5HXAA

Crystal structure of an udp-forming alpha, alpha-terhalose-phosphate synthase from burkholderia xenovorans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
458
structure length
448
Chain Sequence
b'MSRLIVVSNRVGGLAIGVLDALKETGGVWFGWSGETVSEPSAPVIEKQGNVTYATVGLTKRDYDQYYRGFSNATLWPTFHYRNDLSRYDRQEYAGYQRVNATLAKQLKELLKPDDIIWVHDYHLLPFARCLRELGVKNPIGFFLHIPFPVPEVLRTIPPHEELVKAMCSYDVIGFQTDADRQSFVDFIERGQHGTSSEDGMVHAYNRFLKVGAYPIGIYPDAIAKAAEQFTDRKPVRSLRDGMRGRKLIMSVDRLDYSKGLVERFQAFERLLLNAPGWHGRVSLVQIAPPTRADVQTYQRIRQTLEGEAGRINGRFAQLDWTPIQYLNRKYERNLLMALFRQSQVGYVTPLRDGMNLVAKEYVASQDPADPGVLVLSQFAGAAEQLPGALVVNPFDLSQMAEALERALSMPLAERQARHADMMAPMRENNLSVWRDTFLADLRNVATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
publication title Crystal structure of an UDP-forming alpha, alpha-terhalose-phosphate synthase from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Protein binding
total genus 175
structure length 448
sequence length 458
ec nomenclature ec 2.4.1.15: Alpha,alpha-trehalose-phosphate synthase (UDP-forming).
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00982 Glyco_transf_20 Glycosyltransferase family 20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA02
3G2JA 3GUHA 1NVKA 3D1JA 2AMVA 4WADA 3L01A 4X7MA 2ECPA 2OFFA 1KTIA 4GZ6A 2Q6VA 3H4IA 3NC4A 1P4JA 2HY7A 3WC4A 4AY6A 1GG8A 1J39A 2PRIA 2G9RA 2ATIA 5GPBA 3MRVA 1PYGA 3C4QA 5BNWA 4KQMA 4CDRA 2QRMA 2BGTA 2QNBA 2PYIA 2H1FA 1PN3A 3ZCSA 3MS7A 1YA6A 5I45A 3VUFA 1L5VA 4MICA 1WV0A 4KQ1A 4MRAA 3NCHA 2JJMA 2G9QA 4AY5A 3DZCA 2R68A 1WW3A 3VDMA 3BCUA 2XA9A 3L7CA 2QRGA 1LWOA 3MBOA 2G9UA 2IEIA 3UYKA 1JIUA 3TSAA 5JTUA 4L22A 8GPBA 4RBNA 4RIIA 3ZCPA 1JIVA 4EKEA 1HLFA 3MS2A 1VGVA 4BQEA 2R66A 3ZCQA 1P29A 1FTQA 1QM5A 4BQFA 4RELA 2QN3A 4RIFA 3S28A 4AMBA 2X6RA 4YUAA 1L5RA 4GPBA 3T3DA 3MS4A 1JIXA 2GEJA 2XGMA 3NPAA 4NEQA 2YJNA 4WACA 3E3NA 1XC7A 3Q3HA 4M83A 4RIGA 1L5SA 1XL1A 3PE3A 3G2KA 3CUTA 4M60A 4MHSA 3L7AA 2QN1A 5D00A 1UQUA 1F0KA 2BISA 4X7PA 2VCEA 3UYLA 1C50A 1NOKA 1ABBA 1Y6FA 1RRVA 4HLNA 1GPYA 2KS6A 1NOJA 1JG7A 5TMBA 3QKWA 2GJ4A 4FZRA 4GYWA 9GPBA 2XCIA 3C4VA 4CTNA 1JG6A 5TVGA 4CTMA 3DDSA 2FETA 4BQIA 3CEHA 3VUEA 3AMVA 4F9FA 2QLNA 5TMDA 2WTXA 3CV3A 3L7DA 1YGPA 7GPBA 1H5UA 3DDWA 2AZDA 5LQDA 1GGNA 3OY2A 3OKAA 3FROA 1FC0A 4MI9A 4LEIA 3RHZA 2AW3A 2X0FA 2QN9A 1Z6PA 2IUYA 4EL5A 4X6LA 1P4GA 3IA7A 5IKPA 1NZDA 2JLBA 3VDNB 1F6DA 3OTHA 2AV6A 2QN2A 1K08A 2F3UA 3TAXA 3T3HA 3MTAA 3CUVA 4YI3A 3NAZA 3G2HA 3T7DA 1QKJA 2VCHA 1WW2A 2ASVA 1EM6A 2VG8A 3CUYA 4MHOA 2O6LA 3COPA 3CUWA 3NB0A 2ZB2A 4FKZA 2IW1A 2SKCA 1Y8ZA 1XV5A 2FFRA 3C48A 3WAGA 5JTTA 5C1DA 3L79A 4M7PA 2R60A 4BFCA 1M5RA 3H4TA 2PQ6A 3BD7A 1GPAA 1WUYA 3MTBA 3HBNA 1FA9A 4Z5XA 2F3QA 3E3LA 3NP7A 1P2GA 4RIEA 1L6IA 5IKOA 3PE4A 3EBOA 4RIHA 1P4HA 3S0JA 2F9FA 4AMGA 1E4OA 3RSCA 1O6CA 1FTWA 2F3SA 4NC9A 2GPBA 3RSZA 3OKPA 1FU7A 3NP9A 3CEMA 4EL0A 1IIRA 3TOVA 4EKYA 1RZVA 2ACWA 4XIFA 3BCSA 2QN7A 3D0QA 5HXAA 4AN4A 1XKXA 3ZCRA 2X0DA 1BX3A 2R4UA 3CUUA 3L7BA 1FTYA 2IYAA 3OKCA 3T5TA 4LDPA 1C8LA 3MTDA 3OTGA 1EXVA 2R4TA 1AHPA 2H1HA 4GYYA 3MSCA 4N39A 2GM9A 1L5WA 3Q3IA 3S29A 3ZCTA 3HBMA 2IYFA 3SYMA 4EJ2A 2XCUA 2X6QA 3DD1A 2QLLA 3G2LA 1AXRA 3MT8A 3MQFA 2ACVA 1WUTA 3BD8A 2QRPA 5ENZA 1PSWA 4W6QA 4XI9A 1NOIA 3GPBA 5DXFA 3ZCUA 1UZUA 1P2DA 5TMEA 1A8IA 4F96A 3S2UA 4KQ2A 4X7RA 2X0EA 2JZCA 2QZSA 3O3CA 1SXPA 1FU8A 2VSNA 2XGSA 3BD6A 3BCRA 1Z8DA 1XOIA 3HBJA 1UQTA 1V4VA 2BGUA 4F97A 4RENA 3QHPA 4PQGA 2XA1A 2QRHA 1C3JA 3D0RA 2IV3A 1JEJA 4WHMA 4N3AA 3OT5A 2QLMA 1Z6QA 3CEJA 3T3EA 2P6PA 1XL0A 1B4DA 3SYRA 2PRJA 4NESA 3T3IA 1IXYA 2GPNA 4HWGA 4G2TA 1RZUA 3BEOA 4GZ3A 3MT9A 1E1YA 1L5QA 3E3OA 2FF5A 2GPAA 3G2IA 2PYDA 2SKEA 3OTIA 1GZ5A 3MT7A 4YI5A 2C1ZA 4GZ5A 2GEKA 3CX4A 1Z62A 1C8KA 4MI6A 3S27A 5DU2A 1FS4A 2C9ZA 1FU4A 3BDAA 2IV7A 3ZCVA 4QLBA 5DLDA 4MI3A 3IAAA 2IEGA 2XGOA 1NLMA 4N3CA 3Q3EA 2QN8A 2F3PA 1NZFA 2QRQA 4CTOA 2SKDA 3G2NA 3MRTA 2XMPA 1WV1A 4REMA 2C1XA 3OY7A 1L7XA 2BFWA 1GFZA 4N3BA 3T3GA 2G9VA 3RT1A 1SXQA 1Y6GA 2GT1A 3MRXA 4N9WA 3HBFA 3EBPA 5D01A 3WADA 1GPBA 6GPBA 1K06A 1LWNA 2VSYA 2C4MA 2XA2A 1PNVA 1P2BA
chains in the Genus database with same CATH superfamily
3VO9A 5K09A 3G2JA 5HRCA 1UJCA 1O0CA 2D5BA 2E2WA 2A0KA 1A9OA 1OX4B 1BDBA 3KTFA 4BMOB 3T5MA 1NUAA 2R6R1 2B1IA 2C2OA 2XKKA 3V1YA 2OFFA 1DOAA 1K5HA 1G7TA 3WHLA 2A4KA 4CUJA 4R1NA 4HYEA 2B8TA 2GDJA 3CNQS 2OXTA 3FZNA 4YT4A 2RHLA 1IJFA 4FYIA 1R00A 4FOPA 4LZNA 3PB3A 3OFNA 4JFRA 4ER6A 3PZBA 1ZD5A 2O52A 3TLJA 4GL4A 1GG5A 2HWYA 4XDZA 1EE2A 1UH5A 3EGCA 1DTSA 1FQJA 2VHZA 2J3HA 3AUXA 5AK4A 4GWLA 4IV0A 2BY4A 2AI3A 2FMXA 3CFYA 5DM70 2PYIA 4RWZA 3TR6A 1MD9A 1W75A 3LX5A 5G3ZA 1GTJ1 1PX0A 1CJVC 1KAEA 1YS7A 5T8KC 1CG6A 1GAQA 3MMZA 3WRVA 4A9AA 1M75A 2IOFA 3FPGA 4DR3B 2GXSA 1SG0A 1QCCA 3KVOA 5EMMA 1FS5A 1EJ2A 2QSJA 3TZBA 4XZ3A 2F7SA 3JQFA 2X22A 4JUBA 3KZOA 4QTUB 3RBAA 2MSDB 5EVCA 3I0MA 3V1MA 1DRUA 1VBMA 1H2BA 2IKQA 2C0CA 2C78A 4XIJA 1GZ6A 4AYWA 4Z7JA 4E07A 3W5AA 1CZLA 3QSGA 3WBFA 3ZU3A 4YRAA 1MB3A 3IP9A 3LG2A 2VTKA 2CXHA 1OWOA 3P5BA 2X8JA 5K0JA 4A1OA 5AUOB 2EERA 2EGGA 4MW0A 2G09A 5DLEA 5KO2A 4ARZA 5LFAA 1JHYA 2LWIA 2XECA 4DS3A 4R98A 4E1VA 3UMYA 1TJYA 2ZK7A 1LLUA 4DSUA 2O5CA 3FR8A 2J7PD 4IDGA 3RRJA 1C30B 5JYDA 5JTUA 2ZVDA 4R0MA 2EDAA 3KYCA 4JITA 3UJHA 1T4MA 4OK5A 5LQAA 3TD2A 2EKDA 3BGDA 2F3RA 1KH2A 3FE2A 4KXMA 4MV1A 4DN6A 2B4KA 3GI1A 4ZZIA 4QU9A 3RSQA 3PLRA 3RTCA 4WI1A 2HO4A 5EA2A 1T13A 4B0OA 2R66A 3ZXUB 1LA2A 4NJOA 1LW7A 2HXYA 4UAVA 1TJ4A 5E7IA 1DDOA 1E99A 1ZICA 4NMLA 4E09A 2ATVA 4I50B 1W76A 4BX8A 1VE1A 4WFQA 4X45A 4INAA 4H6WA 4ENWA 3E9MA 2HDNB 4CJXA 2N9UA 1T5TA 3ER9A 2W71A 1DAEA 1FZQA 3TMYA 5CGQB 1JKFA 1U0JA 3KEQA 5KOHA 2ZUBA 4HATA 3LLSA 2GEJA 3QFFA 4BU0A 2PE5A 1P1IA 3CRW1 2OHJA 3C15C 3CWCA 3MK31 1DX6A 2AR9A 4RIGA 3WLEA 1T8PA 1SCUA 5BUSA 5J2TB 2WFLA 1XQ9A 1POWA 4G5GA 5CB4A 4P3XA 4HXEB 2ZI9A 4IHAA 2PFKA 2O5RA 4HQ6A 1M2KA 4PW0A 2NU9A 1V6AA 2G72A 4YEDA 2VTEA 1PGJA 3RQIA 2YZNA 1EEHA 1VPWA 3Q3GE 3WI7A 4QGAA 3FGPA 5G40A 3ZDQA 2W98A 1KA9H 1MG0A 1XK7A 5ITSA 5JYBA 3FW1A 5FUBA 4KMRA 1XLVA 2PXXA 2QVXX 5LC1A 2J30A 4TZ6A 1P9NA 4KPEC 1R8XA 4IHJB 4LXUA 6PFKA 4V1CB 2O8EA 4LX8A 3W5SA 3PNOA 2C2GA 3GEMA 1G66A 2PQ2A 4DJEC 4JYAB 3COSA 3JQ7B 3AJ9A 1KOJA 2FN8A 3CMCO 4HV4A 1U94A 5IDWA 3FRIA 3FUTA 5BP7A 1RAIA 1U2ZA 2E0IA 3G2MA 2HEGA 4KCGA 2O7RA 1OTXA 1JDBC 4JU8A 3U7HB 2WHYA 2Z56A 3MUOA 3RYHB 2A3NA 4R69A 4DNQA 2J3EA 3M1YA 1U9IA 4JGGA 1R1DA 2ATEA 5IP5A 3SP1A 2AXNA 3V32A 4DMMA 2DECA 3ORSA 1K6XA 4HZIA 1E7QA 4QO7A 3SC2B 2XUJA 4RC9A 1N8TA 4KV9A 2BCEA 3Q12A 3OQ6A 1EE9A 1MDBA 3ONNA 4KLNA 3V4LA 4W6ZA 4F72A 5DCUA 2QLNA 3GAMA 5TMDA 2I80A 4MWSA 1N9GB 2XQJA 2WTXA 3C87A 4ME6A 3L6OO 4LK2A 3HVUA 5SZIA 3SYNA 2H8KA 3GJTA 3L49A 1SUIA 4YMSA 4C1NA 3TKYA 4B9EA 1EBFA 1J6UA 1ZN8A 2XNHA 4HDMB 4DA9A 4XA8A 3ICQB 4EFLA 3WGVA 1AHIA 5IT4A 2QE7D 1E2UA 4TL8A 3SHVA 2AEJA 1JNXX 1VKZA 1LF5A 1T2VA 2FP4A 2IQ5A 1FJ2A 3LCJA 3MINB 5LVAA 2FZGA 3LKBA 3HHPA 4YV0A 4MWOA 3ZUGA 5BWCA 2IW3A 3ONVA 4N03A 2I7CA 2DHEA 3SQDA 1Z15A 2VRBA 3HEMA 4PNPA 4OV6B 3C3KA 3EF0A 3FBGA 4XVCA 2QPOA 4C0QC 1Q50A 3IQHX 5KZMB 1JFSA 2G1PA 1IB6A 4RA9B 2F3UA 4TROA 5EHGA 5IYZA 4LOKA 3H8SA 3KSMA 4MAFA 4MQBA 4ZEXA 3DM9B 1TVKB 3E1SA 1MC5A 1QBKC 4PZZA 3PGA1 4YP7A 2OVBA 3SJ7A 4XX0B 3SX4A 1QYWA 4HSEA 4TTAA 3SCZA 4CLOA 2WD8A 2CHEA 3FTCA 1XFDA 4HZGA 4RVSA 2BEUA 3G2HA 5CG2A 5AIBA 2D00A 3DBRB 2XCRB 4EHHA 1XEWX 4G4SP 3D3WA 4BVJA 5GTDA 1USUA 1VMEA 1EM6A 2QMZA 5KQPA 2F1HA 4G23A 4ESEA 3EWSA 4UEKA 1J09A 3BXFA 5ISMA 3LY7A 4MS3A 3DSRA 2E4UA 3WL5A 4CM4B 4P7KA 4JQZA 2I76A 3V2UA 3IJEB 2VAWA 3UB3A 4B84A 1G5IA 3LPDA 3IIKA 2LCIA 1D1SA 3C6KA 4JYBA 4MW4A 4HNUA 1U8FO 3WOVA 3KT3A 2EX0A 2FMHA 5ITWA 1XMJA 1Z06A 1E3QA 1FP6A 3U9TA 3U7IA 4RA6A 4DWJA 5JEEA 5JNVA 1UWKA 2OV3A 2BLLA 3CLVA 4LC0A 2VP6A 2KWIA 3GCZA 1UT5A 3GLKA 5ETJA 3THYA 2CJWB 3CH6A 2OM6A 3ZWCA 3WKEA 3AJEA 3RYFA 1FP4A 3GAZA 4LDZA 3ZK9A 3E3LA 5A9SB 1U90A 3EY4A 4Y2UA 3TCNA 5IAAA 5JJ5A 1DXQA 1OASA 1Q20A 3PUIA 3OT4A 1B6SA 1E7WA 2MR5A 3CB4A 5FPYA 1RWOA 1C9JA 2C07A 3N0XA 3OLQA 3PC8C 4UZSA 1KI2A 1BJKA 2YXEA 1V96A 4LDRA 2YWCA 1JPJA 4B5KA 5CHYA 2XB9A 4PTZA 3A4YA 4TXMA 4YO8A 4UTOA 3W4IA 2FSGA 1RD4A 5E3IA 3ZZTA 4ZT2A 3I83A 4XFKA 4QEDA 4IBOA 2IY9A 2QRJA 4PIMA 3IBFA 1KDRA 1ZR2A 4BO6A 1EX6A 1TO6A 3AO0B 4H7KA 2A1UB 2OSVA 2JJ8A 4N8EA 4WKOA 2PJUA 5BQOA 1QRUA 2HL6A 5L7TA 2HCJB 4OSPA 3GGCA 4F4FA 2JLZA 3AKDA 4C0XA 1PTJC 3LY8A 4TSFD 3USCS 2NYUA 3ZCRA 4JBHA 4Q7JB 4OJQA 3KK0A 1ES9A 1W4LA 3KELA 5B1EA 4LJ6A 4CQMB 3E61A 3RVBA 3VOAA 1QG4A 2XVMA 3OCYA 1RXWA 1DJLA 1UZLA 2F43B 1EQAA 1XYYA 1M2WA 2R4TA 1GWNA 5F1YA 2WYOA 5K7SA 1WU7A 1DFHA 2O7VA 1HOTA 2JJQA 4DREA 2Z58A 4EG8A 3E5HA 1OREA 3NV9A 3DPIA 3K4HA 4EENA 1KZ9A 5A0VA 1Z0IA 1X1CA 2WR8A 4O2LA 5EUBA 1UK6A 1BEEA 2ZVJA 2ZR0A 1DZIA 3Q7IA 3OEWA 4NENB 2YHAA 3H97A 3L8YA 1TO2E 1X77A 1A97A 4RJJA 3IUJA 2BMEA 4ZCQA 4UKDA 5EIOA 3WWYA 1CUXA 1JGTA 4KG7A 3BGSA 2BBTA 5D3QA 4UPEA 2P91A 2RGDA 4Y2SA 2WD9A 2E37A 5DBEX 2V8BA 3GPBA 4UJ5A 5ELLA 4GXQA 1Y5MA 3FPKA 1MVNA 5FV7A 4QU0A 1JXAA 1I0IA 1D2GA 1QONA 1N1EA 4HUQA 4NJEA 5CG1A 3MM4A 5LJIA 3HTXA 4FXOA 4QJ3A 4MUXA 4F96A 1XVAA 4MDFA 3S2UA 3W7AA 2HYIC 1KJYA 4LHYA 2PMEA 3CR8A 1E9VA 1T1JA 2RI6A 2W2VA 3DFMA 3FJYA 2OCXA 5AK3A 2FB9A 5EIAA 4UOEA 4L4UA 2WVGA 4BL5A 4YV2A 4WWHA 1ODLA 1P60A 4RSRA 4LISA 2R6GA 2VSNA 1Z28A 2C95A 2XGSA 1KZGB 3D7KA 1AQ6A 1SM4A 4FMBB 1RQPA 3NBYC 4P0QB 1E0JA 2AN4A 2NYAA 2R48A 1Z0ZA 2AYZA 5J4VA 3VNQA 1IULA 3HI4A 1J2TA 2NSLA 3VYTB 5KSZA 2C7BA 1KOGA 3K9FC 3UC9A 3WB2A 4IFEA 1PK9A 621PA 5B36A 2JI4A 3JWPA 4WXRA 2AOXA 3B52X 4NYMR 5ALOA 2ZSDA 4GSKA 1R5BA 1FX1A 3C3CA 3SJCA 3TSOA 1E5QA 2DFPA 4HB2A 4I55B 5KKCA 3KQKA 4Z4EA 5CGZA 2REQB 4XOIA 4KIJA 4YCAA 4RHTA 3FZYA 3SJZA 3HUTA 3JTMA 1W5BA 3H05A 5I7UA 2I1VB 1U3CA 3HLTA 2HA6A 3AQ4A 2CLSA 1ZOIA 4LZOA 2NO9A 4UEQA 3DEFA 3BTVA 4H1VA 1G60A 2WTBA 2WABA 4WEQA 2B2NA 3I5AA 2X7HA 5EIHA 5GONA 2ZKLA 3BVPA 2JKYA 3CRNA 3QKUA 2E5LB 4YRTA 1MRNA 2A9KA 2PRJA 3DL4A 2PTHA 1RRPA 2UXDB 4EGFA 2XJ4A 2QTZA 2VJYA 2YYAA 1BCRB 1DBQA 5ALUA 2XGJA 5CB4F 2HNKA 2IPLA 3MT9A 1TD1A 2AZMA 4I5DA 3RS2A 3K4PA 2WIBA 1PDOA 1IQUA 1UT6A 2A92A 2VN8A 1AE1A 1HYHA 2X7XA 3HUEA 3PGLA 4XGRA 5IW8A 3LC2O 4N40A 3EUFA 3HXLA 1LTQA 4JCOA 1MW9X 4NBLA 4DV7B 5JJLA 1Y34E 2ZULA 4B34A 4BRWA 1Q5PA 4DT1B 3H1EA 4GI7A 4OD0A 5E2AA 1GZ5A 1U8UA 5IN5A 4XFJA 1LDMA 1NVBA 3UAVA 2Q6OA 3N2GB 1JIQA 1SCBA 4J3JA 4ZJZA 2R7NA 3PFGA 4G85A 5ANRB 4ZO4A 1WXHA 3WIOA 5AKHA 2WJZB 1DV2A 4GZ5A 2J0QA 5DCWA 4MWEA 2V6IA 2H0RA 2R1TB 4JB0A 1PLJA 1UXIA 1YT5A 2YXBA 4L6IA 3ZC3A 4JKYA 1Z3IX 2YFKA 1HE3A 2X40A 4N5HX 1NKSA 3KB8A 2MR6A 4N12A 2I5PO 2HZBA 4FR2A 4D0LB 5GJVC 4OGFA 1N8NA 3AG6A 3Q5GA 3C6YA 4KN6A 4KBFA 4ETNA 3IAUA 4YACA 2ZSIA 5DF1A 3X2SA 4O29A 1O3YA 2B0CA 4ZODA 4DCPA 1QQTA 5CLLA 3IAXA 1W36B 5AVUA 3ZGNA 5J2UF 1Q19A 1NBMA 3JATB 1X3LA 3HK2A 1VQ1A 1MEEA 1P9WA 2VHCA 2ZJ0A 4C4SA 4TN5A 4J16C 2H4ZA 4K9QA 4V3BA 5CX1B 2OKGA 2VL7A 1T0HB 1Q92A 5CDHA 1NZFA 1L4KA 4H1WA 2FSUA 2OPHA 4NV3A 3TN7A 1KK1A 1A9PA 1MW8X 4TTIA 3O94A 4B3CA 4IMJB 3E3MA 2JKZA 1JFLA 3DV9A 3DBVO 2R7MA 3GZNA 2C4TA 4KUEA 3PVCA 2BI4A 1YSCA 2INGX 1JHXA 2O0MA 3FIUA 4H7HA 1IPHA 2WZBA 4LZPA 1GITA 4D99A 3B85A 4MVJM 3EC1A 1NA5A 3ABZA 4DGQA 2HRZA 1SXQA 1SB8A 4PRLA 1BKSB 2WT9A 1U0TA 2NX2A 4PLWA 1UOPA 3WE7A 4LWZA 1QDLB 4LYAA 4PAQA 2ID7A 5K3FB 3RK4A 3ZIUA 1RYNA 5CEFA 4IXMA 7ABPA 2NZWA 1OLUA 2J0UB 2RAPA 4YRGA 2V0CA 2VEDA 4XPIA 4GQBA 1DC4A 3FF4A 1VDZA 3TW4A 1ISIA 1WOYA 2HJRA 3WFJA 3QBDA 3PYXA 1SKBA 4DCJA 1QZXA 4MB2A 2OCKA 3O92A 1R0LA 3W7BA 1U8AA 5FL7A 3IBSA 4PBTA 2WTEA 2YWBA 4HADA 5JCJD 2P3OA 2AGVA 5C8DA 1QAQA 2I87A 3IR7A 2DR2A 5CM9C 2JFFA 1E8NA 3D1JA 3EVCA 4BVAA 3L01A 1SXJA 1RWQA 1GU0A 2PX3A 1SHZA 2VPYA 3DKVA 3LD9A 4DCTA 5BVGA 3LVRE 4D81A 3W1EA 4CHTA 3GFQA 3JWJA 1NW6A 3EUWA 3F8SA 1QRSA 2OBBA 2D1FA 2RHWA 2VO1A 3HI6A 4HNVA 4KSBA 4RK4A 2GBGA 3C43A 5FWXA 3MRVA 3G0HA 3C4QA 4YP9A 3OC0A 4HH3C 5IT9A 5CJ2A 3UUFA 1I5RA 2QRMA 2ZCVA 3VPSA 3W8RA 4P80A 1RHMA 3CLSD 2ZZNA 3GJ7A 3LT1A 4FBMA 5DFAA 4LYJA 3NM4A 4JJ6A 3ESZA 4WASA 2QVGA 1X6VA 5FBWB 1RCTE 2E87A 3EDCA 3GCGA 3U31A 4Q3BA 3ZWOA 5CDSA 1CRPA 2CFRA 3DGEC 4MPDA 5I45A 1EZ4A 3AHIA 1ONPA 5T4FA 4K9LA 5DWQA 2NUPB 3DMTA 3QNUA 4P3OA 3ROQA 4RVOA 4KQGA 2ZT5A 3DBLA 4NCKA 2VEOA 4MRAA 4X71A 4H6PA 4JT9A 4M9XA 2WKWA 1EGHA 2OZKA 1QIEA 4RHEA 4DR4B 3PJDA 1I4DD 3INYA 2YIDA 2VFAA 1P33A 4NY1A 2I7XA 1RJEA 5EKTA 1MOZA 4K2HA 2G70A 3QI2A 5CT6A 3VYSB 1V25A 5IKMA 3N8HA 1XDWA 2BFEA 4BX0A 1V8PA 3RS9A 4ZPJA 1WABA 3C5WP 4ZCIA 4YCNA 4A6EA 1QO0A 4YP5A 1VA5A 3EULA 3DP9A 4LZWA 3PR2B 1JIUA 3L0PA 4J3FA 4M9SA 4AB1A 2XIJA 1CF2O 2X3FA 4KK4A 4MR9A 2QD2A 2HPAA 3OEHA 3B6IA 4IIDA 4MQLA 4M6WB 2HXGA 5A5FA 3MJCA 3U4QB 1KYXA 2IP4A 2D7DA 4UQOA 1VGVA 3GJXC 4BQEA 5B6IA 4DLYA 2XB4A 5TEWA 4ARVA 2CD7A 4QGGA 1XQWA 4NHEA 4UCQA 4OLJA 2PMFA 3DONA 1KSGA 1QHFA 2F59A 4AMBA 1ZJYA 2PJZA 4ZVOA 3LHSA 2G0NA 2ADFA 1L5RA 3HA2A 4GBMA 3PF8A 3UGKA 4TYQA 4U6NA 2D54A 2IT1A 5IJWA 1D2EA 3WL6A 1I4LD 5BNIA 3FAZA 3W6PA 3QELB 2VHUA 4MIEA 1MF7A 5I9MA 2WC1A 1K7SN 3C8UA 3HU5A 4C7OB 2AXQA 3VTKA 4BQRA 4OP1A 1FJHA 4DDVA 1IEWA 1UXKA 1HE5A 1CIVA 4PAWA 1UPBA 3DOJA 3L7AA 4RZIA 3VNVA 5D00A 5TPZD 2XLBA 2XBUA 3F1KA 1GFWA 3BM5A 2CXQA 2PX5A 4RADA 4Q1BA 3M34A 1RLOA 2Q3EA 5I5GA 1A5ZA 4PLPA 1YK1A 1GNRA 3WDSA 1VHQA 3VR0A 5LMUB 4EPYA 2IS2A 4PRZA 1WIWA 1C3OA 2RGYA 4M49A 2PJDA 1Y6FA 4IGEA 4XWAA 1SBQA 2PWBA 2CNWA 2GZRA 3CLHA 4OKSA 5I4BA 4B3HA 2OGZA 4M88A 5TF0A 4BVEA 2YIVX 2FW1A 4PS0A 1TO1E 1YWGO 2CVPA 3EJ6A 1T3LA 3UHAA 2YN4A 5I9SA 2LDXA 3ES9A 4W9NA 4IGKA 3C8HA 1EX9A 4FW8A 1RXIA 2WU1A 3GGGA 3CG0A 1ZZGA 2VTVA 4YRLA 1FSSA 5BW5A 2VHXA 1ZUNB 3ISJA 2C3YA 3D0OA 2UYQA 4G56A 4O4JB 2DFLA 4CM1A 4FB5A 1Z56C 2QTTA 4JS0A 3OM8A 5EJIA 1E5DA 3R7LA 3U7JA 3P20A 5A71A 4G8JA 5ALWA 2CUNA 4ZYZA 2Q1XA 3CT6A 5TARA 1G8SA 3FBWA 1T5HX 1KI3A 3ADBA 4IJ6A 4QC2A 5KQGA 3CRQA 4QGFA 1GZSA 1TMYA 4CTMA 4PFQA 1P9OA 1A88A 2X0RA 3KTOA 4XCVA 2EEPA 2V96A 1AA9A 1X8LA 2PGNA 3A9TA 2HFJA 3E84A 4JQCA 3RRMA 4OLBA 4EFNA 2E3JA 5FCDA 1DT5A 1KHTA 2BHSA 3ANSA 1OX5A 4UHCA 3G8AA 3V4SA 2IUUA 1R4NA 4FX2A 1OUMA 3ECAA 1EFKA 1N8KA 2XNCA 3M0EA 3QVLA 4MUGA 4OQYA 3ZEIA 2FEMA 1GA4A 2QAJA 1PZHA 1TCAA 1R50A 1USGA 2O2XA 4MVXA 4AO6A 1N2CA 2EZTA 1IRXA 2FPLA 1JX6A 3E22A 1GGNA 3MMNA 1ID1A 3PNLA 3UW3A 4A92A 1P6QA 5AVQA 3AHJA 1JAHA 4R2IA 5ER9A 3TDMA 2QYTA 3QENA 1PR5A 4OBXA 6YASA 1ESCA 2X2PA 3H3FA 2IZ0A 3OM1A 5EYPB 2C3PA 2IUYA 1KKLA 1YK0A 1CDOA 1FK8A 2JATA 1IIBA 2HEIA 1UADA 3L9WA 1T1IA 1RM4A 1VZ3A 4HNAA 3N6RA 2ZWAA 1O97C 3RS4A 3O1JC 2AJBA 4H0NA 2UXBB 5HQ3B 1E7MA 1LB1B 5LQDA 2RGBA 2AKEA 3PHIA 2BKAA 4F6LA 5A62A 2X7JA 1RS0A 2GBIA 2JCVA 1SKYE 2QYOA 3H1TA 3QVGA 3R4CA 4KUGA 3PGXA 4ZD6A 2HB6A 3MTAA 1XDBA 4G5SA 5H83A 2G1KA 5EP2A 2Q1SA 2CUKA 1QGYA 3CUVA 4H9GA 4MWTA 3KKLA 3KC2A 3E9YA 1SHKA 1O5IA 4RV4A 1KEKA 2J3JA 2P5UA 1W6RA 1O5TA 1RAAA 2HA0A 3JQQA 2VCHA 3K0FB 1X2BA 4O3MA 3NPMA 5TMPA 1IXSB 1ZS9A 4KLAA 4Q7LA 1M1ZA 4QGBA 4YWHA 1GJRA 4WZ6A 2XDAA 3W78A 1YL5A 3WR5A 2IHJA 3W4JA 2GM3A 3O6VA 1A7KA 1H2WA 1G20E 1U3GA 1NMEA 2IXDA 2X2FA 2ZI6A 3O47A 4DKXA 2QR5A 3WAGA 3OJFA 2G06A 5CD1A 4MO9A 2ZYWX 3OF3A 2DPXA 4ZVKA 2PS0A 1PI3A 3IQDB 3DWIA 5JQGB 2C5FA 4ZAWA 2IQIA 1AUQA 4GX1A 3BSWA 3H4TA 1HG0A 1LLCA 1PZMA 1RACA 2C3UA 1N2XA 2Z95A 3M6XA 3OVMA 3TAUA 3WMXA 2PR2A 4NWIA 4AN1A 2DQKA 1UFRA 1U6KA 3WQSB 1V9LA 2JFNA 4LZAA 4IIEA 3LCVB 4OXNA 2A0WA 2I6TA 1QKKA 2Q50A 3BWDD 1XCGB 4DPKA 5KBYA 3CNOA 1DOZA 4AQ7A 1F8YA 2VYFA 2GESA 2Y0PA 5E6RA 3UPTA 1U1CA 1SVOA 4ALJA 5K5EA 1RWNA 1CZOA 2PUBA 5K0FA 1T1GA 1NQAO 1F5SA 2AEEA 2DRIA 2MINB 3D1LA 1T36A 3E8XA 4FU0A 3PS9A 3ULKA 2VPQA 3BK2A 1V1MB 1ZGZA 5JAUA 2V97A 2F9FA 4EG5A 4QIHA 3SZ3A 2WT8A 2X41A 4K9RA 4L75A 2PSJA 2YVUA 3IOCA 4M8LA 3ZWNA 2OXFA 4C0WA 4A5OA 4DJAA 2DR3A 3A6JA 4ZYLA 3UBTA 1VZ2A 4ZA2A 3WMWA 4B75A 3Q1LA 2J7PA 1U7ZA 3DWFA 3ETJA 2XBMA 3MWLA 4LAFA 1KE1A 1OQAA 2N1MA 5LJLA 3DOIA 3GP8A 4OREX 1SVLA 4HRVA 4YP0A 1QDUA 5E1OA 4ZV9A 1T1RA 1K4KA 1OOEA 3OJLA 2V7VA 5DTJA 2D6FA 1YRAA 5DT2A 3IV6A 1GDTA 1VHJA 5LP6A 4W7SA 4DW8A 4Q6BA 5K6AC 1NUSA 2BFDA 1XCPA 1LSOA 2AX3A 5JAIA 3ENWA 1BVYF 2IYAA 4U9UA 1ZI8A 2OBFA 4N49A 3DOCA 2DVMA 3NDJA 1RE1A 1W581 2OYSA 3H5OA 1C8LA 4MGKR 1SOWA 4LJYA 1LU9A 1X94A 1NQ5A 1QF9A 1WEKA 3HO6A 1KEVA 1XAGA 2Q5QA 3INGA 2C8JA 1GA1A 3P26A 4S3MA 3WGMA 1RLUA 3VZQA 4N39A 4F60A 4OFBA 2QRNA 4QUHA 2OAGA 3C6QA 1IZ0A 1QVWA 5DLQC 5LBIA 5FQNA 4EVIA 3DD1A 1QFSA 2B0JA 3EFOA 2X15A 5AI8A 3RIHA 2QTBA 3QF4B 4BATA 3UH0A 4J0GA 3IQGX 2YV1A 3U4CA 4D3YA 2H9YA 5IS2A 8ABPA 4LS3A 3ERCA 4Z4CA 4LVUA 3GLSA 4ARIA 3RODA 3EEYA 1FRZA 3MWEB 3BSYA 2ZZKA 2YJGA 2W93A 2BMDA 3LZDA 3DAGA 5AW3A 1W73A 4MUHA 2VHEA 1PSZA 4WBNB 5J43A 3DE6X 3LE8A 3HRIA 2O2EA 3JX9A 1U0BB 2I78A 2BHNA 3E7XA 5EMJA 3NKVA 3O7MA 3QVVA 1G16A 2WKSA 3IP8A 5HK8A 3X3HA 4ZOCA 2XRMA 4B3JA 4ER3A 1AQNA 1Q44A 3T5BA 2ZUSA 1D7OA 5JRDS 1L7VC 3KU4A 2VUTA 3P9RA 4BO1A 3L06A 4LJKA 5BN4A 4IWYA 2WJ3A 1AKYA 2FSIA 3PHCA 4V0SA 3D3QA 3KOYA 1L7RA 4IFBA 2AUMA 2B8WA 4KR6A 2DUJA 2YJ6A 3R7SA 3UMVA 5KWVA 5BUQA 1ZM4A 3HYSA 1WSDA 1C2YA 3ISVA 5IULC 1FFHA 1BFDA 4B71A 2FSPA 2YMQA 3FDZB 4RTSA 1E1MA 1DXYA 1RADA 3IUQA 1ZJ6A 3Q7EA 2QP4A 4XUDA 3S3TA 1DRJA 3TGPA 5JMPA 3TCXB 1KYZA 2Q3DA 3DAYA 3ITNA 4L4SA 1VMKA 2ZRNA 1F2VA 4F5DA 2VSFA 4QUDA 4X1YB 4TL6A 2A67A 1KZYC 3CJQA 5DNWA 1G6KA 4NARA 3LNTA 3D6UA 3QNMA 5LYYA 1UBEA 4EGAA 3KXLA 2HT6A 2Q2QA 1W5FA 2ATXA 3W77A 5E7QA 7ADHA 1EHYA 4M8KA 2UZ1A 2QE7A 1XL0A 3TQIA 1VLJA 5DULA 3ORHA 1OT3A 5JS7A 3SYRA 3O8OB 3GT0A 4XKJA 3T3IA 1H2YA 3NHAA 2GPNA 4HWGA 4UNPA 2VKQA 5FEMA 2P9YA 1MXFA 1YQDA 1B26A 2WICA 3A2MA 3HVKA 5EJ4A 1RMTA 2YH2A 5JO9A 4J76A 3DYVA 5JSKA 2IPXA 1LBIA 4DIUA 1ZVQA 5BWMA 4LJ8A 4UXJA 4HMOA 4DIFA 4JI7B 3F1LA 2JFYA 3D31A 1C8VB 1ZGBA 1ZM9A 4IJVA 1OD6A 3A7EA 3SD7A 3MG9A 3EMKA 2JAHA 4F5WA 2P35A 2HZ7A 2QZ4A 3QV2A 1GPJA 4YDHB 2D0PB 3NC0C 1NW7A 4V3CA 4Q4JA 5DHAA 4YI5A 2VF4X 3G59A 4ZCRA 5EIEA 2QAIA 5TT0A 1I4EB 1R5OA 4GRAA 4WLEA 3KFVA 4FZ5A 4KE7A 1L5NA 1KS9A 5JROA 2VK8A 2FRXA 4D9IA 2XNDA 5TT1A 1HG1A 4XX1A 2LD4A 2HW8A 2K2WA 1RP1A 4HFJA 1ZGHA 1RQ7A 1EVQA 1J0EA 4EF5A 1D6NA 2IV7A 2GK3A 3BILA 5AJHA 3PF9A 2MSKA 3O4GA 5IXSA 1Z5OA 1MDFA 3GEHA 3BWXA 3AIIA 3GOQA 2QAGC 1ISJA 4IVQA 4N47A 4BB6A 1W4ZA 2WTAA 1NLMA 3N8DA 1JB1A 2J9FA 3BUSA 3FPHA 5ALPA 1FLNA 2QL5A 2X8JB 2XVYA 3BGOS 4PZDA 1PU2A 4LFCB 4D9GA 4TTPA 2DAPA 2GCEA 1ZMTA 4O5AA 2YIMA 3BHMA 4JK3A 3UAOA 4QTTB 1YI8A 3COYA 1LQ2A 1ZCAA 4PBSA 3FPBA 1AO0A 3WIUA 5GY7A 4NE2A 2QD1A 5WRFA 2VA8A 4DQLA 2BFWA 1GFZA 5AW9A 4WN9A 3R3YA 1M2HA 3INRA 1VHWA 3PFKA 2ZSFA 1F9AA 4KLZA 5TS3A 1IAVA 3C1UA 5LKAA 5I51A 1DBWA 1PJZA 2PKYX 5H3CA 1NPYA 2JIDA 2V7PA 1J21A 5IJ0A 5CNMA 2V58A 1B8PA 4UUNA 2PXHA 3SEAA 3HJHA 4KGDA 4CE6A 3I45A 4KO3S 5LQCA 3P9PA 2QLJA 4IICA 4CKBA 3NMUF 1JHRA 2FUNB 3ZLVA 1XU9A 2QZ9A 2ZZMA 2IOFK 4XWGA 4KO4S 3ZJ5A 3WP0A 3WLRA 3EEQA 1CHDA 4D9JA 4H15A 4B1FA 3R5KA 5I9NA 3N53A 5KOHB 2PT9A 2ZBGA 1JECA 2NO5A 4WD3A 4TSFA 1MB0A 3TR0A 3ZWYA 1JQBA 4Y6QA 1F4PA 2OG2A 4Q3AA 3WHIA 1P5HA 1SCUB 1YR7A 1G1MA 2WFLB 3STUA 2XSZD 4OK6A 4UE3S 4FYVA 1W1UA 3KL4A 1ZOOA 5E2IA 5EUCA 4YRKA 1KMCA 4TT3D 2E48A 2W9XA 3ZI0A 5IMSA 3I2GA 2OQVA 7MHTA 4TWJA 4D25A 3AZQA 2WA1A 1EP3B 4YLYA 1I9GA 1C7IA 4HNSA 2NU9B 4KB5A 4WZBE 2G17A 2E1PA 2XDQA 2XTJA 2W2XA 4WKPA 5K0SA 3VKVA 3OQIB 4C6SA 2ATIA 4G63A 3NUGA 3KKMA 3QX3A 5EXDA 2G77B 4DDHA 4FONA 5GMOA 2AFVA 2BKVA 4OP3A 3OCVA 3K71B 1P62B 3GVHA 4E5VA 1L0BA 4FYKA 4JLKA 5HRAA 5DNUA 4K9DA 2RH8A 1NVXQ 2D0DA 1VKRA 2XEXA 3B78A 4XLLA 2O8EB 4RU1A 4ZTZB 1N25A 3EC7A 1YC5A 4AJEA 3WDLA 4DNXA 5AK5A 4DJDC 1NYLA 5AI0A 1QS0B 4P82A 4URWR 1WXQA 5DB4A 4BUJA 2OZVA 2JASA 5I9BA 4EB6A 2VHWA 1GZ7A 3Q72A 3LUDA 2OHXA 4CHGA 3CXRA 3UJ6A 3IAS6 3BICA 3HYNA 2EZUA 4MV9A 4XVQA 2ZYAA 3OJ0A 1L1QA 2H5JA 3ZHZA 1V7ZA 1QCYA 4I5EA 5DK6A 1KEUA 1QH1B 4IEFB 5EWJA 4LGVA 4GM1A 4WQMA 3DQPA 2IJGX 3IPRA 3OMXA 1E1DA 2JBHA 1DKLA 3O1LA 4J07A 4LY0A 2IZ7A 5HZMA 5MGNA 3THXB 2ILTA 4C3OB 2W6MA 2W2LD 2MDTA 3MBOA 4JGIA 3A4TA 3D5TA 3CW9A 1NVUQ 4TL7A 4BMZA 1YE8A 2PGLA 1DG1G 1QSGA 3U9SA 4ZGWA 3BPSA 1OFTA 3MTIA 1JHZA 4YUWA 1NXXA 4N7RA 4JBYA 3UQZA 3G2PA 3FMFA 1E0SA 3B7WA 3IMGA 3K35A 2DBYA 3MS2A 1XZFA 4Q9JA 4AL4A 3NJRA 4TMTA 2P2SA 3C5CA 1MB2A 1SQ0A 1Y1KE 3GEPA 4LQCA 1U0NA 4PSAA 1HNNA 1XMXA 2IIBA 5JAOA 3RFFA 5LP6F 3F6RA 2FP4B 1CEYA 1OTHA 1AVTA 4RM3A 2WDZA 3TRKA 3VOSA 5CDGA 5HM6A 2V4ZA 2JI6A 3HMKA 5LWHA 2VAMA 2RBGA 4YAKA 1KBZA 1M76A 1KJNA 2CHFA 3K16A 3QU7A 1OILA 2EHDA 4JP3A 1Q74A 4B4DA 3WAJA 1YL7A 1TT7A 2YMMA 3DL7A 4TLAA 2ZJBA 4HXGA 4GGPA 3GH1A 4PGAA 2HU2A 4KIWA 3L4BA 1DUIA 1U1FA 3CH4B 3BZUA 4Y6RA 5IYZB 2Q5HA 2D2XA 4WKBA 4ENRA 3L4JA 3P19A 1P2FA 2YJNA 4KEAA 4RWEA 4TN1A 3KJGA 4RETA 5H68A 5GIPE 2Q99A 5AOAA 4Q12A 4ZCMA 5BSGA 4CDNA 2QIPA 1O1YA 2X76A 2J1LA 5KTRA 1BX1A 1ESZA 1AGXA 1N6NA 1Z5WA 2GCPA 3PC3A 3GLIA 4WBSA 4ZAGA 5KIAA 5LWQA 2IYTA 1BXGA 4RACA 3BJMA 3ZWQA 3G0IA 1GPNA 2OORC 3ABQB 4A0HA 2VBFA 1BXRA 3P4XA 3H5VA 2FEXA 2WTUA 1EZ1A 3ORQA 2JI8A 5LXTB 5TF4A 2F1JA 2GUGA 4BPRA 5G4KA 4E03A 1QIGA 1B7GO 1WZCA 3UXMA 2CMFA 1R5JA 1DAFA 1GSIA 1WJGA 1KFKB 4UUQA 1UODA 4FINA 2PZJA 3W6NA 2WAOA 1K66A 4ARCA 3EQ9A 1YDHA 2W0SA 1W1IA 5KYXA 1JLKA 3KQHA 3WISA 4JT8A 3Q3CA 1QJCA 3QKWA 5ALMA 1RLTA 4KE6A 4KO1S 1T5BA 4RA6B 4WTOA 4I1PA 3PUJA 3BE8A 3GF4A 3L7YA 3GLFE 1SY7A 1E59A 3E1GA 5B1DA 3ELUA 4OHWA 2Q28A 4RYDA 5EC8A 5JYEA 1EVZA 4FZVA 4Y2YA 1YD7A 5K3AA 5DM60 2AG1A 2F90A 1HBJA 4TV9F 2BFAA 1TTTA 2ZR8A 4MUNA 5FPKA 2FE4A 3N2YA 2PMWB 1FP4B 1RBYA 1VIYA 2D7JA 3NYWA 4B44A 1YDFA 4CKEA 1I4OA 1ZO8A 4XYBA 1H3FA 4WGFA 4J0HA 3ZZ0A 4WKCA 2ZRMA 2CL5A 3AKCA 2R8ZA 1J49A 2R7KA 1Y1QA 3TW0A 4GOXA 4ISBA 1N0IA 2GD6A 4HLUC 1WF3A 1BRTA 3KP1A 1QUEA 3G13A 1D0SA 1MRSA 2GZ1A 3BIXA 3DTVA 4FEEA 2I4LA 2QZZA 4P4GA 3PIIA 4W5WA 3VH4A 1YGPA 4UBKA 3IOYA 4GLLA 3DDWA 4O25A 3RHTA 2X5OA 1ZXBA 2XI4A 4M9QA 1OA1A 2YWJA 5BV8A 4YXWD 2FWNA 2AQHA 3OY2A 4J2TA 3F7OA 2GBLC 5IM4F 2G76A 3HN2A 2J32A 3O95A 4L8VA 3ER8A 3T52A 2WINI 3M1AA 2H2IA 3PXXA 2BRUA 4P6VF 5AJWA 5HCUA 5I8PA 1LVGA 1GQRA 1Z6AA 4M7OA 1ZUWA 4C3UA 2BKUA 1RYYA 3N07A 3P27A 4ZV4A 1KEEA 1WKVA 4TV8A 1IZ7A 1RPTA 2Y9MB 4Q9DA 1QV6A 4Q39A 2O2CA 5DP2A 5HE8A 3T38A 2Q6TA 1Z6TA 3WA6A 1J8QA 2P27A 1EFLA 3IKVA 4V0NA 5IJXA 3D6VA 4ZGBA 3A14A 5EJ5A 3SVZA 5EFOA 1J1UA 4P3KA 4EJSC 3DEIA 3OQMA 5J9FA 3OX3A 5JCJA 1UDBA 1X7YB 1THZA 3D6TB 4S05A 4A0FA 4GMHA 4Q3OA 3HM2A 2A33A 4E3ZA 1EU1A 1QMPA 1EX1A 1GQYA 5B30A 4N0DA 2H92A 4WLFA 4HQRA 2X9GA 3ENZA 5EIXA 1Z0SA 3FB4A 5EESA 3WMEA 4AZVA 2P3QA 1NW5A 1HL7A 3CYFA 3QOXA 3LPNA 4BFLA 4BE4A 5FWYA 4ZQGA 2IYSA 2BMFA 4A15A 4Z9FA 5IAGA 2PWYA 1CY8A 3RJZA 2A86A 1GD1O 5JT1A 1Z73A 4TZ0A 1I6MA 2P40A 3S7TA 3B12A 1AKTA 4QOEA 4BCDA 2BSQA 1UJ2A 4WBNF 2ANBA 1X7GA 2ODAA 2C04A 5ESXA 4NCAA 1TAUA 3FOBA 1FDOA 4PGMA 4HUQB 4NJEB 3ZY5A 2BGWA 3EVEA 1G2PA 2FSVC 1G8JA 4QAJA 2MSCB 4TXNA 2M32A 2J5QA 1MG5A 2WWXA 3BD7A 2EV9A 4IZOA 3G8BA 1AGYA 3GBVA 5L4LA 2CCGA 5FBRB 1OXXK 1LBQA 1VG1A 3EZFA 4Z5XA 3JWGA 4QM7A 5FNVF 4ASUD 3IIJA 1SHLA 1P2GA 2JAOA 1L6IA 2LVBA 4RESA 2I6UA 4NZMA 4CMEC 3W2EA 5H4HA 1GRCA 5GAJA 4QXOA 1SKQA 2X6TA 4LCJA 2GEVA 4JROA 4ZEOA 2WWVD 1YZNA 1OIVA 1NJ8A 4B8WA 2WF8A 4ZMSA 1DWQA 2XB8A 1Y1RA 2W4IA 3P96A 3RVDA 3LY9A 4XWOA 3FNFA 1CUSA 4L8GA 5D86A 1W0CA 1T24A 2Q7OE 3W34A 2ZUEA 1MXHA 2XUIA 1DQSA 3GUZA 2QUIA 3HZRA 3SXJA 3TL3A 5EJ7A 5ICGA 2IDJA 5I7EA 2V0NA 1PJQA 1S2MA 1SCJA 4OHCA 2AQKA 4DHEA 1Z88A 3TMKA 3V8NA 2SECE 1E8MA 1O6BA 5FWAA 4NU5A 1J5EB 5THQA 3PQ8A 1XNHA 1SPBS 4TMFA 4XIFA 3T7KA 2AL7A 2GVDC 4R41A 5DRYA 4ESVA 3IEPA 2N0SA 4HGYA 5JO0A 2RG7A 1CB0A 3VI3B 1BW9B 2ZWVA 4BQOA 4DPLA 1SBTA 1X0VA 3K73O 5GONB 1B8NA 2QV7A 3K9BA 4LVCA 1XPJA 4OQXA 1S8FA 1VYHA 5CEEA 5JCOC 3UZUA 1Z07A 2AOVA 4EQ6A 4MTCA 4LW8A 1TM2A 4PU0A 1MZVA 3GFVA 1Z4LA 3DR5A 5E1BA 3RU2A 1KI1A 5FLKA 3DTTA 3I6MA 1E9CA 2YY5A 4CU2A 3LA6A 5BQFA 2EFDB 4M98A 5FOUA 5FPTA 2QEQA 1QHHA 1TA4A 5DHFA 2RGRA 3K0HA 3LP6A 3W06A 1L5WA 1PVDA 2PO5A 3G85A 3H9BA 3NTRA 4UZFA 4J0IA 1DINA 3DVQX 3K2QA 1P1KA 3T9EA 4EJ2A 4C08A 2C2WA 2WWRA 3AYXB 4DVGA 2R97A 1A72A 1H8HD 2CZGA 2P9EA 3V80A 4EWLA 3U7GA 5E7MA 3LX8A 4YRPA 1O94C 2AQIA 3T4UA 4QHYA 2A0XA 5TPZA 4G0XA 2OHFA 4JR0A 4UNNA 5TQVA 1AKQA 1U0FA 2DFKB 2I2FA 3RGWS 3SEZA 4AKEA 1V5IA 4RSHA 1EX7A 1YACA 4X44A 1Y82A 4IH4A 3LY5A 1EFAA 5AJYA 4BKOA 2AHRA 4XI9A 1TAGA 4PAGA 2ZBPA 2CLHB 2HC9A 1XTQA 2ALJA 1OV6A 1ONBA 2NXNA 1CUBA 3B1YA 4IEEA 1N34B 2DOKA 3P2OA 2MJLA 1I51A 2GZ3A 3AV3A 1YCGA 3HJTA 2HKIA 3HQ4O 3JYQA 4EA6A 2B1GA 3MUFA 1A2QA 3U26A 2CXTA 4R9NA 2M6SA 8AT1A 4X64B 1A8IA 4C88A 1EWTA 3QE4A 1Z5NA 2HK7A 1PG5A 1UBFA 1H22A 3AXSA 4KREA 4OIMA 2JZCA 3EA5A 3L6UA 1KDYA 1XN1A 1W34A 2H2AA 4LHZA 1EFHA 3EIFA 1ECBA 4YGYA 4YMHA 3HYRA 3O3CA 3PPVA 3PQEA 2C0QA 3JD1A 5M04A 1O6GA 5C80A 4LJ9A 3DMYA 3EW9A 4UUMA 3IJ5A 2CL0X 2JAPA 5JG7A 2AUTA 2Z43A 1Q6ZA 4B7AA 3FCEA 3PGJA 2FW6A 3DAHA 1XLWA 1ZVJA 1TEVA 3HO8A 3KYDA 4FGZA 3Q41A 5AVRA 5JS1A 2YYZA 2IWHA 5HVNA 5LD2C 1S3FA 4N54A 5HFNA 4Q1CA 5FJIA 3ANYB 4XWTA 2I2BA 1JWAB 3D64A 3GN1A 1F7UA 3K53A 1E96A 1U8YA 1I7LA 2Q0SA 4RF4A 5JIBA 1P18A 1ZCJA 1C3JA 5HS6A 2AQ8A 3UOAB 4NFLA 1W6UA 2PD6A 4PCAA 5JQWA 4ZEMA 1OLUB 2LPMA 3AI1A 4OMCA 4W5HA 5JFOA 3OT5A 1S1MA 4XPIB 1QAOA 2W2TA 3QLVC 2GCIA 2O20A 3LGAA 1HETA 4Z7OB 2J8ZA 2YY7A 4GKAA 2ODPA 3QVUA 3ZX4A 1WY5A 3AVPA 3KB1A 1HH4A 3OCWA 5DPMA 2W2NA 1MAUA 3K2IA 4H35A 4BNFA 4BN5A 4CF5A 4D74A 4KX3A 3I52A 4PZ9A 4WERA 2BMAA 3T1YB 2QVCA 4G2TA 1HFKA 5EXXA 4J1TC 5I48A 1RI3A 1LX6A 4ICIA 4KQ9A 3QFRA 4TTVA 3OZSA 1ZL0A 4Q4DA 1UKYA 3FMVA 4HDKA 2QX9A 1ZW1A 3KDAA 2W83A 3A11A 4UVDA 2JLRA 4F7DA 5BVGB 2HU8A 2P4EA 721PA 1FMFA 1XXLA 3U7FB 1E89A 4IXWA 4UVGA 2O6HA 5KVVA 2VT6A 2WQZA 3E03A 3ECCA 1IOVA 3S5UA 2HPHA 3I39X 3FETA 4M0CA 4KFCA 4MYHA 1IAQA 1EDEA 2B61A 2SKEA 4MMZB 4Z51A 1ZZEA 1H4TA 2ZYSA 4HWPA 2YZ7A 5AKEA 5FWXB 1SU4A 1JN0A 1Q21A 1DQNA 2C1ZA 3PR1A 2BEKA 3N0VA 1DQPA 5T7BA 1MZPA 3LHFA 2XB2A 4IS2A 3KYBA 2CJXA 3QY0A 3CVOA 1UBNA 2KX7A 3JVDA 2DQYA 4L76A 1I3OA 4QPJC 5B1HA 4DCSA 4HZUB 5BSRA 4ARSA 2GHIA 4Z4IA 4HN4B 2VJQA 1BXZA 1FSFA 5CRIA 5ELMA 1OYWA 3KPYA 1T3TA 2YMLA 1RYDA 3CNEA 3R3VA 2ONZA 2Q4OA 3FSGD 4OB8A 4PM4A 2XGOA 1NAHA 5LZ4A 4H0CA 5KTPA 3U3OA 5E1MA 2BOVA 1AQUA 5BN3A 1TZCA 2CXOA 1ZR4A 4XYGA 1NTOA 2NW6A 4OM7A 5C5EA 5K3OA 2PJRA 1FFBA 1UP6A 2H07A 4RF3A 3T1VA 2KM1A 3DEAA 3HO1A 2G5TA 3D3NA 5JNRA 3WRXA 2OCYC 1F3OA 3CNHA 2SKDA 3QU5A 5EJMA 4DC1A 3T9FA 4CQNA 1SUWA 3HPRA 4KDCA 3X43A 3MRTA 4ER7A 2XMPA 3VR6D 4KOAA 3KLBA 4Q00A 4KXFB 4FHFA 4EY8A 2YQ5A 4FE4A 2FCRA 4ETWA 4MEAA 4NXMB 1MOQA 2XQFA 3T3GA 1MAHA 3K96A 3QU2A 2N46A 3PA8A 2HLNA 2BV3A 5D85A 3S6JA 1TMOA 2OGTA 4EJMA 3V3KA 1PD1A 1FSZA 1X7XA 4UCFA 1V3TA 3R5TA 4NBTA 1QGOA 1JQ5A 4MW7A 5F4BA 5AI9A 2QD3A 3D3JA 3JRXA 4AROA 1WCXA 2CBZA 4TUYA 2YRXA 4OBEA 1X13A 4FBGA 2AXEA 4FFOA 3NALA 5TB5A 2C42A 5HK9A 3R9XA 4TTJA 3KQVA 5K2OA 2GFQA 2NPIA 3KVVA 4CIBA 3SBXA 5JZMA 2RGCA 3KZCA 2HI0A 5EKDA 4MYCA 3BMOA 2HT1A 3HU1A 2X0IA 2J9YB 2EVWX 4FMPA 4CQLA 5AFSA 3CB2A 2Q0QA 3OPYB 4GSLA 1P39A 2VZLA 4E1BA 4DARA 3KJXA 3E9QA 1ZONA 2H1IA 1PJ8A 2Y99A 1AF4A 1CLEA 1OTYA 1VBFA 1G9XA 4QYIB 4AY3A 4MYUA 1IY2A 5FI0B 1J90A 1T8TA 2D5CA 2XTMA 2YIJA 3O4VA 5CBKA 5JS6A 3WYAA 1GA6A 1D0VA 4IMRA 5JXGA 1MC1A 2EFEB 5KI6A 2UUCB 1XXHB 3BORA 2P90A 4QDJA 4AG3A 3AHFA 2YN2A 4JP8A 1WXDA 3MJFA 2FSHA 4GYKA 9LDTA 1GNPA 1Q22A 1XMQB 2FE1A 4ND8B 2D1YA 1IJKA 1E3WA 3TBKA 1UEXC 1JDJA 1RHUA 2F1OA 3GD5A 4HNRA 1NXQA 5ENDA 4BC0A 4OYRA 4YR9A 3TF5A 5KTOA 5JU6A 3MXOA 4BV2A 4NSNA 3CU5A 4E51A 5E9WA 2QTFA 2XVZA 1B74A 1JG3A 2WMDA 4RGYA 1PN3A 3E48A 2NV6A 4Y2PA 4WZAE 5CM8B 3A0RB 5CDUA 3D2LA 1CY4A 3LAWA 3L0SA 3PC2A 4Z4GA 1ECFA 4NOJA 2HQRA 1P1HA 2JB9A 5JSHA 3FN4A 4CDMA 2Y1DA 2I71A 2BC9A 2LIVA 4QPCA 5T4HA 4CDGA 4D5GA 1AS0A 2BKLA 5C3UA 4F2DA 3DMHA 3LGXA 5CXQA 2JGKA 3L4KA 1G8AA 4LMPA 2EKQA 4CLXA 4LSGA 3OOJA 2RC6A 3V1KA 3OH8A 2G9QA 2Z9DA 4E2XA 1SBHA 3CN7A 4MNTA 3R8XA 1R6VA 1JR4A 3BIOA 4OMUA 1TVCA 3A6LA 1XK6A 5TGTA 3S44A 1OWPA 1W9HA 1QE3A 4GGOA 3WGJA 3OZIA 3E15A 4QG7A 3R20A 4ENPA 4MW6A 4A8HA 1CVRA 3U60B 3MQ2A 1VJRA 1R4NB 1G20A 1XZJA 2TRSB 1N57A 2YWHA 4EG6A 3PXDA 8GPBA 2JLYA 3CPEA 4NV0A 1RQXA 1UPCA 1VL2A 1I01A 3R74A 4AXXA 4U7PB 1N2CB 3E22B 4ZJYA 4V0OA 1K6MA 1MLDA 1M2VA 1OVMA 5EEGA 5C46F 4CEIA 4ZN6A 4MV4A 2W37A 2C3MA 3H2IA 3GZJA 3TEFA 5BSKA 3A1WA 2YINC 4KXVA 1D0IA 2FMUA 4YPVA 4FCTA 3SQMA 5IKXA 4C9BA 2IS4A 5JZVA 2W6JA 1ZJJA 4Q0MA 5ESDA 2ZI5A 1CKEA 3S68A 4YRIA 4HNAB 1IY0A 1ZNQO 2V7BA 2Z6UA 1OXBB 3S5JA 3NIFB 1GN9A 1FNDA 5EJAA 4CG1A 3WV5A 1ULAA 4IVRA 1VI5A 5KNDD 2GZDA 2XT6A 3EG5A 4PZAA 2IHUA 4U7WA 4D3DA 1B6TA 1LPPA 1JT2A 2VDLB 2ZAYA 2ZP1A 1P7CA 3QFHA 3QVGB 3TIXB 3EN0A 2A58A 1N7JA 3NHKA 1ULBA 5ER6A 3GC6A 3G88A 1S2DA 3BOSA 2VT3A 4LKRA 4RFVA 2BBWA 4PV7A 3P9XA 3DC7A 3UB2A 5KX5F 1UBMS 3TG8A 2IPOA 1CJKC 2Q0HA 1UJ5A 3GFFA 4DNFA 4A26A 4BUZA 1Y63A 2DPGA 4XYLA 5SYAA 2OQIA 3SBOA 3O0TA 5TJ9A 2VYQA 4QYMA 3H83A 5LR6A 3R3ZA 1C50A 4R8LA 3OT1A 3UA3A 4YAWA 5K6TA 2R6HA 3MB5A 1XDSA 3UPUA 4M1KA 3HB7A 5JDCC 1KY5A 3GJ5A 3JQDA 1Z0FA 5DGCA 2C5EA 1A2OA 2HHLA 4R7ZA 1JG7A 4E6EA 3IP3A 3VSDA 4QYTA 1B73A 4JT2A 3LX6A 3K31A 3RADC 1BU5A 1QIIA 3LT0A 4N82A 3RIMA 3VV3A 2F8SA 2JLWA 5HZKA 1LDEA 2FMKA 4X3CA 4DG8A 2VQ3A 2X0NA 3OOHA 2AWOA 3ZHRA 3QG1A 1K8ZB 4XFDA 1CPYA 2O2YA 2R79A 2J7KA 4UU7A 1Z08A 2ETVA 2CLLB 1OAAA 1RTKA 1UK8A 2ZYHA 2BJHA 4G0PA 4HDRB 4IDFA 3DXYA 1C7ZA 5E6RB 4ZI2A 3H04A 3M82A 1YQQA 1K8QA 2A0YA 3VC2A 4ZOLA 1ZYUA 1FPQA 1MAWA 1T36B 1W30A 3T8YA 4AJ2A 4N7BA 5BSUA 4ZDKA 3ROPA 1ZOSA 3HFSA 2J08A 2BM8A 4ER0A 3NBFA 4BASA 1VMDA 3DVAA 1E7RA 1XRNA 4OXKA 2PMKA 3Q85A 3WKDA 5JXHA 5CCBA 3BWYA 6AT1A 5KCZA 3TWOA 4FX5A 1TQHA 3OPVA 4CR6A 4LMRA 1P8JA 1EAMA 1OZ0A 5LOVF 3EVNA 1NN5A 1COWD 2OCBA 3KHKA 2C8VA 2PD4A 4PZYA 3ZEAA 4KIFA 1C4OA 2DMRA 4O4LF 1GPUA 2FR0A 4A8JA 3IVAA 4MA0A 4BDSA 5EMNA 1E2EA 1FC0A 4MQFA 2H08A 4UM5A 1LPAB 3F3MA 1KI9A 3T1OA 2P2ZA 3V5NA 4FVTA 4HB3A 4OTZA 4F4IA 1EP9A 1G5FA 1T2CA 1F5NA 1NVMB 3IQZA 3L8FA 4NYIR 5AM3A 4NXNB 1NZDA 1V11A 2JFUA 5TSDA 3LBFA 3HSYA 4NZPA 3RUFA 1FTNA 3L1IA 3ZE1B 2PMDA 1Q91A 3HDGA 3ZOZA 1PJTA 1C7EA 2WTNA 3EWNA 4HS9A 3HABA 1I14A 3ZH2A 3ZQJA 3RJMA 1KL7A 2FRVA 3T3HA 1K89A 4A3SA 2CVHA 4KFRA 4I9UA 4U02A 4LZLA 4CF3A 4QXQA 4TYMA 3JARB 1KP3A 3C74A 3QVJA 4FI3F 3UA4A 3HRHA 3G82C 2BTOA 1Z0DA 2XSZA 3LXRA 1JDPA 3EFOB 4NV1A 4TT3A 4ZYUA 3K5IA 5A04A 3M4NA 3BMQA 4C14A 2IEAA 5IAOA 5A02A 2QPAA 4MRVA 1U2DC 2YCBA 5GQSA 5F2NA 4L7QA 4ND2A 3L7MA 1R6UA 1T8RA 1JTEA 2GPWA 3VVBA 4MQEB 3R8FA 4J0QA 3ETEA 2JIQA 1Z5UA 4QULA 3UY4A 1TI7A 3TQCA 4D42A 1JJIA 5EQTA 2AFIB 1RLIA 4HAZA 4HKTA 4IJQA 1QR6A 4OUDA 1RRFA 5IFLA 3F9RA 1FNNA 1YUNA 1M8KA 4ZU3A 3LYUA 2PT7A 2Y1CA 4CN8A 3Q1KA 2CDBA 1SVSA 2Z9BA 3OFVA 3P0JA 2YL2A 5DYWA 5BQ5A 1HNWB 1T2DA 3HXKA 3RR2A 1WUYA 3RJ5A 2VXYA 1OI3A 1BQEA 4LGMA 3EXG2 3GRFA 1F8XA 5IHPA 1Z2PX 4O59O 1M2OA 5BN4B 1TZ2A 2DQ4A 4AIRA 1SUPA 4PSVA 3SMQA 3N8IA 2PMBA 2HGZA 1BD4A 1WB4A 3AUKA 3H2KA 4OYYA 4L07A 1LCIA 2B82A 2FLVA 1TJ5A 5KJ6A 2KLBA 3EF1A 3R6LA 4L08A 4PAMA 2L17A 3VO8A 4B2LA 4IDAA 5ABPA 5MGBA 1KIFA 4GPD1 4HFNA 3H19A 3KJNA 4BEWA 4YCSA 4PYLA 2E4VA 1E4EA 1QB7A 2PUWA 2QMEA 2W2LA 2NSHA 3HGTA 1OLXA 1Y8QA 2MT9A 5JWOA 5JALA 2V7XA 1K2VN 3FPLA 1V8FA 2IP2A 4QRHA 1KO4A 3E81A 3O03A 3V4OA 2WKPA 1MGOA 3FPJA 4HAWA 3ICEA 1H1TA 2V65A 1KP9A 1Z13A 2WP0A 3ZXXA 2HA2A 5B3LA 1ML3A 3UJ9A 2BR4A 4B4WA 3C3PA 1AIPA 2I3DA 2BGIA 4Q4LA 5CFQA 2UZ1B 4JEMA 4BMDA 1KWGA 5EHIA 3DTYA 5HG0A 5HF6A 3FZEA 2OBMA 2W6OA 4AKIA 1DAGA 1PJRA 2P2LA 2I4MA 1U6IA 1Z36A 3LUBA 1R4ZA 1TECE 2G3YA 3F98A 2OGWA 4UTVA 3NVKI 2C92A 1XDDA 1WHTA 1TFRA 4N6NA 4U2CA 5CM2Z 5LZ2A 4JUIA 1J1ZA 4LY9A 4Y3UA 4ROSA 2QWXA 1H0RA 4G1VA 9LDBA 2ZJ3A 1Z16A 2W00A 2X2OA 3BWMA 3PC6A 5KU1A 4JLNA 4CRWB 2QLBA 1S5PA 2ZYGA 3ZBUA 3HUDA 4DQKA 3EHEA 3UH1A 1G3MA 1HOXA 4NYMQ 3ZCTA 5CYOA 3WGLA 3G2LA 1SB9A 3FSRA 2R44A 3GJ0A 3I1JA 4NBRA 5IAJA 3R5HA 1NVAA 1GEEA 2P9BA 2Z6VA 5FPQA 2HBYA 3UWMA 5KQRA 1WMAA 4R6WA 1JPVA 1XLTC 3RF6A 1Y9ZA 3TLCA 1O7JA 1RYHA 3FMIA 2XMQA 3ZE7A 2PUEA 1Q0QA 4ZT7A 3F6YA 1PSWA 1EFUA 4I81A 5DSTA 1E6KA 3PD1A 4FEAA 5C2JB 3Q0IA 4M89A 4LBYA 1MO2A 4II3A 5SV2A 3V42A 3OZDA 4U9IS 3PEWA 3BXOA 1G3QA 1TZKA 1YJQA 3TPZA 1N3YA 1URPA 2PUAA 1UF9A 3IDFA 3IILA 5DJ5A 2ERXA 3VZDA 4N0MA 1QYRA 1ORDA 2H0QA 1Q0HA 1UZUA 3FY4A 4AICA 5JDIA 5TMEA 1BVHA 2K6GA 1YOBA 3V4VB 1E3TA 2DH6A 4ZQBA 8MHTA 3QW2A 1QCDA 1T2UA 4ARBA 2J9FB 3T0GA 1XTRA 3O8NA 3BTSA 3P1JA 3GLQA 4H1UA 4Q7KA 3CF6R 4WZBA 4YN3A 1KO1A 4ZOQI 2Z2KA 5DDIP 5LQUA 3E53A 3EVZA 4NX2A 4L4YA 4E11A 5FOSA 2GETA 3B9RA 1AH2A 1A5TA 1OSNA 1VGRA 1KHHA 2BE7A 2ID4A 4I1YA 4BNHA 2WHPA 1N2GA 3PYMA 4GXNA 3SN6A 3BD6A 3UNXA 5C3MA 3EB9A 3NJ8A 3KD2A 2PIDA 2RJ3A 2PZFA 1M6HA 3EGIA 5FTWA 3PJGA 4QRDA 4WN9B 2JBAA 4FCVA 4GXTA 1UBCA 3CKKA 4ITVA 3ASUA 4W99A 1S2GA 3I6QA 5G02A 5LB4A 1U8CB 4OYLA 1CUAA 2WM9B 4XQEA 5C51B 4W9MC 1V45E 3KVRA 2B1RA 4UFOA 3NHZA 1AZTA 1WUHS 5JLAA 4HB4A 3RUIA 3IBGA 4XM2A 3AIMA 3AUJB 4CKBB 1RPZA 3S40A 1B15A 1QVRA 4RANA 4ZXFA 3FOFC 2NT4A 4TTSA 4E2ZA 3EXHC 3FTPA 3TTTA 1Q77A 1G64A 1DO0A 1O4WA 3SBDA 3MPOA 1P2TA 4RH3A 1I4WA 3O8RA 3NDRA 3ZWPA 1ZVVA 1OAOA 3JSXA 3CVUA 2HSDA 4MQ5A 3HB0A 3K0EA 3D9QX 5FBLB 2VHYA 3Q6MA 3UV3A 2OCAA 3OURA 3C3MA 3QOFA 3O9VA 2PYZA 4BFZA 2JGRA 4R54A 4QUBA 2BELA 1E1YA 5SY6A 1E6MA 2IV2X 5D5QA 4WRRA 5EWLB 4GMGA 5DRTA 1CUFA 1OJ7A 3F0TA 3L7IA 1SZPA 1D9ZA 1E5TA 1K27A 2RFLA 4CTKA 1Z34A 3UJBA 3H5RA 4GI1A 4JUAA 2EQAA 4FGSA 5B1IA 3BAZA 3VAAA 3P5SA 2XDQB 4YAOA 2IX3A 1PHRA 4GLOA 4YUZA 5FH9A 1Y4SA 3N0RA 2FPRA 1D1TA 3EGXB 1G3RA 4P5PA 1A8QA 2JHFA 1HYQA 3WGHA 3AERB 2C9YA 2XUFA 1W0JD 1E0KA 1VLZA 3COVA 2Q1UA 3R6TA 3DMNA 4MUIA 3NWBA 1VCOA 4L6CA 2CLMB 2EG5A 5IJ9A 3H6HA 3PHHA 4JVMA 4DJ5X 4EHIA 4BVBA 1Z74A 1PQWA 4TLDA 3AUFA 4JQYA 5F21A 4D4LA 1JWLA 1G5RA 1PYOA 5DU2A 5KJEA 4DVJA 4LF5B 4ZI5A 2V9CA 5B3KA 1NSYA 3AR8A 2AZ4A 4HRAA 4Q9LA 1U3WA 1RC1A 2Q3BA 1D1PA 1R0CA 2RGNA 2ZRKA 5J5AA 3VYUB 3D2CA 5ADVA 1XGKA 2JD1A 4JJ4A 4WNAA 5DZSA 1FEZA 1E4VA 1GTG1 4KFTA 3EF3A 4RGQA 3R5XA 1U81A 3IP5A 3PICA 3KQWA 3QMMA 5AW8A 5I7HA 3K5PA 1L5YA 1PD0A 1RQRA 1QZTA 3D5EA 4ZOLF 3LQ1A 1X2EA 3IUBA 3PL5A 1OIWA 4I3FA 5EWJB 7YASA 1O9HA 2B99A 2VF7A 4Z9XA 3R41A 5TEVA 3L6RA 3BWBA 4JI3B 4Z3DA 4CT4B 2RGWA 3R44A 2GAIA 3R3SA 1Z8FA 1BD3A 3LMKA 4NTZA 3UVEA 1DQZA 4CTOA 4JLSA 3WK6A 4Q37A 3I0NA 3SDSA 1BDIA 2OVFA 1C8BA 3MCVA 5CIQA 1B1AA 3ILVA 3ZVLA 2OP1A 1WWKA 1SBCA 3S2GA 2PLRA 3H17A 4I4NA 4NS1A 2Q2WA 4MVYA 4M0PA 1D4AA 1DAHA 1E0DA 1LI4A 3D6FA 4ZREA 4F2HA 2V59A 3G7UA 2GT1A 1FCJA 4JI2B 3ZKWA 1LS1A 2G5PA 2ECQA 2IKSA 4E2FA 3LU1A 2IIQA 2XOXA 4LG1A 5AYVA 3BTOA 1QIHA 4RK1A 1ZIDA 5FV4A 3GLFA 4N9WA 2UZ0A 3SKVA 4CQJA 2G7MC 4DIKA 1E6WA 1O9BA 1GNQA 3HBFA 4ZU1X 3HWRA 3KOOA 6GPBA 3V4PB 4LXHA 3RF7A 1ACMA 4HAUA 4O4HF 4U5XA 4YS6A 1P5JA 3L8ZA 4MQ4A 4C7KA 4CM6A 2XA2A 4BZWA 1J20A 1KO5A 1MABA 2P4QA 3FYHA 3MZ0A 3RIGA 4CZ2A 2G8NA 4HXFB 4WCDA 2QXTA 4QM6A 1IK4A 2JGJA 2GZHA 1QLHA 4MUEA 1GO2A 1ZMRA 1W35A 3CE6A 5HF5A 1Z3CA 5BSMA 5LP1A 5AKKA 1ADBA 2HCFA 1VKOA 8OHMA 4C0KA 5TY0A 1T35A 3S8MA 4YAIA 4XJSA 4PZEA 5MN6A 3KYIB 3O4FA 4FQ7A 2X1HA 1YZQA 4EPWA 3GLIB 3FZGA 1EDOA 1QVVA 4ZKEA 4AY6A 1BXGB 2QAGB 2KQUA 3GDGA 3WC4A 4CMJA 1CJTC 4CLRA 3ZQUA 2EZ8A 3LSYA 1J39A 1TTPB 2RHMA 4P92A 4ZZ3A 5GZ3A 2PRIA 4IS3A 3AGPA 3CUSA 1EGAA 3FSJX 4GPAA 1HI9A 2GAFA 3LF2A 2FPWA 4NAVA 5BNWA 4JHXA 4K9OA 2OK7A 1Z8HA 4QDUA 2BGTA 2X9LA 2V7TA 1LY1A 1OFUA 1TEHA 1WKCA 2NUTB 2XWJI 2PQMA 3PRKE 4O4IF 3A6ZA 1H8HA 1YNOA 4KBYA 3UFXB 4YQZA 4QREA 3RDPA 4CQMD 2ACEA 3M6WA 3P7MA 5KYXB 1FMLA 1VOTA 2EX1A 2XKAA 3PQDA 2PRZA 1YA6A 1J7KA 3VNUA 4X1IA 4FEYA 1Q7RA 4EDHA 5INTA 2JIBA 3FHOA 2GPJA 3QRWA 3THWA 1S2IA 1FDSA 3JQAA 4AG5A 3H6GA 3GG2A 1CU1A 4F5EA 4F46A 1U2EA 4RDHA 4NOLA 1F1BA 4HWTA 3KZMA 1TVEA 3D2BA 5B3AA 1QYXA 4ZCSA 4QOJA 3WB9A 1SKUA 2Q5JA 2CFCA 2ZU0C 4IIXA 4DBLE 3NI2A 4Y9SA 4DEYA 1Y5RA 3DMFA 1XI2A 2ONKA 4TZKA 4P54A 3VH2A 5FUQA 2P4SA 3RWBA 4FZ3A 3VOTA 4CM8A 1KP2A 2C54A 1Y7TA 1LWOA 3A3OA 4O1IA 1NR5A 4AD8A 2HF9A 1CW2B 3IHKA 5AI6A 4ZVSA 2IEIA 4G0ZA 3T6KA 4YRMA 3BJRA 5FR2A 2O0JA 3DTVB 1WZUA 3AW8A 5CDTA 3IEVA 2X86A 1ZK0A 1XEWY 2P75A 2ZI3A 4V24A 3SHOA 2EGHA 5EIWA 2NLOA 2FVYA 4OX9Y 4I4TB 3T5AA 1EFVB 4DA6A 3C8DA 5AESA 3FCOA 1UAAA 2FLWA 1NL3A 1W4RA 2AG8A 1A69A 1WDWB 4K8OA 3SSMA 4LYGA 3FJ1A 4I8XA 5BN5A 3QMPA 2VTDA 3O2JA 3GMDA 3ZCQA 2C9OA 2O1EA 3EPPA 4MQ6A 5B3JC 5BSEA 1GXSA 2JFBA 1YFZA 1V48A 1PFKA 4KQIA 2HDWA 3BRQA 2D5LA 4O8CA 4FHDA 3S28A 1KEEB 4NBNA 4TV8B 5GGYA 1XNGA 1FYWA 1LLFA 4MR8A 1GTVA 1T26A 3FHCB 1MHTA 3D3EA 3HWSA 3TBFA 2FOIA 2BGNA 1RW4A 2NSJA 4KQEA 3BJEA 1A9TA 1EFRD 2A9JA 2WSSA 1ECLA 5EPUA 4E4YA 3H1FA 3UTCA 4HDQB 4HGZA 1E3SA 2GMWA 4R2WA 3AF5A 4O5OA 2W2KA 2JRLA 2C2XA 2NV0A 3UMFA 5CCXA 2F64A 2I6XA 3I8XA 3GPLA 5C8YA 1QH9A 3SHFA 3VGJA 1UFVA 3DEZA 2YXPX 1O8CA 1BRMA 1DBPA 1N75A 4QWMA 4OI2A 1AD2A 1R5NA 2HUPA 1NUQA 3T34A 1X86B 4G81A 2YHIA 3TRJA 3WKBA 2FQWA 5F73A 3TJRA 4DFDA 1ATZA 3UUGA 1MTZA 5FWYB 5BSHA 4M3NA 2GM4A 4U4AA 1B2LA 3LWZA 4A4DA 4J0EA 5H9WA 2FU5C 2J6CA 3DT8A 2Z5VA 2J0EA 1HC7A 2X4GA 4NOMA 1YRBA 5C1IA 2YX1A 1OX6A 1P72A 2XW6A 4KNVA 4MTLA 5EQFA 4JJ7A 3LVFO 2IH4A 1SO8A 2GERA 4DY4A 5IDQA 4MW9A 3E7WA 3R40A 2CMDA 3ANLA 1GQSA 1MN6A 3UHFA 1Y80A 3VSAA 2GEDA 1XZDA 1BHQ1 4DLNA 1XAJA 3GRKA 1JL3A 1JLLB 2DPLA 5P8WA 2PZGA 4QOSA 4GYWA 2VUIB 2WKQA 1E9AA 4WIAA 2J9XB 4LZZA 5EE0A 5AXBA 3GWZA 2PX0A 4CIWA 5DM2A 1DP4A 5DI3B 3RT9A 3HCRA 3CT4A 4WVLA 4FK8A 3GCXA 2Q4BA 4ZDIA 4UPVA 2LE0A 4D3XA 2Y1KA 4MZDA 3G0DA 2IU4A 4LNUA 2V1UA 2ZE6A 2MSLA 1KFJB 5EZSA 2V45A 5LA6A 3R7WA 5AVWA 3PDUA 1FLVA 3VMFA 2AA3A 3IGFA 3R9WA 4NBUA 5KTMA 3N74A 1KJJA 2AJTA 3HCAA 4O63O 2ZE5A 2FUG6 2BFFA 4E7OA 2BSXA 3USZA 1MKYA 2I66A 4QA9A 3SIWA 4MP6A 4MX8A 3UWPA 4EG4A 2V1XA 2X77A 3FROA 4DXAA 3VU3A 1M1YB 3FOWA 4GVLA 3PITA 1HSOA 5IUKC 2PH5A 1NDUA 1K7XB 3QSYA 2AW3A 4DG5A 1E9EA 3SVLA 5AVVA 3RRBA 1U7XA 1YF3A 3PKIA 1Q7EA 2XUKA 3QKRA 3X1MA 2X0FA 3KAQA 1JIKA 4FYHA 3UT0A 3NEJA 2COEA 2G5CA 4H18A 4TQUS 1HQCA 1VJ1A 2JCXA 3DZ8A 1CEQA 1AB5A 4FBLA 1VB5A 4DR7B 1YZFA 3DEJA 2ZUFA 4UC0A 2P1ZA 2GF0A 2O0KA 5F5XA 1V8ZA 3K09C 2PSFA 4XD7D 3VV2A 3M7IA 3M1IA 4P2BA 4MJXA 5IMBA 1FDTA 2QBYA 3KD3A 2Y68A 1QHHB 4I8IA 3N8NA 4IVPA 4EEXA 4MZXA 2AB0A 5CD9A 1NVFA 2YWXA 3CGWA 4HYYA 4RV9A 2POQX 1U1DA 4JMLA 1O08A 1JHUA 3WK9A 1WW2A 4BVHA 1LRKA 5A7GA 1GTMA 1Z8NA 2BR5A 3X1JA 2AMYA 3HM9A 4Z1OA 5HGJA 1ETUA 1W59A 3BFKA 3FGNA 4CG3A 2WJAA 5EIBD 4ZT5A 4F12A 1JKIA 2JGDB 4ZKDA 4P33A 5KHLB 4FKZA 2CBGA 4HBGA 2GLTA 4Y6SA 5AVJA 1NT2A 1XV5A 1DELA 2V3WA 1U4OA 2FFRA 1NXSA 2ZTHA 3TKAA 4Z7QB 3R5SA 1TUIA 4UJ3A 5CNIA 1YONA 2ANCA 4YPFA 1Q57A 3DHNA 1NF3A 4EJFA 5JTTA 4ITRC 3A8TA 4J2OA 1C29B 1N9ZA 5D84A 4EHLA 5JV5A 5HRUA 2GA8A 1E94E 3R3XA 1TKBA 3VPAA 2DCUA 1XZHA 2SNIE 2WD7B 2X8LA 3OIYA 4IO0A 2O8FA 2I33A 2O57A 5KVCA 1XMIA 4D4KA 1V6CA 1O96B 4JBLA 4LRXA 1U0OC 1JA1A 3TK1A 5BURA 2WVJA 5BV2P 3HB4X 2PUJA 1P4AA 4S1VA 2ICAA 3N05A 4RD4A 1E2PA 3IQXA 4HN2A 3VNRA 3I2FA 4DB2A 4MAMA 4ENSA 4C2UA 3IKJA 1OBCA 5IKOA 4PF1A 4RIHA 3E7DA 4V1CI 2W70A 1FP7A 4DYDA 4NBKA 3UBMA 3ZN2A 2EZ9A 2GF2A 4Z9BA 1PGNA 2XYQA 4BAZA 3K4QA 3JAKA 3KE8A 3NHBA 4R9UC 1Q3KA 2H7XA 2ZITA 4IVNA 3ZOKA 4B2IA 5D51S 1RKUA 2BEVA 3DZDA 2GPBA 4QVIA 3GA0A 4FFMA 4ZALA 2AOTA 4C0SA 2A5LA 3SAJA 2B4RO 1PV1A 2FEWB 4YC7A 1SHUX 3OTWA 2V5AA 4EY6A 4F21A 4NPCA 1BFUA 2QX4A 4G86A 4L78A 3VU8A 2NADA 3C7AA 1P7VA 3LT2A 1K6EA 1U8TA 3NHYA 4H3KB 4OKNA 4WINA 4LE2A 5B53A 1MQ9A 3EWIA 4IF4A 3C7CB 1SXGA 1TM1E 3BCSA 3R0JA 5T57A 1Q1BA 3VM6A 4QFMA 3OQJA 2JVIA 3QYPA 4RKEA 3ZDEA 3EAQA 2YS7A 4FLEA 3DZKA 2IEZA 4PFJA 5ECWA 1JXQA 1NONA 2ZYIA 1KAGA 4RVNA 1BH2A 2MSEB 3CZPA 2QTCA 2GUWA 5C0OE 3FRHA 4BKUA 2MYNA 1XTZA 2B2XA 5JHHB 3OQ1A 4UAJA 4DJTA 4EUEA 5HOEA 2QZPA 4HDKB 4RPCA 1JG4A 3ZJ4A 3TBHA 1ZHOA 2FR8C 5BWNA 2VJAA 4BNGA 2DUNA 2ZB7A 3H42B 4X66B 5KNDA 2DHRA 2QVBA 3FWNA 3CVWA 5E9QA 4Q02A 4GMDA 5AM4A 4MIKA 4MKXA 1THTA 2NSYA 4PXYA 2PUCA 5B6PA 1SG9A 4DV6B 2JBWA 4XGKA 1YS9A 3H1GA 3RTEA 3KXPA 1S8NA 3WWEA 4GGMX 3JASA 4B3FX 3IERA 2XYPA 1TK2A 1W44A 3WYNA 2WFAA 3K70C 4UQLA 2IHTA 4L3WA 1BDJA 2COUA 1I6WA 1SC3A 2P77A 3LYLA 2D8MA 1GG2A 2DWOA 2GTHA 2VNHA 4ML3A 1J8VA 1JU9A 4NONA 4WOCA 5ALLA 1LRJA 2FPOA 2ZE7A 2IOHA 3GRVA 4NMMA 5DX8A 3X1XA 2DKNA 1NJGA 2NZ8A 1UBJS 4NAUA 4QARA 3C5EA 3ZXSA 1G8YA 1FOEB 3INTA 1T8UA 1XCLA 1U63A 3TRHA 2VRCD 1J25A 1R2QA 3ITDA 5ALKA 3ZW7A 1AZLA 4GWGA 5BN3B 4FYWA 4XE5A 3ZHQA 5K8IA 1GDDA 3HA5A 1DEOA 3L0IB 3L1HA 4PYNA 4I36A 4ZOAA 4AP6A 2V7QD 1JLRA 3EW7A 5F52A 4EMBA 2K5UA 4L51A 4DBZA 1NTRA 3F7TA 1AUXA 4MITA 4E08A 1MC8A 4L4XA 1U8ZA 2BH9A 2WJJA 3TLZA 1Q15A 3RRFA 4A0SA 1M0TA 1GTSA 1CR0A 3PXUA 3OZFA 1GY8A 1C9DB 1P77A 3U7RA 4JH0A 1ZHFA 1DAPA 2AS0A 1L8LA 3IH5A 1XDZA 5C32A 4YLGA 1P80A 4PSUA 3H1PA 3IUMA 4MW1A 3HCDA 5K4AA 3PKJA 1X7XB 1YXMA 2GS9A 4Y2VA 1QANA 2I2DA 2C03A 3JYOA 2QM0A 4GZMA 3V7WA 1JJVA 3QLUA 4NR0A 4LF4B 1U99A 1JEJA 1M2NA 4TUYB 1IN4A 1O54A 1J0AA 4Z3KA 5H8WA 3R9XB 5JAQA 2M6KA 2QW0X 5E3JA 1VSTA 1L7EA 5EPOA 3UMRA 2M6LA 4ZT4A 5JMWA 3VDRA 1ISHA 13PKA 2O4UX 1A2BA 1E3JA 2PQ0A 3BMOB 4ZQHA 5JE8A 1ZKDA 3KEFA 4D8YA 3FNHA 3KHSA 1O6ZA 4TQ9A 4MYRA 5IVKA 3K0CC 2JHAA 3HB1A 1YIAA 3CTMA 3L05A 4GZ3A 5DTQA 4O02B 4WFIA 2MTBA 4F4UA 2QI9F 1C9MA 1SQFA 2NAPA 4HNHA 5DBGA 2C7RA 1PVVA 2OY0A 3KQNA 2DQSA 1HE4A 1I1OA 1P91A 1RWMA 3C1TA 1PKEA 3CLRD 3TX6A 4DTCA 5KYUA 2J59A 4JBIA 3ND8A 1EK1A 3D8UA 4ISCA 2J6HA 3WZ2A 4CV2A 5KYTA 1F4VA 4I99A 4C43A 4F06A 1WD5A 3G1UA 2EKPA 1QTIA 3GGDA 3OTIA 4RY2A 1NRJB 3MT7A 4HGRA 1TEXA 1XZIA 2PZBA 5CURA 3C5HA 4MRRA 2NPFA 1E3WB 3NOOA 2P78A 1K63A 4EB3A 5U1PA 4I8DA 2GEKA 1Q17A 1BDMA 4ZK2A 3O9ZA 3CF4A 4CR7A 4E5PA 1JZSA 3CX4A 4INPA 3T3MB 1E2IA 3EX7C 2JEZA 3T99A 2H29A 3H4VA 1C3LA 3RW9A 4UMDA 1EFDN 3T9CA 4JDUA 2EP7A 1UXJA 3OU2A 4IDPA 3B6EA 3KBOA 3NBZC 4G5RA 5DLPA 4ZK6A 2UVDA 2XVAA 5IC5A 3GEIA 1PR1A 1IUKA 3ZDRA 4GOND 1YB7A 4ZCTA 2CN1A