5HXAA

Crystal structure of an udp-forming alpha, alpha-terhalose-phosphate synthase from burkholderia xenovorans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
458
structure length
448
Chain Sequence
MSRLIVVSNRVGGLAIGVLDALKETGGVWFGWSGETVSEPSAPVIEKQGNVTYATVGLTKRDYDQYYRGFSNATLWPTFHYRNDLSRYDRQEYAGYQRVNATLAKQLKELLKPDDIIWVHDYHLLPFARCLRELGVKNPIGFFLHIPFPVPEVLRTIPPHEELVKAMCSYDVIGFQTDADRQSFVDFIERGQHGTSSEDGMVHAYNRFLKVGAYPIGIYPDAIAKAAEQFTDRKPVRSLRDGMRGRKLIMSVDRLDYSKGLVERFQAFERLLLNAPGWHGRVSLVQIAPPTRADVQTYQRIRQTLEGEAGRINGRFAQLDWTPIQYLNRKYERNLLMALFRQSQVGYVTPLRDGMNLVAKEYVASQDPADPGVLVLSQFAGAAEQLPGALVVNPFDLSQMAEALERALSMPLAERQARHADMMAPMRENNLSVWRDTFLADLRNVATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an UDP-forming alpha, alpha-terhalose-phosphate synthase from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Protein binding
molecule keywords Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
total genus 175
structure length 448
sequence length 458
ec nomenclature ec 2.4.1.15: Alpha,alpha-trehalose-phosphate synthase (UDP-forming).
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00982 Glyco_transf_20 Glycosyltransferase family 20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA02
4N39A 4EJ2A 4L22A 4KQ2A 3PE4A 2QN9A 3EBOA 5IKOA 2AMVA 2XGSA 4AMGA 4RIIA 1UZUA 1XKXA 4BQIA 2VCHA 2IW1A 2GPAA 1FC0A 3RSCA 1AXRA 2F3QA 4PQGA 3E3LA 1AHPA 3VUFA 4MI6A 4MHSA 2BISA 5D01A 2PQ6A 3T3HA 1L5RA 3S28A 1L5SA 3D0QA 4HWGA 2O6LA 2QN1A 3CEJA 3MRXA 3NPAA 3GPBA 1IIRA 1UQUA 5BNWA 2X6RA 3VDMA 2PYDA 1LWNA 2ASVA 1L5WA 5DU2A 1SXPA 1Z8DA 3MS4A 3MTAA 4NEQA 2XCUA 1LWOA 4G2TA 1PSWA 2X0EA 5TMBA 3MS7A 3DDSA 2F3SA 3L7CA 3G2JA 2R60A 4GZ6A 3L79A 3BCUA 3HBMA 2C4MA 3MT8A 3MQFA 3SYMA 1O6CA 1Y6GA 4GZ3A 2X0DA 3HBNA 1NZDA 1GG8A 4GYYA 8GPBA 2SKEA 1ABBA 3AMVA 2R4TA 3NP9A 4GYWA 2Q6VA 3L01A 2FETA 3D1JA 5TMEA 3E3OA 2GPNA 4NC9A 3OTGA 2XA2A 1J39A 1Y8ZA 3H4IA 2GM9A 1QKJA 3T3GA 1JIUA 1PNVA 4WACA 4AN4A 7GPBA 4MHOA 1EM6A 2G9VA 4EKEA 2GEKA 1K06A 4LDPA 1P2BA 3G2NA 1YGPA 3MT9A 2QN3A 3WC4A 4MRAA 2QRPA 2GPBA 5DXFA 2QZSA 2QRGA 2GJ4A 3UYKA 1NVKA 1C50A 1FTYA 3CUWA 2ACVA 2IV3A 3NP7A 2SKCA 3OY7A 2VSNA 2ECPA 3CEMA 4AY6A 3IAAA 3QKWA 3S27A 1NOJA 2IEGA 1XL0A 2R4UA 3BDAA 4F96A 4AY5A 1RZVA 2C9ZA 1V4VA 2H1HA 2PRJA 3OKPA 3BD7A 3MRVA 1WW3A 4BQFA 2AZDA 1PYGA 1P2GA 3MSCA 3ZCVA 4F9FA 2QN7A 4RIGA 1Y6FA 3NCHA 4RIHA 5I45A 1HLFA 2VSYA 2BFWA 5ENZA 3ZCTA 4YUAA 1XV5A 2QRQA 1C8LA 2BGTA 2XGMA 4M83A 2IUYA 1F0KA 2G9RA 4CDRA 1M5RA 2QN2A 3TOVA 2XA1A 3Q3IA 3VUEA 1JG6A 4BQEA 3S0JA 3ZCQA 4CTMA 3SYRA 3BCRA 3G2HA 1NLMA 3EBPA 9GPBA 3NC4A 2G9QA 3DDWA 3UYLA 2YJNA 3G2LA 2QLLA 1GFZA 3MTBA 4M60A 3T3DA 3CUVA 3GUHA 4XIFA 4W6QA 3S2UA 4X7MA 1EXVA 3G2KA 3T7DA 3COPA 3WAGA 1QM5A 1XOIA 1VGVA 2VG8A 5HXAA 4Z5XA 2IYAA 3PE3A 6GPBA 1FTQA 3MTDA 1PN3A 3OY2A 1JEJA 5TVGA 3HBJA 3MRTA 4AMBA 2FFRA 2XCIA 3CUUA 3HBFA 2HY7A 3OKCA 2PRIA 1GPYA 3L7DA 3E3NA 3VDNB 5IKPA 2JLBA 2GT1A 2XGOA 1E1YA 2VCEA 1E4OA 3Q3EA 4GPBA 3RSZA 2BGUA 4FKZA 4WADA 1JIVA 4YI5A 3S29A 3C4QA 3T3EA 3T3IA 1L6IA 4REMA 1FU4A 3CUTA 2JZCA 4HLNA 3Q3HA 4RIFA 3D0RA 4XI9A 4N3CA 2QNBA 2F9FA 2QRHA 1WV0A 3CUYA 3CEHA 1K08A 4EL0A 2XMPA 3BCSA 3CX4A 3C48A 4MICA 3C4VA 5JTTA 1YA6A 2AW3A 2XA9A 3OTHA 4EKYA 1P2DA 5JTUA 3MBOA 2F3PA 1A8IA 2X0FA 3QHPA 4RENA 1UQTA 3ZCUA 1JIXA 3RT1A 1Z6PA 3L7AA 2QLNA 1XC7A 1GPBA 4F97A 2ACWA 1C3JA 4X6LA 4KQMA 1GGNA 2FF5A 3H4TA 2G9UA 2X6QA 2ZB2A 1P4HA 3MS2A 4YI3A 4M7PA 1F6DA 3CV3A 3MT7A 3TSAA 2WTXA 1L5VA 5D00A 3BEOA 4WHMA 4QLBA 1Z62A 1NOKA 1WV1A 1P4GA 2F3UA 4LEIA 2C1ZA 4N9WA 4KQ1A 1RZUA 5C1DA 4RBNA 4FZRA 4BFCA 1FTWA 2GEJA 1FU7A 1WW2A 3WADA 2H1FA 4MI9A 4NESA 3ZCRA 3ZCSA 1WUTA 3L7BA 2SKDA 5LQDA 3RHZA 1FS4A 5GPBA 3FROA 4GZ5A 1H5UA 1NOIA 1BX3A 1GZ5A 1RRVA 4RIEA 4N3BA 2OFFA 4EL5A 1KTIA 1Z6QA 5DLDA 1SXQA 1WUYA 1JG7A 3NAZA 3ZCPA 4CTNA 1GPAA 5TMDA 4X7RA 3TAXA 4X7PA 3OTIA 1FU8A 3IA7A 3T5TA 3DZCA 1L7XA 2ATIA 4N3AA 2KS6A 3BD8A 2IEIA 3OT5A 2QLMA 1P29A 2IV7A 1XL1A 2PYIA 3OKAA 2C1XA 1P4JA 3DD1A 1C8KA 3BD6A 1IXYA 2IYFA 3G2IA 1L5QA 2QRMA 4CTOA 2R68A 4MI3A 2QN8A 3NB0A 2P6PA 1FA9A 2AV6A 4RELA 1B4DA 2R66A 3O3CA 2JJMA 1NZFA
chains in the Genus database with same CATH superfamily
3L8HA 2GZ2A 3O4VA 3O8DA 4PZDA 4F86A 5HOQA 2ST1A 1RPZA 2WSSD 1QTIA 4BX8A 1K9SA 1A4UA 3LGAA 3EBOA 2BHNA 4Y2JA 2AMVA 4PHGA 2MMGA 2C95A 3QTTA 4GLJA 3TZ6A 4DJAA 1VYHA 3OLVA 3T5BA 1UBEA 4EP1A 4EVIA 2YWCA 2F4VB 4EKDA 4HEA1 4B9EA 3FY4A 3HVRA 1U2QA 1VP3A 4EW2A 2DH5A 2BI8A 3QXGA 5F5XA 2BUAA 1BDMA 2PUHA 4Q1FA 4JYCA 3TL6A 1WDLA 3OC6A 4B7ZA 5EY5B 3KJFA 2FJ0A 1I7LA 2DETA 4IDPA 2V8BA 4EPWA 3MOSA 2WJZB 3GCGA 2WIBA 2WPDA 1DXOA 1SQ5A 1XO1A 1HPLA 4RD3A 1J4AA 1VMEA 5LP1A 1RI4A 1I0LA 2QSYA 5ALRA 4P1ZA 3TL2A 3EYAA 2NO4A 2WU8A 4JGBA 1U3TA 4D8VA 1EEXB 1Y3DE 4ZT5A 1TADA 3KLOA 4CVNA 3LQ2A 2VP5A 3D0QA 3VOAA 3AKCA 2TMKA 5CXXA 2GOYA 4WOBA 1U1CA 2ES4A 3EGDA 1PR2A 3EWIA 3QJ5A 4GE0A 2V65A 1WUJS 3AL3A 4XGRA 5HJEA 5KDLA 1E0AA 1NUSA 4BVAA 4QTUB 3GPBA 1WSWA 2I6QA 3NLLA 1UOQA 4QHSA 1J6UA 4GKKB 2KX7A 4ATNA 1HZZA 4UXIA 2WFAA 4MVXA 1WHSA 5DX1A 3JQ8A 3LP8A 1ZRHA 1N33B 3NHKA 5K3DA 2BFFB 3W2TA 3W90A 3ZHRA 4GWGA 1BC5A 2PGNA 3P4YA 2O54A 1P60A 1JS1X 3O91A 2PGLA 2N1MA 3MQ2A 4L6AA 1N2IA 2BHTA 3LSTA 2IOQA 2YY5A 2PIAA 2Z5VA 5CU7A 1QFJA 1LWOA 1Q0RA 2WJWA 4UVGA 2YZ2A 4JI0B 1MVNA 5CA1B 1PF7E 2O2EA 3SD7A 5ICSA 2QG9A 2GBFA 5IJWA 3PQ3A 4E5MA 3IMCA 4QC2A 3LC0A 1T5IA 2DBVO 2ZCVA 3G2JA 3VPXA 1ODCA 3IV7A 2QN6A 2YN0A 1JPNA 3VPDA 4IUBS 2OHFA 4DV6B 1TM1E 1XDZA 5DN6D 1VPDA 1OOEA 3GP3A 4U8GA 4U2KA 1T5BA 4MWZA 3SYTA 3FYUB 2UYYA 4GZ3A 4NCNA 3RWBA 1U8CB 4BUZA 1J97A 2AEMA 2IDKA 3VOBA 2FRDA 2IX3A 1ES9A 2PWZA 3A2NA 1LZKA 1Y9EA 1NZDA 3DUFA 4HAYA 4UNPA 3WMXA 1RABA 1EESA 4ZQCB 4IXWA 3CRRA 2XUDA 1ZN8A 5FWDA 2ZYTX 1PTJC 1X1TA 2QG4A 2Q1SA 1P7ZA 2FU5C 2RKWA 2ZBDA 1DKOA 4KB5A 5AOBA 3SXPA 4D43A 5T67A 3IMKA 1VG0B 4V38A 3T4PA 1QG2A 3H87A 4MYTA 4KO2S 4DLZA 1PW7A 2AMLA 5ADWA 3NRJA 3O3NB 4LDAA 1TQ2A 4DIBA 2GPNA 4RM2A 5TEVA 4J1NA 4E5SA 2JLCA 2ECOA 3QUQA 3C5VA 4II2A 3B3QA 4V3BA 2XYPA 2H7CA 3I1YA 5KWSA 1W73A 4MWOA 1DAOA 1EGMB 1Y48E 2D8AA 2DQSA 5FUXA 2ZJ0A 4R9NA 4URUR 3GT7A 1HDYA 4HDOB 3PKIA 1DOHA 3H9GA 4ZTBA 3UXYA 4TV9A 3ZWQA 2G70A 3EZYA 5A05A 2QVZX 5D51S 4LAFA 1YB1A 1ICEA 3H19A 2FH5B 1SFRA 2R8YA 1OLXA 5ESRA 1H23A 1P72A 1RPAA 3G9TA 4Q24A 4YIKA 3VPCA 2QN3A 5LP6F 3QPDA 5DH9A 3DZGA 3HO6A 1T35A 3FCEA 3RW9A 4XFDA 4J2OA 1P0PA 2LVBA 4C0JA 3R0IA 4RVGA 2F55A 4ZALA 2GCEA 4B6EA 5EE5B 4CLEA 2P2YA 3L0ZA 2HTFA 1B7GO 4YLEA 2Y3IA 4MWBA 1PJ2A 3LCMA 1HYQA 2Q4OA 3ZE0B 2JAOA 1HGXA 2VAVA 2WF7A 2J7PA 3PXEA 3D4IA 2F64A 2WYUA 4J91A 2P4SA 4ARAA 4E2ZA 1RXIA 1IEXA 4DR7B 1LI4A 1QPBA 1NW4A 3AF4A 3VX4A 1NXWA 1Z6ZA 3C24A 4Q1VA 4ALNA 2HRCA 3JQAB 1WQ1R 5JD3A 1JN0A 1R6BX 4GLFA 2Z6AA 3HCPA 3VH3A 2B4AA 1Y1RA 1YRWA 3ME5A 4Q15A 3A7DA 3H8SA 1QS0A 1VSTA 1QFXA 1JG2A 2ZLBA 2ZYGA 3C6KA 1KJWA 4IY1A 4II3A 3TTXA 1W88B 1MH9A 4MKXA 3QEMB 4IFIA 3JQ9A 2XXJA 2FWIA 3NT4A 2P2ZA 3TLMA 1B8UA 1LPBB 2C29D 3NOVA 1Q77A 1P1IA 1JSCA 1P5FA 1W59A 2CEAA 1XXHB 1JNXX 2H0QA 2RK6A 4OLFA 3S8EA 1JFSA 1J2EA 1DJNA 2CXQA 3EH2A 4I9NA 1K97A 3TRKA 1QP4A 4FMDF 1ZRMA 3K4PA 2HIMA 3LBNA 5HF9A 1XNHA 2W2LA 3O9ZA 3QVWA 4R2WA 3G13A 1W581 4JQYA 4DLRA 4CG0A 2QLFA 2VP0A 4Q48A 5IYZA 2A88A 4H6VA 3RS5A 2ZXEA 4I66A 4MMZB 4CR7A 5JARA 3AVXA 1HXHA 4NHEA 5AHKA 4S2UA 2ZE8A 3HXLA 3B7WA 4HB3A 4JS0A 2IYZA 4H7JA 1JJAA 3HB4X 1NMSA 1HQKA 4P36A 3K05A 1YZLA 2JB9A 2FVXA 1M1YE 1ZZGA 2Z5LA 4AZ0A 4LBWA 2YUIA 2HL6A 4YXFA 1YCDA 4GOMD 2Z1NA 3G6KA 1XEWY 4YBRA 4QA9A 3GYBA 4M4SA 2Y1OA 1AKUA 5DI3B 1G291 2HK9A 3G82C 2CCGA 4N7MA 5FPTA 5A3SA 3S0JA 1JAIA 3GZ4A 3GVCA 3Q2OA 1KJ8A 4OEHA 4YECA 2DPLA 4J75A 4O2AF 4KOEC 4ANFA 3IP8A 3FNIA 4K8RB 4MLPA 1F48A 5ECWA 2WWVD 1WCIA 1L7PA 4R16A 4C0AC 1L8XA 1XMIA 1W0KD 1FK8A 4G89A 2X3YA 3N5KA 5E1MA 1H4TA 1OMOA 2VOEA 3GX1A 3TTTA 3ZX5A 3PEWA 3DLHA 5IAJA 3U7HB 5J4LA 4G0XA 1SHUX 2GHRA 5DT2A 4XD7A 3EPPA 1TZ2A 4Y9SA 3OU7A 5BOVA 2IYOA 4JKIA 4PHTA 1Y1SA 2ZITA 1W4LA 3DAHA 2G72A 5I7SA 1GPNA 3GLSA 1PR3A 2CL5A 1ISRA 1JFFB 1A9YA 4S12A 1HE8B 3G0OA 4TTTS 3D6FA 1GEEA 3T7DA 3COPA 3DT6A 1HDIA 1XZGA 4N01A 1QM5A 2OP1A 1G20B 1GKIA 2GZ3A 1EJ0A 5HXAA 4ONEA 4DBLC 2IHYA 3CJRA 2GM5A 4ALLA 3K09A 3U4QA 1J9EA 2P4HX 1L4UA 3RHSA 4ZV7A 2NLOA 1T8SA 1N6HA 5CB6A 5M29A 3Q8KA 1A04A 3DONA 3HY4A 1R5OA 1XYYA 2WVJA 4V0SA 5G0SA 3KSBC 1Z3CA 2R751 1PS8A 1GG9A 1XWWA 4LDZA 4IF4A 4IKEA 2CNOA 2IBMA 3RAGA 3GRZA 1UODA 1U7DA 1DKLA 3DE4X 3MNFA 1JEJA 1WSBA 2F59A 1QP0A 2Q1TA 3VH4A 1W5AA 1U31A 1UKEA 3JQRA 5IJZA 4DGSA 5EKUA 5BQPA 3RC7A 3WK5A 1KDRA 2I6XA 3O1LA 1U2SA 2AC4A 2W8BB 4TTIA 4CODB 2ZJ2A 1XZKA 1QTRA 2VDQB 3JZAA 1JWAB 5KUTA 4H1TA 1R50A 4TQUS 4JLAA 4RHCA 1Y7IA 4U2DA 2W58A 1OW3B 4PPQA 1QHIA 4C30A 1ZS9A 3I01M 1PCXA 4NBWA 3Q7PA 2B35A 5K3AA 1NM5A 4UAGA 4R8MA 1A1VA 2PUVA 3L77A 4R54A 1N6IA 3KEQA 1TT5A 4PLYA 2Z57A 5A71A 2J48A 4QYXA 1NFRA 3H0KA 2C8JA 3AY0A 3LRXA 4PXAA 1CJSA 3W6PA 2UYCA 3NANA 4QO7A 4E5PA 3GFRA 3D6VA 1YDGA 1VBKA 5IK2A 1P9RA 4REMA 3RCBA 1PGNA 1VL1A 2DKFA 3U2QA 3CUTA 5JCXA 3N53A 2YZGA 4RABA 3LLMA 2QUBA 4L85A 3BOSA 1RS0A 3A1EA 1TZCA 2GM3A 3GF4A 1QRSA 2P3SA 2RJOA 4OIMA 1RACA 1WMDA 1ZSYA 2PX4A 4PWZA 1JF8A 2HIHA 2HWKA 4Q7KA 4B6QA 4DNOA 3PD7A 1PR9A 3L4BA 2AN4A 1YAHA 4BOYA 5KJFA 4MKZA 3R9XA 3OF5A 1XD2B 4EKYA 3PDIA 3NIFB 1DVRA 3DMHA 1ZXLA 4MUKA 1C1YA 2CNNA 3DGFC 4AYTA 2GKOA 2IUTA 4C0QC 4DRXB 1WXEA 4ZOQI 4IIJF 5F9MA 1QHNA 3T95A 1JXAA 2G1PA 1TMKA 1HFEL 2GEVA 2P77A 3C5CA 3QFTA 5CJ2A 4YUXA 2O3SA 4J3FA 4PSCA 3RT1A 4B85A 2I2XB 5IZCC 1DAMA 1WXWA 2QLNA 3D1LA 3I83A 4CKEA 3WICA 4JI4B 2D1TA 1X1CA 2XY4A 3EDQA 2IXEA 5KC9A 2PGDA 4NE2A 2ZIZA 3I2IA 4D44A 1SCUB 1X8LA 4KQMA 3VU8A 4OOFA 5CVUA 2HMWA 3DFMA 5AVXA 2GHTA 1KP9A 3KZVA 5THKA 3I6YA 3FPBA 4G8JA 1OZFA 2OPHA 3RIGA 4IMPA 2FG5A 1D1TA 1GSOA 3WSWA 5B6PA 1SBTA 1PWEA 1LGYA 2D3TA 2X3FA 2XUOA 3C3XA 3E23A 4Z9AA 4BMXA 3J7AC 1GA6A 2O8FA 4JJZA 1ZI8A 1PYOA 3WGNA 4K03A 3EARA 3NBAA 1W1UA 4KTTE 3R7BA 3GNQA 3P0IA 3PNQA 5TSDA 3WLPA 3ML1A 4UOEA 1IM8A 3TECE 1XXHE 3FJYA 4BDTA 1EFTA 3G88A 3VYTB 1W75A 2WV7A 1DPFA 4EHFA 4X5OA 5LZ9A 5B3LA 1DUIA 1H69A 4X64B 4A1OA 4R01A 1TMGE 3M6IA 3QUAA 2IHJA 2WABA 4DIEA 2O7RA 4LDJA 1R0SA 3EMKA 4N6NA 4H4DA 2IT1A 1EA7A 2XCRB 2SHKA 4BQSA 1RFLA 2O06A 1L5FA 1YR6A 2DPGA 2Q2QA 1RWVA 4D9FA 1NMZA 4LJ8A 3W6UA 1OTXA 1JDNA 5AVUA 5HIAA 4B3MB 3LH5A 5AM4A 1Z0JA 3GRPA 3QXHA 2HSGA 4HQLA 1BVRA 2ODEA 3O8BA 3EG5A 3IBFA 1L1RA 1U3CA 5I4BA 3EF1A 4NENB 3W9YA 2WDPA 1Y8RB 3PJGA 1LSOA 3AILA 5CNMA 1JL3A 3ORFA 5HQJA 3TIGA 4KCGA 4C4XA 3QHAA 2J5XA 1I3LA 2SKDA 5AVQA 3WNQA 1P0FA 2F8LA 3ETNA 3ITEA 2N75A 3WIBA 1H2FA 1W48A 2C1EA 2SNIE 1FS4A 4HX2A 3THOA 3W1VA 4M1TA 4AG6A 3OUTA 3WFIA 4M1MA 5IVPA 3E6AA 2ZRJA 4BV9A 4ZHQF 2HSWA 1E1RA 4UM8B 1CHDA 4IAOA 2NAFA 1S96A 4Q4AA 2CEKA 2HXYA 4HNSA 2FX2A 1T9BA 3NHAA 4BIIA 3NTOA 1V4BA 5KOIA 3ZH9B 5LYJB 3BIJA 2QGZA 3AFGA 4RC9A 3O8OB 4R2LA 1CJUC 2PQ2A 4Q3KA 2VUSA 4D8XA 3K0FB 4LK2A 4FEEA 4JEUA 1P0CA 2Q1XA 4LJ5A 3QY9A 5HDQA 3ZE7A 1E1MA 2D1QA 1OY1A 1VIYA 5FAXA 2AC2A 4MVJA 4E2YA 1EDOA 4RVFA 3AR7A 3AU9A 3EIQA 2ORWA 4JXJA 3TSZA 2DR0A 4QTZA 3QPCA 3WDMA 4NECA 4CBVA 4UOZA 4EGCB 2G4CA 4PSAA 3RTGA 3KD2A 1ORIA 4ZVTA 3DFIA 2F00A 1TA4A 2JKZA 2X13A 4O2BA 4TLDA 5AIBA 5IYZB 2IPXA 2ZBEA 3GDGA 1UMCB 1WCWA 2MDTA 3CR3C 4OI4A 1G7SA 1P1JA 3TKYA 2AF3C 2B2CA 1DAGA 5KWJA 1Z16A 2IYLD 2OUIA 4UBIA 4JI3B 3DPUA 3I9OA 3O4HA 1CR4A 3EJ6A 2XWSA 5EHGA 1XXHA 4F0JA 1D4AA 5AKEA 3W1WA 5A4MS 3JD0A 2GVDC 3AF6A 2YX1A 1IXYA 2I3BA 3OFKA 1JQLB 1SHKA 3C3AA 4FHFA 1Y6QA 1Z26A 1CUWA 2D54A 5IVIA 2DJ5A 3V4SA 1ZK2A 4FOOA 3HCAA 2F1JA 1AKEA 2GYWA 4I4TF 4TV8A 1U3UA 1D1QA 3AU8A 1Z34A 2VLIA 4K28A 2JJ2A 3IOMA 2IA5A 2AXEA 2OSVA 4YACA 3VHXA 4A1FA 3ZKWA 2ONKA 2RGNC 3TNDA 1I1NA 1R8QA 4WPGA 4RELA 1B4DA 2X7HA 4JODA 3EGVA 1JLLB 1EBBA 1ANKA 2FMFA 1A2KC 3JQAA 2EFCB 3KSMA 3NGMA 4KAJA 3C1OA 1WKBA 3NBXX 1P9NA 3ZK7A 2XYHA 4DA8A 1YZTA 1XIVA 3OC0A 4FSDA 2JH3A 2QY9A 1NYLA 4ARCA 4UUPA 3PE4A 1U0TA 4X6UA 2RKOA 2C97A 1S1MA 4M1QA 4UZEA 1FFSA 2QA5A 1KU6A 2ODWA 2VPQA 3AGPA 3LGXA 1MVOA 3BGOS 4A5SA 4BC1A 2EW8A 1XMOB 1RJ9A 1MN6A 3D8RA 3GI1A 1JEQA 3JZFA 3OFNA 4O4LA 3I5AA 4LRYA 5LA6B 4PF1A 1Z63A 2W4QA 3EGWA 4QTYA 1IBCA 4Y6RA 3S7ZA 1BMTA 1Z5UA 4PR0A 4XOIA 2QYTA 4OAPA 1GT6A 1KVUA 2OXEA 2ZI6A 2ZRIA 5EG5A 3ROPA 2FPRA 3NO4A 3V55A 4HVCA 4Z4CA 2Z83A 3TLYA 4ARSA 2ID4A 1RKXA 2FUCA 4WL0A 3EAQA 1CY6A 3BH6A 4BY9E 2DVMA 2O7NA 2IP1A 3HRKA 1JH8A 4ND8B 4DWWA 1ATIA 1EFRD 4E4RA 4CM9A 1QCDA 1CQIB 5FPKA 2FW7A 4FGLA 5K3BA 5E4TA 3MTGA 2CVQA 1QE3A 2FPWA 2GLXA 2WJ4A 4N5NA 1DX9A 3IAEA 4PO1A 1J8FA 1LDBA 2QTTA 4GLBA 1V16A 1GQFA 3EC7A 4M6WB 3K16A 4KC0A 5H3CA 4L8WB 4J0IA 5D3ZA 4EJ6A 4DSAA 3JYNA 2HHHB 2KW5A 4U6QA 3CW2A 5A4KA 3OCVA 5H83A 5J3JA 3BE8A 1M6WA 4ZOCA 1V8OA 3EA5A 3PFHA 4PLZA 1RHUA 5BSFA 1L5WA 3CNOA 3FLMA 1GLVA 4RY8A 3VR6H 4ZJUA 2FV8A 1N2SA 2ZBVA 3MRSA 3CX6A 1P18A 1UXHA 1Z8DA 3KJZA 4G07A 3ULKA 1F7UA 3EZGA 1RHMA 1ESCA 2D00A 2VTDA 4U02A 1IY2A 2JIOA 3GQBA 2VP6A 2REXB 1U1DA 3CWQA 2CSUA 5ENDA 4ZJZA 1Y9JA 3HH8A 3STVA 3U1TA 4CFYA 4G2TA 1DV1A 2WM8A 3GL9A 3OO0A 1EK2A 5CB0A 4BPBA 3AR5A 4YR9A 4ARVA 1H3FA 3PX3A 3PHGA 5CMLA 1PJRA 4JQZA 4YO8A 3VI3B 3IC5A 5T4FA 3REQA 4QAJA 3PYLA 4MZXA 4JUBA 3AHJA 2UXCB 1V1RB 3TZCA 4R2HA 3PWZA 2A9FA 4L5BA 4DMCA 2W2VA 3CH4B 3UUWA 1OR8A 1GZDA 4ZCRA 1LSUA 3FMIA 3K20A 3TDNA 3GCXA 3GXOA 3GA0A 3MQFA 1XZDA 1FXWF 1XTVA 1WF6A 3KZKA 3DFZA 2PKRA 4XB2A 9ABPA 4WXYB 1H9BA 1Q1QA 3TXYA 5HCUA 2HIGA 4GQIA 2J0EA 5BR8B 2O0KA 3FUXA 2YH2A 4YJDA 1IYZA 1H66A 2YJTD 4ZXPA 3COVA 1Z08A 1T9KA 3AFOA 1P8JA 2IHZA 2V6JA 1LBQA 3OQJA 4MEAA 3OLQA 3BX1A 1QX4A 3WY9A 3ZEIA 3ZIAA 1JTFA 1EIZA 1DUSA 2QGNA 4K9QA 1OA1A 2FWMX 4MV0A 2ZYAA 5BVHB 4L76A 4RKFA 4XTCS 1NJ5A 1B0AA 2I71A 3VO1A 5EP4A 2FHSA 1I01A 4UD6A 1L5NA 3ZJYA 5TMEA 4LXTA 3HJTA 4ILKA 3VTZA 1ESEA 1TUBB 3I05A 2ODNA 3TR0A 4YRAA 1ATZA 1SH7A 5I7RA 1RBQA 1IZ9A 4DAOA 3B3JA 3H4IA 3KELA 1QPZA 2IOYA 1N5MA 2QAGA 3HB7A 4B47A 5L6LB 1Q7GA 1JIUA 4WACA 4OUDA 3U81A 1YCFA 4NCXA 4NK4A 4M53A 3F3YA 2BP7A 2JFWA 4ODIA 1G1AA 4G0UA 1MC8A 1FP1D 3V34A 1ZAKA 1BMFD 1IULA 4N6GA 1XFAA 3MJSA 5B37A 1FSPA 4PYIA 1WP4A 2CL6X 1VE3A 3K8YA 5AO9A 5EE3A 5EIBD 3ZHOA 2WSMA 5IG2A 5BSVA 1MR3F 1FNSA 5JAOA 3UYKA 3LUAA 4Q3AA 3QYFA 4BMNA 2WIKA 4V0KA 1YFLA 4XYGA 1JA1A 3Q0IA 5JFOA 5JSUA 3TNFA 4NL4H 3C43A 3CUWA 3UWKA 2QTLA 3MD9A 2L2QA 3TWOA 2P6OA 4EHKA 1U8AA 3ORYA 2VWPA 3AF5A 3KB1A 1Q91A 4JUCA 1PVOA 4CKCB 5CT9A 5F78A 4LYYA 1MMFB 4MVJF 5TX7A 4D3XA 1SOVA 1SUPA 2F1HA 5H16A 4I1VA 3USCS 1N6PA 1A9RA 3LOUA 1NMQA 5AVTA 2R1TB 1T2EA 5TGDA 2OCLA 2PS9A 2PUTA 4OGWA 5LMUB 1AV6A 4XASA 1NN1A 1WMSA 4Q3OA 4E14A 5A4DA 3TD9A 1N3BA 4L4UA 3MJHA 5T4HA 4DAEA 2OHXA 5EUCA 1TJPB 4JLOA 3IR5A 4RQTA 1Q0QA 4ZC8A 1AGRA 3AWIA 4US2R 4EECA 4PNPA 1IB0A 3MRVA 2RGYA 4I2VA 3VXKA 1ISHA 5HRAA 2AG1A 1G5TA 2QTFA 4RVUA 2DF8A 3N2LA 4O4JA 1U2GA 1QBGA 3JTMA 3BWDD 3NNDA 3MSCA 3QKTA 4ND6A 4OFXA 4QDJA 4AUEA 3OOYA 2QVLA 1KYQA 3GPDG 3PC8A 3RS0A 3IKMB 4R8VA 4F9FA 2ZSDA 1CUZA 4PYQA 1D1PA 1K2VN 1MCZA 3TR6A 3WIEA 2FSVA 3WLAA 1XLTC 2X15A 1U7TA 4MB0A 2PH1A 3JD3A 2X0JA 5HF6A 4AJEA 4EQ6B 5EJ9A 2D2IA 2E4XA 4HH1A 3CLSC 4K9RA 1PJZA 2I80A 1G8HA 4UHFA 5CNIA 3QYAA 2BGTA 3CEPB 4R1PA 1XAHA 1O95D 2A92A 4F91B 2WNHA 4B8ZA 4B3JA 2VFAA 3BMQB 2NVUA 2RD2A 4LGMA 5DLQC 4TLMB 3V1YA 1AGXA 2QG6A 1E1KA 2J4DA 1XZEA 2OKGA 2Q5OA 3KSZO 3MWJA 4JMLA 3ZCQA 4LXYA 1N25A 3A0UA 3LXMA 1BZYA 5C1PA 2YNMC 4WLVA 1U6IA 4GKAA 4OJYA 2FNAA 1LTKA 5TS3A 2CKDA 3QEJA 3DMGA 4KQ9A 1TTQB 4GGOA 5EYPA 3ZZNA 4TMZA 2BF7A 5JMPA 3RS8A 3QV2A 4PQEA 5IC4A 3M82A 4R1SA 1YVRA 4FJ1A 4DR3B 2OV2A 1QIDA 3RU9A 1YBFA 2NU9A 1RWOA 1TTHA 4EHJA 4MV8A 1RLTA 3LCUA 2D74A 4U7HA 4M60A 3GJ4A 1KK1A 4U9UA 2XCTB 4W82A 1WQ3A 1ZR4A 1EUCA 1JG1A 1RAIA 2OYCA 2C92A 1DAKA 2VNAA 4G4SO 3IURA 3RADC 1LQTA 1YCGA 1VE9A 1Z8HA 2HSJA 3ACDA 3O75A 3QNMA 1M2KA 4I6JA 4RF2A 4RVDA 5EVCA 3O8OA 4ZVNA 1OREA 4LISA 5JJBA 4CV2A 3CKMA 4AX4A 4PN7A 2VG8A 3OZFA 4HMQA 4QBKA 1JDVA 5B4TA 4UARA 3ZLVA 1HETA 2G82A 1ODTC 1BDBA 1YI1A 2HGSA 2I34A 4RFSA 1XDDA 1TD9A 3ZY5A 3BXOA 3IVMA 1XCPA 2IYAA 1K1EA 5HM6A 1NXVA 3M6UA 3LBAA 3QXXA 2CXOA 4CKZA 1FMLA 5EZ6B 1JBEA 4QPDA 1LCIA 1TC2A 4C21A 1KSJA 4D41A 2AI1A 1NLZA 3AK4A 2ROQA 5FOUA 1HEIA 3CG0A 3HB5X 4HPXB 3W3ZB 4AX8A 4B46A 5TVGA 4Q4HB 2R0QC 1GRVA 1H6AA 2NV6A 5ANRB 4O0MA 3H5TA 3NVMB 4RKYA 4DCGA 3WA7A 1ADFA 2OL4A 3BA6A 1DT5A 5AXAA 2NVUB 2A30A 3GH1A 3F4KA 4QZVA 1H5QA 1LJ8A 1KBQA 3ONNA 4OQZA 3WMEA 3ZLBA 4JI7B 2UVPB 1E64A 5DRYA 2UUCB 4AN1A 2XB6A 4IJQA 1Z0AA 1QIMA 5JI3E 4QVIA 1G38A 1SG9A 2ZWOA 1KO1A 3SK0A 2DUWA 1TJ5A 3NHLA 3W7BA 2X4LA 3L6UA 4MUJA 5EP2A 3SOZA 4CF3A 2VCEA 3LUDA 3A9UA 1JAHA 2OXTA 2ISCA 4EQ6A 1D6MA 1HX7A 1RRFA 1W5EA 1MEJA 1QIJA 1LDMA 1RJFA 3CRZA 3NHJA 2WZCA 4XQ0A 3N8HA 5KX5A 1TF2A 3LS2A 4AFNA 5JZBA 4C6TA 4A6EA 3X2EA 3KQOA 3ZEAA 1GDTA 3Q3HA 2Q3CA 2R87A 2WG1A 4TT3D 1Y9ZA 2HU5A 3IIIA 2Q2VA 3DAPA 3PIRA 4I4CA 4JP8A 2NSHA 4B3FX 2F9FA 5HFJA 1NE2A 1QR2A 1EU1A 1HYBA 1K08A 2HSDA 1L7VC 1P6XA 2OZKA 2WOOA 3FETA 3GY0A 2IHTA 5C4IA 1OZAA 3FMPB 3ZDXB 2ZSIA 2JL1A 1X38A 1OPRA 4CKBB 1YA6A 1S01A 3LYAA 3LT5A 4PXSA 1G4HA 1JEOA 2BDUA 4WJZA 1P2DA 4DNFA 3HLYA 4AWAA 1O8BA 1Z0UA 4Q5IA 3WISA 4CGYA 1SCIA 4DG5A 5JADA 2XTMA 1DB3A 1XPRA 2R00A 1SRRA 1CQJB 5JYBA 2VPWA 5EJMA 1ULUA 1MNQA 1YUMA 5FNVF 2YZ7A 1PTJA 1LFDB 2HMVA 1XMSA 2WKWA 3WNCA 1XXLA 3F3SA 4RH1A 4XSGA 1R66A 2ET6A 3N5CA 4QJ5A 3U0BA 1VPWA 1A8SA 3EWSA 4O63O 5DX8A 3CZ9A 3PLAE 1LU9A 2AFHE 3JATB 3PUVA 1SCAA 2QYOA 2J3KA 3M0EA 4N0PA 5A3RA 4K8OA 4URHA 5JXJA 1J42A 3VVBA 4MR9A 3DVRX 4ER3A 5K9ZA 3AKYA 4A15A 5FPYA 2DUNA 1C5KA 1CRQA 1EJBA 3O82A 3AY6A 2YBEA 4LMBA 3FBTA 5EQTA 4A10A 2QU7A 3HVIA 4WJKB 3PQ8A 2P91A 4OUDB 2Y1LA 4G3XA 4MIOA 1MB4A 5ABPA 2M6LA 1XQWA 3IUJA 4DCSA 1Z62A 2GR9A 3A6HA 1BOFA 3GFSA 1CK4A 1G8JA 2VTVA 3OE4A 4LHXA 4QGHA 4TN1A 3U09A 1R10A 2ZRPA 3T9BA 3IYLW 1WULS 2QW1A 3BYZA 4C08A 1LDGA 1ZMTA 4KQ1A 1OB5A 1OXSC 3NDPA 1L8AA 1NKTA 1Q3TA 4B6RA 3AV3A 5C4GB 3VGJA 2DQKA 2A9OA 2F3RA 3HLTA 5LJLA 3BMCA 2ZCJA 1K75A 2GCGA 3T0IA 4BX0A 3AG6A 4UUMA 2VUTA 4KFCA 3Q8XB 3QK7A 4PONA 4RPGA 4R40A 5KYWA 4JL8A 1WP9A 2HNKA 4RV9A 3IJ5A 1HY3A 2ZIGA 1IFXA 1X1SA 1X7ZB 2GBIA 1POWA 2H1FA 5HQ3A 3PXCX 1R8SA 4X1IB 4Q4JB 1DC6A 2BFDA 1TAGA 3L1JA 3NHYA 4RDHA 3SU8A 4EFDA 1EVZA 3N1UA 3ZZ0A 4ZJPA 3F5DA 2B98A 4OP1A 3VHLB 4AP9A 4DSUA 1HDCA 4A26A 2JJ1D 1XNGA 3KQLA 2QZZA 3LXXA 4MRPA 4Y1RA 5LYJA 1GSIA 2KLBA 2P9ZA 2XE6A 1JIJA 3Q0TA 3QITA 3G8DA 4S3MA 1VHJA 3V2GA 2OCKA 4GM4A 1IH8A 4YMHA 4G37A 2WWGA 2B7BA 3DD5A 5E3JA 1JDPA 4ZI7F 2LE0A 3DKVA 3E5NA 5CGZA 3WMRA 1R0KA 1AN9A 2P0YA 5H82A 4IJMA 1RAHA 4B87A 1T6XA 3LXUX 4ND8A 1I0ZA 2Y2VA 2AQKA 4BEBA 1OZHA 4E5NA 5HVNA 1VPLA 3M6XA 4LSWA 2QY6A 3R0JA 2ZTUA 1I7PA 1HNNA 3QELB 1MF7A 4JYBA 5ETJA 3VI4B 1C81A 3KKNA 1LV7A 3DPSA 3K0CC 1Y3HA 4NLLA 3X0DA 1HMPA 1V7QA 5CBKA 2B2NA 3P0HA 3DMYA 4G85A 4HNUA 1DZ3A 1G2QA 2OBYA 4G01B 4FCCA 2B9VA 3WDSA 1M2OA 4FXOA 4ZO6A 2ZVPX 4J0QA 4GQBA 1OBCA 5I7FA 4DPMA 1H4QA 4FHEA 2HLPA 1ZBQA 3NFRA 5C2JB 2VRWA 4M88A 5AKXA 4QGGA 1A9QA 3TCXB 4P54A 3UH1A 5KU7A 5KAPA 1FZTA 5K6AC 3MINA 4ROTA 4XGQA 4Q7EA 1HSOA 2NADA 2GZ1A 2D1RA 4JLUA 3GG2A 5E4FA 5DI3A 4BVEA 3KUCA 3CKLA 5DGHA 5F9FA 1GDDA 2W11A 1CQZA 4UBNA 3HFGA 5DVZA 3CVJA 1PG0A 4P38A 3O8CA 1JALA 1TYEB 2Y1EA 5AJWA 3RUEA 4DEVA 2H6EA 1Z2PX 4RAQA 3D5EA 4BAGA 4PNZA 3ZZ1A 2PFKA 5KHLB 1WETA 3AVWA 3B6KA 3PDIB 3EEIA 2V3WA 1HLGA 1NI4A 1XTUA 5FI0B 3WWEA 4C3UA 1PD0A 4FX2A 2IC5A 1BU5A 4BKRA 2ZRFA 1R9GA 3NKFA 3GJSA 1MDFA 4K9OA 3RF7A 1Q5PA 2DUUA 4MV6A 4P31A 1V35A 3KAKA 4XX0B 4ZT7A 2QTMA 2CY0A 4KPYA 4KLAA 5T64A 2WT4A 4WFJA 1RJ9B 3CS3A 4RUKA 4QUEA 2H85A 2K2WA 4CIAA 2CLKB 1XAGA 3M1LA 4ZOAA 1GPJA 2GVZC 1UKZA 2FW8A 4J0EA 1WXGA 2ID9A 3CH5A 2ZTSA 5DHAA 1IZZA 1KIAA 2H16A 3BWVA 3PZBA 4FHDA 4GE3A 2C9OA 5CW2A 2HHLA 3VTAA 3E48A 1AK1A 3WP0A 4TZ0A 2WAOA 1UDAA 3D6JA 4C7XA 4MWDA 3G85A 5MGBA 1UZUA 3UN1A 1NMEA 3WGGA 4J9UE 4Z86A 3AGQA 3IDAA 3LP6A 2C7VA 1QJCA 5DSZA 2F3QA 3NWBA 1LZLA 1W49A 2WTNA 4LKOA 3VR3A 5FPHA 2HT6A 1VGQA 1CRWG 3I0NA 4JC8A 1FFEA 2I66A 4LPSA 3U62A 3HSKA 1ZJYA 3QRWA 2A1UB 3KWFA 5EGNA 2AFHA 5CTAA 1X7WA 1T5LA 4GU5A 1KE2A 5IULC 2F8MA 1UJNA 3HZZA 1W4BA 2RHDA 1NATA 4W1SA 5CIYA 1RM4A 4EJSA 3UA3A 2D7CA 2B2XA 1KMHB 2H17A 3HV0A 1IBRA 3EXIA 5CITA 1JUDA 4AYWA 3JWHA 3GHYA 1UINA 1WCXA 1IHPA 2GD1O 1V25A 1W0CA 3AF2A 1BWRA 3FUCA 4AY3A 3THXA 4FYJA 1L4MA 5JBQA 4EZBA 3CEJA 1MAVA 5BN4A 1YWGO 2XTNA 1QGAA 2YOFA 4BV2A 3CXUA 1VP9A 2VDPB 3NUGA 5YASA 3KQKA 3FLEA 2VYND 3LZDA 3DBHA 4L75A 4LQCA 3FTFA 2PT5A 4ZQHA 2CF5A 2BFEA 2FVYA 4IH1A 3F7MA 3DNFA 4H60A 3RYCA 1CFZA 1DQZA 5A9SA 1TVCA 4YJ2B 4L5JA 4YJ3F 3HA3A 4ENWA 4CL2A 1IN4A 1I6MA 4AZ3B 3ZLTA 3RRJA 4DV1B 1IRXA 1J2JA 3PR3A 1NLYA 3JZDA 2ZGVA 1UAGA 1ZKMA 2OCGA 1TJNA 4NJOA 1WZEA 1KSFX 2BLLA 4D80A 2XRFA 4UVEA 5BW4A 4D45A 3L8GA 3LDGA 5LLSA 1A82A 1UJBA 1QLHA 1A5AB 4MYCA 3OP1A 4E4YA 2NO5A 4UC0A 2OO5A 4MVJD 3W8DA 2QD4A 2C99A 4QJBA 1IN6A 3ZY2A 1ZUNB 3L7LA 1WX1A 5A3JA 5KCZA 1BROA 2C5AA 2CVOA 1TAHA 2IXGA 3E05A 1US8B 1VSQA 3F67A 3IDOA 3LPAA 5DBEX 5G4KB 2H9AA 1LS6A 2Q62A 4B4VA 2P5TB 1BXZA 2RH8A 1PNRA 3FF4A 1IB6A 4YBZA 1S2IA 2VZ0A 3GLGB 4D5GA 1NG9A 3LMKA 2RMKA 3JAWA 1A77A 1UKCA 1JDBC 2ZUEA 3KOYA 3UMRA 1G59A 4TTJA 3LFTA 2ZJ5A 1A97A 2L17A 4CV3A 4D98A 4X6YA 4XYLA 5IXYA 3B3GA 1D03A 1CV2A 3A6GA 3HPQA 4IILA 3PUJA 3G49A 3JR7A 3RQSA 3X1YA 5JCZA 1O5TA 1R37A 2G09A 3HXOA 2O5RA 1PQWA 3RVBA 2XVZA 3V3KA 3PCXA 4EA7A 2DERA 3PPWA 1KARA 3MT0A 3ORQA 1HZJA 5AKYA 3ZE6A 3A6LA 4OBBA 1STOA 2EX1A 3PI6A 3WTCA 2DXIA 4XX0A 1XRNA 1QH8A 2H8GA 3L4SO 3BL8A 1A8UA 4NYIQ 2EL7A 1TECE 3AERB 5KNDA 2Q3MA 2R8XA 3QPVA 1J5XA 3GYGA 1URPA 1XLWA 2PX8A 1RYZA 1NF9A 2YWGA 3CF4G 4IM7A 4PRLA 2ORED 1ML3A 2CLIB 1L4YA 2VKQA 5DBHX 1YFJA 4DS3A 4YT4A 1NW5A 2JLYA 3VZDA 2JATA 1G0NA 1W25A 2VNJA 1RWXA 4EGJA 4N8EA 1WKVA 2FPGB 4UTNA 4TRMA 1Z12A 4L3VA 1Z5PA 2Y0BA 1RW4A 1X74A 2JFOA 1DIRA 5E95A 4BZXA 3LQFA 2HCRA 4LOLA 4ZT2A 3VYSB 1SG6A 1WHSB 3IMGA 1FRVA 3OZUA 3TW6A 3DEJA 1YC5A 3M5DA 3Q72A 4GT1A 4TVKA 1QG4A 4QO8A 3S68A 4JGGA 5JY1A 4NZOA 2FPXA 2FUKA 2IPOA 2QRGA 2WTAA 1YZKA 3DT8A 1NN5A 2AC7A 1FYVA 1O58A 3GJYA 3I9V1 3IQFA 4NPHA 5FTNA 5AXBA 5BURA 3AKZA 3OTQA 4LY6A 4KQFA 4F71A 2E2WA 4P4SB 3SFZA 3EIHA 4NBTA 3RRXA 4I50B 2W2NA 4ML3A 3BWXA 1QP8A 2IELA 1E3TA 2X0NA 2ZRGA 3LYHA 3GFGA 3U3RA 3U3MA 2EOAA 4RANA 4D9KA 3H5LA 1WLSA 2HIAA 1K8YB 1KY4A 1ZJZA 4FMPA 4HYYA 4D9BA 5EE1A 2IU3A 4PZYA 3HCBA 3FF1A 1BJTA 1W1WA 5D8DA 1OFIA 2XRMA 4MUMA 4X0EA 2RGRA 1ZM2A 2OCXA 4R0VA 3BRWA 1MJFA 1THZA 4AS3A 1ZGBA 4B83A 2BPOA 5A7FA 4BRZA 5F4BA 2BD0A 3QM1A 2NTJA 3JWJA 3STHA 2YW2A 2EDAA 2MSLA 3LC2O 4CKWB 3DVQX 3T1YB 1ABEA 4HDAA 1YOVA 2ZJYA 3R7FA 1CCWA 2B7CA 4UXJA 1C1XB 1E89A 3AY7A 4HB0A 5B1SA 4MLZA 4LYDA 4PC7A 1DWPA 2I9KA 2W93A 4OCZA 1FS6A 3MUEA 3RREA 4Q9NA 1T5OA 3RG8A 2XVMA 3MA0A 1RXSA 4Z6KA 2YOGA 4RZUA 3I2GA 3N87A 1ULBA 3DHNA 3ZCXA 4RADA 1DQYA 3CVOA 1UT8A 4ZQBA 4DWVA 5LXTF 2ZYSA 5ITWA 2EJCA 2VHYA 4JCOA 2ZPTX 1UXJA 1ILEA 4HH4A 3QIVA 2CHEA 2MT9A 1QOZA 5DI9A 2Q46A 1BDHA 1G21E 2BFWA 2WAMA 2AN1A 2V6IA 1A69A 3G1UA 3QFHA 5AVJA 2VQFB 2CE2X 4TROA 3ZCTA 4KSYA 3PDCA 3MUNA 4YUAA 1FPQA 1KETA 2C0QA 4BGEA 3AG5A 4UVHA 9LDBA 1OGYA 3GMTA 2WF5A 1QVZA 1BMDA 4LMRA 2GYVA 4OLJA 3ABZA 3QLEA 4IS3A 3KU1A 5ECDA 3RASA 2UUOA 3V1TC 3UXMA 5E2IA 3X1WA 4E46A 4EVQA 1B2RA 1M5RA 4PVCA 4MVJP 4Y0AA 2XKJE 5G3YA 2O1WA 3A14A 3RROA 5C8YF 3N2KB 2VSOA 2HREA 4LF9B 3RK4A 4EUFA 1KJNA 1EZ4A 2DOKA 2O6HA 1KQFA 5GV8A 2TECE 4M38A 2UZ4A 1DDOA 1ZXBA 3ZHBA 4LXGA 1G1MA 3ENKA 5DISB 4ESHA 1GP2A 2OZLA 3B53X 2PVPA 1ZOPA 4QPCA 3W4KA 2VWHA 4BBZA 5CUQA 1GZ7A 3MCTA 3DTTA 2BLNA 4ENSA 2W83A 3IBSA 3HDYA 1GNPA 2FQYA 2HW8A 4AJPA 3MTBA 2W6ID 3OPQA 1ORHA 3EUEA 1PJ8A 5CX1B 3VU9A 2QTHA 2OVFA 4D56A 1X14A 3U4QB 2QIPA 1UR5A 2VTKA 4K81B 4QU8A 2EFHB 4Q9AA 3SOPA 1PAUA 3WWZA 1R6TA 1JZQA 2NV0A 4XWAA 1H94A 2A14A 1ZPDA 2P1ZA 4X7MA 3N07A 3ZDQA 1E94E 2NV2B 1BG6A 3GVXA 1R6AA 1QIHA 3B9QA 3ROXA 2X4GA 3L1IA 4YDSA 2CDAA 2NT3A 2YS6A 5CFPA 4B6PA 5EHXA 3ABRB 4FCTA 5ERXA 3WRYA 1TM5E 1YE5A 5IFLA 4GQAA 1JW9B 1NVVQ 3FMVA 4ZVKA 3WFZA 1W35A 1WZCA 4CM6A 4IVNA 2XBLA 2OOSA 1ZCBA 2WM2A 4OXRA 1YRYE 5GONA 3RJTA 4AKIA 4JR0A 1FFXA 4HS9A 4BKUA 4FYVA 2O1SA 1PJBA 1S7CA 3A9VA 5B53A 4MS1B 4BN5A 3L8MA 3N6VA 4MP8A 1DCFA 1T4DA 1JHUA 3VQTA 4XFKA 1FFAA 2CFOA 3HYRA 3Q9LA 4B3XA 2JBWA 2LZ0A 2HPAA 1PFQA 3B9RA 4JX9A 1EJ6A 1VLLA 2FWJA 2VUUA 1AF7A 3HZOA 3PEEA 4P58A 3WBKA 5D85A 4IIYA 2ZE7A 2DPXA 3V4PB 1K86A 1U2TA 3SHVA 2Q3FA 2WQZA 4KQKA 1NVXQ 2AYYA 3OPMA 1GG5A 5KTTA 4UATA 3RTAA 4DG9A 5KYNA 2COEA 5ALFA 1YKFA 4KMSA 3E18A 4YQFA 5K0FA 3A4IA 2BGJA 1UJCA 2PD3A 3E4DA 3PGMA 4EUSA 5B55A 1FJXA 4UE6A 2HCFA 3PVSA 3B5EA 1WWKA 1BKDR 2QVCA 1VJCA 2Q5FA 3LPNA 3LQ1A 4Y6PA 4BO7A 4TYYA 4WJLA 5KWEA 1FYDA 3M6LA 3KU4A 4AIRA 1SQSA 3LUCA 3SC2A 2LW7A 2IQIA 4JBHA 1QLJA 4MUHA 2GJSA 1DI0A 2EJVA 4LDRA 4Q4JA 5C52B 2ZYUX 3Q5EA 1RBZA 3NR2A 2XXAB 3JQGA 4FVTA 5NULA 1UBJS 1JKFA 1QG0A 3D59A 3CLRD 2WWHA 3DTVB 5ALSA 5F7XA 4G65A 1OZGA 1JB9A 1JJFA 5THQA 2PGAA 1J8VA 1U9IC 2CL0X 2BFCA 2ID7A 2ZYRA 3C7TA 3FOCA 4IIEA 4YO7A 5SZHB 2BH2A 4R05A 5JTTA 3WQSB 2VDNB 4U2CA 2YWRA 1SD2A 2FZCA 3H2SA 3AUSA 4DIOA 3AESB 3R0QA 1Z9BA 1HG0A 3F7OA 1BDJA 1DLJA 2J67A 4LXQA 1DEKA 1NYQA 4MKHA 1QGOA 2EBFX 2C77A 2WW8A 1NBMA 3AX6A 4R83A 3EZ7A 4HEA6 5T6MA 1A8IA 1C41A 4CIDA 1DCTA 1XG5A 2BEVA 5E6SB 4YXWD 5KOYA 4KH0A 4MVYA 2B20A 2K7FA 5BV0A 3PUWA 2Q9UA 3WS7A 4HYEA 4UXHA 4AUNA 1PDOA 3IILA 2ABWA 4TYMA 2IIPA 3DOJA 2JRCA 5FFMA 2Z8YM 5FQNA 1X3LA 3P71T 2ZU0C 1GFIA 2JIZA 1MD9A 5C3UA 1MP0A 2QMOA 3II6X 1T6NA 3IBYA 2R6JA 4IZOA 4UDYX 2YJ6A 1RYDA 3D02A 2OXIA 2G5CA 4P32A 5E6UB 1P2SA 2XZPA 2WHRA 2YZNA 3ZD9A 5JMOA 2J9XB 2BT4A 2YW9A 3LFHA 3MT7A 4XCVA 1DARA 4HFMA 3PFKA 3TNLA 1O5IA 3FCXA 1WPXA 1GPLA 3JD2A 1N77A 1IONA 2J3QA 1EQ2A 3Q3CA 4TL8A 4YP7A 3RD5A 1JHPA 2CT8A 4YP6A 5K8TA 4DDWA 5KKAA 2QAGC 1M10A 3S7TA 1NW3A 4OYYA 2B83A 4Q18A 3DP9A 3OJWA 1YB4A 2OESA 1YHZA 1JFTA 2W6PA 5HE9A 3W5BA 2R7LA 1OIVA 1G8KA 1W6RA 2YTZA 3G7SA 1N5KA 1NT2A 1U9YA 1AUVA 1GXSB 1QH1B 1GLNA 3PT9A 1ZA2A 3TPFA 4KKVA 4MDHA 1PKEA 1G6OA 1YQDA 4LWPA 4MWEA 5EN4A 1DXYA 5KU1A 3CLHA 3C6MA 1QAMA 4JBYA 2JI9A 1C3LA 2CDRA 2Z3VA 4KRFA 5TRTA 1RFGE 2EFEB 2NQ8A 2ZRAA 1NDHA 3LAWA 2G7MC 1XCOA 3L6OO 3ZCRA 3QJGA 5JDCA 1YBVA 4YASA 4K9LA 4YREA 4Z8XA 3W5SA 3VJMA 3FFXA 2AD5A 3D3WB 1A9XA 3L02A 4HNHA 3WJ2A 1G6Q1 3WGOA 4BFWA 4CU5A 3WB1A 2JF0A 1QKIA 2AFVA 2L69A 4P0QB 3FSRA 4GZ5A 4QXRA 3FHLA 4KQWA 1ZH2A 3FR8A 3ZX4A 1NHGA 3ET5A 1BX3A 1K2WA 3GFBA 2YDYA 3MD0A 2LIVA 3E8MA 4N41A 2Q3DA 1GZHB 4B44A 2WHPA 1XDGA 4Q12A 1EM8A 4A2PA 3F6PA 2V6GA 3STXA 1E79D 4KIWA 1EFHA 2JHFA 4AXXA 4W1QA 2QSJA 2OR3A 4XEHA 1ZHHA 3ZU6A 1UWVA 3UXHA 4AROA 1T3TA 1HE4A 2XKAA 4MQ5A 4NR0A 5ALYA 3GRVA 2JAPA 3AI1A 1GEGA 1LLQA 3KWMA 5IKEA 5JANA 5TQJA 4LSGA 5F33A 5JQGF 1WDKA 1FL9A 3PC8C 4AKEA 2OD9A 5JW6A 5HBGA 2Y66A 2HTEA 1NAIA 4YJHB 3WXMA 3NDJA 3VHXB 2L42A 3DKRA 2I7TA 3E03A 4OYLA 2FE4A 2FWNA 3OM1A 5C0OE 3ZHVA 3F47A 3VKFA 4D4HA 5ED0A 2QQEA 3IODA 5EKSA 3ROMA 3ICCA 1Q0PA 1CVLA 5GZ3A 3CONA 3EVBA 4W99A 2QQFA 3A9TA 2EFDB 4JI5B 3ZDFA 4K9MA 4GKBA 5E3IA 3OCWA 5KIAA 1B76A 1KMIY 1YONA 2D2VA 4GWLA 4P83A 4F6LA 4WY5A 1OROA 3WGYA 2MJLA 2Y1GA 5CEEA 2IYFA 3SEFA 4G84A 2E6KA 2QSZA 2CUZA 1R0WA 2EX0A 3WL8A 4B6OA 4W5RA 1RHKA 4YPFA 1KOLA 2ZAMA 4MI3A 5ILGA 3N0TA 3MGKA 3TZLA 4JJ7A 3AUTA 5AW6A 3SY8A 4DA0A 3PQFA 2HA4A 3V6LA 4E70A 3CLTC 1AT1A 3J81k 3JSAA 2P6PA 1GYQA 3OFJA 5KVAA 1ECBA 3C70A 1MB3A 1NR1A 4WN3A 2EF1A 4HL6A 2R66A 4IIBA 1G9SA 1FEZA 1UOPA 2PD6A 4NBLA 4UPDA 2PL5A 4WD3A 4F85A 4UTRA 4TV8F 1S4QA 5LMNB 1CERA 2BM0A 2VT2A 1HRDA 1SXJD 3L1HA 3V8NA 1N7HA 2JCBA 1UPAA 5A4JA 1F06A 4F21A 2QORA 4YC7A 2ZB7A 1QE0A 3ENWA 1IWOA 1PGOA 5KS2A 3UPTA 2FY8A 2D2EA 4AQDA 2GASA 3H7IA 2H2AA 2Y8EA 5AHWA 7MHTA 2ZAIA 3OU2A 2ODAA 4Q4AB 3AOEC 4NZZA 1FC0A 3KG2A 2B7LA 1AXRA 3L07A 5JC8A 1G4UR 5DBIA 3NIGB 1PZEA 2DY1A 1N2HA 3KP1A 3DHEA 3Q4GA 3HBLA 4YS6A 2EFGA 2QUKA 5IJAA 3PNOA 4FNOA 4MGZR 4J7UA 3P94A 1UDCA 2JH9A 1Y9DA 2P11A 3OHSX 5REQB 4MHTA 1XRLA 4N7JA 2WHPB 5C5DA 4EA8A 4AJOA 4AXBA 1SKYE 2J45A 1DG3A 1KAQA 1WXQA 3FDFA 3IMFA 4IEIA 2AMJA 1IM2A 1Z75A 3GIWA 4Q3NA 3T1HB 1FTSA 3NJ8A 2Q5QA 3D8TA 1PBTA 3IIMA 1R12A 4O3FA 2JIPA 1L2TA 2R5FA 5I9BA 4B7CA 3D8BA 2YASA 4J43A 3CR8A 3BULA 2HRDA 4K1LA 1VQ1A 5LA6A 3TVTA 3VKHA 5LQNA 2YKGA 2JD0A 3PTZA 4PZAA 4NONA 5ECGC 4RA6A 3CN9A 1EX1A 2QV0A 4H1HA 2E1RA 2GXQA 1LX7A 2O2HA 2D5LA 3AHEA 5FI3A 3C45A 3I72A 3HBAA 1I10A 3O93A 2ZSJA 2C4VA 2E4VA 5KZMB 5AVRA 3CF2A 2Z2KA 3FFTA 3M4JA 2AJLI 3PC2A 3MS4A 4BKOA 1QORA 5DLYA 1M7HA 3BWYA 1VG1A 1V3UA 1Z4LA 2QPTA 2BGGA 4AYXA 4NH4A 4LGVA 1J1IA 3GPCA 4CQLB 3B52X 2JFNA 3F71A 4MRRA 3WMGA 4Y2VA 3SBXA 1IC6A 2EFYA 2XZOA 2A5FA 4EHHA 4O8ZA 3NALA 5G0TA 2IXTA 4KE7A 4EEZA 1PL6A 2CHUA 2F3SA 3D4BA 4UCQA 3BJZA 3GJQA 3SICE 2PH3A 1RTTA 2BFCB 2E5FA 1KI7A 1ND5A 2NSJA 1Z83A 2YY6A 4FMBB 1KJQA 2R1TA 4RHXA 3ZWXA 5B4VA 5ALZA 3I53A 1A9XB 1EGHA 4RFLA 1MV8A 2X0KA 2VYVA 2OB1A 3H1PA 4BNJA 4CNQA 1NIJA 2OK8A 3FRIA 4OHWA 2WJJA 4PRZA 4XVHA 4HTFB 4YP1A 4AJHA 1UMCA 1NSYA 3IP7A 5LP6B 3AVOA 1YQUA 2LD4A 2RKBA 3FM9A 1X8KA 3Q98A 4PGFA 1JJIA 3CZMA 3GGGA 4XUCA 4Z9BA 4G41A 5IARA 3TCNA 3C7CB 5CFOA 1H65A 3QLUA 5GWXA 3RFXA 1GTL1 3ELYA 4KQIA 1C7IA 5BRAA 3MMXA 5K4HA 2GEDA 3D1JA 2W48A 1SGWA 2ZWPA 1VJ0A 1PWYE 4JH0A 3MLAA 3A9RA 5EEHA 4BFLA 3OTGA 2VQEB 3JWGA 4JYMA 2A33A 1GM5A 4F92B 4UMVA 4JYAB 4KHPB 4R81A 1S8NA 2RIRA 4FFLA 4O1MA 4H1UA 4AN4A 4PSUA 2HDHA 2PZJA 1Z0IA 2OV3A 1U0HC 2B1GA 4KU4A 5FWAA 1J33A 2NXEA 3KR2A 3NV9A 5HGJA 4WKCA 4CM8B 2DHRA 2PMBA 4Z9FA 3OHMA 2XYRA 2QNRA 4ITRC 4V1CA 1CZHA 4CQNA 3P9XA 4X9XA 1OFUX 1VHWA 3C6ZA 1FYFA 1UAAA 1KRXA 4CCAA 4K7JA 2QRPA 4DMHA 2UZ0A 3EFHA 4L15A 2GJ4A 4JITA 2O8VA 1B8OA 1HH4A 1WBDA 3CIFA 3DTVA 5FUVA 4JJIA 4XUDA 2W6CX 3KBBA 1FP4A 1Y8RA 1L4EA 1YQWA 2WC1A 1VBNA 2QAJA 4JVNA 1XZNA 1PL8A 4NPCA 1IDOA 4RLSA 5EP1A 5HIKA 2P2GA 4MNTA 4RA9A 1PT5A 4V0RA 2RAFA 4BGDA 4C9BA 1U2GC 4R2XA 3T7EA 5MN5A 4R0NA 4H1WA 3EZ9A 4JIMA 3KSDO 3HUTA 5TY0A 3CFYA 1SU8A 1L1EA 1W96A 4YYZA 3T52A 2GF2A 4HAUA 1L7AA 1VYUA 1LLUA 3ZD8A 4ZEOA 1SHZA 3I4CA 4BAZA 3VU1A 4P93A 2FP4B 4AY5A 4FI3C 3MMPA 4Z8YA 2GCNA 3S1LA 5KYKA 4L73A 1L7NA 1VJ1A 2FEWB 2O1EA 1JFVA 5FTMA 2OVBA 5I51A 2UYHA 1NUTA 2FRXA 1OAOC 2C2KA 1ZO8A 2AFRA 3AR6A 3W06A 4GIBA 3L7OA 3UHFA 4AAYA 2HEGA 2SICE 4BQFA 1BS1A 3HZHA 3K32A 4ZRMA 5IWCA 4GM1A 3D81A 3DKPA 3ETCA 5FUWA 4FI3F 2O0HA 4JJ6A 2I5PO 4AM8A 5AVZA 3CA8A 3N2GA 2QP9X 2OKCA 1ODSA 5J4VA 5LZ5A 3H13A 5E1OA 5FWYB 3R3UA 2EW1A 3ETJA 3CNBA 3IUBA 1BYIA 4P6VF 1G17A 4IQ4A 1NG1A 1Z36A 2FK8A 3HVHA 1NPDA 3NUQA 4MW4A 5BRJA 5A3QA 2FPIB 3COJA 3HXQA 4TMTA 4F45A 3QUTA 4KXLA 4DLAA 4YRMA 4AIIA 1X7XB 1NF2A 3E9NA 4FLMA 4KP7A 2CE7A 4QGFA 4TKLA 5K3FA 2V54A 3A3NA 1K66A 1NL3A 5JAUA 4BTVA 1Z8FA 1XJWA 4ZEXA 3Q9NA 2YYAA 4E13A 2B4RO 1YA4A 2BEWA 2HLNA 2HX1A 3G2MA 1ZK1A 4I5IA 3AUUA 1DTSA 3RF6A 3ED1A 4JDUA 3KCQA 5DX0A 4DDMA 3HE3A 4Y9TA 2P8JA 3NWOA 1Q1NA 2A1UA 2DCMA 4OA8A 4R1NA 1FYXA 4FEAA 4XZ3A 1FSGA 2BJVA 1ZITA 5FTKA 2O8EB 1J2RA 4DOMA 4ASUD 1IEVA 2ONZA 3OFVA 4GG1A 2JGLA 2HCBA 4QPZA 2P4QA 1RIFA 3NM6B 5TPZA 4OXYA 2XODA 5DSXA 2ZYVX 3E53A 4FZ5A 4JLWA 4HDMA 2B8EA 3HV2A 3KZXA 4XJVA 1UBNA 1F3OA 3OJ0A 4DCOA 2FQQA 4D1YA 1LKZA 3CQ9A 4ND5A 1IWPB 4FSHA 1HC7A 3W34A 3L0BA 2NW6A 4H7DA 4U63A 4A6XA 4KGZA 4JYPA 3F49S 3BQ9A 5IXSA 5KMGB 5FPQA 5CFRA 1VZ2A 4IEFB 4TWAA 1QF6A 4GI2A 5HIIA 1MABB 3WIUA 1XCMA 2PJZA 1FPMA 3V97A 2XMSA 1DJMA 1Z2DA 5DKFA 4GOND 1NAHA 3D3EA 1UFRA 2UZIR 1YS1X 2XKBA 2VRCA 4YP5A 2L18A 2AJDA 4I8DA 1WD5A 3DEFA 1C4KA 1GGMA 1DFIA 2DR3A 3DW1X 5KYYA 4JJGA 3BGSA 4CLXA 1B42A 4BMYA 3WKAA 1QAQA 1KRHA 1F9AA 3ETGA 1SIUA 3SHOA 4PFKA 3SS7X 2ZYDA 1GAJA 4EHBA 4RSGA 3BHJA 1KZ6A 3RK1A 1XHFA 1CR0A 1D5CA 2GK4A 3CH6A 4TQ9A 4TXLA 5IEBA 4D46A 1N2CA 4EPRA 4AMGA 5TF4A 3GAFA 3A4NA 3ZYCA 2JJQA 4RPLA 3SJ7A 4IHQA 1NUHA 3CEAA 2MSCB 3CURA 5LD2C 2YC2C 4J4TA 1KIFA 1IN5A 1JU9A 4H16A 2CLCX 2PAFA 4OHOA 3PXUA 3O94A 4HX5A 5A6VA 4R69A 3IUQA 1R4MA 4MQ4A 3VDNB 2X3UA 1EDBA 4A2QA 1P4SA 3ROZA 4OAOA 3MYYA 2BFEB 2BEJA 4G25A 4HJRA 3T4EA 4ZI2A 2F3TA 3P9KA 3NWJA 2KHZA 1PS9A 2Z4TA 5IZCA 4FOPA 2XDQB 1EUYA 2IBTA 2BGUA 3WYNA 5CDTA 1KH1A 1W94A 1B16A 5BPHA 3BSSA 2RGDA 1GG2A 4YI5A 4N0MA 5EJFA 5SYMA 2ZR0A 2GLUA 2JLVA 4PBSA 3FAKA 3T3IA 3WXBA 3LP5A 1AURA 1U4NA 4GBED 3CSDA 3EBLA 1FU4A 5JE8A 2I1WA 1RRGA 1FXSA 2PMCA 5JJ5A 2PY6A 3CTMA 3G1WA 4RK6A 3WLJA 1M8PA 1V7ZA 4ZVSA 2IV2X 1T1GA 2X5KO 5DGIA 4EEKA 1JTVA 2QRHA 5C5CA 5IF3A 3CEHA 4LDQA 1Q1BA 1TO6A 3C1UA 3FIUA 4E88A 4R5MA 3SXUA 3UT6A 4DCVA 1MRSA 3B1FA 3IKVA 3PNSA 1XZAA 3F2IA 5MDHA 1U94A 1EUDA 3CLKA 3CIOA 2DFNA 1M8JA 3TS1A 4IWXA 4C7KA 1EP1B 1UH5A 4KJXA 4LNUA 3PGKA 4CEHB 1E1RD 1Q83A 1R3DA 1DQRA 2X0FA 1CDOA 2ZIUB 2ZBRA 4WLNA 1YBHA 3O5AA 3RBAA 1P2FA 3HUEA 4RENA 3R74A 5EPOA 3W04A 4BNGA 4H4CA 4I5EA 3F9CA 3UT0A 5KNBA 1H1LA 1H2EA 1RP1A 1YUBA 3ZZTA 4AZ0B 4DWOA 1RCFA 4QQKA 4XIIA 5A9TA 2P6RA 3EXAA 3IRUA 1CVIA 3HB1A 2OHGA 4O08A 2H1IA 2OP0A 5EERA 3VYRB 4EYKA 4P0PB 3WE7A 1JAXA 3FCUB 2WWXA 3RUHA 1EAYA 4PC2A 4TTSA 3KXPA 2XJ4A 3DE1X 5GGXA 4DYVA 2DQ4A 2VKTA 2VP3A 1JBQA 3UNXA 2R9VA 4OK5A 2FMHA 4U3JA 4XEUA 2VQDA 4RZIA 2JLRA 4TS3A 4NMMA 3ND5A 3RE1A 3U60B 3QKRA 4I9FA 1D4OA 4HMPA 3I0ZA 5ER9A 2JAXA 4ME6A 1OYVA 4BO3A 1H8EA 3L3BA 2MYPA 1NXXA 1RPNA 3W79A 3TIIA 1WE2A 2G4VA 1I13A 1WXFA 4OHVA 3HMQA 3P0RA 3PV0A 1HLPA 1I7NA 1WV1A 1NJFA 4WERA 5KCMA 1TW2A 4QYSA 3QEMA 5DYGA 1AY0A 2F3UA 3S99A 3S1SA 4JOSA 1KDYA 3QENA 4Y3UA 4EFKA 1O89A 3QEBZ 2VT6A 1QZZA 4XUGB 1BTOA 1R00A 3WGVA 2K2QB 4FZRA 1WQ4A 2E7ZA 3QE4A 1CY8A 1GWNA 1FTWA 1ZMBA 3V2IA 1L5HB 1PT6A 2VJBA 1PZXA 1BRMA 5ARBA 4F93B 1U8ZA 4GL4A 3WADA 4HUQA 2LP4Y 3AUKA 4MO2A 2XE7A 3FPCA 3I6ZA 4JLKA 3NBMA 4BVBA 1D4ZA 1VLMA 4FYPA 4D92A 5CBPB 4JJEA 2QTVB 1P9OA 4C6HA 3DMPA 3HYLA 4EZIA 4EZEA 3N28A 3HRHA 4WKBA 5M5BA 2Z3WA 3ETDA 1E1QD 5KOJB 2YJZA 3E8XA 4IOLA 4WX2B 2C96A 1DEAA 1E32A 1QR6A 5BRNA 1LBSA 2J9GA 3GZTB 3MJ4A 1SKBA 2Z8YA 5ULLA 5J4YA 1VFPA 3KK0A 4EFLA 3GK3A 4KVGA 4Y2SA 1GPDG 2OY0A 10MHA 1VKJA 2EEZA 1O4WA 2WA1A 4WUTA 1UC9A 4CUZA 1LNZA 1PG5A 4P0TA 3STWA 4RQAA 1X94A 2WJIA 5JSZA 1HYHA 1NX6A 4BBPA 4L7VA 3LPMA 4IMRA 1OT3A 2C57A 3K92A 3GGOA 1SAYA 1PGQA 1NC1A 3KZMA 1OLUB 3NTXA 5DHQA 5TQ0B 1E6EA 2NUTA 8OHMA 1XALA 1U0OC 2FR8A 2ZTLA 1ZWKA 3FGNA 3SMVA 1ZH4A 1G7CA 1E62A 3RGGA 4EMTA 1DZIA 1W5SA 2V6MA 4OY3A 1ZHFA 2P1RA 3UMVA 3EK2A 3TINA 4DEXA 3E15A 2AEFA 5CLGA 3UAXA 4CFZA 3HJRA 3K9BA 4KO8A 2K7ZA 4R98A 3ZK9A 5JNSA 3RYCB 1D1SA 4Q9KA 3AH8A 4P4NA 2GH1A 4JV5B 5TT0A 4JC0A 2MYNA 3DAFA 2G25A 3FVVA 4RTQA 5LC1A 2ZJ6A 1JMKC 2FKAA 1JA0A 1NPTO 1KVQA 1SN7A 2HKIA 2C84A 2QLMA 4UDNA 4XUEA 3DL0A 4B73A 4DQ0A 5B3JA 1XL1A 4LZPA 5D2CA 3RRNA 3RS9A 2UVDA 3DYVA 4ZAFA 3ZXIA 3AEUB 3RVQA 4B74A 4E5VA 3U37A 2YQZA 3CPEA 2XQKA 2NO7A 2EF0A 4CLHA 1S6YA 4ECAA 1M5TA 2GZRA 2JAHA 1NDQA 1FLNA 5HZMA 1FLDA 4G8DA 1UJ2A 3BGIA 3GJ7A 4CMCA 2QTRA 1L3IA 1MW8X 1ID1A 5CT6A 4NATA 1WCIB 4B7AA 1OJLA 3DDHA 4FGZA 1PKXA 3IXLA 2EJUA 4ZIRB 4URYR 3TG8A 3QFCA 2DWCA 2ZE6A 3PUKA 4M46A 4ZV9A 1GTRA 1B3RA 4NBNA 5J2UF 4AO7A 1I5RA 3CZ4A 3H42B 4G0ZA 2GF0A 2IEAA 3QWHA 2E37A 1XDUA 1MOQA 2KWIA 4HC4A 1UM8A 1YE8A 3TN7A 4ZHSA 2OLKA 4LV6A 4S1NA 4WXEA 2YXDA 5ALVA 1JFFA 2NZYA 1RJWA 2QN9A 4LRSB 3U5ZB 1DBWA 1N6NA 4ALKA 4HD8A 1ZD1A 1PO7A 4W8GA 2J3IA 1EINA 5F1PA 3IEMA 5EUMA 4AKHA 1XZPA 721PA 4OQFA 3WLSA 2J3HA 3TEJA 5AKIA 5K5EA 1X6VA 1V3QE 3B6IA 2AXQA 3ZBUA 2F17A 1A9OA 2VQSA 3CPJB 3K9GA 4QFMA 1CS0B 4PO8A 2AYXA 4ZOLA 3L0IB 4IRUB 3STTA 2ZSFA 1CULC 2HNBA 1CUFA 2R8PA 4LVUA 1FZQA 1C7FA 1D2NA 1MOSA 1QXSA 2AD1A 2H2WA 2NU7B 4GGPA 4MH0R 4O02B 4B3TB 5SYAA 3EWAA 4K6HA 2CZGA 1QU2A 5BQOA 1D5WA 2QVXX 2SECE 2F1KA 2X4IA 4OHZA 1ZWLA 4OQDA 4EY8A 4B6FA 1IJFA 1OH8A 3ELUA 3HZRA 4JLBA 2BEWB 2O0LA 3IKTA 2H1OA 4Q1CA 4JN6B 2VDOB 2VXOA 3AOEA 4C7BA 5F98A 1KFKB 3MN1A 4O4HB 3UWDA 5B64A 2JJ1A 4F06A 4Z99A 1V5GA 5DTQA 1R18A 3HL4A 2WMDA 3UJDA 5FJIA 3DYBA 3R9WA 1IIRA 2DLDA 3C1TA 3B8HA 1V43A 4YGYA 4FX5A 1NDUA 5JD5A 3LCCA 2PFGA 1MPTA 3C74A 5EWMB 3SM9A 2NZUG 2PL9A 3K1AA 3FNBA 1KWGA 4UHJA 4BLQA 3HXTA 1ODJA 2AKYA 4KYTA 1BD3A 2FFQA 3KVVA 1GARA 3IO5A 3JD4A 1RI3A 4HZGA 1DWQA 4AKSA 1PJAA 2H5EA 3IHWA 1TTPB 1JWBB 1IM5A 4NX2A 3BJMA 5E6RB 2JH8A 1Z7YA 2X0EA 3I52A 3MS7A 2WPDD 4UASA 3UC9A 1V2HE 3RHFA 3E7PA 1ULAA 1AQLA 1EVJA 1FDTA 2XRZA 1IBLB 2QTCA 1W47A 1USIA 5AH0A 3URMA 1XROA 1ZCAA 4UDOA 3IT3A 4WN9B 3NORA 1VE6A 3U31A 3QX9A 3EFOA 3TQOA 1FYWA 3LRPA 4AULA 5AJTA 4OB8A 3V7UA 1O6CA 2QM7A 1QFYA 2NSDA 3ID6C 4DZTA 4FT4A 2CLEB 3K6KA 4I9UA 4RMNA 4TKVA 2XD4A 2BKUA 2PBZA 3WWOA 1A4RA 3M1AA 3N2YA 1QGUA 3QH4A 3ETHA 1T36A 3ACCA 1J90A 4EVSA 1KZHA 1T5SA 1OA0A 4IIJA 4YQYA 3ZDYB 3GJRA 2H00A 1GG8A 2A2ZA 4KVZA 3G68A 3CNEA 4HXYA 3VV2A 4NYJR 5C32A 3TGLA 5IKXA 2HMAA 3PD1A 4JLPA 2AEEA 4Q82A 4JYZA 2YY7A 4CF7A 4M1EA 1D4FA 2GHQA 2WNIA 1O6BA 4I81A 2IH2A 2FZGA 4KLRA 2P9CA 2P9FA 2X4DA 3CLUC 4IMIB 4TXNA 4CM8A 3UGTA 1X19A 2CNKA 3OPVA 3MMSA 4ZGGA 2V96A 3M6FA 2QP3A 3IQZA 3AP3A 5JAPA 3P2MA 4QUBA 1H93A 1YQGA 4WE3A 1RLJA 1V1MA 4TUYF 1FF9A 4NE7A 4AO6A 3IHTA 1KDPA 1AM4D 4M0MA 4EARA 1KGDA 4EKEA 5DNYB 2GDZA 5FLXA 2YYSA 1SVNA 3VPHA 5HRUA 1ACLA 4PV7A 3DCYA 5KSYA 3CVVA 3VDRA 2HZBA 3NBKA 1MIHA 1H2ZA 2J85A 4W5HA 5JFGA 4IZIA 4PM4A 2D62A 1Z29A 1F38A 4E12A 5LUAA 2AE1A 2WJHA 1XZIA 3CC8A 3MTIA 3WGHA 3COYA 5G3ZA 4JENA 4AG3A 1M6YA 1OKKD 1C50A 2J6HA 4TVBA 4F72A 2I7DA 5BN5B 3UM9A 4NS4A 1DKQA 2VN8A 4HQRA 3MWLA 1G20A 2W6JA 1UC4B 1G55A 2Z0MA 4ZAYA 3ZQKA 2DECA 2SKCA 4KACA 4MA5A 4P8RA 5CA0B 3KAQA 4C76A 4NMXB 3AJEA 1I2AA 4A23A 5BW5A 1XTZA 1YFZA 2WHYA 3G5UA 3K9LA 3PITA 1U1IA 5FRDA 3WYAA 1VLHA 1CX9B 1QQ5A 4B32A 2DP4E 4CDGA 3LYLA 4YIHA 2W0MA 3SEQA 4C89A 4E2WA 2FWAA 1ORRA 1C2YA 1E1QA 2G0NA 3RS7A 2DFVA 1UZAA 4B4WA 4F9TA 2VJOA 5JS2A 1DO0A 2QMQA 3Q10A 4HLUA 4MGYR 3LY9A 5I9TA 4EG1A 1HFJA 5JPDA 5EWJB 4NDZA 1BE6A 4DJEC 3ORHA 5IWAB 3ZNQA 5C7LO 5CYOA 3MXOA 2O8EA 4Y2XA 4LA4A 4D9HA 2E1PA 3BD7A 1FE8A 2XGGA 2V5VA 3QU7A 1WW3A 5C8YA 1YB5A 3EUWA 3E2IA 4ZYTA 3UWSA 1P2GA 3GBPA 4TYPA 4JEMA 1VBMA 5ALGA 4B4UA 2FK7A 2GAAA 2GEBA 1K0FA 1JECA 2WZBA 2JCXA 4Y8VA 2JGFA 4H31A 3UFXB 1AV7A 2JFXA 3GELA 2A9KA 4A5OA 5LUBA 3ZBQA 1OHHD 3KV3O 2XMBA 4TMXA 5F3DA 3DM9B 3MSXA 3GG9A 4YJHA 1AN0A 3O92A 4G0QA 1M54A 2IKSA 1OH5A 3KQSA 3H04A 1HE5A 4M1OA 3SBEA 4OVKA 5DLEA 4O33A 1E3DA 4EY3A 4NEGA 1E2NA 3JZIA 3KJQA 4NU0A 1C8LA 1CLUA 2ZJ8A 3O0DA 1G19A 3JARB 3LHSA 3P9IA 4EO7A 4BWVA 2BN4A 1N78A 1E2UA 2OQIA 2PIDA 1R6XA 4EIWA 4S0ZA 2K87A 1FFDA 1XEWX 1RXWA 1U5CA 4BNTA 1SXJE 3PL5A 1QVVA 5L9AA 3HCDA 1WZUA 2ZIWB 4L5IA 4J0CA 3EGXB 1A8HA 3T9AA 2NWQA 2VHJA 4EX6A 4XVQA 3BJIC 4MGHA 5AQ1A 5B3KA 2IXDA 2QPLA 1H4VB 2OZPA 4M0FA 1A1SA 1FVOA 1BGWA 3BBLA 3OHPA 4KWCA 4C5CA 1YHYA 4EHDA 5K8CA 1V47A 5DE3A 3PX2A 2Z58A 2CCKA 4FW8A 1GFZA 3RVMA 2JRLA 5B1YA 4GKJB 1BO6A 5J5VA 4XIFA 3NC0C 1TVEA 2VS1A 3COWA 5BP7A 4GPTA 1M73E 4XLTA 4LZJA 1HOTA 1JJVA 2D4AA 3JR3A 3BIWA 3GD7A 2YV5A 3V80A 4HN9A 4XWOA 2IXAA 3ONWA 4HXGA 2PH7A 1XPUA 4KGVA 4ZU6X 3CWCA 2VWQA 3OA2A 4YNBA 3MGGA 5J2UA 3K53A 1EP9A 5H9WA 4W5OA 4RDCA 4Z4FA 3QPWA 1C7ZA 1RYNA 1P91A 2X2EA 4RD2A 1Q11A 4J94A 1ORTA 2DWPA 4OFZA 3DBOB 3RS2A 2YBDA 3PE3A 4LV5B 1I2BA 4WCFB 2B30A 3LG2A 5ECYA 4DMRA 1VCIA 2X42A 3IDZA 3TLGA 4D9JA 4LN1A 4NQRA 1O1YA 2VZLA 2W7TA 5LBUA 4X1YA 3F1KA 3U44B 5C80A 5JS7A 1T25A 1LVGA 2JJYA 3PA8A 5GONF 5KYVA 4BKPA 2C2BA 3U3ZA 2FZKA 4MMXB 1RZRD 4LF7B 1V96A 2YIDA 1SQ6A 3D7NA 4TL7A 3UY4A 2HSEA 3EDMA 4BWGA 1LJLA 1O4VA 5G41A 4NAVA 4HEJA 3R3JA 1MAWA 1O77A 4ZYXA 4KYUA 2CZQA 3V2HA 2HJVA 5BN5A 3TIXB 1GTVA 2RGUA 3LCRA 5BNZA 1V1JA 4NK5A 3UOAB 1C9EA 4J9VA 3IQIX 3RPEA 1TEHA 3BM5A 2IVZA 3MTEA 2VH1A 1IOVA 4FHGA 1EBUA 1N9ZA 2Q0HA 4RLHA 3DOFA 2R8ZA 2WTEA 3KT6A 5FL7D 1L9KA 4E7PA 3QVGB 4DV4B 4J0FA 1H2XA 1QGED 4XIGS 4C14A 4M9UA 2A4MA 4XPZA 4BNNA 4DIMA 4UNRA 4EI9A 1S2MA 3ZNPA 4BMOB 2ZYWX 3KQTA 4NEHB 4R7ZA 5AJYA 3KLMX 3GCZA 3U7IA 3K70B 4GUDA 2RBKA 2ZSAA 3DULA 2ZRDA 1FVHA 4GOKA 2EWMA 4J0KA 3WOHA 1BXKA 4CIWA 3S40A 4XX1A 3GZNA 3CVYA 1UWLA 3QFFA 5DGCA 3P32A 1A7JA 4JP5A 3MCAA 4R9RA 3VSDA 3EC1A 4E08A 3KVRA 4WLFA 4FDMA 3CJQA 1P1HA 5KI6A 4BP1A 3N0WA 3OEWA 2N47A 4G1FA 3NXSA 4L4RA 2OXCA 2IYRA 4YDRA 2Y6VA 3D8SA 4HX9A 3O26A 4MAMA 1ONBA 3KEOA 4ZU3A 3WHLA 4S04A 2D5AA 4G0MA 5FP0A 3DOCA 3HMKA 4HDNB 3EMBA 3TLXA 3EASA 3N8IA 1JI0A 2DFPA 3MILA 3T61A 1JIXA 3ET4A 2HB6A 1H3EA 1GY8A 4H6PA 5CXUA 1QE5A 3MJTA 5E4JA 2Z3ZA 2WHQA 1DNPA 2ZVDA 2QUHA 3H5IA 3MJEA 3PVZA 4R31A 1ZVKA 3A31A 3DMNA 4AG5A 2YVUA 5I9IA 3KKEA 3G9UA 2ZRBA 5TC4A 5EESA 5E2AA 3ZJ5A 4ASUA 5AK0A 3JQ8B 3P7MA 2QT9A 4OH7A 1XA4A 1DS6A 1E18A 1ZGJA 3TSWA 2ZB4A 3E2MA 3EVNA 3HKCB 3W3AA 5KHAA 1KQNA 4F11A 3THSA 2NQ2C 2WLSA 1KFCB 1D09A 4G6ZA 1QIKA 3NONA 4M7PA 2BMWA 4J0JA 4TPKA 1K9VF 4CG2A 3EGDB 3IE2A 2ATXA 4HQFA 2RHWA 3TKAA 1VE7A 1FNCA 1Z5OA 2WG0A 5AI4A 4BO9A 1NKSA 1TPZA 4KWEA 1NWCA 2OHVA 3F46A 4MWTA 3T5GA 3RKUA 1HNZB 1NOKA 4NMLA 2X1VA 1G5QA 2JLWA 4F2GA 1GHTA 3A3YA 4Q03A 1N2EA 2X58A 3CZ5A 3EDCA 3M89A 2ZIFA 4GMFA 1E3EA 1RZUA 5IH7A 1FQOA 3RAEC 3AXSA 1WAMA 3VYUB 2CMKA 3A9WA 3DE2X 1AUQA 5EIBC 3WV4A 1Q0TA 1PX2A 3K5HA 4YRDA 4GPAA 1C0IA 4YX9A 1M2GA 1Q84A 1JGTA 3KQYA 5F23A 4QM7A 4NU8X 1FVXA 1XF1A 1F9EA 2TS1A 4L8VA 1G2PA 4PCVA 1ARZA 4KEAA 3NGLA 4RJLA 3RV3A 2PK3A 3INGA 4PYLA 1XCGB 4BS9A 4DBLE 5A4FS 1JXOA 2H1VA 1IHYA 3UJ3X 3WLIA 1RXEA 2RBGA 4DV5B 4TMYA 1Z07A 3L7BA 1J7JA 4QXPA 1SR8A 2YICA 3LCVB 4MJXA 4PG5A 4AMUA 2P6MA 3GLIE 5KNCA 4WK0B 5TVKA 3IKLA 1RVDA 3TGPA 3FROA 3NHUA 1BWPA 4ZOLB 1XLUA 2VYVD 2ZJBA 3IE0A 1V8PA 1H2BA 1PJSA 2VBIA 4UHHA 4RTNA 2VC2B 4MINA 2V7PA 1AXEA 2QTNA 1E3LA 5COAA 4DLLA 2VAXA 5HX7A 3RC8A 2I6TA 4N3BA 4X3PA 2FZVA 4BE4A 1U3WA 4FE7A 4HRYA 4JXKA 4WKNA 2X5NA 2H31A 2IH4A 1NWHA 1L9XA 2GYYA 3WIDA 1MT3A 2JGJA 3GQBB 5FUMA 3R40A 4C6SA 1RE1A 3G5TA 1TT7A 2C8KA 4F1JA 3OZVA 5HBRA 1J0AA 1E20A 1LJUA 3RAPR 4DVGA 2IXBA 4HLCA