R86A 3HUUA 2YWCA 1YO6A 5A9RA 1J4AA 4JQCA 4X45A 3OFNA 3FSRA 4C6TB 1GCAA 3ZY5A 4GBGA 3ESYA 2FKAA 3HKDA 4MUKA 3HKBA 4DC0A 3OY2A 2V6GA 3LDUA 4DMFA 2FN7A 3OTOB 4YFVA 2DTEA 3GK3A 2VSOA 4OHBA 3JQDA 3RT7A 4K0KB 1E60A 1L1QA 1FK8A 3ZI0A 2V7EA 3DYBA 1U9IA 3EW9A 1P4JA 2QRUA 5JXGA 1J56A 1G17A 3BB3A 3CNNA 2KBEA 5FPYA 4Z7OB 4OX9B 4QBFA 2FMUA 3V2IA 5KC9A 1DP4A 3HVRA 2QW1A 1CUVA 1PJSA 2ZYRA 1Y8RB 1YCFA 2ZS7A 1P0FA 4GE0A 2V3CC 1FU7A 1YRBA 1L6RA 2I3GA 1J8YF 2DKOA 3HYLA 1T35A 2YOFA 2ZVPX 3PF8A 4FZ5A 3BZWA 4Q4JB 3V55A 4ESEA 2BGGA 4QUDA 1A4XA 3VHXA 4XIFA 2FX3A 2H1CA 3E3LA 1R4NA 1S8NA 2YWGA 3RIEA 1BGVA 3R6GA 4RK5A 4UMFA 2YZGA 1VCHA 1D0IA 4Q1FA 4QGBA 3L0OA 4HUTA 4RTJA 4A4DA 2PGLA 4NF2A 4ETIA 3DTVA 1Q74A 2X4DA 1ODLA 4NZNA 2DHCA 2MYNA 1ZH4A 4UBJA 3W2FA 3ZCPA 5FR2A 3CXRA 5KNLA 1UK6A 1KFKB 1PJ3A 4NFLA 3OWXA 1RMYA 1RAHA 5DULA 1FS4A 2FFJA 3F8SA 3DWFA 4E2XA 3OOSA 1QHGA 1WTAA 1YJAA 1WXHA 3IV7A 3OUUA 3V5NA 1CUYA 2PJZA 4NQRA 3B1KA 1U0TA 3GJ7A 1J9ZA 2WU0A 2R1TA 1I51A 5J2TF 2XSZD 2E37A 4MDFA 2BDUA 2WSLA 3E3NA 3GEBA 4UNRA 2GTHA 1WW2A 3TL6A 3ZK7A 5A7FA 1TKCA 2HH9A 3FB1A 2FZWA 3MMNA 3QIVA 4KVGA 1GR1A 5AW4A 1S6YA 3TIIA 1K27A 3KOOA 3OWOA 2WAMA 2ZM5A 1MA3A 1JEQB 2IH5A 2QTMA 3D1VA 1GTVA 3O47A 1ZHOA 2G5PA 5BW5A 3DONA 5IHXA 1X7WB 3GAZA 3OPYB 1JDJA 4I3GA 1YJ5A 5LUBA 3TR0A 5A06A 4ETMA 4ZQIA 2OOKA 2CUKA 2JIQA 4IW3B 3VTKA 4ZT3A 1O97C 5LQRA 1AUQA 4ZEVA 4JV5B 3L7JA 4LHWA 2ONKA 1PUJA 2ORIA 1TEVA 4X93A 5KQRA 3IT1A 3IEIA 2CCGA 3QLJA 4WN3A 1RI3A 1ID1A 2P79A 3AEXA 4KDFA 2F7SA 3FOFC 1YKFA 1LSJA 1ZMOA 2AKYA 2QROA 3BX1A 2ZJ4A 4MI1A 1RP1A 2JIPA 5CIWA 1HDZA 3DLIA 2CHVA 5MN5A 4M46A 1YZHA 5AM1A 1E58A 3ZJUA 4C20A 3IL2A 1Z35A 3HVHA 2V8OA 1JDSA 1QTRA 2G0AA 2IXEA 4KPFC 4J4BA 4DV5B 1YTUA 1B93A 3NT4A 2I4NA 2P27A 3CRW1 4YMSA 2QP4A 1QQTA 1M2OB 1P2DA 3IULA 3KIPA 3PFHA 3IR6A 4BX3A 4C7OB 1RM5A 2P5SA 2P9GA 1J00A 1SUDA 4MWCA 1H2EA 1DRWA 4N82A 4ASUA 4UBOA 5JE8A 3ZJ4A 1RC0A 3F6YA 2NXJA 3LUJA 4P08A 4AZTA 5GINE 5DB4A 3VR2D 5GM2A 4WNIA 4AURA 3AG6A 3BFVA 2I2XB 3NORA 1R15A 2A0UA 2PYDA 1NQ5A 1UMKA 5BRNA 3TSZA 3PHLA 4Z9AA 1J24A 1N2GA 5CVDA 3VKWA 3ORYA 5I7VA 3AERB 5C1OA 1TAGA 1RQ2A 1L5FA 4WBNF 3BD8A 3LF2A 4L4XA 3RSOA 5E6UA 1QYCA 1C7RA 5KNBH 1M34E 2IGBA 5JXHA 1SA0B 3SEAA 4EX7A 5GAJA 5JDCA 3ZZMA 1FX0B 2WVHA 5GJWC 4EI7A 4DN6A 3SVLA 3TXXA 4AKGA 2I6FA 4AY2A 5B1SA 1A2BA 4MTCA 2DQZA 1KMIY 3BH0A 4MQEA 5DU2A 2QRJA 1B14A 1WBJB 3ROMA 2Q99A 5ALYA 4ARZA 3HEAA 5UKDA 3TIXB 3PC8A 2QV0A 2OXRA 1IC6A 2GT1A 3GVCA 3HBLA 2WE8A 3AI1A 2MIIA 2R6HA 4QSHA 4BMOB 2W2VA 4HAOA 5CA1F 5FL3A 4L4RA 3VAYA 1S8OA 3HYCA 4G97A 4DBLE 4V1CB 1C8VB 5B1IA 1DBWA 1HSZA 1D9ZA 2COEA 4DBZA 1J0XO 4CLDA 4CIYA 1JPUA 5TMDA 4G24A 1EK0A 4BVAA 4BATA 3PI7A 1A9XB 3ICEA 3EJWA 4X9XA 4CUKA 2WKWA 4UDYX 4E08A 2HPAA 2QSYA 4IH4A 1SXPA 3A14A 3ILSA 5I47A 1G20A 1W25A 4PC7A 2GBIA 3ETHA 5H8WA 2AL7A 4TQ9A 4FX5A 1YB4A 3KJHA 1P81A 1J07A 5AJVB 1OV4A 5CBPA 1OPRA 2C3MA 3PWZA 3QBDA 3QVLA 3WYNA 1EFLA 3BS4A 3NXKA 4EHKA 5FWNA 3IFSA 1HH4A 1BG6A 4X7PA 5EIHA 1D2GA 3WMXA 4DA9A 5B7GA 3IURA 3O3MB 3R0VA 3L0YA 5C1BA 1UBJS 2JH8A 4QT0A 4QLAA 4P35A 5A3SA 1AK2A 2C3PA 1J49A 1GOTA 2EDAA 3NDBB 1WULS 1K89A 1M2NA 1L8AA 3BMQA 2XCIA 3CUEF 3NBZC 2XTNA 1VMEA 3GJ4A 1CPYA 2FEXA 4R81A 3WHLA 5FRDA 1E1MA 2D13A 4CL8A 3OHMA 4PYNA 1XKLA 1ZVQA 1ACJA 1VL8A 3CU5A 4DQKA 4P0PB 2R6ZA 4JR0A 3PA8A 4GNKA 4BJ3A 1MAWA 3RRMA 2EYQA 4PN3A 5BSWA 4DV3B 2VZ8A 2UYYA 1U0GA 7MHTA 3Q5GA 5IYZF 3AUFA 3Q8XB 1ISSA 5BNWA 2GJKA 3RC8A 2G3YA 1KI9A 2WIBA 5I3CA 4PPGA 3RSLA 4YJFB 1JAIA 1FMTA 5IABA 4YRLA 1ZG3A 4ZIRA 1EVZA 3DS8A 5KVSA 5B5SA 4GR4A 4C7XA 1EFPA 1S8AA 1XVLA 2WAOA 2IY8A 3GJ6A 4M9CA 5CLIA 3R5SA 4Q7LA 1IBRA 1MXFA 1KAOA 1ZXXA 3B6EA 3BK7A 1HORA 2OZLA 4WOKA 3Q41A 2Z9DA 1DOAA 2CLEB 1P7CA 3JVDA 3MGKA 2EZ9A 4QBHA 4TYQA 4UNPA 4AROA 4KMRA 2XLBA 1VLQA 4C7KA 2BGMA 5F64A 4ZXPA 1AHPA 2C20A 4D8YA 3ZV7A 2CHFA 2GHTA 2VUUA 2VOJA 3R24A 1UKYA 2A1TR 5E2AA 5JISA 2JLQA 3MZ0A 1VBNA 3DMGA 4XYEA 5DM70 4X1YA 4BU0A 1NVWQ 1T1JA 4XQ9A 2J3QA 1EUCB 3RAFC 3RVSA 3G68A 1O89A 2JBAB 4LYJA 2YWHA 1AO3A 1N6NA 4I5DA 3TSCA 4KYVA 5GP1A 1BYIA 3G5MA 2BTEA 2GRJA 3ACDA 4LXYA 1NUSA 1C1DB 2OVBA 1GAWA 3LPMA 2QL7A 1CIPA 1HF3A 1INLA 1Z4LA 3TCNA 3RHFA 1LU9A 1PJQA 4AMVA 2GUGA 4YY3B 1TM2A 2YQ5A 2I7XA 2C5AA 1L8XA 3WGZA 2YWBA 5K8JB 1CZKA 2HHJA 3GEEA 1I36A 4MPPA 2XGJA 3MWKA 5AICA 3RVRA 1IVNA 5IXYA 2FB9A 4P80A 3DXXA 3L1HA 5EE0A 3W6NA 1BJTA 1JNYA 1FW8A 2V9ZA 5FA6A 3PUVA 5EZSA 1W49A 2MYUA 3ECSA 3G5AA 3DZDA 1OROA 2FWAA 4WXRA 4G1UC 4KYIB 4KREA 1XNHA 2O8FB 2FZ4A 3EDMA 1SWWA 1UCFA 3L6BA 4CLHA 3LUHA 3KQPA 1J8VA 1IVYA 1LBIA 3WLSA 1EWKA 4CG3A 3UPUA 2JPDA 1MHTA 3QU9A 3ETGA 4FGSA 5C18A 1W76A 2WHEA 4W4TA 2AVNA 5G3YA 3O4JA 3P1JA 1L5ZA 4UEOA 3WNCA 3PL1A 3U7EB 2C5FA 4HTAA 4N8SA 4QNNA 1NRJB 1PFQA 2NUTB 3ZDZB 5JMWA 5IBQA 2E6KA 3JVVA 1E6LA 4YP1A 4YRGA 4WKPA 1P3DA 4EYKA 2E5FA 3IEVA 4F84A 1C8KA 4ED9A 1XZBA 2IPLA 2ZYWX 4QIHA 2GZMA 5K03A 3BBLA 4Y2SA 3JQAB 3O83A 4Q15A 3FGPA 4HF7A 4I08A 2ZIUB 1VMAA 3L0ZA 2XOKA 3TLXA 3FUUA 1YBAA 3FKQA 4YNBA 1QPBA 3AR4A 1ZGHA 2XUQA 4OQZA 5FUXA 1KI1A 1RXIA 2UYQA 3G85A 4GM0A 3KCNA 4U4AA 3UOGA 3QEBZ 2QP9X 1TK3A 4RJKA 2QK4A 1SCKA 1AKRA 2J7PD 4NTZA 1X1CA 1ZGAA 2Z04A 3EIXA 4ARIA 1GUDA 3LS2A 1CF4A 2VF8A 3RYCA 1JF8A 3ZX4A 2FWJA 1XMSA 3AXSA 1G8JA 1YAHA 1O58A 2ZSUA 3IDFA 4RK1A 1BDJA 2NTYC 1ZUWA 3AOEC 4EA6A 5IT9A 1UAGA 2BHLA 2BFWA 3ERCA 1G4AE 1W88B 3Q15C 2P4EA 4PZZA 1L5RA 8ATCA 4X6XA 2RFLA 1K06A 2DPXA 1NPTO 4A1FA 3WIEA 5LD2B 4FUTA 3FOAA 3ORSA 5JR3A 3H6KA 3ZKAA 3WWDA 1WPRA 2GK6A 5EYPA 1Z0ZA 4A0GA 3GBSA 4NPCA 4BGEA 4DIMA 4B48A 1TK9A 4TS9A 4L28A 4CM1A 3F6BX 4EY3A 3TF5A 4YQEA 1FSPA 2C8LA 4FE4A 1KRXA 1H65A 1N2CE 1N5IA 4WNAA 5E9AA 2GN1A 2AYZA 2H08A 2QKYA 3NAMA 5IDVA 5GZ1A 2WK1A 1TYEB 4UBKA 1Q1NA 4PS0A 2HIHA 3QHQA 3IP9A 4JJEA 2O5RA 1PU2A 1ZUNB 2ZS8A 3A3PA 4WA7A 1AIPA 3IT3A 5T4EA 2EU8A 3X1JA 4GX5A 2Z83A 4G1CA 3VDMA 4D2IA 3ZDXB 4AS2A 4FP9A 4AJNA 4IV5A 2A9OA 4M54A 4OD0A 4MR8B 1ZNXA 4F5WA 4S04A 2IXAA 2AUNA 1W4BA 4NENA 2XUDA 2H18A 1NAHA 4J4TA 4MXDA 1ZMTA 2B6HA 5ESWA 4DXAA 2WAYA 2DT8A 4JQZA 4RKEA 4EUSA 5L3ZA 1E1NA 4L7VA 4TMTA 5KTKA 1OH6A 4X85A 4DWVA 1FXWF 4UE3S 1DELA 3EVFA 2AZDA 4O4LF 3C7DB 2YJNA 3NB0A 5JJCA 5E38A 3ZWCA 2YRXA 3H9GA 3O0TA 1YZKA 4UUPA 3C97A 4C0AC 1M83A 3IUJA 4P58A 1W5AA 1N8TA 3R7NA 3UMCA 1NU8A 4N4AA 3OKCA 3PXGA 2ZANA 2J30A 4AZ0B 3BWYA 4DVGA 2PZMA 4NBUA 3E5HA 4D3FA 2OCPA 1X2BA 3ZY4A 4TLEA 4RYLA 1ULSA 5FI1B 1XTRA 3HBFA 3E61A 3LNTA 4JLAA 2WZBA 1GG5A 2Y92A 3HLYA 4Q16A 3LDFA 2KWIA 3PUWA 3OCUA 5LDGA 3V2UA 2XGGA 1E2KA 1DINA 1WPGA 3DF9A 3AP1A 3KJFA 5LA6B 3G82C 6LDHA 1GTRA 3F97A 2V7QA 4LSGA 2O8CA 3PEWA 2ZEJA 2I4MA 1PR3A 2QAGC 3JATB 4IYRA 5HJ7A 2XXBA 1G98A 1W52X 5B1EA 1MABB 4JVNA 1LBQA 4DSNA 2Z8XA 1PSWA 1EG7A 4YI5A 1P2SA 2P9ZA 5DBGA 5KJ1A 4TMFA 4ZAVA 2VUSA 3WP1B 2RKBA 2ZKIA 1R6XA 1WKCA 3DE6X 1WLYA 1XWFA 2ZUDA 1KIFA 2EEPA 3MCTA 3FKSA 1RJFA 1E32A 4XARA 3SQLA 5LSAA 2HWWA 2JGEA 3NKFA 3C2QA 4KK4A 4MTLA 1XDWA 5CB8A 3KQKA 3CJTA 5EZ5A 3ZHBA 1VKZA 2PL9A 4RQBA 3OA2A 1L7NA 4QEDA 1CE8B 4H6PA 2PLAA 1Z2EA 5BWLA 3FTQA 2EW2A 4A2CA 1IEVA 1EZ1A 2HMWA 5KOHA 4OI2A 3QPAA 1K8XB 2I7DA 4O3MA 3TMAA 2ZWVA 4ZEXA 2BMEA 4KX3A 5KOYA 4L3VA 2EQ5A 3BN3A 1O8CA 3R8XA 3JQ9A 1MC4A 5IDXA 3KPUA 1I94B 1LNQA 2O0KA 4KIGA 2ADOA 3SZOA 2IXFA 3THXB 1XZHA 4W6ZA 1UODA 1YQEA 2PXAA 3P2IA 4IJWA 4BRZA 5T5QA 3CZQA 3MWEA 4CM9D 4RQAA 2P6OA 2VHWA 3NBXX 4WJZA 5DOZA 3RT1A 1X80B 1DU4A 3PDIA 1DI0A 2PZKA 4FFLA 1JTFA 1UBMS 4QM7A 1FRNA 2ZJ5A 4XQGA 3W9SA 4DVJA 1BVHA 2FQ1A 2QPLA 3P94A 4MS3B 1HL7A 1Y6ZA 3DFKA 4QA9A 1K8RA 3B6IA 1SXIA 4G8DA 4UREA 4UHDA 3EIHA 5I9SA 3T52A 2XDAA 4G0XA 5HS4A 2PX5A 1QOZA 1T1EA 1XLUA 1DEAA 3A9UA 3E6AA 3BUSA 1I3MA 3HDJA 3M6LA 4TV8B 4BUCA 1CRPA 4DQVA 1YK1A 3N0RA 1QYIA 1SMKA 2QWXA 3DVAB 2JLRA 3VSCA 1ZS9A 2REQB 3VPXA 2NZVG 3FYTA 3ZE0B 1BE1A 2WQZA 3WLAA 4ZPXA 3BMCA 4DJTA 3DAHA 1FNBA 2OECA 3M5WA 4FK8A 3A25A 5TQ2A 5LXTA 4LTNA 4EJMA 1C3LA 1YGYA 2Z2ZA 1R18A 1RYBA 2X1LA 3OO1A 5G2OA 3DYIA 1PK9A 2PUTA 3UAZA 1KWGA 5FFNA 2QUZA 3FLAA 3TUZC 2V03A 1YJXA 3IHTA 4HLQB 3URMA 4BMZA 1YCHA 1U2DC 2SECE 2GD1O 2K4MA 1TQ6A 2LTAA 1TZKA 1Z6YA 3FDZB 3CV3A 5E4YA 3F7TA 2LDBA 2FSIA 4LKRA 2VZ0A 5FWYA 2WJ6A 5DASA 1A2QA 1ISGA 1KEUA 4MULA 1WM1A 1ZIPA 1BOFA 3M5DA 4N49A 2ZUCA 1GGKA 1CX9B 1DRUA 2FPIB 4O2BA 2C95A 4AJJA 1YKSA 1O95D 5LQCA 3PU6A 3GF4A 3DSRA 1TM1E 3LZCA 2R65A 3NRCA 2I5PO 4KQHA 5A4IS 2AXEA 2XI4A 2ZP1A 3HVIA 1G1AA 1D4FA 1JIVA 2AXNA 3IUBA 3UPTA 2Y2UA 3NIDB 3T7EA 4YRZA 2H9YA 5EIAA 3T54A 1J8QA 1L7VC 4EHJA 5L45A 1PNQA 1BJRE 3PGXA 1OXSC 1WEKA 2ZB4A 4L50A 5E0OA 4UUAA 3UUEA 2QZZA 4OAPA 3WXMA 2G5TA 3A0RB 4FHDA 1P91A 1PWZA 4HATA 3L01A 2XKJE 3GG9A 2YOHA 1BE0A 5KSPA 4WLEA 1SOMA 4ZC8A 4W1QA 4OOEA 3C6MA 4OK6A 4YT4A 2H63A 4JXKA 2P0EA 1MAAA 2PBLA 5ELMA 1NXWA 3VI3B 4CTJA 3O1LA 1I14A 3S44A 1T3HA 1L7AA 4YUZA 1YB7A 4LXQA 1KY4A 1SQ6A 1UAAA 3WQHA 1IHUA 3C4QA 2C9MA 3OJCA 4M9UA 1M76A 1OU0A 2FP4B 4FFBA 4S1PA 2AF4C 3IQDB 2RK4A 2IVFA 2WABA 5ALKA 1KJIA 3S8MA 3VHRA 1YHYA 2IZ1A 4BWGA 1N2BA 3CEPB 3L02A 1ZD3A 1KMCA 4I1IA 3GP5A 4MUJA 5DYGA 2Y6VA 1YUNA 5EJIA 2GD6A 3IUYA 4OMFG 1G0NA 1ELOA 1EA7A 3O2QB 3K6SA 1NVDA 3IAM1 2CLSA 3SSMA 3EXIB 3C14C 3WRXC 4OAQA 3W3AA 3Q8WA 3THRA 3A26A 1R8SA 4KQXA 5I6DA 1YR9A 5BRAA 5TGTA 1H2FA 2FN9A 5F21A 4A27A 1C9MA 2C4VA 1E3IA 2PMBA 1RE1A 4M7PA 3R7FA 3H2SA 2O3QA 3TOCA 5KZMB 2GLTA 2R25B 1V11B 1GGEA 3TN7A 1P1CA 1PJ8A 3CEMA 2O05A 2J45A 3ROFA 4K6FA 2NADA 3EIQA 1V43A 5L7WA 2PMFA 1VMDA 3QBVA 3C3WA 1RPJA 5GPBA 3I6QA 3R5KA 1RADA 4GEKA 2SKDA 4HN4B 4PSVA 1SBCA 4AUKA 5HZGA 3DEHA 5K0FA 4JI0B 1GA6A 5AI4A 1HT0A 1JSLA 2JLSA 2P30A 3ZIUA 1G42A 3T8YA 4D9EA 1FTQA 4AJPA 2CK3D 2VTEA 2X14A 3GCWA 1I2MA 2NSJA 4D9HA 5IZCA 4YALA 2L0XA 2O8NA 2VQ3A 3T61A 4E13A 3IAM6 1OXBB 5IAEA 5IF9A 1PUXA 2CZQA 4BFYA 3FF4A 2JZOA 3K5PA 4O08A 4DLAA 3DQPA 3AT1A 4NZOA 4UNSA 3S29A 2W2PA 1GG9A 1XZIA 2OM2A 3BRWA 3DNFA 3O9ZA 5FWXB 5CB4A 1EFUA 3PJGA 3BA6A 1VFNA 2HZBA 1E9DA 3NJ8A 2BHRA 5CM2Z 1N92A 2P69A 1QS0B 1M1UA 4G23A 3UB3A 5EJ8A 3HABA 3DMNA 1SUPA 1EA5A 2OEPA 4UUBA 4A0FA 2RGBA 3GN2A 3KSRA 5AXAA 5LZ9A 3H4IA 3IHKA 4N0DA 1HE1C 2WG2A 1ECPA 3CKLA 4P4UA 1JMKC 5FTMA 3S6JA 1QGDA 4Q4AA 4AY4A 1HV8A 2AG8A 3OECA 1SU6A 1XQ1A 4WLNA 1KGSA 4BRWA 1J22A 1G6HA 4WERA 4H3HB 2J3LA 4DJAA 2WSSD 1WDWB 4LWOA 2WB4A 4XTRA 4P34A 3KV3O 3I1JA 1KE2A 1TC2A 4KXUA 4NYJQ 4JOQA 5F98A 4GMHA 1C50A 1CVIA 1DIRA 1NJ1A 2OAP1 2WYVA 3KQNA 2X19A 3E8SA 5TPWA 4WBNB 1K4MA 1N25A 4H9GA 1KPHA 2VDOB 3UAOA 4UNQA 4PHTA 2DQKA 2QMOA 3LBAA 1CRQA 1A5SB 1DIGA 3G6KA 3NHSA 3O75A 1ZZGA 2ZI4A 2FUKA 3RVOA 2PGAA 1RXVA 4V03A 1XHEA 4UM5A 1NZDA 4NBVA 2QTWB 2YFKA 4CDGA 4B6FA 1SO8A 3H1FA 4LVOA 1GU7A 3L7MA 5B3LA 2O2XA 3EPKA 3QVVA 3HXTA 3SDSA 1KEZA 3Q7SA 4WN9A 1X9IA 1Q2UA 3U4DA 4DPKA 5CA1B 2AG0A 3UAXA 2QENA 4JBGA 3S7TA 3D2CA 4CL0A 4N1AA 5JH7A 2VNHA 1VJCA 2C2WA 4X65B 2Q6OA 3P71T 1M1ZA 2GFQA 1K0UA 1TCUA 3WYDA 4F2HA 2X58A 1OYYA 2J3IA 4MVJP 2C4KA 1RRFA 4NK4A 3RGGA 3OU6A 4LAFA 1M6VA 2PL5A 4JC5A 4ESOA 4EWLA 1OA1A 1PL6A 1ZBQA 2OVFA 3FI9A 3IMFA 3PD0A 1T0JB 5EIBC 3I61A 1UPFA 4U7DA 1C3VA 3IQZA 1QIMA 1W4CA 1YDMA 4ZDIA 5HX7A 4X63A 2F00A 1T0PA 2IYZA 3P4YA 2J9FB 3GV0A 1Y1PA 4RVDA 5JD5A 2EBHX 3FZNA 1WHSA 2M1XA 2EL9A 2WOJA 3EEYA 3R6DA 3C3KA 5ALQA 5FEUA 1A8IA 2VHZA 4X1IB 1N7GA 3H9UA 2PV0A 5BNFA 3HZZA 3HGTA 1RRKA 2HHAA 3KELA 3C3JA 4DR3B 3RARA 3OX1A 4WHMA 3VKVA 1CJMA 5IUJC 5EWLB 3E3AA 4IDGA 2NTJA 3NYQA 4BQQA 2IHYA 3H5NA 3VKHA 4CXMA 1LI5A 2OQ2A 3LC7O 2B2XA 4IVNA 5KDOA 1IWOA 1ZC3A 1ZK3A 2E5WA 4KN9S 3WFIA 1JFSA 1VKRA 4H7DA 2OAQ1 2Y0CA 3UCFA 3NAQA 5E3JA 2CUNA 3OP4A 4H16A 2TMKA 3ISVA 4JOCA 3SC2B 4XVCA 2H0AA 3JD4A 1KYIA 5G4KA 2GPTA 5K3FA 2IU0A 2QVCA 4X84A 4Z5XA 3V1TC 4FOOA 2MJLA 1Z63A 3LT0A 1JKXA 1YGPA 2ZSBA 1IQRA 1KY5A 2QGNA 1JU3A 2X15A 4LJ9A 4CEJB 5IPFA 1L5MA 3DO6A 3PITA 4IZOA 4Z9FA 3AHJA 2ZB2A 4HGYA 2D74A 3MGAA 1EEXB 2BSXA 4MV0A 3WYGA 1E9RA 5AVXA 1L0BA 1L7OA 1QR2A 1EQ2A 2NP7A 5AXBA 1P7VA 5BXQC 3A4NA 5CFQA 1E2PA 1X19A 1HDCA 3O2NA 3OZXA 4M8KA 3CVOA 2ASEA 1YQXA 2NYUA 3ZE8A 1H9CA 2YZKA 1J33A 1L4HA 1UQRA 2WF8A 2E4VA 2ACKA 2PGXA 4HGRA 3L8GA 5H80A 4OHYA 4E7PA 4YAJA 4ERXA 1I7LA 4G1EB 1QZ3A 3WBFA 4AYWA 2QIPA 2W8BA 3I9JA 2CXPA 2KW5A 4LNHA 1R9MA 3R0XA 2VJPA 4E4TA 2WUVA 1MO6A 4OQEA 4PE5B 2EERA 4QZVA 3R6TA 2CEAA 3Q7QA 2CZGA 2XB8A 3UG7A 5JDIA 1UEJA 1DBVO 5THQA 2NUPA 2BISA 5D85A 2I03A 4R0NA 2V5AA 5CIYA 3IEPA 4EHAA 3NQ41 3LHFA 1A1SA 2PYZA 1OQAA 2OC4A 3DE0X 3H18A 3M70A 4G3XA 4YECA 1DT3A 4CM4A 5IULC 2R5FA 2W43A 2ZRBA 4J29A 1N6RA 3WYEA 4EHNA 4X1KA 2EFGA 3RC1A 3AKCA 4MKZA 1S2NA 2NOAA 3IMCA 5K5EA 1XNQB 3JVIA 2J0VA 2QD4A 3DTVD 2YASA 4JBWA 4PXAA 3L0DA 1J0CA 3QVJA 4MKFA 3A04A 4OXYA 4CI9A 4BLUA 4YP6A 1S1CA 4GVLA 2P9FA 1E9CA 2J9XB 3NHZA 4Z7JA 1X7DA 3JWGA 2BMVA 1JHQA 5U9CA 1YS7A 4RPCA 5G53C 1DTWA 1OGJA 1FUYB 2QTVA 3PB3A 3DW1X 3N1UA 4HXYA 4KGXA 4RD0A 1JQAA 2D00A 3HRHA 2XX3A 4PQEA 3SU8A 4CODB 3DMPA 3L0BA 2CXRA 2QA5A 4IIVA 5DCYA 1GYQA 5FTJA 2A5FA 1RTTA 3V7NA 3OLWA 1PJTA 2F67A 3KAJA 4V3CA 4DJDC 2NO6A 2XB4A 5I48A 4FT2A 3EZNA 3Q3EA 5CH5A 4BB9A 4ZK6A 1Y98A 1OAOA 3H9QA 4F2DA 4F96A 4ZICA 4C7BA 4ZK2A 2XXAA 1SXJA 4B82A 4IIJB 4XYLA 1UMBA 3KSBC 4WOPA 2QN8A 5J3JA 4FQ8A 5BOSB 3KXIA 5HIAA 4G4SO 5TSDA 4ZEMA 2ZE7A 1PCXA 2GNPA 2X9LA 5LD2C 5ALEA 1DXYA 4FKZA 2ISCA 1PS0A 3HCFA 4K9SA 1WZEA 3QVMA 3I0MA 3AK4A 3BM5A 5HRUA 5EZYF 3UAGA 3DOIA 5CHYA 4Z0PA 1QFZA 4RBNA 2FQXA 1TD9A 3PZRA 3UXYA 3O8LA 3W06A 3DAPA 1B1CA 1BEEA 2NNLD 4UNIA 4ZOBA 1SG0A 2ZWAA 4JJKA 2O6HA 1FP2A 3WSTA 4G84A 4J0GA 4XUDA 2WHXA 1FBNA 1J2UA 5LKRA 2A67A 2RDMA 3NDRA 1G7CA 1N6IA 4EOGA 3FOBA 3RIXA 4YJ3F 4ND3A 2XZDA 3KZVA 1JFFA 3AUKA 1O5TA 3W2TA 3KRTA 2I4TA 2CXXA 5ALOA 4H31A 4P81A 1OU4A 2H8GA 2WNIA 3P5SA 2W6JD 2X3YA 3CZAA 1G5QA 3JQ8A 4U0JA 3KKZA 4JL5A 1XLVA 1C4OA 1QPGA 3D4LA 4QDJA 4JLNA 2HN9A 4I1RA 1KSGA 4C0QC 4GPEA 5G4LA 1X7XB 1SGWA 1RWKA 4JBYA 4UE2A 1J42A 3A2MA 3BFPA 2FPPA 3EXG2 5DWVA 2GDZA 2G71A 4BNMA 3A37A 4X8LA 1MB3A 1BJKA 1S3IA 4WZAA 2QNBA 4P4SA 4QXRA 2ZE5A 5FLYA 4FHZA 3SBXA 5DH9A 5J5VA 2VQDA 2DPHA 4YRJA 3T5GA 4XSGA 1CSEE 2ECOA 4NE9A 1MFPA 1P2GA 5HRAA 1RYEA 1RHJA 2C1ZA 3CTMA 4GZ5A 4ON9A 4EFNA 3RCBA 3LF1A 1IPEA 4PSUA 3FDIA 5H82A 3D9QX 5JCJD 1NL3A 3PXDA 3ESXA 5ALDA 4TMWA 2XCTB 1SUIA 2JGKA 3A9SA 1VG1A 2H3EA 2QG9A 3GLSA 1DV2A 1KI7A 2DWCA 5ES3A 2WFLB 2X1MA 1Y3FE 5TXGA 1QG4A 5GWXA 5LYJF 2A9RA 4Z2AA 1U63A 2QN6A 1XTUA 1DWQA 2QTFA 2OXEA 4LQLA 1NN5A 5TEWA 4EY5A 3JX9A 4OQDA 1N2EA 5HIKA 3FPKA 1F4PA 5H70A 1YASA 4NFYA 2Q4BA 2J4DA 5GZ6A 2UZIR 3EWNA 4L6CA 4G2TA 4O3FA 2Y4NA 2PD3A 1LCIA 3KFLA 4BCDA 4YJGB 2N42A 2C77A 3EWIA 4GE3A 2OYSA 1SB9A 4M1QA 4MINA 4B7XA 4F8YA 4KHPB 1MA0A 2M6KA 2V98A 1OKKD 1LKZA 3ABRB 3BK1A 3H3FA 2ZTSA 3Q85A 4ESVA 4QQNA 1GFSA 2OORC 4X00A 4WXEA 2CMHA 5LZ2A 2E7ZA 3W1VA 1MGPA 4Q7QA 1YJBA 1QPZA 1U0SY 1JFVA 2WSYB 4EF5A 3F6RA 4W9NA 4KIFA 3RRNA 5FV7A 1FRQA 5TJHA 4AY6A 2GXUA 4GGMX 1MAUA 1TO1E 3MTIA 2B2CA 5FOWA 3GLIA 3U7RA 3PGJA 1F9AA 1Q0HA 2K87A 1GO2A 2AQ8A 1HQCA 5HE9A 4TSFA 5CFZA 3TLGB 1GTJ1 1KETA 1V47A 4Q9KA 3A6JA 1IL0A 1U8TA 4NCHA 4UVDA 4P98A 5JG7A 4FFVA 4JXXA 2QMYA 2VNSA 2Q1UA 4LG1A 2QVGA 3CH5A 4C1BA 1C3OA 1LDMA 2JFQA 2DSTA 4LIPD 5LXTF 4AMUA 3BTOA 5A5VA 3E84A 2WT9A 3QKUA 4ZGGA 3HB1A 4PGGA 5C5EA 2Q7OE 3AJ9A 3GFSA 3VO2A 4URXR 3U4QB 1P9RA 2WKSA 2IOHA 3LFTA 3L7KA 4BO6A 4KXMA 2VTBB 1IBSA 3A1NA 1XZ8A 1M1YA 1EDBA 3G3EA 4C7MA 2OCYC 3DEZA 1UPAA 2AN5A 3ZD9A 5BQFA 3FVWA 4JODA 1Z6QA 2J0UA 2X4IA 2E18A 2JCBA 3AUTA 3FUXA 1D2MA 2FFAA 4Q3EA 4IO0A 1OWMA 4FS8A 3TZBA 3K2BA 2CDBA 4IXWA 4NZ9A 4O2BF 4REOA 5BN4B 5K3DA 5MFPA 3FZGA 1D1PA 3P96A 3Q7EA 3A9VA 3GDGA 3O1IC 1DXHA 2GXSA 3DLAA 3R5HA 4QRIA 1Y4ZA 5CGQB 2QQGA 4JHXA 5DSTA 3DPSA 3GEPA 3UH0A 4F2GA 3FHOA 3RFFA 1MOPA 2DUNA 5K51A 3ZYCA 4BE4A 3HKDB 1K98A 1U4NA 3HKBB 3TFOA 1OOEA 3M0EA 5HF6A 5A3QA 1ETUA 1NE2A 1U0JA 3IP1A 5HUQA 4AZWA 2FEPA 2RGEA 3Q6IA 4RCYA 2JANA 2D54A 2Y1FA 4LZNA 4QL3A 4YPFA 1WDTA 1QH9A 2V55B 1L5GB 1L4EA 2NACA 5F1PA 4F9FA 3ANMA 4EO4A 2CKMA 4L57A 4DMRA 3CT6A 2ZVDA 1F51E 1ZNWA 3UCXA 1UJCA 1G18A 4JU9A 1O6GA 1Z07A 1X2EA 3VHXB 1JG4A 1P0QA 1JG2A 2P68A 3FMIA 1R4NB 1RD4A 4EYSA 5A1TA 4WVFA 1ORRA 3TUJC 1ZOPA 2CFIA 2HU8A 3CVXA 5BW6B 2IOQA 3F3SA 2I7VA 3QE3A 4OJNA 2G8NA 1XX6A 2OR3A 4FYKA 4YDRA 4WJLA 3FLMA 2VCEA 3DTVB 2PNFA 2C99A 3L1VA 5K0TA 1SKUA 2VPQA 4YMHA 2XCRB 2WLTA 4YHHB 1H8EA 2DX7A 2XBLA 3TIVA 3WG9A 4EI8A 2O1SA 2X40A 3GAFA 4NI5A 3NEJA 4DLPA 4PTLA 4BVHA 2GFHA 4ZODA 1ZK0A 1EFRA 3SIWA 1SKBA 1QHNA 1T1RA 4G67A 1C30A 3LGXA 3FTEA 1OI4A 3ND9A 4RF2A 4FB4A 1GDTA 2BDTA 1F8UA 2A30A 1DVRA 1JTVA 1U3DA 2PKXA 2R1TB 1N5OX 2W0MA 1BGWA 3HR7A 5M29A 2DWQA 2Z2KA 1DARA 2QHXA 3KKKA 1ZICA 2J7KA 4HDQB 2Q3LA 1OE0A 4FD3A 5L3RA 4CNBA 5KSOA 3OZSA 4IS3A 2O2ZA 3C8MA 3RFVA 2HFJA 1DQYA 4GXTA 4CLOA 3AFNA 2UZ0A 1ZUHA 4YAKA 3WL6A 4LOLA 5LMUB 3X1WA 1Q6YA 4PZUA 1OAKA 3EVNA 2ZQYA 2DQYA 4IDDA 3KQOA 4KMMA 4R1MA 5DCWA 4YPVA 2R6JA 1OXXK 3HFRA 3I2IA 1NI4A 1XZCA 4I5FA 4A2PA 4C9BA 1SC9A 1WB4A 4RK6A 2IP4A 1U7XA 2QS9A 3L40A 2XOKD 4EUFA 5JAHA 3W2HA 3L7IA 3SFZA 3RV4A 4E6PA 1UDAA 3B2QA 1BTOA 1AKNA 4RMIA 1N36B 4M1TA 2X76A 1A9PA 4JJAA 1ICIA 1ID8A 4KXXA 1XD8A 4GM1A 4AXXA 2HB6A 4NKRA 1CS4C 2PPVA 3RROA 3W5UA 4UTPA 1W47A 2YS7A 5D2CA 4RFVA 3A4TA 3RT9A 1RBZA 1T5HX 3H5RA 1Y0BA 3TSYA 1USVA 3LVBA 3O03A 3FNIA 4HBGA 4V02A 3UWPA 1NXXA 3DEKA 3L7OA 4MCAA 5IZ4A 1QANA 2CNNA 2EZTA 4I4IA 3QV2A 3ICCA 2OHXA 4FN4A 3I30X 1VI2A 2Z58A 3ET5A 2BF4A 4QEZA 3FR8A 4PLFA 4URHA 3U7IA 4QHTA 4M21A 4XYBA 2P9TA 3M6UA 3O4GA 2V59A 3LVRE 2HFKA 4HLCA 2G9UA 1EZ4A 1BD3A 1FFWA 3FY4A 4JXJA 3TIGA 4E5DA 5K4GA 3P27A 1U2QA 3NOOA 2XQKA 1I7QB 2WF5A 4BP1A 5E6UB 2AF3C 1IEWA 1XPUA 2CLHB 3FBGA 3JSAA 4Y9SA 2C5SA 2HWKA 4FDUA 4JEUA 2H2DA 1BXZA 1Z2NX 2G0TA 4F0JA 5HKKA 4D43A 1UADA 5IM5A 3WIUA 2ZUWA 4MQEB 4DLUA 4ATNA 3PRJA 4B5KA 2B4YA 5JARA 1RBQA 5AKXA 4ARZB 3LI2A 5C8VA 3SQNA 1N2ZA 4PAWA 4AAYA 1ATIA 4D74A 4UHEA 1M0WA 3COPA 4BLWA 4X62B 4DR1B 2ZVQX 2QL6A 1DOZA 4PC1A 3MJVA 4D41A 1KZ6A 3C4JA 1W19A 1C9KA 3DE7X 3GN1A 3JZDA 1AXRA 4GO1A 4R2KA 2PVSA 4H7HA 3IPAA 3LLMA 2VYVA 4RHEA 2OV2A 4BMSA 5IP5A 4RTMA 3ER8A 1M75A 3TW8A 3K9CA 1ZOIA 4OYRA 3UK2A 1UWVA 3MW8A 3C1TA 3NFYA 4RULA 2IXTA 5G1PA 2F3QA 1CIJA 4M49A 5ECWA 2FZGA 1VLLA 1G20B 1IMJA 1ORWA 1RRPA 2UKDA 3EYWA 4TTAA 3TQCA 4HBZA 1F6DA 2WI8A 2O5EA 1PJCA 3NEAA 2WM8A 2ZRKA 4ZYUA 4BGUA 5CBPB 1Y3IA 2KPOA 1TM4E 2WWWA 3B82A 4GGOA 4O8CA 5E1MA 2BEWA 1PVOA 1RLIA 2IRWA 4D0GA 1WSDA 1CUJA 1HY3A 3GH3A 3LT2A 2WKQA 5KTMA 3K1TA 1U0OC 2CL7X 1G3UA 2O23A 2YJ4A 2O3SA 1M7BA 4FMBB 5F51A 3WL8A 2PUBA 3PUHA 1D2NA 3BMQB 2CFOA 1W59A 1YQGA 1NJ8A 1YUBA 1PV2A 2VAXA 5A3VA 5AIAA 3WL5A 3KUUA 4FOLA 4IKPA 5ED0A 4Z0HO 1ENZA 4DSUA 1ZA2A 3FVQA 3K6KA 5EPOA 3V1KA 2P41A 2HYDA 5BO5A 1QC5A 3RTEA 4J94A 3HK2A 3CH6A 3TPZA 1PE0A 5J1TB 3UCEA 4NRDA 4D57A 5HPYB 3HXOA 2R00A 3L1IA 1GTL1 3RU3A 4M0CA 5CNMA 4GOOD 2R6R1 4L15A 5GONF 2YJ3A 4NZZA 3VV3A 2QB5A 1TJNA 1RJGA 5CD9A 2YZNA 2BKUA 3CA8A 4ZIRB 3OEEA 5FJJA 1C14A 5I5GA 4L9RA 3Q5DA 1ODKA 2NPFA 1EFPB 2YHAA 1DV1A 5JPCA 3OHSX 2Z8YA 2OZLB 1HYEA 2ZUUA 2EJUA 3E9ZA 4Y2UA 1TTHA 3QITA 4DUYB 1RBMA 1KH3A 3GT0A 4MWSA 2XRFA 2WTMA 4PY2A 2VP2A 3L4BC 4KMOA 4YEDA 3ZD7A 1NXVA 1IIBA 4N41A 2RE8A 4OHFA 3LLVA 3WOVA 3I42A 2A1UA 1XHLA 3VX3A 1NC3A 4TTRA 1ZBDA 1QX3A 1Y4AE 3WSVA 2IXGA 5EJEA 2WB2A 1GFZA 1GUAA 2ISSD 2R7NA 4X1YB 4DLWA 3LKDA 3KETA 2IEZA 4R2HA 2DG2A 2OK7A 3ANLA 4LISA 4WD3A 2WG1A 2I91A 3ZTYA 4BTVA 3CQ9A 1NC1A 2WVGA 4MJ3A 1XXLA 3OG9A 1J2RA 3E5RA 3HFJA 1RXEA 1JJVA 3MWJA 3COSA 1YA4A 1LSSA 3SXUA 1Z15A 2X23A 4Y6PA 5T3YA 4ND5A 1SQFA 4ZJZA 1OFUA 1FF9A 1ZMRA 1E1LA 3LPNA 2WT8A 3BD9A 4DIBA 2CMDA 4N12A 3R40A 2YL2A 1LZKA 4YQZA 3DH0A 4HEQA 4C3VA 2O48X 3LFUA 1U7WA 3LU1A 3SIRA 3TVYA 3U3OA 4AZSA 2ZXUA 3DMYA 1C1HA 1PWEA 1WXWA 1ZWLA 3EAFA 3N2LA 1I2BA 5TMPA 4E11A 1WABA 2B1IA 1SKAA 2H07A 1NXQA 4DARA 3A7DA 3MJHA 5AKKA 3M6FA 5G1OA 5EQJB 2RBGA 2C5LA 4FBMA 4UZSA 2XUFA 3T15A 3VO9A 3VU8A 5KNCH 2G9ZA 4HS4A 2NU8A 3OZCA 5JNSA 3EFHA 3E9EA 4K1XA 1PLLA 4FWIB 4IX9A 5BQXA 4LF8B 1YUMA 2XHZA 1J8FA 3G9TA 2HU2A 3GDOA 1JIXA 2N47A 3U3JA 4E2YA 1KVUA 1XALA 5AW2A 4I14A 2AC7A 3AOGA 3IJRA 2KLHA 3ZXUB 1BXRA 1H8HA 1DKNA 2L82A 2Q4EA 1UPXA 1KDTA 5EIBD 2BCJQ 2A33A 1X38A 4MA4A 4HDSA 4NU0A 1QTNA 3HP7A 3MUNA 3T34A 4GU5A 5KVVA 1E6CA 1CHDA 1NATA 3NHPA 2CJXA 3QX8A 4HNHA 3HMQA 5JEEA 5CM8B 2HAEA 2XTZA 4FFNA 4AMBA 2G4CA 2X6RA 2MU1A 3QWIA 3VR5A 2WICA 2HEGA 3LIPA 2CE2X 5EESA 3NHJA 2GERA 3MBKA 4QTUB 2ETXA 3EZ9A 4YJDA 4K05A 4D3SA 4M1OA 4KXQA 5JTTA 1ZD2P 3GJXC 1T34A 4U9IS 1JDTA 1M67A 2H5EA 4E09A 3RYCB 1K5GA 3I2GA 2Z2XA 1RJ9A 3I39X 1UXKA 4V39A 1N0UA 2Q2WA 3P0RA 1MN6A 3AM3A 3P9QA 4ZVVA 3HJFA 2GCEA 3NYWA 1GPWB 4RQUA 3CT4A 2ZIEA 1SC4A 1YZ3A 4JYPA 5D1HA 5DBEX 2R5WA 1D6NA 3EY4A 1EP2B 3WNDA 1PS9A 2O8BA 3LMKA 721PA 5A7GA 3L05A 2PEZA 3KKEA 3FGOA 1Y81A 2VT3A 1JB1A 1LGYA 2QX8A 2WDZA 1GTMA 3E5NA 3QPBA 4MPRA 1K4KA 1V5EA 2IQ5A 4GBMA 4ZOEA 3WRYA 2A9KA 4Y9UA 2O0JA 4RY0A 1WETA 5CDFA 2IBMA 2J08A 4GFDA 1CP3A 3QVOA 4JDPA 4OYLA 2R8EA 3FN4A 2DSNA 4MX8A 4P5PA 4EKEA 2AYYA 4PAQA 3O4RA 2AD5A 4WNAB 2E82A 5CJ2A 2RIPA 4JBLA 4UJ3A 2RK6A 4WLFA 3ZGLA 3I3SR 3LTNC 3ZDDA 2HCJB 4MVXA 2IUTA 1JDUA 3UF0A 1NG1A 3AHGA 5E9QA 1GZVA 2P3OA 1L5OA 3BJMA 2IU4A 4Q00A 1YR3A 2EG9A 3WX0A 1IM8A 3GB9A 4XOUA 1QGZA 2IU6A 5JQGF 3JWPA 3KLPX 3GOQA 1OA0A 1XMJA 1Z36A 4NENB 4LX0A 4GMGA 2ZZKA 3NWJA 3AQ4A 1K8QA 1KBZA 1WD7A 3RNLA 3M1IA 1GILA 2ZBQA 2I87A 4XGNA 1SAYA 4FWTA 2FSPA 2ZRHA 1FDRA 4AQYB 4FILA 4L5JA 2YYYA 2P4HX 1TVCA 2V7UA 2WJVA 2ZFUA 3P4UA 4INJA 2ZUTA 4JYBA 3TQSA 1C2YA 3VZBA 2GPJA 1YD7A 1Y6RA 4GLLA 4OGLA 2G36A 3FPSA 3BRWD 4KQ6A 2OENG 2DEUA 4OK3A 2D1RA 3HUTA 3L0SA 1FRZA 1HUQA 3GEMA 3DTTA 4OP3A 5AJWA 5H1YA 1L8QA 3ACBA 5KU7A 2WWTA 5TB5A 5CVTA 3HB0A 5IKXA 2H2WA 5B1DA 2R4QA 3PNBA 4JLPA 4RENA 4AO6A 3FCSB 3MRSA 1I5EA 4ZD6A 5FT9A 3UXEA 2O8CB 1XL1A 1QG6A 3T3MB 1VIMA 1EFVA 2R3SA 2YJTD 2HGZA 2HOQA 4NAVA 2FW0A 3ILVA 4AJ4A 1HYQA 4V0OA 3LQRA 1WVMA 1BHQ1 2ZT7A 3OQNA 1QE5A 3CBQA 2Y1DA 1CEQA 3MRVA 2FMHA 4YTEA 1BU5A 5I9IA 3LPCA 1KZ1A 3BHMA 5DYTA 3GLHA 3T3NA 1XFAA 2CHGA 4II7A 4WA8A 3AUAA 2HRRA 4JUFA 4WI1A 1NAIA 1Q12A 3U9SA 3WWYA 3AR2A 3FCOA 3MCVA 3WYCA 1JALA 1FYVA 3RYTC 1PVVA 2PL3A 4BKPA 2F6RA 2O4UX 3WQBA 3D8SA 2QXTA 2W7TA 4YWJA 5A5DA 4MEBA 4CMKA 1RLTA 4WCFA 4EAAA 3TOZA 1CHNA 2FG6C 3HDHA 3BSSA 2X42A 5KOHB 3IVXA 4INPA 1ZGJA 5BQPA 2AC2A 3JYOA 2HF8A 3TE6A 2W6ZA 2BUCA 1HT2E 2R1VA 4RU1A 3AJAA 3LWBA 1U7HA 1X1QA 2RSLA 4D9NA 1FDSA 1N3LA 2WHYA 2F9FA 2ZIVB 4IH9A 2X13A 1RXWA 3QFRA 1LTQA 1QE0A 4MI9A 5T4BA 3AM4A 4MDYA 1QIGA 2E4YA 2M1ZA 3MWEB 4IRMA 4B4OA 4LOHA 1XLTA 3VYWA 1YS2X 2WP0A 1GZ7A 3PDIB 1VJ0A 4R98A 5DYIA 5D7NA 3LP5A 3QX3A 3QXXA 1IB6A 1PT5A 2BD0A 4XGQA 2F90A 4MA0A 3UWSA 1OT5A 4NJOA 1AA6A 1DTEA 4UXJA 2Z1NA 3BXHA 4NAHA 5CH3A 3VHLB 2E49A 4MYSA 1DJOA 1RMTA 1QLHA 2B25A 2DY0A 2EKQA 2VQSA 3P97A 1LVHA 1Z4OA 4M9QA 4UD6A 5IKOA 1SBHA 4AUMA 3SS8A 3L9XA 3T5PA 2GAFA 1ZSYA 3JZFA 3HO6A 1QFMA 1ZWKA 4Y1RA 4OFBA 3M49A 4RPLA 3BMCB 1E66A 2GM5A 1N1EA 3UJ9A 4CL2A 5LOVF 1I0LA 1K08A 3JXEA 4M99A 2QNIA 2VAVA 1E96A 1TD1A 3FRHA 5TQ2B 4RDXA 5LXTB 3IDOA 1ZQ1A 2PSFA 2QE6A 1ECJA 3UIEA 1XCGB 1CWUA 3GFOA 1KZGB 1OC4A 4JJZA 5IT4A 5JAZA 5DRTA 3C87A 5DZSA 4ZVTA 1WXQA 4CTNA 1JIKA 4W99A 2O14A 2POQX 5FLKA 4CM6A 3CS3A 3I2FA 2EBFX 4JROA 5EMNA 2PJRA 1Q83A 4KQFA 1U6KA 3TQOA 5L7TA 4ARAA 1E0AA 1EB9A 5FWYB 4BVGA 3FZYA 5D00A 1OREA 2CD7A 1RRMA 1I4TD 2FZEA 3QFHA 4KRYA 3RU2A 3G2LA 2Q0HA 4JKIA 4O2BB 4RZIA 4I9HA 1RPTA 3NALA 3OJWA 1DKMA 4G26A 4HFNA 4TRJA 3W8DA 3QLVA 2XB6A 4JITA 1NQUA 1MR3F 3BXPA 1SY7A 4Z86A 3ZHXA 1XIVA 4XEUA 1NASA 3TQIA 4YP5A 3MOIA 4Y6GB 2FSVC 5TMBA 4IUYA 2J6IA 4BTLA 3QUSA 4PAMA 2WU3A 2H7YA 2GHIA 2W8ZA 3OEWA 1QIDA 1I1QB 3HDYA 3IH5A 4KB5A 2D2XA 1O5IA 3ELYA 4LZLA 4XI9A 5GY7A 3SEFA 3DHEA 1IK4A 3L79A 4LDRA 1QGUA 5A0VA 1OGIA 4Q4LA 4OIFA 3OD5A 1YR6A 4HB4A 4AYXA 2HA7A 1W46A 1SVWA 2Y2VA 3RTDA 1U3UA 4LYDA 4B17A 1KFJB 1ILWA 1IZ0A 3V1YA 4E5MA 1JFTA 5DGCA 5KTTA 4E5UA 2O1WA 3TRHA 4Q01A 2EFJA 2PRJA 4H0FA 2VJOA 4FFBB 4UHBA 4MVJA 5J4KA 1GV1A 1VQ1A 2DUMA 4UAJA 3K1JA 1EDDA 1ACMA 4RQTA 5GM1A 3IIJA 5B3KA 3FKJA 4M7OA 2VJKA 1RABA 3HYNA 1G6Q1 4LWPA 3K6SB 2BR5A 4XSHA 3QPVA 4CTKA 3TZQA 1H2RS 2XKKA 5BVHA 2VWPA 2Y9PB 4ESHA 1AGNA 4WGGA 1PGOA 3CNHA 2ID9A 2NWQA 4ZANA 1WCIA 3TZHA 1EVYA 3HY3A 3QGMA 3E2IA 3ZV6A 4ZCRA 1NVVR 2G28A 4WLOA 4BP8A 5JJLA 3WGMA 2A0WA 3DFUA 5D3ZA 5TDHA 2XUJA 2IV7A 2LWIA 1VCOA 3NBUA 1N6LA 3QUCA 4HHEA 1JGTA 4ASUD 1P0PA 3S40A 3WNZA 3E53A 3SVZA 4DSTA 1WY7A 1Z8NA 1VG0B 4LBYA 1TQ8A 1C4KA 1YDFA 3ANNA 4IXMA 5KJFA 2PBFA 1PW5A 2RHBA 1ZLXA 1W2WB 1XAIA 2EZ4A 2TMYA 2VA8A 1RRVA 3LQ4A 4OK5A 5F35A 3NVKI 2JIZD 1YS6A 1SXJD 4NWIA 3AU9A 3ME5A 3ZVRA 1C0PA 5DHUA 1YZYA 5DX8A 4EP1A 2JIRA 3U0VA 4BPRA 2EKLA 2PMWB 5DHPA 1LPNA 2A6PA 2FE1A 3DCYA 4Q18A 3C5VA 1U8UA 1SBYA 2EJTA 1R8YA 2BJVA 2AI1A 4CKCA 4P0QB 1JIIA 4E3WA 2E0IA 1U2RA 1HM5A 2MSDB 3GROA 3QBEA 5CB4B 3O3CA 5DWDA 3CW2A 3OOEA 1UFQA 3HL0A 3L4KA 1CZUA 1URPA 4TLMB 1DQSA 1XZKA 3R3WA 2Z6QA 5JU6A 3ZLBA 5BSUA 4KJXA 1NBOA 2H9AA 3SZGA 4GI1A 2D8MA 4PGMA 4AWAA 2GEUA 2JI6A 4CMCA 4Q4AB 3HO8A 4LEIA 5HYVA 3GLFE 5AJHA 3WC4A 1WHTA 2DPLA 2XNSA 3CNLA 4A0HA 2GBPA 1LC3A 3GFFA 5IC5A 2AUMA 3H2JA 1P80A 3KX2A 1A9ZA 1LK5A 4HY3A 3CNQS 2MINA 1XP8A 3GLUA 4O1HA 5TPWB 3V4RA 4DR5B 4HB3A 3OOHA 2ROQA 4RMGA 2JGIA 3T7JA 1IYZA 1WW8A 1KQGA 2QX9A 2BR4A 3PX2A 1O4VA 2ZJOA 3Q3JB 4Y7CA 1C8LA 1Z7YA 3H4VA 4BASA 1BX0A 1KSHA 4Q6WA 5KNDH 4LJRA 4BO3A 1MIOA 4I4CA 1D0SA 4L4SA 1FS6A 3EGIA 3V1MA 3VZPA 5K4HA 1JHDA 2FPGA 2MSEB 1POXA 1CR1A 2YYZA 1OZHA 3LA6A 3I73A 4KP7A 3RS2A 2I6GA 3HJUA 4QUGA 2IZ6A 5AM0A 4UMDA 1X1DA 1BIFA 2C94A 3SICE 4WN9B 1XTBA 1J97A 1XU7A 4A15A 5JH7B 5L7YA 2PXHA 4ZOLA 3MM4A 3IBCA 5T7BA 1ZMBA 2Z09A 2Z1DA 3OC0A 1W5FA 3U3RA 4DCOA 4MKRA 3TECE 3ZOZA 1XZPA 2R9VA 5AHKA 1XEWY 1M6VB 3NRJA 2AFHA 2XCSB 1PD1A 2ORWA 1HO3A 5IJ9A 3NTVA 1IJEA 1VB5A 4NABA 1LBHA 3PC6A 4X41A 3UM9A 5KTOA 1DSSG 2AQIA 2NT3A 2XB2A 3N39C 3UJ7A 3O82A 4UTZA 2QTBA 1IM5A 3HUFA 3UA3A 3ICOA 1JXMA 5YASA 4B45A 1E6WA 4QPNA 5FPHA 3H2KA 1V9LA 1WHSB 3B6ZA 4BNIA 3PC2A 4NX2A 4UU8A 3FE2A 3E27A 3EF1A 1ML3A 2YFHA 3GRZA 2JEZA 3V9AA 3MXOA 4DJFC 3DC2A 3IE2A 221PA 1N34B 3VKGA 2R6GA 5G1NA 4Y7DA 4GP6A 1Z39A 2WIFA 4TSFD 3VU1A 4NHOA 1W0CA 2WYWA 5DHQA 1OLOA 3PTZA 1FDOA 3GJ3A 3G2HA 2BBSA 3OFJA 2GTPA 4P32A 3RRZA 5HP4A 1VIAA 2WYUA 1BCRA 5JSUA 3FX2A 3PC4A 3BSFA 1PR6A 2ZYUX 3RKUA 4YONB 3QPUA 4XAQA 2VQEB 2F9MA 1Z62A 2YZMA 4KIUA 1JB9A 3OLXA 4KUHA 3LKVA 1W87A 3B48A 1ISFA 3NP9A 3GUYA 2AXPA 5G4KB 3F47A 5K3FB 5GVSA 1UOEA 3WIDA 1KEEA 4A36A 1W0JD 2VT2A 4HNRA 2F17A 5BYAA 4YLEA 1E2NA 3ADKA 2PL1A 1Z2OX 4H08A 1I2AA 1IB0A 3TRJA 3NONA 3ZCUA 1X8JA 4E4YA 2QPTA 4EPYA 2PMKA 2PSSA 4F5DA 4MW1A 4FSHA 2D7CA 2X8AA 5JAIA 2CDNA 3FD8A 1JW9B 1OWNA 3C0KA 4YGXB 1IUPA 2W00A 3Q10A 2KSQA 2YQZA 4QHYA 3DT8A 3MSXA 4H35A 5ITZA 1KFBB 3HNPA 4FSDA 5CK4A 2LCIA 4PYIA 1PR1A 5AXDA 4D45A 5CCBA 2PY6A 5JD6A 3W5BA 2EATA 5REQA 5EE3A 3N87A 5E2BA 4R2JA 1GHTA 4TROA 2F48A 4LHZA 2I99A 4N5LA 1L7DA 4HMOA 1II9A 1AUXA 2W8BB 2IV3A 3F2VA 1QM5A 1Y5IA 5KQLA 4D9GA 3AZPA 2OOSA 1IXYA 2IYLD 1WB6A 3HSKA 3T5CA 4C88A 3HDTA 3ABOB 4EY8A 3U56A 3F9CA 5CA0A 2H1SA 2QDXA 2XCLA 2JFPA 2QW8A 3SDZA 2NUPB 1KIAA 4RV5A 3X1XA 1H4QA 2YYSA 2WMDA 1RWNA 1THGA 2H1RA 3L46A 4QWMA 4QPZA 2GK7A 2G9RA 4CM4B 4KNWA 2CVPA 1TQDA 3Q9UA 1ZOSA 1O94C 5KCMA 1B4DA 1A4RA 1VI6A 4X1KB 2PVPA 3CNOA 4AKIA 3LH5A 2VK2A 2UVQA 4LE0A 2X7XA 4UFPA 3V4PB 4DBLC 2FK8A 4ZOAA 4K6HA 3SSNA 5KWJA 3RODA 1ETHA 3OHPA 2VJYA 3L8FA 3COZA 5GV8A 3QMVA 4Z0TA 3K9FC 1N9ZA 2X8LA 4KOAA 4ZC1A 5K8VA 5G0SA 4YV2A 5IJAA 4ZTUB 1DTWB 2AK3A 2D4HA 2QTVB 3WHIA 2G70A 1E4OA 2FEOA 2ZULA 1H0RA 4J16A 4PC2A 4QGSA 3GLGA 2FDXA 4XCVA 1ZL2A 3MEQA 1XR3A 2O3UA 2I2DA 2XYRA 3KLNA 3H1PA 2AIRA 3ND8A 1Y3AA 4MAAA 3GL9A 4DPLA 4ZYXA 2ZUEA 3ZHCA 1T29A 4KO8A 4HADA 4OJYA 3ZS9A 3ZZUA 4XWWA 1KTVA 1WY5A 4O0MA 2BFBA 2AI3A 1PJ2A 4OI4A 4MROA 4P3XA 3VNBA 3ZLVA 1DGQA 3SHOA 2XXAB 1XDUA 1SXJB 4U63A 1R3DA 1UMBB 4EF6A 1V8FA 3VJMA 1K75A 1T6YA 3DZHA 4RJIA 4XTCS 4EH1A 3R3JA 4Q1DA 4TTPA 2QUHA 3AF1A 3QXSA 1U2PA 3NBQA 4G0MA 1JZQA 2WF7A 4IIXA 1SIUA 3ZTWA 4CIVA 3DO5A 4JMPA 3PVCA 1ZM2A 4U1RA 2AZXA 3WP0A 1PEDA 2Q4RA 2XUPA 4B8WA 1DHRA 3OZWA 3LOPA 2G82A 1PJBA 3AUYA 3RC7A 3LLCA 4IFEA 4LOKA 1SBQA 3WA7A 5K1ZA 4TLLB 3SJZA 1G8YA 2GPWA 4MUHA 4CMGA 5ESRA 4OEHA 4XEHA 3ITKA 3KXLA 3WXBA 2GB4A 3ES9A 3PVSA 2CJYA 4N0EA 2Q6TA 1AKVA 1ZLYA 1ZOOA 2V5VA 3FFBA 3I8SA 4I8XA 4MGHA 3TAXA 5ALVA 3X0DA 1AGPA 2W2LA 1JFFB 3KSZO 4NYIR 4WX2B 4HNTA 4JLKA 3CX3A 2O3RA 2CD9A 2WZDA 3Q98A 4TXLA 5ESDA 4IX1A 5K0CA 3U3MA 3JQ8B 3G1WA 3FJ1A 3T6KA 4GLOA 3RRFA 4TZ6A 1NXSA 1ULTA 3AIIA 1IG3A 3I28A 4Z4HA 2IS2A 4DCPA 4HT3B 3EFEA 1XTJA 3MMXA 2FPPB 4BXOA 2PX6A 1X77A 3SYRA 4LX8A 1JS1X 4WZAB 1WKBA 2Z5FA 2BW0A 1D2EA 1WSAA 3VVMA 5GOZA 4CI0B 1TEHA 3CNBA 3L6DA 3QG5A 1GDDA 1W73A 3QW2A 4DCSA 3FOZA 4D26A 1AE1A 2QLBA 4IGEA 4GYWA 4LXTA 1STOA 1JJFA 4JP1A 5ESXA 2WUGA 3D5TA 5FP0A 1TCCA 2WYOA 3FFXA 3DF7A 2A5DA 3SFVA 4LS3A 2JGLA 3ECAA 5IK2A 3NUQA 3FF1A 5ANRB 3C74A 1AO0A 2B8EA 4CV0A 3GR6A 4HB0A 1B8PA 1E69A 5K0LA 4WK4B 3EX7C 1K8YB 3EZFA 4LHYA 3VI4B 2L69A 1T6NA 2E55A 2H16A 2P9JA 3IC5A 4IICA 4L51A 5KYVA 3U3KA 3V8NA 4EDHA 2BM9A 1BXGA 1OJ7A 2BH9A 4MQ5A 1IPFA 2G5GX 2PGNA 3AZQA 4PHFA 4PONA 4BNDA 5L4NA 4MQBA 4OHUA 4IGFA 4ARCA 5H16A 4R3UC 2C5GA 2GHQA 2H0QA 4I4TF 3N2ZB 4IM7A 2X5XA 4W7IA 4CQNA 3LOUA 1MVNA 1E3JA 3L41A 1E2DA 4MV8A 3U31A 1ADYA 1HZZC 1KK2A 2C0PA 1H3EA 1A3CA 1W8DA 3A2NA 3ZC3A 1CIVA 1YA6A 4A0QA 1FPMA 2DT5A 2IYSA 3JASA 2R11A 4IY1A 1RU3A 4OXIA 1ZM3A 1NBMA 3GLIB 4FE3A 3OJEA 4PR0A 3S1AA 2ZS9A 3CISA 4BKRA 3BGVA 4BVJA 4BO9A 3P7MA 3INRA 4AW9A 3FM9A 4D5GA 1KR5A 1DKLA 4DDKA 1N9GA 1GZ6A 1ZPDA 1AMUA 1KBOA 1WL8A 5DTRA 4O6VA 3VZCA 2HRCA 3KZMA 1U8ZA 1LQ2A 3SYLA 3FWKA 1XU9A 2VEDA 1IPHA 2AX4A 2GWHA 3FETA 4NBSA 3AQIA 1C3OB 1IK6A 5CU7A 1PI3A 1Z3CA 1DZIA 1KKUA 1M6NA 2DPYA 3CLRD 4JUCA 4XM1A 5EE9A 3U13A 2QUKA 1G2QA 4NU8X 4ZV7A 1O9HA 3A6ZA 2GBFA 2P2SA 1RYYA 2J3HA 1ZSNA 2VOEA 1DBQA 1PQUA 3KQSA 5HWSA 5DDIP 3FTFA 4RV9A 1Y6GA 1QRUA 4RE6A 1M1YB 4J9UE 4HQRA 4V1CI 5AH0A 5I01A 3WDKA 4DRXA 3DTYA 1MD9A 2J0UB 4DM7A 5CLFA 2ZG6A 1R5OA 1T0HB 5JY1A 3U6BA 4P7JA 4RDIA 1CQXA 3WICA 2IS1A 1N57A 4K9QA 2D1QA 3CF6R 5T8KA 3UK0A 2WJWA 4PWZA 5AESA 3G88A 2IHUA 4DMGA 1RHMA 1RBYA 1K9SA 2HSWA 1VDMA 2C4NA 3KZOA 3OI7A 4QDZA 4AT1A 3U5ZB 3KSMA 1FFEA 3CUYA 2HSGA 4OQMA 4AIRA 3CCBA 3EGDA 1SCBA 1P1HA 3OZBA 1FB5A 5EYPB 1SOUA 3ZXIA 2YUTA 2HHHB 1X1BA 4JZYA 5JYDA 3EVZA 5HK8A 5LP6C 1IAVA 2H29A 3CH4B 4QOSA 4E4RA 4P1ZA 4NONA 1E9VA 1A7AA 1U2SA 5C3MA 2OO7A 3TH5A 3MGGA 3X43A 4D44A 4Z53A 5JALA 3G17A 3TX6A 1DAMA 1MRZA 1RKBA 2C9OA 2CLIB 1A5BB 4JA0A 2G9QA 2XJ9A 2RGYA 1TYBE 4LZJA 2CXOA 1QNLA 1K97A 4YRPA 4KTTE 3UBTA 1K5PA 1FVXA 3EC2A 2VHUA 4COKA 1F3OA 8ABPA 4RS4A 1Q0QA 4M0LA 4WXMA 4ZAGA 4PGHA 3V46A 5JC8A 4JC4A 5DGHA 4DHWA 4OLFA 4ZQBA 4BIMA 1DAFA 2OO5A 2IZZA 4AL4A 4Y6OA 1PTJA 2XHEA 4FZ3A 4IDFA 4CW7A 4EJ6A 3HJGA 1AUPA 1NRWA 4N8EA 4ZO9A 4DG8A 1TM7E 4KGZA 4W7HA 1Q0LA 4XCQA 1NA5A 1SU8A 2IDZA 2VL7A 3AP2A 2RHOA 1KA9H 3NTUA 3UMBA 4R54A 4EVRA 5GJBA 3GUUA 4XGKA 1C30B 3ZY3A 3QK7A 5HA5A 2ZRLA 3J7TA 3G2OA 3K1ZA 2VRWA 1R2QA 2YXEA 2J3EA 4ZFNA 5ABPA 4EHBA 5CK5A 3VJRA 3AEYA 4B3GA 1EAMA 3EF0A 3RHSA 9GPBA 2QQ0A 5BW8A 1ONPA 1HYHA 3ZW7A 3A27A 3BWDD 5KI6A 3OFSA 3QWBA 5E6SA 1DAOA 1MGOA 2XKBA 2XWBF 4LYEA 3LUPA 4NNOA 3CHYA 3UEOA 3ZDFA 4CLOB 3MMZA 3BQMB 2DPGA 5EUCA 1LQTA 2P4UA 5JI3E 3AFGA 3R3HA 3CLTC 4I1UA 4GPIB 2FG7C 1X0VA 3I5UA 4Y2YA 1TIPA 2WD7A 1NI4B 2PUVA 1R16A 1PJZA 2QMHA 1CFZA 3JU3A 3LHKA 1Z2PX 3OETA 4IQ0A 3AIOA 5CJPA 4BMDA 1C3EA 2WNHA 2YCBA 4FE7A 3JV7A 1JR6A 4MQMA 2F1JA 3BWEA 3QTLA 4I6GA 1C0EA 2D4AA 2Q1WA 1SHZA 4OXKA 1DBSA 1J7JA 3FCEA 3EULA 3FNGA 4JEMA 1AF7A 2K7ZA 4RF4A 2C3OA 5GV7A 3VR5D 3P2OA 4YCAA 5IVPA 2I29A 4AJKA 1JDPA 2HRQA 3NDIA 4Z7NB 5JS7A 1F2VA 2BONA 1K0FA 1W4LA 3NJRA 4XD7D 5THXA 6Q21A 4JB2A 1KFCB 1P2VA 2V7XA 3GO4A 5BN1A 4BNVA 2E4AA 1UBCA 3PPYA 1TM3E 1HZJA 1REQA 2ZOSA 4LRUA 3ZDQA 4Z3KA 2XRYA 1JR3E 1L9KA 2XIJA 1QU3A 1T9GS 3I04A 1GAXA 1SWVA 3OH8A 3KOZA 5LZ7A 4QECA 1JPNA 5IZCC 3EA0A 2CCKA 3LUCA 4DV7B 4NK5A 4PNPA 3SZUA 2XUKA 2C2XA 1FP1D 4M0PA 1C81A 1W7AA 1RAEA 3HGMA 2VBFA 3HUDA 3KPYA 5AIBA 3L7NA 3TTWA 4PX9A 4GMDA 1OZAA 2JARA 1KNXA 3G6WA 4WXPA 2WPNA 3AR9A 3VR6A 4ZT7A 4YRAA 3MWGA 4OXQA 4F9GA 4LE2A 5T41A 1GCGA 1XVUA 4GC9A 4LN1A 3THSA 3UN1A 1XO1A 4HAWA 3JQRA 1DC8A 3IQXA 4NMHA 1ZVVA 5LZ8A 1TMOA 4QNRA 4W7SA 5HM8A 1HG0A 4UOZA 3HU1A 2AOXA 4FGLA 1PR5A 3ZDEA 2B4TO 2G0NA 3T0FA 5IDWA 4B3MB 1YL6A 4E07A 1ODSA 1RCFA 2IDJA 4UDNA 3HYTA 4CETA 5J4VA 2PH7A 3OEHA 1C9EA 4YQYA 3RVNA 5JECA 4IMJB 3TW0A 1YI1A 3EY9A 4OHWA 3KNZA 3UJ6A 4OLBA 3EH2A 3ZXYA 4NCKA 2FPRA 1R5JA 1FTSA 2Y1KA 3TW8B 3A1TA 1R5NA 4V0LA 4IDEA 2PX0A 4IJMA 3RYIA 5JNWA 4C1NA 2RG7A 3QE4A 1QYWA 4KR2A 2W6IA 4YDQA 1G5PA 4FS3A 3PLNA 1YR2A 3TQRA 3PHIA 5EXTA 1MQ9A 4AXBA 1T9KA 1KI4A 3BD6A 2ATIA 3EGCA 4ICIA 4MIEA 4UEQA 4C3UA 2IODA 4J0JA 2QGFA 1NHGA 2BC9A 5F4BA 4ENQA 2DUUA 1HLDA 1MV8A 1TU0A 2BEWB 5JBNA 2OY0A 4C0BA 3QE9Y 3T9EA 4H3KB 1F3LA 5HQ3A 3OAAD 4LE1A 3DV9A 2JIBA 1IZ8A 3UUFA 4E33A 3IPRA 3LM8A 2WM3A 4KDRA 2ZXEA 3D8RA 3IB6A 4JQSA 3AESA 3D1JA 5IH3A 4QU8A 4Q9JA 2VEOA 1KYWA 1UIRA 3C5WP 1TA9A 2OTCA 1ZVMA 2JFBA 1GDHA 3ZKWB 5CNIA 4LYGA 1THZA 1ZK1A 4Z2YA 5CTAA 2HXYA 3OVMA 2O6LA 2GEDA 4BV3A 4DUGA 1QC5B 4OJQA 1JT2A 4IIEA 4ZMRA 1JMYA 4KGVA 1X7YA 1IEXA 3HJBA 4U7GA 1C80A 3EGXA 2OHOA 5E4JA 1KAMA 1FYFA 1V35A 4YK7A 5LQJA 2Z6VA 2BGJA 3P4XA 4G5HA 4RK0A 4ZTBA 1G8AA 4RD1A 3VU9A 6CHYA 4ZCMA 2KYRA 2PWYA 2RB4A 4NMXB 3UGQA 1F17A 3CWQA 4TWAA 1GQ2A 1PTKA 2PEYA 3A1DA 2VK8A 2BI4A 5TQVA 4BYGA 3R0IA 3QJYA 1E8NA 4JI7B 3L4SO 3RF6A 1ODCA 3F8WA 1L4UA 2IITA 2W83A 1GRRA 1Z8HA 3PKZA 3QHAA 4OQXA 4Q05A 3ZBPA 1KHTA 1FEZA 5JSKA 1II8A 2CYBA 3IAEA 4BV2A 2Y71A 2PT6A 3OEYA 1JEAA 4GYYA 1ZN2A 2JAHA 3O4VA 3RREA 3U1TA 3ZWYA 4V0NA 4Y2VA 3PEFA 1T1SA 3RF7A 3QLEA 3G79A 1J99A 3ADOA 1T8PA 2A1UB 4M8LA 2G67A 1UWKA 2YN0A 4D0LB 5AM3A 2X7HA 4S12A 1Q7TA 3N74A 1UBUS 3G13A 1E3SA 3BPSA 4IRXA 4MVYA 4WK2B 4DG5A 3MCUA 3MMSA 1H85A 1KEVA 4P5EA 1N4DA 2JAXA 4J6FA 1Y7PA 2ZUVA 3KSDO 3EZYA 3S70A 5HOEA 4A7PA 2VPIA 3VXKA 3WMRA 4G4SP 1JHAA 1DAEA 4J7XA 4M9SA 3ROTA 3UYLA 1FVHA 1XRPA 1Z0AA 3JQPA 2BFEA 5I7WA 3KVOA 4HGNA 3EEQA 3SXUB 2BTQA 2F3TA 1OFGA 4G9EA 5G3ZA 2W6QA 4RLFA 1M8FA 4B4KA 1K9VF 4DDVA 4L08A 1G7RA 1K6EA 5ARDA 1IULA 2R8RA 4KAXA 3NCHA 4FYMA 4TLCA 4OHZA 2IIBA 5DGXA 1D9XA 3DD1A 3SN6A 3KT0A 4KR0A 1JSCA 2ZYIA 3SNHA 3MTQA 3KZXA 5FFMA 2QRPA 5EEGA 5F1OA 3SG0A 4F9EA 3LQQA 3SJCA 5GIPE 5K0SA 1WBDA 4EG0A 5GADl 3K0SA 4F7DA 2NU8B 3IQFA 1EVQA 2LVBA 4RPJA 1SKMA 3CZ5A 3NANA 4YRQA 2QSZA 3CBGA 1I2DA 1TU4A 4B3SB 3PYMA 1ZI8A 1JYEA 3CJQA 3OOYA 4YRKA 2B9EA 3LWDA 3IVMA 5IJ0A 1RPZA 4MGYR 3VBCA 5IJXA 2BEVA 5HJ5A 3MAJA 4K3UA 4WKBA 1G38A 4KFCA 1BXRB 4ZVUA 5HM6A 3W5IA 4JKYA 5JROA 5LB2A 4HDSB 2NSDA 2ZI7A 5LP6F 4QDUA 2B98A 1V9SA 3K9LA 2DLCX 3EZ2A 5CX1A 1JXAA 2ZI6A 4G1MB 3BGSA 5SZIA 4Q9NA 1U0LA 4N9WA 1RHKA 5K4AA 3T3DA 2NGRA 2I6SA 1R6VA 1LXCA 4RK4A 5DJ5A 3KHTA 5A62A 1USIA 4UAUA 3PZBA 3ZWKA 4NNJA 1G8HA 3FSGA 2R97A 1PG0A 4PFSA 1COWA 1WEHA 4AUEA 3DOJA 1ULHA 1X74A 2FF7A 1MAVA 4R9SA 1TYCA 2EP7A 1GSIA 3GJ8A 4B9AA 1AA9A 3DB2A 5FL7A 3HEBA 4DLZA 5CAEA 4FW8A 3LY8A 3UICA 2P2NA 1CTQA 1RJ9B 5AHRA 2B2NA 2UXDB 5E3HA 4U39A 3UG6A 1G2OA 1VYUA 4Q03A 4PZYA 2RHDA 4QUJA 4UXHA 4FZJA 3ER6A 4CWAA 4XB1A 5ICFA 2O8BB 4D42A 3T9CA 3M2PA 4GNRA 1UL1X 3X2EA 2HK6A 4QUHA 1NJ2A 2G5CA 3ORQA 2JHFA 1UBRS 1DBIA 1YZUA 2Y1OA 4Q4CA 1VFPA 2GRUA 4IDQA 1E9FA 3IIKA 1WOYA 1O6CA 1PSZA 4MK4A 4U7PB 5FTWA 2NQ8A 2CVFA 4S35A 3ZW8A 2GAIA 2PIAA 5GGYA 3NX4A 5JS8A 4YRSA 2NO9A 1YIDA 5AKYA 2YV2A 4J1TC 4CKYA 3IT0A 5GGXA 3DE3X 4KWTA 4O4IA 4ADSG 4B44A 5B30A 1CZLA 3KB2A 5DI9A 2NAPA 1N8NA 2N9UA 2BEJA 3OWHA 2X5OA 5LQKA 3GLVA 1HETA 3U4GA 4AECA 3CKYA 1UM9A 2RH8A 4HRVA 4HRAA 3RLFA 2C1EA 4EABA 3H87A 3EC1A 1DS6A 2Y0PA 2B35A 3O9VA 1E2HA 5C8YA 1N4AA 4CIDA 2GFIA 3N9IA 4Q7JB 4NZPA 4DS3A 2HRZA 1J7KA 1NI5A 2ZE6A 2XYPA 1ZY2A 3A1EA 2J6BA 3KAPA 4IHKA 2FUNB 1IDOA 2R60A 1Z0SA 2WE7A 3IKJA 1ZEMA 1DAGA 3MJCA 3Q9SA 2WFMA 3QMMA 4P3YA 3OM0A 1MTOA 3TZLA 4B2LA 2FFRA 4E7OA 5K8CA 3OY7A 3P0IA 4BFSA 1H3NA 4RAQA 3T4EA 1G16A 1UUFA 2DXIA 2P4SA 3AY7A 2AR9A 3WRVA 4CV3A 4JJ7A 1JECA 5AUNB 1DC7A 3VR3A 1C5KA 4ZRDA 2AE1A 1VGRA 5JJ5A 5I7UA 5KNBD 2A9VA 2Q5QA 3O8BA 5DNEA 3W3ZB 5HOQA 2Z08A 1LJLA 2JFUA 4D7AA 2F2TA 1Q3HA 4WDRA 1JZTA 3VZSA 1F0NA 3EQ2A 1MX1A 3JPYA 1IOVA 4R3WA 1WE2A 3OCXA 2BFOA 3OT1A 2FLKA 4GD3Q 5LLSA 2REOA 1IXSB 3PRHA 3RKRA 1IWPB 1PGNA 3P9SA 1K6MA 1EFVB 3ETCA 3KQVA 1EUZA 4GMFA 4I50F 3TLEA 1JJBA 3WGYA 4X20A 2ZJ1A 1QF6A 4AP5A 1JSZA 3D2LA 3TG2A 2YVLA 1LV7A 4RTPA 3TQFA 1KHHA 3HBMA 1XWWA 2QX6A 3F3MA 3GG2A 1RIIA 3MC1A 3VR1A 2IOYA 4UBIA 4LRWA 4WINA 1A1VA 3GLHB 1JKMA 2AJCA 2I4LA 3G5TA 1LTHR 2X5KO 2Q4OA 3N58A 3VVCA 4R2LA 3BWXA 4MB0A 1V3VA 2OBBA 1QHIA 2QJTA 4M8NE 4YLYA 5JWHA 5CCDA 3RLIA 1TF5A 1BEZA 1SVOA 3WGTA 4IGAA 1OSNA 2R2GA 1JXQA 4U2EA 3G59A 1PJ4A 1T2VA 1ZK4A 1W2HA 2P77A 3PUYA 4O4HF 4YDHB 5F78A 5FI5A 5I9NA 2ZJ3A 3S2GA 5M7EA 1JLLA 4WCFB 2VJBA 3KR2A 3A11A 3OOJA 1K63A 3IYLW 2BFAA 3Q40A 5KQGA 4TTQA 3FCXA 3TW6A 5K7SA 1EUQA 2L18A 4BJ5A 4TV9A 2R1VB 1VA4A 3QELA 1A7KA 4FGJA 4ABTA 4MRAA 1B2RA 1B74A 1SUWA 4H15A 4BBJA 2TS1A 2RAFA 4ZP1A 2CEKA 3WYFA 2HV8A 4FEGA 3AF5A 5E7QA 1C9YA 3SZ3A 3BXZA 2F3RA 4B87A 1SVUA 5KYNA 2QE7D 4KE8A 4MJLA 3THYA 4RESA 2L17A 4UCXA 1WF6A 3HV2A 3SEQA 4I36A 1NFRA 2IQIA 5BYKA 1I5OA 4TXNA 1WUJS 4R7TA 1C0KA 1SIOA 1WA5A 4HAUA 2AHRA 2DHQA 1DJQA 3W90A 1GL7A 4QQFA 2HK7A 5AVVA 1TMYA 2Q07A 3OZAA 4EKGA 5AUOB 1AQJA 4ZN6A 2Q6KA 1LTKA 4KIJA 3COYA 3DDCA 3OE7D 3QA3E 2AGVA 4OY3A 2B1QA 4Y1RB 2Q8QA 4XDYA 1PGJA 4KPEC 4C07A 2DCMA 2OV4A 3NHAA 4P84A 2QQFA 3ULKA 1C4WA 5J47A 4MRNA 2FU5C 2FWMX 3VKUA 5K0EA 4NP6A 4HKTA 4OYYA 4FMDB 3RPEA 2E89A 4Z1MA 3VUEA 2CNBA 3V3TA 4NAUA 4FHFA 3WHKA 1UWCA 2Z56A 4FCWA 4ZRMA 3IEXA 5HIJA 4AKEA 3MQFA 1U04A 3D8TA 1WNFA 3K9WA 4L3OA 4G4JA 3LUAA 4GGPA 4XKJA 4B4WA 2EW8A 3BSWA 2ID7A 1XZEA 1Y34E 4JFAA 4EO9A 2XQJA 3KB6A 4ISCA 4C05A 1SKYE 4KSBA 5BQOA 4WRRA 4DMKA 5J43A 2NAFA 2H54A 4Y2QA 2FOIA 4RVGA 4BTEA 3WMWA 2B36A 4NMWA 2ONZA 4DR7B 3WKDA 1V1MA 3U16A 1FY2A 3GPIA 4F3YA