5HXAA

Crystal structure of an udp-forming alpha, alpha-terhalose-phosphate synthase from burkholderia xenovorans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
458
structure length
448
Chain Sequence
MSRLIVVSNRVGGLAIGVLDALKETGGVWFGWSGETVSEPSAPVIEKQGNVTYATVGLTKRDYDQYYRGFSNATLWPTFHYRNDLSRYDRQEYAGYQRVNATLAKQLKELLKPDDIIWVHDYHLLPFARCLRELGVKNPIGFFLHIPFPVPEVLRTIPPHEELVKAMCSYDVIGFQTDADRQSFVDFIERGQHGTSSEDGMVHAYNRFLKVGAYPIGIYPDAIAKAAEQFTDRKPVRSLRDGMRGRKLIMSVDRLDYSKGLVERFQAFERLLLNAPGWHGRVSLVQIAPPTRADVQTYQRIRQTLEGEAGRINGRFAQLDWTPIQYLNRKYERNLLMALFRQSQVGYVTPLRDGMNLVAKEYVASQDPADPGVLVLSQFAGAAEQLPGALVVNPFDLSQMAEALERALSMPLAERQARHADMMAPMRENNLSVWRDTFLADLRNVATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
publication title Crystal structure of an UDP-forming alpha, alpha-terhalose-phosphate synthase from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
total genus 175
structure length 448
sequence length 458
ec nomenclature ec 2.4.1.15: Alpha,alpha-trehalose-phosphate synthase (UDP-forming).
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00982 Glyco_transf_20 Glycosyltransferase family 20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA02
3ZCTA 1FU8A 4FZRA 3BDAA 2AW3A 1V4VA 3RSZA 2ACWA 1QKJA 3MT8A 5JTTA 2QRMA 3BD6A 3VUFA 2JZCA 1NZDA 4CTMA 4MHSA 1XV5A 1P2BA 4AY6A 1NLMA 4W6QA 2XCUA 3OY7A 1PYGA 2QLNA 1FS4A 2VCHA 2ACVA 3E3LA 5TMDA 2FFRA 1NOJA 1E4OA 1JG6A 1GGNA 4EL5A 2ATIA 1C3JA 3QKWA 4MI6A 2QLMA 3UYKA 4RBNA 4M60A 1RZUA 3CEJA 4X7MA 4LEIA 3S28A 5TMEA 2FF5A 3D0RA 5HXAA 3L7CA 3D0QA 1YA6A 1WW2A 2XMPA 3H4IA 1UZUA 3T3HA 1C8LA 1A8IA 2X6RA 4AMBA 3EBPA 1JIUA 1PN3A 4KQ1A 4BQIA 4GYWA 2QNBA 3OKCA 3OT5A 1VGVA 2C9ZA 3CUVA 3MTDA 1NZFA 3NP9A 3S2UA 4NESA 2HY7A 2QRHA 3CV3A 2IYFA 5DLDA 1P4GA 2F3UA 3Q3HA 4N3CA 4EKYA 3CUYA 2OFFA 4RIIA 3MTAA 2C1ZA 2P6PA 3OTGA 1FTQA 2H1FA 1GZ5A 2YJNA 3VUEA 3S27A 1L5RA 3T3IA 4GZ3A 3CUWA 1FTYA 3G2HA 2IV3A 4XIFA 2Q6VA 3RT1A 1JIVA 1XKXA 4MI3A 3ZCVA 1F0KA 1O6CA 2QRGA 2QRQA 2R68A 3CUTA 3CX4A 1C8KA 3BCSA 1L5WA 2G9QA 3L79A 1K08A 3OY2A 3G2JA 3HBMA 3OTIA 1EXVA 4MRAA 2QN8A 1IXYA 2XA2A 2QN3A 3MT9A 4KQMA 3NPAA 1P2GA 4MHOA 1L5VA 3SYRA 4N9WA 2AV6A 2XGOA 1FU4A 3C4VA 2XGSA 4BFCA 1LWNA 3WAGA 1RRVA 1FTWA 1WUTA 4GPBA 1C50A 4REMA 3EBOA 4F9FA 1Y6GA 3IA7A 2VSNA 2VCEA 3AMVA 2GJ4A 1P4JA 1AXRA 3T3DA 3GPBA 1GFZA 3D1JA 2PRJA 5JTUA 2JLBA 1EM6A 2G9RA 1Z62A 2VSYA 5TMBA 8GPBA 1AHPA 1XOIA 2C4MA 4RIGA 5D01A 4QLBA 2GPNA 3H4TA 2GPBA 2AZDA 3G2KA 1QM5A 4AMGA 4WADA 3NB0A 2BFWA 3TSAA 2QRPA 3ZCPA 1P4HA 1UQUA 2KS6A 3BCRA 9GPBA 1JEJA 3G2IA 1L5SA 1WUYA 1L6IA 2R66A 2VG8A 1FU7A 2GM9A 3DDSA 2R60A 4YUAA 3ZCRA 2IEIA 2BISA 5D00A 3T7DA 2C1XA 3C4QA 4GZ6A 4HWGA 3OTHA 4WHMA 3TAXA 3MS4A 1B4DA 3NC4A 4N3AA 4MI9A 3BEOA 1PNVA 3VDNB 1XC7A 4G2TA 1SXPA 2ECPA 3Q3EA 2XGMA 4GZ5A 2H1HA 3NCHA 2GPAA 3BD7A 3L7AA 2X0DA 3E3OA 2XCIA 3MS7A 2R4UA 4L22A 3L7DA 7GPBA 4KQ2A 1Z6QA 2FETA 3IAAA 5DU2A 4F97A 1FC0A 2QN9A 3MT7A 4GYYA 3T5TA 4CTNA 4X6LA 2IW1A 2G9VA 4BQEA 4N3BA 5DXFA 2BGUA 3PE3A 1J39A 4AY5A 4N39A 1NVKA 3CEHA 1Y6FA 2GEKA 2JJMA 2BGTA 2QZSA 1WV1A 2IEGA 2R4TA 4YI5A 1HLFA 2IV7A 2ZB2A 5I45A 2ASVA 4EL0A 3Q3IA 4M7PA 2GEJA 1PSWA 1WV0A 1GPBA 3TOVA 3ZCUA 3O3CA 5GPBA 5C1DA 4AN4A 3C48A 4HLNA 1Y8ZA 3MRXA 1ABBA 4CTOA 3QHPA 5IKOA 3WC4A 2QN1A 3HBNA 3BD8A 4NEQA 4LDPA 3E3NA 4XI9A 2X6QA 1H5UA 3S0JA 4RELA 3UYLA 1E1YA 3COPA 2PQ6A 2IYAA 2QN2A 3OKPA 1SXQA 3HBJA 2GT1A 3G2NA 3L7BA 2QN7A 1P29A 1P2DA 4YI3A 4FKZA 3ZCQA 2XA1A 2F3QA 2AMVA 3G2LA 1YGPA 1GPAA 3OKAA 1JG7A 1FA9A 3NP7A 2F3PA 1NOKA 4M83A 3VDMA 1KTIA 1XL0A 5TVGA 1Z6PA 1JIXA 3DDWA 2X0EA 2WTXA 3GUHA 4WACA 2SKEA 3MRVA 3DD1A 3MBOA 3S29A 2IUYA 3MTBA 1RZVA 4MICA 4EKEA 5ENZA 1XL1A 4NC9A 5LQDA 3RSCA 3MQFA 1M5RA 2XA9A 2F9FA 4BQFA 3WADA 6GPBA 4Z5XA 1IIRA 2SKDA 2SKCA 3CUUA 1GPYA 3HBFA 1L5QA 1L7XA 1K06A 4F96A 2PYIA 5IKPA 4CDRA 3DZCA 3FROA 4RIEA 3MRTA 1BX3A 2O6LA 1LWOA 2PRIA 3BCUA 3SYMA 3RHZA 3PE4A 2G9UA 2F3SA 5BNWA 4EJ2A 4X7RA 1WW3A 1NOIA 3T3EA 4X7PA 4RENA 1F6DA 4RIHA 4RIFA 4PQGA 3L01A 3ZCSA 3NAZA 2PYDA 3MSCA 2X0FA 3T3GA 1Z8DA 2QLLA 3MS2A 1GG8A 1UQTA 3CEMA
chains in the Genus database with same CATH superfamily
2CN1A 2ZB8A 1LK5A 3PHHA 4HGQA 1OBHA 4Y30A 5E38A 5HF5A 4YPOA 5A2GA 3GGCA 1GUAA 2ZREA 4FSXA 4HXFB 4X1YA 1YI8A 2XUJA 3TO5A 1JR6A 1ZN8A 2QVCA 1I4TD 3JQAA 5IT9A 4WTOA 1WEHA 3IPYA 5HRAA 1DUIA 5DP1A 3REGA 4CKWB 4TYWA 2P4QA 2UZ1A 3KB1A 4PIVA 5EMKA 3D59A 1Y3BE 3D54D 4EHJA 3BD6A 4QC2A 5HKAA 2P6UA 5EOVA 5DNVA 1HZZC 5KYUA 2E4ZA 1ZGCA 3H1TA 2Q2OA 3HZRA 4MHSA 4KEAA 3VU9B 5IXJA 3ZD6A 3O4VA 5HQJA 4QBFA 3P9QA 3K9LA 3TVDA 1FF9A 3LU1A 1P7PA 2XCUA 4OP3A 3LVRE 1B1CA 3CXUA 1U94A 5IAJA 1JPJA 1U04A 4GMFA 1TVKB 1F9AA 2UAGA 2A3NA 2NACA 4GVXA 3VZSA 4M0PA 5DNCA 3QSYA 3R7NA 3I2KA 4NOMA 4B74A 3OJLA 2NSJA 3GN2A 1JF8A 2ZSEA 1VE3A 3HR8A 3ZWOA 3P9SA 5KJFA 3R0IA 1NBHA 4UBMA 2X4IA 3COZA 2W6CX 3KKLA 4OFZA 1NURA 4BVJA 1T8YA 3BMXA 1GNQA 3FZQA 5F5XA 4RZ3A 5KDDA 1QO7A 5DNWA 2W2MA 4DV1B 4ENWA 4RL6A 3HI6A 3F6CA 3QVGA 4O4LA 4Q9NA 1XDWA 4MQFA 4ZZ3A 3RO7A 3K9GA 2AGVA 3EIOA 4G24A 1G6Q1 2CNBA 4JMPA 4BN0A 4CMEC 4EYQA 4M0KA 1IUKA 2J85A 3HSKA 4UBJA 4AICA 3EQZA 3N70A 1F17A 3BXHA 1CUIA 3ZX5A 5CA1B 1P0CA 2ONJA 1PJCA 4U7DA 1GM5A 2Z04A 2AFIE 5AVOA 3CVYA 1H2WA 1QQ6A 2FQQA 1SUPA 1XA4A 2XOXA 1TCUA 4J76A 5BXQC 2O23A 1PEDA 2VSOA 2XE4A 4P2BA 4R81A 3HKCA 4K6CA 1GIAA 1QTQA 4EYGA 4PFKA 3WG9A 3JRXA 4AX8A 4G5OA 3KP1A 3T7TA 2A1TR 4YREA 3I2FA 3HCPA 4INOA 4KFRA 4KXUA 3AR2A 5K4GA 1QK3A 1YI0A 3Q15C 1XDUA 2BTQA 3N6VA 3K9HA 2OGWA 5IP5A 4LYEA 1B8NA 3B7PA 1VP3A 2C4HA 1ORRA 3RYIA 3T54A 2QSYA 3TR0A 1JHXA 2J45A 3Q8WA 1C3EA 4BAUA 5IYZB 4IHAA 4KO3S 4QO7A 5DIFA 3LS2A 2XB2A 1OXSC 1P2VA 3LUPA 4PX5A 1WPQA 4UJ5A 5EIFA 4ZYLA 3E7WA 1L5ZA 1SKAA 1JIKA 4YXWD 5JEDA 5ALYA 4PW0A 1O95D 5EZ5A 1IG3A 1CQIA 2GZHA 4CUKA 4DV2B 5J1SB 5EPUA 1P1KA 4Q1BA 1YASA 1HL3A 3CLVA 3NEAA 3GWZA 4Y3UA 1J7KA 1XYGA 1NC3A 4W5QA 4Q3CA 2P6MA 4YDSA 3LSYA 1VJ1A 1E2PA 4YDRA 2W6ZA 2OM6A 1L7DA 5DBEX 2BM8A 3LF2A 3ETJA 1USVA 3OTGA 3GHYA 4RHFA 3WO1A 4D4GA 2NVOA 2XCRB 1WQ1R 3OA0A 1XD2A 1NKSA 3KKEA 3OEHD 3HCEA 4LYFA 3VR2D 1JU4A 1NONA 2CXPA 3TS1A 4CIWA 3PUVA 4TYNA 2IIBA 2WJIA 4OHCA 4F85A 4HUJA 1EA7A 3S27A 1OGYA 4WBNA 4PSVA 3R3VA 1H3FA 2SBTA 4F7DA 3E82A 1DAMA 1YQXA 4Q7MB 4TMTA 3U9LA 4RGYA 4BV8A 2EBWA 4TT8A 1Y9ZA 5JS2A 2IIQA 2QV0A 1LCIA 4LOAA 1TJ5A 2OG1A 2XE6A 4AJOA 5IULC 2I5PO 5LZ5A 3SC3A 5IVPA 4TMFA 3OX3A 4AAYA 1KJYA 1VZ2A 1IY0A 3LZCA 2CDNA 2IF0A 2JFBA 3F8TA 1DC5A 1M8PA 3DC7A 4HBGA 2OG2A 5FBHA 1N33B 2ZTMA 1EFRD 4P1ZA 1EI9A 2BHSA 3UMBA 3CX4A 1H5QA 3B78A 3C2QA 4DIDA 1IJEA 1EK0A 4J0DA 3U3RA 4M0UA 1YVEI 4RWZA 2EP5A 1X7ZA 3K6JA 4LMBA 1CU1A 2NV6A 2R7NA 3RH0A 4FFNA 4B2IA 4L51A 1Z0KA 5CX4A 5B4TA 8MHTA 3WZMA 3B6EA 3ZDAA 5HTKA 1N6LA 3BX1A 5JYEA 3WYCA 4N54A 1PTJC 3OVMA 2D3TA 2W22A 3DOCA 3EVCA 3M49A 3PNKA 2AI2A 5EIBC 5IJXA 1VKOA 2RHLA 4YRIA 1V2GA 3LQRA 2PHZA 2F48A 2OZKA 3K3PA 1YHNA 3N07A 1NP6A 2REQA 4WIAA 3UGQA 1XHLA 3AKDA 3UB4A 4BDTA 2YMMA 3JQBA 1O9GA 2ZWVA 2WDZA 4DNOA 1T26A 2Q3DA 4X90A 1PJ8A 2NU7B 5IARA 3VHQA 3BFPA 1PWXA 2PFGA 4G5YA 1E9CA 4UXJA 3UG7A 4DQUA 5LMCA 3A6PC 2AN9A 2XGOA 3GU3A 3DFUA 3M6IA 1Q7TA 1Z28A 4QRHA 1NN1A 4CJXA 1D2AA 1GQRA 4XYBA 3T1YB 2RKBA 2VP5A 1D8AA 3WAGA 3RC9A 3RSFA 5I5GA 1EWTA 2BP7A 1TM3E 3TN7A 4LYDA 4F06A 5A04A 4Y9TA 5BWMA 3EPHA 1ZDMA 2C4KA 3EBOA 1X1TA 4BTEA 3HJGA 2V8OA 4J0QA 5J2UA 1SXQA 1EUYA 4DIBA 4EMUA 4C7VA 3C5WP 4DCVA 4BFWA 1PCXA 4BRUA 5AVUA 4IJ6A 2QPTA 2VFAA 1YKFA 5E2AA 3HKBB 1QH1A 4WL0A 3ZGZA 4PWYA 3A9TA 2GJ4A 3ZE0B 1FX1A 2PGAA 3FMFA 1I80A 4S1VA 1NVFA 1Q83A 3N2ZB 4TKZA 1JMVA 4L5IA 3GLTA 3UQYS 1U7OA 4DLTA 3RFXA 4J2OA 5IEJA 2HLNA 1F8UA 4QUEA 3ILHA 4LJ7A 3ZEAA 1QYRA 1UEJA 3R6WA 4LZOA 3WZ2A 4G5GA 4D6XA 2PBLA 3U09A 1VE9A 1HWYA 4QHTA 3VISA 5T7BA 3NWBA 3W6OA 1XOIA 3NVKI 1QMPA 2Z2XA 2KBEA 3K4PA 3H4TA 3ZV7A 1W88B 2J59A 3ZN2A 1JE1A 4S2UA 5DN6D 3MQ4A 4M1TA 2WTBA 2GTHA 3AR5A 2F1OA 3AXSA 1KYVA 1WPGA 4EP1A 1KMNA 2OPBA 3DZHA 3LL7A 1V1RA 1I9CA 4MB2A 4H6XA 1TQ6A 3QMMA 2XKAA 4EELA 3HO1A 4IDAA 1ZWLA 2FRDA 3E2IA 5G3YA 2P2SA 1NNI1 4PGFA 2FFJA 2KS6A 3GBSA 3LOQA 1KVRA 3ELWA 4H7FA 4V0NA 4URUR 5SYMA 1N4AA 5IAOA 4JV5B 2HRZA 1FQKA 5T41A 4RTKA 1L5SA 5KYWA 4DR6B 2R66A 4D6YA 5D2CA 1O6GA 4S0ZA 3WB2A 2YVUA 1U90A 2PPLA 1CQWA 2CXTA 3SMVA 1EQ2A 1ABFA 3PA8A 4GIBA 4PLZA 1TW2A 4U6NA 1QPBA 2BISA 4EGFA 1FLAA 1WO8A 4O2AA 1KYTA 1SCIA 2QU8A 2WR8A 4X44A 1AKRA 1QYIA 5ENVA 1TOAA 1BIFA 1E9RA 4AY3A 4HWGA 3OX4A 1OXTA 1ZW1A 4LFCB 2X2OA 3P8ZA 1QCZA 1FRZA 1ODSA 3MUNA 3TAXA 3TLCA 4F6RA 5M2QA 3NC4A 1CC1S 1HI9A 2JIOA 3PQFA 3RGWS 2DBZA 2WV9A 3DJYA 1WKBA 4QU9A 3VDNB 3E58A 3DV9A 4PSCA 4BEVA 5JCOC 3ADBA 6NULA 3O4GA 1NL3A 4XIYA 3NTOA 4IDEA 5CDTA 2ZRFA 3VZBA 1H9CA 1QCYA 5C7YA 1Z6ZA 3N0RA 3L6RA 1O0BA 1Z4OA 4EHNA 4U00A 1DSSG 3M6XA 1RIIA 2F7SA 3E9MA 1PK9A 3GIDA 2CUKA 1EFVA 5KWEA 3VPCA 5AVJA 2O0HA 1RYBA 1H23A 1T6YA 2AEMA 3D0KA 4HAZA 5EZQA 3KOWA 3L7DA 4KVAA 7GPBA 4HH0A 8ATCA 3RARA 3JPWA 3CO0S 3PRJA 4HPWA 5KTYA 4Q1FA 1OXVA 4NZNA 4R68A 1PL7A 1NA5A 4X6LA 2GAAA 4KP7A 5L45A 4DMCA 3FAKA 3HNRA 2I67A 1FLNA 3PR2B 2CMFA 2QTVA 3DNFA 4CLOB 3FHCB 5HWSA 3PHBE 1Z5OA 4TWRA 5GGXA 1Z35A 5ILGA 4ZHQB 1CY0A 5TF0A 1QP4A 4OM7A 2EERA 2QUJA 1NW4A 3ETEA 4CNQA 4EPWA 1ZX1A 2R6CA 3G8YA 1BKSB 2I71A 3RFTA 3PPVA 4IWYA 3THWB 1JQ3A 2VATA 3H0EA 4WQMA 2COKA 3HWRA 3I34X 2B92A 4YN3A 5CG1A 1TCAA 3JQAB 3W9BA 4AJKA 2P4EA 3NYIA 1M1YA 3UHAA 2Q07A 4PQYA 5B30A 5K8JB 2UZ1B 1IUPA 3WLRA 1D6JA 2ZUBA 3DVSX 4KLRA 1U7TA 2V7BA 3P97A 4LVUA 4AO8A 4C0AC 4BB5A 2I78A 2VNHA 1M7HA 3NUQA 1S3FA 3QPWA 1XEXA 4IZIA 1UPFA 3FFTA 3OM9A 4M0DA 5TQ2B 3FYDA 3I9OA 1PJZA 4X9XA 1YC2A 2C4WA 2YWBA 3BOSA 3MUEA 5ECWA 4ALMA 3ZW8A 3HYRA 2A0KA 4OUDB 5AI6A 3EIHA 1B7GO 3U9TA 2A14A 1F0NA 2JCYA 2PUVA 2BCGY 1U6IA 1ZY2A 4XCQA 2TMGA 5IC5A 3WGZA 4F72A 1KAOA 3H5TA 4B6QA 3BH0A 4JN6B 4OJTA 1OROA 1T6XA 5HJ5A 2WD9A 5CPFA 4OSOA 4MI1A 4HBZA 4K6KA 3RFVA 4J16A 3RSQA 3VC2A 1N6NA 2LV8A 3L7NA 3EZXA 1XF9A 4PC6A 4ADSG 4FPXA 1DLJA 1ZOIA 2FN4A 3GPCA 1TF2A 2J07A 1ISFA 5LZ9A 1M1NB 3F4KA 4DLSA 4QQRA 5E2BA 1JEYA 1HFWA 2B8NA 2HT1A 1EWVA 3MMPA 4QX6A 4DRXB 4DNQA 4LBZA 4COOA 3AQ4A 4NQRA 3M2TA 4TT3D 3B13B 1XZGA 1Z3CA 4AG5A 2CJFA 4XUCA 2UUCB 4M7OA 5TVKA 4J7XA 4MPTA 3K5PA 4MPPA 4CFSA 3ZIUA 4R9SA 4EFLA 2EP8A 2V8BA 3OPQA 3W3AA 5IUKC 3U48A 1DEHA 1ZH4A 1J9GA 4N18A 2PR7A 2RGCA 4JC5A 2WMYA 1XAHA 3ESYA 1VMIA 3OLWA 2F3QA 3OBBA 2IWRA 1E1RA 3FZYA 1ZJJA 3P5BA 1LV7A 4QUHA 5K0NA 1YGPA 5D86A 3OKAA 4O4HB 5K4AA 3HKCB 4MUFA 3WTBA 2VPYA 4DSOA 1MV5A 1EFTA 2IY8A 3FGOA 4MR9A 5BPFA 4BY9E 1ISSA 1CP2A 4QYIA 2AXQA 4PLYA 4FHZA 5I9TA 4UVGA 2PXAA 4BO7A 2ZUTA 1XMJA 3BE5A 3DDWA 3G8AA 3GH3A 1Z0JA 4G2NA 4V03A 5U1PA 2DX7A 4WNIA 1Y8CA 3GUHA 2QQGA 1BXGA 4H35A 4RF4A 3RYIB 4HB0A 3QEAZ 4X95A 5JLJA 4QXQA 4B6RA 3DMDA 3BWVA 1PJ2A 1RZVA 2F1IA 2GMWA 2VYVD 3DHWC 3FUCA 4RC9A 4D4MA 3IAM1 1DFHA 2ZJ3A 1AGPA 2QQ5A 3A2NA 4FBMA 4UCFA 5CT9A 2NVUB 4MUNA 5F51A 1M75A 1ZSNA 1N5LA 2DFDA 4PZPA 3E61A 3T5BA 3R5TA 5JECA 5DGXA 3WGNA 5CA0F 1P4AA 3B1KA 5DYGA 1Z7GA 1XTPA 3NU1A 3M70A 5A02A 2LE0A 3B3GA 2FPPB 1E8MA 1XEWY 1XWIA 1XQYA 3BILA 3JASA 1ZNQO 2V6IA 2DHDA 2GF9A 4JLWA 5BWLA 1KRHA 1X80A 2I76A 2QRZA 5CHYA 1E58A 2WWWA 2HWWA 4E03A 3PJGA 1ZM2A 1K8YB 4MWZA 3CSUA 4G41A 2VQFB 1R6AA 1YXMA 4OHBA 5DK6A 4IDQA 4NCNA 4B73A 3T15A 1LQ2A 3LKDA 2O2DA 1CDEA 4OHKA 4KDRA 1XYYA 3FXAA 1TF7A 1ESMA 1TUGA 3VHXA 1J9ZA 2E37A 1YNSA 4P08A 3UAYA 3NMUF 5ALEA 1V0JA 2NTVA 4YMIA 5KJ1A 4ZT6A 3Q9SA 4GSYA 1AT1A 1V11B 1YR8A 3ZE9A 1YIAA 5KOYA 1QUEA 4FNAA 3EARA 4IDHA 1QFXA 3RS2A 4AK9A 2O4CA 4PS1A 2NPIA 2BGJA 4TTTS 1PNQA 2XUAA 2QVZX 3KT0A 5GJBA 3BIWA 4M22A 4URXR 2O8CA 1B23P 1F4PA 2JFXA 2OUIA 2H0AA 4WFIA 4ZHSA 2QI9C 5JAOA 4QGGA 3QG5A 2XXJA 3GUZA 5KTMA 1ID1A 1IDOA 1PR1A 4UULA 4ZAXA 2GERA 1G66A 1NJ8A 2PMWB 1OZHA 4G25A 5DZSA 4P9NA 1JKIA 1WW3A 2YVQA 2VH2A 1PGNA 2QB5A 4NABA 4FB5A 4XVRA 3V1MA 1ZHFA 1M1XB 1FYFA 1F6DA 2YQ5A 2Z5LA 4LG1A 1SIBE 4RENA 1OYVA 5EPEA 4BNHA 4EF5A 5JZSA 1J6UA 2ODWA 1DT5A 1JDUA 2DPLA 4MW5A 3RYFA 3RVOA 5BWCA 3I52A 2G1PA 1YOBA 4QRIA 5TJ9A 4H59A 5KKNB 3COVA 4YVFA 1JECA 3C6QA 1YFJA 2REQB 2QTNA 3W5HA 1PQWA 1G8SA 1KO7A 1IE3A 3CF4A 2RH8A 2UXBB 3ELYA 2X0IA 4KQWA 4KO2S 2WSIA 3NHAA 1KR2A 4EVQA 1RAEA 2D1RA 3F1LA 5EJ9A 2WTUA 2VP9A 3RC8A 3S44A 4RZIA 2BH9A 1ZGBA 4IDDA 2IBTA 4LQCA 4Y2RA 1U7PA 4KSBA 3KEGA 3RIGA 5B58T 1N75A 2BFOA 3EW9A 4P5DA 2JGMA 2H2IA 3H3FA 1U2TA 2P9YA 4MUYA 4UBLA 4CT5A 4XVUA 2JH8A 3NBYC 5M29A 2YJTD 3AR8A 1KJ9A 4MINA 4X62B 2OCPA 2ZOSA 1GCIA 2EWMA 3B5EA 1NFFA 2O0MA 3NR2A 5SV2A 5KQPA 1CJVC 2RGXA 3J7AC 1U8EA 3REOA 3RIXA 3SICE 3L04A 2PMBA 2H51A 1U6KA 2BEUA 2ZWMA 4M1OA 4CLXA 1PJ4A 3WSTA 4DZTA 4GNRA 1Z0ZA 3DTVB 3HWSA 1DAIA 1NDQA 2G71A 4ML3A 4W5HA 5D3MB 1P5ZB 3TFQA 1KK3A 3BWEA 3HABA 2QKYA 3HB9A 4ES6A 4ZVSA 3IMFA 3N7UA 2VJMB 1VA5A 3R3SA 2UYHA 4ARIA 5AH0A 1C3JA 5CH5A 1GYQA 3N8NA 3R1IA 3TVTA 3ZVRA 1J0AA 3PRKE 5HS4A 1U0SY 1FSGA 1Z34A 3JZMA 1KYYA 4M60A 4MUGA 4Q1EA 4I1UA 1X92A 3LUHA 4L9AA 3MJDA 1Y1TA 1N32B 4MWEA 2I2XB 3NH6A 2ZKIA 2LKDA 2XWJI 3KWJA 4BJ1A 5FA6A 2DAPA 3FDZA 3IKJA 2XHZA 2X41A 1BZYA 2NMVA 2SICE 5CDUA 1XKQA 3QLTA 5A0FA 1S0UA 5KYWB 1AE1A 4JH0A 1F9EA 3THYA 2YVKA 1MEEA 1CXZA 1PN3A 2Q5OA 4IV8A 4KQ1A 2ZIVB 4PVCA 4UVIA 1ZA1A 2QNBA 4H6VA 3W6NA 4OFXA 3EPLA 2FAXA 3ROTA 2HYIC 2ECKA 2HF7A 2VN8A 4MUAA 3N8IA 7REQA 1MTZA 1DAKA 5TGZA 1TL7C 2O2YA 5CW1A 1GDTA 3QXCA 4DQVA 1TE2A 1PNTA 3DB1A 2WNHA 3C3BA 2ATCA 3AINA 3L0IB 1W46A 3NLLA 4GNKA 4QTZA 4TROA 1IHOA 4XWYA 4BZZA 4F6RB 2H54A 3IE1A 4F9GA 1Y3IA 2HRBA 2P1ZA 4V2IA 3FBWA 3J7TA 4INPA 4PZAA 5I3ZA 2ZWAA 3EMKA 2QORA 3KYCA 3G0IA 4KYTA 3AJEA 4W63A 3S2SA 3T0FA 4CR8A 3KQWA 2GHTA 3Q3HA 1WUIS 2OD7A 4JB0A 4LJ9A 5EN4A 2Z1DA 1UJ4A 2QQFA 5JASA 2XAUA 2JAHA 1SKYE 2ZDHA 3HCRA 2EGGA 1MB2A 1XTSA 1S5PA 5F1YA 5KTKA 5ALQA 1O0CA 3U7FB 2W2NA 2DULA 4CUZA 2KW5A 4NONA 3TCKA 5EGNA 1FX0A 2JVIA 3LT5A 4IGKA 4CM5A 3DUWA 3EGDA 2JRCA 3PFKA 5JS1A 2BBTA 1P0PA 1RJGA 4AUMA 4KHPB 2VP3A 3R9XA 2H1FA 5GINE 2AF4C 4F56A 2WF6A 4L72A 1ADYA 2RB4A 1R10A 2GAOA 1LDEA 3W4KA 2GPTA 2QTVB 4Q7KA 4UVHA 2GK4A 4YX9A 3CY6A 1BSVA 4DCCA 1GPKA 3ZD8A 4V0ME 1BWSA 1Z06A 3K9BA 4MKHA 2VK1A 1GU1A 1NVTA 3GHHA 3QU9A 4FMBB 1M34A 2J6IA 4HN9A 2GTPA 4D4LA 1I01A 2J9FA 3PC8C 4HQRA 4KAFA 3ZGLA 4JROA 4L75A 1Y89A 4O5AA 3ZCVA 2WZQA 4Z7NB 1Q0PA 2HU2A 1IQPA 4KKXB 4G0OA 4QJ4A 5EQJB 3ZHRA 2XODA 1EVKA 1G5IA 4K6OA 5LQMA 4TVSA 3N0VA 4TKVA 1USGA 1SUCA 3BL5A 1BH2A 3UT6A 3M5WA 4I3FA 2XADA 4D3FA 1FTNA 2ZLBA 3KTAA 2WB2A 3IA2A 4DYVA 1DT3A 1TD1A 2OENG 4PHFA 1UWCA 1EA5A 1XEXB 3GFBA 2DT5A 5JROA 2D0DA 1E7SA 4JGBA 3I09A 1E1DA 4J6FA 3ZDQA 4C4ZA 4QOEA 1OWOA 4L4ZA 1WWKA 4QVGA 3JQDA 1WULS 4QNRA 4ILEA 3L79A 3M89A 5BUZA 1ONOA 3PXXA 4KI7A 4CMJA 1DEKA 3QI2A 1N2XA 5C8VA 2Z6QA 3PQCA 4RZHA 4DQKA 4JQSA 4YT4A 1M9NA 3V2UA 3QVOA 3H84A 1GR1A 1LB1B 2WM9B 4OMDA 4ZOQI 4D8TA 5DB4A 2YWGA 2ZJ0A 3HA5A 4RJIA 5CIWA 1WBJB 2EJCA 2CL6X 1DNPA 3LO5A 4FIZA 2AT1A 4ZEVA 1DBIA 6REQA 1GQYA 3UHOA 4EG5A 1ORWA 2VCYA 2WF9A 1SB9A 1N7JA 1UXHA 1FJGB 1VLMA 2BI4A 2EJTA 5IN4A 3PTLA 2ZBPA 3HYLA 5JD6A 2PA0A 1V71A 5KU1A 1M73E 3G0CA 1K7CA 1PJBA 4XWOA 1YB6A 2FRDC 2J32A 1RQ2A 1PYOA 1R4AA 3DBVO 4H77A 2X9NA 5H5JA 2IYZA 1EJBA 3A3NA 4REMA 4XX1A 1FPMA 1T3HA 3A6KA 4TVBA 1LDYA 1GQQA 2J41A 2ZRQA 4FMCF 2JLRA 4HB2A 3X44A 1ODKA 3GD7A 3WO0A 1CEYA 3D3KA 2Y71A 1ZU4A 1JBEA 3A1FA 2QTFA 2HWXA 2J7PA 4FFMA 4XJSA 3KEQA 1YGYA 3RUIA 2HSJA 1ZIDA 4QYIB 5JVDA 1NJFA 1E2EA 5CB6A 1XRJA 5JATA 1R0BA 3ZW9A 4NYJQ 2H29A 4DMLA 4LWOA 4NU6A 2O2IA 1SVMA 4DV7B 5KX5A 4CM4A 3GRCA 4NG5A 2ZQZA 2CJPA 2PRJA 5TX7A 3UK6A 1AKEA 3RFUA 4HWTA 1PR3A 3G8CA 2EKPA 1X2EA 3SR0A 3HR7A 1PDOA 4RIGA 2GPNA 3EY9A 4GPEA 4JA2A 1FSZA 3D4PA 2D0PB 2ZIFA 4K86A 4Q47A 1GZ7A 2E9SA 1DDOA 2FWBA 1JR3D 4UMEA 1DCKA 1R4MB 5FHRA 1J7JA 1H65A 1R9MA 4Q6BA 3ISTA 3RPEA 5KVSA 1KY3A 1RRPA 5ALJA 3TLZA 6CHYA 1DGQA 1T8RA 3MPUA 1NKVA 3N0TA 4A0RA 5ULLA 5ALIA 3WOVA 3B70A 1NQOA 1CIJA 1UOEA 5LP1A 1L6IA 5KDLA 1GGKA 3BGDA 2AR7A 5FHQA 4RY8A 1XD8A 2DY1A 3ABZA 3P71T 4N6GA 2OFXA 3WI7A 1R5NA 3D7KA 3MT0A 3WJ1A 3TUIC 5EKXA 3ZWVA 5LXTB 5CG2A 4QXAA 4TVOA 3HJFA 2WAMA 3IBTA 2YWRA 5JIBA 5AW8A 1KI6B 1Q7EA 4EY3A 3R9WA 5DCYA 1IDN1 3M3DA 5I9MA 5TXGA 5JCZA 1EQUA 3O8NA 1KY2A 2ZRMA 2PLAA 4UXIA 3OSUA 2AD1A 1L5KA 4DPMA 1R88A 2GF0A 1PZGA 1RJ9B 2BR4A 4R0MA 3PQDA 3ZY5A 3HGMA 2VHVA 2X77A 5FWNA 1ZBQA 3DP9A 3OLXA 3C1OA 4H1UA 3VPXA 1EX9A 1YS2X 5BVGB 3EOZA 2BHNA 5LKRA 5DE3A 1XRNA 4NICA 1OZFA 3K6RA 3O92A 4M8IA 3VVLA 4DLBA 1XVUA 4RXTA 1O97D 2G77B 1IM2A 3QITA 3R5KA 2B37A 2NYRA 3E3OA 3ASZA 1OT5A 1C3XA 1E1CB 2BJHA 3CR8A 3KXIA 2IIPA 4U7FA 2IX9A 3UKJA 2VYNA 2JFVA 1K4YA 2CL0X 2JAWA 1KO4A 2B5VA 5SZKB 2BMAA 1ECBA 1SZCA 3LY7A 4F4DA 4J16C 5EPOA 4R8LA 3RYFB 2F6RA 1NRXA 2PT7A 4MAAA 2PNJA 4I50F 1BN6A 5A4MS 1CE8B 1J07A 2M9MA 3DZFA 4H60A 5C31A 1FDTA 3O2QB 3MFYA 1P8AA 1KWGA 2PEZA 2R8YA 3UMYA 3HJBA 1MEOA 3CONA 4RLQA 5D84A 4IXTA 1NVKA 3CEHA 5KI6A 2V97A 1YIDA 2GCEA 5J5VA 4IKOA 4JC0A 3MHPA 4ZV4A 5ADVA 1MV8A 2B7CA 5FV4A 4JOBA 3DOHA 4KXQA 2ETXA 9LDTA 2WYIA 4FFRA 3BWMA 3RHTA 1NI4A 1PR0A 1L3BA 3EW7A 4X1KA 3VI4B 1AURA 3AVYA 3DWEX 1KETA 5D85A 2XMQA 3A6FA 1G8HA 2BL4A 6LDHA 4M6WB 3TECE 2AKEA 1MFZA 1WV0A 2D0OB 4MXDA 2WICA 1E8DA 1XZPA 2CMKA 1V5GA 4WNCA 2XVZA 1VRWA 1S1MA 4NV1A 3OA2A 1HG1A 4MYSA 2ZRIA 2IU3A 1K89A 2XNDD 3KWFA 3WL6A 2OC9A 3H5RA 2BD0A 4AF7A 1M74A 4FBLA 2XDWA 3MLAA 5C1DA 4JXJA 2ZJZA 1PS8A 2BEUB 2A1UB 3RV3A 1UBNA 2XD4A 2ZR8A 5F7OA 3MWJA 1ZQ1A 3EVEA 1E64A 3DZGA 1ZZEA 3N8DA 1KPIA 1L4HA 2HN9A 2F9LA 2GPJA 1FP4A 3QUTA 4E5NA 1XRSB 2JI7A 3NNNA 5IDWA 2EJBA 3GEHA 1TECE 2YHSA 4KO4S 4A73A 2EEZA 1MJ5A 4JI2B 3O93A 5IMSA 4J2HA 1YUBA 4TSKA 2RKWA 3TTXA 3PF8A 5DRYA 5K0JA 4Y2XA 5KOHB 1GSHA 5EIXA 1CYEA 2FX2A 3BBLA 3PNVA 5CDYA 1T4CB 4JR2A 3CR7A 5ALPA 2PN1A 5I9IA 4GKJB 1TZBA 2RHWA 3T12A 1EX7A 2DBVO 4DA4A 2V5VA 2BV3A 2DKOA 1B14A 1SEVA 1VSVA 1Z6YA 2JFWA 2JGDB 1XNGA 2WRZA 1KFJB 3Q2OA 2P8SA 3QKUA 4KXXA 2PWAA 1KQFA 1KYQA 1K98A 5E8RA 4RPLA 5J2TF 5I4IA 1RXIA 4G67A 2ZYIA 5BQOA 4BNFA 1PKXA 1FA9A 4OK5A 1PVOA 4M1QA 2DE0X 4Y6SA 2HDNB 5FL7D 4QM7A 2UYCA 1PEAA 1J09A 3UV7A 4BYGA 2GH1A 1P4RA 3GLIB 3HKEB 2PE5A 3LI2A 3FSGA 7REQB 2JAUA 3RYCA 3EEOA 3HXTA 4DARA 3PWZA 4HNGA 4MQEB 3P2IA 1Q0RA 2PKCA 1JPNA 3MBOA 3DMPA 4OXXA 1JAYA 3PVSA 1DEOA 4YQFA 5A5DA 3R9IA 4TTQA 3H5WA 1JJBA 1Z0AA 2G25A 2OBLA 1E92A 2QY6A 4JITA 4WKBA 4DB2A 4E70A 4UKDA 2P77A 2OO7A 4FHGA 2JAPA 3ZJ5A 1N77A 3F5QA 1JV2B 3L1KA 3DKRA 1UMCA 3H8VA 3WLQA 3V1UA 1K2VN 4QATA 1XZJA 4MS1B 1G2QA 4GI1A 5E1OA 3Q41A 3H5NA 1QHFA 2XNSA 1IMJA 3RUAA 3EGDB 5B5SA 4UTVA 2BM0A 2JFFA 3CH4B 3JY6A 3LG2A 3UXEA 5CLHA 3VOSA 1RU3A 3SQXA 2N9UA 3GB9A 1FYDA 3ASVA 4RPHA 1GPYA 2WWRA 1SZPA 3KOUA 4BJ5A 5K6TA 1YULA 4OAPA 3TD9A 3C5CA 1Z4PX 1LC3A 1CUSA 2AOVA 4QEDA 5KS2A 1M34B 2XNJA 2J9FB 1H3EA 2L18A 4Z2YA 2ZWIA 4U5XA 4BC0A 3AUFA 2ZUEA 1J23A 3MTIA 3GLRA 4OKNA 1PU2A 3O31A 2Q5HA 3LUBA 1NN0A 4TQGA 2HBQA 3TX6A 4XDZA 4KV7A 4XIJA 4AKTA 3F96A 2ZB3A 1S7CA 3MUFA 5ELMA 4BFZA 2HQSA 1OD6A 1S8AA 1Q44A 5G4KA 1N5OX 4RF5A 1ZC4A 3TOZA 2G06A 3C1AA 2MSNA 4JDPA 4W7SA 3WKCA 5KYNA 2QRJA 4G1MB 5HKKD 5EJ4A 4KDCA 1UBSB 1Q57A 2L2QA 1M2GA 3K7EA 3L6OO 4WKPA 4BNIA 4WOJA 2CCJA 2XMZA 4EWLA 1ESEA 1A2OA 1XU4A 1FNDA 1JVSA 2CHVA 2WIFA 3H0KA 2GBLA 4PCVA 1GZ6A 4WN3A 5BSRA 4S1WA 3AF1A 3FFBA 1E6UA 1SPBS 2PL3A 3H1PA 4NNOA 4EY7A 3RBAA 3SDZA 4DPLA 2I6SA 2ZIGA 4GF5A 1OYWA 2GYWA 2A3RA 1BNCA 4OHUA 1S02A 4HDRA 6REQB 4JT9A 5TE9A 2P90A 2I1WA 3ESXA 4RV4A 4UCXA 3ROKA 2XIJA 3AVQA 4UBOA 3WICA 1ND5A 1UDCA 1QHNA 4TRRA 4YMUA 1I14A 3IUMA 4ARZB 1J2TA 1M0EA 4BO9A 1WDMA 4QQKA 4XXHA 5KJ6A 3FI9A 5JTTA 2ZFUA 1G3QA 3FCEA 1WUJS 3LY9A 3DUFB 3EZLA 3GRUA 3X0DA 3BL8A 3AHGA 4ZZIA 1XA0A 3KAKA 4EPTA 4YCNA 2IKQA 3AF2A 2DHRA 2I9PA 1TM2A 5FUYA 1EU1A 4GLLA 2FUG6 5ALTA 3C6YA 1T9KA 3U2QA 5KMGB 4WEOA 1TVEA 3GYBA 3K30A 1TLTA 3M4JA 4UC0A 4H27A 5KNDH 3L46A 2YMQA 1U7DA 3LFUA 3C97A 5JVDB 1TYEB 4CV0A 5K2MA 3CNOA 5COBA 1GPMA 4C06A 4ZZ0A 1C0IA 3O94A 2H8KA 1HRDA 3DDCA 5KX5B 3HH8A 1NRWA 1DC3A 4OHFA 2UZAA 4ZAYA 1SUAA 5TLSA 3QJYA 1CZRA 4ZREA 3AC0A 1XAGA 3AUSA 4AY2A 4NDZA 1LEHA 2Q28A 3H9JA 3HMQA 1DZIA 4HWKA 3RWMB 4B6SA 4UD2A 4TZ0A 2VUTA 4X7MA 4ZXFA 4EKGA 5J4LA 4DUZB 3EC7A 1V6SA 4IDGA 5DHRA 2CL5A 3SLKA 1FDSA 1FZQA 1QZ3A 1H2FA 4IDCA 2QAGB 2BR5A 4B6OA 2Y77A 1VE1A 2RC6A 3HR4A 4D56A 5IK2D 4CTJA 3A14A 4BFYA 4Q3EA 2PPVA 4UASA 3WGKA 4IICA 4D42A 1SJ9A 4FHCA 4IOMA 4RH1A 5BT8A 5IVDA 2DFLA 1RYEA 4HRAA 2EJUA 1F8XA 1F5NA 3I6QA 4B43A 1E3IA 5A9SA 3GEPA 4P7GA 4YQEA 5CLQA 1DC7A 3WV4A 4XR4A 4AZTA 5IWAB 2RE8A 4DA7A 3ER8A 3T9EA 1GG2A 5C35A 2OV8A 4NMXB 2PG3A 5F9MA 2IODA 2ATVA 5ITWA 2WFLA 3OKCA 2C83A 1DC4A 1UMBA 2OGSA 2PMDA 2V1UA 2C9CA 2HT6A 1L1FA 2A58A 2C9ZA 3DL7A 1AS3A 1ZU5A 1C4KA 1JTFA 1WVIA 3VNRA 1TM1E 1CFJA 1GLNA 3REQA 1GILA 4NESA 2AMJA 1IATA 3PQ2A 1JAHA 3TMKA 2JHAA 4V0QA 5GIOE 1DIRA 1VQ1A 4OFBA 4Q93A 2ZBDA 4G07A 3KQYA 2HK7A 3CZ4A 4Z4IA 2N3ZA 1DX4A 2PMFA 2CKMA 2TSYB 3DBLA 1FDRA 2RI0A 4LV6A 4DG8A 2P9HA 5AVQA 3L06A 4QBKA 1KDTA 2GD6A 4YECA 5F4BA 3AF3A 4WA8A 1P5RA 2RSLA 2P2GA 4XDYA 3WWZA 4EI7A 1RZRD 3MTAA 4XYEA 4MP6A 1WXFA 1NXPA 1E2IA 3FWYA 2EL7A 3M1AA 4FOSA 3FVRA 1R8SA 4RA9B 1VLHA 3UF0A 4CIXA 1U3WA 3TD6A 5JJIA 4ZKDA 2QG4A 3EPKA 4KQXA 4QDKA 1KZ7B 2ZYSA 2QR2A 4YJ2B 1LLUA 1ORIA 1KJQA 3PDCA 4BQRA 3BMNA 1UOQA 2Y9PB 3GPDG 3S8MA 1K8QA 2CNWA 3GLGB 3V8MA 3DWFA 3DNPA 2OBYA 3J80A 3IJEB 3JQFC 3OQBA 4IBOA 4HDNA 4JIGA 5DPMA 1G2PA 4DSAA 2XXAA 1HX7A 1HEUA 1JIVA 4UBKA 2WZCA 4LJSA 4EJSA 5ITZB 2IBMA 3M4XA 5GZ1A 2R2GA 4YQYA 3GARA 2C4UA 2IYNA 2FR0A 1BGVA 1D6NA 1YDFA 1YAJA 2J67A 3DAGA 2CZCA 2XMBA 4MQUA 4YQZA 1F14A 2WVAA 1UKAA 3JYNA 1W581 3JV7A 5LR6A 1VBNA 3ANNA 4E3WA 4UEOA 1LRJA 3CLUD 2HHJA 3TW8A 4AJEA 4CMIB 2XZOA 5CTAA 4N8SA 1E1QD 4FINA 2GEBA 2GN8A 5BWOA 1N5JA 4E07A 1GKUB 5BUQA 1GTRA 3LT2A 1XNJA 4ZVTA 3HCOA 1XPJA 5JSKA 4J9UE 2QT9A 2FCRA 1QIEA 3I12A 1KXZA 3RG8A 1FB5A 1JQDA 4CCAA 4FJ2A 2QTMA 4RK0A 3EIXA 3N2EA 2O6HA 2PX5A 2QN8A 2INGX 1SBYA 3T0GA 2YYAA 3OOJA 4F21A 3A28A 3KR1A 5BN5B 1G3MA 4LI0A 2VPQA 3D6FA 4LOIA 1SBTA 2YJ5A 3L0YA 4TMXA 2VJLA 3QNMA 1NDUA 1T5OA 3GFQA 4GC9A 3K15A 2OSVA 4ROSA 1I7LA 4UEJA 2HOQA 1K7SN 3F5SA 1R0RE 4DTCA 4P7BA 3NBFA 4ZJYA 3OCYA 4PTLA 2VHEA 2VH5R 4XDGA 3GJRA 5JSYA 3UAGA 2Q29A 4RLHA 3K0FA 5AVTA 1D7OA 2AV6A 4LTNA 3RKSA 1MXFA 3LPLA 1P0QA 1V4NA 3RW9A 5K8UA 3BRCA 5B1HA 4QSHA 3N7AA 2H1RA 3M83A 4P7JA 3EDQA 3CLKA 3WWDA 1K92A 3LUDA 3ETDA 3RBXA 1X0XA 1WUTA 5B58C 1X7XA 4OA5A 4B4OA 4A6XA 1GCGA 3OWOA 4OFWA 3PCXA 5KVCA 2QMHA 3GVIA 3OH8A 5E9AA 5C32A 1TT5B 4YAWA 5EESA 4G0VA 1KR5A 2OLEA 4PPYA 5KWSA 3PDIB 3AJAA 3P94A 5IJ9B 3RS9A 1ZAKA 2G9ZA 1OBCA 1KI4A 2OXEA 3RRYA 4OK6A 3UMVA 1TK2A 3TM5A 3W2GA 3WK7A 4O0LA 4RH3A 2E82A 4BZPA 5IWCA 2C8KA 2X8LA 1Z62A 1NW6A 3ISVA 4AN0A 2ROQA 1WZEA 4NE7A 1MC4A 2Q45A 3KHKA 1AA9A 1TTPB 2SECE 4GQAA 4MP8A 4YXWA 1O95A 4TS3A 3UMSA 3V33A 2O1WA 2A0XA 1DP4A 3SIWA 4D02A 3MZ0A 2EFEB 2CYBA 1KK1A 3I5UA 1IN7A 5L53A 1U0RA 2YWHA 3JS5A 3MD9A 2PV0A 2DU8A 4L02A 4D9HA 2QIPA 4JASB 1QRAA 1P2SA 4Q4HA 4IIVA 5TMPA 1JWLA 1R6UA 2Q5FA 3B9RA 5A03A 4GMGA 3DWIA 2EXXA 3VKGA 3O75A 5CB4A 1RM0A 5K0GA 1LFAA 2PZFA 2FW8A 2QRPA 5L4SA 1PTKA 3OEHA 1NE2A 2UKDA 2YICA 5LBIA 1JUDA 3VR2A 1YFLA 2JLUA 4BZQA 1P31A 4B45A 4BB9A 3PGMA 2I2BA 4FCVA 3R3UA 1XUOA 2R60A 1DG9A 3II6X 4U6SA 5AW5A 3USZA 3QYPA 2Z09A 2FE4A 1E4EA 3LIPA 5CD1A 2QNIA 2FW0A 2AD5A 4C4SA 3NDIA 5CBPA 3BXXA 3U1BA 2ZI3A 1J8MF 4PF1A 4K6HA 4UUMA 4D82A 4E94A 3OTHA 4JB3A 2W0MA 3EZ6A 4ZEOA 1SU7A 1ZMOA 2J7KA 3MS4A 2H1VA 3EEQA 3V4OA 1DXYA 1DG3A 1TKRA 4N3AA 5HM6A 5IABA 5IPFA 4PYJA 3PQ4A 1AQUA 2QXUA 4RH0A 3MIZA 1UAGA 4DCNA 4NOLA 5G4KB 6ABPA 1QQBA 4PCLA 3E7DA 2YN0A 1PUIA 3O91A 3ZS8A 4EJ6A 2A9KA 3OOSA 5HR5A 2P75A 2X5NA 1J56A 4OHRA 3Q3EA 4GXNA 3HRHA 1SKUA 5F3DA 3RIYA 4X71A 3LRXA 4OB6A 2R48A 4HGYA 1PT8A 1EB8A 1J8QA 4RD4A 3IUEA 2DFTA 1H1LB 4ZO9A 4HVCA 1IU9A 3N75A 4K26A 1CIVA 4HYQA 3RK0A 4BBPA 5HPYB 2XUIA 4DANA 2X3YA 1TQHA 1Z12A 2NO4A 4FDTA 4WZAA 2CXNA 4JYBA 5FT9A 1ILWA 2JFHA 3ZWCA 3R3YA 3MT7A 1XXHB 1M2KA 4GS5A 4TS1A 4EKIA 1EWKA 1I32A 1PIWA 3WIDA 1I2CA 3EQ8A 2X8WA 3R8FA 2BELA 2C82A 4ZI7F 4OHWA 2PGOA 3EVDA 1NNEA 2BGUA 3EDMA 1T0UA 2QTLA 2YMPA 4LHZA 3I2HA 4YO7A 5JJ5A 5MN4A 1DQSA 3HXMA 1D6MA 3M9WA 2AUTA 5B4UA 2PSJA 3TK1A 3AEKB 2OHFA 3PPYA 1EE9A 1KI2A 2JHCA 1EEXB 1BXKA 1WLYA 4F7WA 4KR3A 1Q0LA 1Y34E 4RXMA 1RXWA 4LA4A 4DA6A 2OCDA 3WYEA 4ZQFA 4OB7A 3V48A 3AI3A 3KOYA 1IWBB 4BS9A 4P7FA 2NXEA 1OX6A 4ZYZA 1NUUA 1CT9A 4HXEB 1KKUA 3UKDA 4R8VA 3WFZA 4QOHA 3RC3A 1YQWA 4ALLA 4ZPXA 3QE2A 4CKEB 3RSGA 1WU8A 2X5JO 1KOFA 3CLTD 2WWGA 3EVFA 4Y6LA 3CLSD 3AVTA 2VWPA 4L76A 1TO1E 3EB9A 3WL4A 1SKMA 5FLYA 3GEGA 1IOLA 4HPXB 2DM6A 4E6PA 3W5BA 1IJBA 1L7RA 5FTJA 1FDVA 1UJ5A 3FB4A 4DCOA 4XRGA 5GJCA 3OJXA 2OFWA 3K4QA 5DNUA 2VDLB 2QD1A 3C16C 5IKOA 4HGPA 4D8UA 2TMDA 1H94A 1MU0A 4KE7A 5HGXA 1W85A 4RKFA 2NYUA 4NQZA 1P9WA 1TC1A 2HQBA 3WMFA 2QE7D 4R2HA 5CJ2A 4MPDA 3BD8A 4OVKA 3H11A 5A05A 1Y42X 1PL8A 1XI2A 5DN6A 4IDPA 4BLSA 4I1RA 2VF7A 2WU3A 2XYPA 3FPGA 4QQNA 3D43A 1RMTA 5JNUA 2NZYA 2YCBA 3D2BA 1FTSA 5H83A 2X7JA 1LRKA 3OKPA 3EC2A 3RF7A 3TQHA 1C3OA 4G8JA 2PUAA 4G8CA 3CUSA 4UTXA 3SDBA 4QDOA 2JVKA 4K9QA 2WI8A 3VU0A 4BNGA 1RBYA 3FGZA 4HS4A 2X0KA 4WZBB 1JJAA 2NUAB 4FVTA 3VH2A 4E12A 1Z2CA 2I3GA 4JI5B 2Y1DA 3LY8A 3N2LA 4NZPA 1GN8A 5A9SB 5BSEA 1QZUA 2C78A 4Q21A 4U2KA 4B8ZA 1KNXA 3T1TA 1YONA 5FI3A 3KR9A 4IXWA 1YCHA 3KM0A 2VZ8A 3PYMA 2I0FA 2FW9A 2XWSA 2VHTA 3G9ZA 4K1XA 1IZ8A 4XQ0A 5G0VA 3TQFA 2JJ1D 2I7VA 3D4NA 3DYVA 4I5GA 3KLOA 3DOEA 1S3IA 4LZJA 3IVGA 3MBKA 1RI5A 3WLHA 2Q3FA 4WKCA 3NWOA 4M4SA 1I2MA 2PX3A 5JCJD 3AV3A 3X2EA 2OCAA 4WK0B 4E33A 2K7FA 2RAFA 2EFGA 3T94A 2E87A 1FRQA 4AG3A 4S04A 3L6BA 2BEWA 2HSGA 4GVPA 5T6BA 3QE9Y 2A9QA 4P5PA 3TEFA 4OHVA 1XLWA 1I6KA 2W8BA 2YASA 2FMFA 2YY5A 4OQDA 4RAQA 5CT4A 1G8AA 3UJ7A 1ZKMA 2RBEA 2XA9A 5J4VA 2CDAA 2GTIA 1B15A 2V4ZA 5CFQA 5KKCA 3OETA 5KYYB 3VZQA 3GGDA 3PPIA 1JR2A 1E99A 3MSXA 2C92A 1J1IA 4FDMA 4LZZA 3IAFA 1SVLA 2A57A 3HDVA 3AG6A 4IGFA 4CCYB 4I1SA 1X7GA 1I3MA 1XZMA 2BUCA 5HK8A 1UJNA 4IO1A 5K3CA 5TJHA 1NV8A 4K03A 3TE7A 1W4RA 1UBEA 2GD2A 5A6VA 1Y5MA 1UBHS 1ENYA 2IYRA 2OZLA 4L3VA 4NATA 5F1KA 4OYHA 3D2LA 4U8GA 2AHOA 2E0IA 4KLAA 4UU1A 4DGQA 3G82C 4BKPA 2NNLD 3HBFA 4CR7A 2B69A 2OGTA 3NDJA 4CMHA 3D5EA 4BMXA 3B89A 3A9SA 3F47A 5ALDA 4QOSA 1N9KA 5IVIA 5IT0A 4QJ3A 1SNYA 2FWRA 3EA5A 3QOXA 3THOA 3WLAA 3NOXA 4KIUA 4AO6A 4EIWA 5A5GA 3L8GA 4N5NA 4H31A 3WB0A 2ZQ5A 4IQGA 5EZ6B 5ISMA 4UEQA 2Z43A 4CQMB 3RVPA 2JIZD 4RIEA 3ITDA 3QLJA 1ZINA 5IDXA 1DEXA 3T3OA 2J0EA 3AEXA 5AHRA 2FFAA 3IS3A 4BOYA 4R2LA 4YP7A 3F74A 1W4CA 4FD3A 3A1CA 2G09A 2CBZA 1L5FA 3DAOA 1II8B 3G9QA 3I01M 13PKA 3PPXA 4ILKA 4KFUA 4UTRA 2QEQA 3TW8B 2JD1A 3ML1A 4NZMA 4EW2A 4UREA 4ZVLA 3RJ9A 2ZJAA 1UBCA 4PHTA 1RRCA 2B2NA 3O2JA 5THQA 1W1UA 2A35A 4P3XA 4U2FA 4L9WA 1BFDA 1MPXA 4EG0A 1Y98A 3GY0A 1NLZA 1PWEA 4WNAA 1W2HA 3RSLA 1L9KA 3A3PA 1CLUA 3EAFA 4QGBA 3WNDA 1MAAA 4RIHA 2EU8A 3I1JA 2OXCA 2BFCA 1XRMA 1ZM9A 2B8JA 1LD3A 2G6TA 4HPJB 5AUQA 4B46A 1EZZA 1J70A 3JQ7A 2PSEA 3FNFA 4D5EA 4TZ6A 2QT0A 3DEAA 4AZWA 2VT6A 3CTPA 3WYNA 3OFND 4RTJA 2QLLA 3FCXA 1QAQA 1QHHA 2YY6A 1UK7A 1MRNA 2BFNA 8LDHA 1UK9A 2AN3A 2J0SA 2QBYB 4U8HA 2GVDC 3LHIA 4JHXA 3X1XA 4DABA 4ND2A 4TT3A 5IKMA 4LXYA 1T43A 5HF8A 3EXEB 6ADHA 4QUBA 2BMJA 3Q40A 1W94A 2YV5A 3R0VA 3T4XA 1AZWA 4KFSA 4J91A 4LJ8A 1V3QE 3SCZA 1TRHA 1P7WA 1RTKA 1WABA 2HLDD 4J4HA 4LY9A 4DCUA 3K0CA 3JYLA 5TIIA 1GD1O 1U8AA 1Z2PX 1WCWA 3RFFA 1QR2A 4D8WA 3SBXA 2GN6A 1BCRA 3PGKA 1YK1A 1A9XB 5EG5A 3K0EA 2OO5C 3G2QA 1LPBB 1L7MA 2VUHB 2AXPA 3PC3A 4Q1DA 4QD3A 1OA1A 2CHEA 3OMLA 4UHHA 1I3OA 2N47A 3OEYA 2XB8A 4MYUA 1VE6A 4B3SB 3HB1A 3IP5A 4F92B 1ZCFA 4YH1A 1IPHA 4ND4A 2VXYA 5GAJA 4CZ2A 4E51A 2C96A 4FE4A 2FVXA 2KE5A 4PXSA 1VCMA 3GRAA 2VYVA 3UBMA 3ZIAD 2J0UB 3W1EA 3BH7A 3GN1A 3IUSA 2VDRB 4L27A 5AK3A 1SBQA 1ZGZA 3TR6A 4FS8A 2V7PA 1EE2A 4CIAA 3AM5A 1FDUA 2HZ7A 4PCUA 1VL1A 1RZUA 1YJXA 3CEJA 3W9SA 1TCCA 2D00A 2I4MA 3E1SA 4IVQA 1NY5A 5EHZA 1PT5A 4Q4HB 2C5SA 4YONB 2BSQA 4YJGB 2ZRLA 1ACMA 2F67A 1W5AA 4B3FX 1WW2A 2PL1A 1RWMA 2YC4C 3R5FA 4K9RA 4MRRA 2J33A 3NT5A 4RK4A 2BHRA 4P3KA 3U7QA 3A37A 4BX0A 2NN3C 4AY4A 1TAGA 1CF2O 1DINA 1NW5A 3FB1A 2ZPTX 3U4QA 2QV7A 1D09A 2AZMA 2B83A 2MYTA 1JIUA 1QK4A 2NZWA 2IYTA 2D4AA 4F1JA 4G0XA 1W6RA 1JS1X 4HXYA 4BEBA 3LUGA 1C7QA 1BMTA 5CBPB 2PH3A 3C8ZA 3PWSA 3VYRB 2XD9A 2K2QB 1T2FA 2NU6B 1P17A 2OBFA 3E18A 3GLFB 521PA 3A25A 1H2XA 1HT0A 1ZSVA 4MGHA 5DCLA 1DJLA 5FNVF 1KDYA 1YMVA 4EI8A 2O3UA 1GO2A 4HNAB 4BMOB 4KG7A 2OP0A 4HT3B 1NVVQ 2IYFA 4UVEA 5A4DA 4EOGA 2F3RA 3DMNA 3QVTA 5KCZA 2WWTA 3LGXA 1FJXA 1DAOA 1HQCA 4W9NC 4D9MA 1KIAA 2X76A 1W4ZA 1ZD9A 3OX1A 3QEKA 1XWWA 3SS8A 2B99A 2AFHB 2I3BA 1P6XA 2XUQA 3X1KA 1FS5A 2VHYA 3DG9A 4LRUA 1XTJA 1SPXA 4B83A 1RWNA 4MS4A 1RI4A 3VVMA 3LYUA 4EUFA 3LQ1A 1SQ6A 4D9IA 1ORDA 1S9DA 1O5OA 2BEVA 4B3BA 1QGOA 3KDPA 4YRNA 4FM9A 1GZ5A 2ZVJA 1TIPA 4L15A 3WLSA 2GKGA 2P68A 2JA2A 4C6SA 3C87A 3Q88A 1L4FA 5AK6A 2W2OA 3BS4A 5LJLA 2WQ7A 3EZYA 1X70A 3OU7A 3T38A 3WK5A 5EXXA 4ENSA 4B8WA 5I48A 4KE6A 2Y6UA 2BGGA 2ZI4A 4GI2A 1BYUA 2EKZA 4F3RA 3G2HA 2IV3A 5K3OA 2FQYA 3QSGA 4XZ3A 4YJKA 4Q7QA 5JH7A 3TSYA 2Z8YM 3ZWBA 2GFQA 1AXEA 3AFGA 4YCAA 1TJYA 2IS6A 1CZHA 4M1SA 1U1EA 3U4GA 3X1DA 5JZMA 3TZ6A 4Q00A 4KMOA 4Q03A 4EA8A 3UC9A 5LZ2A 1RXVA 4QASA 1UPTA 5A62A 3E3AA 1R7RA 4H18A 5B3KA 3PQEA 2O0KA 4ND1A 1Q77A 1U4NA 2ZBGA 3NM4A 1R0XA 4HWSA 5BSTA 4OX9B 1ENOA 3RNOA 5AJHA 4BP9A 3JR3A 3RODA 3JATA 4B9AA 4Y2PA 2TMYA 1YH3A 3FYCA 5I9NA 3L5KA 2I4TA 3JQGA 3T95A 3K72B 2PMCA 2Q9UA 2V7VA 1N9GA 1UXOA 1ZG3A 3R5SA 1L5HA 4X63A 4XTCS 4EKDA 2Q2WA 4YCLA 4AP9A 2H1WA 1N25A 3G1UA 3WL8A 1NVEA 2NOAA 5DX0A 1NVGA 1H69A 4UAJA 2VK2A 4ONEA 4DPKA 3NPAA 2WAYA 4F1KA 1P74A 4Y6PA 3MTEA 1PFWA 1Z6XA 4XVHA 5IAGA 4PYNA 3R7LA 4AQDA 4MRSA 5DJ5A 2NP7A 3TKLA 4PO9A 1YRWA 5C8ZA 1O95C 2GASA 3RSOA 3IKVA 2H9YA 4U02A 3SEFA 2HNKA 3A9VA 5F2EA 4DA0A 3SOPA 4AJIA 4BX2A 1KEEA 1N5RA 3TGPA 1VHDA 5J23A 4LX0A 1KARA 4BO8A 1EHYA 4C0WA 1B3RA 1NW9B 2P4HX 3C43A 3LRPA 4FJ0A 4NOJA 5I7FA 3JVEA 2LBPA 1OFVA 1EFKA 1F0YA 3KVRA 3ZW7A 2NUTA 2OV6A 2K6GA 1TAQA 1E7YA 1O8BA 2Z5GA 3AKCA 4UFOA 3S2IA 4V0LA 5DBHX 4CF6A 3CVOA 1QPZA 1RRVA 5AUNB 1YB2A 3HWWA 5MHTA 2DWPA 1YJQA 1Z82A 1KU6A 1YD7A 2P9QA 3N2GB 2IBSA 3KDAA 4L3OA 4E09A 2WJAA 3E9ZA 3GGPA 3IJ5A 4RVNA 3WHPA 5COQA 1U8FO 1RXYA 1SHUX 1QC5A 1E0KA 3WISA 4ZK2A 3LH5A 2JI8A 1EVIA 1IHDA 1HNXB 1TUBB 3F7TA 4PAOA 1IBSA 5F64A 2QRKA 4I1YA 3UW3A 5EXSA 3EFEA 4AMVA 1AXRA 1QOQB 1ZXLA 5T4FA 4QPZA 1M7GA 1NAIA 1R0KA 2WF8A 2XMRA 1W1WA 1EKXA 1HTTA 2O2GA 5JTUA 4H7IA 1I6LA 5EMLA 2OFPA 4YCCA 4GXTA 4Q9IA 1JAIA 5FPHA 2QSJA 4ZCQA 1RWPA 2G8NA 3OIDA 3CNHA 3OCJA 4C07A 1VPEA 5K6RA 2OHOA 2VAWA 4ZTBA 3IQGX 1I9GA 1N7IA 1V5FA 2GPBA 1KDZA 2FP3A 4K88A 1E9DA 3MGGA 3W5VA 3RYTC 3FN4A 2OCYC 2O3JA 1ZMTA 4BPRA 2FDXA 1U3TA 3WNZA 3B60A 3WDKA 3MINA 5CBKA 2BFFA 2NUPB 3BAZA 1Z8HA 1L5YA 3MJRA 1PJRA 5E0OA 1R4ZA 4FTWA 1P39A 3LPDA 5DNEA 1FJ2A 1F5SA 5JZVA 5LMUB 4M9ZA 2CMGA 4DR4B 2D1TA 4L2IA 3HEAA 3WRXC 3KD3A 5K1ZA 2NO7A 4RTPA 4KQ9A 3ABOB 4R2WA 3AVPA 5SICE 1X1BA 1ZNWA 3QF7A 5KQMA 1PNOA 2IX3A 2CLCX 1BAPA 2IEIA 4J43A 4GX0A 1PUJA 3O9MA 4KAXA 1ZD2P 3VR6H 2PAFA 1OI7A 3ZWPA 1X1DA 2WWFA 3LXXA 1GFSA 3H5AA 2V96A 3H5VA 1FMTA 3L7KA 4IRXA 4JJ6A 4MW6A 4WHMA 3GXBA 2BFEA 2YOFA 2JCXA 3VNUA 1UP7A 5KHAA 3LWDA 3FOWA 4D99A 4L4XA 2FG7C 1T2VA 3RU7A 4MVYA 5AXBA 2E89A 3OFVA 1UKYA 1W29A 3HGTA 1SOWA 3KJIA 4S1PA 1QGUA 4MKZA 4A36A 2WLTA 1JDBB 1SUSA 4JL8A 5HS6A 3EE6A 3KYBA 4QFDA 3SHTA 1DQYA 3W3ZB 4BV2A 4KI0A 2Q41A 5FR1A 1VHWA 5EJGA 3M0EA 5BQFA 4RMNA 2F8TA 3DBHB 1DV2A 4U5QA 5DYWA 2EW1A 3U62A 4RAOA 1CUDA 1EBFA 3EF0A 4E5DA 2BFCB 1JQJC 1MA3A 2I4RA 4W1RA 4JI8B 4GLFA 3C3DA 5L3RA 1SFRA 1RP7A 3A05A 2HPAA 3Q7IA 4M1EA 5AM1A 4CTNA 3KQNA 2PBZA 5EE0A 2I6XA 2Y4OA 3I2IA 4J3NA 2XTJA 3ZZMA 3O03A 3A9CA 1Z6AA 3IE0A 1H1DA 4ZCSA 1L1EA 1YFKA 1ZWKA 4A1FA 3K5WA 1L4LA 2JI4A 3EXG2 3GFPA 3FVQA 4TQ9A 4QJBA 1N3IA 4NJOA 3CINA 2HCFA 2FFHA 1K1EA 2J0VA 2J5BA 3B6ZA 5CM9C 3QH4A 4WGFA 5AM5A 1U0NA 4I5IA 3G2MA 3KVYA 3CPEA 2PQMA 1JSCA 3R3XA 4A8JB 4NZYA 2CV2A 3DEHA 3JQ8B 3JWEA 3QJ5A 2IP2A 1AHNA 2O2EA 3REFA 1S2OA 2R1VB 5T4EA 1UFRA 4FT4A 1HNNA 2A0WA 3D6AA 2KM1A 2BN4A 4NTZA 2Y1FA 2OYRA 1MRZA 1DO0A 1T1EA 2FW7A 2JGJA 4LY3A 3V7YA 5T4BA 1EK5A 2PKWA 1QZTA 2PZBA 5KZMB 2ZAYA 4C5CA 1R0ZA 2A5GA 3KSMA 3MCTA 3NNSA 3ZTYA 5H02A 1N8NA 1NW7A 2O19A 2GCIA 2BI7A 2RK3A 4KYUA 5EMNA 2I8CA 5LOVF 1SG9A 2OQRA 4CF5A 1QRRA 3QOWA 2I8LA 2ZK7A 1W93A 2LWIA 4J6EA 4ZOLF 4UE6A 3VSDA 5CVUA 4R83A 2OQIA 4LXHA 5CYPA 4HR7A 1K7YA 3ADCA 3RTBA 1Q14A 1HYQA 1X7WA 3NT4A 5HEKA 1BMDA 2QN1A 1E60A 2IDMA 4JBNA 4DM4A 1RLMA 2C2XA 1YJ8A 2CXHA 2YC2C 4GPZA 4E1BA 2HJRA 2EP7A 1UMDB 3MMNA 3KL2A 4HGOA 5ARBA 1JDTA 4L0MA 1P72A 3AU8A 4EHDA 3NIBA 1EDDA 5ADUS 2J9YB 2OEPA 3QFFA 1HO3A 2XI4A 1G8PA 1I3NA 1JR3A 3PFCA 4F9EA 4RTLA 1X7DA 4E5PA 1BDJA 4G1CA 2CEAA 5TPZD 3T5AA 3Q5EA 3ANSA 4HSGA 1ZN7A 3DZBA 3FGPA 5B3AA 4QGFA 3DLIA 1TUEA 4KWIA 3ZH9B 1EBUA 1YRAA 2X86A 4G23A 4EARA 1XCBA 3LWZA 1P29A 1ZIOA 1BOFA 2AJCA 3LUFA 5CJPA 4E21A 3FJ1A 1PK8A 2LDBA 1E66A 2PL9A 3KUCA 4W82A 2XITA 1JLRA 4DMFA 4OMFG 2D7JA 3P96A 4XYMA 3WLNA 5KNDD 5EAIA 1EIWA 3SJUA 1DKQA 4XGNA 3W5JA 1G1MA 1WNTA 1E5DA 5D3QA 5JR3A 4CE6A 4IIYA 5GM1A 4MZDA 1T15A 2C2BA 1LC0A 1RLJA 2GM3A 4GOKA 4WERA 4Y2TA 1YBVA 3CX6A 4WACA 1NULA 2V45A 4BCDA 1I51A 3PTAA 5FL3A 4ZP1A 3CNEA 3ROXA 3MTBA 2C0QA 2QX7A 3ZY6A 3DVQX 4ROTA 5HMLA 5K8VA 1Y1RA 1EM8A 4JP3A 4NC9A 4D8YA 1OGJA 1ZQ9A 2IS1A 2IYYA 2WKWA 3HXQA 2DUNA 4CF4A 4QPDA 4OQ4A 2I8AA 2ILVA 3AJDA 4X3OA 3ZE7A 5B36A 5KYGA 1JDBC 5B4VA 4DT1A 3VKHA 2ZR0A 3ZE6A 4IIJF 5F52A 4DLLA 3H4VA 4PZ0A 4PN3A 3NKVA 4MS4B 1R6BX 1NXSA 5KINB 4XPIB 1O6ZA 2WJZB 3WJAA 1RYFA 4N48A 3ROPA 1C8BA 1TU0A 4MR8B 3RB8A 3UAXA 4DL9A 3OMXA 2EG5A 3KTOA 4HAVA 3PC2A 2QTZA 3PGA1 1DG1G 4XM2A 3MYYA 3HBLA 4XASA 1VG0B 3AL2A 2PS1A 1L7AA 4I4TF 2XLCA 4PC7A 4F96A 2PYIA 2BZ1A 3CC8A 1E3LA 4HQLA 4PFQA 5HUQA 1YCDA 1ZICA 3SEAA 3X2FA 3HXKA 1U3DA 4G8BA 2JLAA 3HYNA 2CC2A 3F4BA 4HQ6A 4WV3A 2E5LB 4BU1A 3HQ4O 2ZIZA 3OQ1A 2VEOA 1VYTA 3K0CC 1YQUA 3PUYA 4MLCA 1FUKA 4A8JC 3SXUB 1M83A 4BZWA 5B57C 3L4BC 1YKGA 3WQSB 4P6VF 4HLUC 2A30A 4DCJA 2QX8A 1R00A 2IYEA 4ZALA 1GPWB 3ME5A 1FNBA 4GE3A 2HYDA 2VNJA 1ZI9A 3L9XA 4C04A 4B7CA 2DLDA 1GZSA 3KPVA 3O0DA 5KREA 2XNDA 5E6RA 3E9YA 1G8YA 3IHTA 2X8JB 3JATB 3N6XA 4YO8A 5BUCA 4QEKA 4UCQA 3JQGB 1UBTS 3KU1A 3TLXA 1N78A 2JFOA 3FW1A 2PLRA 4YLGA 2ZRDA 2AH5A 3NUGA 1TB4A 2H2WA 5EE1A 5EEHA 2AFIB 5CCDA 4YWJA 4A3SA 1ZK4A 2ZYVX 3RTEA 3B48A 1VCOA 1KS9A 4CLDA 1MKYA 2I99A 2ZVPX 2VHZA 2QMEA 3NGXA 4I1OA 4D3ZA 4QEZA 1NI3A 1N2CA 2CXOA 4HTFB 3COWA 3CEMA 3IELA 2YX1A 4TTVA 5IM4F 1UADA 2I6TA 3ZCTA 3AVXA 2A1IA 2D5CA 2ODNA 3OT1B 2XHEA 5SY9A 1VL6A 1PJSA 1QH9A 4QL3A 2AC7A 4C5AA 3DE2X 4BECA 2G76A 3BGWA 4Y2JA 4LXXA 4B7UA 4E4RA 5IAAA 2EKBA 1G4UR 2P9GA 4FEYA 1E3WB 2VF8A 2VHXA 3FYHA 1GNTA 1E20A 5THXA 1G6KA 2WVGA 2WEKA 1TZMA 3FCUB 1P1RA 5HVNA 3HZHA 4Q5IA 2F59A 1G9XA 1OQAA 2FSFA 3E5NA 1XRPA 4GR5A 3QX3A 1XKTA 2EBUA 4DADA 1V6AA 4GVLA 1F7UA 1H2HA 1T25A 5FL7A 3AERA 1MA0A 2WUFA 4R1NA 4EG3A 1QC5B 2FGKA 2X1MA 4HEA1 4QUJA 1RHJA 1Q2XA 1CKEA 3DKPA 3OY7A 4I1VA 2VYQA 2FPGA 5ER9A 5ICSA 3K09A 3AI1A 3ILXA 4YV7A 4JNCA 3U80A 2HJVA 5LQRA 4BJ6A 1WPRA 1X1RA 4K0RA 2DH6A 4JU8A 3ILYA 3RS8A 4UEWA 3ZJTA 2VPXA 1JWBB 3JQQA 4JX9A 1SQ0A 4GKVA 4JBIA 1UKCA 4BATA 4NAUA 4FBGA 2NZUG 5AM3A 4D45A 2AG6A 3HV2A 4D9FA 5BRNA 4L5CA 2CD9A 4PGMA 4O33A 1F2DA 4MA5A 1GZVA 2XRYA 1XTKA 3BMCA 1UBMS 3WWOA 2WJPA 3D0QA 2FPWA 3KALA 3ON5A 2BFFB 1LU9A 3IO3A 4JLSA 4QIHA 4EAAA 1GPDG 1WLSA 1X42A 1T4DA 1QV6A 3GNLA 2P9BA 4OJKA 3AF6A 3LLMA 4EEXA 3NBXX 4GXRA 3RIMA 4I0WB 1SB8A 2WHPA 4K9OA 1R37A 2Q7DA 1RYHA 1WS6A 4KPUA 1C8LA 2EF1A 4XVQA 5A4FS 1PNRA 4PLPA 5I01A 3AFNA 3A3KA 3OTOB 3K70D 5FP0A 5DTIA 2GA9A 4HNTA 1DIAA 4O4JB 3HKDB 2FJUA 1DXOA 1GARA 1QIDA 1P1JA 3K2QA 3M34A 1XZDA 3I9V1 1IZ9A 1M6HA 2AFVA 2HFJA 5DWQA 4RVGA 4AZ3A 2RHMA 3Q72A 4ZI2A 4C89A 4F5WA 4I46A 2LTAA 4II2A 2BFEB 3M9LA 3MTDA 1VTKA 5DH9A 4JI4B 2MSKA 4I9GA 5K51A 4R7GA 4B7XA 1U2PA 4TL7A 4JT4A 2IHVA 1J49A 2NNWB 3VBEA 1U2QA 4DR2B 2FWAA 3DMHA 2G1KA 1YV9A 3MCWA 1OLXA 4MIYA 1QGDA 1DO8A 2OLJA 4RHYA 1C7ZA 3LL4A 4X24A 3D8NA 2VK4A 4AUKA 3LPNA 4X92A 3SF8A 1QGUB 5HKKA 1BRTA 4MRMB 4A5OA 1N6OA 1Q11A 2A5YB 3I30X 4HNQA 4NXNB 2PWYA 2GQ0A 3SD7A 2QJOA 1D5CA 2FPUA 2RBGA 3FCOA 2WU8A 4TXJA 1Z88A 4ZXPA 3V97A 5LB4A 1T6ZA 2WWVD 3W5SA 3M6WA 3O26A 2HQRA 3C15C 3EIUA 3FBGA 2XVMA 4RK6A 4S12A 1BQ4A 3RS4A 1CF4A 2Q3CA 2V6MA 5I7SA 3FPSA 4GG1A 4EA9A 3ABIA 2WIDA 5I9LA 2HHAA 2ADMA 5CAEA 2FMIA 2H2FA 3G17A 2HWUA 2XSZD 1OFIA 3PKIA 4L8YA 3ST7A 4D0RA 1J0DA 1WQ4A 3KVNA 2IS2A 3K1JA 3WHKA 2I9KA 3D64A 3DS8A 2IF2A 1T1IA 1D4OA 4B6GA 2H57A 2O05A 4P4NA 4Y98A 1QF9A 3MWLA 4X6XA 2C98A 2NYAA 3HHEA 2WOJA 1GQOA 2MSDB 3UAZA 5E4FA 1FUUA 4G0YA 3QLUA 5U9CA 2X0JA 3ZIDA 3R3JA 2RHOA 1XTUA 5BWNA 1MX1A 1QKKA 1Z56C 3OQVA 1GG5A 4MV9A 1YR7A 1CPYA 1KJWA 2GVZC 4Z0NA 4D9BA 3E70C 1VHLA 1T1GA 4DC9A 5LFAA 1PQ4A 1Z4JA 1JDNA 2YZNA 3RWBA 1MH1A 4FW8A 2QD2A 3KV3O 1Z0SA 4Y6GB 5TT0A 4AJ1A 1V35A 2C99A 2CWDA 2FN3A 3GQBA 2GILA 4FZVA 1EUDA 2NADA 4LJ5A 4LRYA 3CJQA 2H5EA 4R2JA 4OBBA 5TB5A 4MEAA 3VGPA 2ZU0C 4B4KA 4FNOA 9ABPA 4OQMA 4P93A 1B41A 3JWPA 3DT8A 5JNTA 4KXNA 2H65A 3MJVA 4OEHA 5ERXA 5BNIA 3NBUA 3ESQA 4K9DA 4TTJA 2W6MA 3VU8A 2GD1O 5DXJA 3DDUA 5GONF 1U0JA 3IVRA 4PYQA 3UCXA 4CNBA 5J47A 3GJ8A 5KTNA 5AOAA 3TZBA 5CFRA 1E1MA 4D9EA 3LJKA 4CEJB 1ZUWA 3IP1A 1TD9A 4FGZA 2QBYA 3GJ5A 5DM60 2J3EA 4GDMA 4BFSA 2W98A 1TW3A 3D7MA 3H86A 4FWBA 1VPVA 2BKAA 4HNUA 5L40A 1XKLA 2JLVA 1RXEA 4FK8A 5EJ2A 5BMVF 3QUAA 1ZUNB 1NLFA 3ENQA 4U2GA 5K8IA 2J3HA 2QTGA 1UBGA 3HA7A 3K8QA 1K6JA 5HIKA 2FPIB 4PX3A 2P11A 4AECA 4KLNA 5C1IA 4ARCA 2XZDA 1G21B 2R1TB 4DVJA 1Z6TA 2IP1A 1CUGA 2CW5A 1G0OA 3OZSA 4A6PA 1P9NA 1Q3HA 5ELXA 4O4IA 4OM8A 3NONA 2R6FA 4OH1A 4QBTA 3N3AC 2JCSA 4MWGA 3N39C 3PEFA 4RZQA 3M5CA 2CUTA 3RVJA 3DPUA 1M6YA 1QVAA 1HXHA 3V2IA 3WK8A 4IFIA 1HSZA 4BO3A 4JAVC 1TFUA 1QSGA 2QP4A 4Q9AA 4XEHA 4XM1A 1J8YF 1FFDA 2BM1A 4ZTZB 3KFVA 1TJNA 4C88A 4QQ8A 3D1JA 2ZJYA 3N2KA 1EM6A 3DE6X 1HYGA 5TPWA 5AVYA 1EVEA 2Y2UA 5TMBA 1UF9A 2QY9A 1E62A 2MU1A 4IJWA 1W2WB 4K9NA 3ELDA 2IEAA 2RC5A 4KNVA 4MIKA 4JBHA 4P83A 4LGYA 1JFFA 2IUUA 4BUCA 1KJZA 1XMXA 3B85A 4UOQA 4B84A 1I33A 4WADA 4CG1A 2XX3A 3NBAA 1E2KA 1A69A 3BHMA 3W5DA 2EWVA 3JAMA 1RZRA 4REOA 3QVKA 4MVJH 4LZAA 5CK5A 1TAUA 5NLLA 3TSAA 3PUKA 4TSFA 1DKOA 3QXGA 3WLMA 8AT1A 3HL4A 1HZJA 2FHSA 1AOXA 4BNDA 2IYVA 3CNNA 4ZCTA 1NR1A 2GZDA 1DU4A 2XR1A 1XQXA 3OUZA 1WUYA 4IXNA 4JBXA 3G9UA 3JARA 4IH4A 2P7IA 3G8DA 4A2WA 3FSRA 3NAMA 3CCCA 2QVGA 5KHOC 2ZPAA 3DQQA 3ZCRA 4UTNA 4ZVMA 1JXQA 1FOEB 4ER3A 3CVWA 3AX6A 1HLDA 3GEIA 1FW8A 4FOTA 2UV8A 2ORWA 4U2CA 4A5SA 3I9FA 1WZCA 4JUBA 5K0BA 3S8EA 2G5CA 4R98A 3GMTA 4WN9B 3E2PA 2E4XA 3ZV4A 1B4DA 3PR3A 2ZDGA 3FIJA 4HO1X 5DBOA 1KJIA 4DBZA 5KQRA 2DWOA 2UZ3A 4RHEA 4F4CA 1FNCA 3VU1A 3ZV3A 4B0OA 3U0BA 3PD0A 5I7HA 1Q7CA 3EGXA 1E1QA 3RV4A 3JTMA 3KE8A 4UQOA 2XGMA 3TX2A 4GZ5A 1RQPA 2EJVA 1TYBE 5IHXA 4OXQA 4E08A 3FMGA 1Q7GA 2GPAA 2JF0A 3FPHA 3IX7A 4WLVA 5E6RB 2XCTB 2O59A 5IH3A 1NBME 3R3HA 2ALJA 4FFBA 3VNSA 4YRTA 3RVBA 4F6CA 4WY8A 1Y9AA 4ZMRA 1SA0B 2FETA 1EG7A 1TPYA 4TXHA 2YUTA 3QFHA 3D7SA 5CLIA 1BE1A 2W2KA 3OU6A 4PG5A 4BFVA 3RJTA 2BFMA 4MH0R 2YOHA 4CG2A 3N74A 3H4MA 4KXWA 4O8CA 4MO2A 4PEVA 1DJPA 3PFFA 4C5BA 1QG0A 5HUJA 2R85A 1UM8A 1ISGA 2PGDA 3FD8A 3N5KA 5B1IA 3V6LA 4F11A 5JYCA 4HDKB 1V3UA 2IHTA 1RM5A 1NQXA 2D1QA 2AXNA 2D59A 2NTEA 1JFTA 2PZ8A 1MGPA 4UAGA 1Q3KA 4DIOA 1UDXA 1W4AA 4N39A 5G0TA 4QUDA 5H81A 1CNFA 2YTZA 3TTSA 1GDDA 1VCNA 2QM8A 3JU3A 5IDYA 2P6RA 4C22A 3LHSA 4UUAA 4HNRA 3U37A 2OV4A 1FFXA 5K8LA 4ALJA 3L40A 2SCUB 2W71A 2WTAA 3LLSA 5BR1A 4JP5A 3IAUA 4L73A 3H2KA 1IBCA 1N0VC 1GTVA 3RAGA 1V9SA 3H7AA 1KQPA 1QF6A 1UPUA 1P2TA 3HU3A 4JC8A 2R4QA 4EGJA 2NV0A 5LN1A 1W6UA 3A6HA 2V6GA 4U2BA 2WWYA 4Q4CA 2JPDA 3FJOA 4X61A 2R62A 3N59A 3O73A 2UYOA 3NALA 5IEBA 4C43A 1SXHA 2YFKA 2IYWA 3QBDA 1P9RA 1OTXA 2QA5A 4I9FA 1P1CA 3A4YA 4X91A 1XVTA 1JXMA 3UGTA 2PT9A 5CGQB 3KE9A 3O3CA 3VZPA 3EJWA 2B82A 3FWZA 2R87A 2X9VA 5KO2A 2H11A 1KMCA 2P1DA 4JP1A 4BRZA 4A15A 4LF7B 4GWLA 3ZHSA 4GAEA 1D9XA 3PC4A 1UT8A 4HYYA 2GK7A 4Z7JA 5CFNA 1U3CA 3E4CA 5CFZA 1HFJA 3DH0A 5ALLA 1T1SA 2EGHA 1DRVA 5JPIA 2AK2A 2VAVA 1HA3A 2YW2A 3AR7A 1WW8A 2PMEA 3IB3A 4K9PA 4WH0A 4MUJA 2IOHA 6Q21A 1HGXA 2VJBA 3HYTA 1JDSA 4HJRA 4D4IA 4DMRA 1X7HA 5KYXB 4CL0A 2D7DA 5ES4B 5EYPA 3SM9A 4HFRA 5CX1B 2Q5LA 1WETA 5ARCA 1O97C 2B94A 2WIJA 4E5VA 3UYLA 5H3LA 4QXOA 5INTA 5EWMA 4KVZA 2YJGA 3C24A 1GR0A 4RZSA 1BFUA 2VAMA 3PB3A 4F8JA 3AIOA 5K05A 5MDHA 2IDZA 2HWYA 2WJYA 3OTWA 3LQFA 3R6DA 3CUEF 4G89A 3EXAA 5B53A 3WJ2A 4BLWA 1PFGA 1V7CA 4RKRA 2HNBA 3BZUA 2QLJA 4ZQHA 1CY6A 2CJYA 2C5AA 2ANBA 1JSLA 3SP1A 1II0A 3ORYA 1VJTA 1U28A 3QP9A 4J03A 3WAJA 3EBLA 2W43A 3GNTA 3L41A 4N12A 1OYOA 1VIMA 1YB4A 2QRVB 2UVQA 4F1WA 1E59A 5BORA 5HJ2A 1YZTA 4YRLA 3VDMA 5TVGA 1JFSA 3T52A 2BHTA 1T0HB 3GWGA 4NZOA 1SHZA 4O0MA 5DWVA 3TQIA 4H3SA 5L3SB 1MAHA 3IHKA 4AZ3B 3DGEC 3DPSA 1AZTA 3ZI0A 2ISSD 3IO5A 5BMOA 3CBGA 2RGEA 3FZGA 2NYVA 2VQDA 4HMQA 1XVIA 1E2BA 3HCBA 1G59A 4QOJA 1DBSA 1L3IA 1MQAA 1D2HA 1NDHA 4IIJA 5C18A 5JU6A 2FI1A 2UYQA 1OLXB 2X2EA 3BHJA 4OH7A 3N87A 2P2LA 4PPGA 3CFYA 3D3WA 4RY2A 3SE7A 4KX5A 3KAJA 1L5MA 2Z9CA 1LGYA 4KB5A 1G42A 1NFRA 2XAAA 4G5FA 5EHIA 1U2RA 2QZZA 3DZKA 2Q8NA 2PY6A 3PD7A 4LCEA 6GPBA 1XPOA 2ZSHA 4JMLA 3E15A 4DAEA 1ZH0A 4KH0A 1RSZA 1WNFA 2QGFA 5F4ZA 4EUKA 5M04A 4G5SA 3ZDCA 2HJHA 3P27A 4C0XA 1SUDA 4V24A 2P5TB 3G02A 4UNIA 2ORED 4J1TC 3FPEA 4N0DA 4MMYB 4I4TA 3GZNB 2XF2A 1L1RA 1XCLA 4C0SA 4DJJA 1JHYA 5I4KA 4YJ3F 2BKVA 4HWRA 4EMSA 4H6WA 2CT8A 2QD5A 2FTKE 1OYYA 3LUJA 1V9LA 2B1GA 1MEJA 1V1MA 4BUJA 5GZ6A 3NHSA