4PGAA

Glutaminase-asparaginase from pseudomonas 7a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINASE-ASPARAGINASE
publication title Ion binding induces closed conformation in Pseudomonas 7A glutaminase-asparaginase (PGA): crystal structure of the PGA-SO4(2-)-NH4+ complex at 1.7 A resolution.
pubmed doi rcsb
source organism Pseudomonas sp. 7a
molecule tags Bacterial amidohydrolase
total genus 117
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pgaA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4pgaA01
4R8LA 1JAZA 3ECAA 1WSAA 4PGAA 2WT4A 1HFKA 5K4GA 1JJAA 1ZCFA 4ECAA 4RA6A 1HG1A 5K3OA 5K4HA 4RA6B 5F52A 2D6FA 2JK0A 3NTXA 4RA9A 5CBPA 1DJOA 1HO3A 1ZQ1A 4RA9B 5I4BA 5CBPB 2WLTA 5DNCA 1IHDA 1HFJA 1JSRA 5DNDA 3PGA1 5HW0A 2GVNA 4Q0MA 2P2NA 4R8KA 2HLNA 5I48A 4NJEA 2P2DA 4NJEB 5DNEA 2HIMA 1AGXA 3NXKA 1WLSA 1DJPA 1O7JA 2OCDA 5I3ZA 5K45A 1NNSA 1HG0A 1JSLA 1HFWA 1WNFA
chains in the Genus database with same CATH superfamily
3IQHX 2YQ4A 1N6OA 1QRAA 1RHMA 1NRJB 4FX2A 4K6OA 2UZ3A 1OU4A 3EXG2 1DZ3A 2W6ZA 4WNCA 3RJ9A 5L95A 5JNVA 5IFLA 3FSRA 1L5FA 1WG8A 5DM4A 1JW9B 4WD3A 4IX9A 3WXBA 4DCJA 3GUYA 1OKKA 1SQFA 2GZDA 1R9JA 1U4OA 3ANYB 3DTTA 2P75A 3F5QA 4NOLA 4Q02A 1OAAA 4OLHA 1NKVA 2GJAA 1B6RA 2P6MA 2GN1A 2NTJA 4JNKA 2DPXA 1M3SA 2EZUA 3PGXA 5BRNA 5L4LA 4RD3A 5DLEA 4O2RA 2MYPA 4DWVA 1CUDA 1HA3A 1TYZA 2MINA 3KOOA 3QLUA 4G41A 4FXOA 4J9VA 2P6UA 1GDTA 2AIRA 3DVLA 4EHIA 3O3OB 1YJ5A 2NUAA 3OU7A 3WL5A 2PLWA 3QLVC 2ECFA 2NU9A 1YZKA 4XJSA 4XI9A 1BX0A 3AR8A 4OU5A 3OT5A 4I7EA 4YP5A 1NURA 2P40A 4LJ9A 4DMCA 2IH4A 3HSKA 4M1KA 2ZRPA 2JGNA 2JGEA 4B35A 1EXMA 2O2SA 4PO3X 4EPVA 1OH7A 3L4EA 3OFKA 5B6PA 4EA7A 2WICA 5I8ZA 1J20A 2FEOA 2J46A 1ZZGA 1SG9A 1RRPA 1Y48E 1CUFA 1RLTA 3CHYA 1E20A 1X7ZB 5KQMA 4L27A 1P1RA 4QOJA 1XAIA 3FMOB 3PGA1 4KDEA 1K92A 2HCTA 2PEYA 1S4QA 3R5SA 3WLEA 2DWOA 2B1IA 3O92A 3DZHA 2ZTUA 1HLPA 3C7AA 1SHUX 1SCAA 3MUFA 4JP5A 5MGBA 4G4JA 2G17A 3LU1A 1XRLA 2D0DA 3DBIA 3L40A 5I9MA 2WIBA 2UYCA 4DKJA 3HCPA 3RODA 2YHIA 3R5FA 2WF9A 3A25A 5BWCA 4IDPA 2O8FB 3PJFA 1IZ8A 3EEOA 1K75A 4OP2A 3TO5A 5F64A 1QP8A 4JOCA 4LRXA 4TXHA 3TQTA 4FGSA 3RC7A 2XT0A 3UZUA 1ECGA 3CF4A 3KFLA 3I39X 4HFMA 4KO8A 4RMGA 3PGKA 4Y7CA 1J4AA 3VTFA 2NXJA 3GLVA 4UUQA 3PYLA 2X7HA 1ZU5A 2XIJA 3HBAA 1Y8RA 2HTFA 1WDWB 2L17A 2VHYA 1WB6A 4CQLA 2RAFA 3GRYA 3KKOA 1QV7A 1JPNA 5GQSA 5DBEX 3AVQA 5FUBA 1XRSB 2YHAA 1OZGA 4U7TB 1P7ZA 3WB9A 2DUNA 3GLIB 3GPIA 4GIBA 3RF6A 4AN1A 3CTPA 1XCLA 1T5LA 2WT8A 3PKJA 4TWIA 4NENB 2AN4A 4Q1EA 3PC8A 1XAGA 4RTLA 1RQ2A 1ZVJA 1D4FA 3MGBA 1NUTA 2QENA 3D8HA 1BWQA 4ZYTA 4X1YA 2CUKA 2O05A 1MAAA 3O4GA 1JEOA 2QVYX 2IWHA 5HE8A 4LK3A 4DWJA 4FP9A 1V39A 3A4VA 3D1VA 1ZIOA 3Q5EA 3D3JA 3RSZA 1AGRA 5A0VA 5FPPA 3FR8A 5HA5A 1JWBB 4D42A 4D56A 1X2EA 1RKQA 1DRUA 1U8AA 2JC3A 4K9NA 4QC2A 4YPFA 4MYHA 2XCSB 4DANA 1JDVA 1OT3A 1WV1A 2ZE5A 3DTNA 1BQEA 4DB2A 3E5NA 3CA8A 3Q1LA 1OZ0A 3IEVA 2CHQA 3N5CA 5EKSA 1PFWA 1EFAA 5IU6A 5A05A 4E5VA 2W8BB 2VF2A 2O14A 3O7MA 5LJIA 4TV8F 4XIJA 2XYVA 3DMTA 4BMYA 1MC1A 3DE7X 4H4EA 4ER0A 5BSHA 2JFZA 3O91A 4K9SA 4WBNF 3BULA 1TVMA 5DWVA 4TXMA 1B16A 2REQA 2V55B 3Q6NA 2PRJA 1CIPA 3QE0A 4K7JA 4WECA 3TAXA 2IQ5A 5KO2A 4IIVA 4X6YA 4BRUA 3UB4A 3ZDXB 4MUNA 3W3AA 3UCXA 1ZDMA 3FDZA 3ZQUA 3FHCB 4UM9B 1KYIA 1CT9A 1XUOA 3HVIA 4MLZA 1LBSA 2C7QA 2ZRFA 5JJKA 1DELA 3OESA 2Y0PA 3QTTA 1DUIA 1JLSA 2O48X 3GRKA 5IAKA 2FW0A 2EHJA 2EZTA 4BU0A 2F3SA 2OAP1 3PHIA 5G4KB 3OCCA 5A9SB 4UNNA 2XUZA 1WIWA 4QG3A 1PFUA 4Y0AA 5CM8B 4E46A 5JS7A 3PF8A 4XDHA 1I36A 4E5NA 1A9SA 1EWRA 1F1BA 4QYIA 3RBZA 5B64A 5KVAA 3GGCA 3VVMA 5FLKA 3CH5A 4DG9A 2JF0A 3T3NA 5JUWA 3LX8A 3AVVA 4MUHA 3IA2A 1JR2A 3FOAA 1ACMA 4R5HA 3T7IA 1DT5A 2PSEA 3M4NA 3SM3A 4TVOA 2YJZA 2JGJA 3IPAA 4DGQA 4X92A 2WDPA 4QXQA 1OI7A 1QBKC 1G55A 1VM6A 1NASA 1EFTA 3B38A 1Q7BA 1SVMA 4D8WA 5A3RA 4QXMA 4B8ZA 1QVAA 3DAPA 2E4VA 4K03A 3T35A 2UYGA 5JR3A 1QIGA 1X1CA 3KWLA 4UCXA 4I5GA 2I91A 1V8ZA 1ZH2A 4W1QA 5AW8A 1JLLA 4OQXA 4BY9E 2ODBA 4JLDA 1T9ZA 1U80A 1HDYA 2IEBA 3FGNA 4R2IA 3GG9A 2HU5A 2ZXEA 1OLSA 3GGJA 5ES3A 2XX3A 3KLNA 5E2AA 3M3DA 2Y27A 4D8UA 2GHRA 2VZ9A 4IJUA 2RGRA 5C81A 4RENA 1PGNA 2NO4A 5FNVB 3CX6A 2DLDA 3N8DA 2ONJA 2QYOA 3NGMA 4X3PA 2Q2VA 1DQZA 3H5LA 3WS7A 4MRNA 2CNNA 4HQOA 3S27A 4KITB 1TJ4A 4ER6A 4KMSA 3QXJA 2O8DA 3ZDZB 4JA0A 1Z0AA 3TIGA 3DD5A 4Y2JA 3WRXA 4DNQA 4A26A 5KNBA 4BAUA 3VTKA 4CIYA 1YULA 3ZE1B 3IP5A 4JKIA 1QO9A 4X3CA 1TMOA 2H0RA 2IIQA 3DVRX 3U3JA 5BWBA 5CLJA 5JQGA 2ZW9A 3F73A 5JVDF 2GGSA 2HQSA 4OD0A 3IQEA 4JR1A 3EXG1 3LCUA 3OQIA 3HR4A 2OYCA 4BE4A 3MCVA 2Z8XA 2A8YA 4NS4A 3S3TA 1JPVA 1Y6ZA 3WNVA 1KY2A 2NQ2C 3P0RA 2PAFA 4G0ZA 2WE8A 3T3PB 3T12A 1KEUA 4B3HA 1JHRA 2QHXA 1MNQA 3TFOA 3ZVNA 4KH0A 4F4CA 4TS1A 1AO3A 2H4WA 1BDMA 3GJSA 3DZFA 2YMQA 2ZPAA 1QB7A 1VBNA 4LJSA 3PF9A 1USKA 3U3KA 1OGIA 2WU4A 3N5KA 5DB4A 1Y81A 2Y1GA 1I0ZA 1Z74A 3UXMA 1X80A 2W6QA 1UJ2A 4UAUA 4DEVA 4YRSA 5AM2A 3M4JA 4GX2A 4FINA 4J6EA 4YDHB 5EZQA 4NDZA 1K7SN 3KEQA 1EXNA 2XT9A 4E1VA 3I9NA 3VR5H 5DP1A 4RA9B 3TWOA 1WUIS 2WA1A 2WYWA 3QTBA 4OBBA 2YVLA 4WADA 2WD7A 1D2MA 2ONYA 2ZJBA 2FSGA 3EZ2A 2QZ9A 4G67A 1O5OA 1DS6A 1ZCBA 2C8KA 3OJWA 4ZOLA 3BS4A 3B7GA 3H4MA 3ISTA 4ER5A 4B17A 4YV2A 1XTPA 4PRZA 4PQFA 1XMXA 1J0BA 1WY7A 1XD2B 4M55A 3S2IA 3W79A 5GONB 1ECPA 1VE5A 4GP6A 2CV0A 4WOPA 1QGUA 3MJDA 3PXEA 1VJ5A 3O6VA 4AAYA 4MGEA 4NYJR 2HBRA 5F9MA 3OUZA 4ZDKA 5FWNA 1V8FA 5ERXA 2XJ4A 1XAHA 4QGSA 1Y4DE 5FI5A 1UOEA 4QO7A 2JLBA 3VMMA 3WQBA 4L9RA 3NTQA 2J0EA 3HL4A 3RVLA 4JP1A 3T1QA 1ZR2A 1I4EB 3HN2A 1T5HX 4MGYR 2FVYA 2QTGA 3HH8A 3FDXA 2RH9B 2RK3A 1L7DA 3HCAA 2C2KA 4OGWA 5EY5B 5EAIA 2VDUE 3O75A 2C4KA 3Q2OA 1LLDA 2QD3A 2VR1A 4UCQA 8ADHA 3AF5A 4HOYA 1MX5A 1VC2A 1WS6A 2OV2A 3JWHA 3WQSB 1KYQA 3PQEA 1TM5E 3N59A 3R6LA 5T4EA 3RG2A 1VHQA 3AZQA 2OEPA 2N9UA 4BZZA 4AZSA 4MKZA 5IT4A 1H2XA 3FPBA 1FPMA 3KFVA 1FNCA 4JR2A 1YS9A 4XH9B 3O9VA 1YBAA 2W6JA 5E7QA 1CTQA 4CVNA 9LDBA 1EGVB 1Q7RA 4Q6BA 3TLBA 1BMFA 4IVRA 3R9XB 1I2ZA 1PDOA 3GO4A 1G8AA 3P0EA 2J0UA 3VYRB 2IP1A 2IVFA 2Q99A 4MVJH 4U2CA 4QBHA 1ZHHA 3HKEA 3QOXA 3I01M 2FP4A 2J07A 3DR5A 5EIFA 6Q21A 4L9SA 2V0NA 5FF9A 3ER9A 4UTVA 1AKNA 1W6UA 3G5LA 5F1OA 2C92A 3MK31 1CUIA 1DUVG 3MD9A 1RXUA 1H4TA 1V1JA 3DTVB 5I4KA 4F1KA 4I3FA 3AHIA 2ERYA 2WT9A 2ATXA 4NBKA 1OXKB 1LBTA 4HY3A 4KDCA 5DIFA 3JQEA 4B40A 1SD5A 4YJ3F 2RHLA 5C1IA 4LJYA 1EX1A 3PXGA 3DZJA 2QBYA 1OCEA 3EFBA 3JQCA 4K26A 4NS1A 4H3SA 1SXJA 2FYTA 4B7CA 1QKKA 5EUBA 4F84A 1KVUA 1U2TA 1HORA 1GZ4A 1W0CA 4ZO7A 4YUAA 1EGMB 3FJYA 1ZC3A 4DIFA 1FJXA 4FSHA 2ZE7A 3M5DA 3KXKA 3JW8A 3SSAA 4QT0A 1JI3A 3GMDA 3BD7A 3DLHA 3D9QX 3O8QB 4RANA 1Z6XA 1ZNYA 4WN9B 1U8YA 4LIPD 5ERYA 3KQSA 4UOQA 3DMGA 2XTAA 2GERA 1IXYA 3LCVB 3LFHA 2H2DA 4N5IX 1FMTA 1BGWA 1DI0A 2WZQA 2X9VA 4M49A 4OB8A 5C35A 1GILA 3QF4A 2GLUA 1MP0A 1NUSA 4QM6A 4MLCA 1X8LA 3F6EX 3KJGA 4WFJA 3RBXA 1FVHA 4IXTA 1P9RA 2XAUA 1NW6A 4HDSB 7REQA 1QU2A 2V6IA 1OWLA 4DJAA 4FFOA 4FKMA 1PR0A 3STVA 1D2RA 1S3GA 2H1VA 4TMWA 3S2FA 4DDKA 1YJAA 2JCGA 2WU8A 4HAOA 4MR9A 4DGSA 1OFUA 1IHYA 4JB3A 3TLGB 4F86A 1Z88A 2G6BA 5CXSA 5KYGA 1M8KA 1QCDA 1R6BX 2WJAA 2Z9CA 3FVVA 4X1KA 5C8YF 1TC2A 2VDLB 4KUEA 3JS5A 4UFOA 4L72A 4WMLA 4DSNA 4QQ8A 4QUGA 1NP6A 3ROEA 3ZK9A 4KQ1A 3KC2A 2ZQYA 5JPDA 2EP5A 2BBSA 1NA5A 1GAXA 3WIDA 1E3WB 1KI9A 1Q1QA 1US8A 2H2WA 2HOQA 3FNGA 3KJEA 3WNDA 4BX2A 3UPTA 2VEDA 2JK1A 3PX3A 3GW8A 4KODA 1B74A 3B7WA 2ZTVA 3TDKA 3V4FA 4A0HA 5LM3A 2C2MA 2GUWA 2X5OA 1OILA 1PT5A 2QZZA 5KYVA 1G16A 5AK6A 2ZI3A 4XSGA 4ESVA 4KPFC 5CPBA 5AKEA 1ZIYA 3RABA 3PPXA 1DAEA 1JJ7A 4ENQA 5KJ6A 4BZQA 1SXPA 4QYXA 1AF4A 2A5LA 2NV6A 3BMNB 3UWMA 5HX7A 3G88A 1YU6A 1RHUA 3DYIA 1LS1A 1JT9A 1RR6A 4NBLA 1HTTA 2XI4A 1X8XA 4TTRA 5FWDA 1CZKA 4P4SA 5T64A 3RJZA 1QGYA 4J16C 1N33B 2PWPA 2V8BA 1DXHA 1TJ5A 4RGYA 4CLOB 2JRCA 4JASB 3OSUA 4OU4A 1BCRB 1PLKA 3FLAA 5L3QA 3GFPA 1VXOA 3RC9A 2IEYA 2ZQ5A 2H9AA 4B6QA 4UFPA 3BXHA 3FHJA 4MWOA 4L8YA 3JZFA 1JEQA 4S04A 2LKCA 4H6XA 2AHOA 1YAHA 4EQ6B 4AROA 4LV8B 1J90A 1GQYA 4MCJA 3PUVA 1F14A 5JH7A 4BUCA 4LE1A 3GN2A 1I4WA 1VSQA 4Y2GA 3Q2IA 5L3SA 2OGUA 5I9BA 4RF3A 3URMA 1HLDA 2BM0A 1GTG1 4DW8A 3V6LA 1AV6A 3FSGD 1SRQA 4MJ7A 3VSAA 1DCFA 1N3BA 2CBGA 2FK7A 3UJ8A 4BMNA 3CLSC 3EIWA 4F5EA 4ENWA 1CEEA 3B9QA 3K09A 2IPOA 2JCBA 5BSTA 1V16A 1JQBA 1XCGB 5C31A 3AEQA 3BRWD 4KBFA 5K0ZA 3EZFA 3BVPA 4HNSA 1TTHA 4URWR 4HXEB 5EIXA 2BEVA 1SHZA 3KWFA 4M83A 4UUAA 4C43A 2OXRA 5CDUA 3CMMA 3ENNA 3K32A 3ECSA 4RA6A 3MOIA 2HSWA 3MF4A 3PZRA 2Z4SA 4BX8A 2PUCA 1Z7WA 2HJVA 1E7SA 1JVSA 3LUFA 2IV7A 4NV0A 4CFSA 4YMIA 3TINA 3ZZTA 2WIJA 5TMEA 1WVMA 4MWGA 4BFWA 4V3BA 3RTBA 3O5AA 1OOEA 1I1OA 4QDJA 4GP9A 4NCJA 2GF2A 1L1RA 2AOVA 4S1VA 3S2GA 3ZCVA 5HM8A 3C3YA 3I04A 5LQUA 1E61A 2GARA 5D3KA 1SBIA 3RH0A 1NVAA 1PWHA 4FGZA 4QFBA 5CW2A 1VYHA 1QMGA 4RPCA 3THOA 3W6ZA 4JBYA 4KFCA 3GY0A 3GXOA 1SCQA 5D51S 3SIPA 5JSUA 4WCFC 2WSSD 1YKFA 3T3MB 3VO8A 3U4QA 1SELA 3WLSA 1IBLB 5EWLB 2PN1A 1XD8A 3L1JA 3IPXA 3QLJA 4G0MA 3NUGA 4XUDA 2CT8A 1Y9AA 4HWGA 4I4TA 1KIMA 4FZRA 4CMEC 1ODFA 4LKRA 3W34A 4EPWA 3RVDA 1NJGA 1HQCA 2VJYA 2YWCA 4JB8A 3ZGXA 2GQ0A 1YASA 1M2OB 3B2QA 3OCVA 2HFJA 3IKLA 1W88B 1E2BA 4GMFA 1AB5A 5AFSA 3AFOA 3M89A 5DXFA 4BGEA 5M5BA 4EI2A 1QO7A 1L3BA 3BTUA 1Q7EA 4RS4A 2Z30A 4WLNA 4WOJA 1UDRA 4HO1X 1SOUA 1OMOA 3KUXA 3QEMB 1XA0A 1AGYA 3ASYA 4BNLA 5LCXA 3TLYA 2P9ZA 3PEUA 3HU1A 4L8GA 3OJEA 2P3SA 4D8TA 4BLOA 1IAQA 2EQBA 2CF6A 3K6RA 4Y1RA 3WKDA 3KTAB 1BMFD 2NYUA 3MTEA 2FMKA 2RH8A 4XQGA 3A14A 3LP5A 3D43A 4OJTA 5HIMA 4EG5A 1RXIA 3Q72A 1VLZA 3IRUA 1TCCA 3KR0A 4QU9A 5G3ZA 1UDWA 4CEJA 4LKOA 3AF3A 4NAHA 4AQ7A 1KJIA 1SOMA 2CFCA 1Q15A 4WZZA 4AKEA 4Y6QA 3ZHUA 4TMKA 4DNOA 1D2EA 2PSFA 2R2GA 3WJ1A 1PQUA 2R7MA 4MVCA 3PT5A 3PNKA 3U1TA 3DOOA 4R7ZA 5TR9A 5JXWA 3AM1A 3RQSA 2ZRNA 3P9IA 4H4CA 3PNSA 4X7RA 5LA6B 1FSFA 1WXEA 3F9RA 2H85A 4PHCA 3O03A 3ESRA 3QSGA 2GD0A 4QODA 2GRAA 1VKHA 3O4IA 4DEXA 1YDMA 3ZXXA 2DKFA 1BVHA 2IS6A 3H5IA 2JNWA 2YRFA 3IBYA 2WAYA 3V4SA 4AF6A 1V5EA 1T6NA 4RLQA 3RHZA 5CYOA 1Z12A 2DFDA 4R6XA 3IDQA 1SNYA 5F3DA 4CQJA 4F97A 2XHZA 1AQIA 1TLFA 2FU5C 3FCUB 1I5OA 1WW3A 2V6FA 4BHTA 7YASA 3PG5A 1LJLA 3TBHA 3IP7A 4U2DA 1AN0A 1P1CA 3EXFB 5LYJB 5KYWB 3H9JA 3R5HA 2ZAMA 1JH8A 1Z63A 3CN7A 2Z2JA 2ZUVA 4P08A 5LBIA 1M7GA 3FBTA 3OKCA 4PZYA 1R0WA 3QENA 3BMCB 2VO1A 4KSYA 1NV8A 2QGZA 1W0JD 5HBRA 3KQKA 4HGRA 2QGFA 1EJ0A 4FONA 4BVAA 4DJ5X 5DNVA 1WF6A 2X9NA 4DSOA 3V80A 1U2GA 1PUJA 4P7BA 3KKEA 4TRNA 4FYMA 1M2EA 3Q7EA 5DCUA 1Z0DA 2ZGVA 6NULA 1BYIA 4OAPA 1NWHA 1TM3E 4L85A 1IY9A 3ETEA 5EIAA 3MJRA 3THXB 1TQ4A 1NRXA 3SR0A 3TQHA 3VNAA 2ZRAA 3WBBA 2EBFX 4AG5A 1BZYA 3X44A 4XSHA 3LYHA 5HXAA 4YAEA 1RXEA 5TPWB 3E2PA 1DKUA 4WA7A 2ZVJA 4WZ6A 4R2MA 5L51A 4JVNA 3FPCA 1ECLA 3CLHA 4HDNA 4YGYA 5AVXA 5JTUA 1Q7CA 4M1ZA 121PA 1VCMA 2C9DA 4JEMA 4IICA 3V97A 3FDJA 4EZEA 3GLFA 2OBXA 4EB6A 4P83A 3L93A 4M60A 4E32A 1ZA2A 1CHDA 3W6UA 1JDPA 3BSYA 2R1ZA 4KQMA 4WZAB 2V1UA 1XTSA 1FYFA 3DEKA 1OXSC 4NZYA 4LNUA 2H7CA 4L1KA 5CVDA 4WLOA 3KAQA 3ODGA 4Y9RA 2AYXA 2XGOA 4IDEA 5AKYA 1X9HA 1YR6A 4Q03A 3RVQA 2GCEA 2C2YA 4IIEA 3VR2A 2DBRA 4WE3A 1QF6A 3L06A 5HMMA 5IVHA 1WM1A 4UREA 5GJCA 1P5HA 4AYWA 1PGPA 1E7YA 3S0JA 3HKBB 3FMPB 1IN8A 1VZ3A 3Q11A 4PCAA 3KALA 3BSFA 2Q50A 1T36B 1J2JA 2VJMA 3TE7A 1UODA 1U6KA 3PUHA 1E79D 1N0IA 2GZAA 2LWIA 2RK6A 5GM2A 3AY6A 1Z6PA 1LNZA 4UXHA 2H59A 1X13A 4R5MA 3KB8A 2CNDA 4WOKA 2VNHA 2X8JB 2YYYA 3FNHA 3KYCA 3TUJC 4DCPA 2NOAA 1L5KA 4E5YA 4RTQA 4LDAA 1YRAA 4N12A 3PC7A 1PKEA 3GLHB 1IHUA 3STXA 4DVGA 4LZOA 2RHRA 1SXJE 2XVYA 1QCCA 3R75A 1DDOA 2PMFA 4XGQA 4Y9SA 3DTYA 4ND2A 1EK2A 3NU1A 3OA0A 5HJ7A 1HF3A 3OF3A 5DBOA 3GEBA 2NXNA 1UPFA 1L7BA 1TJ3A 1ZI6A 1U3TA 2Z1DA 4W7SA 4GD3Q 4WCFB 4B6EA 5ELXA 1V8PA 1XMIA 3AJ9A 2PJRA 3OA2A 4KQEA 1ECCA 3K70D 1RTTA 3JWJA 1U0JA 4LJRA 2CJXA 3CRNA 5ECWA 1PJTA 2VRCA 2A86A 1XYGA 3W4IA 3C6BA 2LBPA 2GVZC 4L4ZA 2UUOA 3OZXA 5CCXA 4HMQA 3G79A 2VP3A 1RBZA 4XWTA 1I4OA 1L9XA 3D2BA 1LLUA 2EP8A 2GH1A 1E6MA 1JQLB 2VSQA 4FNOA 4RZHA 1MZPA 3IALA 1NYQA 4DM3A 2YWXA 4DWWA 1WXQA 2ZDQA 4ZTUB 3C6KA 4U3JB 1W6RA 2FZWA 3CVOA 4FLMA 3UOGA 3ZKWA 4V1CI 1Y4ZA 2NO1A 3CNLA 5ELLA 1G59A 4KXNA 1Z4LA 1Y80A 5FOTA 1MB3A 4AY3A 3FY4A 1U1FA 4YRIA 3C1OA 5A03A 1KJ8A 3WIUA 1BAPA 3NTVA 1T0JB 3I05A 3X0DA 4LC1A 2VUHB 4TQAA 3O4VA 3M7IA 4ESHA 1AS3A 1L4NA 3EGIA 3PGLA 3SNKA 4R8LA 3RK1A 2A1TS 1PO7A 3FOCA 2ZI6A 3R6DA 2DUWA 2W6IA 1NFFA 4V0ME 1AK2A 2IE8A 3RIMA 3U3MA 2OXEA 3AERA 1O97D 5KYTA 2JATA 1SIWA 3I45A 3MBKA 1HSOA 3GRAA 3MTBA 5H02A 3UUFA 2CCJA 4EFLA 4IG9A 5D3ZA 1GSAA 4PNPA 2N1BA 3D2CA 3RKSA 1M7HA 1S02A 2OESA 4JKYA 4QJBA 2IUSA 2C84A 1CETA 1LTHR 2Q3DA 1UBCA 1I8TA 5K1ZA 1RFGE 4WCDA 4A6XA 1BXZA 2QN1A 2ONZA 3R0ZA 2R8OA 2FH5B 1PZFA 4MVJF 1XL0A 5D1NA 4G5QA 4Q4AB 1W19A 3PDHA 3WO1A 4KWCA 3CWZA 2ODAA 5EJ5A 3X1WA 2ZI5A 5LBTA 5BR8B 5IKEA 1QIKA 2BDTA 2I3ZA 1Q5PA 4CIVA 2V3CC 5LD2C 2TMKA 5A5GA 2YV5A 1JB9A 1QG2A 4A16A 1N78A 2OECA 2NXWA 4FFMA 2NYRA 1QGED 3RYCA 1NJ6A 3MJFA 1ZD5A 3VDQA 2V03A 1NBME 2IZZA 1QSGA 1H65A 1ONNA 4MYDA 2DCMA 4CG2A 4L74A 5B7PA 1TU0A 2QM8A 4QVKA 4IIHA 3MTJA 4X0EA 2X0KA 1YAJA 1XQ9A 3QKWA 4ZK6A 3IBTA 3GCZA 1TC1A 4RU1A 4Q05A 2EFYA 3MPOA 4ERNA 5IJ9B 1LDYA 2D1QA 2P5SA 2GZ1A 4N0EA 4U5QA 1U65A 6LDHA 3N6VA 3ROZA 5H9WA 1AKMA 3HA2A 1LRJA 3NLLA 4RTPA 3CIFA 4RPLA 1MD9A 1URPA 1FEZA 1AXEA 1QNLA 4AW9A 2P4SA 5BVHA 4F6RB 1HEYA 3GFTA 3SZMA 3ZDYB 5LMUB 3PJRA 1Q74A 3MJSA 1RMYA 2CKMA 1ZGCA 3MWEA 4CT0A 4P4NA 4BGUA 3IQXA 5E7JA 1CR0A 1YS1X 5JZOA 4G0NA 2W37A 1OD6A 4PY2A 3P0JA 3UJ6A 1Z17A 3ZE0B 1MN6A 2R8ZA 1ILWA 3E1SA 3KUCA 3LHIA 4MYRA 3P4XA 4WK2B 1OBHA 2FZ4A 1TJPB 1JHAA 5AW5A 4TPKA 5GOZA 1NATA 2YYSA 4MB2A 4TMZA 4LFCB 2EX1A 4ZI2A 5C8XA 1GFWA 5J1TB 1JQ3A 3EVZA 4E88A 5HUHA 4L5CA 1PSDA 3PQ7A 1NUUA 2E18A 1ZXXA 4ZV9A 5A4JA 4KGVA 1GVHA 4QYSA 4F1JA 3L7IA 2BEJA 4XOIA 2X13A 3RS7A 5KSPA 2C1EA 4NHEA 4DSUA 4RF5A 4E2YA 4C9BA 1YTUA 3HFGA 1YZFA 1E18A 1I2DA 4JLWA 4HQ0A 2Y9PB 3OOWA 5DSXA 5CDFE 3PFIA 4OREX 3CBGA 3EH1A 3H11A 1CUCA 2Z2ZA 1ZVQA 3ESYA 2C8LA 3TTSA 6YASA 4ADSG 3L0YA 5K3CA 5KTPA 2CDCA 3Q9UA 1ECFA 3CEAA 4LVOA 1HSZA 3BCHA 3EWIA 1DHTA 2FW8A 2YQ5A 3G13A 1G2QA 2B8WA 3KDAA 3KAJA 1PIWA 1ZW1A 2DT8A 1WSAA 3GELA 3AIIA 3CB4A 4UQOA 1ZQ9A 1U2ZA 2W2QA 2XVXA 4PPQA 4YRMA 1T9GR 5SYNA 4B6JA 5KDDA 5DLQC 4C03A 3VR2D 1SEPA 3H3XA 4EGCB 1ORHA 1T9AA 5HZKA 4QGBA 2H6EA 3C45A 1X1DA 3SF0A 2ID4A 1TM7E 1QZXA 2WVAA 1Z0SA 4Y6GB 5AW0A 4QM7A 2AE1A 1A5ZA 1NVGA 3B1KA 2GS9A 5DI3B 3GEIA 4I08A 3UYKA 5BSRA 2G0TA 2FSHA 3E58A 4IFTA 3SQWA 1T9CA 1E1KA 4C0KA 3CSUA 2NSHA 1J2YA 3T6KA 2PEZA 1YDFA 3UHJA 2MSWA 4PAGA 4DMLA 1VJCA 1FQWA 2V98A 2EIHA 3GXBA 1GLVA 2WTXA 4HGNA 4XIFA 3KZCA 5AKXA 1QV6A 3O47A 3U6BA 1XZPA 1H5NA 3K8YA 1XXHB 1SBHA 1UFQA 3PHCA 2CWWA 2IU3A 1ODCA 5DWDA 1DQPA 3GP3A 4YASA 4MVJP 3S55A 1ITZA 4TMTA 4BMCA 5B57C 5G1OA 5EHXA 3AVTA 4G01B 2IZ1A 3PXDA 3QMVA 5BYKA 1J7JA 3QEJA 1A3CA 4EAAA 2CXXA 1SBQA 2QSJA 4UQLA 1I7PA 2G06A 6GPBA 4UHCA 2JDID 4YRTA 4BLUA 5I9LA 2Q6LA 4C06A 1CUUA 1OXTA 2COUA 2AFHB 4D43A 4PLTA 3I62A 1P8AA 2HWWA 3MJ4A 3OOSA 2OZLB 1KDPA 4GC9A 3SR3A 1P33A 1WA5A 3PVZA 4XUEA 5JCZA 1EVLA 4E09A 4XVHA 1LPPA 2Q5EA 2WABA 3JQ8B 4IUDS 2JH9A 3K6SB 2OZPA 1OXVA 3WYFA 3ROXA 5D3MB 3ISJA 3LY8A 2TECE 2N3ZA 3PVSA 1PFGA 3NETA 4FW8A 3FYTA 3TSYA 4RVNA 4X65B 4ZAFA 3WL7A 2HF9A 4W5HA 2IEGA 4I8XA 3A32A 4I1YA 4UC0A 2Y77A 3EIFA 3QX9A 5B6IA 1Z38A 4A0RA 4OQYA 2P2DA 4UEJA 4ZMBA 2XYGA 5IHPA 4RTOA 1XYVA 5HDBB 3QFFA 3TZCA 4HBGA 2PV7A 2C9ZA 4TYQA 3WK5A 3PR2B 4LQ4A 4MR7A 5J1SB 1QNFA 3AESA 4LMPA 1N57A 1NVTA 1TQ6A 2W6ID 4HB0A 4O2AA 4X8OA 4D4GA 2O6HA 5BP7A 3BXXA 4FHCA 4Z86A 3RPEA 1E3JA 3TQSA 4EABA 1A1VA 2ZJ5A 4L15A 2XOXA 1F6DA 4KVGA 3UA4A 1SWVA 2F3UA 1KEZA 2VAWA 5AVVA 4UHKA 5I4CA 1Z18A 4F3RA 4O4IA 1BA3A 1J8YF 3GCWA 1XQVA 3K1AA 4CGYA 5IMBA 1KFEB 1XDUA 1GAQA 2EDCA 4OB7A 2DHEA 2PBFA 4R3NA 1L5HB 3H1AA 4RHFA 2IYLD 2UDPA 4LJLA 2BONA 4EB8A 4TVSA 1TCBA 3GBPA 1YZUA 1GTMA 3LVQE 1KIFA 5CTJA 2G6TA 3W9UA 2JLWA 4EW2A 2J5BA 4OGFA 1JJFA 2JD1A 3CZQA 1YVRA 2VHJA 1OXMA 2XAAA 3RNOA 5K3OA 2QF7A 3GFOA 1UBJS 1FFBA 1QVZA 2AZMA 4XQCA 1NDQA 1E2UA 1AKQA 1WCV1 3N2NA 3C5VA 1T4BA 3Q3EA 4CG0A 1V35A 1GPKA 4KXMA 5IRCD 2GDZA 5JSYA 5DP2A 4ZCPA 3F3SA 4DA4A 1QQBA 1C9KA 4FGWA 4TXLA 5B30A 1C2TA 2ZB4A 4J49A 4GUAA 1IU9A 2Y0BA 1T0BA 4UKDA 2DETA 3FLBA 2HX1A 2O2EA 2Q3CA 1RDFA 2WTMA 2H48A 3IMFA 2ET6A 1ORTA 1TECE 3V42A 4YRDA 1PR3A 3VC2A 4ZYXA 4X8HA 1Z2PX 3BJRA 4IIJB 5FNVF 4PFSA 4DKXA 5JJBA 3MB5A 3R4CA 2MMGA 2E1PA 3ZE2B 2HWKA 2PSHA 2BOVA 1LD3A 3DOUA 5CT9A 4DBVO 2G77B 3LC7O 3OD1A 3N2EA 3VR6A 1C29B 1F9AA 2VCHA 4FS8A 3DT9A 4GEKA 4GSLA 4X41A 5EHGA 1SIOA 3CR8A 3PWKA 5J63A 1T9GS 2XQVA 3KELA 3PI6A 1DAHA 4IIFA 4CM6A 5FH9A 1E8DA 1DC5A 2HWYA 5ALFA 1OFVA 1SC9A 3AHDA 4HLNA 1KO8A 3U7IA 3VHQA 4FC7A 4E5PA 2GN0A 1M5UA 3DZ8A 1ZGZA 3MZ0A 4FMDF 5L7WA 4YA6A 2WSIA 3WL3A 5H4HA 1QHXA 1KAEA 3SFVA 2P5UA 3FB1A 4TS9A 1NXVA 2X0FA 1ZWLA 4TKMA 2Z5FA 4M8SA 5JBQA 3LPLA 1P2BA 2QWXA 1NLYA 2IBTA 1MJHA 1F2TB 2B9EA 3NWOA 3F1LA 3P9KA 1GUDA 2RC6A 3EQ6A 4J03A 1T9HA 2WEKA 5DCLA 3RIYA 1U3WA 3AY3A 3S2EA 2Y76A 4EGQA 5DNWA 1NG1A 3PJDA 1DX6A 1XDWA 2RHWA 4YEDA 1XCBA 2VJQA 4RVSA 1G3QA 2BP7A 4PYLA 3PRHA 1QZ3A 1NMEA 5CH8A 1K4MA 2DHQA 2PFKA 2H1OA 1IY1A 1U1CA 2NO9A 3I2HA 4BFYA 1NZDA 3GWZA 1E3EA 2KB0A 2ZRBA 2ZRKA 3N70A 4TROA 3D7LA 3OKAA 3UK6A 1IZ0A 4BMXA 5F5NA 5GONF 2RH5A 3Q7RA 3RHFA 2X40A 1XPUA 5LZ9A 1UWVA 2QTAA 1RHJA 1VGVA 5ADUS 1X1RA 2A3NA 2Y0DA 1WXIA 1PL7A 3A6KA 4MIYA 3F4LA 4COKA 4KQ9A 2DR3A 1RD4A 2CXQA 1VG1A 5L8VA 5TS3A 3BEDA 2WZDA 4ETIA 4M38A 4M9CA 4R0VA 4DB4A 1DRJA 2CXUA 1E2EA 2Z8YM 2OCYC 3OI7A 3HHPA 2AVDA 5KAMA 2OCAA 4FOOA 2NAPA 4G63A 3H0EA 4KUHA 2ZWVA 3NHFA 4IVPA 3H1EA 5AVRA 1PHRA 5BT9A 2C58A 1RBMA 3OMXA 1XGKA 4MUKA 4UM5A 1OWNA 4YPOA 3AG6A 2E2WA 3U3DA 4NSNA 1CZUA 3KYDB 1LS6A 2ZT7A 3UT0A 3GLGE 3NJ4A 3Q7QA 4KQFA 5IKXA 4RJ2A 4FBGA 3LRTA 3UV7A 2YRWA 5LDHA 4F4UA 2VZEA 2RD2A 3BTSA 4PLGA 3OOYA 4M9XA 2ZB3A 4ON9A 4QBTA 4EUNA 1JILA 2VKTA 2VAMA 1X3LA 3BGDA 2ORED 3T1VA 1OH6A 2VJCA 2E6KA 1WXGA 1AKUA 2OFXA 1KIAA 4UZEA 4YJFA 1A2BA 3CRRA 3H9QA 2H06A 2RB4A 4PFJA 5EE5B 3RGGA 3K72B 4F92B 2YWRA 3I23A 3CKYA 3M6XA 1FUIA 3OTHA 1CLUA 3KQOA 1FSSA 2C2XA 3TKAA 3VU9B 3TD2A 2N46A 2F1IA 3SYRA 2AI3A 4XFDA 3VVCA 2HRBA 3INTA 4UMVA 2W2XA 1ZO8A 1ZIXA 5AI5A 1LPAB 4OATA 3ND9A 4XASA 4B4KA 1VDMA 1ZEMA 3KBBA 3QLUC 4EATA 1ETUA 4E6EA 5H81A 2NIPA 5K3DA 4JL6A 3DAGA 3R0VA 3STYA 1B0PA 3B78A 4FNGA 1EH5A 3IJRA 3PRKE 2FEPA 3AHHA 1ORWA 3LD9A 3T0IA 4QXAA 3IUNA 4L0CA 3SHQA 1HRDA 3G0IA 3HBFA 2AG1A 3A3PA 2Z56A 2XR1A 3IBGA 3FZGA 3AEKA 5DI9A 4KIFA 2XUQA 4CM3A 1AQYA 1FCJA 5ALSA 3PL1A 4PLFA 1X1EA 4HRVA 4KPUA 1YE5A 4TKLA 4F11A 3MCTA 2I6QA 2PX3A 2WAOA 3ZD7A 2IOFA 2IXGA 4MA0A 4NONA 3WYCA 1HZZA 1UINA 1G7TA 3C3PA 3O9ZA 3OWOA 3WL8A 1H2YA 3NEPX 3BAZA 4PC3A 5CA1B 5M3BA 3ETJA 2VTEA 3NEJA 2VWPA 4UDOA 2H4YA 3SFZA 2AD1A 3ZCRA 1RI3A 3I9KA 4JD5A 4KTTE 3D3EA 1FRVA 1NDUA 1NF9A 4DBLC 2IYZA 2W2VA 3G0GA 2OLJA 4CR7A 1NKSA 4IDCA 2H1FA 5FOQA 1YE8A 5C7LO 2DB3A 2BFEA 2PL1A 1DBIA 3JAKB 4MYUA 4RTNA 4D96A 1THGA 1U2PA 2BFPA 5CFOA 1HUQA 1YJ8A 1GRNA 2WT4A 4ZKDA 3HCCA 5HF6A 5IF3A 5IEBA 1KEPA 1AKEA 5IYZA 2PGJA 4EZIA 2G9RA 3NOVA 4HN9A 2QORA 3DKPA 4OUDB 4PU0A 4QUHA 2O6LA 1EP3B 5EZSA 5EJAA 2OM6A 3V3KA 1KI2A 5EIBC 2BF4A 3QOYA 2C7OA 4TQGA 1ZVKA 3ZD8A 3DEAA 2PUHA 4LQDA 1WU8A 2ZIFA 2NXCA 1BXGB 4J76A 2VVTA 4RHUA 4XQEA 4FGLA 3WLKX 1DADA 1WW8A 2VBIA 2BI8A 2ENWA 4EG3A 2ECKA 1F2UB 1M6NA 2XECA 3P9NA 3PC8C 2Y05A 3K8ZA 5FHQA 4EF6A 4HDKB 1GYQA 1WHTB 2VTDA 1NXSA 4GPEA 3UFXA 3HQ4O 1LSJA 4LDQA 1IXZA 2PM8A 1NTRA 2VXBA 2FN9A 4KPYA 1ZAKA 4D0GA 2CXOA 2IZ0A 4F3NA 3PR3A 1CR6A 4F38A 2RJNA 2HBZA 4LDZA 2ZDGA 1TKCA 1OJLA 2IELA 5HKAA 3D7MA 4KR2A 2NUPA 3CUWA 4EY6A 3HZRA 4MP6A 1P29A 5ULLA 1A8HA 4N4AA 5JJIA 3VR6D 3EWNA 3SLRA 3GT4A 3S5UA 2CNBA 3G2IA 3ORYA 3QNWA 3FGOA 1YONA 3WLAA 1FFXA 1ZK0A 1GN9A 2QZSA 1YMQA 3CZPA 3FUVA 3KZXA 2P9GA 2CMHA 3ZGYA 4XRGA 3RC3A 1Y1PA 1RSZA 2R7NA 3DMTC 1E94E 1QIDA 2VZLA 3USZA 4A8JA 1E98A 1NI3A 2CHVA 3G1UA 4ZT3A 2AX3A 3ER8A 3MTAA 3KQHA 1XP5A 2YJ4A 3F9CA 4K81B 4EZBA 3ANNA 4Y98A 1QF7A 1ULHA 4D97A 3UKJA 4M8KA 3A36A 1IDOA 1WAMA 5JSQA 1VCHA 4F06A 1JEAA 3FX2A 4JMLA 4CE6A 1QZTA 3ZX5A 5GJWC 3WDSA 1TD9A 1X7XB 2ZJ4A 1GJRA 4X44A 4W5TA 5REQB 1PT9A 3DCIA 5JASA 1UMCB 1FXSA 3V1UA 1L8LA 4KOAA 3TZLA 3MMXA 2SCUA 4NBNA 1HE2A 3CLUC 5FA8A 5BSEA 4IFBA 3UQYS 4CR6A 1N75A 5BNZA 1M0SA 2E5LB 1W47A 2UUAB 1YTLA 3E7DA 5E6SA 1DZIA 1GT91 3AP1A 3JRXA 1IG0A 1CS4C 1Y3FE 3ZN2A 2VPZA 2FEWB 1O77A 3AR5A 1DC8A 3OLCX 4RDCA 5H70A 5IM5A 3T06B 4BB6A 5A4IS 1N32B 2OORA 3ZLBA 1GUZA 3RTGA 2FFBA 3KJXA 2Z4RA 4HNVA 3RADC 5B53A 1GQSA 2VWGA 2UAGA 1DCMA 4E33A 4FDVA 4ZEXA 1O96A 1VSBA 2PZJA 3T5DA 2PUAA 4LSWA 3K9WA 2VSOA 3LHKA 3QVWA 1VKRA 1NQ5A 1KAGA 4G3XA 4PLZA 3TL6A 1SXQA 1A88A 4B6PA 4DM7A 4NP6A 5FJIA 3GMSA 4UDXX 4MNTA 4EKDA 3VPGA 4EY5A 2MINB 4BEJA 2B7BA 2RHOA 4NCIA 2UKDA 3NHSA 3TVDA 4DA8A 2H9IA 3E3OA 2RCNA 4IS2A 4QRDA 3EULA 3UPUA 3KV3O 2R5FA 3C7TA 3ZWYA 1QP0A 4OJYA 2NU9B 3JYOA 2QX6A 1T8UA 4QPNA 1RNLA 3T7SA 1Z6QA 5EE3A 3CVYA 2B98A 2Q5LA 4JXJA 4TM8A 4ZRDA 3BJIC 3G8DA 1M1YA 4EA6A 2RCYA 3V33A 1KZGB 4JBXA 5FOSA 2WWXA 4DR5B 1T3GA 3TW8A 3DZDA 3JATA 1V37A 3I2FA 1MIOA 3F46A 3IUPA 1LFDB 2CBXA 3TR0A 3H1TA 3SF8A 3LOUA 1W4BA 2ZBVA 4RZ3A 3WRXC 4PR3A 2ZYAA 2A67A 1FRFS 1I0IA 2GM3A 3KXLA 3R9KA 1N2CA 2AQKA 5BQ3A 1UM8A 4AI6A 3CUUA 3E82A 2E4XA 1W7AA 1WBBA 1XMVA 3EEBA 2ILVA 4EHHA 2XNSA 4LYEA 3AFNA 1KJ9A 5JAMA 1Y3DE 1WMDA 5BMOA 3VDNB 4WZBA 1MB0A 5LA6F 2R8BA 2K4MA 4MDHA 3RVPA 3LTEA 1RWMA 2X1MA 2BFCA 2Y3IA 5E2BA 4RK0A 4ZVPA 3RFVA 3FVTA 3P9XA 4BYMA 4FFNA 1OLUA 2PX2A 2ZAYA 3OM8A 4B80A 1LRLA 2QXYA 4LWZA 2DAPA 4MYTA 4TLLB 2Y9MB 2B0JA 2LP4Y 3FIJA 3TQRA 2B94A 1GRRA 3QU7A 4YGXB 4FR0A 5LYJF 4TSRA 5TGDA 1YB7A 1U04A 5AUQA 1RKXA 3VZSA 1M5TA 4TMFA 5JI3E 2OCDA 2A30A 5G40A 3ZW7A 2HUPA 2PUVA 3Q3GE 4R84A 5D3QA 3NRBA 1VJTA 3HYCA 3INYA 3SI7A 3JASA 4MI1A 1NU6A 4UXIA 4R71A 4AKIA 3L8MA 3DWIA 5KQPA 1FSZA 2AGVA 2SBTA 2C61A 4IRUB 4JJ6A 2VPTA 4RFLA 4YQZA 2H4XA 2PWAA 1L4EA 1FFHA 1Z15A 4FN4A 4MS1A 4M3NA 2ZRIA 3RVJA 3V46A 3WGQA 1FS5A 3SHWA 3GAFA 2C5FA 3VNSA 4OHPA 2ODNA 2ZSJA 3ADCA 3EVCA 3P2OA 2GETA 4KGDA 4Z99A 4FE7A 1TTTA 4A3SA 2GM9A 3NIDB 4X1YB 1Z33A 3FZQA 4Q7MB 3KE9A 2P30A 4H3VA 4IQ8A 4RZ2A 4YVFA 2DQYA 3NXKA 2QN2A 2YTZA 2ZKLA 5AVUA 1AMOA 1CF4A 1Y5NA 3CZCA 1IBRA 2VCYA 3OZSA 1P5FA 2Z09A 2IEZA 3BXFA 3EXIA 4FEAA 1Y7TA 5FD8A 1L5LA 4BQQA 1E6KA 2PX6A 3BE8A 4JYMA 1PV4A 2WPDA 1I3LA 2O3UA 1KU6A 3O95A 3QEOA 3QFRA 2HY7A 4MVJI 4CKEA 4FVTA 3SC6A 3A37A 1DJLA 1KFKB 1MH9A 2W6NA 1E6CA 4PAQA 5I9TA 4L7QA 2YHBA 3EODA 1NHGA 4GXRA 4GNRA 5LB2A 1QF9A 3E4CA 3HWSA 2I8CA 2BKLA 1O08A 2PT5A 1LWNA 4MWCA 2AJTA 1I10A 1IHDA 2FSPA 2YDYA 3FCAA 3IAXA 3WGGA 2TS1A 1AZSC 3BQNB 3QU4A 4QUBA 1UH5A 3O74A 4WEOA 1KTIA 4I4CA 1L5VA 1VHLA 4BVJA 3LPAA 4IHJB 3FF1A 2H1LA 4HVAA 4QHTA 2ZS9A 1ZMXA 2GYWA 1P1IA 1Y3BE 2F2TA 4B7ZA 1Z5UA 4KGZA 5JS6A 1SEVA 3MINA 4BNZA 1FJ2A 3AHJA 3HR8A 5J5AA 3O9MA 3KTFA 1PZXA 3CPSA 3VV2A 4BLPA 2B8JA 3P32A 1VCOA 1PR4A 1XQYA 4DG5A 1E5XA 4TL8A 3GLTA 3AINA 3TLCA 3QRWA 3EDRA 2XBUA 4KTVE 2HHHB 1F38A 2NGRA 2P69A 3B6ZA 2PH5A 1GCUA 1R27A 3LRXA 1SXJC 2VH2A 3GLUA 4WKPA 4NYIQ 1UXHA 4HTAA 4ND7A 3JD1A 2QVLA 5T3YA 1N77A 3GGGA 4BE7B 5FWXB 1V25A 4OXXA 3K53A 3JZAA 4XA8A 5IH3A 1DLJA 3AEUA 5CD9A 3MB8A 5TMPA 4N5HX 4XCVA 3SS9X 1U0LA 4LOJA 2Q4RA 4F5ZA 2HUNA 3M3HA 4UVGA 3CINA 3FWPA 3ZXIA 4PGGA 5AUNB 3Q9SA 2ZYUX 1I2CA 3HXLA 1IOZA 2DPLA 3DXXA 3IX7A 4J1NA 4C0SA 3S81A 3A9VA 3CZ5A 4MB0A 3A05A 2VJOA 3F5SA 1L4MA 4E07A 2AOUA 2EJVA 4DCCA 1EJ6A 1K63A 4OHWA 2XYHA 4HX9A 1U90A 4U7GA 3X1KA 4DIEA 1GL9B 5KYXB 3W8EA 5JYCA 2Z95A 5EIWA 4YT5A 4N03A 3O82A 3QPVA 5A1TA 3PWZA 4MMZB 2ZR0A 2OILA 2R79A 1MOSA 2VBCA 1N2XA 3F98A 3H2YA 1KS2A 3LBNA 5G0VA 1H2HA 2Q3BA 2Q6KA 2ZBPA 4XJVA 5SZIA 2AD5A 5TQJA 5B3KA 2IEAA 5BVGA 1QKJA 3QP9A 1YB6A 3ILVA 1Y4UA 4Z9FA 4EGJA 3RBAA 1RC8A 5MHTA 2PZEA 1FK8A 2UZ1A 4JC0A 5AI6A 1P0FA 2BUBA 1IK4A 2H18A 1KE1A 1TVCA 2QU7A 3ULKA 1YKGA 1H2RS 3WI7A 1ZSNA 2YMPA 2PU7A 4YCCA 5KZMB 4B9EA 2E48A 1DJOA 2NTNA 1VL0A 1LVGA 1VE9A 3ZLVA 1G8PA 4F72A 3F8WA 5IBCA 2H16A 2R0QC 1PVOA 3SYTA 3LDUA 2FPXA 3QU9A 3TNJA 4CN9A 4CEHA 1W46A 2X7XA 4ER7A 4FQ8A 1XZHA 5EINA 3TIXB 2PS3A 4F4FA 4RV5A 1OZAA 3OQIB 4EFNA 4DLKA 2QMUA 1Y7LA 2C4HA 4AO7A 4FOPA 1CQIA 1LI5A 2VP6A 1D07A 1H5UA 2YWBA 2FLVA 4Y2UA 2AL7A 2RHDA 1EX9A 3MXTA 3M6FA 4R2XA 4TL9A 3USES 3V1LA 1WXDA 3DXFA 2FPPB 1UADA 3KVOA 3VC3A 4BRZA 3HY3A 3F7TA 2RJOA 3PNMA 2VHWA 4PLVA 4UEKA 5BN3A 3WWPA 5AT1A 1DB3A 1JJAA 4G89A 2X6RA 3AM3A 3WP0A 1X80B 3P1JA 2EWWA 2AJDA 3IB6A 3VMFA 1RYBA 4A1FA 5FTLA 4L8VA 1AGPA 1ZQ1A 4FT4A 1VHDA 2G9QA 4KN9S 2FUNB 3H84A 3A2MA 1C5KA 5KI6A 4PLYA 1XZFA 2JAXA 2WD7B 5FCDA 1QYIA 1TTPB 4I5DA 2X42A 5TJHA 2REXB 3FPFA 5EE0A 3JAWA 2OBYA 3QU5A 2VJDA 2PLFA 4KLAA 4N6GA 3T4UA 5BW6B 2G1AA 1DBRA 4YQFA 1U0OC 4EBFA 1BJKA 1GQRA 2WHRA 4RKQA 2VUUA 2ZS7A 2D3TA 3TB6A 4C7JA 5EKDA 2PLNA 1QGUB 3AVUA 3DW3X 4XPIA 5TQ2A 4B4VA 5EKUA 3WK6A 3F7OA 4NCNA 4QT4A 3K70C 2JLUA 3VZQA 1BN7A 3K09C 4OGGA 2V5VA 4RQAA 1CUAA 5CW1A 3A1WA 1SOWA 3NOQA 1IQRA 1G8KA 3U7GA 4YRNA 2CFTA 2Q07A 3KWJA 2AN3A 1TLTA 1TO2E 4K2HA 4D9GA 2I4MA 1YL6A 3ZLTA 3K1YA 3F2VA 3ZOKA 3ZXUB 1S2OA 2IOYA 5KHAA 3ZPXA 1DCKA 3RYFA 3JSAA 4B71A 5GZ3A 1EX7A 3PNVA 1G5QA 1CP2A 3L77A 4DCUA 5I48A 3A3KA 2QTVA 5HF5A 1R3UA 4Q9NA 1IEVA 1PR2A 4Y3UA 3A4TA 4MP8A 4Z0NA 5IKOA 4RM2A 4D3DA 5CFLA 1KYTA 2TMYA 1DKMA 1H0KA 1V5FA 2C9OA 2IK8A 3G6WA 3O8LA 4KR7A 3ZBUA 3NBUA 4C0BA 1U9YA 2C4WA 3C6YA 3Q98A 5A5VA 5DMXA 3UGKA 2WWWA 4WRRA 1RQRA 4FJ0A 2PL9A 3Q6MA 3WKAA 2D5AA 4DREA 2J0UB 3F3YA 3ECCA 1A27A 2FMFA 3IJPA 4QWMA 3HKEB 2SICE 3EBPA 1J0EA 5C3UA 2FP4B 3RCBA 3R6GA 4CF7A 1WZIA 2PZLA 2Q2OA 2YVQA 2A2ZA 4OJQA 5DT9A 3B3FA 2BFFB 2X5NA 2ZIXA 4JUIA 4J29A 5EIEA 5JNSA 5F9FA 3IVCA 1FRZA 1IMOA 2IGBA 2W4IA 3LCCA 4TZTA 3U5ZB 2R4QA 3A9CA 3U37A 5DEIA 2P3QA 2EZ8A 2ZUTA 2QS9A 1EGQA 2B9VA 2F4NA 1P75A 4LXHA 4M0PA 2QBYB 4K9DA 1BCSA 2I4LA 2RGGA 1OB2A 1SXJB 1ZC4A 4ZODA 5GIOE 2FTKE 2FUCA 4JLUA 1EG2A 1D1TA 5K3EA 4MW4A 4FHDA 1FXUA 5BW5A 5JJLA 5KTRA 2YWFA 2ZE6A 4JAVC 5C4MA 1WETA 1ZN2A 3L0IB 1W0KD 5FPSA 3FPKA 1M1YE 2HRRA 3SJUA 4HEA6 3GA7A 3TOVA 1TLLA 4X6LA 2WKPA 4MVJG 3IEKA 3DEZA 3EMKA 3H7IA 2Z6VA 3HGQA 3PPIA 3P9RA 3PQ4A 1KXJA 1NMQA 2VWQA 4V0QA 5FL3A 3MCZA 1UKEA 1T6BY 1LTQA 3D6VA 2IEIA 4L5IA 1DAMA 1SKYE 4R01A 3QUTA 4MGHA 5JPIA 1Y1QA 3TXAA 5KSYA 3CS3A 4YDRA 2CEKA 1LDEA 5BOSA 1RJ9A 4QFMA 5G0WA 5C8YA 3X1ZA 4OCZA 2VYNA 5FUYA 5JECA 3BQ9A 7REQB 3GP8A 5EHZA 1RWXA 2QL7A 3WMGA 3RU7A 3A1EA 3H16A 2J4CA 1ZVMA 4BECA 3NC1C 1ESZA 4DJDC 3QPWA 3VV3A 2DRIA 3HEMA 2LXNA 2O3JA 5ITVA 2PQMA 4MKXA 4WJZA 8AT1A 2JARA 3LLVA 1C0EA 3E4DA 4IH4A 4JXKA 3OIYA 1NXWA 4K6HA 5IXYA 4TSKA 3KLMX 1P4HA 3WMRA 1RXSA 3UT6A 3D0OA 3ZQ6A 2QSYA 2H1WA 5HS4A 4I2VA 1US8B 4R69A 1SHLA 5JZMA 2M6KA 4IGFA 4WDRA 3KEMA 4OMFG 2WW8A 4XGRA 5DFAA 4MGIR 1QVVA 5KC8A 2BZGA 1I1QB 2F59A 4NARA 1ONPA 3MGAA 2CV1A 1H4VB 5KS2A 1DVRA 2CJWA 1ND5A 1ONBA 4L50A 5C4IA 3TECE 4HEQA 3HV2A 1R4ZA 3FYHA 1FRNA 1ISIA 1PTJA 3RJMA 2EYUA 4HFNA 3ZHBA 4OO3A 1U2GC 3B48A 1XTZA 4E3WA 4V38A 1I3KA 3ASUA 1I3MA 4BX0A 3ZY2A 4KCGA 4AS2A 3FCYA 4A92A 4F3YA 4JT9A 1I32A 5ER9A 1JHDA 4CI9A 1DKNA 4GLJA 1UP6A 4PG5A 2C20A 4LXGA 4XUGB 4IDBA 4P4SB 3OLQA 1Z7GA 4N76A 4FD3A 1CW2B 1ZINA 2BEUA 2CUTA 3BIOA 4ZP1A 4I3HA 3IUMA 1HE5A 1N5DA 1PG0A 3PFWO 1FQJA 1B76A 4CF3A 1PQPA 2EJUA 1JDZA 1B14A 3HUEA 4H1HA 2FMIA 5L3QB 1S9DA 2HPVA 2VIIA 1V4BA 3Q3VA 2PBRA 2DMRA 1JEQB 4CL2A 5DYTA 3BGVA 4PFQA 1S2IA 3VQTA 1IVYA 2QP9X 2XZTA 2XVAA 3FNQA 3G85A 2CJYA 2K5UA 3LLCA 4PBTA 4PPGA 3ZIUA 1G9TA 5HS6A 3CU5A 3OCUA 3IEUA 1K6JA 5L3SB 1VPDA 1MQ9A 2CYAA 2FWBA 1GPJA 4XDZA 5FPTA 4E1BA 1L6RA 3BA6A 3HVJA 2P2SA 1KOGA 1NE2A 4JUAA 1VYTA 3PVCA 4NL4H 4GVPA 1AX9A 4ILKA 2F8SA 3MG9A 1D04A 4DAOA 3I04M 3R23A 3P4UA 5BXYA 1SIBE 5DIZA 3G7SA 1V16B 5JYBA 3AEQB 3V3TA 3F7MA 1XFDA 1J8MF 3PFNA 4DR1B 3FUTA 3FVWA 1SQ6A 2BEVB 2C3MA 4H1VA 3WHPA 5JRJA 4ZVUA 2O5EA 1Q50A 5EESA 2QNRA 1J97A 3BF7A 1B00A 5TARA 2C31A 1QIIA 1AUPA 3O4HA 3W1EA 4AQDA 3VU3A 1UOPA 3I6ZA 3GA0A 1DQNA 3RRZA 1BH6A 1JIIA 2F6RA 2BYTA 1TO1E 2PKYX 4HH4A 1KZ6A 4F2GA 1M1XB 2P5TB 3GEEA 2Q3LA 5B58C 3SLKA 4K9PA 1LQ2A 2FW7A 2NO6A 2QDXA 3VVLA 3PTZA 2IH5A 3NYWA 5A06A 5EXSA 4AURA 1MNAA 2E3JA 3I8SA 1B6SA 1FFCA 3WBJA 5BPFA 4Y2XA 3HE3A 1PZEA 4KO4S 4UATA 4XD2A 4EI7A 3AZOA 4P0TA 4BKUA 1YUNA 1CUYA 3RSLA 2QLFA 3HJUA 3CNEA 4IIJF 5TT1A 3VR4D 1DTEA 4B45A 5ALIA 2JGIA 2HT1A 1FMLA 3O3NB 1XZ8A 4L76A 2BPOA 3LVBA 5HQ3A 3F4BA 2XXAB 2JHCA 3DWEX 4JLJA 3AP3A 3SG0A 1CRWG 4U8GA 1NF3A 5FEUA 5FBHA 3HNOA 1ICEA 1Z06A 1I9GA 1O3YA 1OZHA 1WCYA 3BMQB 3DMHA 2HLNA 5DGIA 2C2GA 2HEGA 4A03A 3D4LA 2O3TA 1HQKA 2VSXA 4Q7JB 1LCIA 3DT6A 4I6JA 4I1OA 4CMIA 1E58A 1M6WA 1JU9A 2DFKB 3CMCO 3DEYX 1ZL2A 5GGXA 4ZKEA 2TRSB 1ZN7A 3RFCA 4JBHA 1XEXA 4R9VA 3KQQA 5IMSA 5LNK6 3K0HA 1Y6JA 1UK7A 2AV6A 3DQQA 1NVMB 1O4WA 3OP1A 1JDTA 1YZYA 3MD0A 4Y1RB 5GP1A 5JWHA 4L7VA 2V7EA 1T5BA 5J2TF 1D0IA 4CL3A 1H3EA 3U49A 4CEJB 3RIEA 4X1IA 3T38A 4NOKA 2YL2A 3ZTWA 2J9FA 1HR0B 2ATEA 1PT6A 1QRDA 2F43A 2P9QA 4BDSA 4XKJA 3EYWA 2JLCA 3WFZA 2V3VA 4KFTA 5LOVB 1XB2A 2FETA 4UVHA 3Q5DA 4NVRA 1M34E 1HOXA 5AI0A 1DC4A 1FDRA 3BGSA 3LXRA 4EGAA 5I47A 3C7KA 3UHAA 1XTVA 3K9HA 1MW9X 4FMBB 2PH3A 3O94A 4G8CA 1BMDA 4PSDA 5HRAA 2XDWA 5DW3A 2VF5X 3VO9A 3I64A 1ZW6A 5DYWA 1U8XX 3G0BA 4PE5B 3UK7A 2HYIC 4TOIA 4M1TA 1IUOA 1MUUA 1Z08A 1ZH0A 3SPXA 3R44A 4WGGA 5EQDA 3QVOA 1Z3IX 1JF8A 2Y6VA 1TFUA 1R0RE 3DLPX 2B4TO 4FZ3A 1KYWA 3CLTD 2GCNA 4LXYA 3TRJA 4IIDA 3KSZO 4ESEA 3FA2A 4CV3A 4C6HA 1Z7YA 1IRXA 1JLKA 1U7OA 3QHAA 1J56A 3WGOA 3QY0A 4R3UC 5IZCA 4XLZA 5FT9A 1M33A 2EP7A 4G0WA 5C5DA 4DJEC 5K05A 3AHGA 1TZCA 1J2UA 4LS3A 3UW1A 3DZBA 5KQRA 1O9GA 4Z6KA 3V7NA 2CL5A 3GJ8A 3GYBA 3ZCTA 2H5JA 4IV0A 2B8TA 2QTRA 3PJGA 1EEHA 1KHTA 3Q0TA 4RIHA 4TYPA 3TLMA 1FYXA 1ZCFA 1U4SA 1OTYA 4A2PA 2BM1A 4LF8B 1PHPA 1BROA 4GSYA 4OSEA 4D6YA 1JV2B 1R5JA 3A6JA 1MPTA 3ON5A 2QRJA 1KSHA 1MABA 2WU3A 2I2CA 1W44A 3PDWA 2FPGA 4KFSA 1X7YA 1GOTA 3SC4A 1QHFA 5F2KA 1L5SA 4KE9A 3U4IA 2NZJA 3OHSX 1TAHA 3LDFA 3WIOA 4O8CA 3NH9A 2GEJA 3VVBA 3JAMA 3CWCA 1C9YA 3CX7A 3O7WA 4HDNB 1AH2A 3DUWA 4PVDA 2X2EA 4LK2A 1AO0A 2XDYA 1CY7A 2PQ6A 4EB6B 2GJ8A 3DMDA 4FT2A 4P32A 3KLOA 1AOXA 3NB0A 4X97A 1R6AA 4ZEWA 1COWD 4F7DA 4LNUB 3I2KA 2CB9A 3PHJA 3L4KA 4MDEA 1CUZA 5L4NA 2XODA 2I1LA 2BI7A 2XCIA 3CO5A 4PQRA 5CNJA 3EWAA 3JQFA 4Q3NA 4M86A 3VBCA 5B55A 3D81A 4A8TA 1HM5A 1SCUA 3RO7A 3FE2A 3SBEA 5AVWA 3ZJYA 2WB2A 1OLXB 1XEFA 1B0ZA 4YMHA 4AICA 4JGGA 2M6LA 1QPZA 2IHVA 2WUWE 4QASA 1QIMA 1G6OA 1GKLA 2QRGA 3BM5A 4R54A 2JZCA 2VJMB 2FDRA 3NC4A 3IMEA 3V4OA 5KMGB 1K5DA 4HAIA 1MBZA 1QDEA 1WF3A 4U7PB 5D85A 4JQSA 2ZR9A 2FWAA 3QMWA 2QLNA 3I0NA 3N8NA 4C87A 1N3IA 2Q3FA 3KYCB 1WQ4A 1XZIA 2D7JA 3PRYA 4ID3A 4KPGA 5DWQA 5K09A 1E32A 1EM8A 3OT1B 1OBVA 2Q3EA 4OFXA 2A5YB 3UGTA 4BZPA 3CNQS 3Q5GA 3RTAA 4Q9JA 2VNSA 2Z04A 5DBFA 4L57A 4PPYA 4B3JA 4ZGGA 3ORRA 3TBFA 3BKXA 2VHTA 3TLXA 4KPEC 3RAFC 4UZSA 1XV5A 4MUEA 4YI5A 2GFHA 1Z4IA 1Q83A 3ZR4B 4PXSA 4B43A 4J3JA 2MSNA 4MQFA 2Q9AA 4EW1A 4MR8A 2IZOA 4JLMA 4HPJB 1YC2A 1UJMA 3G8YA 4A6EA 1ZEJA 5CXQA 3C3AA 2G4VA 4K0RA 4PFKA 4GYJA 1TAQA 2VHUA 2CK3A 4ZEOA 1PK7A 4C1NA 1KOLA 1S7GA 1Z0KA 4JJAA 1ST3A 3TL3A 4JB2A 2BR5A 5A7GA 5TIIA 1A5SB 3GZNA 4NMMA 4EKNB 2OT3B 4YRRA 4OHFA 2AZXA 1F1JA 5HG0A 3NS7A 1Q21A 3FAKA 4FLFA 2PUBA 1NN5A 3QE3A 2XA9A 3LBIA 3CJTA 3QBTA 2R6DA 4MCIA 4PHTA 1SVIA 3LV8A 4P31A 4F21A 5AP9A 1JRLA 4H9GA 4RWEA 1OZFA 3THSA 3BZWA 4M1EA 1ZH8A 1ULZA 2C9BA 1EUZA 4O29A 3SJ7A 1STOA 1M7BA 1CZHA 5J4YA 3QUSA 4NYIR 4G1MB 3MGCA 4GQIA 1OC4A 2BN4A 1CZOA 4MS3A 4YLGA 4BV9A 5K0BA 3UJ9A 4WK6A 5K0GA 2QX8A 4HRAA 4IQ0A 4LW8A 5CJPA 4ZQFA 5KJEA 1ZITA 5H0IA 1KGSA 1U9CA 1XZEA 3EPRA 5TXGA 3AERB 1QE5A 5LSAA 1H1TA 2AJCA 3PWSA 4CI0B 3NIFB 3DWGA 1OYWA 4RC9A 3RC2A 3CIOA 1QUEA 4YCSA 4ZMRA 4C0QC 4YMLA 3AVYA 4H6WA 2JCYA 4E2WA 1Z07A 3IEIA 5IT5A 5K6RA 1QR2A 1YR8A 2VJAA 4QVGA 4XGIA 1IYZA 4MTLA 1SKMA 3OLZA 4DRXA 4G0QA 4G0XA 2HSJA 3AC0A 2JIOA 3R3YA 4G1VA 2CXHA 4GEGA 4NJEB 5K3SA 3GJRA 3PEVA 3KKKA 1CQPA 1RLIA 1G0NA 3DPUA 3KZNA 3OZFA 3GJ7A 4KXUA 4NMLA 4D4LA 1AKVA 1GPLA 3OTQA 1OY1A 5JC8A 5DNYB 3FLMA 1GUYA 4XD7A 2AXEA 1I3CA 2VZ0A 1CUWA 1EP9A 2GN8A 3HL0A 3WRVA 4JITA 2JS7A 4GRDA 3FKSD 1Y7IA 4S0XA 1XLWA 2IPLA 4EMSA 1CQXA 2GSWA 3ZNNA 1FW6A 2CFIA 3QSYA 2AF3C 3UFBA 4QGAA 1N4DA 5DTQA 2JIRA 3AMVA 1XTKA 3N0WA 1O89A 2BC9A 2HJRA 4IWNA 4UTZA 1IJEA 1E1LA 3P94A 3VH4A 5K0TA 4W8GA 1H22A 3ANXA 4KW7A 3UQZA 3IUQA 3ENZA 1R0ZA 2MHCA 1CUEA 3LI2A 2J32A 1UZLA 3GIWA 1XROA 1Y33E 1JWAB 4PGAA 5FI0B 4CW7A 5DM2A 4ZIRA 2PXXA 3ACBA 5CVEA 3W5SA 5I5GA 5K4HA 2F67A 2P4UA 3TUZC 1Q0RA 5A3SA 3LQ4A 2XCOA 2PPVA 2YRXA 5BVHB 1GV1A 3PNLA 3P7MA 1G291 1SIUA 5CCDA 4Z9BA 3SD7A 4YAOA 1C14A 5EUMA 1DO0A 3NBQA 3MWEB 1M10A 4A0FA 1BXRA 1GEEA 4KYUA 3CPHA 3LWDA 2QQFA 1CXZA 4PWYA 3AKDA 5COAA 3VRHA 1IN7A 3QU2A 1NBHA 3BK7A 1ADBA 4OQZA 3KTDA 2X14A 5TJ9A 2X5KO 1N2EA 4EHDA 1OV4A 1YWGO 1IK6A 1IQ0A 1CV2A 4FD2A 3KPJA 2JLAA 1ES9A 3OY2A 5BN5A 5ADVA 1LKZA 2IC5A 2Y1LA 1E1RA 3TG8A 1M0TA 4G5RA 1VIVA 5J58A 1SVNA 4L0MA 1HRKA 5K8LA 5BMVA 5CK4A 1KYYA 1LV7A 2J30A 4R1LA 5JO0A 5CCBA 2C0PA 3P2KA 2OD9A 3HB1A 5EKTA 3URKA 2D1RA 5NLLA 3UTDA 5AJTA 5ICGA 3UMGA 1V96A 2DJIA 3PGVA 4WVLA 5JFGA 4BWGA 5U9CA 3DLCA 2YWHA 3H11B 2D1SA 4RIEA 2RC5A 1Z6GA 1E3LA 5T4FA 3QK7A 5JZBA 3VZCA 1ETHA 2FEMA 5ED4A 3FTPA 1SZDA 1F60A 1YU9A 3TAHA 5HKBA 5LMZA 3GARA 1S2MA 3VKUA 3C14C 2OHOA 2XE7A 1MENA 3KQWA 4QOHA 1KJQA 1D8AA 3H97A 1T8RA 4ROSA 3PTLA 3KT0A 1LRKA 3CRQA 3NKLA 1N5LA 2O5VA 5JALA 3PQDA 2QTWB 3NOXA 1FIUA 4PLPA 3GHYA 2BTOA 4D9CA 3SYMA 2FJUA 3A2NA 1VBMA 5LKAA 1FXWF 2WA2A 3PKZA 2VPWA 4G5GA 4REOA 3AL3A 5BNWA 1CY0A 3MT7A 2G1PA 3GZ4A 4RJJA 1AA6A 1UBRS 3NDIA 3ERCA 2OUIA 1XDBA 2CL7X 2P65A 4RDIA 1I2AA 3RAJA 1QHYA 2XCUA 1PL8A 4L08A 2OB1A 3S5JA 3IQDB 4ZYWA 1Z25A 1UMBA 2LPMA 3L8DA 1A82A 4OHXA 1YDGA 1XD9A 1T1EA 4R1TA 1JMYA 4LRSB 3R3UA 1USUA 2P91A 2QMOA 5GZ1A 4YAIA 1Z45A 4TZ6A 2EFJA 4UHHA 5K5EA 2H07A 2D4AA 4YJHA 3GG2A 3R3XA 3KVRA 3U7FB 3BJMA 5B7GA 1A5AB 1NUQA 4HWPA 4EMTA 1CPYA 3RFFA 3TIVA 3M6WA 4C08A 5JU6A 3ICWA 4MI6A 4TWZA 2CFOA 3JYHA 4W7HA 1FDUA 3IAM1 2W0SA 4HX2A 4HDRB 1JA9A 1N7IA 2VYFA 3FCXA 4UNPA 4YK7A 4F56A 3GVHA 4XYGA 4DOMA 3U56A 1N1EA 3FCSB 5CAEB 4D9HA 2CK3D 5AJUA 3OO1A 1JB1A 4BP1A 1HGXA 1NVEA 4DLRA 4CKXA 5SZKB 4BVLA 4GHWA 2OC4A 1MB9A 3O8NA 3ZGNA 3O8DA 5JISA 1QYRA 3TXXA 1Y9DA 3KFXA 1W75A 3KQUA 1TM4E 2GPWA 2CXRA 4FMCB 3JPYA 3LY9A 1KMQA 4Q47A 2FXIA 3BOSA 5JZVA 2AJLI 4UHBA 3ZVRA 1ZUNB 4MVYA 4XIIA 1FFEA 2OHHA 1QC5A 3EIXA 3K0SA 3UENA 3WWEA 1PJQA 1XLVA 3DKRA 4C3OB 4QSHA 3CCBA 4A23A 3AXSA 1H8EA 3ICQB 1MO3A 4R2LA 4OH1A 4LJ6A 2B1RA 3RRXA 3BREA 4DLXA 3LIPA 2HHLA 1A9ZA 2ZYTX 2IUTA 2ATIA 2GCOA 2O2GA 3WZ2A 2BH2A 5JXIA 3F78A 1FTSA 4G1BA 5JLAA 2C97A 3OTIA 4JK3A 2NT3A 2W83A 2GPBA 1KJWA 3I32A 3P9SA 4J94A 4L4XA 4KHZA 1K8RA 2Q0HA 4WDQA 5F98A 4RNDB 1DCTA 3ENQA 2OSBA 2Y92A 2FUG1 4IG4A 4MR7B 2I7XA 2AI1A 2PMBA 3NALA 5J4HA 1GU0A 3AESB 3G9QA 1P9WA 3Q9NA 4KN8A 4O2AB 4R9RA 5KX5F 3ABZA 4LTDA 3RS5A 4YJKA 3DDCA 1KQFA 3STUA 4MROA 2G71A 2V7WA 3ZJ5A 1GZ3A 2WV7A 2VI5A 4HAYA 4DQXA 1E5QA 2K7FA 5FA6A 1ZUWA 5GMOA 3EHDA 4LF9B 3P9ZA 3I92A 1MIHA 1RCTE 1K6EA 2NACA 4YAUA 3L7YA 3CISA 4O4IB 4ZRNA 5IC6A 3ITEA 2PUEA 3CUTA 5A4FS 2QJRA 1H8HD 2V7QA 3JX9A 4XIYA 5E4FA 3SEQA 2WINI 1T15A 5KNDA 1J5EB 3TNFA 1PNVA 2OO7A 2YJ3A 3CE9A 3FN4A 4N65A 5EJMA 2GEUA 4EK9A 4B6GA 1OYVA 3T5CA 1Y1KE 3IODA 1LNSA 4BNUA 2ORVA 4C2AA 4EJSA 4XD7D 2MSLA 3ZQJA 4OHUA 2VXYA 3AL2A 5T3UA 4F12A 1L7MA 4OQPA 3QKRA 4JOSA 1ISGA 1I13A 2OVBA 3N2ZB 3ST7A 1SUDA 1JXQA 4R2HA 1TYAE 2XBMA 1OHHA 4CDRA 1R1DA 1XF9A 1T35A 3LUPA 4TKVA 2ZM6B 5H16A 1MRZA 5CB4A 3OLVA 5JYDA 1JMVA 1HZZC 5KTSA 1RMQA 3L5KA 4NZPA 4LFAB 4HLCA 4RXTA 5IUNC 2BKAA 4EHFA 2G8LA 3OZCA 3PC2A 2JJ2A 3QVVA 1R8SA 3GNSA 4MARA 3RVRA 3DMYA 4CR8A 2A0FA 4QHYA 3Q9LA 3VUFA 2HK7A 3ED1A 2B82A 4ZARA 1RWNA 4OKNA 4PYJA 4M54A 3ZIDA 4X93A 2YCBA 2CLCX 2P2YA 2A94A 2HJSA 3GI1A 3PGMA 1DO8A 1SQSA 1TQ2A 3N2LA 1XEWY 3COYA 3W5VA 4EG4A 3NAMA 2PKWA 4XGNA 2PJUA 1RZUA 3QPBA 1V1RB 1W5TA 2DUJA 1FNDA 1GPYA 3DD1A 3HABA 3L02A 4GPIB 5EWMB 3RS2A 4E5KA 2V6JA 4FNMA 2FP3A 3QKTA 5E1BA 5JAZA 2WD8A 3CLVA 4BNNA 5JQGF 3LUAA 2E4UA 3OE4A 4I1SA 4NAUA 1Z2EA 5AMXA 3TSOA 2AFRA 4Q18A 5IEJA 2VG8A 2X4LA 2Y8EA 3MBIA 3OFNA 4H31A 2RHCA 3ZDEA 4D4HA 2PMDA 2CVPA 1ID1A 4GO1A 4ITRC 4J0KA 3CW8X 4WINA 3HCRA 4R4JA 4JJIA 3LKDA 3L5OA 2NAFA 3HO6A 3D3NA 1JA1A 1TYCA 4B8WA 3SP1A 3O3MB 5IASA 1GGEA 3P9QA 4R1PA 4MKRA 4F4HA 1P9NA 1MEEA 1QANA 3NIWA 2CL0X 3AY7A 3ZTYA 4GOMD 4F5DA 4JDPA 2VDQB 1CUSA 4J7UA 4N54A 4ZJUA 4PZLA 4MVJE 2FLWA 4DZRA 4F2PA 4Q7KA 4YWJA 2YOFA 1KVQA 1L3CA 2BP7B 4Q01A 4YAWA 1KZ4A 4TLMB 3V4VB 5TC4A 1FA9A 3ZHQA 4OFZA 1OVGA 4HZUA 5DHTA 4ZOLF 1LQTA 2ZR7A 3GUZA 2Y1XA 3BC1A 3OCYA 1L5GB 1E1MA 1AGNA 5CUQA 3WBKA 5EVJA 3LPDA 2CXSA 2IPXA 1ATIA 1I3OA 4IEIA 4BRWA 3GNQA 3SK0A 4IGAA 3FPLA 4FUQA 4EKIA 1IG3A 2HADA 3GUVA 4A8JC 1FJGB 3PPYA 1H2AS 3KKLA 1CJSA 3MTQA 3E7XA 3R3VA 2CYCA 3E03A 5ESWA 1BGVA 1L5QA 3AEZA 3I6MA 2UUCB 2GFQA 3VFDA 3N1UA 4GXTA 4LNHA 5LMNB 5I51A 5AW9A 2W00A 2F9LA 5ALQA 3KLPX 1KMCA 3W8FA 1N7HA 1Y3IA 4TLBA 4WESA 3G2QA 4B0OA 2HMYB 2PDAA 1HYQA 3N3AC 4S1TA 4Y2QA 2X1HA 1NL3A 3EFOB 3FROA 1QFMA 5IAJA 1V3VA 4Z2AA 3I5XA 2N42A 1XALA 3IERA 4D26A 1IWBB 1PL0A 3D0QA 2BKVA 2WJZB 5J5CA 3RUAA 1Y63A 3TD6A 4QFCA 1RRVA 5DEOA 2W90A 5BQ5A 4L75A 3WYNA 1PK9A 1TF5A 3OEHA 1T3LA 1EVQA 5IC4A 4D79A 3R1IA 2P3OA 1CEQA 1XKTA 2ATVA 3M2TA 4QOFA 4MZXA 4V3CA 2OORC 3LUHA 1UR5A 1CUBA 3IURA 2J59A 3HWX1 4F3KA 1WXHA 1RWBA 1VBKA 1YS7A 2OAQ1 3G9ZA 3EVDA 2YFQA 4HH1A 5K0LA 3VOSA 2AN1A 2ZYSA 5G2OA 4ZI7A 2A0YA 2I33A 5EIOA 1I0LA 2WJHA 3JR3A 3TLJA 4BOYA 2P6NA 4KB5A 3ZDBA 1NPYA 2C59A 2Q5JA 4NI5A 2LRHA 4D3YA 1L7VC 4MAAA 2R97A 4O2BA 1MEJA 4W8OA 4AY2A 2G0NA 1G8MA 2AI2A 3D3WA 1XQ6A 3EGXB 4WFKA 1HT0A 5F3WB 3V32A 2NVWA 5AOCA 4Q16A 1TCUA 1KAOA 1U3FA 2X15A 4FUTA 3WLIA 2PX5A 1YB2A 1GNLA 2YVKA 4ESOA 5DLPA 1GGVA 3KHSA 1U1GA 2H9YA 2ORIA 4RM3A 5FO1A 1WUYA 3TW6A 4C3VA 3IKMB 3VU8A 4DLTA 1GZ5A 2ZZMA 4WTOA 2GRJA 4BGIA 5F1PA 4DDTA 4ZTZB 1AQLA 4UAGA 1DT3A 1RKUA 1PV2A 2ZZNA 3SHTA 4FCVA 4GZLA 4BO3A 3AEKB 1F8YA 4HN4B 2CCKA 2PD3A 3EGDB 1RAAA 1H0HA 4K87A 1E2LA 4LNAA 4NCKA 3EOBI 2DCUA 5B1IA 1K4KA 5CLGA 1TI7A 3JQBA 4RK1A 5TMBA 5UKDA 2PZBA 3TR6A 2QUIA 3EY4A 1JKJB 1E9DA 4M7RA 1GGMA 1FQOA 3PICA 3W04A 1IFXA 3COWA 4Z0PA 4QTYA 4DARA 1L5OA 4ZDWA 1DUSA 1F3LA 3QBVA 3T94A 3ZE9A 3I5YA 5ESRA 4CKBA 2GAAA 5CIYA 5FORA 5I5EA 1U0SY 3IP1A 1V11A 2V7QD 3EGWA 4IHQA 3VZBA 1Z7BA 3BIXA 3EQ9A 1X7DA 1X0XA 1KJYA 3DEHA 4HNAA 4WFQA 4O6VA 1Q92A 1DARA 2BFEB 2BGWA 1T26A 3LY5A 1UIRA 1O4VA 3KVVA 5H68A 3VYTB 1O0BA 3LBFA 4LVNA 3GLIE 1T8TA 1YA8A 2BE7A 4JYAB 2ZRGA 4RZXA 1J23A 1XR3A 3PNOA 4DIOA 1SXIA 4D41A 2J3LA 5IYZB 5KCMA 5IAGA 3ZWMA 3DF9A 2CLOB 1AXGA 1XDDA 1YQQA 1J2TA 4AMYA 1Z73A 2Q8NA 4DUZB 1Q6YA 3NBFA 4DY6A 1AQ6A 1VJRA 1R6UA 1WDMA 5B1EA 2Q7XA 3JU3A 2HJ9A 4MUFA 3V7FA 1Z5VA 1RI1A 4HEA1 4YUXA 1XRRA 1RM0A 2XDQA 3B6IA 3E18A 2R1TB 3OX2A 1T1IA 1N7GA 2H63A 2IP2A 3QH4A 4ZAYA 3WAJA 3CNHA 1PZNA 3EVBA 3JSXA 4M6WA 4ME6A 1CZNA 4DHWA 2JJ2D 3HEBA 4TZ0A 1JMKC 4MW9A 4DTIA 3UFXB 5T7BA 2DUUA 4E51A 4IDNA 4PSKA 2EKBA 2OWEA 2P90A 2I55A 4IDGA 4U4AA 2IYYA 4RVGA 2HSGA 2Y0CA 3L7LA 4BJ1A 3KT8A 1Y82A 1MAVA 5CYPA 3AR4A 3A7EA 1HYBA 1ESMA 1W30A 2NUPB 3FMGA 1HWYA 1SA0A 3IBCA 4FK8A 4KK3A 1N6HA 4MRVA 5THKA 1SVUA 2OFFA 3UOAB 3IYLW 4QTXA 2DPMA 4LC0A 4BNXA 1THTA 1AZTA 4RHXA 4IZOA 1WOMA 1Q3TA 1BHO1 5IABA 2EF1A 2PA0A 3LKBA 2PRIA 5CIQA 5JH7F 1OC2A 1FFXB 1MO4A 1CNMA 3K3PA 4IYJA 4UUMA 2V8OA 2VZ8A 3OFND 3RFTA 3SEAA 3QJYA 4O0LA 1EWQA 4OTZA 4IKPA 4ZN6A 1XNQB 4ZAVA 2R6AA 3WFJA 2XADA 3NDBB 2JFPA 1QGDA 3ZJVA 4OY3A 4TTVA 1UBTS 2J3HA 3ETGA 4YRLA 4KU4A 4HUQA 1PT8A 2A9JA 1JU3A 4G8JA 4O3FA 4N8SA 3ZK8A 2X9LA 2G9VA 4CMCA 1E99A 3H99A 3ITDA 4CUZA 1U6IA 2EWMA 1NJ2A 4IEFB 2Q2QA 2XVMA 2ISSD 5IXJA 2C03A 5IM4A 3NT2A 4C14A 1LTKA 2P2NA 2RFLA 1WXFA 2AE2A 2AR9A 4DR3B 1V3TA 1YBMA 2J09A 3A4MA 4IXWA 2SCUB 3L4BA 4CIBA 1E2JA 1Q3HA 4TUYA 4OBEA 3QJ5A 3FDIA 2XCLA 3PUKA 4O25A 3ZCSA 5E6SB 2XLBA 2DTXA 2X5XA 3QHPA 4I55F 1JH9A 4MOWA 1JLHA 2Z0MA 1U98A 3HVHA 3ZI7A 1BS9A 2HWUA 4U00A 4Y67A 3THYA 2ZRCA 1N0VC 2BGIA 3ME5A 3U61B 1FZTA 4C7BA 4Y1EA 1O0SA 1V3QE 3DB1A 3EIQA 3IKVA 3PIRA 4MP3A 4QXRA 3REQB 1O96B 4NKRA 4Q3LA 1GA1A 1MGPA 1KR5A 5I9NA 4I4LA 1JHMA 2WSBA 4I4TF 1L2TA 2Q1SA 1MG5A 3SY8A 3ZI0A 1GO2A 1G60A 1C0IA 1ML4A 1VL8A 4KQKA 2G9NA 2ORYA 2Z3VA 3BORA 2GT1A 5CNMA 5ANRB 3HUDA 5AW7A 3S8EA 2G40A 5C52B 1NC3A 3SXJA 1NW9B 1NQTA 4NG5A 1CEXA 1P3Y1 3W05A 3BDAA 1VPEA 2PS0A 4DCNA 4ECAA 2QTFA 1PNQA 2EVWX 2YV1A 2QNIA 3AHEA 3DAOA 4Y6LA 4EKEA 4D4KA 2OAGA 1MC5A 4LV5B 1QVWA 3DGFC 3L0CA 1JKXA 1WBJB 3NBXX 1M1YB 3P9CA 3ELYA 4GUDA 5FADA 4F9GA 3OEHD 1MB4A 2VHZA 5EMHA 3BGWA 2ZSHA 5DOVA 4ZT7A 2ZZKA 3TW8B 4AM8A 5LFAA 3RAEC 2GEVA 5I7UA 1U7DA 3JD4A 3SF8B 3OY7A 1WSWA 3E9EA 1SH7A 1J25A 4MW7A 3DZIA 1UK8A 3NHLA 3OQPA 4N8DA 4DMKA 1SKYB 2KYRA 2Y99A 2NSYA <