4PGAA

Glutaminase-asparaginase from pseudomonas 7a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion binding induces closed conformation in Pseudomonas 7A glutaminase-asparaginase (PGA): crystal structure of the PGA-SO4(2-)-NH4+ complex at 1.7 A resolution.
pubmed doi rcsb
source organism Pseudomonas sp. 7a
molecule tags Bacterial amidohydrolase
molecule keywords GLUTAMINASE-ASPARAGINASE
total genus 117
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pgaA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4pgaA01
1DJPA 5F52A 2D6FA 1HO3A 1O7JA 1AGXA 3NXKA 3ECAA 4RA9B 5CBPB 1JAZA 5DNEA 4PGAA 4R8KA 5K4HA 5I48A 1DJOA 2OCDA 4NJEB 1NNSA 1ZQ1A 1HG0A 5DNDA 2HLNA 1ZCFA 2P2NA 4NJEA 4RA6A 5I4BA 1JSLA 1WSAA 1WLSA 5I3ZA 4RA9A 1IHDA 2GVNA 2P2DA 5K45A 5K3OA 4RA6B 2WLTA 1HFWA 5DNCA 3NTXA 4R8LA 1JSRA 1JJAA 5K4GA 2HIMA 4ECAA 1HG1A 1WNFA 1HFKA 5HW0A 2WT4A 3PGA1 2JK0A 1HFJA 5CBPA 4Q0MA
chains in the Genus database with same CATH superfamily
4MUHA 1YWGO 4A8JB 4DIKA 2H0QA 1TUBA 1Q44A 1U2QA 4E7OA 2QGNA 4ZOBA 2ZT6A 1XEXB 3NONA 4L5AA 2B36A 3PVCA 3VKVA 3DE2X 3REQA 1G21A 2GPAA 3NBFA 1FMFA 1FL9A 2QLNA 4G0PA 3TKLA 3GVIA 4OH1A 2CVQA 3A1DA 3N2KA 3OQVA 3L06A 4JL6A 1PR5A 3W4KA 4E5VA 5B36A 2WWFA 3G0OA 1XL1A 3FG9A 2EKQA 4WAUA 1XF1A 2QYTA 3N53A 5A7GA 3L7BA 3R7SA 1QYRA 2NOAA 1QLWA 3HLYA 1SPBS 3TCXB 4XR4A 1UPTA 1E1QA 2KMLA 5BSHA 1YI0A 2I6SA 4C2AA 4K9SA 2L17A 2IKQA 4X60A 3HTXA 4W1PA 1V8FA 1LLCA 1Z2EA 1CUUA 3K9NA 1PK9A 5TLSA 4YRGA 3ONNA 3M6XA 2I2FA 4YHBA 1KQFA 1OXXK 2E18A 2ZRLA 4KQEA 4XAQA 2JIPA 5K4HA 3EK2A 3TOVA 4P3KA 5CB6A 1SG9A 1MOZA 1HFEL 1DQSA 2A1IA 2H4WA 2HX1A 3QLEA 1EE1A 4BNZA 3PXAA 2QI9C 4BO3A 1KO8A 2C9CA 4Z7NB 3LC2O 1IHDA 1U31A 3QBDA 1FFHA 4IGAA 4N40A 4DL9A 4URVR 4OI0A 3KSUA 3ZW7A 4HNVA 1T15A 5CDSA 1BGWA 4DPKA 1CRWG 2QN9A 3RD5A 3GUZA 2E85A 2QUHA 2QLMA 1XKXA 2GH1A 4L5CA 4GM1A 4PR0A 1NBMD 1Y6JA 2ST1A 3E9NA 4JU9A 1Y5RA 4ENPA 1DWOA 2L82A 2FSVC 2VWQA 3G0IA 4ZOQI 3U80A 1FVXA 3PXBA 3EDQA 4LRUA 4FGJA 2BGIA 3A11A 4ZI2A 2GHIA 1JE0A 1HT0A 4CM8B 3OHMA 3WNQA 3LC1O 1E2NA 2NSHA 2QN2A 2YIMA 3C14C 1TCUA 3D7MA 4CMAA 1W4LA 4CL3A 1EDBA 2FJ0A 4KQCA 4F4CA 5K45A 1UC9A 3K70D 3ILYA 2M1ZA 1YTLA 2WG0A 2WM3A 4RACA 4AUKA 1BW9B 5JANA 3JQAB 4FC7A 2PRKA 1ULBA 2FPKA 4GUAA 1YKFA 4XA8A 5FCDA 3QX7A 3WLMA 1OZGA 5T5QA 1EXDA 1DGQA 2GX6A 1B0AA 4K5QA 1W5EA 1Z5UA 3OE1A 2JH3A 4IH4A 3TLMA 4EB6B 1P5HA 4PBSA 1WABA 4Z8YA 4DLLA 3K1AB 3MYRA 1ST2A 1GFIA 1F1BA 1I32A 5HFAA 1UPXA 4ZIRB 5LSAA 3CNOA 3IEUA 1QRUA 5DI3A 4U2DA 2OUKA 3HCRA 3T12A 1E3MA 4YRMA 4Z0PA 3VSBA 1DTWA 5LZ8A 2GEJA 2X7HA 1W6UA 3JQRA 3FFTA 4ZO9A 5LR6A 2XNDD 1TEVA 2YOFA 3IKMB 2ZUBA 3R24A 4ITRC 1C30A 3L40A 2A9OA 5IJXA 4MVJI 3MM4A 4KR9A 3TH5A 4DVJA 2X2PA 1RS0A 2BWJA 1HNXB 4B6QA 2FZEA 5I01A 3OT1A 4N5IX 2Y1WA 5CA1A 1VG8A 2CHVA 1W19A 3TG2A 1RQXA 3ETNA 3CR3C 4EW3A 1Q7GA 4ZIRA 4QZVA 1FDRA 1SD1A 3TI7A 4HDNB 5H70A 3UAVA 4RZ2A 1Z7EA 4PHCA 4AJEA 2HT6A 2XDYA 3G89A 2OBFA 2IBMA 1I7NA 2ZI6A 3F5FA 1KOJA 2EZUA 4M37A 4WZBE 3RE1A 2VDVE 2RG7A 2Q5IA 4RJIA 3IE1A 1E0AA 2FW9A 1M1XB 2MYPA 1SVLA 3GZ4A 4M87A 4UBNA 3RROA 3UNXA 3GEHA 1BX3A 1V1MA 4FS3A 3FSRA 3E0XA 3BRCA 5DLPA 4JP2A 1GPJA 3OT1B 1T1SA 5CFQA 5HKOA 5KUTA 2JGDB 1KORA 4Q9AA 2XB8A 5ALHA 1K08A 3WV5A 2F2TA 5FA8A 2JJQA 3O8OA 2Y6VA 4WV3A 3JD2A 2JLWA 1Q77A 4YR7A 5GIOE 1CUJA 3NC4A 4MQ6A 2D0IA 4DWOA 1EX9A 1KI2A 1Z6AA 2AFHA 3IP5A 3NOXA 3OZXA 3HJHA 3I9NA 5TPWA 3WRYC 1TIKA 3CG0A 3S99A 2Y6UA 5LMZA 5KJ1A 2V6BA 2DT8A 3T4XA 5FA5A 2P6UA 3FHTA 1KSHA 2PWAA 4IL5A 1S2MA 5DZSA 1C9DB 3BMQA 3C1TA 4JS0A 4UDYX 3UB2A 1QVRA 3F4LA 2C59A 3QPVA 3WWZA 4EKDA 1XDSA 3ASZA 1O0BA 3PHJA 2ATIA 1B6RA 3UQYS 1X8LA 4R9UC 2B78A 1P31A 2X19A 5JCJD 4IIDA 1HLDA 2EXXA 4LF8B 2PYDA 1WZ2A 4PQRA 4Q1CA 2PNFA 5ES3A 3B78A 2GAJA 3PL1A 4UHDA 3H5NA 4RU1A 3ZUPA 4CCYB 3EMVA 3NOOA 5LZ5A 4WIAA 4S2UA 1K75A 3B89A 2QL6A 5B37A 4PC1A 4RM3A 4YJ2B 1I6WA 4B3IA 2PUDA 2IEYA 3A58B 4ZALA 1XFAA 5KQPA 3KB8A 3TIFA 1OPXA 1NQ5A 1VIDA 4CDNA 4CDMA 4DQUA 2HF7A 2I3DA 1IIRA 4BVJA 2PUAA 1TT5A 1AK1A 5TF0A 2NVBA 2JJ1A 1KVRA 2CXRA 5U4XA 4RQAA 1SHTX 4XVRA 2GERA 4BIIA 1Y3AA 3WZMA 1NKSA 1S2DA 4JL5A 1UK8A 1B41A 1XZEA 2A5FA 2IYOA 1NFRA 2QN3A 2VP2A 3K1TA 4KFRA 4LYEA 4TYQA 3RK4A 4NZYA 3KKNA 1XRJA 2AUMA 1KY5A 2ID4A 5EZ5A 4OJMX 2IQ5A 2D5LA 4KPUB 5C1BA 2FPLA 2QBYA 2P6NA 5T4EA 1UIRA 7MDHA 3PS9A 5EHZA 1QLHA 3BB4A 2FUG6 2XHEA 3P71T 4PO9A 1U0RA 2JJMA 2P2LA 4AP5A 1Q50A 1D2CA 4B3FX 3HC7A 5JY1A 4JOBA 5CX4A 4J4TA 1LK7A 5G0VA 1UAYA 1Z2NX 1YJXA 2CMKA 2DWCA 3UOAB 4K3VA 3RVRA 2NO1A 1JG6A 4XM1A 3W8FA 4DJJA 4JHLA 4ARCA 1SHJA 4J91A 4Q1DA 5BQ5A 4CFSA 1JDSA 1HFKA 4A8JA 3VKFA 4JWKA 2D2XA 4EHNA 3BKWA 2IY9A 2WIBA 4E6EA 1I1OA 4G84A 5IABA 3GCGA 1Z8HA 5B7PA 1G21B 1XG5A 1KS9A 3GLFA 3KSAC 2YHAA 1KIMA 4EMSA 2XIJA 4YRKA 1UZNA 5BQXA 1Q14A 2OHOA 3R41A 2OCKA 4NFYA 4HDMA 3HCDA 1G59A 3TX6A 4N6GA 3DBRA 4ZJYA 2UUCB 3IAS1 3FDZB 3I1FA 2Q5CA 421PA 4L75A 4RADA 5LWHA 2B4AA 4RYDA 3PQ2A 4X91A 2GD2A 3A6KA 2SCUB 1DIBA 1FA9A 3GJTA 3FYUC 1MQSA 3FKSA 5IAGA 1L3IA 3ZE1B 2B1JA 1LSUA 1OQAA 3MB8A 5HKKA 5JQWA 5LNK6 3UPTA 3WLRA 3NCTA 1SZJG 1DLJA 4RPCA 4ZYVA 1JT2A 2NU8B 1B0ZA 3SQWA 1KI3A 3EXHA 3ZWMA 1GZSA 2C7OA 2QRHA 4BKUA 1TVEA 3OQHA 2ZB3A 4WA7A 2H29A 1AKUA 5DCLA 3AVYA 2M1XA 3SBEA 1VB5A 2JDID 5K4AA 4LC1A 4XOUA 4JX8A 5DGCA 2EZ9A 4KXYA 4EK9A 3VHLB 4Q5IA 3PIDA 1LNQA 1UJ4A 1ZM9A 3PTLA 3WO0A 3D2BA 1ZIXA 1L7EA 3DLAA 1JIVA 2VSYA 5BSTA 1ADFA 2O8NA 5KSZA 1STOA 2ZSEA 2GEFA 1AMUA 3IXLA 4DMRA 5EWJB 3D7LA 3AP2A 1VJ0A 1TZMA 1UJBA 1DBSA 4QVKA 1ZNQO 2G09A 2G4VA 2P2CA 3GCDA 2P78A 4A8PA 2PLFA 2I66A 4LOAA 2BOVA 1K6MA 3EIQA 4C06A 4X9XA 2D54A 2W98A 3IMCA 3RKUA 1BEZA 2AFHE 3RANA 5M2QA 5JNRA 3E58A 4FKBA 4OHWA 2XGMA 2VDQB 2ZRDA 2B61A 3MD0A 3UJ7A 4K0KB 5G4LA 4BBZA 1O6ZA 2G4LA 5IX8A 4QNMA 3TZQA 4DE5A 1GZ6A 5KQGA 1ZOSA 4O02B 3V3KA 1EK6A 3G9UA 3HBFA 1T36A 4WLOA 3GQBA 1JDBC 3ZD9A 1U3UA 2OK7A 2R8EA 1A69A 3T5CA 4GS5A 7MHTA 3QMWA 4H9GA 5B55A 4TLAA 1DAKA 3EZ6A 4EHAA 4YJ3B 1CUDA 2X77A 3ND8A 4HOYA 1H2YA 2JD2A 3HSYA 1I01A 1Z22A 3SYLA 3DOOA 1SWVA 5ALSA 1JLLA 5KHAA 2AMLA 4BVHA 1HDYA 5B58C 3S2UA 4COKA 3JRWA 1R2QA 4G0ZA 1GZHB 3W5JA 3DKRA 1ECPA 2ONZA 4EJSB 4LNUA 4D98A 5JH7A 1YDHA 4YDSA 3PHCA 5K09A 2O8FB 4QUJA 5DEIA 3B13B 3GL9A 1ZIPA 1RE1A 1IPEA 1NBHA 2OOSA 3F4BA 3SZMA 4DDVA 3WKBA 3IB6A 3LVRE 1YDFA 3EXIA 4U3JB 1NR1A 4Q19A 2BV3A 1C8KA 3DWFA 3QKRB 1UC4B 1HQDA 4HXEB 5J2TB 4DBVO 1TUIA 2DBQA 3OMWA 4UFPA 3SR3A 4S35A 4J9UE 3LWZA 1S7CA 2DQZA 2ZQYA 3G2IA 1JH8A 1KEUA 3Q3GE 1W36C 3RT7A 3IBTA 2W93A 1DCMA 3FA2A 1L5LA 2PWBA 4GBJA 3QYFA 3AY6A 2OE2A 2G5TA 2V45A 4JLMA 1F3OA 3FMPB 2ZAIA 4HGOA 4K87A 4LYAA 4V0MA 3VO8A 2E6UX 4U7WA 4NPHA 2QR2A 1DLIA 1MVOA 3B2QA 3HU5A 1MGPA 5D5HA 4AURA 1MJGA 3FPEA 1NULA 3DMNA 3WR5A 3FAKA 1Y5NA 3OKCA 1K86A 1O4WA 4B5KA 1UBNA 4BMNA 1HT3A 1ZUNB 3C41J 3RJ5A 3T5PA 2AJLI 3JWHA 1FP4A 4E70A 3UV6A 1N6PA 4XWWA 4KR7A 3WL5A 3UMFA 1S3GA 4H3HB 1OT3A 1BMQA 4DMGA 5TPWB 1TZJA 3RFCA 4Y30A 1OREA 3IKLA 1A2BA 3NHAA 5AK3A 2ZIGA 4I1RA 3DTTA 2RGBA 4TX1A 3VPXA 3QU2A 1KA9H 2BFAA 2VP0A 3U7JA 1CF4A 3FDIA 5BPFA 2VKQA 1LF5A 2YW2A 1Q17A 4MHSA 3G17A 2GBCA 2VJDA 4JJ7A 4OG2A 2FQXA 5L45A 5F4ZA 2PO7A 1NHGA 1QAMA 2FWPA 3LECA 3EXAA 3GR6A 3NASA 1UC5B 2QRJA 3TMAA 2HDOA 3EPPA 3ETGA 5B1HA 1SKAA 3JVDA 3G7NA 3OTOB 4N41A 1EFRA 3DMTC 2GKGA 2CVOA 3BZWA 4MINA 5DOVA 3VV3A 1OROA 3F5DA 3LHDA 3O2QB 3IUSA 1FMLA 3P5BA 2B34A 2IYWA 2OORC 5CIYA 3ETDA 3FE2A 3BWDD 1CEYA 4M7WA 1SXGA 3H5WA 4W1SA 3JAKB 5ILGA 1AS0A 4A23A 3TOSA 4WZAB 3BSFA 3GLTA 2P9BA 3NATA 4MV3A 1NN0A 1R64A 3SEAA 3W2TA 1CC1S 1SBQA 5F2NA 1V4BA 2FGJA 3PNSA 3K0AA 4KQIA 5D51S 1ZM2A 3ZIDA 4H7EA 4J07A 1XDZA 1P75A 2WFMA 1A5SB 3E9CA 2RGXA 5JRJA 3KETA 2BEVB 3TJMA 1A4IA 1Q6YA 1TT5B 4FYIA 2HA2A 4KWCA 1SVIA 1Z6ZA 1RHJA 4TSRA 2K6GA 4IIYA 4NONA 3BH0A 3QX9A 4MR9B 5J5VA 3UB3A 4ANFA 2GBLA 3IURA 3OKPA 1T3GA 3R3VA 4X8MA 3KO8A 2F3PA 3O47A 3K0FA 5DNCA 3GNSA 2VDWB 4LXGA 4C7BA 3ODGA 2DCUA 1FFAA 1P74A 3L7AA 1U0JA 3AP3A 1J42A 4CWAA 5CVTA 4MW6A 8ADHA 5G02A 5DM1A 4ATNA 5JS7A 5CCXA 4CV3A 1CQJB 1TECE 4N9WA 5DNDA 4QLBA 5BV0A 5HX7A 5K9ZA 4A15A 4YCCA 4BZQA 1K5HA 9LDTA 2HJVA 4DB4A 4JOSA 3BCHA 5KEIA 3PDUA 5A62A 2O5CA 5CITA 5IBCA 2GXAA 1SOWA 2MTBA 3DDCA 1RI1A 1ULTA 4RSRA 1NONA 1PX2A 3B53X 2EWMA 3WTCA 3E84A 1U0OC 1DG9A 3TD6A 2YCLA 3QGMA 2GJ9A 1XX6A 1MA3A 2HF2A 4ASUA 4URUR 4DDKA 2HLPA 4EY7A 3SQXA 3B8EA 1QQBA 5EJ8A 2DWPA 2QIOA 1SNYA 3HCFA 5LLSA 4J16C 3BWCA 1SCDA 4KRGA 4L5JA 1B42A 3T5GA 2XQIA 1RWNA 1GCGA 1FS4A 1I13A 1UR5A 2VDKB 4JYMA 5AJZA 2F43B 3WHPA 5KC9A 5KU7A 2WWTA 1QRTA 2O54A 3BGSA 2JCBA 5JZOA 4RENA 4HQOA 4FFMA 2WNIA 2AZ4A 1U9IA 1G5RA 1G8PA 1CYDA 2WKQA 1LDGA 3M6LA 4KQGA 1ELOA 4J1QA 1GA6A 3T95A 1KI7A 4UFNA 2WPDA 4IIXA 2ZETA 4RZIA 4DJ5X 3ROQA 5T7BA 5A7HA 2O8DB 1M2EA 1NQVA 3O4GA 3IEIA 3QWHA 4PSKA 3QXXA 2VJAA 1CQZA 4V0ME 2AZDA 1PR9A 3NQ41 4KWHA 2P9GA 1BDMA 4LJ6A 3T7IA 1Z73A 4ZGBA 3V4PB 1PQ4A 4BLRA 1GPDG 4CUZA 1ISGA 3NDBB 1X8JA 3TJZA 2GLTA 3KSZO 4I0WB 1ZOIA 3MFYA 3HEMA 2PWYA 1IU9A 4M1QA 1TPYA 4BNKA 2D3WA 1FVFA 2QJRA 2R65A 4C3ZA 2KI5A 1LZLA 1N8KA 1Q0ZA 2P0EA 2ZLBA 5DBOA 5BN1A 1ZVJA 8ATCA 1XA3A 3PEVA 4D9CA 4TXHA 3PLAE 3QG5A 5LYJA 1O95C 4FQ8A 1E3EA 4OSPA 2OA0A 4I6GA 1YRYE 2Z6VA 3IPCA 5HF9A 3W4IA 1T6ZA 2WVJA 5JVDA 4R1PA 3VHRA 4NENA 4YRNA 4AG6A 2YYSA 4YMWA 1EFRD 1SXJD 3FNFA 3TIIA 2Y92A 3W1VA 1H4TA 1N6NA 3P4YA 2ZKLA 3UICA 2XV1A 2VPXA 5LLDA 3DF9A 1V5WA 2PR2A 3HUUA 3L5OA 5EI5A 4F4FA 2AR9A 5KYKA 4ZI7A 5LN1A 4G89A 4OHUA 1AKRA 2GCOA 1ZAKA 2JRLA 4B82A 4QTYA 1KWGA 2IP4A 3WLTA 4TLEA 3I4FA 2V7WA 4KDCA 5EWLB 5A4KA 1Z37A 4B83A 1L1QA 1APBA 1ETHA 4J7UA 2C5FA 2RSLA 5C1DA 5ADUS 1SCIA 5FTMA 2CXNA 5JZ9A 2P8JA 1A9OA 1E32A 3SYMA 3ZHRA 4CDGA 1D4AA 1YQEA 2WF8A 2JH8A 5ALDA 4D80A 4HBGA 2IYEA 4ZYXA 3QE3A 4YC7A 3CF2A 2C78A 4FOLA 1N2BA 2NSLA 2QM0A 4WESB 3ORQA 3X2FA 4FU0A 1CHNA 2DSTA 3UAZA 3WMGA 3PEWA 2GJKA 2F8MA 2VXCA 4HVLA 3AWDA 1E2IA 4I7EA 3ZVMA 5TJHA 3K7EA 1E0DA 5HKLA 4C5AA 3TM5A 5CFPA 4RTQA 4PHHA 3F3MA 1P19A 2A5DA 2X76A 3BFJA 4G2TA 4HNRA 4QBIA 5DXFA 5HW0A 4GOOD 3CEJA 1SC9A 4RCYA 1PS8A 1VYUA 4ALJA 3AU9A 2W6IA 3O4VA 3JWIA 4FDLA 1M34A 3W6OA 4LJRA 1GADO 1GUYA 4HDSB 2ZUEA 1JG1A 1M3SA 3FZGA 2PMKA 3OURA 3WWEA 4KMRA 5AUPB 1L5MA 2BEWB 2OCBA 2Y0DA 4UHKA 3WYNA 4DT1B 1RZRD 1RXWA 9MHTA 3RVMA 5KNDD 1GNPA 4CQJA 4TS3A 1G38A 3NVMB 5AHRA 2BGMA 4OQPA 3VU9B 1J7KA 3K9LA 2JLSA 5C34B 5JVDF 1Q3HA 1E1CA 2HA6A 2A35A 2Y1GA 5T67A 4UNRA 3MERA 1ZM3A 4DANA 5HRAA 3QF4A 4L51A 3IESA 5CG1A 3CLUC 4QPCA 5D7NA 5EHQA 3T9BA 4EVIA 3RYFB 1EQAA 2XNJA 4XLZA 5FWNA 1R12A 1D0IA 2XWBF 1ZGBA 2CHQA 3HU1A 2WUGA 3HWWA 5I8PA 3PXXA 3T94A 1WP4A 2BSXA 1C3EA 3CVOA 3I23A 3Q1KA 4ZKEA 3ZHYA 1Y4DE 3FPGA 3FBWA 1RBMA 1G2QA 3K5HA 4LVOA 5LIPA 4XCQA 2WF7A 1YF3A 2ODAA 3IR5A 4GSYA 2IDZA 4M4SA 1Y7LA 1GUZA 5CW1A 1BDIA 4R51A 1D03A 3WGQA 1JTVA 1OT5A 3I4LA 2MMGA 5TQ0A 2O3RA 2C5LA 4YRQA 1N77A 1AVTA 3T1OA 1Z39A 2DHEA 3VBCA 3RSCA 4NE9A 4Z3DA 3ZCTA 4EFDA 5ALGA 4ARBA 1Y3IA 4RZSA 1V11A 2OD9A 5FUYA 3PNPA 2J31A 2E4XA 4JUBA 3U9LA 1RLIA 1TA4A 3K5WA 4TV8A 5EAIA 5EYPB 4R2IA 5HZKA 3V3TA 1BYUA 4ACAA 2E1RA 4AO8A 4A10A 4OSEA 1YVUA 1I3CA 1RTTA 2VZLA 3PC8C 2ZRCA 4XB2A 2ZRKA 2NGRA 4UCQA 4AKIA 4YAUA 5TS2A 2OXFA 5T4BA 5KINB 1U0SY 1MC1A 2YWBA 4KODA 3NORA 4YP0A 1MT3A 2BKVA 2RCNA 1XD2B 1Y34E 5IVIA 2QX7A 1XYYA 3FCYA 2A88A 1TQ6A 2MIIA 4A0QA 4BNWA 3DQZA 1VJTA 4URHA 3RTDA 4YQYA 4LYFA 1YR9A 2PX8A 2VZ0A 3IUMA 4J0EA 4P5PA 4DY4A 3KWJA 4YMHA 3A1FA 1Z7BA 3MN1A 3NP9A 4MEAA 6AT1A 1DIOB 2OXCA 3L8EA 1MC5A 1ZN2A 4UE3S 5F5LA 4A8JC 2FEAA 2WV7A 4YHHB 3GUVA 4QNRA 1N8TA 5AKHA 1RXVA 2WWIA 1A50B 3TG8A 4HDKB 4GIBA 1PFKA 1SA0B 2WK1A 3ILXA 3WGVA 2OFPA 3MRVA 1FFGA 1FFBA 3QK7A 4DLUA 4O2BB 3RJTA 1DC4A 3C3XA 1IZ0A 4QNNA 4RCZA 4WZ6A 4L08A 2JGAA 5CDTA 2G77B 2YMMA 3SU8A 1ZGZA 4LSZA 1WQ1R 4JVLA 3ORYA 1T0BA 1D8TA 2GJSA 3B6ZA 4J94A 2CEKA 4MH0R 4WXYB 3LA6A 5FPYA 2FPPB 4BATA 4LFBB 2I76A 3GUYA 2C4KA 3MMXA 3ROFA 4UBLA 3STXA 3E22B 5A9RA 2GWHA 2IUTA 5IDYA 3E81A 5KVCA 3HB4X 4TQUS 2CD9A 4TV9A 2LZ0A 2OP1A 5ECYA 1VGQA 2Z2KA 3GFRA 2X5JO 4D7AA 4D81A 2JB9A 1ZZGA 1HNNA 1OZHA 1R6VA 3RCBA 1XVAA 2Y76A 5AM3A 5G4KA 3FYHA 3U7GA 4CKCA 1W88B 2WFLB 4ZICA 4IUBS 3NX4A 3WISA 4RK6A 3AKYA 3FJ1A 3G2LA 4KZKA 4RGYA 3QPDA 3V7WA 3ZXXA 4EY5A 2Q6VA 1TJ5A 5JCOC 4UVIA 1AGYA 2I6TA 3DBVO 3FKQA 1L3CA 1XC7A 4L3OA 4BPBA 2YJ5A 3H9BA 3FTNA 3DA8A 1C5KA 1RHMA 1B0UA 1V6AA 4FGZA 5AVRA 1TK3A 4RYLA 4HN4B 1EQ2A 4XPIA 5F1YA 5H82A 1QVAA 4PSVA 2ZVDA 2XMDA 3W4JA 2I67A 1FFXA 1G5FA 4KEAA 1PZEA 3ER6A 4V0KA 3DLTA 3TXYA 4CM4B 1ATZA 3M3HA 1EG2A 5FI5A 2PQ0A 2NUAB 4ZHQA 1XCOA 3P0FA 1HM5A 1KQPA 3R6WA 5TXGA 2IUEA 3RS5A 4KX3A 4BNIA 3FUCA 3AGPA 1QGDA 1VLMA 3E48A 4EYSA 1RYHA 1TKCA 2DUNA 2P5UA 2C4NA 3ZD8A 4LN1A 3N3BC 4DM4A 1NRJB 4IG9A 4FXPA 3PQ8A 3WNBA 8ABPA 3VGPA 2XCQA 1S1MA 3EWAA 4PVDA 1P1FA 4N82A 5L6LB 3IOYA 2UZ3A 3KOXA 4QPZA 3BFKA 1EGVB 3VUFA 3A05A 1QGYA 2ZE7A 2WVGA 3A4TA 4EA6A 1KZGB 1EUCA 4OGGA 2J09A 1SCUB 2HREA 5EXDA 3KAQA 4KR2A 3WLPA 4C20A 3UUFA 1JALA 1OH8A 2GN8A 3T41A 1RJ9A 3ZJVA 1YKGA 1AS3A 2FETA 1GAXA 2CCKA 2WUEA 2J0EA 4EARA 4CF4A 1RP7A 1FPMA 1YJQA 3IPXA 1NVDA 4YV0A 5I9SA 1L5WA 3MWEA 3IIJA 4Q16A 5T57A 1LC0A 4CR7A 4ZVQA 5C5CA 5I7VA 5DTMA 4MI1A 4IMPA 5CNKA 4D96A 3QSYA 2OYSA 3RFUA 1L7NA 4JA0A 3D2AA 4QTTB 5EUMA 1NGSA 8MHTA 1RHRA 2O48X 3KU1A 1ZJYA 2A9KA 2J5RA 4Q3KA 4F6CA 1E64A 2CWWA 5DX8A 5EN4A 4NCAA 2O0KA 4FUTA 5DW3A 2YJ6A 5FORA 4IO1A 2I91A 5E6SA 1WE2A 2W42A 4M2LA 1DBRA 1RE0A 2ZANA 3N1UA 4OL0A 2R9VA 2G0TA 2ZYTX 4WLEA 4ZV9A 1N2OA 1ZJZA 4XD2A 2X0FA 2BHRA 3X1WA 3UJ6A 2Z57A 4L7VA 4U39A 2HHHB 3PT9A 2JFPA 2X4DA 1AGXA 3TB4A 2AF3C 2C3YA 2PUBA 4DLYA 3H0CA 3GH1A 4B4WA 3JQ9A 5LIRA 5ITWA 3PQ3A 2OFFA 5J2UA 4AQYB 3EWNA 3F97A 1TIPA 1UODA 1PJQA 2YH2A 3A9WA 3WL6A 5LFAA 3K0EA 1U4NA 2ABWA 1W0JA 2D7JA 4DR2B 4XGIA 4W5RA 1EDDA 5AM5A 4KFTA 5BO5A 4GKAA 1VPTA 1YQGA 1RBZA 4A1FA 3F49S 2AYZA 1VM6A 4GKBA 4HEA1 1A4RA 4UAGA 4F9EA 1OOEA 4HS9A 4NEQA 5CUQA 1RAIA 2CE2X 1Q6ZA 4YT4A 2H1VA 2CUNA 4J1NA 1GGNA 4BPRA 3D7SA 5K2MA 3EGDB 4XUGB 2VT7A 1HDIA 4B9EA 3TF5A 1AX9A 3N7TA 4P36A 4WX2B 1UMCB 5DNVA 3TCNA 5BRJA 4OMFG 4E14A 5C7OO 4J9VA 4FILA 4OF4A 3LNTA 2K7ZA 5IVKA 4F3TA 1E1NA 2ZCVA 5CGZA 4WASA 3AR7A 2C92A 1N1MA 4NE7A 4ZKDA 1WLYA 5HE9A 2I7CA 1U7PA 3RQSA 1CJBA 4TROA 2ES4A 4LOJA 1A7AA 4J1TC 2Y77A 5ECWA 4N8EA 4PAWA 1KJJA 5CAEB 4BQPA 3Q7SA 4BCCA 1PVOA 1FZQA 1NUHA 3ONVA 3QXSA 1KYXA 3P96A 5AKYA 2C2WA 2X8LA 5B3JA 1QF6A 3CWCA 4YJFB 4MWSA 4Q15A 3TL6A 5JAMA 5E3IA 2I1QA 3GT0A 4BFXA 2EU8A 1FX0A 5JCPA 5LOVF 4Z3OA 4ZRDA 5JC1A 1FXWF 5DN9A 3NHMA 2GARA 1T5DX 5BVGA 5ERYA 3D3EA 2EX1A 4BQQA 4A0FA 4AZSA 3TUZC 2QI9F 2G9ZA 2XWSA 3EBPA 3KYBA 2HF8A 5A06A 4GX2A 5DBHX 2GAAA 1H5NA 3NALA 4X63A 1ILWA 2O2DA 2XWQA 1XJ5A 3G0DA 4YUVA 2GXQA 2P4UA 4J7CA 4MOWA 3QW2A 3W06A 2FU5C 3EDRA 1L5YA 2CW5A 1PSDA 2NQTA 2KBFA 5KJ6A 4DR6B 3B3FA 4OHCA 5SY4A 4FZ3A 2AC2A 2GTHA 5J59A 2QD1A 4CKWB 4MLDA 1Z4LA 1VBNA 4P4SB 3ZY3A 5HUJA 1OLXA 1L5HB 4TQ9A 4P9NA 4BMOB 2LIPA 3P2EA 1NMEA 1YZKA 3CR7A 3R3UA 4JWTA 1IPHA 1AUQA 2ZJ1A 4N5LA 1FS6A 1NSYA 4XGQA 3WQBA 3RAFC 1Y8RB 2RAVA 3FNBA 4R7GA 1JIIA 1BX1A 3KWFA 3I01A 3LRTA 4JKOA 4M7OA 2B1GA 4BGUA 2RHHA 4LI3X 4D4HA 4KREA 4TKUA 1Y3DE 3CR8A 4R8VA 2V7EA 3MGCA 1S2GA 4J0JA 2CLHB 3JQ8A 3L01A 1Q1NA 1GAQA 1QYVA 4NCHA 3GEEA 5KNCH 1KJWA 3L1VA 1E99A 1J8YF 3TZEA 4CMJA 3INRA 4JCOA 1SRQA 2BMWA 4I1IA 2ZSHA 3IUQA 4WCFC 4CT0A 2PKEA 4GSKA 1T8PA 2AFIE 1ZCAA 3CZ9A 4OM8A 5IANA 1LNSA 1YR8A 3SS8A 3MRTA 3GA7A 4TL9A 2L0XA 1GPLA 3CRNA 5FNVA 3TLJA 1XTPA 2C3UA 4HYYA 4BWGA 5AJUA 5FO0A 1VL1A 2LD4A 3W04A 5JAPA 1M2JA 4BFLA 1FTGA 3BMXA 5JSZA 2VUSA 4WLFA 3R74A 4MAAA 4Z1MA 5A4AA 5L3VA 4OHKA 2SKDA 5BURA 2QX9A 4AT1A 3TTWA 1UK6A 4KUHA 1WZCA 4WN9B 2GSWA 2RKOA 1A4XA 4IXWA 4ZCMA 4O1HA 4QUKA 1KNXA 3MTEA 3WKCA 1XAGA 2QRZA 3GMDA 4U9UA 1G66A 4W9NC 1FU4A 1PU2A 1BIFA 1TRKA 2JAWA 1ZJ6A 3OBIA 4A36A 3COSA 1ORDA 2ZUDA 2O1EA 1GCIA 1QONA 1RWWA 2VKTA 5B12A 3OZCA 4O4LB 3OWHA 4YGYA 1OXKB 2DECA 4HDCA 4ZAGA 2PL5A 3HFJA 4AW9A 3E9YA 4BTVA 3JAWB 3D4IA 4Z4EA 2I6XA 3EYWA 5JE8A 2ZYUX 3P9XA 1XNHA 2QZPA 3CKMA 2GNAA 1V37A 4HV4A 5HKKD 1KARA 1IBRA 1R18A 3DR3A 3HBJA 3EARA 4RO0A 3K4HA 1TCCA 4GBED 4MLZA 3KJGA 2XYHA 1IM2A 5ELMA 4B5LA 5G40A 3LPLA 5IXYA 2GO1A 3TSZA 4WOKA 2B5OA 3RYFA 3HYCA 1C0IA 1I5EA 2VSOA 2WOOA 1H3NA 1EX1A 4QOSA 5E2IA 2C2ZA 3IAHA 4R4JA 5LZ4A 2H5JA 2WILA 1DRUA 3FYSA 1DU4A 3KQPA 4R3WA 4WY2A 2C3MA 3IAM6 2PJZA 4CF3A 1JU4A 1EVIA 4BECA 3O1JC 3VKHA 1NE2A 4JBXA 4CM9D 5KTYA 4IEFB 5SYMA 3BOSA 3VPBA 5E4FA 3A4VA 1DC7A 1QUEA 4RZHA 5F78A 5HBRA 1EFAA 4Z0HO 2JKVA 4BY9E 4PLZA 2PZLA 3EZLA 4DUZB 2TMGA 1IULA 1ISJA 1BGVA 1CJKC 1R0ZA 2DBYA 3G6WA 3KSMA 3NIWA 4R16A 3ICCA 5CHEA 4Q93A 1RZUA 1WW3A 2Z58A 2AFIA 2EJVA 2MSDB 1OIXA 2XCSB 1R6XA 3WYFA 4BZPA 4PLPA 5EQTA 3L1IA 4FGSA 1HG1A 1VLLA 3NKLA 5FUXA 1ZH0A 3M83A 3EGWA 1NBME 1Z8DA 3GRYA 5JDCC 3KQNA 3JZFA 3ED1A 2FPMA 2OAQ1 2C8LA 3T3OA 2YVQA 4NPCA 3TRIA 2ZRJA 3F9RA 1N5OX 2PK3A 1RXIA 2W6OA 4IQFA 4JT2A 4C3OB 1V25A 3D6MA 4OXYA 2XCTB 2XQFA 2JA2A 1DJOA 1XRQA 1GGEA 2HPAA 2IYVA 2OSBA 3M49A 2ZZMA 5AHOA 1NXXA 1U3WA 4CCWA 4GD3Q 4AO7A 4PONA 3U39A 4LDPA 1I36A 5E2AA 2CYCA 4L3WA 1ADJA 4PNEA 5JTUA 4PPFA 4JCCA 4LZZA 1XIVA 3ZLBA 4WKPA 3W77A 4QPPA 4BJ5A 4MVJF 4UPDA 3DL0A 4PBRA 5I47A 1VJCA 1WQ3A 2RHGB 3WJ2A 1PV4A 2ZAGA 4PSDA 4GC9A 2CVPA 4QXAA 1YASA 4XGKA 3ETJA 4EG5A 3U1BA 1F12A 1YDEA 1N2JA 1XP5A 3N6VA 4QGGA 3UW1A 3VI4B 2XF8A 3MCAA 3O8NA 5JRDS 1FIUA 4GNRA 3B5JA 1W581 4JEMA 1EHIA 1Y80A 1U8ZA 4X1IB 5EQJB 4UTRA 4GUDA 4R98A 3W3AD 1RWKA 5FTJA 2BFWA 4C0KA 3CG4A 1RKXA 1TF7A 2IUSA 2V7PA 3GRFA 4LXHA 3EY9A 1W75A 5C8YA 2O8VA 2AOXA 1IEXA 2XQVA 1E7YA 2XF2A 2GYWA 2YC2C 3HJAA 3OE4A 1VZ3A 3OZGA 1DQRA 4J8PA 1CUBA 2HJHA 1JQKA 1JEAA 3EVGA 1MP0A 4ENUA 1BCRA 4PFKA 1G6KA 2GS9A 3RH0A 3AR9A 1N0UA 4EG0A 3K0BA 3DTVB 3T1YB 1J5EB 3DMHA 1VL2A 1AKYA 4RH0A 4TRRA 4TV8F 2O07A 4C7KA 2FMXA 2J3MA 3QZUA 1C1HA 1NI4B 2XRYA 3K2IA 1TM4E 4PVCA 1QTNA 4I9NA 1G3RA 4RLHA 5EIBC 5F4BA 5GONF 3SHVA 4F8JA 5IC4A 1UFOA 3YASA 1ZYUA 4GR9A 1WL8A 1NY6A 3GLVA 1F9AA 3BMCA 3EQ2A 3QM1A 1ZH2A 4MKZA 3ROKA 2QNBA 2W2PA 3KBBA 4IIUA 5EE9A 2Q3EA 4G4IA 3ACCA 4Y0VA 3ELBA 4HN2A 3AR6A 2F9MA 4REQA 5DMXA 2WAMA 4PFSA 3K20A 2WFZA 3DWGA 1K63A 5GOTA 1QE5A 1F0NA 3PRJA 1V4VA 3KTDA 4GGOA 4D57A 1R8YA 2OESA 2C9ZA 1Z12A 2PZKA 1TZBA 2PZBA 4D5GA 1TM5E 3RRNA 3UJCA 4JXXA 5CH3A 1H4SA 1NWCA 3I52A 4PXSA 1L4BA 5AJXA 4DS3A 1QFZA 3FIUA 1R16A 1UK7A 3MJFA 4WJKB 4H18A 4RLQA 4UMFA 1ECGA 1K2WA 2D1RA 2Z83A 4FLEA 4KO3S 5F51A 4UUMA 4FN4A 4B74A 2XBLA 2O0LA 3SYTA 9ATCA 1G0NA 1VKHA 3A4NA 4ONEA 2B2CA 1S0UA 5BNTA 1NMXA 3L7KA 3LDAA 3IVAA 5B4UA 2PD6A 5AXDA 3KEMA 5KOHB 2I8LA 5LYJB 1FUUA 5H7XA 1ENOA 2HTFA 1NJFA 4TRMA 2VQSA 3A4LA 1BQ4A 1MMFB 1P7CA 2Q41A 1BE0A 1HEYA 2X9VA 2XTNA 3IBFA 4ETNA 2WF5A 4GPZA 1KI6A 3WRXA 4YMLA 4BO5A 4KXXA 3AYZB 5B3AA 3EDCA 5FLYA 4AY4A 5EZQA 5F3RA 3AETB 1UFRA 3DJFA 4ZU6X 2JHFA 3M6VA 4L8GA 4JBWA 2O23A 1FFYA 4M83A 1Q95A 1F2UB 1QF7A 1EBBA 1VL6A 4FMDB 2A78A 3IO3A 3L7YA 3LGAA 4M0MA 3RIMA 3I53A 2VF5X 3L8FA 3K9BA 4RMJA 1WWKA 5BW5A 1J39A 4Y8VA 2ZW9A 1U2DA 1WW2A 1Z8NA 3VKWA 1E3WA 1V47A 2B37A 3WRWA 3CHYA 5JNWA 2IHVA 1PT8A 4V0QA 1FSGA 2QUAA 2OV1A 2VQEB 1OC2A 5HQ3A 4QO7A 1XU7A 1VRVA 1HZZA 2DY0A 2WE7A 3I05A 5JZVA 2QMUA 3LS2A 3BXHA 1QB8A 2W70A 4YP1A 5T8KC 3DVRX 4TTSA 4BWYA 2ZJZA 3E3LA 3WWPA 1NNLA 1DSSG 1YS2X 2UDPA 3DV9A 2J9FB 1GLGA 5GPBA 1KH3A 5LUBA 3EF1A 1T9CA 2XCOA 3DMDA 4OLBA 1P8JA 3O8QA 4UZFA 2RGNA 1GZVA 1E0SA 3A26A 5F1PA 1N75A 5CAEA 5EHGA 3UENA 2ZJ2A 4RX1A 1NSFA 2R00C 3TS1A 4S0ZA 4MWZA 5HA5A 4FHGA 4RQBA 5FR1A 2B69A 3BD8A 5DBEX 1BN7A 2CFOA 5B3JC 2GVNA 4L8VA 2W2KB 3C2QA 4JI6B 1P0MA 1RYBA 1XWFA 2EW1A 2KE5A 2QVXX 2TMDA 1SQ6A 4I1OA 4OK3A 2IUUA 3OZAA 3OCVA 1G0OA 3HKCA 4ZYTA 1U2RA 1PSWA 2H4ZA 4J0KA 3TVDA 4DC1A 4DTCA 5JQGB 3AQIA 1ZNZA 2FWNA 1LPNA 3AIMA 3T4PA 3E61A 3QX8A 4N76A 1OB5A 1EWQA 1C7ZA 4AM8A 3C43A 2N9UA 5FV4A 3RNOA 1XTIA 1QG4A 2L18A 2EFCB 2HQBA 2JFBA 3KQVA 2ZBQA 1KJ9A 4MS4A 4PQFA 3W78A 5FBVB 2QV7A 2X0KA 3FETA 3CUSA 4IDQA 2V6MA 5KVQA 1E6CA 4OAPA 5E9QA 3DNMA 3B36A 4BUJA 3QFRA 4TMZA 2QR5A 4DY6A 3W5BA 6YASA 1D04A 1Q1BA 1WPRA 2VSNA 3E7XA 2Z1MA 4YA6A 3AUFA 4CZ2A 3ZJTA 4JI2B 1D0SA 1KEVA 4QXRA 4RVUA 3RBXA 1IM8A 1U7DA 2OG2A 4TXNA 4II7A 5H0IA 1Q0QA 3UFXB 2K4MA 2XYPA 2W0SA 4YI3A 3RGGA 3W5CA 1K9VF 2QZ9A 5ELXA 3GC6A 2CK3A 1JFFB 1RMTA 4H1TA 3JZMA 4B7UA 4ZEOA 4Y2HA 3TLBA 1G3IA 1JECA 4L6IA 4MYCA 1UK9A 1MD9A 4CTJA 3VR2A 1QP8A 3HCPA 3QFSA 5COQA 4P7BA 4CGYA 3MCTA 4C4XA 1D9ZA 4EY8A 3GEGA 2E5FA 2OM6A 5CDFA 1TJNA 3E8XA 1R8QA 1IOLA 1KMCA 1Z2CA 3TD2A 3HK2A 4IFEA 3ZCVA 4C30A 2YXBA 2VUTA 1JKMA 3EZ2A 4C7VA 5I9NA 5FOSA 2ONYA 4RDXA 5KOYA 2FJPA 3BJZA 1DIAA 1PL6A 1HQKA 2P9FA 5EKTA 1GR1A 4EKGA 3BAZA 4S1VA 4E13A 4C2UA 1QFJA 1RACA 4GL2A 4Q7EA 6NULA 1ONPA 2G7ZA 2P9HA 3ZCUA 2J9XB 2GZAA 1VG0B 2NVUA 3DWIA 3WLKX 4F4JA 4ZHSA 3PGA1 3LW7A 2XLBA 4Y0NA 5ICEA 4DNPA 3GCWA 1K6XA 1YI8A 1U1FA 1ZOPA 2HK6A 3D5EA 3EHEA 4JROA 5JJBA 2WYOA 4LHZA 5JLJA 3QQ5A 4BCBA 1UM9B 1HG0A 2G4CA 1ODSA 3DEKA 5EVCA 3CX3A 1VL8A 3TEFA 2DPHA 3EZNA 2E6KA 2G72A 2PUTA 1O1YA 4PSCA 3EMDA 3SC6A 4CQLB 3UCXA 2ZZNA 4D56A 2AA3A 5K3FA 1RXYA 4FXOA 5U4QA 1W96A 4CL2A 4F7WA 4U4AA 1JR3A 3WYEA 1A97A 3TLEA 1YDMA 3KAPA 1VE7A 2XOXA 4OHYA 5TT1A 1MAUA 3OIFA 1SVUA 3HXMA 1HYQA 1QZTA 4AFNA 3RUFA 3Q6MA 4TM8A 2YHSA 3ZCSA 4YGXB 4LJ5A 1H1TA 4OUDA 1U1EA 2JCSA 3WIOA 1RHUA 3OLQA 4DG9A 5CXQA 1UKEA 2FR1A 3HNPA 3O5AA 2A59A 3KDSE 4ZU3A 3A6GA 1DOZA 4I8XA 1ODJA 1D6SA 3KZNA 3TDKA 2HTEA 3BDAA 3GLFB 1NQOA 1QHYA 1W25A 1TMYA 2O3SA 3Q6IA 1OIWA 3KX2A 4LRXA 2C9YA 1G9XA 2JAHA 2VO1A 4KRXA 1EFVA 2RD2A 2H4XA 2DFDA 3D5TA 3LSTA 1W94A 3SC2B 2GPTA 3HJCA 2PHZA 2EKLA 2SCUA 3FVRA 2HWUA 4LBWA 2JFOA 3PEUA 3RVLA 1MAHA 3R5KA 3UK0A 4HGZA 1OLSA 4ZHQB 1HO3A 2Q9UA 2ZUVA 5IP5A 4WFJA 3E03A 3GMIA 2LGJA 5JXGA 5CFOA 1XRNA 5KKAA 2ZVJA 2G1PA 3NNSA 1R4ZA 3VYRB 1RRFA 1R6AA 4AAYA 1K5PA 3HYRA 5JALA 1YONA 4LDQA 1CJVC 3OFJA 1ZD9A 3C4JA 1F0YA 4MSUA 1AA9A 3KOYA 2OQRA 1YT5A 4IDNA 3U9SA 2VBGA 3N2NA 4CMCA 3ESZA 4HO1X 4O2AA 1S4MA 4OGFA 5COAA 3O4RA 1GZ4A 3VU0A 4F4HA 3ZXUB 1QCCA 4YYEA 1U0LA 3DZFA 1Y33E 2VHTA 3JYPA 3SDBA 1XMXA 4B73A 4Q39A 4F9FA 4KR6A 1BHO1 1OILA 2H00A 4NDAA 3SSOA 2Q7XA 1RT9A 2RBEA 4BDSA 2YV3A 1NW5A 3A37A 3T15A 2YFQA 1EIZA 2OCDA 1O6BA 3UMVA 5A03A 4MA4A 2DBRA 3QMVA 3RBVA 1TO6A 2BI4A 2QJFA 4QGBA 4UJ5A 3TQIA 4EHKA 4F38A 3G0BA 1HE4A 2AG8A 3B60A 5FP0A 2OHVA 4PYQA 1CEEA 3GRCA 3PFGA 1NXVA 4Y6GB 1D2MA 3LPDA 4NU0A 4C4PA 1USUA 3KZXA 4CL8A 2ACKA 4MUGA 5A3QA 2XBMA 1LDNA 1AM4D 3TTVA 2CNBA 4G5HA 2YWXA 2OAGA 2CYBA 4AF8A 5K7SA 3RFXA 1VIMA 3R7BA 4EL0A 3BWXA 4MVWA 1NN3A 2P1RA 1T0UA 4WY5A 1M6EX 3VPCA 4CR6A 2OHJA 2J9RA 3TZ6A 3MTJA 4FDUA 4I6JA 5BT8A 1WZNA 5I4KA 4UTOA 5B7QA 1RRKA 2FN8A 1DOAA 4GYWA 4MVCA 1Z5ZA 2AFHB 4FFSA 4PGMA 1SVWA 4BU1A 1N2EA 2VJMA 4CLHA 2GEUA 3PC8A 1JHUA 1JIJA 3F74A 2V59A 4V0RA 2IS2A 5GJVC 5IARA 1J1ZA 2PM8A 3U62A 1KJ8A 5EJ2A 3TMKA 2XMPA 3ZDRA 1VPLA 3Q8WA 2PS3A 5FF9A 5CVCA 1RZRA 2A4MA 4D9NA 4EUEA 4MEBA 1FYVA 4HAWA 2VSFA 4FC6A 3N86A 1MX3A 1Y6FA 5IAAA 4ZN6A 4W5QA 2IK8A 1ZRMA 1JDJA 1PR1A 2VZEA 4Q24A 3WHLA 4D9EA 5A7FA 1JPNA 2GYYA 2VL7A 3VDQA 4YV2A 4B6RA 2ZS7A 1AHNA 2XOKD 2ZJ8A 3E3MA 3UC9A 3RS3A 2FEOA 2ZYIA 4WDQA 2X42A 4M0KA 1N5KA 3MD9A 4FCTA 4HX2A 3VZBA 1NT2A 2F1RA 4G25A 2HXGA 5HOQA 4UD2A 3PXUA 1WAMA 4G0NA 1WUJS 1W73A 2IHBA 3HEAA 1DBWA 3UAWA 3LPNA 2ZI7A 4H08A 3LX5A 4WACA 1M1YE 4Q9LA 5DTIA 3W2FA 3MWDA 2XJ9A 1V7PC 3DFFA 1NY5A 5CVDA 5GQSA 4YQZA 5IDVA 4KWTA 1MIHA 3IL2A 3CVYA 3DCJA 1LQUA 2A7XA 3BB1A 2ASEA 1LLDA 2OBLA 1O87A 2CXHA 4NZOA 4RANA 1IJBA 5K1ZA 3UHFA 4RPHA 3V4FA 1C8LA 3U16A 3HKEA 3AR3A 4TGLA 1YZVA 2BFCB 1KP9A 5DHFA 5EA2A 1UDRA 5LA6B 2LE0A 2ZBVA 1E2JA 2PUWA 4KB5A 4KBYA 3VOAA 5AW2A 4CEJA 4UUAA 2YFYA 5EP4A 1NFFA 2R8YA 1U2GA 3WC4A 4W9MC 3T9AA 3CO0S 2Q46A 1WD7A 3EH2A 4LNHA 3CMCO 4C29A 2CD7A 4EPWA 2NTEA 1W0CA 3GT7A 5JJKA 1COWD 3SXPA 4D6YA 2HK7A 5ESRA 2WFAA 2AN3A 1L4NA 1NA5A 4Q1VA 2REQA 3AW8A 3IT1A 1YRBA 2IF0A 1K97A 1XZBA 3DHWC 4ZMSA 4OL9A 1RKQA 4Y1RA 5FUQA 5EZYB 4DCSA 5J4HA 3E9DA 5FWDA 1KK1A 5GGYA 4AZ3A 5CH5A 3VR5D 1RWBA 2IGBA 2CDBA 2ORWA 2W6JA 5EGSA 4YJ3A 5ER6A 3VJKA 5BW8A 5K0JA 1O03A 3JZIA 3AQ4A 3O9MA 3H2GA 4WUVA 5EVJA 5JH7F 1RIIA 2I1WA 2HPZA 4J0IA 1XD9A 2OVBA 3GY0A 5LP1A 2YQ4A 2PXHA 4FGKA 2J87A 1AURA 2W2LD 1U3VA 3ANNA 3QE4A 4ND1A 4EI8A 1GDTA 1PEDA 3NVAA 4Q3DA 4M0CA 2REQB 1PFQA 1UBRS 3KXPA 4N5DA 2RGRA 1V26A 1P1RA 1ZK0A 3AW9A 5KAPA 4YRAA 3KCNA 4ZGGA 3O0DA 4WLUA 1X1SA 1TAUA 2Z30A 3ICWA 1O5TA 3A1VA 1DVRA 1NRWA 3ZZTA 1GG8A 3LCCA 4DKXA 1GPBA 4AD8A 1YR2A 2RHBA 3DYIA 3WGZA 4DWVA 2H48A 2I1VB 4KP7A 4TN1A 4E2WA 4MKFA 4YS6A 2R87A 1QYCA 2IHTA 4YMGA 1YV9A 4DHEA 3VYVA 3FMVA 3N2GB 2QD3A 3PIRA 3RS4A 2BCJQ 1SK9A 3O3CA 3PVZA 1Z5NA 4LVCA 1V3QE 4CV2A 4RPLA 4EFKA 4MYRA 4F1JA 3HUTA 4CLRA 5ED0A 4C2BA 3I2YX 1ZX1A 4TPKA 5DHTA 5ELLA 1PD1A 4MW0A 4IX1A 1Y3FE 5DGIA 4ER6A 1MO3A 5DYWA 1U90A 2J7PA 1KDRA 3IX7A 3GNQA 3WSTA 4BO6A 2EX4A 1IY2A 3VYUB 1QQ7A 5SYNA 2IZ6A 3WYBA 3CLTC 3PHHA 1EFUA 3VO2A 4DYDA 1QB7A 1U4SA 2BTOA 3KTOA 3Q15C 2QD5A 3TX2A 1XLTC 4LF4B 4CIYA 2A1UA 4LDAA 5FUBA 3JXEA 5IJWA 2V7BA 3FWYA 3A6EA 1KEPA 1Z9BA 4Y1GA 3COWA 5A5FA 2I8CA 2PS0A 2PV7A 4KIFA 3DZHA 4MRMA 3VJRA 4M21A 2FG6C 4YTEA 2INGX 1FLVA 3MJSA 1N6LA 4BUCA 1PVDA 3PLRA 3CJTA 3FKJA 3NBAA 1RQ7A 3JWPA 2CDRA 2YDYA 5LWQA 1XDWA 3H84A 1T6BY 4J16A 1PUIA 3AOEA 1MZPA 2ZCUA 2UUBB 2WWVD 3G82C 2AMJA 2LKDA 4CMEA 1GNQA 3KVNA 3P4UA 1GQFA 1KI8A 4KN8A 2X58A 3LQQA 4QSMA 3VUEA 2TRSB 1JA9A 2JJYA 1UH5A 5D1NA 5AKXA 2OCXA 1AZTA 3LL4A 5EESA 1XVTA 4GOXA 1NNUA 5D3KA 5HYVA 2FG5A 3KJFA 1YIDA 4TVBA 3J80A 1EFLA 1SM4A 4MITA 5DVZA 5GMOA 4BX2A 4AG3A 2IA5A 3ZHTA 3RVKA 5E3HA 2JAOA 5DN6A 5U9CA 3OLZA 2OT3B 3VJLA 2ZVQX 1RADA 2X8JA 1GFZA 3BH6A 1JAHA 1CT9A 2GVDC 4MKRA 3UKJA 2O1XA 2NP7A 1GNSA 2RI0A 3FOEC 1W85A 2JJ2A 4J2OA 2X9QA 3N8KA 5KX5F 1NZFA 4QPNA 1RC1A 1SMKA 5LQRA 1ND5A 3L1JA 1P73A 2WJWA 2F3UA 5CIQA 2P2GA 5K0TA 4MTCA 4LS3A 2V6FA 5FPSA 3RC8A 3KE8A 4HXYA 3BIFA 1DCTA 4G6ZA 5IU6A 2IL1A 1FVOA 4EW6A 2FN7A 3H3JA 3ND6A 4R5HA 1MAAA 5JHHB 2Q8QA 1XTJA 2JIQA 4WWHA 4WY8A 1BKSB 3OESA 4MCHA 4D82A 2G28A 4CCSA 3CO5A 4DZTA 1CRZA 3LM8A 4B3HA 4B6OA 4XSGA 1EBFA 3C5EA 4QHYA 1YQXA 3I1YA 3N9IA 4NAHA 1SN7A 1SKYE 2H2DA 1E1KA 1AGNA 2OHHA 4FZJA 5BSRA 2O1SA 4UATA 1K6JA 4PCUA 3DH0A 1QYIA 5BRAA 3KHTA 3L1UA 5ILQA 3S28A 3X1MA 3BCUA 1J07A 1CUZA 3OPXA 1E5TA 5E6RA 2FLKA 2PBFA 4AUEA 5IEJA 4DR7B 1ZXXA 1ACJA 2XYGA 3CUWA 3NIFB 4HUJA 2BDUA 1NRXA 4FOPA 1XAHA 3EIWA 3I34X 1MNQA 1GQQA 4CW7A 5ALVA 2RBKA 1A72A 1F2TA 3FPLA 1VKRA 4YCMA 4B33A 5BN4B 1FW8A 4HB3A 1Y7HA 1T9GR 1QWOA 3ZQUA 1EM8A 5AVZA 2BDTA 3HGQA 4WW0A 4JODA 4BZWA 4Y2RA 1XYGA 5KYWA 4E08A 4JLSA 1XALA 4B4UA 3ILVA 3QVKA 3IILA 3IQEA 2BFOA 4RM2A 1IMJA 4KXFB 3CH4B 4B6SA 3FFXA 5CEFA 2RH4A 3QEKA 3GLIA 3O4HA 3EGIA 621PA 1A9XA 1DC6A 1KY3A 1W2GA 3T7CA 2DB3A 3HFGA 4EKIA 4REOA 1TTTA 4IJUA 3GJ7A 3K71B 4R1QA 1NIPA 4D8WA 1NURA 3GRZA 1AS2A 1NATA 1ZWLA 2VTEA 4IVNA 4KQMA 4MQUA 1B8NA 1Q3TA 4HNAB 3ZBUA 1X0XA 3VR6D 2PN1A 3RSQA 3JQEA 1H8EA 2HIAA 2ZSKA 2KS6A 2QQFA 3AXSA 3CKLA 4CJXA 3PZRA 5CDYA 5JO9A 5KYWB 2X0EA 2FEPA 4QASA 2G5CA 2X41A 3HKBB 1I2DA 3W5VA 1FMJA 1O95D 1TJYA 1FVHA 3H2ZA 4B34A 4FZVA 4YRSA 5ALFA 1I4LD 1N9GA 3NT2A 4OGLA 2F8TA 4IDOA 4LJ8A 5A6SB 3VDXA 1QO0A 2OOKA 3VX4A 3R20A 3W9SA 4TL8A 1AV7A 1TF5A 4EJFA 4CR8A 4NOLA 1LBQA 2CJFA 4M55A 4B2PA 1H9CA 5K3EA 2XA9A 4RA6A 1H2EA 5L4SA 1QKKA 2C7BA 1C9NA 1PR2A 3AFOA 3CEAA 3JATB 1PDVA 2WTMA 3MJHA 4XVQA 3IOCA 2JHGA 4WK2B 1RCUA 2QUKA 1IOVA 3NDPA 5JYEA 1UJMA 3D8UA 3NWPA 3FLBA 2J8ZA 4BO4A 1BFKA 4MULA 1YVEI 3P9NA 3SFVA 1HMYA 1OXSC 4W5TA 5AJWA 3OF3A 4B3RB 4HADA 4ZVKA 2HWXA 2JIDA 2NZXA 2YMQA 1I1NA 1YMUA 4EUSA 2OY0A 2PGJA 3REFA 3ROMA 4GXTA 4DV2B 2QTRA 3PJGA 1NG1A 2BFFA 1DKPA 4KAXA 2G17A 2LCQA 5ES4B 4EG7A 4R5MA 5CB4A 1PKXA 1T0IA 3A2LA 4NG4A 4QOHA 1RVDA 3E9RA 4JP8A 1V48A 4NBWA 2GD1O 1SG0A 1JDVA 2OFOA 3B9QA 1GGMA 3AUTA 2JAXA 4HD8A 1N0VC 1VGVA 3QXJA 4RTRA 1JHMA 2O8EA 4DZZA 1L5NA 4ZQEA 1WF6A 1E9BA 3AL0C 5CDHA 1H65A 1UOPA 1Z0UA 2NAFA 1YZQA 4Z7JA 1K7YA 5GJBA 3UF0A 4LPSA 4C88A 2YHUA 4KHZA 5JD4A 4MJLA 1DJPA 1RYYA 2CLEB 4WKNA 5T64A 4E5DA 1N9KA 3UXMA 2W48A 1KI4A 2VDOB 4G5GA 4DA8A 5GVSA 2XSZD 1OXTA 4M8IA 3I6QA 4Z7QB 2QLTA 2PT9A 3E6AA 3L4BC 3O93A 2XR1A 4CI0B 1CB7A 1AUVA 1F4LA 1XEFA 3JAWA 5CT9A 2G71A 1DO8A 3W8NA 2VNJA 1E62A 2BFDA 3LIPA 2B0CA 4HLCA 4D4JA 2FSIA 2XZLA 4UQPA 1X80A 1T4BA 2F67A 3AUAA 3DW3X 3W6ZA 5IF3A 3F3KA 4Y3UA 3FPFA 2YXPX 1ZESA 3MEQA 2CUKA 4FE3A 2X9NA 3MJVA 5JTTA 1ETUA 3FD8A 4IXTA 3NHPA 1VCOA 1M9NA 5A5EA 2AV6A 1QG0A 3JQ7B 4LF9B 4MVXA 4ERNA 2VCHA 1QPGA 3MXOA 3O83A 3BC1A 1DX6A 1KF0A 5HIJA 2FK8A 4BRZA 1SBTA 4UBMA 3VDMA 3B5IA 4JL8A 2CV0A 2O50A 2MSLA 1JEOA 1TCVA 1Z3IX 2ZDHA 3Q9SA 3Q7TA 4Y2TA 1AY0A 3VBEA 3K6SA 1TUBB 1XR3A 3H1AA 2GLUA 1ORTA 5K4GA 3WK4A 4BNGA 4ZOCA 1EVLA 2V7QA 4BRSA 1ESCA 2IX3A 1ZSVA 3AHDA 1I3MA 2OZPA 3KQLA 3L8MA 4PS0A 2HR1A 2PRJA 1HK7A 2GDZA 3N0RA 1GPWB 1P33A 3N2LA 1R88A 2I2DA 4UVGA 4JEIA 1RI2A 3NBYC 4O63O 2OXIA 3CINA 1JXMA 2ZQZA 4HH0A 3NBMA 4WXEA 3U40A 3SEZA 4R71A 3T3DA 4G0WA 1JXOA 3MAGA 1N0WA 2OO3A 1NUPA 2B2XA 1ADCA 3QKSB 4LK2A 3IMFA 1Y37A 2O8CB 2PSSA 3HB7A 1WHTB 3QVWA 1EZ1A 4FWBA 1UQTA 2QRGA 2DRIA 2AC4A 1UKYA 4PFQA 1RLMA 4LZPA 3EVZA 1GUDA 4NECA 3WYAA 3AVUA 4J4BA 4DEYA 3WJAA 5LQMA 3EVDA 1YVRA 4EUNA 4PM4A 3ENVA 4B4KA 1RLJA 1WXWA 3NFRA 4FYWA 4MWTA 4U2FA 3IEKA 3SC2A 3JYNA 3WLNA 4D1YA 2QG4A 2QSUA 3OSUA 3Q11A 3KJNA 4OLHA 1K9SA 5J58A 3QVMA 4MARA 1R6DA 1C4WA 4DN6A 1Y6GA 4W7SA 1S89A 2NNWB 3A6HA 2Q6KA 3BIWA 1GSOA 3B20A 2FEMA 2SECE 3K5PA 4RVCA 4I36A 4DQLA 2I03A 4NAVA 2Q50A 5F2EA 4P31A 4C89A 1Z33A 3ITNA 3DDZX 3V42A 1YC2A 2IYYA 3OX1A 2XRZA 4UTNA 2FFHA 1KIAA 3D6JA 1ARZA 5LPNA 1DTEA 3GNLA 2C9OA 1ENYA 2J5QA 2VDRB 3NXSA 4PYNA 7GPBA 1A1VA 2HYIC 1OUMA 2AE1A 4EHDA 3N28A 1IQ0A 4EW1A 5JCZA 4DR4B 4QUHA 5AW9A 1E2KA 4N3GA 2XUDA 1DAPA 2YWRA 1X0VA 2G76A 1NOIA 2A5GA 2D3TA 1W59A 3EFHA 2CNWA 5DYIA 3I64A 3GZTB 3HVHA 1X13A 4QOJA 4QVGA 5L53A 3ICPA 1N36B 1AQLA 4RPGA 3WO1A 1ODFA 1N5LA 3DKVA 2ZRIA 1D6NA 3SNHA 3DOFA 4KGVA 1Q92A 4HGYA 2FR0A 1G9TA 2VDMB 2XAUA 4U5XA 4RH1A 4N65A 4EB6A 4O4IB 5BUCA 8LDHA 1E2QA 2JGJA 2ZXEA 1UBLS 2EEZA 1E8MA 1KDOA 2D2EA 3KTFA 2PMWB 2YY5A 1T0PA 3RGWS 3MC1A 1BROA 1C9YA 2GF2A 2VEDA 3GELA 4HWGA 4JBHA 4NC9A 5CX1B 4LBZA 2NIPA 1IN7A 1FP1D 3GD7A 1M2NA 4KMOA 4RXUA 3QVVA 3KEFA 2C5HA 1V7ZA 2IXBA 1JQJC 2Q27A 3KOUA 3AJDA 4HWKA 4X71A 3VNQA 3FGPA 4DSZA 2C2KA 2OAEA 4HAIA 1E1LA 2QWXA 2CV2A 2X7XA 2Z8XA 1G20A 4F92B 4PRKA 1ZP6A 5I7EA 2NN3C 1NWHA 5KPJA 3EN0A 3AKCA 4YJGA 2QW8A 3JR3A 2YL2A 3P97A 2WD8A 3C45A 4HHEA 5P8WA 4BAGA 1YZTA 2WNSA 5K01A 1NJ2A 2BJWA 5BNWA 5JMOA 4F72A 2R1ZA 2Y9MB 1AMOA 1N0IA 1D5CA 1UBSB 3PX2A 4OJQA 2G83A 3RSFA 2VJMB 4DLBA 2D8AA 4CM5A 1D8AA 3DCNA 2YN4A 4CVNA 2IP1A 3EXG1 1ADBA 1H1LA 1X1DA 2C4HA 3ADOA 5JSUA 4HLUA 2V1UA 2Z6QA 4DA7A 2NSJA 3KFVA 4K0RA 4RQTA 1ZLYA 1SO8A 4FM9A 1CU1A 3ZLUA 3G2HA 3ME5A 4Z1MD 2Z2JA 3SXUA 1SC1A 3ISTA 1T13A 1ZISA 5EMLA 1UWCA 1FQKA 1JH9A 1VHLA 2BLNA 4ZO6A 3KZ1E 4R2KA 4Z6KA 4GZ3A 1OBOA 3ITEA 4UM7A 4YR9A 3BIOA 1NMQA 3UWMA 1D1PA 5C8YF 1M6HA 1TO1E 1N7JA 5EZ6B 3EEYA 3M1AA 1CS0A 3W2EA 2O2GA 3R4VA 2X14A 3F4KA 2PX5A 3ZV5A 4LECA 4S05A 1KO4A 3RV3A 3RSSA 3L4SO 2VJBA 2XE8A 3MYYA 4GGMX 4Z7OB 4B3GA 4HTAA 1J0EA 5FR2A 1J0XO 1SJ9A 1R5OA 2HBRA 3DEHA 5T6MA 4BLPA 2UYGA 5FBRB 2I1LA 3SJBA 4E4RA 3EODA 3K8OE 1Y1SA 4QDTA 3NC0C 1IEQA 1TYZA 1HZJA 5EHNA 2ZZKA 4PLHA 3SC4A 1WXQA 4LE0A 4WEOA 1SZCA 2ACWA 1I3LA 2JZOA 3DLCA 1LKZA 2VK2A 4FMPA 1RYFA 4TLLB 3KYCA 3H9CA 1U11A 3GIDA 2V7VA 3RUDA 5JZMA 4QHSA 4ALIA 2DY1A 4EPYA 2I7XA 3G8DA 5AKZA 2VRBA 1GR0A 2P9EA 4DRZA 1NMYA 2ZM6B 5C80A 5DDIP 5CM9C 1UEXC 5KTPA 1ZR4A 4YT2A 5K99A 3MMNA 2EP7A 2VYQA 4YACA 3SCZA 2ANBA 3AFHA 3UT5B 2ID8A 3KVVA 3WLSA 1U0BB 4D6XA 1MEJA 3WVNA 4BAUA 3GPIA 4ND3A 4AWAA 1H8HD 5IVPA 2XUHA 3WLQA 4ESEA 1GHTA 1F6BA 1PZGA 1ZONA 2IYNA 3SQOA 4KVZA 3MTBA 4ND8A 1FJGB 3FRIA 1H2RS 2WQ7A 1IIBA 4UU7A 3NHFA 2H1CA 1WSWA 5ECGC 1DQYA 1EFTA 3PDHA 2OBNA 3FOZA 2YQ5A 1J99A 1M76A 4CKBA 4PPGA 1Z74A 4I50A 5IK2D 4LXYA 2FXVA 4JKYA 1ZI8A 5HF5A 1U8TA 2XB6A 3QEOA 4EW2A 1QH8A 2CL6X 3A0RB 4F3NA 1NR5A 5CT4A 3R7WA 4F9TA 1JIKA 2Z0MA 3DOIA 3DZGA 3C3MA 5DKFA 1PTKA 5E2BA 1EXNA 4U2EA 4F6RA 4O4JF 2YZ7A 1SCBA 2FZCA 1XAJA 4RLFA 1IAQA 4MGZR 5WRFA 3DYVA 4KAJA 2FOLA 2G1KA 4BVLA 1ZCBA 1BKDR 2HQOA 5JBNA 1N3IA 2IZOA 2BZ1A 4QQKA 4IAOA 1EVYA 3EBLA 2XPCA 3I0NA 2VSQA 2Q2WA 5J2UB 4BWVA 4D44A 2ZE5A 2PGIA 2FDRA 2WJIA 2ZR9A 2Q2OA 4PLTA 3ZE2B 2VJNA 2Z9BA 2XUPA 3ETCA 3GLGE 4ZYYA 2BDEA 3DDHA 2XY4A 5HP4A 1MV8A 1Z18A 3UHPA 2ZWIA 1HWYA 2EKDA 2A5JA 2CYAA 2FB9A 2ZPAA 3I28A 2QTVB 2UZ0A 4K6FA 2ODQA 5C7LO 1ZA2A 5A5VA 3VDRA 4N8SA 2NUTB 2PTHA 3BFVA 3I8SA 1KDYA 4KO8A 4CHGA 3W3AH 3DFIA 3HRKA 4G65A 1O97C 3A3YA 2QTMA 2WMOB 4TSFA 1P7YA 1QDLB 3SHQA 2EERA 4BUZA 1JJIA 1Q0HA 2D13A 1DFHA 3IQFA 5SZHB 3U4QB 3CN9A 1QDEA 2B6HA 1X2BA 2JAQA 1UINA 4E5NA 2HCTA 5KJFA 4Q9DA 2HH9A 2HV8A 2P3OA 4AP9A 1RM5A 1HA3A 3Q85A 2C77A 5MF6A 4C7OA 4M1WA 5MGBA 1TJ3A 2ZSUA 1OWLA 1AQ6A 2QVGA 3KKEA 4EJ6A 1E7MA 1ES9A 1LFDB 2JFZA 4GLFA 5CLQA 2LRHA 2IZZA 5JI3E 5C52B 1U3TA 2IS4A 1OB2A 5I4IA 4TT3D 4YCNA 3ABZA 2OHXA 4YQEA 2HQSA 1TF2A 4BNFA 2WUDA 1N7GA 1L1EA 3QEMA 4RW0A 4ZDWA 4MGKR 3KBOA 3U31A 3ZWPA 4X7PA 4KLNA 2XITA 2J5KA 2YNMC 1LVGA 1XCGB 1NKVA 4MZXA 1XXHE 3QIAA 3IUBA 2WSMA 5KHOC 2HPHA 4QT0A 3WLHA 1VG9B 5AQ1A 2A9FA 3CLVA 4YX9A 4X3CA 3HWRA 3ED5A 4KBFA 2NO0A 2L69A 1HMPA 1WXXA 2NYUA 1T3SA 1WY7A 4CBVA 2NV6A 3EXEA 1BAPA 1Z07A 4MR7B 1B74A 4QG7A 4LFCB 4BB5A 2H2FA 4DJTA 3RTEA 4J03A 4XJXA 4B3DA 3T3NA 1DT5A 2F3QA 4RV4A 2BBOA 4OX9B 2JG3A 1JDPA 1C7EA 1FNDA 4UFOA 3RVDA 1U2EA 4UEOA 1I0ZA 1IUNA 1TX4B 2BRUA 3VHQA 1QMGA 1W85B 1C7JA 3A0UA 3I5AA 1HF3A 5KCZA 2DJ5A 3IHKA 3MB5A 1ZAYA 3DTVA 4H0FA 4MDHA 4ZT6A 3RYIA 3AYXB 3O1HB 3DXFA 3KKKA 1DJQA 1JT9A 2IE0A 4I3HA 3STVA 1OVMA 1V11B 3CVXA 3AB7A 4IEIA 5AI8A 1XTUA 3ROEA 4M0EA 5BUSA 1ODIA 3H1TA 4Q02A 3AG6A 4FFPA 3OTIA 4I55B 1SXJC 3BWBA 2D8MA 4WERA 3GV0A 4TQGA 1NUUA 2XMCA 1ND6A 1UBUS 1HY3A 3FNGA 1M2FA 2IELA 1OFTA 3EAGA 3O38A 3RRJA 3FYCA 2JLXA 1SKMA 3TUJC 1CTQA 1EQUA 3OC6A 1YRAA 3OPMA 4ZAYA 1L1FA 1NN5A 1U8XX 2ILTA 1QHNA 1NBMA 3QFHA 5CT8A 2ODTX 3NYWA 4JH0A 4EENA 5LNK1 1JPVA 2BSAA 1QC5B 3GCXA 2I4LA 3L0CA 4POAA 3CXUA 5K0NA 3VVBA 5DM60 3RS0A 3W5DA 3P0JA 1A77A 4O4HA 4MPRA 2AR7A 4A03A 2D7DA 2QENA 4UDXX 5DF1A 1P1CA 3K0AB 5JDCA 4RF5A 5ALIA 1TYAE 1E0JA 4EQZA 5JDIC 4Z99A 3FSJX 4JIMA 3W5UA 5IRCD 4QM7A 2FOIA 5E0OA 3NBQA 2R25B 1IZZA 1NXPA 3NKVA 3OCUA 3P1JA 4HQ6A 4AMZA 1DEOA 4B40A 4DM7A 5A4DA 4MUBA 3QFFA 2JFFA 3PDCA 3BVPA 2PR7A 2HA5A 1ZL2A 3FSGD 4U2CA 4AICA 3D8BA 5EPUA 2IU4A 2CZQA 4FJ1A 2AZTA 3WBKA 2QXYA 4UAUA 4BNYA 3UPUA 4MRRA 2BP7A 2I2BA 4LHYA 1ECJA 3AF1A 3GMSA 1OA1A 4FCVA 3UJPA 4V1CA 3L6BA 4YDQA 1QHSA 3IVMA 3C6YA 2Q1XA 4L3VA 2PX4A 3E27A 2AFRA 1TK9A 4B6GA 4LJ9A 4D74A 1OZ0A 1ZK4A 1XTRA 4KYUA 4JJ4A 2GM9A 5H02A 2J7KA 2VH1A 3FYUB 3QXHA 4DRXB 1IVNA 1ZUHA 1TLFA 1UBEA 3HVUA 4AMBA 1JFRA 3OT5A 1P29A 1U6JA 5AMXA 2QMHA 4DBLC 2BBSA 4K40A 4PHFA 2AEMA 2VH2A 4AF7A 3OH8A 3I83A 2WWRA 3WNZA 3IKTA 1CR2A 1W46A 3RABA 4CETA 2NXNA 3PQ7A 2K87A 1AKTA 4EAQA 3AESB 3VHXA 1GRNA 2JGKA 2OHIA 1EVQA 4UUQA 4YAKA 4TZ6A 2FZVA 4DLPA 4FX2A 4RPJA 1K6IA 2EEPA 2PJUA 3DEAA 3R0XA 4FHEA 4F4IA 4GX0A 2ZBGA 3F2IA 2HWKA 4PZCA 3AWIA 1NC1A 3HSSA 4I5IA 1KYIA 4N39A 1X1TA 2JJ1D 4H1WA 2Y1FA 3EA0A 5CA1F 1JHXA 1L5VA 1KZ6A 1M8KA 1ZSYA 3PQ4A 1Z08A 4QA9A 4DMHA 1G5QA 3P2MA 1ZR2A 4NQZA 1RWMA 4BXOA 2AI3A 4ZZ2A 1QYDA 2JKZA 3R7DA 2VCEA 5EE0A 2Z4RA 3RLFA 3T5AA 1Q3KA 1KSGA 4F84A 2Y1EA 1KJZA 3ZGOA 1OWPA 1ZY2A 4JUDX 4MW4A 1VA4A 2EF1A 4MHOA 2JBAB 4FMCB 1DKRA 1OFUX 4OBEA 1ZG3A 5G3YA 4BKMA 5E9WA 5IJ9A 4GQAA 4IIBA 2DOKA 1OPRA 2GPJA 2FRVA 5TIIA 1C3JA 2FPRA 4K9NA 2YFHA 2OQIA 4NATA 1DRWA 2AN9A 2Q0SA 5EJFA 5FOXA 3ZV4A 1YU6A 3WNCA 4DIMA 1N2GA 4MPTA 4JVOA 3ZVLA 2QN7A 2W6NA 3N0WA 3KUUA 2QVZX 1LF0A 1VXRA 2CLMB 2VI5A 3EBOA 3QUQA 2BR4A 4NENB 5FULA 3OZRA 2I4RA 2QRVB 2W6CX 1M73E 4HNAA 4NE2A 4Q3EA 2VOJA 5LXTA 3U5ZB 3K0SA 4BQSA 2PRSA 1MJNA 2CXQA 4LY6A 1H4VB 1H2ZA 5CYOA 2WTXA 2ZE8A 4QRHA 3ETHA 2AGVA 3RM3A 1D1SA 1E2EA 1E9AA 3C87A 1U7XA 1L6RA 4LQDA 2D2IA 2RK6A 4I14A 1E1DA 1L5SA 4GP9A 4TVOA 1R37A 5KI6A 1GU1A 4EB0A 1W93A 3DBIA 1T4CA 1ZL0A 1I2CA 3LJKA 2HRDA 1SUEA 3TAHA 3NMUF 4TMFA 1T8YA 3QKRA 1NXQA 1A4UA 3O8QB 3U61B 1QIFA 2JIBA 4WI1A 3TVTA 4EDFA 4LF7B 3DOCA 4JLBA 5CK4A 5CD1A 1CUXA 3W7BA 4KMSA 3GPLA 1GL9B 2AK2A 5LL6P 5D1HA 2R44A 2V74B 4BN0A 3ZN2A 4DG5A 1U0TA 4UEJA 2G9NA 5I6DA 4LNUB 4F96A 5IKXA 1O4VA 2ISSD 2X4GA 1UBKS 1ATIA 1V3VA 2JGRA 3K15A 3LT5A 3OEYA 3BDVA 5CJ2A 3SMVA 3NB0A 1EJ0A 3JD1A 3SAJA 2P77A 3AMVA 3FVQA 2B20A 3GFBA 2NVOA 1YDWA 2J1LA 1G3UA 2Q4DA 4MGEA 3ADBA 1VE1A 3A3NA 4HNGA 1BXRA 1GOTA 4X41A 1OGYA 1A7KA 1YOBA 5ALWA 2CLCX 2DH6A 4YWHA 4U3JA 4R2WA 2XA1A 5CJJA 3GGDA 1TI7A 4ZCIA 2ZGVA 4RY0A 4GPAA 3JQFC 5ERGB 2RAFA 3O1IC 2G9QA 2RGGA 2W0MA 4EYQA 1Q5PA 2J46A 2BE9A 3KOMA 3QKSA 4N5HX 4GRAA 4FX5A 3RTGA 4JYPA 1GPMA 1NUAA 3WBBA 1QE3A 1LTKA 2OO7A 5ALXA 3RFTA 2AS0A 2Z3ZA 4A16A 1LPOA 3PTAA 4ROTA 5LKAA 1ZHHA 2WA1A 3OQPA 2NYAA 4E09A 4Y2QA 2BONA 5KU1A 1QR2A 2XXBA 3E9EA 1PK7A 1E79A 2X40A 1Y8RA 4GOKA 2XNSA 3BCSA 1GL6A 1PJAA 5FV7A 3T1QA 2EJBA 4R01A 3VTKA 3WHKA 4D2IA 4IR7A 1DI0A 3FZQA 4RGQA 4CKXA 2W2NA 4CXMA 3QUCA 1XRSB 1G2PA 2ZR8A 1IOZA 2C9MA 3ACBA 3D8TA 3IERA 1QH8B 2VNKA 3QLUA 4A26A 2IW1A 1MVNA 3E2MA 5E7JA 3S5JA 1U5CA 1P8AA 4LNAA 1GZUA 2IUYA 1B8PA 3M4ZA 2LR0A 4UBJA 4B2LA 4IKOA 2JFUA 1TZ2A 2A92A 2YYZA 5AW5A 4AROA 4UE6A 1XPJA 2A7QA 3AEUA 1YMQA 3OWXA 4IDHA 1U1GA 3FW1A 4YRLA 4AYTA 3T34A 4KYTA 1IBMB 2GJAA 4HPWA 4C4OA 1IXYA 3BJEA 5IPFA 3I12A 3MCZA 1U04A 4QE3A 4LBVA 3RC2A 5L3ZA 4F0JA 2FSGA 3KALA 3F7MA 1E7WA 5FFNA 4ZCLA 2P68A 1CY6A 1JSXA 3BEDA 3HY3A 3IP3A 4AN0A 3JVEA 1LY1A 1SBIA 4Z4HA 3HJFA 5JAIA 1R6TA 1JSLA 2O57A 4MYDA 1XE3A 3AHFA 3IH5A 2ZBDA 3R8FA 2BFCA 3K6JA 4QDZA 3P26A 4LTMA 4MEJA 4AULA 3M82A 1U1DA 4XPIB 5F35A 5IJ0B 1CRQA 1QCYA 4PYIA 2D1QA 1VJ5A 2FLWA 1SK8A 1GNRA 3CX6A 5KNDA 5K0LA 1KI9A 4IJKA 3P9QA 2H06A 5HZGA 5EIFA 3OP1A 4DYVA 2GASA 1HTTA 2G82A 4BLWA 1Y9ZA 3TINA 3WGLA 1IHYA 2DKNA 3MMPA 3IMEA 5DNEA 2WP8J 1OTXA 1SG6A 1YRQA 3HU2A 4QGHA 1EK5A 5K8UA 2CVHA 4ENQA 4X1OA 4KIUA 3WZLA 2PMDA 2QBYB 3GAAA 1XHEA 1M8GA 1DKOA 4YRZA 4ZYUA 1FP2A 3D0QA 3OLWA 1XDDA 1D2RA 4LXIA 4TLCA 1GGJA 1TM1E 3GA0A 5BSKA 3QBVA 5AW0A 1VKNA 5BV8A 3JYHA 1OXBB 1DKQA 5KTKA 4CEIB 2RDMA 3IIMA 3RRZA 3X1YA 1MLDA 2HZ7A 2V6IA 3RF7A 2BGTA 2JASA 3IAAA 3PI7A 3UK2A 3H97A 1FTWA 1RJ9B 4JBYA 1DV2A 1XTKA 2ZBRA 4UM5A 5JDIA 3ELUA 4IH1A 1YJ5A 3ASUA 2B8JA 1VLJA 4FFBB 4MDYA 4MQEB 4HPXB 4RD2A 4YASA 5I7AA 3RJZA 1NNSA 4AIIA 3PFIA 2QN8A 1GJRA 1G6HA 1G8MA 4UHJA 2A3NA 3S1AB 3TEMA 1CF9A 3ZKWA 5HPYB 3DEYX 3HDYA 1Y6QA 1XCBA 2GNOA 2JNWA 3AVPA 3OIVA 2J4DA 2BFPA 2VK8A 2QUZA 3F6EX 3IUPA 3TGWA 1YMVA 4W4TA 1E6LA 5J63A 4P0PB 1JL3A 1TZKA 4HGRA 4F56A 1L9XA 1JR6A 1WNTA 2ERCA 1I6KA 3GN1A 1SC3A 2XDQB 3M8KA 2JAUA 3UJDA 4RTSA 2JPDA 4LXUA 3O94A 4DZRA 1PT7A 2QYHA 2H6EA 2Y93A 3QE0A 1PFYA 2IPMA 4NTZA 3ROPA 4UVHA 1KPIA 2DULA 2ORYA 3FHLA 5K6AA 4JR1A 1H8ED 2PVSA 2WHRA 2Z2ZA 3P2IA 3STYA 2PAFA 2ZJ5A 1WULS 2XVYA 1XLVA 1CCWA 4LMBA 5EMNA 3BRQA 1GPKA 3GFPA 4OY3A 4BX9A 1Y1KE 4UBKA 2X1LA 4XOIA 3TFOA 3R1IA 1E58A 3ILHA 4L72A 1ZKMA 3LDUA 4F5EA 4BBAA 4Y2JA 3NPAA 4GDFA 2JFVA 2Z95A 4CQMB 4IV8A 1QFXA 1EWYA 1KZ1A 4IJ6A 5JO0A 1J5XA 4LV8B 3T4UA 5HJEA 3H3XA 4JKIA 4WFQA 4CIVA 3HKEB 3TTTA 3TXAA 2RC6A 3LYHA 1XROA 3G9ZA 1CUIA 4ZAFA 5D00A 1UJNA 4KPEC 1Z7YA 1KYWA 4UU0A 3RU2A 1LEHA 5KQLA 2DKFA 5FJJA 1SBCA 5GONA 2O2ZA 4DC9A 4CNBA 4X94A 1CZKA 2ERXA 3RR2A 2YNMA 1Y4ZA 1DT3A 1RLOA 5CX1A 1EWVA 1DO0A 5ALMA 1B43A 4IRMA 2FX5A 4IFBA 1ZK1A 3AI2A 4MKGA 4LAFA 4NCKA 4C01A 2R7LA 1CQIA 4YT5A 1E6MA 3WJ1A 4IJMA 2CMFA 4IZHA 4KLAA 1Y5LA 1BJKA 1ZEJA 1UKZA 2BPOA 4MV0A 4GLJA 4QFCA 4FYKA 4E2FA 4R2LA 4DTIA 2FZKA 3GZJA 1SULA 5KOIA 2Z8YA 4ROSA 1RJEA 1RM4A 2UZIR 4W99A 4EG3A 1XDGA 2Q5OA 3H0EA 4Q4HB 2MT9A 2W8BB 4N0MA 4G4JA 4X84A 4P4LA 1E66A 3IBCA 3Q1LA 4EJSA 2PLNA 3SD7A 4BNVA 4DEVA 1ADYA 2PMFA 2FX3A 4E2XA 1PR6A 4XKJA 2IPAB 3FR8A 1VI5A 4OI1A 3QPCA 2FUG1 2CXPA 4EECA 5CPFA 4D6PA 4TZ0A 4KXMA 5J40A 4EGSA 3S2YA 2PD4A 1QOQB 2C8KA 2JFXA 1LVUA 1QX3A 2E87A 3K9WA 3MTDA 3R40A 3U6KA 4DJFC 2WQZA 4D8UA 4CTMA 2BN4A 2P40A 1HT1E 2LNDA 1E61A 2QGFA 1ISIA 1N6HA 1W1IA 1Z0ZA 3OZTA 3BRSA 3DD1A 3AIIA 3A06A 4Y2PA 3FPJA 4GR5A 4QEKA 2QP3A 1YQ9A 3WOHA 2DFTA 4XWAA 2QQ0A 1SIOA 4ZCQA 3H4TA 2HSEA 2OB1A 2QTZA 1OKKD 2DHRA 3LO5A 3LWNA 4GM0A 4UTZA 2PO5A 1I0IA 3SI7A 2OGWA 4WKCA 1DAEA 5ENZA 3WQQA 4F2PA 2WIFA 3N87A 1SD5A 2IP2A 4JQOA 2WG2A 4DFDA 2IYAA 3JQCA 2WDZA 3DLPX 3BMNB 2C5AA 1KVUA 4FHFA 5C2JB 3L7MA 1OY1A 3RBAA 3ENNA 5DGXA 4AJOA 3T1TA 1QKIA 4Q6WA 2B25A 5D8DA 4POOA 3EIOA 5GZ6A 1J23A 3DUFA 2J5BA 4Q37A 2VQDA 3TB6A 1NHWA 3SG0A 4X66B 2OL4A 3E4DA 4YIHA 1BX0A 2QF7A 1RI3A 4TUYA 5K0GA 2HA7A 5CGQB 1X74A 1NLYA 3SICE 5DBIA 3KCQA 4QQNA 1LV7A 4C4RA 3FOAA 1NRIA 2HRCA 3K8ZA 3NWOA 3ZWWA 4MKXA 4HGPA 1X6VA 2OILA 3ZQ6A 4Q1BA 5L7WA 5F3WB 4RAOA