5HXAA

Crystal structure of an udp-forming alpha, alpha-terhalose-phosphate synthase from burkholderia xenovorans
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
458
structure length
448
Chain Sequence
MSRLIVVSNRVGGLAIGVLDALKETGGVWFGWSGETVSEPSAPVIEKQGNVTYATVGLTKRDYDQYYRGFSNATLWPTFHYRNDLSRYDRQEYAGYQRVNATLAKQLKELLKPDDIIWVHDYHLLPFARCLRELGVKNPIGFFLHIPFPVPEVLRTIPPHEELVKAMCSYDVIGFQTDADRQSFVDFIERGQHGTSSEDGMVHAYNRFLKVGAYPIGIYPDAIAKAAEQFTDRKPVRSLRDGMRGRKLIMSVDRLDYSKGLVERFQAFERLLLNAPGWHGRVSLVQIAPPTRADVQTYQRIRQTLEGEAGRINGRFAQLDWTPIQYLNRKYERNLLMALFRQSQVGYVTPLRDGMNLVAKEYVASQDPADPGVLVLSQFAGAAEQLPGALVVNPFDLSQMAEALERALSMPLAERQARHADMMAPMRENNLSVWRDTFLADLRNVATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
publication title Crystal structure of an UDP-forming alpha, alpha-terhalose-phosphate synthase from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Protein binding
total genus 175
structure length 448
sequence length 458
ec nomenclature ec 2.4.1.15: Alpha,alpha-trehalose-phosphate synthase (UDP-forming).
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00982 Glyco_transf_20 Glycosyltransferase family 20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5hxaA02
1FU8A 2XGMA 3BD6A 3VDMA 3MTBA 3D1JA 3ZCPA 1KTIA 1Y6FA 2QN9A 5ENZA 3CUTA 1FTYA 3CUVA 2WTXA 3HBMA 3NP9A 3L7BA 2QLLA 3CEJA 3CEHA 3AMVA 1GG8A 1EM6A 3MQFA 3IAAA 3H4IA 4F96A 3D0QA 1M5RA 3MTDA 3D0RA 4KQMA 5D01A 2IEIA 3ZCVA 3OKAA 2QN2A 4MRAA 3H4TA 1WW2A 4BQEA 3RT1A 2IW1A 3L79A 1RZVA 5TMBA 1FS4A 1FU4A 1L5VA 3G2NA 1P2BA 1NOIA 1PN3A 5DU2A 2HY7A 3RHZA 2ECPA 1XC7A 2F3SA 2QRQA 3C4QA 2GJ4A 3CUYA 3OY7A 3OTGA 2BFWA 2AZDA 4GZ6A 4YUAA 1HLFA 1WV1A 3NP7A 3MRXA 2QN8A 2YJNA 4X7PA 3VUEA 2BGTA 2R60A 2Q6VA 3CEMA 3T3EA 3S2UA 3EBPA 1JIVA 3WAGA 1L5RA 1V4VA 1P4HA 2AMVA 2XMPA 1L5SA 2VCHA 4RBNA 3TAXA 3OT5A 1FTWA 1GPBA 3OTHA 3UYKA 3ZCRA 2GPAA 3PE4A 4CTNA 1FTQA 7GPBA 3Q3EA 4GZ3A 1WUTA 1FC0A 1XL0A 3CV3A 2ASVA 2C1ZA 1RRVA 5HXAA 4FKZA 3MRTA 1P4GA 1Z6QA 4RELA 2FFRA 3NAZA 4EKYA 3BD8A 3MS7A 5IKPA 4YI5A 3MBOA 3BCUA 1YGPA 3E3LA 2XGOA 5C1DA 3L7DA 2XA2A 3VDNB 2SKCA 2JZCA 1A8IA 3FROA 1L5WA 2XGSA 1B4DA 2GT1A 9GPBA 4AMBA 3HBFA 3MT8A 2X6QA 2F3QA 4N39A 3GUHA 3SYMA 4LEIA 4G2TA 4XIFA 5D00A 1GZ5A 4N3BA 1E4OA 3MSCA 1AXRA 2FETA 2GEJA 2R4TA 2G9UA 4REMA 1JG7A 4PQGA 3CX4A 3ZCQA 3ZCUA 3C4VA 1L6IA 4FZRA 1PSWA 1FU7A 5TMEA 3DD1A 1VGVA 3HBNA 4MHSA 3MS2A 4RIFA 1IIRA 1P2DA 3ZCTA 3T5TA 4MI6A 2F9FA 8GPBA 1UZUA 3VUFA 4AY5A 4WHMA 2GPBA 5DXFA 4GZ5A 1P4JA 3OKPA 3BCRA 2C1XA 3Q3HA 2PYDA 2X0EA 4AMGA 3BD7A 1F0KA 2XA1A 3MT9A 4HWGA 5JTTA 1ABBA 1NVKA 1AHPA 4RIIA 3WC4A 4MHOA 2AV6A 2X0FA 3G2HA 5TVGA 3G2JA 3S29A 3BDAA 4QLBA 4HLNA 4NC9A 3CUWA 1NOKA 1WUYA 4BQIA 2R66A 1H5UA 4CTMA 1L7XA 2QN3A 3SYRA 2PRJA 1NLMA 2GPNA 2XCIA 1LWOA 1GPYA 1EXVA 4CTOA 2QLMA 3QHPA 2ATIA 2SKDA 1Z6PA 1PYGA 2G9VA 3CUUA 4M60A 4L22A 1SXQA 3T3HA 1GPAA 1XL1A 3NC4A 4RIHA 2PRIA 4F9FA 3NPAA 2QRHA 1L5QA 2VSYA 4CDRA 2X6RA 2QLNA 3OKCA 4GYWA 1O6CA 3O3CA 1Y8ZA 2QRMA 1QM5A 4M83A 3GPBA 3S0JA 2H1HA 3C48A 2C4MA 1C3JA 1WV0A 5LQDA 1E1YA 2AW3A 3S28A 2SKEA 1PNVA 1XV5A 2IEGA 4AY6A 2ZB2A 4RIGA 1NZDA 3BEOA 3TOVA 1Z8DA 2O6LA 1UQUA 2PYIA 2ACWA 4WACA 2X0DA 2OFFA 4RENA 1C8LA 4MI9A 3RSZA 4N9WA 2IYFA 1JIUA 3HBJA 4EL5A 2IV7A 3RSCA 4EKEA 1IXYA 1K06A 3DZCA 2GM9A 5I45A 2BISA 4N3AA 1JG6A 3NB0A 3L01A 3BCSA 1F6DA 3L7CA 3TSAA 4GYYA 4Z5XA 2F3PA 4X6LA 5JTUA 4MICA 1GFZA 2QN1A 2PQ6A 2IYAA 1WW3A 4W6QA 3DDWA 4F97A 4EJ2A 3MS4A 4EL0A 3MRVA 4YI3A 2QRGA 4NESA 3OY2A 2QZSA 1JEJA 5IKOA 1Z62A 1XKXA 3UYLA 1C50A 3OTIA 1NOJA 2JLBA 2GEKA 3T7DA 1NZFA 2QNBA 3G2LA 2G9QA 4WADA 2QN7A 4AN4A 4BFCA 1K08A 3MT7A 2G9RA 4GPBA 4MI3A 4XI9A 1Y6GA 1J39A 2VSNA 1UQTA 3L7AA 2FF5A 2IUYA 2IV3A 2XCUA 3MTAA 4X7MA 1C8KA 1P29A 1YA6A 2R68A 1P2GA 1RZUA 5DLDA 3G2KA 3ZCSA 3T3GA 2F3UA 3NCHA 2KS6A 2C9ZA 2VCEA 3Q3IA 2ACVA 3S27A 2VG8A 2H1FA 4X7RA 1XOIA 2JJMA 3PE3A 4M7PA 1FA9A 4KQ1A 1SXPA 4RIEA 2R4UA 1GGNA 2XA9A 4NEQA 1JIXA 1QKJA 3T3IA 3E3NA 3EBOA 4KQ2A 2P6PA 5TMDA 5GPBA 5BNWA 3E3OA 4LDPA 3QKWA 4N3CA 3G2IA 3DDSA 2QRPA 4BQFA 3WADA 1LWNA 3IA7A 2BGUA 3T3DA 1BX3A 6GPBA 3COPA
chains in the Genus database with same CATH superfamily
1K92A 1WNFA 2CVOA 1KU0A 4I9HA 4QUKA 1O2DA 1EFLA 4E5MA 1XQ1A 2JJ2A 2OORC 3L1KA 3PWTA 2CCGA 4NCHA 3AJRA 4NS1A 1KTIA 2O8EB 4L9AA 1WD5A 4J0QA 3OO1A 4IFEA 3RFCA 2G4CA 3ER6A 4MPDA 3DBVO 3SS7X 4OVKA 4QDKA 2BLLA 2IEAA 4XW2A 3GMDA 3DDOA 2ZBRA 4CEJA 5HKAA 1M83A 121PA 5LDDC 1MHPA 1PRYA 4LXYA 5BSMA 2YZ2A 2VKTA 3QXSA 4Y2YA 3SZ3A 5BMVA 4MS4A 3FBTA 1NXPA 1C7IA 2JNWA 3D0KA 1WCIA 2BGLA 2J6CA 3H5IA 4LECA 2P4QA 4RVFA 3RU3A 3SX0A 1CIVA 4JBYA 1LY1A 2CZGA 4YDQA 4CMGA 4JVSB 2JGKA 4WLEA 4FDUA 2FX2A 4F96A 3BN3A 1RAHA 2O54A 3V2HA 1EQ2A 1KFEB 1X7WB 3QQ5A 4FKMA 5T4EA 4V02A 5TEWA 2HIMA 4UZEA 1IHPA 1SBNE 1ZR2A 2A0YA 3TTSA 2DC1A 3H1EA 3VHLB 1FYXA 1FLVA 2Y2VA 3QPAA 1TU4A 3KJGA 5BW8A 2D54A 4W99A 1CY4A 4G1MB 1KSHA 1UIRA 1UMBB 1NUUA 2XOXA 3A6ZA 3IXLA 3KX2A 4TRRA 2NUAB 1DAOA 1COZA 3RARA 4BBPA 2QSZA 2CLDX 3CR7A 1G5QA 3M1LA 2ZSEA 3DKKA 2YJ5A 1TZJA 2BCGY 1Y8AA 5G02A 3F7OA 4BB9A 2PUEA 2V1UA 1XSEA 5HIAA 3ENVA 4LZZA 5CEFA 1Y7PA 3GLTA 4KMSA 4P6VF 4R2LA 1G3IA 2ATEA 4GBMA 3T15A 1H6BA 5JNVA 3E9EA 4N5NA 4BO6A 5JPCA 4KB5A 4MWEA 2AI3A 3RTBA 4TXJA 4IO0A 1E61A 1M2FA 4A2PA 1CJBA 4GZ6A 1HLFA 3PLAE 3VO2A 1TYZA 5H80A 3DGEC 4IJMA 4AB1A 3IQEA 5KREA 3R4VA 3AU9A 2JLRA 4KQJA 4DLAA 1L5OA 1Z0FA 2RK3A 3BMOB 3OCWA 1W0JD 4O6VA 4D96A 1RABA 2OCGA 5K8CA 1TOAA 5IFLA 2XE7A 3QOFA 3AHFA 1IIBA 2X3UA 1FFWA 1QRDA 3KB1A 4M53A 1Z5PA 3QNUA 3DTYA 3DMPA 3WKCA 4HAXA 2AYXA 3AFIA 5TPWB 4B17A 4AY2A 3AJDA 2GM3A 4RYLA 5EE9A 1SZPA 3KSMA 3DOHA 3MINA 1W0KD 2OLKA 1GKIA 1RJWA 2PZAA 4UVGA 3TZ6A 3VR4D 4EHJA 2I2FA 3SS9X 5A5DA 1IM5A 1FQWA 3PUYA 4QXPA 1U28C 1G6HA 2IZZA 2OFWA 3QZUA 3OTHA 3S5UA 4Q4CA 1JMKC 5EHXA 4E1VA 4UTRA 5CW1A 4UD2A 1T1GA 2RHLA 7GPBA 4TYYA 1W6RA 2DCUA 3FNFA 4KTVE 5HBGA 4IQ4A 5BY2A 3EGVA 3OCZA 2R87A 4BLPA 2X41A 3PNYA 3V1UA 4CN8A 1E9EA 2EIXA 3EDMA 1DQYA 4EHLA 1UJ2A 3I2JA 1KDZA 1UZLA 1U8UA 3LWNA 4U6QA 1ZCBA 2W00A 5DM2A 1V7PC 4F2GA 3QFFA 1PEDA 2EGHA 4J6FA 5AVZA 5JU6A 3ZD6A 2D1TA 3AP3A 1QGYA 1P4GA 1UK9A 4R3WA 1RQ7A 4RELA 3WNCA 5JAQA 6ADHA 1JAZA 1ETHA 4L78A 4L0CA 4BU0A 1Z7WA 4IXDA 4EKYA 2JA1A 2QTRA 4OHYA 2N42A 4FI3F 1EVLA 4ZT2A 3ND7A 4QVGA 2QV7A 1K2WA 3ETCA 4EMUA 1G2QA 2HRCA 3NV9A 3FMVA 2MCFA 2F48A 2RHTA 1SUDA 4P4UA 2E82A 4G5XA 1N9GA 1UEXC 1VP3A 4TVSA 1T3HA 3DOCA 4GIBA 1H0RA 4BNIA 4Y2PA 1DAIA 1YGPA 2WAXA 4Q4JB 2P9CA 1CW2B 2IDJA 1P4SA 3QP9A 3YASA 1JHDA 5GGXA 3RUAA 5CD9A 2GZDA 2REQB 2WVAA 4IX9A 4UHCA 3T41A 1QGZA 3L8HA 3DOIA 2IGTA 5K8JB 4ZVRA 1O0BA 4JNCA 3RUHA 5CVDA 1UM9A 3ZDRA 2C2GA 4XDHA 1JAIA 1UR5A 1VECA 2PT5A 1XDGA 2J4DA 3V2UA 2GN2A 2H2GA 3L5KA 3WJ2A 1L4LA 3TPFA 2C2ZA 2C7VA 1Z63A 1J25A 2EKLA 4UEJA 3RIEA 3OJEA 2O3RA 1IULA 3ZIAD 1BMDA 4K81B 3ITEA 1CB0A 1EX9A 1LSSA 4MPJA 3W4JA 4W4TA 2O8NA 4QRDA 4QG3A 4OP3A 2Q0XA 4LZJA 1ZM4A 3FYUC 1K27A 2C78A 2FSSA 1NDUA 4ID3A 3IP8A 1DHRA 2JHAA 3ZWYA 1XLUA 5HZHA 1D07A 3ABSB 2NGRA 2YJGA 3B1FA 2GJKA 1XZJA 3RS8A 2B8EA 2O2CA 4L50A 3TH5A 1RJ9A 3FH0A 4LY3A 3NI2A 5F5XA 3N2KA 2R79A 1W8DA 4AJ1A 4J8PA 4D9MA 3EC7A 4QRHA 3SIXA 5DASA 3ZE7A 3RHFA 1M1YB 1ZMOA 2JIQA 2QM7A 4UKDA 4D8XA 3RSSA 3A9UA 5JI3E 1VHJA 3RFVA 4PE5B 4MSUA 3OUZA 2VPQA 5AM5A 1ULBA 2GGSA 3O2JA 2HO5A 1ZYUA 3I05A 4H6XA 4ARAA 4B2PA 3DZGA 1E2UA 4O8CA 1O6BA 4XA8A 4CHTA 2UXCB 3ZDXB 4H0CA 1GKKA 3HB4X 1XD8A 3BXHA 4UCXA 3OAAD 1Y3FE 2JCGA 3L84A 3PI6A 4J03A 1YASA 3O83A 1F2DA 2ZGVA 3R5HA 4L4XA 1B1CA 2YHBA 5DPMA 3WIUA 1XVLA 4RPCA 4GP6A 2A35A 2IT1A 1E98A 5ALSA 4LF4B 4FYYA 4ND8B 3CINA 3K1AB 4LKRA 4C5AA 2O5VA 2ONZA 1RKQA 1UBRS 4M6WB 1YFLA 1V5FA 2DQSA 1F1BA 2WICA 4B2LA 1NVKA 3V7WA 3AR5A 1MG0A 2DCMA 3G2PA 4GT1A 2XB2A 2O2HA 4LVNA 2LIPA 4MW2A 3OOHA 4BRSA 1JBEA 2BOVA 2HV8A 3EFOA 2RMKA 5ICCA 2H0RA 1GPKA 2FSVC 2H59A 2Q5JA 1AUOA 1R0SA 2HMYB 3CUWA 3LLMA 4FYHA 4MQMA 1X7YA 2Y68A 4GM1A 3THSA 3NRJA 4Z49A 1DBWA 1JA0A 3HR8A 1CSEE 2WTEA 3EVGA 1XF1A 3HA5A 4I9NA 3TQCA 3VSAA 5KYWA 3NHMA 8LDHA 3Q98A 3PL5A 3DYBA 1KOJA 1IHDA 2FHSA 1YA8A 2FR8A 2P1DA 3L4SO 3QXJA 3DMTC 4MH0R 1HT0A 4TKUB 1BIFA 1R16A 3N6RA 3VOTA 3K4QA 2F1KA 4HQNA 1JQEA 3IQZA 1ZSNA 4TLEA 2DFNA 4CLEA 5I9IA 1BMFA 1Y42X 2ZWOA 4EM6A 4G24A 3BHJA 3HLTA 4OGLA 4C6TA 2CXUA 3FHLA 5DLPA 2BGIA 1FLAA 4FXPA 2PNJA 3EPJA 4QE3A 2WHYA 3JATB 3D8SA 3VR4H 3KLMX 1SCDA 4DJ5X 3L02A 2PUBA 1RP7A 5A3RA 1NNEA 2Q6TA 4KWCA 4M4SA 4RFSB 4RC9A 5A1TA 2BI4A 3FR8A 4L6CA 3PFGA 3KEMA 4P5EA 3F6PA 4NCKA 1NURA 2X9VA 3CY6A 2GD0A 4IDBA 3AEZA 3CKMA 2NAPA 3V4PB 1KMNA 1M2JA 5B2ZA 4JV5B 3BFKA 2R8ZA 2RGNC 3AESB 3S0JA 5DHTA 1QH9A 1C3JA 1LBEA 3SJZA 4Q3AA 3E53A 1RQLA 3I5UA 1N2ZA 1EEHA 5KOHA 3I04A 4KXUA 2DEUA 4ZCTA 1E4YA 4PO9A 4AL4A 1M67A 2XDQB 4Y0AA 4LOIA 1EUCB 4OHCA 4ZANA 1DC4A 2DSTA 1MLDA 2YS6A 2O0JA 2OV3A 3OZXA 3QEBZ 3H9CA 3FMOB 3DWGA 1XCLA 2DFTA 3MWGA 4PVCA 1WETA 1BWQA 1E1KA 4TT3D 1QFZA 5DDIP 1TKCA 2C9CA 3GIWA 1Y1RA 2WNIA 2AN9A 3GAZA 4MI9A 1L8OA 4J43A 1UT6A 4HUTA 1ZD1A 2QTCA 3RSZA 4H3KB 4CMKA 3ZDCA 2A7QA 1NW4A 1RYBA 1X8LA 2LCQA 3SE7A 4MYDA 3RE1A 1GT91 4PZCA 3U44B 5IJWA 1OXKB 1GNSA 2DHQA 2XHEA 1EVIA 2W93A 3VSDA 1EHCA 4HNRA 4N6NA 3OPQA 2WY2D 2IXEA 1DRWA 2GCNA 1GKUB 1VGRA 3A9TA 2QD2A 1FX0A 4MV6A 3THYB 3QWAA 1OH8A 2H5EA 4LGCA 2X2OA 3HN7A 3NB0A 2C92A 4MZDA 1RAEA 1VMKA 3E5NA 3JZIA 2LKCA 3MC1A 4NDAA 5EIBD 4ZKEA 2PJRA 3PKZA 2OQIA 5AOAA 2EZ4A 2ZYDA 4LRTB 4O4IB 1X74A 5KSOA 3W6NA 1J8YF 3TRJA 1Y9EA 1MX5A 5KX5B 4IIJF 2V7TA 1X80A 3LY7A 3ZWWA 1MP0A 1JMVA 1N9ZA 4FX2A 1AN0A 4LOJA 1KY5A 5JZVA 2IZOA 1QTNA 2H1OA 5KU1A 5KNDA 2QTNA 4L5IA 4WA7A 3CW2A 4A8TA 5JOQA 5ALHA 3EY4A 5HF8A 2DWPA 4HSGA 1Z0SA 3EPRA 2W8BA 3IIEA 2QY6A 4BP9A 1U5AA 4YRIA 1C0PA 2UVDA 3G8BA 2ZS9A 1QP0A 5K09A 3RVSA 3ZUPA 3ADPA 1D1SA 4KBYA 4MRPA 4F97A 1VBFA 5BWLA 5KJFA 4KYUA 4BBAA 3OCYA 4CM4B 3VYVA 2X19A 4Z3OA 2X22A 1RKXA 5A0VA 3VYWA 1BHO1 1K1EA 3KXIA 3K1JA 3H11A 2X2FA 2HMVA 3KTAB 1L5GB 4EWLA 4QU9A 5DN6D 1M5UA 2IUFA 2OV2A 1ZQ1A 5F3DA 4RE5A 1L5HA 4IG4A 3W77A 4B5KA 3STTA 4TQ9A 2YRXA 2ZJ6A 3BWBA 2CNKA 5LP1A 4NBTA 1ADFA 3RJ9A 1NW7A 2ZRJA 1KYXA 2W0MA 2NM0A 4BO9A 3F8WA 2HQSA 1JEQB 3T5CA 3LP6A 1SURA 4BE4A 2A5YB 2W4MA 5ILQA 1VJRA 2HCTA 3NHFA 4N5LA 1SBTA 3G9UA 4IIHA 4EARA 4JLWA 3AY6A 3K73O 4BVAA 1W87A 1Y3BE 3P4UA 4PFQA 1R4NA 2YKGA 4C5BA 1RHJA 4YJHA 1KQOA 4JODA 3U4GA 4BE9A 4OUKX 2GZRA 3GEMA 3L49A 3L6CA 4ROTA 1IN6A 3D8BA 4BN4A 1ZUNB 1S5PA 4BFCA 3GRFA 2PX2A 1JLMA 1HY3A 1X77A 2BPOA 4N5DA 1YKFA 4OQ4A 1AUXA 5E1DA 1Y6GA 1XYVA 3DR3A 4TZKA 4P93A 1XZBA 4BEWA 4G37A 2NU9B 1G2PA 3OM9A 4LRQA 3B6MA 4OB6A 3RWOA 4Y9SA 4CL0A 4NV0A 1QB7A 1SUEA 3N2NA 4ZVQA 1C8KA 4MRMA 4OHRA 3URMA 4DXDA 3WI7A 1UPXA 3N74A 4MA5A 3WNQA 2AK2A 2FMKA 1QDLB 3T1VA 5JD6A 3G5LA 3BGVA 3JZDA 1YZTA 2J85A 4D98A 1Y9JA 3ZDAA 1QNLA 1RXVA 4U7TB 2G0NA 2EBHX 3OZTA 4UZFA 3OU7A 1TA4A 1AZSC 5HZKA 2X40A 3GW8A 4U2CA 4MR9A 3TS1A 3L46A 3C1AA 16PKA 2CFCA 3U3JA 5B6JA 1GPNA 2O48X 2HU7A 3X2SA 2GARA 4MWGA 1TJYA 4PGHA 2FMUA 1V4BA 4GL4A 2OGTA 4N01A 4OUDA 3PNLA 5B1DA 2OYCA 4LRSB 2ZSJA 1BQEA 3BVPA 3UPDA 2CXQA 4TYNA 4BMOB 3EXEB 3TL3A 4R40A 3HU1A 3UXHA 2XB6A 1JFLA 2JD0A 3IC5A 3NV7A 5EMLA 2DHCA 4GNKA 1E2DA 2KWIA 3GVCA 2IL1A 3NIFB 4LZLA 3RYCB 5KQPA 2X58A 4BB0A 1EAYA 1KMIY 3IEIA 4KZPA 3W5AA 1VC2A 4JKYA 1SC9A 1V35A 1YI1A 1KERA 1E2IA 1PLJA 1PJ4A 1CVLA 2JLCA 2P3SA 3DG9A 3UMFA 2WK1A 1DTSA 3WMGA 2FSFA 1Q16A 3DL2A 4ZZ0A 1RXSA 3JWGA 4LDPA 4X44A 4I4TF 1W1IA 1Q7TA 3NOQA 5C3MA 3H16A 5BN4B 4BFXA 1DKMA 1Z36A 3E8SA 1IFXA 2WF9A 1QSGA 1S89A 4D8WA 3GEPA 1X2EA 2XY4A 1VB5A 3O75A 1H5QA 3L7KA 5HKBA 4UNPA 1YDFA 1V71A 1Y6RA 2V9PA 1PK7A 1Z4JA 4M0MA 3V4OA 4CCWA 1GAWA 1K2VN 1U0RA 1F9EA 1FVOA 2VN8A 2WOJA 3ENWA 3GB9A 3GT3A 4HH3C 4AJJA 2P9TA 2OQVA 4MUHA 3AR4A 3RJTA 1X42A 3FTEA 2WABA 4ODIA 3VFDA 2X8JA 1WMEA 3SFVA 2O3JA 2PSHA 3OLXA 3UWMA 5JYCA 3ONFA 2PIAA 3KR1A 4FYVA 5CB4B 4ITUA 3HFJA 2AUTA 2EBWA 2GKOA 5ENZA 4BZQA 1SXGA 2Q5IA 4OOFA 2BKUA 3BD9A 3CUTA 3L18A 4RY2A 1GQRA 1TRHA 4B82A 4U39A 4C4ZA 5E0OA 4DV3B 4GDFA 2D1YA 1XZQA 4G1VA 1X7ZB 4IDCA 3PDIA 4TTRA 4RESA 3ZWMA 2HX1A 2QK4A 3W5DA 2V7EA 3RC7A 5A02A 1I3MA 1P5JA 3IUBA 5FP0A 1PJTA 4FFOA 3L6EA 4IDOA 5EXTA 2ZJ5A 3IAAA 2FQXA 4K0RA 4RUKA 5ERGB 5KSWB 3Q8MA 4R8SA 4B47A 1DQZA 3LX6A 3UUGA 1ILEA 3OOEA 1GPWB 2B25A 3ORYA 2HR1A 4KVZA 1TGVA 1Z34A 1RE0A 2POQX 3DUWA 4PCVA 1V8FA 2BJWA 3D0RA 1VDMA 4L0MA 1FBNA 4AS1A 4RDIA 3AUYA 4YJ3B 3LC1O 1JLRA 2UXDB 3HXMA 3UH0A 2A5DA 3N6XA 1EHYA 2VZ8A 3OLCX 3VV3A 5IJ9B 2FN9A 2IW1A 3ONDA 2IOFK 4RA6A 3O8BA 3M0EA 4EVRA 3PC4A 1G4UR 1FS4A 3Q9SA 3E3MA 1QH8A 1WE2A 3F46A 2VOEA 2FEWB 2GS9A 1NMEA 1P81A 3DZBA 2JIDA 4J0EA 3R23A 4AM8A 4GGOA 3R7BA 5B7PA 1PT8A 3HV0A 2O06A 3I9NA 4GKBA 5HUJA 1R9GA 3E7PA 2JFOA 3VGPA 5JPDA 2CXNA 2YXEA 3KHTA 4YJFA 3J81A 3BHMA 1T8PA 1SQFA 3CO0S 2XKAA 4MIYA 2HQRA 3IR7A 2F62A 1ZVKA 3ICVA 3NTLA 1O94D 4B6FA 4YUAA 1PGQA 2RBEA 3WA7A 2FFBA 2YZKA 1VJ0A 2I4NA 2B4TO 4NZMA 4OQPA 4Z8XA 3GXBA 3QKSB 2X5XA 2GCGA 2ONYA 3LO5A 2X0KA 1USGA 4KSYA 2KBEA 4XB2A 4D41A 5ADHA 10MHA 3ET5A 1DJPA 1XN4A 1EM8B 4YY3B 1E2NA 3NTOA 4C3ZA 4POOA 3EXFB 4B8YA 1YVDA 3DBLB 4PBSA 2A9RA 5J5CA 1UWVA 1F8FA 1YZ3A 1OI7A 4UULA 4RH3A 4IEIA 4X9XA 1AZLA 3KELA 3EE6A 5TC4A 1Z83A 3UGTA 3W1WA 2Q5QA 4PW0A 1AOXA 1NBAA 1L5SA 2KPOA 2Y76A 4H4EA 4R05A 4H1VA 4Q6WA 3R7DA 3P5SA 4MP8A 1U2SA 3TBKA 2IQ5A 2NUPB 2AFHA 4M0DA 4CF6A 5IUKC 2HU5A 2GCOB 3PC8C 3OT5A 2XRMA 1XCGB 3NC1C 1ELOA 4PS0A 1XZPA 3T1YB 2CDAA 2VL7A 4KE9A 3FNHA 2IVZA 4N18A 3UYKA 3FTQA 5CXUA 1R6XA 4WFIA 1G55A 1PR0A 1Q1NA 2XWQA 1YACA 3AKCA 2BKEA 2TYSB 2VUIB 4LVCA 4RLSA 1PV4A 5I4CA 4OM7A 1ADJA 3E0QA 3AM1A 2VDVE 3JWEA 3D59A 4CVNA 1VI2A 1LZKA 1PAUA 1JLKA 1Z5OA 3AV0B 3MJ4A 4EY7A 5BVGB 2BHTA 1Z4LA 2FWNA 2PJUA 1FDVA 1J5PA 3K70C 2X0IA 1QO9A 1N1EA 1RRVA 4TXHA 5CRIA 2ZRLA 3J7TA 4MQBA 1XAJA 1QZXA 1Z5ZA 2ZIGA 4ROSA 1WG8A 4GM0A 5I9SA 3ROGA 3WSVA 1A95A 1U7HA 3G17A 4JBGA 3EGCA 2ZI7A 3JS5A 4YJKA 5IYZB 2O7NA 1VCIA 1YBAA 2AD1A 4KFCA 3VO9A 4P4GA 4HNAB 4CRWB 4WUTA 2HIAA 3QE3A 1FNBA 1TM3E 3R6DA 4NCIA 1GCAA 4AKSA 2C5HA 1RBQA 4BNJA 2PIDA 4R3UC 4G9EA 3B7WA 1IEVA 4JJ8A 4UBIA 5E6UA 3AOGA 2JGLA 1MJFA 2QGZA 3OX4A 3T7JA 3GJXC 3VR2A 4BCCA 8ABPA 3VPAA 5AI8A 2C2MA 3WISA 1A27A 3GOQA 3L7DA 4J16C 3S7TA 3N76A 2UYHA 2IZ0A 5CA0A 4IINA 1V95A 2ZBQA 4HAVA 3U9SA 3C1OA 2XA2A 1BX0A 3OP4A 1P8JA 1ZS9A 2LPMA 1QIEA 4OLBA 1WP4A 3RSOA 3MFQA 1MDBA 5DYIA 1ZJWA 1WXIA 5G0UA 5HJEA 3KOUA 1O4WA 2Z6AA 4CF4A 3ZI7A 4I6GA 3M1YA 1R3UA 1YCFA 5JSHA 5CDUA 2IYRA 4A6XA 4BMSA 5I8PA 3CNLA 4TN1A 1TU0A 1N3IA 2V55B 3AEQA 3VH2A 1FDRA 4EBBA 4EMSA 2A0FA 1ARZA 4MYHA 2BT4A 2RGGA 5F73A 3OOWA 3UXYA 5LXTA 3W8DA 2Y1DA 1KYIA 3VC7A 4MQ6A 4B3GA 5FNVA 1UMDA 3HP1A 1E4OA 1KKLA 1PGJA 2AMLA 1UC8A 2ZYHA 5ITSA 1OLSA 2HU2A 3NDPA 3GLKA 4LJLA 3T3MB 5A3VA 3V6MA 4EAAA 3HI4A 5LIRA 4I55A 3ETJA 3FF4A 2ERYA 4XASA 4YO7A 1LI4A 4Q9DA 1V25A 4EFDA 4DC0A 3H3XA 1IJKA 3T0FA 4XYMA 5COBA 1KH3A 1DZIA 1AN9A 1LW7A 3H05A 4F4FA 1L4YA 3EUAA 3LHFA 3IYLW 1US8A 1BEZA 4BBJA 5AOBA 3QLUC 2F9FA 5JARA 2CK3D 1ZH6A 5LZ2A 2VTBA 5CFMA 4YRKA 3FYTA 3X1ZA 1J0EA 1MGOA 3KXLA 4FGKA 4W1RA 1GM5A 2HU8A 1Y4SA 2ZUCA 2NO9A 4C9BA 4QKQA 3T1OA 3T7EA 4FW9A 1C3OB 4AWBA 1K88A 2OXCA 5K6AA 3H2KA 3PFFA 5L9AA 3AEYA 1IU9A 1SKUA 2X8AA 3DLTA 4V0QA 1E9CA 1JHPA 4UJ3A 2O2YA 4WBNB 2E4ZA 1DV2A 1EDDA 1FYWA 1HURA 4I1SA 3RK4A 1A8UA 1N6OA 2WLTA 4ZAVA 2LZ0A 5A7HA 3FVWA 2LCFA 1PZMA 4NAVA 4AMGA 4NTZA 4YREA 1LVGA 3JVEA 3CVXA 5IZCA 1OJLA 1J0XO 1QKIA 5EJ5A 1SWWA 3ELDA 1FDSA 4AO8A 1KEUA 1KQ3A 3OX2A 2UYOA 5FORA 3ZY2A 2IP4A 4DWWA 2YWGA 3H2IA 3F6CA 1G1AA 5DOZA 5EKXA 4JIMA 4RDCA 1G42A 5CM9C 4DNXA 2IHYA 1KVUA 5ALGA 5EEGA 1XZIA 4YC7A 3U48A 3ZYCA 4A4DA 4A8JA 2JFZA 2PUTA 1R0BA 3TQOA 1RAIA 3QMVA 2Q0HA 1CK4A 4GSKA 4N0MA 2HBZA 3GRVA 3UC5A 1JTVA 2XBUA 4MS1A 1USVA 3Q3VA 1XMVA 2RJNA 1UXHA 5M3BA 4RPLA 3U40A 3UJAA 1MQAA 2Q7DA 4QBGB 3AVYA 4CM6A 2H1CA 2OESA 1HRDA 1THZA 2IU6A 3DE0X 3A4NA 1XCPA 3EOZA 3MG9A 4GPIB 4F4UA 2J0SA 3JQBC 3JRNA 4PGAA 1VYHA 1NJFA 5M04A 2NVUA 3A28A 3L0OA 4LHXA 4WZZA 4KKVA 3E1GA 3COWA 1ZWLA 5KPJA 1N2SA 3FOWA 1ZL2A 5DH9A 1XKTA 4KWIA 2JATA 1OQAA 1Q91A 2BY4A 1KBOA 3M4ZA 1GPAA 4K6CA 3RV3A 4A9AA 4DLYA 4RZ3A 4RD2A 3PEFA 4K9QA 2WRZA 3R41A 4RIHA 1YHYA 5H8WA 1JQ3A 3SYTA 1YS7A 1BCRA 3N1UA 2VSYA 2I7XA 2C4TA 4UUQA 1DBSA 3O74A 4FXOA 1N3LA 5DISB 4DSTA 1DLIA 1O0SA 3A27A 2OZVA 3M9WA 4MUAA 2O2ZA 4QPDA 3U81A 3GLFE 1ZPDA 4BRZA 5JWRA 1J49A 1O1YA 2I2AA 2WUDA 3LRXA 3G23A 4M83A 5FBQB 3Q41A 5HOEA 1ZMXA 3O4VA 1ENZA 4NQZA 3RRYA 4FFSA 1U3GA 1BOOA 3V7YA 2WZQA 3CLTC 1EFKA 1ISIA 4M9RA 4OHBA 2ZJBA 2NU8B 4C2TA 3LA6A 1TAGA 4RQAA 2BR5A 1FRVA 4H1HA 1J8MF 2HSDA 1DT3A 1T1IA 1GAQA 3IXMA 2ZCVA 2XTZA 4FQ5A 3OC0A 1UP6A 1NMXA 5AI5A 4F71A 4CEHA 4XJVA 3B9RA 5D84A 2GJSA 3JWJA 3BEOA 3QA3E 5BWNA 2GHRA 4MQEA 3UFXB 1Y1SA 2PYIA 4IHJA 2B0CA 1GR0A 5FBVB 5BSTA 2VF4X 1YE8A 4PNHA 2Q2NA 5TJ9A 2NZVG 1CEYA 3BWVA 3EVAA 3U39A 4LSMA 3R7SA 3GH1A 1ZMBA 1VGQA 1PJ8A 1OX4B 4ZZ3A 2XQVA 1DCKA 3CNEA 5B3AA 3ISVA 3AOEC 5TR9A 2IV7A 8ATCA 1N57A 3KQSA 1OIWA 3O8OA 4BQSA 1Q92A 3N0TA 1QPGA 2D0DA 3ORHA 2OGWA 5CLGA 5EZ6B 4DDHA 1CQIA 5JO0A 3LQFA 4E4RA 4LFAB 1WZIA 2ZTLA 1TTHA 4U02A 3R0QA 1H9BA 3R3WA 1HDYA 2C99A 3DZCA 3M5DA 4OL9A 1XA4A 4B80A 2CW5A 3AM3A 3MBIA 3O26A 5BSHA 2CLHB 4NZYA 4XRRA 4ZP1A 1QGOA 3EGXA 1OYWA 3U09A 4LYFA 2CY0A 5AHOA 3Q72A 4ZZ2A 4BJ5A 1WBBA 1DKUA 1UANA 3PT9A 4Z9YA 4N41A 3REQB 1Z22A 3QOXA 4TV8A 5EE0A 1XIVA 1GSAA 1JFFB 5ALTA 4LCEA 1C0IA 5AKGA 2A9KA 2EVWX 3JWHA 1HF3A 4HFRA 5DWQA 3A9CA 1CIPA 1O3YA 4IIBA 5KKAA 5GIOE 1CY1A 1W4AA 3PXUA 4MXDA 1I7NA 1GTMA 1SQ0A 3PGKA 4IIVA 1YJBA 4BB6A 3CLKA 1U3FA 1EBFA 2HNBA 4PPFA 4D9CA 1S7CA 1IJEA 5LZ4A 2K7FA 3KSUA 4MAFA 3SBEA 2IYAA 4TL6A 2QAJA 1UT5A 4JLDA 5J40A 2XTJA 1C3VA 1DBRA 2EJCA 2JAOA 2XYPA 4BMDA 4IWNA 3EIXA 4DWOA 5F1KA 1V45E 1WPQA 3MMPA 1A2BA 3VYRB 2J32A 3L0ZA 4GO1A 2WJHA 4RJIA 4G63A 4DA0A 3ML1A 1UKAA 2FX5A 3GZJA 4RY8A 5KDDA 4X66B 1SVMA 4NESA 1ZK3A 3FMGA 2EL7A 4HGQA 4IKPA 1PUIA 1Q6ZA 2C2YA 3QW4B 5DBGA 1T6YA 1H9AA 4MAMA 3QEKA 4YCLA 1JEJA 4GX5A 3EMKA 5TGDA 1SEPA 3C7KA 5KOYA 2CJWB 3DKVA 3DXXA 3EXIB 3LDHA 4YQZA 3G2MA 3U3OA 4DMLA 5CBKA 2AJ8A 4KP7A 1RNLA 4JY7A 3KXKA 3L0PA 4Y2XA 3QITA 2QP4A 2EYQA 5LQKA 1JA1A 3DH0A 4MB2A 4PYRA 1HDEA 4TWAA 4DYDA 2EF1A 2OGSA 2QMZA 2ZG6A 1IZYA 5LZ8A 1KVRA 1GTVA 2Z3ZA 4I2VA 3SS8A 3V1TC 4BP1A 1HE1C 4DCMA 1U1EA 5JHHB 4IMPA 2BGNA 2W6JA 3V5NA 2A9FA 2BP7A 2GEDA 3HCBA 2RIRA 5HF5A 4IICA 3X2EA 3ANYB 2GZAA 3MAAC 5DEIA 5DZSA 5IAGA 5AKZA 4LF6B 1I9GA 3CUKA 4URUR 4UU7A 3X1WA 1NQUA 1Y5IA 2FMXA 4B74A 5KVSA 2XCOA 5GM2A 4EUFA 3BKWA 4IGFA 1G0OA 1ZJJA 2M6LA 5CCEA 1DO0A 1WCWA 2ZRNA 5KWSA 2M1XA 3OQHA 1I0LA 1FFBA 5A7FA 3SBXA 1E1DA 5G53C 2GZSA 4G0MA 1F51E 2ZRBA 1DBPA 2XYHA 3OMXA 1P72A 1VLZA 2HJGA 5JWHA 1SXJA 5CH8A 3TSWA 3MTJA 3V8EA 4MDFA 2WTMA 2Z6QA 3LK6A 3KZOA 4RQBA 2BHRA 2PT7A 2B37A 3TVTA 4RTQA 2R5WA 3EF0A 4RPGA 4P54A 2PT6A 2ACVA 2VHZA 2Y05A 4YMUA 3DL4A 2BFCA 2GBCA 2DPGA 4OU4A 4Q1BA 4TSKA 5H9WA 3BE4A 1SUAA 1DTWB 1KETA 1ACLA 1YFKA 1DO2A 1ZC4A 1ULSA 4HJXA 3TLXA 1XZDA 1YI0A 2WAOA 3INRA 1C3EA 1I9CA 2W2VA 4X71A 3S7ZA 4XVUA 4CLOA 1YIAA 4R1PA 2ZYRA 3G5AA 3FJYA 3WLMA 1JU9A 1H5NA 5H3LA 3BXZA 5E4TA 2EQAA 2XBMA 3NT5A 3PA6A 4LQ4A 2ZSAA 1APBA 1SG6A 1NR7A 2XA9A 3ZG6A 1CQJA 1CX9B 3G1WA 3FMIA 3AERA 2MSDB 2RAVA 4G9GA 4ZARA 1A9ZA 2X5JO 3FJ1A 2R6JA 3HFGA 3JD3A 2K5UA 1JFSA 1NQTA 3DAPA 3Q11A 1GUDA 4R1UA 5BNWA 3U1BA 2J3HA 2BKAA 3RYTC 5LQAA 1UZNA 3OTOB 3OFVA 2ZYGA 1G2IA 4GG1A 5IXSA 4M22A 3GEGA 4RPHA 3UMVA 4BQFA 1E2QA 4OJMX 2QA5A 3IILA 4PNZA 3ZHUA 2P9FA 2RE8A 1QOZA 4BVFA 3V2IA 2XUGA 1WIWA 1RCTE 2DM6A 1YULA 3QPVA 4R54A 4YLGA 2P4SA 3BD6A 5B53A 4YJGB 1Y33E 2GYVA 2ECKA 3ZY6A 1EK6A 2WA1A 3MTBA 3N7TA 1OV6A 4G8DA 2HD4A 3BQ9A 1MJGM 3GDFA 4U0KA 2JVIA 3VR3A 1EG7A 3HCOA 3G88A 4ENQA 1LTKA 4A1OA 5A06A 5AHKA 4B4WA 4EB3A 1TECE 2IOQA 4Y2UA 4HH1A 4XWYA 2VLBA 3RU2A 4DV0B 3NFYA 2DZDA 1MH9A 3DHYA 4QPJC 1XJCA 3ELYA 3HB5X 2BM1A 4KAJA 1H23A 1JLLB 4OQZA 5EZQA 2OCLA 4BO1A 3DL0A 3LU1A 3EBLA 4FOTA 5JZMA 3I6BA 2ZANA 5JQGF 1M5RA 1BKSB 1NQOA 4HAYA 4B31A 2RGCA 5AW2A 3OU2A 4GX1A 1I3CA 3IPRA 3DTVA 4V24A 4YJ2F 4GMHA 1HM5A 1RPNA 2AKYA 2QE7D 3LDFA 1R4MB 2VJAA 2J3KA 1XNRB 3ZDEA 2Y67A 4YCCA 1SVUA 1N2IA 1TDJA 2OL4A 4QIHA 3H84A 3EZ6A 5C5DA 2PQ0A 1CIJA 1YDWA 2XCLA 1DU4A 3GA7A 2R8RA 3OT1A 4NZZA 1F48A 3P2IA 4OK6A 1GCUA 3TZQA 4A73A 4DCGA 4EVQA 5K6AC 5L3QB 4A36A 2JB9A 3SJAA 1XNGA 4JLMA 5AK3A 4AKEA 1E2FA 1HE3A 3II6X 1O6FA 1MJGA 4G4IA 4MIEA 4TKLA 1LNQA 1NLFA 1U4SA 1ZVMA 4BKMA 3DMGA 1JT9A 1ACMA 4RK0A 4GPTA 2HCFA 3G82C 4MUXA 1Y98A 3AHIA 2GXSA 5EIAA 4EJMA 4XUCA 4OLAA 4CFZA 2HJ9A 3C41J 3DZ8A 1SB9A 2C8JA 2PA0A 3PEUA 4KUEA 4O4LF 4WCDA 5DYYA 4FONA 1V5GA 1W2WB 1GPMA 2AN5A 2JFHA 4P4NA 4P0QB 4ZRMA 3PZRA 1D8AA 3I39X 1W36B 3OEYA 4IQFA 1X1DA 4YGYA 3GCZA 4WZ6A 2AB0A 2Q8PA 4AJHA 1EXNA 2IYXA 2N9UA 4D3FA 1WKVA 4D25A 5H82A 4N7JA 3KETA 4LUCA 1ORVA 1KZ1A 4JYAB 4CKBB 4E5PA 3D7RA 3K5WA 4D92A 4OJTA 3VNUA 5ITVA 4AJ9A 2JFUA 5KVVA 1VLLA 2PSFA 3Q7PA 3ZTWA 3QOWA 3M82A 4R5HA 5IM4F 1RJEA 3EEBA 3GLUA 4RBNA 4EFLA 3BC1A 4TLAA 3N5KA 2NOAA 4X0EA 1VYVA 1LBSA 4PC6A 4BVEA 2XR1A 4QULA 5LNK1 2BTQA 4D8TA 1PW5A 2GPAA 5JAOA 1HEUA 2DJ5A 4ZAXA 2BEVB 3MB8A 4KO3S 1EDEA 5CK4A 1X1QA 2VVTA 3KV1A 3L0YA 4YRTA 5FTMA 5TEVA 3SAJA 3ZJYA 1R9MA 3LUKA 1CKEA 3QEMA 1W1UA 5FPSA 5IBPA 2HUPA 3I58A 1IQRA 1BEEA 3V55A 1C0KA 3VSEA 2HCBA 1UPTA 3WLRA 4NEHB 1RW4A 1RJGA 1WTAA 2EFEB 4PEVA 3A3YA 1M34B 1OMOA 1XEXB 2PGIA 2PNFA 4IGKA 5CU7A 3GELA 5EERA 1TZKA 1QIHA 1G41A 3QMWA 4AKTA 1H2YA 3WRXA 4V1CB 3U60B 4GC5A 1EUYA 1E7QA 4J4TA 3FKQA 1Z0UA 2R8PA 3HJFA 1W5AA 1Y1LA 5JNWA 2FFRA 3Q9UA 3SKYA 1PVDA 5HQ3B 3S40A 1Z0AA 2R6FA 2L42A 3QOYA 3M6WA 3RRZA 5BSVA 1DWQA 4JN6B 5F2OA 5EA2A 3JQ8A 2G83A 1FFAA 4KE8A 5E95A 5C1PA 1C1HA 2WJIA 1BDHA 1A0OA 1JH8A 3GVPA 2Y0BA 4FMBB 1R88A 4TXMA 1HXHA 2JGIA 1ZA2A 4KJZA 1KAEA 4S1WA 5DBOA 5HGJA 5C7OO 1S2NA 4UC0A 3BL8A 2BFDA 1F60A 4I1RA 3TQFA 4CM7A 1YDHA 2ZUUA 1DIOB 2IDKA 4LRWA 2CBGA 3W34A 1PZHA 3CTMA 5A5VA 3BSWA 5CFOA 2P8SA 5IJZA 3SF8A 1R15A 3W5SA 1WBDA 3FSJX 3ADOA 3CVOA 3HYCA 4RHYA 4EO9A 3HDQA 5BV1A 2YIJA 4UVEA 3TK1A 4KN8A 3V4VB 4YCNA 4BU1A 1VI5A 4JFRA 4CT0A 2P6OA 1H3NA 1XAGA 3HJUA 4RO0A 3R76A 2R6CA 4R8MA 4JUCA 2CHVA 3HS3A 3IV6A 2HO4A 2NNLD 3M2PA 1PGPA 2VUTA 1M73E 1IYZA 1T4GA 3UM9A 1YB4A 4HDKA 3S1SA 1RRFA 3I9FA 4XARA 4B3HA 4EYGA 2BE9A 3JSAA 1B93A 3DOOA 2MYTA 2C7QA 1LX7A 2P6MA 1OWMA 3N58A 1K3FA 4KMMA 2CJXA 1PS9A 4LY9A 2YZGA 4MQ5A 4OHOA 2PJDA 5H3CA 4F4DA 5IKEA 4PCLA 4JT4A 3S2GA 4XM1A 3MSCA 4O08A 1DOZA 4DUGA 3RYHB 3TIXB 1LDEA 1XWWA 5KPDA 2PGNA 2XNHA 1TLTA 3OSZA 3C3CA 3OQIA 1ZIDA 2XB8A 4JLPA 4WEQA 3VAZA 4TKZA 4OHWA 4X85A 4BX3A 2J45A 2Y1XA 5BYBA 1IE3A 2HPVA 4ALNA 1SUCA 1E1CB 2GI4A 4KC0A 1HYGA 1NGSA 4QXQA 2WFLB 4HMQA 2H4HA 2GSWA 4MROA 1IMOA 4DLRA 3GLGA 1RMQA 4BL5A 1WZ2A 2PL1A 3ABOB 2OVFA 1DX9A 1QC5B 4Q00A 3T5TA 1DUIA 1T36B 2JH9A 3TLKA 2Q5EA 1TTTA 1SA0B 1EP1B 1F17A 1L7OA 2DUUA 5CMLA 1KI7A 4HDNA 4P32A 1PS0A 3WDSA 3TZCA 2H1IA 3INNA 4XFJA 3R7WB 3Q8LA 1RQPA 1YQWA 3JVVA 4JVLA 4D9HA 1BXKA 1CR2A 4GUDA 3B6KA 2YBEA 3R77A 1U4NA 4BLWA 2DBVO 1JB9A 5I6DA 4ZDIA 3ON5A 4EB6B 3AUJB 3QMMA 3HB9A 1NJSA 3EMBA 3LQ1A 4L76A 1YAHA 2Q49A 3VI4B 4F4JA 4BUCA 5I7OA 2RBGA 3ODPA 5A9RA 2DBQA 4ZQEA 1JFTA 2DLCX 4H7JA 4RHFA 1R0LA 4ZT6A 1K63A 3U7JA 3QNWA 4BAGA 4QNRA 3AY7A 3T95A 1M5TA 1E8NA 3SP1A 4CF3A 4Y2HA 4UEWA 1F06A 2JC3A 3BDIA 3G7UA 1J21A 1KIAA 5H02A 5JO9A 4D9JA 4DKXA 4R71A 3N8HA 3G2HA 1Z4QA 5BQPA 4F9EA 4BFUA 1Z7GA 3BDAA 5FTJA 4N6OA 4LYEA 1ZINA 4Y2TA 1B3RA 5U1PA 1BROA 3LW8A 1LJ8A 3A1UA 3VAAA 5FUWA 3AHJA 4TGLA 3VZQA 4OKIA 4HUQA 3OZIA 4ID9A 2JFPA 4W5HA 2TECE 1YE5A 2NADA 4QOFA 1KBQA 3QVWA 2NW6A 3OPYI 3UPTA 1EX6A 1UC9A 1XCOA 5KAPA 3G7SA 2YUIA 5DM0A 2EFCB 3A0UA 3CNNA 3M3DA 3VRHA 3RV4A 1G18A 2XBLA 1TADA 1O54A 4WECA 5B30A 3THXA 5JR3A 5ALOA 1WQ4A 3WK6A 3B53X 3JZMA 3ANTA 5JH7B 3BRCA 1XQXA 3ZV6A 1A82A 5A5FA 5I4IA 1KYQA 3TZKA 3W6OA 1C9KA 1UDAA 3AGQA 2FLKA 3EN0A 1ZP6A 1MEOA 3EMVA 1YB7A 2WJPA 3CXUA 4H3HB 1NLUA 1P1BA 3U3RA 4Q3CA 5CR9A 2YS7A 4NMMA 5AK0A 5MGBA 3K8QA 2PRIA 4TRMA 4C7XA 4GR9A 2TMGA 3OHSX 3MZ0A 1ANKA 3VO1A 1AQUA 1L5QA 4B6PA 1Y9DA 4DRXA 2X6RA 4H9GA 1V7CA 2ENUA 5FL7A 1T35A 1P5RA 4A1FA 4C0WA 1NJGA 1VHWA 3IAS1 4J2TA 3U3XA 2JK0A 3EQ2A 3F6SA 1VJ5A 3A25A 3FHJA 3GPBA 4Q1CA 1VKHA 3RYFA 3T9CA 3U13A 3ICEA 3A3NA 3S1AA 5CEEA 3Q7SA 4CUJA 2VXBA 4N0PA 4DPKA 4P2GA 4UDOA 4CDMA 5EINA 3L8CA 1YB2A 1MH1A 3JASA 3D3NA 1P75A 3ESDA 3GU3A 5CT5A 4O2AB 4IP0A 1G5PA 2RC6A 1T4CB 4YFVA 3WYEA 4CM9D 2WHXA 3OD1A 1TQDA 2QAGC 4BS9A 4RKWA 1BYUA 3DLIA 1HDCA 3I2HA 3QVLA 4HADA 4MKHA 5CNIA 4R5MA 5KNBA 4MUBA 3KS9A 1FP7A 5JSZB 4ZZIA 5KC8A 3PR3A 4NQRA 3HKBB 2VT7A 1UQUA 5C1OA 3AUFA 4JLVA 1I14A 3W1EA 4CL2A 4FZVA 1XDDA 1FQOA 3SX4A 3KOZA 3QKRB 1NPTO 4JP5A 1ZKDA 2WSYB 5FOVA 2WQ6A 3OA0A 4QGSA 1TFUA 3WFIA 1UPCA 2Z6VA 2FEMA 4M8LA 5DLQC 1SVOA 3W2TA 4EHNA 1KEPA 1I7PA 1U8XX 4BLVA 2CL7X 4Z3DA 2ONJA 1T3LA 4J6EA 2MU1A 1FDOA 4C5CA 3D31A 4XLTA 5KHAA 3DV0B 1XMJA 2XECA 1AT1A 4IWYA 3UNXA 2O57A 1UFKA 1VG1A 3D7SA 3L4BA 1QHXA 4H60A 4XTRA 1XTZA 3HLKA 1FP6A 2ZKLA 4Q3NA 4M36A 4ZZ1A 4JJGA 4DZTA 4ZQGA 4MGYR 1CDDA 1W0CA 3N07A 3BCSA 1YJAA 1P45A 1TT5A 4K40A 1PD1A 1ZJZA 1DEOA 3HCWA 3IVRA 4YBZA 1BMTA 2QENA 4UBMA 5JRZA 5IT9A 2JGRA 1EIWA 2QMHA 3OEHA 4Z5XA 1KAMA 1U2DA 2AZMA 3AG6A 3BTOA 4HLCA 1P33A 2PV0A 3PNPA 4I3FA 4PLYA 4YQFA 2JPDA 3C5EA 3I1IA 2J33A 1OAOA 1L3CA 4OA8A 2VRCA 4PO3X 4C6RA 4Y9TA 3I5MA 1AK1A 1MOPA 2K2QB 4MKFA 5JANA 1JW9B 4Z0HO 2PD4A 5GP1A 1WW3A 2X2PA 4GXRA 4IF6A 4XJXA 4TT8A 2IYPA 3RVOA 4BO2A 1QIDA 5G1NA 2CWWA 4PLPA 3RH0A 3V97A 1U8CB 2JK1A 5T57A 2II6A 5A03A 2Z1DA 4IOJA 3OE7A 4IEFB 4MJXA 2Y0CA 1FDIA 2ZUSA 4CI9A 4JJ4A 2XNJA 221PA 3IVMA 3HEMA 5DX1A 4C89A 2Z5FA 1K8QA 1PW7A 2KLBA 4DQ0A 3BQNB 4CFSA 1SBYA 3JR7A 1O5TA 5ECYA 2WR8A 4LZPA 3WX0A 3HKEA 2HF8A 1SCKA 4MA4A 4CCYA 3BGSA 3FBWA 4GAEA 3SVTA 1BXRB 4FR2A 2H5IA 2ILVA 4B6QA 1EK1A 2Z09A 1W6UA 2I71A 3NLLA 3SFTA 1QORA 1BNCA 1D2HA 1IPEA 1DI0A 5HHTA 1SEVA 1RLJA 5AW3A 1NV9A 5K0EA 2PUAA 5ALDA 5L4NA 3QX8A 4TZTA 2HNKA 2YWFA 1R0CA 4AYXA 1R6BX 2A58A 4GICA 3WAJA 4LJ4A 1ULAA 3BTSA 1AU9A 2WFAA 1R50A 3K4HA 4FHGA 3SM3A 1THTA 3DT6A 4B79A 4I4CA 4L4RA 3VZDA 4D3DA 4MVJG 1EFTA 4G4SO 4DADA 2VP2A 4CMEA 3MTAA 3OJ0A 5TX7A 4BNHA 1J2UA 1Z68A 2V3WA 4P98A 4LY0A 3SQOA 4L4YA 3EPHA 2ARKA 1L1RA 1P29A 5IWAB 2PY6A 3K53A 3NHKA 4X54A 5CAEB 1RKUA 3RS5A 1QRSA 1AV6A 4JGGA 2W90A 1ECCA 1IB6A 5HM6A 2XMGA 2F55A 4QELA 2YZMA 1AURA 4WASA 1RIFA 1QF9A 2VYQA 1OXUA 3KYDB 4P7GA 3ZY3A 2HHCA 2RHBA 3WQSB 3EC1A 3NH9A 1ZGGA 3GP5A 3CR3C 2YVAA 1M8JA 2K4MA 1PJ3A 2EEZA 3T9BA 1UAGA 4KE7A 1BWRA 3MLAA 3U37A 3USZA 1HEIA 3TLGA 2IDZA 2GNPA 1ADCA 3TLCA 4BNFA 2VA8A 3KBBA 3FSGD 4WXYB 5JXJA 4B5LA 3P27A 4KQXA 1BX1A 5CJ2A 2PHZA 4YT2A 5JC8A 1OH5A 4ZAZA 1VKRA 5KNCD 1JLHA 3DXYA 4JU9A 3GUZA 4IDEA 1GZSA 3LOUA 2R4UA 5EWJB 1QFSA 4O4HA 5ALPA 4R8VA 3F2IA 3MMXA 2QVBA 3LKBA 1IAVA 1AS0A 1MJNA 3STYA 2HRQA 4NYJQ 4FQ8A 2XMCA 4ZFNA 4ISBA 4L7QA 4M9SA 4B85A 1QIKA 2VATA 3E3NA 4UM9D 4YP0A 1OA1A 4EJFA 2FPKA 4F46A 1S8FA 2E87A 1QFYA 5CH3A 4YH1A 3WV5A 4V1CI 4KX5A 5TMDA 4JR1A 5GPBA 1R0KA 4NMWA 1CUDA 2WWTA 2BFEB 1C5KA 1P9RA 4INAA 1HFJA 2FWMX 2XD4A 1VJGA 1SOMA 1EVZA 2VYND 4KRGA 5EJMA 3VC3A 1FNCA 3HCPA 3EGDA 3A1NA 5LQJA 2WU3A 1E3SA 2ZU6A 1ZGZA 4M2LA 5BR1A 3EWNA 3W9YA 4P7KA 4PY2A 1V4NA 3WFJA 5KQSA 3AVUA 2ZAMA 3H8VA 2JLXA 2YIMA 3IOEA 4A6DA 4DMGA 5B2FA 4YEDA 3RQSA 2OY0A 3CLTD 3E22A 4XIYA 1V26A 4N49A 5IBCA 2ZIWB 3FDZA 3ROFA 2V4UA 2EJWA 3FXAA 1SBHA 2W98A 3SXPA 1EWQA 3UHOA 2FWJA 1RYHA 1Y5LA 2FN8A 5TXGA 2WTUA 3GD5A 4WZBE 3TQSA 2I1LA 1O6ZA 3NZEA 3QFCA 2FP4B 1AQYA 3NUQA 3WL5A 1M6EX 4UNNA 3OESA 3VJKA 1DL5A 2BSAA 2BEWB 4EYKA 5LP6C 3F0TA 2HDOA 4IQ8A 3DVSX 1HTTA 4ZVOA 1UEJA 4OH7A 3P9NA 4HOYA 4EG6A 5BMVF 4JD5A 2X23A 4FIZA 1Z2OX 1DIGA 2I2BA 3AV3A 1RC0A 2A30A 4JSYA 1I4OA 4JUAA 3H1FA 4UDNA 1L7EA 2GA8A 3C39A 4IFBA 5BSGA 2R5NA 1KVTA 1ZD2P 3PUKA 1P0MA 4KPUB 4M0CA 2XTMA 4Q24A 4EGSA 4GBJA 2PKQP 5DXAA 2GRJA 3AZPA 1DPGA 3LO8A 5EVJA 3KSAC 1W2GA 3DQQA 2F1IA 3DVQX 2AUNA 2C4NA 4BQEA 5EPOA 3P9SA 1DLJA 4O2LA 3UBTA 4LZWA 3LH5A 3L79A 1RZ3A 1JWBB 4DLBA 1A2OA 1F2UA 4OEHA 5ALQA 1P1RA 1QQ5A 3LPMA 2M32A 3WGNA 5BVHB 4P5PA 5CHYA 1PN3A 2O0LA 4YNBA 4AXXA 1NQVA 1U9ZA 3PNBA 1O8CA 1DUVG 1XC7A 2ZJ4A 1LD3A 4M7WA 3M8KA 3OTWA 3HDVA 4HLUA 2PGLA 2XF2A 3ZTTA 4PICA 1CJVC 3CUYA 4WA8A 2W9XA 2HMUA 2NO7A 3WZ2A 4FTWA 4CM8A 5I7EA 3NP7A 1XCJA 2JLQA 3C87A 3MXOA 4FD2A 3ZE6A 2VUSA 1GIAA 2R44A 3IODA 3IEMA 1LJLA 4Q9HA 1W88A 4RHTA 4Z7QB 1HOXA 1KJZA 1U8FO 1VA5A 1RM0A 1T2DA 4YRRA 1POXA 3T3EA 4YP5A 4DLUA 3T5GA 4Z2YA 3EBPA 2Q2VA 3ZHYA 3PITA 4FCCA 5IABA 3WAGA 1QU2A 4CQMD 1V4VA 4NPHA 5LWQA 4JVMA 4Q19A 5CDGA 3SZRA 5AW1A 1P4HA 2ALJA 4PFSA 1I30A 1II0A 2ONKA 2ZTSA 3ILVA 2J6IA 1NULA 2PU5A 1X8KA 4JMLA 2R96A 4O2BB 1XRSB 5CNKA 5K6TA 3MUNA 3WGOA 4YT5A 4E2XA 4FYJA 1GGVA 4JXKA 5KJEA 3P20A 3S99A 1ZC3A 3S81A 2C61A 1I01A 1U2GC 2L19A 4TV9B 1JE0A 3CX7A 5CTAA 4YPOA 3HVKA 3ZHRA 1Y9ZA 3RABA 3C6MA 5TMPA 4KR7A 4URZR 1PEKE 1D6MA 1MC1A 5AJTA 4GZ3A 4L9RA 4QBHA 3NVKI 3ECCA 3EHDA 2PTGA 2Z5VA 1QX3A 4NBUA 3HQ4O 2P3OA 5CVCA 3QWIA 1RYNA 1ODKA 4ZOLA 1CP3A 1OI3A 1FP4B 2IPXA 1Z6TA 2GCIA 2EP7A 4NV1A 4DLPA 1H1DA 2WYWA 3AU8A 4BQOA 3CH6A 1TCAA 1T9KA 1TD1A 5JJ5A 1LEHA 5I7RA 3HVUA 2AOTB 3AJ8A 3PG5A 4R3NA 1SK8A 3TW4A 1YMQA 5LQUA 3NAZA 1R12A 3Q87B 4RLFA 5AYVA 3WK5A 4LSGA 3AYXB 1Q17A 1RWWA 2P9GA 3KFLA 4ADSG 1H22A 3K0SA 3M3HA 3FMPB 2Q7OE 1NYRA 5KNCH 3O1JC 3A7EA 4EF5A 2R3SA 2ZR9A 3KK0A 4ZODA 4PTZA 2RC5A 1GU1A 1RLTA 4WCVA 2ZPTX 1YJXA 3M1AA 4JC0A 2JCBA 1H2WA 4K2HA 1QHYA 2DF8A 4N65A 1RBZA 1FQJA 3QLJA 4EUNA 5FWYA 2V96A 5FDFA 5FA5A 5BOSB 3HMKA 1THGA 3A1WA 1E6KA 3DHVA 3MPUA 3OF2A 4I36A 4N7BA 3PI7A 3F1KA 2EP5A 4Q12A 4TQGA 3FGZA 3KOMA 2IXFA 2PQMA 2SKCA 4X3OA 4BVLA 2JZCA 1PR2A 4RVSA 2OV1A 3ROZA 5SY6A 1GRNA 5I9TA 3NGMA 4EYQA 2PGAA 2AKEA 4L4SA 2QVGA 4YECA 2QL5A 2NX2A 4PG7A 1VPEA 3DPUA 3TEFA 5D85A 1JYEA 2HPHA 1R6DA 4H7DA 1MOQA 1U81A 4MVJM 2OB1A 5DCYA 5LN1A 3ZOKA 3Q6MA 3CX6A 1FZQA 3D8NA 3FFTA 3GJ7A 1VB3A 5EMNA 3PGJA 1E4EB 2E2WA 5F77A 3WMXA 3IQIX 4LWOA 3HKDB 3E84A 2GTIA 2HCRA 5GADl 3CO5A 2GK6A 1QB8A 1OC4A 2I6GA 5E9QA 4CMIA 4IOKA 2B8NA 3KJXA 1AKTA 2F90A 5JYEA 4W5NA 3OQNA 1XCBA 2IYZA 1JG7A 1USUA 1D6SA 2XEDA 1YIOA 3H2JA 3QJGA 4LOKA 1E6CA 3EZNA 4FINA 1MOZA 1T8TA 2YVKA 5EYPB 1P0IA 3ZCQA 2QV0A 1CUCA 4GZMA 3VPSA 1J09A 2IU3A 3ZCUA 2XZOA 4J9UE 1PSWA 2LXNA 5FV7A 3ZNQA 4CIXA 2WWRA 4DIDA 1VGVA 4MHSA 2X15A 1WWKA 1XZFA 4ABTA 2HN9A 3SHTA 4KRFA 2PX3A 4J1TC 4MV9A 3O9VA 4RZQA 3IX7A 5F3RA 1P2DA 3ORSA 5DNWA 2PBZA 4KUGA 5J2UA 1Z45A 3L1JA 4UNIA 3R2JA 3ADCA 3BYZA 2NG1A 4YAUA 3F3MA 3UWKA 2HF9A 3F7TA 2NO0A 4FMDF 1TM2A 2Q9UA 3OKPA 5SY4A 4X1YA 3UW3A 2XYGA 1D2MA 2ZPAA 4MV4A 3IUMA 5BT8A 1GAEO 5T6BA 4CLXA 1MRZA 5EL0A 4RACA 2D1QA 3LKZA 4S12A 1VCHA 2CUNA 3GCXA 3ADKA 1UUFA 4D6YA 4ARUA 5AW7A 3K9CA 1Y1TA 2WWHA 2XNDD 2CE2X 1PJZA 2FXIA 2P79A 1RE1A 2YBDA 3OIGA 3OQBA 2QTLA 2PUFA 1GLVA 3HUDA 2E4VA 4M1MA 4R01A 4E13A 4AMUA 3DEAA 1T10A 4GU5A 4OO3A 4ALLA 4XPIA 2CXRA 4V39A 3ZI4A 2IU0A 4A10A 2X0FA 1FF9A 3Q3CA 2GM5A 3DEFA 1EE2A 3CVUA 2R84A 4KODA 4BZWA 2AXNA 3CB4A 2O7RA 4QLBA 3AP2A 1T9DA 2DT5A 3F8TA 4FFPA 2Q8NA 3AI2A 2PH5A 4KMRA 1XKQA 4LQCA 5HGXA 4QFCA 3MJDA 4JKOA 4E2ZA 4FSHA 4OMDA 2OOKA 2PRJA 2RB4A 3E82A 3WL7A 1XTKA 2FN7A 3ZW7A 3K5HA 1SAYA 2GSDA 5HS4A 4CJXA 5IJXA 1E9BA 4RVOA 3KPUA 3ES9A 1VPDA 3OFSA 1H3EA 3BIXA 1Y7TA 3WWYA 2Y27A 1GNQA 5JDIA 4M6WA 4DDWA 1LK5A 1B3BA 3KYJB 5IN5A 3ZGYA 3FCEA 3LSTA 3AB7A 4AG6A 2Q07A 4DV2B 3UY4A 4PIVA 2ATXA 5KTSA 1SBIA 2XYQA 3AO0B 4RMJA 4MITA 1FP2A 3KKEA 4KXWA 1KS2A 2YWCA 2L82A 1GHTA 5AW6A 1I5OA 4MI1A 4KV7A 2OP0A 1SCUA 4CG0A 4UNQA 4BDTA 1G7SA 2PX6A 2Q3JA 3ODGA 3T7IA 1M6WA 1I1NA 4QD3A 4RWEA 3LDAA 5DNAA 4DDVA 4GYWA 1JVSA 1LLDA 3KLOA 4OHPA 3DJFA 2J1LA 4DRZA 4MKGA 1IXRC 1NXXA 2WB2A 4AJOA 4MJLA 1CUZA 1JHOA 3PQ6A 4MQ4A 2HA4A 4PHCA 5BWMA 1B42A 1MAVA 2PKYX 3MYYA 4REQB 3BPSA 5ALLA 3ZU6A 2HWUA 3HCCA 2RGWA 3WRWA 3WGIA 1PWXA 1XV5A 2VJKA 5F64A 4HHEA 2WB4A 2ZB2A 1I7QB 3H18A 2V6IA 1NMZA 2RIPA 4NG5A 4EQ6A 3B7PA 1XJWA 3SJUA 2J5KA 2QJTA 4KQFA 4BXOB 4K9PA 4WCFA 2LV8A 1L4FA 2YN0A 3D4NA 1DG9A 1T3SA 1PDWA 4RFSA 3LYLA 1RHUA 2PM8A 5CXQA 3E1KA 1K75A 4ZVLA 1D1TA 4GMDA 2Q50A 1OFGA 1FB5A 5AJWA 4BO0A 1D2GA 5K4GA 4V0LA 1ZH4A 3QXGA 4Z9BA 4E5YA 1L5MA 4HFMA 4WQMA 2HK9A 3IELA 4G4JA 4HZUB 3W6UA 5ITZB 2YCBA 4YRQA 3K0FA 4Z4EA 3LUCA 2ABWA 2DQKA 3D6MA 3LOPA 4MQFB 3U7RA 4DA9A 2P65A 2XDWA 4EK9A 3K70B 2XDQA 3LBNA 3NIDB 3M3PA 4QFBA 3PUXA 4TSFD 3M81A 3VNVA 2HKIA 1I2MA 2YR0A 3F9IA 3FLMA 2M98A 2GEFA 4EA7A 1F6DA 3VR0A 4GSLA 3WHKA 4XWWA 3L7CA 4JXZA 3LYAA 1NWCA 1AXGA 4UM8B 2B78A 2RB5A 5FLKA 4ZC8A 3VU9B 2VHJA 5JAPA 5KKCA 2PXAA 1KBZA 3M6FA 1VKZA 4N3GA 4NYMQ 1YK1A 4PBTA 1X9IA 2PSJA 1ZIYA 3DGFC 2ZRIA 2BFAA 2FVXA 5HK9A 3FYCA 2JA2A 1T5LA 5JECA 1QRRA 2NQ2C 3TSZA 1DRVA 1EWKA 2EW8A 2QVXX 4HH4A 2FOIA 2IPMA 4S24A 2YW9A 4PM4A 2J5XA 3GN1A 1E1RD 2UDPA 4OGKA 4V0SA 3GPLA 2WG2A 3JPWA 4MPTA 3EYAA 4WOBA 3TW8B 1DOHA 4JOSA 2ZT6A 3ECSA 4EJ2A 2OO3A 1J8VA 4RV9A 4F5DA 3ROEA 2JFWA 3ACCA 4WXMA 2I4MA 3TWOA 1NTOA 1C9JA 3GFRA 4G8CA 1RR6A 2PSSA 2HFKA 4B4UA 4BNLA 1TIBA 3DHNA 1UXKA 1MQ9A 2AJLI 3GCWA 1MO5A 1SOAA 3GROA 4O4IA 1KC1A 3RLIA 1F9AA 4KACA 4Q4LA 1ZXLA 2ZE7A 3O31A 2CDRA 3G0IA 4NG4A 1GFWA 3GLRA 5L3SB 5CDTA 2HZ7A 5TQ2A 1NJ8A 3ILHA 4OMCA 4C7OB 3N8DA 4P4LA 2CE7A 1TT7A 1KJQA 3UMGA 3V1NA 2GHIA 4KYTA 5D3QA 4Z9FA 1T2UA 5TLSA 3DAFA 1WKBA 1M7HA 4JASB 5K0GA 2CN1A 2HQ1A 1RWOA 3CSDA 4YCAA 2GEKA 2JW5A 1RXEA 1GTJ1 1XXHE 1VHQA 1CB7A 1RM5A 5JJLA 3R7FA 1Z6YA 1N7GA 2J67A 4NCAA 2FB9A 2H7VA 5IARA 4S1TA 3SC6A 2QMUA 4ETNA 4F85A 1HT3A 4JC8A 2PZBA 4KQEA 4L9SA 1RC8A 3HDHA 1NW5A 3MWLA 2JLVA 1W75A 3CX8A 5KYVA 1QYXA 2OCXA 1PK9A 2XT6A 3ZW8A 3O3NB 4YRMA 4EY6A 1UPAA 5SYAA 1OROA 1OXSC 1RS0A 3KTAA 1Y8RA 3PDCA 1B73A 2XWJI 4PHHA 4C14A 3V34A 2IV3A 5CNJA 5KDOA 3D2AA 3I52A 2H5LA 2MTBA 1M2VB 3I9JA 1M6VA 1N5RA 5AKLA 3WLNA 4L5CA 4P86A 2XI4A 3W2GA 3GFBA 4AZ0B 4G0OA 1YA6A 3QWBA 3IO3A 1U3WA 1SN7A 4G97A 1LLFA 1XP8A 2PD3A 1M0TA 3C74A 1N1DA 2IZ5A 1PWHA 3NHYA 4JL8A 4EABA 1TJ4A 3BG5A 1MEEA 2V6MA 3ER9A 1B41A 4JQZA 4ZEVA 4Q7EA 1Q0ZA 4C4XA 3C6BA 2A84A 4FZ5A 2C9ZA 4MMXB 3RFUA 4YMVA 3HA2A 3QW2A 2P7IA 2ICAA 5U4QA 4U2KA 3CBGA 4DR4B 4OMUA 1KDVA 2B21A 2G70A 3N8NA 4MW0A 3WNVA 1R0XA 4DLWA 3OICA 2AH5A 2B3TA 1N2JA 2I34A 4WLUA 4URVR 2IXGA 4GZLA 5C4GB 5JYBA 2F64A 3MF4A 3OH8A 5CDFA 3ZWQA 1P1CA 2JZNA 1R00A 1XHLA 4EJ6A 1VIVA 4G1UC 3C16C 4E33A 4HFNA 2B1IA 4IIFA 4WZBB 4KNYA 4KQ2A 2YL2A 1NI5A 4IIJB 1PZEA 2GA9A 3H9JA 3NEAA 2CHEA 1PBTA 3I9KA 2WJYA 4Z7OB 3GVXA 2CLEB 4TMXA 1VHTA 1ZX1A 3TOXA 4F5ZA 3U6KA 4DA8A 3WHIA 4M76B 3UMYA 4MUYA 3HG7A 1G7RA 1YR8A 2BMDA 5JEEA 5FQNA 3QKWA 3EAQA 3ROKA 4UM9B 2EJVA 4YASA 3HJNA 4H1TA 3KP1A 2D59A 1SD5A 3HO6A 1H0HA 2XVMA 4UAVA 4KR9A 2C7GA 2E89A 3PQ5A 4HN9A 4K6HA 2ZUTA 2IS4A 2BFNA 3M5PA 1JLSA 2J6HA 2VYVA 5KVAA 1TIKA 3RADC 3I3OA 3FWYA 4FHZA 1J00A 2QTHA 4W8HA 3TE7A 1DKRA 4IY1A 4AXBA 3BZWA 3KJNA 4F06A 3VDMA 1G3MA 1RRPA 2DH5A 3G0OA 4B09A 5IAKA 4UBNA 3FOAA 3QWHA 4C4AA 3R20A 4D9IA 4LZAA 4NEGA 4OXYA 4XQ0A 4Z4HA 3BB3A 2I8LA 2OO5A 2H1WA 1F8YA 1JDJA 3UAVA 2CLMB 2FMHA 2I8CA 3PENA 1CULC 4N82A 1HK7A 2FW7A 2PUVA 3NJ4A 3OQ6A 4IH1A 3UF0A 3KEQA 3SQXA 4PRLA 1H4SA 4FLFA 4GPAA 3RTGA 1QF6A 4GOXA 2DLNA 3MJVA 2HT1A 2OK7A 4EGJA 5BN4A 3U17A 1LZLA 2D7CA 3W7AA 1K7EB 2DUWA 4Q9KA 1DE0A 2Z8XA 3WIVA 4CNQA 5A4JA 3B89A 5BN3A 1JQJC 2ZZMA 4WPGA 4CTJA 5I7UA 1M2OB 1UWLA 3VNRA 4DLZA 4OFWA 3RUPA 3ZOZA 1ZITA 3D0QA 3I32A 3C8DA 2L0XA 1JIJA 3MTDA 4FFNA 1AGNA 4AICA 3THWA 4HXYA 3V1MA 1UKEA 4OP1A 4QX6A 5AVQA 2MSKA 4ZHQA 2YRWA 2NTYC 1JALA 4FWIB 1DQSA 1P9LA 1C4WA 1V8PA 2GQ0A 2HSEA 2VZ0A 3A4MA 2ZRHA 5CVJA 5CB4A 1U0TA 4KQ6A 5F9HA 1L4EA 2HK6A 4I4LA 1GSOA 1U5CA 5FPYA 4OB8A 2C4WA 5H70A 1XHEA 1QO0A 1ZD3A 4YMTA 3DCJA 3G2NA 1U7WA 3M89A 2BZ1A 3T5AA 4JDPA 5JROA 2GYYA 1DELA 2LKDA 3RHZA 1JU3A 2ZR0A 4HX9A 1SHZA 1O08A 2Y3IA 4BNUA 4RKEA 3K2EA 5IM5A 4DN6A 1U8ZA 2ZRDA 3KLBA 3USCS 1JTFA 2H07A 1C8BA 3WK9A 5KZMB 2YRFA 1R6AA 2OHGA 2YHUA 4U5QA 2OAP1 4BVBA 1NTRA 1ZW1A 3GT4A 2NV6A 3WOHA 2CFSA 3WYAA 2AVNA 2KYRA 5HCNA 1SUFA 2IBSA 1XD2B 5JJKA 5AK6A 2ZP1A 2B82A 4RY9A 2B4AA 3C6ZA 2X8LA 4ND4A 1QRUA 1U8YA 3UJ9A 4XVHA 1E2PA 1P62B 2OXRA 2ZDHA 1Q11A 2V4MA 1VG0B 3F6YA 1JDTA 1PVOA 4BC1A 5HR5A 3ZH9B 5KYUB 5DLYA 2VHYA 5E1MA 2DRIA 1N4DA 1U0LA 2XE4A 3PPIA 5TVKA 3PNOA 2OCIA 1YGYA 5B1EA 4PPGA 4KQGA 4KX3A 1IC6A 3HBAA 5EXPA 2I2WA 2CB9A 1U7XA 3F5QA 2ST1A 1O8BA 1Y34E 1P1IA 2UZAA 3MOIA 1GNRA 4I4TB 4WOJA 3U1VA 4C78A 4RTKA 3OLZA 1I6MA 2WUFA 3AETB 1VKJA 1A3CA 4QWWA 3VNSA 4CW7A 1EZZA 5T5QA 2QI9C 3BREA 1CHDA 3ROMA 3UMBA 3AQ4A 3KAPA 4ZK6A 4JBHA 1HO3A 1YS4A 1S0UA 3LL7A 4PYLA 3QKSA 1KMHB 1PNQA 4FYXA 5FPQA 3BUSA 1EVQA 3EVNA 3GJRA 1ZN9A 4Z9AA 4QUDA 4ER5A 4PYJA 4QBFA 4DW8A 1EX7A 2D1FA 1AF4A 4C4TA 4D2IA 1UXOA 2Y71A 1KPIA 5F2EA 4BMNA 2XQJA 1GWNA 4ZJYA 3CBQA 5IJ0B 3U4MA 1BYIA 1JZTA 1O89A 4EBFA 3I9LA 4N12A 1KTVA 4DEVA 5A2QA 3EARA 3BMNA 5I5GA 5F1OA 3CVVA 1PJBA 4Q9NA 1SQ6A 2SHKA 4YP6A 2OCBA 1EX1A 1H6DA 1X39A 1DDIA 1W0JA 5FD8A 4B2YA 1PYDA 3C2QA 3VTFA 4OQQA 4C7BA 5IASA 4LXXA 4QDJA 5LOVF 2V7UA 4HXEB 4FS8A 4N4AA 3ZQKA 2G40A 2FJPA 1B7GO 1NLYA 4H15A 1XDBA 2IOHA 1SM4A 1L6RA 2VDMB 2XNCA 3BCUA 3O2QB 4BQQA 1SKMA 3QYPA 2QPOA 4UM5A 3NVAA 2FW0A 4YUWA 1KK3A 2O1SA 2HDHA 2VQDA 3B3JA 2K6GA 3HADA 3OM0A 2D1RA 2RKWA 5J5VA 3T4EA 3VR4A 2R1VB 1WEHA 2CL6X 4TMZA 4EPYA 4PQYA 3IVGA 2EF0A 4I5EA 3ESQA 3AWIA 4LTNA 3BULA 4TWRA 5K20A 2B8JA 1VJ1A 1C3LA 4GBED 3W9UA 5CCBA 4M8IA 3D8UA 2NWQA 3L1VA 1C1XB 2JFGA 1HYEA 3M6MD 5JG7A 2FR8C 2FPIB 1DFGA 1YZQA 3ZIUA 4GOMD 2JFQA 1ISHA 2ZI3A 1U6KA 1BDIA 1YVRA 5F1YA 3O8QB 3ZXUB 2I54A 4N0EA 3ABIA 4NHEA 5IYZA 3FG9A 3PYMA 4O0MA 5DM4A 1GL9B 5ALWA 9GPBA 2ZRPA 4QUGA 3NWBA 2XCQA 4AS3A 2X4LA 3RBVA 4PSVA 3JVUA 3V2GA 3HBFA 2QZ4A 1DEHA 2I7CA 3KR9A 1B0AA 4S2UA 3TG2A 2W22A 1J2TA 4ALMA 3SPXA 1QFXA 3FCSB 4H6PA 2W6OA 4P4SA 4BEJA 5LXTF 3T4XA 2X0RA 1V6AA 1PG5A 1YZKA 1M8PA 2ZE5A 4I4IA 4WKNA 3QTTA 3AR3A 5FNVF 4XIIA 4TZ0A 1X14A 2IHTA 2WG1A 4HRXA 2FETA 3PQFA 2GEJA 4PIMA 4QQFA 2HXYA 1ZRMA 1F3OA 2F9MA 1VG9B 3OJFA 4EPXA 1NN0A 4RGVA 4I55F 5B7GA 4ISCA 2FNAA 2JFYA 2Q3MA 5DI3B 2VXCA 4WKGA 3LA8A 3ID6C 3BE5A 2ZBGA 2VZ9A 4XYEA 3RROA 2DT8A 3RG2A 3V3TA 5JS8A 4K03A 4GNRA 4CDGA 4RIFA 1YSCA 1OI2A 1TUGA 3HJAA 1T24A 4L15A 4U7JA 5CHEA 5ABPA 1RRGA 2R62A 3VBCA 3FCOA 3BXPA 1GXSA 3GMTA 2BIFA 4WJZA 3CPEA 5B36A 2ZWIA 3HACA 2ZI9A 1JEDA 2PXHA 1C9NA 5E3IA 4DIBA 1PJCA 2VNHA 3BIWA 2W2NA 1RXYA 2FZGA 2H7XA 2P5UA 4L3OA 2BMWA 5DX0A 5DXFA 3R3JA 1NVAA 3TOCA 3VTAA 4F5EA 4F6LA 1I8TA 1MAWA 2BMFA 3Q8WA 4OLJA 3TO5A 3GA0A 2PBFA 1EFHA 3UT5A 3NWEA 5HDBB 3ZIAA 2EEPA 2AFIA 5JXGA 1WB4A 4KN5A 4M9ZA 4Y67A 1N25A 3WKAA 1RYMA 4K6GA 1IPFA 1KC3A 1AGRA 5IVHA 4EUHA 4BO8A 2VDUE 1OYOA 1D2CA 4UU8A 1QK5A 3QUAA 1E7SA 2HWKA 3DBOB 4LXQA 2OG2A 5C8XA 2CLOB 3L7MA 4RORA 5FADA 1T9GR 1BCSB 1FQKA 2NZWA 3B6IA 4EELA 1V1RA 3DFFA 1PLKA 2XT0A 3ZLVA 4GLBA 4UCQA 9ATCA 1T0HB 3REGA 3BWXA 1XPOA 2XCRB 1VPTA 4YO8A 2ZIVB 1X1SA 1H5UA 2OV6A 3JYNA 3LTNC 3JQAD 3BSFA 3PF9A 3AB3A 5KSZA 5BV7A 1H3FA 2QRVA 2J5RA 1G60A 2RKOA 2BHNA 2Z9CA 2BKLA 1XELA 4HDMB 1GPYA 1TEVA 2AUMA 4DBZA 3UJNA 4DMHA 3RFFA 3N6VA 3VZCA 3AIOA 2FSIA 1U1FA 2MINB 4J29A 3V8NA 1PYGA 3CUUA 4K5QA 3IEPA 4DAEA 2J3QA 2PZFA 2VDWB 2V98A 2ECFA 3KOYA 3OAAA 3U4AA 2ZJ3A 1JSLA 2AFRA 1ADBA 3SSMA 3VR6A 3KB2A 1BS9A 2HHLA 4HX2A 4QOIA 4JI3B 4BWVA 1SXQA 1EB8A 2O14A 3FUTA 5HZGA 2E6KA 1NG9A 2J08A 4BX0A 2QL7A 2P69A 1I32A 3UOWA 3NBMA 4LJAA 4C2BA 4DF3A 3IH5A 1GRQA 3QLVC 1JNXX 5G0WA 1Z7YA 2BD0A 3C8ZA 4NU0A 2Q4EA 2QL9A 4BX8A 5LYJF 4KFTA 4IZ6A 3PLRA 4QJ5A 5T41A 1PL7A 4J3NA 4OL0A 2ZB8A 1UBEA 4ARBA 1GG5A 4QNMA 3ROPA 1WHSB 3UJ8A 5IUNC 4X1IA 1M10A 2ID4A 4P58A 3MJFA 4EZIA 4MRSA 4FK8A 1KXZA 3JQDA 4YJDA 1L4MA 3CXRA 1TMOA 3D54D 4KQHA 2QZPA 4JP2A 5T64A 3RSLA 1JJIA 3BJMA 3SE0A 2C7BA 6Q21A 2AFHE 1IDN1 1ZVJA 2OAEA 1X7XB 2I55A 1LPPA 3A2KA 1QGDA 3TD9A 3L7IA 2W37A 3HCFA 4WIAA 4JUDX 4ZREA 1KGSA 1IEQA 2O6LA 2XGGA 2GF9A 3TNLA 1CLEA 5ADWA 2DJIA 5EJ8A 5JE8A 1P0PA 2ACWA 1E3MA 1II9A 1IEWA 1ES9A 3ESZA 1C30A 3QVSA 2OBLA 3C3BA 4IHJF 4AI6A 3LYHA 4RENA 3LQ4A 1YZLA 4YR9A 1NNLA 2GAFA 1B8OA 1MB0A 1VE6A 2C5LA 2WMDA 3E48A 5CA1A 4X8OA 4UMEA 1DBQA 1WXQA 2BDTA 2A14A 4YIKA 2HMWA 1XA0A 3LG2A 1Y7HA 3TVYA 4N0QA 4JHXA 1MT0A 3UV7A 3K6SA 3KB8A 5D7BA 5L3VA 3QHQA 3DZIA 1K06A 1IMJA 3EZ7A 5T8KA 2NU8A 5CFZA 3O1IC 5GVSA 2VHQA 4XFDA 1PFKA 2BBTA 1RAAA 4G5OA 4U63A 1OAAA 1KEKA 1BFKA 3NBAA 1IG0A 2Y4NA 3OHMA 3OKFA 4ZPJA 2PRSA 3EISA 5KWIA 2PU7A 2TMDA 3UFXA 3QELB 4Q3KA 1AA6A 2CUTA 4N8DA 1D4AA 1JSZA 1T8WA 4LVOA 4XOIA 4D4JA 4LV8B 3QU9A 5REQB 4TTAA 1QLHA 2GDJA 3FDJA 5HS6A 5SYMA 1EK2A 1TLLA 1R37A 1FNMA 2AJCA 4Q7KA 2GR9A 3DS8A 2FHPA 2E85A 2FLWA 2ZR7A 1R10A 1BMQA 5LA6A 1FCJA 3BWEA 4TT3A 2JAPA 2IYVA 3WRVA 1WXXA 2XUOA 1NDQA 1Q1ZA 1CNFA 2GAAA 3T4PA 3DE5X 1E4VA 1RQNA 1M66A 1T6ZA 2HBRA 2A78A 1HGXA 1MAHA 1YAJA 2P9YA 2UZ0A 3E7WA 3K35A 1WABA 3CF6R 3KO8A 1E9VA 3AONB 4FHEA 4HK4A 3LQQA 3Q7IA 1Z4MA 2ZWVA 4JOCA 2RHMA 3DB1A 3QM1A 3FGPA 4M87A 1P6XA 2O2IA 3GWGA 2FZWA 2FG6C 2I78A 4QATA 1N78A 3QFTA 1Q1EA 1GL7A 1QOPB 2X86A 3QPUA 5LDGA 2I22A 2C2HA 3ACBA 2ZETA 3RF7A 1H0SA 1X3LA 4G1CA 1R0RE 3UWSA 4B7AA 5JV5A 5E7QA 1F0PA 4L4ZA 3OTIA 2QP9X 4Q5IA 1EUDB 4MRRA 5KWJA 2JIZD 2XWBF 4EF4A 4ON9A 5IDWA 3EAGA 4TVOA 4OIMA 4WOKA 5FO1A 1QTQA 4RANA 4XJTA 1MPXA 2I29A 5ICSA 4I5FA 3FGOA 4UTOA 3O4GA 4YALA 4GMKA 2NIPA 1TPZA 4HTAA 4ME6A 1HDOA 5IHXA 1CXZA 2IYYA 2ETVA 4Z86A 4K0KB 3WKBA 2IE8A 4HN4B 3B1WA 1QYRA 1G9XA 3HY3A 5HUQA 3FTNA 1WHTB 1JWAB 2R65A 2H9YA 3NKVA 2CL0X 1WW8A 3U9TA 1JKMA 1NVFA 5JMPA 1A7JA 2YOFA 4FYPA 2FF5A 5FFFA 1E8DA 2BF4A 3KLNA 2G1KA 3LBAA 5KTRA 3MJTA 1OX5A 4PO1A 3NM6B 1PHPA 4QPPA 1KE2A 2ZTMA 3N0WA 1R64A 4MNTA 1OVMA 3UB4A 3KZ1E 3W1VA 2IITA 2O5EA 1ND5A