4PGAA

Glutaminase-asparaginase from pseudomonas 7a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion binding induces closed conformation in Pseudomonas 7A glutaminase-asparaginase (PGA): crystal structure of the PGA-SO4(2-)-NH4+ complex at 1.7 A resolution.
pubmed doi rcsb
source organism Pseudomonas sp. 7a
molecule tags Bacterial amidohydrolase
molecule keywords GLUTAMINASE-ASPARAGINASE
total genus 117
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pgaA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4pgaA01
2HLNA 5HW0A 2HIMA 1HFJA 2WT4A 1WNFA 2OCDA 1ZQ1A 1IHDA 5DNDA 1DJOA 4R8KA 2P2DA 4RA6A 4RA9A 4ECAA 2P2NA 5K3OA 3PGA1 1HFKA 5DNEA 5I4BA 5K4GA 1NNSA 1JSRA 5I48A 2D6FA 5K4HA 1ZCFA 5F52A 4PGAA 2JK0A 1HG0A 5CBPA 1JAZA 4NJEA 5I3ZA 3NXKA 1JSLA 1JJAA 4R8LA 3NTXA 5K45A 2WLTA 1HO3A 1O7JA 1HFWA 1AGXA 1DJPA 5CBPB 1HG1A 3ECAA 1WLSA 5DNCA 4RA6B 4RA9B 2GVNA 4Q0MA 1WSAA 4NJEB
chains in the Genus database with same CATH superfamily
4PX3A 3LA8A 3SIRA 1QQ6A 3A1DA 3IIEA 2HXGA 5EHIA 1SQGA 4JXZA 3WKDA 4CR7A 3E7PA 1GCAA 4K7JA 4OAQA 5JZSA 2D2VA 1HE5A 3DUWA 4CKEA 3ZGLA 5EJGA 1VG8A 1R15A 5K4GA 5ARCA 3OZEA 1DPFA 5F5LA 1DKPA 2HSGA 3C7KA 3RQSA 1Z5GA 2GX6A 3I92A 3Q8WA 3IAEA 4ALNA 4W99A 4XWGA 4M8IA 4NX2A 1SRRA 3G49A 2EATA 1JQ5A 4NH0A 1X7YA 2TMYA 4YCLA 3DWEX 4U3JB 1BEZA 5HIMA 1C80A 1EGMB 2XNHA 5BN4A 1BO6A 3NDRA 2R6JA 1XLUA 1DKUA 4TQAA 1XYVA 1SD5A 2OMEA 2G80A 1TFUA 1IHUA 4CJXA 2ZSHA 3O8QA 4J0HA 2KI5A 2OSBA 3AKEA 2DERA 4ESHA 4I8XA 3OUUA 1JZSA 1YDEA 3CJRA 3R20A 3RC8A 1VYUA 2ZIGA 5KB3A 4Y7DA 1YK0A 1TOAA 1SA0B 4NBTA 5IYZF 4G97A 5D5QA 5M5BA 2JGAA 3LHKA 4RDCA 4CMKA 4NABA 2VBGA 4YPFA 1O77A 1OE0A 3OT4A 3OTIA 3SZUA 3LC1O 2AHRA 1DEOA 2CUTA 4KGZA 2YYAA 3PJGA 4EG4A 4ZTZB 2BEWA 1T3LA 2O2EA 2BMAA 4MRSA 2HBYA 2VDUE 1NDUA 1KYXA 2UDPA 3B3QA 4HWOA 1B2RA 5J2TB 1CY0A 2AJ8A 4LY9A 4PZ9A 2COUA 3B53X 1L4MA 4KSBA 2WV7A 3CINA 4GR5A 4Z99A 1U5AA 3BSFA 4J4TA 3D6FA 3UXHA 3GLFE 4FOTA 4IIDA 2W6OA 1HSOA 2R6CA 4QSMA 1XDGA 3R6WA 5BN1A 1R18A 5LOVF 1LBIA 3KV1A 2N1MA 1NHWA 2B6HA 4NSNA 1CDEA 1A96A 3FWZA 3MUNA 4DKXA 3C7CB 4NZPA 4ZYYA 2HPHA 2VKTA 4ETNA 1D6NA 5I4BA 1TKBA 2I2BA 3AK4A 3BL5A 2FN7A 2PT6A 1K4KA 4NZOA 4Y6LA 3Q6NA 4DDUA 3DUFB 3ZG6A 2IS2A 3TOVA 1FUYB 2QXUA 3AR3A 3UCEA 3M6UA 1DI0A 1KAOA 2BEUB 2PQ0A 1X3SA 4N82A 1ZU4A 3FYDA 3NP7A 4FFNA 2EVWX 4OHMA 3T5DA 3GJ3A 3L06A 5BVGB 1F8YA 1V41E 1P4SA 4K9SA 4CM5A 4D97A 1YMVA 3GGSA 4WSOA 1CUHA 3H83A 2FRDA 1E69A 2VPQA 1EFDN 2O0KA 4DIBA 1V96A 3MLAA 4NCJA 2IELA 2RC6A 3IDFA 2WJWA 3W3AA 1Y6FA 1XZPA 2XMRA 2EL7A 4UQOA 1RXVA 1M7GA 1Q7RA 2B25A 5A71A 4PG4A 1OBOA 1NPYA 2VDJA 4L78A 3KFVA 4D96A 2XOKD 2HA3A 3IBFA 4NV0A 3KXLA 4JVNA 3EHDA 1E6EA 1M1ZA 2P9ZA 3X1XA 4A3SA 4M0FA 1IB6A 4AJOA 2XB2A 3NIFB 2PGIA 3PNPA 3N58A 1Q2UA 1Y6GA 1B2LA 3ANMA 3IEPA 4PZUA 4YQEA 3DSRA 3ETGA 3I9FA 4TMTA 2WMDA 5GONB 3T5MA 4YUZA 3O8RA 2M98A 1PV1A 1AK1A 5EWJA 1QVWA 5F3RA 1DO8A 4HQ0A 3RUPA 1RCUA 3UWKA 1AXEA 2WZCA 4O63O 421PA 1WMAA 4XQEA 1X7ZB 1ZN2A 2B4TO 4TV9B 4DLZA 1KWGA 2OXEA 3VAYA 1XP8A 3OIVA 5DFAA 1H9BA 1UXGA 1XK6A 1ZW1A 2YFKA 4K6MA 4XIYA 2XE6A 5CXXA 4ZAYA 4DNXA 5G4KA 3BPSA 2IVFA 1N77A 1IK4A 2ZDGA 3VC1A 4ZTBA 5ARBA 1C0LA 1HL7A 1AKUA 1SC6A 2FW6A 3L4BA 3P0JA 4M36A 1JL3A 3C70A 3KT8A 1J20A 4KWTA 3U3OA 4QT0A 4E5YA 3VV2A 1NKSA 2L82A 2QQFA 5AKHA 3IE1A 3ZHBA 4QATA 3CEMA 1E7YA 8LDHA 5FBWB 3H4IA 2R1VB 2V03A 3QX3A 3TDMA 2GN4A 3N1UA 4WLFA 1GKYA 2LCIA 3MTDA 3ZK7A 5LIRA 1LRLA 4B3SB 1U0BB 4I6EA 1YDFA 4KNWA 1C9KA 2YR0A 2B3TA 2Z2YA 5M04A 1ADJA 3ZLVA 4GOMD 3AI1A 3WSWA 2NSJA 3AKDA 4B09A 1UC5B 2CVPA 3JWGA 3QJYA 4M22A 2VPXA 4RU1A 3ND8A 5D6OA 5DNWA 3DEAA 3AUXA 1D07A 1J8DA 3LCRA 3MWGA 2O2JA 4BNZA 1ZSNA 2XCIA 4C0AC 4YMLA 3FBGA 5FL3A 2YJZA 4MW0A 3GOHA 3ETJA 1C41A 1HT3A 2FSSA 4DG5A 2UUAB 2NWQA 3HRKA 4JEMA 2WE7A 2VXBA 4HN2A 4IXMA 3H0KA 3AG6A 1A27A 4S24A 3PKIA 5JWHA 1NNUA 2ZJ4A 3VKFA 1R0KA 2WU8A 5T4EA 3KTOA 3VX3A 2DUNA 5CW2A 1SKQA 5ALJA 3C3AA 1EX1A 1FVHA 4LNUA 4PRLA 4D9JA 2YDYA 1JMKC 2CWWA 3UAXA 4KUHA 1I14A 5ALIA 1WMBA 3G2JA 4HUJA 1O95D 5DASA 4AXBA 5C35A 5HEKA 3V8RA 5KHOC 1PWXA 3HB1A 4XFDA 4YAIA 5CBPA 4UU8A 1Y7TA 4LF9B 4DN6A 5CJJA 2IYVA 3IAS1 5AVOA 5HF6A 1JBKA 2J0UA 4HSEA 2HOQA 2JI7A 2QMZA 3G79A 2J08A 2O8CB 5EGNA 2QD1A 3S2YA 3TUIC 1BCRB 3PFHA 1QG4A 1HT2E 2PKEA 2Q9BA 4PZZA 1GTMA 2AG0A 1Z6PA 3PNBA 1O5OA 2C3YA 2ZSKA 3CA8A 1VCOA 1WOYA 1Z06A 2JEOA 2PUTA 1Y8RA 4BQFA 1EDZA 2IE8A 2V8BA 3TVYA 2ZJ0A 2FLVA 1NJ6A 2V4ZA 3CUEF 4MUJA 2LPMA 4I46A 4W6QA 1DAFA 1XIVA 1GL6A 5B1IA 3PKJA 4FX2A 1D1TA 4PGHA 1DDGA 1XZMA 1C2TA 4LXXA 5G3YA 1X94A 5BR1A 1WD5A 2EFYA 1CR4A 1G6HA 6PFKA 4ENPA 4H4DA 3P0IA 3OTQA 3EY4A 3M81A 5DM0A 1V25A 1TCAA 3ETHA 2ZUBA 3MTIA 3AYZB 3PFCA 3DBHA 4K6KA 4UE6A 2OYCA 3A04A 3Q0TA 1I94B 4B7XA 4ZGBA 4G67A 4BMYA 2YHIB 3W6NA 3HK2A 5KNDA 1H93A 1UQUA 2GHQA 1K3UB 4KXFB 2PZFA 1V5IA 4HNAA 4DIFA 2QAGC 1XTVA 2FZCA 5BN3A 1OWPA 1YONA 3SBEA 1ODIA 2IXFA 1QUEA 6REQA 3QVVA 1PJ8A 2VZEA 5CLGA 1RI4A 3EMDA 1J8QA 1Q2XA 2I22A 3AFOA 4PZEA 4L4ZA 1Y3DE 2I2AA 1NBWB 5JEDA 3TQOA 3LPLA 2YWGA 2D4AA 4HPJB 1H2HA 3Q41A 4PCLA 1VFPA 2R8OA 4HBZA 1A88A 4Q4AB 3JD0A 1GCGA 3TLJA 2X3YA 2QTWB 2OXIA 4DV2B 1LSSA 2WUWE 3PXAA 4IFIA 3BRSA 3H9CA 3E48A 5DP2A 5H59A 3SVTA 2PZ8A 4JGGA 3ZCPA 1JE0A 1VL5A 2R5NA 4UM5A 3RTAA 1Z38A 2A5GA 2C95A 4MSUA 3WMGA 5FQOA 4AZ3A 1QRUA 3RVBA 2ZW9A 1BCRA 1G8MA 1SQ0A 2VTVA 3CLHA 3GZTB 3IDOA 5LA6F 1HNWB 1J90A 1F8GA 1FFBA 1JSCA 1MQ9A 1UBMS 3E53A 4TTQA 5AMXA 4ETIA 1T5IA 3F3SA 3N05A 3KYJB 3RDPA 1V3VA 4FLFA 2BBSA 2W22A 4JB0A 2HCTA 1L8AA 1R3DA 2FRDC 4EY7A 3VPFA 2GYYA 2O2IA 5DGTA 4BUCA 2PUFA 1B23P 4ZMSA 2OM6A 2FUCA 1TM4E 1H6BA 3FWHA 3KLBA 4ZP1A 5ERYA 3RAJA 4CTJA 4HVTA 4TTTS 5ISMA 3OJCA 3BMQB 4HUTA 3CUSA 1AGPA 2ZR8A 3A9CA 4KXMA 1N5MA 4YK7A 1ZXXA 3B1ZA 2E4AA 3LYHA 3F5FA 4JLAA 5IUKC 5CYGA 5JBQA 2DUUA 3C0KA 2QGZA 2JFZA 1ZIYA 3GRFA 3TLAA 3HI4A 4DMUB 4H1WA 3GXBA 4DHEA 2D5AA 3D5TA 5HFAA 1DG1G 1T15A 3A10A 4CW7A 2WJGA 3HFRA 2KSQA 3QSGA 4YMSA 5BSVA 3QLTA 1H0SA 4F21A 1LNQA 2JK0A 2QZJA 3QHQA 1B41A 4LDAA 1G2IA 5J58A 2FW1A 3H17A 4XM2A 1P2GA 4JLUA 1W2GA 1TIPA 3NTXA 4BNDB 3ROQA 1F3OA 2E4VA 4IGKA 4RIIA 1U1EA 3C1TA 3L7BA 1KP9A 1KU0A 4FNMA 1Q1BA 1N5LA 3KYDA 3PUWA 4PFKA 1VG0B 1DTSA 5KSPA 5C8VA 1W4RA 3G82C 2VLIA 3K1AB 2FSFA 3DGEC 4OQZA 5ALZA 2RE8A 3CVJA 4PHGA 4QWWA 3M3DA 3ODGA 2WG2A 2PGDA 2HNBA 1QH9A 5KJCA 3KB8A 2BI7A 2QPAA 2P6RA 2XCSB 2HRQA 4JT9A 1FNNA 1VL0A 2PS3A 1M1YB 4NNPA 5LXTA 2AFHB 4GWLA 4QJBA 1XVVA 1M34B 5K5EA 1PNQA 1Z45A 2JGLA 2LP4Y 4LRQA 1RQGA 1TRHA 2L18A 4JC0A 1MU0A 5AHWA 5A6SA 5MF6A 7REQB 1R4NA 3SN6A 1XCGB 1DMRA 4WCDA 2C7GA 2RHTA 4EY8A 2DKOA 1PQWA 3LO8A 4EUHA 3M83A 5HBGA 4YYEA 2VJLA 3F8TA 1AF4A 2J0SA 3LU1A 2AK3A 5C37A 1FNCA 3E22A 2J45A 4EHDA 4LPKA 1XWIA 2YN4A 3RRZA 4RWZA 5TPWA 3GAZA 3GLQA 3JW8A 3KOZA 2B1GA 3JD1A 3Q1KA 2DWQA 3ZUPA 3HLYA 4BJ1A 2HB6A 4DIKA 3DMHA 5BRNA 1LX6A 4FQ8A 1AA9A 1ZN8A 2BR4A 3AFNA 3CFYA 4NYMQ 1JVBA 3NVMB 4ALIA 4C2AA 4JB2A 4BCDA 2HUNA 4FHEA 1MJGM 4YBZA 3RREA 2ZRDA 3W5CA 4OLAA 3TCNA 4HZGA 5JO0A 1RWPA 1RCTE 2MINA 1X7XA 2O2DA 1H2RS 1KETA 5HOEA 4FR5A 5B55A 1PZFA 4MS1B 1OVMA 1IFXA 4W7IA 5L4SA 2KWIA 3SM9A 2FZVA 4G23A 4KVFA 3ZHRA 1MIOA 3BQNB 1T36B 1OWMA 1QVVA 2N75A 3L0IB 4DCTA 2ZM5A 4BNWA 3IQEA 5TS2A 3LYUA 1P9RA 2WU0A 2OZLB 2PUBA 2Y1CA 3QVLA 5C5DA 1ZVVA 2NQTA 1VM6A 1JV2B 2QTFA 3W5SA 1RXSA 4RMIA 5ULLA 2CFSA 5K0JA 1ORDA 3U44A 1Q84A 1QK5A 5CK5A 4S1TA 1L5HB 1G5RA 2JAPA 5TGTA 3W2HA 3WAGA 4ML3A 1ADGA 4ZU6X 1YNSA 1KI9A 3BREA 4X64B 2IL1A 2ZJYA 1X1RA 4DYHA 2B7CA 1O4VA 3DE2X 3HUUA 4DDTA 1L4UA 3FUXA 5M34A 3A3PA 1G8YA 5BN3B 3OE1A 3ISJA 1N36B 1LK7A 1OBFO 2GZDA 3GLIE 1A9OA 1JLKA 4PIVA 3W6UA 2B5WA 4Z6KA 2G9VA 5K3EA 2ANBA 2G1UA 2QZSA 2Z0MA 4Q00A 4CMGA 3I0NA 1KFEB 3C7AA 4QRHA 1N6LA 2PUHA 4CM1A 4PONA 5AUOB 1LY1A 2VA9A 1XU7A 2IZZA 1USUA 3ORFA 2BHTA 1R5JA 3VR6A 2SKCA 4KC0A 4AMZA 3X2FA 1ZMRA 3SKVA 1NRIA 3EPHA 1YS4A 5ALHA 4ZI7B 1O9BA 3ZY5A 4E2XA 1I33A 1WDTA 3U40A 1E64A 1DEHA 3DEHA 4B6JA 2GM9A 2ISSD 4RAQA 4MUXA 3U7RA 1U63A 2ZYUX 1M2EA 3E5NA 5G3ZA 2H06A 4XUEA 4MJ7A 3MGBA 3WRVA 5B5SA 2OXTA 4AWBA 2V3WA 4KQXA 4N3GA 1I3KA 2WIDA 3V8BA 3FYTA 1G60A 4BUJA 4DOMA 4Z54A 1QQBA 4R2WA 3TMKA 1F12A 1PFWA 3QOWA 3WLLA 4V0QA 3BQ9A 4HNQA 4M7PA 5TARA 1XPJA 5KQPA 2OCKA 3FPBA 5BWLA 3ED5A 2HRBA 4IFBA 1KE1A 4GYYA 1NT2A 2K2WA 3RNOA 1ARZA 2INGX 1CF9A 3G2NA 2XYVA 4G1VA 2VK1A 3FDJA 1R6AA 1ZG3A 4P7FA 4KITB 4IDBA 5I5EA 5FEMA 2OFXA 2C7RA 4NVRA 3U5TA 3O2SB 1M76A 1L7EA 4CV3A 4WUTA 3GGOA 3N6RA 3NU1A 4PRZA 4HGPA 4XYBA 5T6BA 2AG5A 2IDJA 2WM3A 4MVYA 4Z8YA 2NSHA 4KX3A 5EP1A 1L8LA 2EF0A 3PHHA 1MAVA 4B45A 2ZLBA 3AY0A 4TMWA 1XA0A 1V3UA 3GLUA 3GUUA 2ZI3A 2X5NA 2F43A 1KH1A 3G1UA 4QXOA 1X74A 5B3KA 2QUIA 4J43A 2CSXA 4GOOD 4K6FA 4C3OB 4K87A 1BXKA 1FB5A 2PYZA 4WESA 3OX2A 4HLUA 5HRCA 4OP3A 4WV3A 3FWPA 2GBCA 2JJ8A 3AF2A 4RSHA 1GQ2A 2QLFA 3PFKA 1NY6A 2Y0EA 3C8ZA 2J7KA 4CKBB 3TZ6A 4JJ7A 1JSLA 4Z7QB 2OWDA 5ESRA 3PUXA 1N6OA 1YRQA 2II6A 1HRKA 1LVGA 1CX9B 4GI1A 4E7OA 3GNSA 4U5XA 1QZ3A 4P5DA 4UCXA 4EG3A 4CLOA 3EIXA 3TNDA 3A32A 1PCXA 4EWLA 1JKJB 4GP7A 4OKSA 4TN5A 3EQ8A 5FJJA 3T54A 4Q9DA 3O9VA 4ED9A 9LDTA 1XZGA 1A4IA 4CEIB 2IBSA 1J0DA 4OX9B 3L02A 1M8KA 5TT0A 4AKTA 1YR1A 4EJ6A 3K0HA 2IYZA 2EU8A 3ND6A 3WB9A 1UOQA 1ZS9A 3NGXA 4I5DA 3WADA 4EYGA 3EXHC 3QA9A 1C8KA 1U8YA 3P9IA 4CM7A 4EENA 4OIFA 5SY6A 1C7ZA 1BA2A 4DLVA 4QPPA 4QQNA 4I9UA 2COEA 1P9NA 3WGYA 5HUHA 2JB9A 2JKVA 2G67A 3EQ9A 4HZIA 4LJ6A 2IUSA 4YMWA 3LNCA 3RK0A 3TB6A 4DB4A 2CNLA 2REQB 2C7PA 3C3XA 2QAGB 1N6HA 4H1TA 2V7TA 5BMVA 4OHXA 2A9OA 1H8HA 3LQKA 2QN8A 1K88A 1I3NA 3C24A 3PDJA 3TRKA 1AO3A 1U2SA 2EZ4A 3ZWPA 2HH9A 4Q21A 5IAEA 1ZEJA 3TVTA 3W3AD 1DMSA 4B3BA 3HKEB 1YS7A 3VFDA 4X90A 1JYSA 5CB6A 4I19A 1F5SA 4RVFA 1EJ2A 5JI2E 1ZW6A 2BDEA 5FUXA 4AG5A 1NF9A 1ZMBA 2HQRA 4YUAA 2X58A 3HB7A 5AI4A 5B1HA 3RWBA 2QTTA 3DAPA 1B8UA 3DAGA 5AJHA 1BQEA 3FPKA 3JARB 5EIBD 2FEMA 3FN4A 4PHFA 4CMIB 5KNBA 1TYAE 1ZZGA 2C7OA 2GN1A 5DBOA 3S5UA 3A6ZA 1IM2A 1Z4LA 2XE7A 3NXSA 3UB2A 5KYYB 4ND8B 1KTVA 3DZGA 3FHLA 4LXGA 4BYMA 3E2IA 2P9TA 4GLBA 2RH9B 4R7ZA 3Q9SA 5FADA 2GCOA 1W4BA 4JI4B 3LFTA 2H2FA 4MCHA 4MIKA 3KOYA 4MVXA 4ZQIA 5KSOA 3QSYA 3HCFA 3RKRA 4IVQA 3OPVA 5E2IA 3WHKA 2ZAOA 1FYDA 1N92A 2IGBA 4IHKA 4NI5A 4A5OA 1VP9A 4N5DA 4B6PA 4MIOA 1C0PA 1YQTA 3PK0A 4B7ZA 4ZVMA 1GSOA 4CKXA 1ZNZA 4JASB 4WKGA 4HQKA 3DBOB 3JD2A 5HQ3A 1K6MA 1RYHA 3OPYB 3OLVA 2Z3VA 4D4GA 5BRAA 2MU1A 5ED4A 1GT91 3JQFC 4E5MA 2V5VA 3I5MA 5HKLA 1Q7GA 1ONNA 4B5LA 3B7PA 3SS8A 2EARA 4OAPA 2ACVA 3DVLA 2O2GA 3FETA 1LK0A 1ZUD1 3OMXA 4C2TA 3UATA 5F33A 1PK9A 5FQNA 1G6OA 1KI8A 4RTKA 2J07A 4BVLA 1QE0A 4GHWA 5EJ7A 4FXPA 2LIPA 5IC6A 2G9ZA 4YO8A 5DRYA 4A8TA 1IQUA 4LGMA 4TZ6A 3KAJA 2HMSA 2QG6A 1VOTA 1XAGA 1EZ4A 3IQZA 3L4JA 5IFKA 1O4WA 2R8BA 5ALMA 2QTNA 4HWPA 1OZFA 4S12A 3EPLA 3QFTA 2G72A 2VK4A 3JPWA 4GECA 4DR6B 2Q3MA 3ROEA 4TVSA 5DYIA 2O1XA 5FHRA 3OT1B 3FDFA 3MPUA 3UNXA 1OFVA 1OYWA 4J7CA 2I3ZA 3IPYA 3ACBA 5AVZA 1NUPA 3GV0A 5FLEX 2OGWA 5IDVA 3T7TA 1CY1A 4G6ZA 2YVUA 4N4AA 4JC8A 5ALNA 2FG7C 2Y6VA 1HYEA 2E7ZA 3TZKA 3KCNA 3GQVA 3RTEA 1MAAA 2B69A 4UCFA 1SIWA 3N7TA 1CFZA 1PHRA 3OZFA 3O1HB 4KACA 1C0EA 2X8LA 4KE6A 4U39A 5ALKA 5C3UA 3TLBA 4RPIA 4XVUA 5EJ9A 2VT7A 2IW1A 3GH3A 4RGVA 4DDWA 4NBRA 5BOVA 2UVPA 3QXJA 1P1KA 3NHRA 1T34A 5EMMA 1F2DA 3EFHA 3UJ8A 3ZXUB 4D6PA 5DHRA 4TUYB 1Q0UA 1Y7PA 3PGVA 4FWBA 5KMGB 1NAIA 3OPYA 4QVIA 5IBRA 4PO9A 4GMGA 4IF4A 2XRZA 1GAEO 5AUQA 4BQEA 3B1KA 3ZN2A 2E4YA 3KZ1E 1DXOA 2PL5A 3SS7X 2WIGA 3HGMA 4RANA 3X1ZA 4F7WA 5A02A 4D45A 5UKDA 5FUMA 5HTOA 3UK0A 1KMHA 5EHNA 2OBYA 3TGWA 2VJQA 3C3WA 3QI7A 4RV9A 3RU3A 3ZHOA 2ICAA 3ZCQA 1F6DA 4DREA 3ZGOA 3T3OA 1ZLXA 2E21A 3B1YA 2YZ7A 1USWA 3KG2A 3QITA 4QKQA 4S04A 3EPJA 3MFYA 4KVAA 3RS9A 4B7UA 1QP4A 1DIHA 2PO5A 2REBA 5MFPA 2RHMA 4KMSA 1B6SA 1KPHA 1KI4A 3DAHA 3LVQE 4HI0E 1Z07A 4R0NA 5KO2A 1ESEA 2EJVA 3S2SA 3D4OA 1USGA 3OQJA 4U02A 3V42A 2YWFA 3B2QA 1E7WA 1AGYA 1GOTA 1X38A 2A8YA 5DN6A 3UXYA 2EX1A 3OD1A 3Q3CA 2HIMA 3OBBA 3E5MA 4WLVA 4WOJA 5PGMA 4XOUA 3UMSA 4B6SA 2SKEA 1Z26A 1CY2A 2W5UA 2BOVA 2P78A 3UBTA 1G21E 3VZRA 4ND5A 4BVBA 2FWPA 3TLXA 4LQLA 3WRYA 4YECA 3IFSA 5I47A 3RSHA 5AVVA 4PLTA 2HHHB 1DARA 4J0DA 3C4JA 4CIWA 4Z4GA 1ZY2A 3L79A 3MWDA 3N76A 4H0CA 4LN1A 4OEHA 2V9CA 2DBVO 4MRMB 5L3SB 4X65B 1G6Q1 1FA9A 1KJ8A 1N3YA 3JS5A 4RA9B 4D3ZA 5J5CA 1HZJA 3D7MA 2OUKA 4I5GA 2EP7A 2IITA 5C4IA 1BXGB 2JZOA 3T7CA 1E1YA 4OQXA 1ODFA 3K5IA 2PPVA 2ZBPA 1RPZA 3VPXA 2PRIA 1U28C 1K2WA 1FP7A 1V1MB 4UFOA 3ZZ0A 2ORVA 1NXTA 5LP1A 4N41A 4Y2QA 3AQIA 3QVWA 7ADHA 4EP1A 4IO0A 1E2DA 2NU9B 3LV8A 2KS6A 3WMXA 4LF4B 3ZOZA 1C3JA 1XMJA 1AF7A 5LM3A 1KAEA 3C3JA 4R8LA 4J9UE 3ZVNA 4UDYX 3IR7A 3R09A 1D09A 1W0CA 2QOEA 1KP2A 1DU4A 3QWBA 1A5AB 4QBGB 1N5OX 3NAZA 4PTLA 1UBFA 2DBZA 3VYVA 5JD3A 4C30A 3A0UA 5ITZB 2KPOA 5JNVA 2PX0A 3U56A 1L7MA 4UHDA 4F72A 4HGOA 1YR9A 3TQIA 5JSQA 1G7RA 2QL5A 4BX9A 1HY3A 2W83A 2GAJA 2I1QA 4CQLA 5D5HA 3BB1A 3W8RA 4F1JA 1QG2A 4CEHA 4G01B 2J41A 3E5RA 5F1KA 4MS3A 3FR8A 3OFSA 4RZQA 1VRCA 3RSLA 5LD2C 1FMFA 4JBIA 5KOHA 1RWVA 2H1OA 2O5EA 1L7XA 1YZFA 3ADKA 2BM1A 5KVAA 3RK4A 3WOVA 2J0VA 2O1WA 1H4QA 1N78A 4G2TA 2P4SA 5E8RA 3F7OA 1NY5A 3AU9A 3HDQA 3QF4A 3ZTTA 5JCXA 1HX7A 2H5IA 4CM9A 1KZ9A 1PJ3A 3CCCA 1EE1A 3MM4A 5C46F 1W7AA 1INLA 1CJSA 3KK0A 5ER6A 2P2DA 3DV2A 4MCJA 4RA9A 1RM0A 1S5PA 3IEUA 4N3NA 3O95A 2DUMA 5AOCA 1W34A 4G0XA 3L8GA 3VR3D 4AJ2A 5K3CA 3UYLA 2X8JB 4LYEA 2WJVA 3LP5A 1QP8A 3QKTA 3A3YA 2PRZA 1ZHOA 1PW7A 1ZJYA 4M0CA 2VPPA 1TMGE 2J3DA 4LMPA 3ONWA 1UXKA 5AJXA 1A50B 5EVCA 3SSOA 4I8IA 3RYFA 5C1PA 3ZU2A 3CVXA 221PA 2EWMA 2JFFA 4DWVA 1GYRA 2H4WA 3EQZA 4ALLA 1UZUA 4FC6A 4RVCA 5FWYA 2DJ5A 1JIQA 3GVIA 1G2OA 4G4JA 4YJ2F 2R00A 3MS7A 1GITA 4R1SA 1C4KA 3PSHA 4R1UA 2ZR0A 4G63A 3TZBA 5ICMA 3PR2B 4FS3A 1Q17A 4P0QB 4JENA 5IKEA 5FI1B 2P0EA 3B51X 5JSYA 4FHDA 1NMEA 2P4HX 3KPVA 1W29A 1N6KA 2ZT5A 2HQSA 3FOEC 2PD3A 3T3MB 2HADA 5FOUA 1PLJA 3ZPXA 3KXDA 2AR0A 2UZ1B 2QTLA 1MGPA 2Z95A 5AJTA 2IUEA 4EM6A 3R7BA 4B9AA 3C16C 1BWSA 1TVMA 4PYNA 4OH1A 4WDRA 1TQ2A 3R7DA 1H2EA 4DG8A 1WF3A 4O0MA 5HNKA 1VLMA 1J99A 1BD3A 1XWWA 2R9VA 1EVYA 1JA1A 2YMQA 3D4IA 3LHFA 3N0TA 1KZ1A 1N2SA 3BG5A 5GZ6A 3RIXA 4XB1A 2K7FA 5JAIA 4BGIA 1BMFD 5DT2A 5BUQA 2YIVX 8ADHA 3F6CA 3EY9A 3X1JA 2JFWA 3N8NA 3DMGA 2RK4A 2O5RA 4RLHA 5DK6A 1OA1A 1N0UA 2G63A 2QS9A 1IUNA 3H87A 3G2HA 3GFOA 3BXHA 1TIBA 4C14A 4RXTA 4JT4A 1FNSA 5L3ZA 3EVTA 2EGHA 2P7HA 2QRKA 3GC6A 4L72A 4MRVA 4Y1EA 3SY8A 3TTYA 2NQ2C 3PUIA 3D6NB 1JDBC 1KI7A 3I2YX 1RMTA 1L6IA 1E6CA 3K7EA 3UAZA 4HLQB 1QF6A 4BZZA 1JIVA 2GBLC 2GZ2A 4OB8A 4XJVA 1E9SA 3UXMA 1NQAO 3BMOB 2VYND 3G13A 2VHUA 2R68A 5YASA 2BKEA 1JQEA 1I1QB 2MSWA 2CE7A 1X8KA 3MHPA 1GGEA 3D3NA 3G9UA 3GMSA 2GK7A 3J81A 2Z1DA 4DUGD 4BU0A 2C2OA 1I6LA 1X42A 2Q28A 3HKBB 3JU3A 4OYYA 2H29A 5CFQA 2HQOA 1SG9A 4LWPA 2Q4DA 2PO7A 1U2PA 2FSPA 4RC9A 1ZVMA 2G6BA 3OE7A 4GZ5A 4KZKA 1OTYA 1LBTA 3FZQA 1K6JA 1LKZA 1UM9A 4PXAA 4ZCLA 4ZI5A 5DM70 3CZ4A 3REOA 2PHZA 3ZNOA 1O96B 1Q6ZA 3AC0A 3GG2A 4UHJA 4DQVA 4UU0A 5I8PA 2PANA 4UAVA 1YRAA 1PGPA 3E9YA 5AHRA 1YZYA 4RUKA 1E2JA 2GSWA 2VTKA 5DHFA 1FFWA 1XVIA 1IZ9A 3GVPA 1EB9A 2ET6A 3OQMA 1DC4A 3I3SR 4YJGB 1OBHA 3PYXA 4YRRA 2CUKA 3JSXA 2WAMA 2J9XB 3BCRA 2V4MA 3PNKA 4GSLA 4YCJA 2P2NA 1HDXA 1K63A 1FS5A 2GSDA 3OLXA 4QBFA 2BBTA 1ZYUA 4RVNA 3ZI4A 5JPDA 3N8KA 1SCUA 4MDYA 1FLAA 3PCXA 1YZNA 1TT5B 4QOJA 1JS1X 5ANRB 4KO2S 4YWHA 4CQMD 2Z1NA 1HT0A 1PJ2A 1M33A 1XZBA 3GN1A 4QPZA 3VTZA 5ABPA 2TMDA 5JFGA 3FLMA 4ZTUB 2BZGA 3EZ2A 3R9IA 4Y6QA 3QVTA 1G16A 3L0SA 4FKBA 4QVKA 1WBBA 4B2LA 1QM5A 4D43A 3F47A 2OHOA 1XDWA 4RLSA 2ID4A 2H4XA 3GR6A 4EQ6A 4F6RB 1PTJC 5CDTA 3IOMA 1U8ZA 1DNPA 3SR3A 2Y1LA 1GAWA 1WXXA 4CF7A 1B7GO 3ABIA 5JUWA 3C14C 2CL5A 3U48A 4LGYA 3S27A 2YW2A 4LC0A 1G42A 4LA4A 1EVLA 3UUGA 1EBBA 4UVDA 3V1UA 2A5FA 3LRTA 4LSZA 4E09A 2M1ZA 2Z08A 3F6RA 2B21A 3IVAA 3WNZA 3ZGXA 1TAHA 3B38A 3E2PA 3ZUGA 1AXRA 1ZC4A 2B8WA 4IMRA 1RCFA 4TMFA 4EF4A 2I99A 2IUFA 1G3MA 1WNTA 3ACCA 4ZT7A 5EKDA 5HCUA 2EDCA 4JA0A 4KFCA 5MN6A 4CNQA 5KOJA 4DC9A 1J2TA 1ZD3A 2WPDA 2JARA 4ZAVA 5JYBA 3KLOA 2A3RA 2VJCA 1RXCA 4PZDA 3ZBQA 4LHZA 4F4DA 4P3XA 4B32A 5EZYA 1NVUQ 3FB4A 4BX3A 2FU5C 2GOYA 4UVIA 1JBQA 1D3AA 4BX8A 4YUXA 2Z8YA 5IK2D 3HN7A 2HCJB 4OQYA 2G77B 1K08A 2GNOA 3D0QA 4PSVA 1PJZA 1CUJA 5CLLA 3D2LA 2RGNA 1OROA 4QQFA 3OOWA 3QVJA 3QKRB 1EUQA 4MXDA 4WKNA 2IUUA 4X3PA 2E55A 3CNHA 3IV9A 1MT3A 3UC9A 1XCBA 1EWVA 1XN1A 1XMIA 1U0NA 1OXBB 4GKVA 4QYWA 5EMNA 3OZAA 5FHQA 1G98A 1K7EB 1QOQB 5GJWC 2GZHA 1X2EA 2DHRA 3UCXA 2XBMA 4IIEA 4N8EA 5JXGA 2H7XA 4JA2A 1AOXA 2QYSA 1WEHA 2AMJA 1WO8A 3WA7A 2NO4A 4C7VA 4DV0B 1P1JA 4OJTA 3K4QA 1TK2A 4CQNA 2ZRCA 2GK6A 2H85A 3VBEA 4F6RA 1NJSA 3AP2A 3WK8A 4DLAA 4ROSA 5LZ9A 4W1QA 2ZOSA 3HYSA 1NVKA 1M74A 3ELUA 1W1UA 2IZ7A 2WU4A 4JXJA 4G86A 4L74A 1TKAA 1G5PA 4XUCA 3TE6A 2YMMA 1DTWA 4WNIA 1YBVA 5IT0A 4KVGA 4LAFA 4YQZA 2YZ2A 2ZJ2A 3L2OB 3M9WA 4LBZA 3NO4A 4TROA 3I4FA 4X1KB 1V1RB 1CVLA 3WL5A 3ZV6A 5K0FA 5KYTA 1MHTA 3I62A 1JJBA 4LGVA 3QMWA 4MAAA 3EE6A 1UFVA 4J75A 3W7VA 2FWRA 5KTRA 3SR4A 3HDHA 2Y0BA 4XA8A 2QYOA 2G88A 3TX6A 3E35A 2I8CA 1KDTA 1NX6A 1D4FA 3A9VA 3HBFA 2AJTA 3PPWA 4JQOA 1WJGA 4WKCA 1RRGA 3OEYA 3N8HA 1KJWA 2NPIA 3WICA 5AK4A 1U8FO 3L0CA 5EKXA 3LKVA 3VVMA 1BVUA 2O3UA 2CXXA 3HGQA 4FYYA 3PEWA 3EMBA 1I5OA 1CZNA 1TQDA 4PLCA 4GM0A 1FU7A 3ZZMA 2A57A 5DBIA 3FWYA 2AHOA 4DTIA 1VHDA 4P4TA 3R5XA 4Q24A 3DDOA 1W5AA 5IDXA 1ZINA 3H2SA 3KSBC 4LXQA 4KK3A 4C0QC 4EBBA 5DBHX 1U1DA 2HMVA 2OO5C 4QUKA 3FTEA 3F90A 1P1IA 4WXYB 4RVOA 1E2BA 4BNKA 1PKEA 4FZ3A 5DI3B 3ITEA 1DQZA 2XXAB 3WLHA 2D2XA 2EYUA 2V0CA 5H3LA 4P4GA 1A7UA 5HJEA 1NULA 3HDYA 4QXQA 5IVKA 2ZIXB 4QAQA 3W0LB 2VJNA 1PUIA 3TS1A 2ZBFA 3N8IA 1ADYA 3SJZA 4BFWA 1QQ7A 4MLCA 3QVKA 4ZVQA 5E95A 4AJIA 2DY0A 1ZGGA 3UC5A 4ZCMA 4QOHA 4WN9B 4IOKA 4QTZA 3W8DA 4JLOA 1QZZA 3C6QA 4PQFA 4RPGA 4QO7A 5TGDA 2GJ4A 3JQDA 2PA0A 4LQDA 3CNLA 3SJ7A 1B26A 3DL2A 5BV2P 1ZISA 1O94D 4ASUA 2P9BA 3BL8A 1HDIA 1WA5A 1ZBDA 1ORVA 2AVNA 3I0ZA 5DTJA 4BVFA 3VJRA 1ZD5A 1ZH4A 2F7SA 1G2PA 2QM0A 2VBIA 3BXPA 3U4DA 3GUYA 4FYXA 4MHOA 4YEDA 5FBVB 4OHZA 2WF6A 1LW7A 5GWXA 4C0WA 2C3PA 1ZICA 2ZR7A 3CXUA 3OTHA 3R7WB 3MCAA 1ZXLA 2HU5A 2AMYA 2YKGA 4BPRA 4B47A 4F4FA 2P91A 1RWNA 3OX1A 3TVDA 2WUGA 1SKYB 4I4NA 2XXJA 2GERA 3HY4A 5DM2A 3RUCA 1JHXA 3NZEA 3WGLA 4EOGA 1U9CA 1OWOA 3P0EA 2Q0HA 3Q9LA 5JECA 4U2EA 1SBNE 5HF8A 3ZE2B 5AXDA 3HR8A 2QRHA 1KJJA 4QGFA 3LFHA 1GQYA 1KOGA 4H7FA 1Q0HA 3OOHA 4RQUA 3U0VA 5KKCA 3G2IA 2IEGA 2Y99A 1L5KA 2VQEB 1IBLB 3A70A 1R8XA 3OOYA 4E5NA 3M9LA 1XDBA 3LXXA 1PJCA 1Q0RA 1T0HB 2PRSA 3BF7A 2I4MA 2QJFA 1MHPA 2CBXA 4PPNA 5DHAA 3T9FA 4YMTA 3D3KA 1Z5NA 3OEED 4H15A 4L22A 4QU8A 4BVGA 1MEOA 4G81A 3LYAA 5EUBA 521PA 1XOIA 1H2WA 4DJJA 1WL8A 4D8UA 2BLNA 3KNZA 5DI3A 1QK3A 4MW6A 4NCNA 2AL7A 2XF2A 3H3JA 5FWDA 3TXYA 2HV9A 2IU4A 3UK6A 2OFOA 3VKHA 1R6XA 3EFBA 4REMA 2IXDA 3CBGA 3CIOA 5JOQA 3SJAA 2BMJA 3KQLA 1MJ5A 4GPZA 2O8BB 1SXJB 4JH0A 1SUAA 3RFXA 1E2LA 2XVMA 4HQOA 5K45A 3E81A 3GK3A 4M98A 1E6LA 4LF6B 3ED1A 3L43A 5GZ3A 5JIBA 2VPYA 2QV0A 3EEYA 4GAEA 2CL0X 5ALRA 3RRMA 1LQ2A 1S2LA 1KVRA 1WSAA 4MUNA 1TYCA 3O8QB 2NTEA 3WNDA 2AK2A 1YR3A 2ZRGA 4L51A 3QFHA 1SIUA 1XDSA 2Q0QA 1GZ4A 4MV3A 2P3SA 4QGHA 5K3OA 2RONA 3GJ8A 1NP6A 2BZ0A 1N57A 4Q93A 1NX9A 2HMWA 2D6FA 2HWYA 5C81A 1C1HA 1WBJB 4XIFA 3C8DA 3RH0A 1IE3A 3HCCA 2EYQA 1E5DA 2I62A 2J3MA 3KUXA 4QREA 4TV9A 4E5PA 4W5TA 2DLCX 2JI9A 1PZHA 4HRYA 1UBKS 2NO0A 2ZK7A 2NG1A 1LJLA 3BM5A 5CH3A 4UATA 3MB5A 2WWFA 1G20B 1CXZA 1KE2A 4EUSA 3EEFA 4OHRA 3NUQA 3IAS6 4LFAB 1U80A 3D9QX 1X0XA 4X24A 3RYTC 1DC7A 2RGXA 2VNJA 5TMPA 1VKZA 3TG8A 1N9ZA 2XVXA 4EY4A 1WXWA 5LQCA 2PWAA 1FFXB 4J0CA 4U0JA 2XITA 3P0RA 2F9MA 2C5SA 3SZMA 1MDFA 1Y4SA 3KEMA 1VG9B 4OUKX 1PJRA 3VR4H 2AQKA 5DKFA 2B0CA 4L8YA 4FR0A 1BG6A 2RK6A 4JBNA 3TLCA 1XAIA 4DB2A 1K7CA 4ZEMA 2Y4OA 3SEFA 1HV8A 3VZCA 1X8XA 2ZYHA 1EX9A 2XYPA 3WIDA 5KBYA 1EESA 4YS6A 3G9ZA 3RK1A 2E4ZA 1E2HA 4RD4A 5GADl 2EJBA 5FBKA 2FQXA 2DQKA 2QMOA 4BFYA 4R2KA 2PUVA 2WD8A 2YV3A 1L9KA 4V0NA 2Q5EA 3JATA 2V8OA 1G4HA 3MCVA 3UWDA 3UT0A 2JGEA 2NN3C 3K0AB 2WJJA 4EVSA 1F60A 4B0OA 2HLDA 4J16A 4EA7A 2NSYA 4REOA 4C07A 4DRYA 2C1XA 4GLFA 3I1IA 3GBVA 4EMBA 3PC6A 4ZRNA 4ECAA 5LOVA 1SBYA 4P92A 3U7QB 1BS2A 3ZCXA 1JXMA 1KSJA 1SMKA 2W8BB 3K2BA 3L6RA 3NIBA 3P2EA 3VMMA 1AIPA 5TNXA 4D7AA 4XFJA 5GONA 1CLEA 3SZOA 4D4JA 4HGRA 2WB2A 4X7RA 4YRQA 3KR9A 8MHTA 4L16A 2WILA 4N40A 2QUKA 2YWBA 3QUTA 4IDGA 2IBMA 3SFZA 2F1KA 3S2UA 4A6PA 1UQTA 3VPDA 1FEZA 4L95C 1N2GA 1O94C 1J9EA 2A1UB 2O0JA 3AXTA 3OZSA 4UDXX 1EDEA 1VHQA 4FGUA 4F8EA 1XMOB 1QGAA 1EFPB 1WG8A 5IVDA 5AW9A 5CPFA 1WOMA 3TTUA 3U4QA 3RTBA 2D5CA 1VZ3A 4P9NA 1R4AA 1Z4KA 3T9CA 1KL7A 4BV9A 5JCOC 4BAGA 3M2PA 5A4KA 1C1XB 3M5PA 4BJHB 1U9ZA 3CNBA 3E5HA 3O03A 3RSQA 5HX7A 4QYIB 3GGDA 4ZARA 3AKYA 3G2OA 3W5AA 2O52A 2QN3A 5HK9A 4KQFA 5B4TA 1GGKA 3LL7A 3ZC3A 3L0YA 1C1DB 1EG7A 3HRIA 4WY2A 1H6CA 1ZNWA 3DKKA 1AQIA 2F64A 4WFKA 5NULA 3V1TC 4KNYA 2B9VA 4ZK6A 2C03A 1PX0A 4E6EA 4V02A 1W0KD 2HEGA 1DWQA 4FSHA 3RIYA 1NOKA 3FOAA 3FYUB 1P7VA 1F2UB 2PUJA 2PLFA 2V45A 1KF0A 3O3OB 4L7VA 1K4MA 2RHWA 4PNEA 1WQ3A 5LB2A 1L7PA 2EX4A 2PX2A 2NV2B 4GE0A 2AKYA 1IRIA 3QVUA 3FLEA 3QBDA 1NRWA 3M3HA 2HDWA 3X1KA 2EKQA 5CM9C 3L1IA 4BMSA 4KLRA 1K8QA 1FQJA 5AI9A 4ETMA 4JI2B 4AI6A 4ZGWA 3OHMA 3JVIA 4CR6A 1M6EX 2RBEA 1XVUA 1ZVKA 1EVIA 5LLTA 2WSSD 1OPXA 1M1NA 1US8B 1QX3A 2GJKA 3UG6A 3TLYA 3PHGA 1OF1A 3VU9A 3VZDA 3W1WA 1ANKA 2W2XA 4YRZA 1M2WA 2WWHA 3FE2A 1GPMA 2FSHA 3SQOA 1A8HA 3JZMA 4MAMA 4MW5A 1WUKS 3T5TA 2R8ZA 2OZVA 1MAWA 5FX2A 3WGQA 1E1NA 1ZJWA 2LCFA 4IUDS 2FZ4A 3LBIA 1GNRA 4AY5A 2XIJA 2ZT6A 1GTSA 4D9EA 2V7EA 1JI3A 4CLRB 1NQOA 1RVV1 2ERXA 3I58A 3DF9A 4G9EA 5FI5A 1L4YA 2ES4A 4D92A 3E9QA 2JCGA 2RARA 2IV7A 2DM6A 3GDWA 4EJSC 2ODAA 2YCBA 3I6ZA 1R8JA 5CB4F 3WQBA 1V6CA 4E13A 1IBKB 4O4JB 2CLHB 3KALA 2D0PB 4EVRA 1KQNA 1FFHA 1JVNA 2PCJA 3OEHA 3LBYA 1DUIA 4AVYA 3T06B 1G64A 4W5QA 1GU0A 3K09A 1GT6A 1Y8RB 2XJ4A 1CCWA 2PBFA 3ABQB 3HLKA 3OIFA 5EKSA 5F76A 4B3TB 3G2QA 3IP8A 3IURA 3EVAA 4M9UA 4NRDA 5FFFA 3WMRA 1N33B 3RTCA 1N2ZA 3OZGA 1BD4A 4WZAB 5CLHA 3U80A 2OWEA 3H5RA 4DR4B 1OFTA 1YL5A 2VS1A 3HYRA 4M9QA 2CMKA 3HUFA 3KT0A 4NFYA 4X95A 4BLPA 4CI0B 3OLYA 2QM8A 5ITSA 1ZM9A 3A3NA 4B6QA 5AXCA 5IAKA 1R0BA 1Y5NA 6GPBA 2J6HA 3PI6A 3WNVA 4Q7KA 5LCXA 3ZIDA 1A2OA 2W6JA 4BEBA 4ZU3A 2R60A 3AUUA 2F00A 1SN7A 4Q4HB 2ST1A 3VC3A 4QQRA 5AKZA 4JYMA 1VE5A 4RZ2A 4MR8A 4RGBA 3SDSA 3LE8A 4A26A 2OGZA 2VJBA 1ZQ9A 4IHJB 3CZ9A 4B71A 4DWJA 4YT4A 1ZAYA 2JBHA 5KC9A 4HNAB 5TIIA 4OBBA 5FL7A 5D00A 4BV8A 4UCWA 1XZJA 2P40A 1TF5A 2FZLA 5DEIA 4W1RA 1KYWA 4NZNA 4TX1A 5C31A 3RUEA 4B31A 3LDHA 2VUTA 2PVSA 4X91A 1EU1A 4DYVA 3JVVA 1GTVA 3JSAA 1FYXA 4JS0A 1JB1A 1UK8A 4KQKA 1E5XA 1QAOA 2YX1A 3DYVA 5C8YA 4BJ6A 1VMAA 1IYZA 1KY4A 1XTZA 5HKKA 3MJEA 3Q12A 2Q3JA 5JNRA 1JJVA 4LV5B 4ZOLB 3EXFB 3JX9A 1YVRA 1UXJA 3D3QA 5FBHA 3K4HA 4YJHB 1MB2A 3W5VA 2V6IA 4BE7B 3NMUF 1E8DA 1T5DX 2LDBA 1S2IA 3R40A 3IIKA 4LYYA 3H1TA 4YJ3F 1IG3A 3WGIA 2OL4A 3AY6A 3FWNA 3IERA 1MB0A 4AF6A 2JIZA 3BBLA 3QKSA 3NWEA 1DQYA 2MMGA 3ITNA 1E3IA 3VISA 3K70B 2OD7A 4FVTA 2FSIA 2XCUA 4WFIA 3G9QA 4HFJA 4P81A 2ZT7A 5BR7A 1OHHA 1XMPA 1STOA 2PG3A 3UB3A 3KO8A 3WA6A 3NWPA 1TADA 5CLIA 1RJ9B 2A67A 3H97A 2XLBA 3PEUA 3PNOA 4TTPA 1Z6TA 5ALEA 1T13A 2RCNA 4NPAA 3TIGA 8ATCA 1V39A 1L2TA 1YQQA 4MMZB 1VMEA 4M0KA 4O4HF 1I7PA 2JLXA 4EG5A 2XKBA 2AN3A 3HEMA 2BFPA 1OB5A 1JWAB 1KO4A 4FGKA 4PICA 5CDSA 5FUBA 1JTFA 3MFQA 4GLLA 3KQSA 5TRTA 3V6MA 3BXFA 2YHUA 4R9UC 4R01A 5KJ6A 2E49A 3OPXA 1V7PC 2V5AA 4N6NA 2ZWIA 3BIFA 2O1SA 4KMRA 3RRYA 2XUOA 3IQXA 3GG9A 4HB2A 2UYCA 2GAFA 2DH6A 2YASA 4EYEA 2ZR9A 1AZTA 1E8MA 3EOAI 2C5LA 4Y30A 1F1BA 1NNLA 3CW2A 1L5GB 1JKMA 5B3JC 4CTKA 1V11B 2C9MA 3I3OA 4TL7A 1XHFA 3TFOA 3LPCA 4Y2HA 4XDZA 1NUQA 3STTA 2GNPA 3L07A 4AD8A 1SXPA 3TOXA 4JLKA 1O08A 2J31A 1T1IA 4NPCA 4ZAFA 4XVHA 4AMVA 5BVGA 3M1YA 4O4LB 3DAFA 4MUGA 4BQSA 4OBWA 1UDCA 3GLKA 2CF5A 4XEUA 2IWRA 3FFTA 4D9IA 2J59A 3ZIAD 3OPQA 5EPEA 3AP1A 1KGSA 2CY0A 3LK7A 4GI2A 4E70A 5MDHA 4ZO9A 1OLUA 5CFOA 1ORTA 4XRRA 5BYBA 2CFTA 1W96A 2VSXA 4IV8A 2FN8A 2VTBB 4W8HA 3FROA 1CEYA 2CEKA 1XR3A 3UAWA 5IJZA 4OGLA 4DE5A 4ZI7A 4PYRA 3V2IA 4DR2B 4QICA 1CB7A 1UBSB 1L5MA 3B2EA 3SX4A 1V0JA 1KH3A 5ICCA 3H86A 1D7OA 1ZN9A 3ICCA 1YL7A 2WWTA 2JCVA 3INNA 4MQBA 2W2PA 3QXSA 4RLFA 1KQFA 1VL8A 3VU3A 4NJMA 1T8SA 4TWJA 1V48A 4PYKA 5BORA 1U0JA 2QL7A 3AT1A 3HN2A 1N0HA 2B3DA 1QCCA 3OPMA 4W8GA 5LXTF 3MTQA 1FXWF 1NXOA 4GMXA 1NI5A 2J09A 4LXYA 2DFDA 1E3QA 1OUMA 3GVXA 1MUUA 2DFLA 4Q9NA 1ULSA 1USIA 4L02A 5B6IA 1E89A 3ECAA 1KOLA 3VHRA 1AUOA 3MWFA 3QUQA 4KR7A 3A58B 1DO0A 3PX3A 4NJEB 1JEAA 3K9NA 1BJTA 1OWNA 3DONA 2BM0A 1SCNE 1U0TA 5FTLA 1RAIA 5ALXA 5FTMA 2Y93A 3ZQJA 1DRUA 1WPGA 1GAJA 1ZCBA 1TFRA 2VJYA 1PG2A 5CBKA 3SJBA 4MQFB 5ARDA 1YFJA 1NLZA 2CUNA 4UTZA 4FEYA 3BEDA 2B20A 2I9PA 2QUZA 2R751 4Y2JA 2UYOA 4YRSA 1HUQA 1ISIA 3BUSA 3HCPA 3R3JA 1NUHA 1PK8A 3V4OA 2AUNA 3OE4A 4U4AA 5LVAA 3W5HA 1IBCA 3T7AA 1ZA1A 3V48A 3EZ6A 3R7NA 3T5CA 4B83A 5JNSA 4EDFA 3AILA 4WFJA 3CLSD 3MCZA 2V6GA 1D8AA 3F5SA 3QELB 4ZO7A 4DVGA 4CMEC 2A9RA 4QGSA 5EIWA 4TSKA 2R6DA 1W36B 1UBGA 4KPUB 4P7BA 5JEEA 4WW0A 5BPHA 2ZIEA 3R0IA 3QYPA 1U5BB 1KI6A 4URHA 3HRHA 2BM8A 1ZGHA 1VL2A 2I2DA 3RRXA 1RMYA 2VYVA 4K0RA 1NU6A 3N07A 2ZEJA 3CLRC 2ZDQA 3IAFA 6NULA 1AMOA 4U8GA 1JQKA 2XXAA 1I2AA 4RD6A 4KWCA 3JAWA 5DBGA 5K2MA 4J2TA 1GLNA 4UOEA 4IXDA 2YXNA 4RE5A 1CQPA 2W2VA 3A6EA 3IP1A 2X0IA 3FVVA 4HDRB 4LYDA 1J2EA 1E2FA 3Q11A 1W76A 1NBEA 2HNKA 2V4UA 3D31A 3X1YA 4EYKA 1H2BA 2O3QA 4R1LA 2WKRA 3LUFA 2BI8A 2YINC 4TKZA 3DNPA 4RIEA 4Y1GA 2XIQA 1K5HA 4PVDA 4I1YA 5EXEA 2XEDA 4QTUB 1EFHA 1FP1D 1ULHA 3F2IA 1DQNA 4P93A 3PPYA 4N5HX 4NE2A 1NI4A 5IKOA 2W2OA 4UASA 1TEXA 4ONEA 3JQGA 3OM1A 1NONA 1SUSA 4BFSA 1NTOA 3QV2A 3DO6A 3LWBA 3DS8A 3HJHA 2IOFK 3K71B 3NFRA 5G1PA 2I91A 1NWHA 3B82A 4IDOA 3JARA 4CZ2A 3ANTA 2XMCA 4Z2YA 2IP2A 2VHQA 1AV6A 5G0UA 3U9SA 4B79A 3U4GA 3VU1A 2I7DA 3RUFA 4EL0A 4L85A 3DH0A 3E4CA 1J8MF 3DLPX 3SX0A 1IU9A 3CBQA 4CIBA 3GLHB 2RGRA 4BRZA 3GT3A 2EX0A 4KN8A 3QELA 3BILA 3M6AA 1VJCA 1W0JA 4K1XA 3PQ6A 2DULA 3EZFA 3T4EA 4D26A 3UWMA 1QO0D 3EB9A 3STXA 3V5NA 4Z7JA 4R3NA 4D8TA 1UUFA 1CUCA 4XW2A 1MORA 2IQ5A 3HU1A 3BH6A 3D8SA 1KI6B 3HY3A 1HE1C 2PBZA 3T5GA 4KMMA 4BWFB 1NVBA 4JHXA 3UOWA 1T3ZA 8GPBA 2JGFA 2JASA 1EB8A 5BYAA 4B0PA 3LG2A 1W88B 4RO0A 4ZQBA 5KUTA 1QE3A 4DJTA 3GX1A 2HMTA 3AF4A 2A5YB 1P1FA 2JBAB 4PC1A 4WASA 3UT5B 3GLHE 2QN1A 4JEIA 4GDMA 3AM1A 1Z08A 1C8BA 3ZCUA 2LNDA 3CONA 6AT1A 3CRMA 1Y5IA 1KI1A 3Q98A 3S40A 2IE0A 3OQNA 1E3SA 1PZMA 3UK2A 1MIHA 1OV4A 1IY9A 1E4YA 1AJEA 1W36D 1E18A 4M1TA 3PFBA 4WINA 5EQJB 2WP0A 2AH5A 3I83A 5B53A 4AROA 4WXMA 3RNLA 5TR9A 2W2LD 1KR5A 5E7IA 2J5KA 1MOPA 5KAPA 1BHO1 3WG9A 4EG0A 4DF3A 1P2UA 1VLJA 2GWHA 2BDTA 3K2EA 2XDWA 3SXJA 1NI4B 2WM2A 4FE7A 1NBOA 2JCBA 2GGSA 3PNMA 3FJOA 4R5HA 1L5SA 4YLEA 1JDBB 1W9HA 4MITA 4A2CA 4EY6A 3MHTA 2AOTA 4P34A 1LCIA 2Z2JA 3AOEA 4QBIA 2H51A 1ODCA 2ZI7A 1MX3A 3AHDA 4G2NA 2VWHA 4C4AA 3ZDZB 2ID8A 4YRDA 4N3AA 3NBZC 4ARVA 3ZHVA 4XZ3A 3LGSA 2WWRA 3V9AA 4NAVA 4EKIA 5C5EA 2VNAA 1IBMB 2YS6A 4GO1A 4YV1A 4LQ4A 2OXCA 4L4UA 3MD9A 4MB6A 5DLEA 1EP9A 1E59A 2Q50A 1HNNA 1P31A 2FOLA 1ETUA 2FN3A 4IXWA 3V8PA 5BUCA 1RTTA 1T29A 1V3TA 2YFHA 2I3BA 3KFXA 2I6TA 1XHLA 4KLNA 2GTPA 3DMRA 4YDRA 4FD2A 1HI9A 1AHIA 1VKOA 4ANFA 5BMVF 3OIUA 3LW8A 3LWNA 4Q1EA 4DBZA 2I7TA 3AGPA 1I2BA 4HDNA 2K5UA 2Q21A 1BA3A 1G5HA 1SHKA 2FQWA 1CUWA 2NTNA 3KJXA 4KJXA 3W9SA 4AULA 1U31A 3L0DA 3D8UA 4G5SA 5B58T 2L42A 4TQ9A 3THYA 2HU2A 2YJ3A 1ZOLA 3DBLA 3T9EA 4N7RA 4MVCA 1I4TD 1OMOA 2DQSA 2KMLA 1X9HA 4IIXA 4ILEA 4OHUA 3GLFA 2W2QA 1LLFA 3O4RA 1G9SA 1XAHA 2UZIR 4H60A 2BGRA 5CT5A 3GDHA 4C7JA 5IASA 4YV2A 4WOKA 1UC9A 3D4PA 3GPIA 4RPJA 1M5UA 1COZA 2YICA 3B20A 1U0OC 3AERB 3H6KA 1DELA 3KFLA 3HWX1 3L6CA 4L7QA 1X1DA 4TSFD 5AKXA 1PT6A 3TBKA 3GLSA 4BE9A 4ARCA 3KIPA 1ESDA 3II6X 4NK4A 2Z6UA 2C9ZA 2WD7A 3WZLA 2F3RA 3RSFA 1DO2A 1RKBA 2VF8A 1UAYA 4K9DA 1F7VA 1OH8A 2XCRB 2EFJA 2RI6A 3R0XA 1TQ8A 4ZREA 2FLWA 2NT3A 2ZJZA 4Q3BA 3LGAA 4EIWA 1NV9A 2CLCX 4S2EA 2PS0A 1HEYA 1FTGA 1FOEB 3I9V1 3QVOA 1S96A 1WUTA 4HFRA 5DH9A 1FMJA 2BLLA 3H4VA 3ORQA 2CKDA 5REQB 3U3RA 1JMVA 2DWPA 2P2SA 3PUVA 4DLXA 2V59A 4ODIA 4BXOA 3CUTA 4MR7A 1A4XA 3OF2A 1XNHA 2DT8A 2QLMA 2VDQB 2Z5FA 4RAOA 4BQIA 3TMYA 3COWA 3IULA 3AF3A 2FAXA 3AJAA 4IDQA 5JXIA 2Y4NA 3T3DA 4JIGA 4KL8S 4HH0A 1KSFX 2C7BA 1RHQA 1FU8A 2DPGA 1BMTA 5LD2B 4TV9F 4KPYA 4A27A 1FMCA 1CETA 1JFLA 2R25B 1ZI6A 2AUMA 2VP5A 2W6QA 3CX6A 3F5MA 2HBZA 1FDVA 3P0FA 4Q1FA 1PR1A 3W1VA 1P7YA 5CIYA 3L0BA 3RBZA 3VYRB 1GUAA 2CD9A 3MOSA 5JNWA 1QUFA 5EP4A 3BHMA 4FOPA 3VMFA 2C83A 1RYFA 3OHSX 1EINA 3F3MA 1H9CA 1AB6A 1E1CA 2WBLC 5FB3A 1E2UA 2JAHA 2XGSA 2SKDA 3NBFA 3N75A 1T0BA 4PYOA 3ZHXA 2VP2A 3V8EA 3V3KA 3OCJA 3KHKA 5BOSB 1NJ1A 5A0VA 1TW2A 3CNQS 4EBFA 4H27A 2GN2A 4MQMA 4KOEC 2XWJI 3I52A 4TLCA 3U7FB 4H3SA 1KI3A 1AKYA 1YCDA 4GNRA 4H35A 1GQQA 3W5JA 1DBIA 5LMNB 4OLBA 1KC1A 3SOPA 3MTEA 4EL5A 1TPYA 1XTPA 3MNFA 1B76A 5BNZA 3OETA 2VJMA 3EVCA 3SC3A 1NFQA 4HP8A 5AI8A 1D6SA 1DOHA 2WD7B 4MUEA 3WLEA 2WNIA 1BU8A 3Q8LA 1HZZC 2IYNA 5ITZA 1NVFA 2PWPA 2WWVD 5CA0F 3FM9A 4MPJA 5E4JA 1B00A 1SXJD 1L1FA 1GEGA 4JVLA 5CFMA 5HR5A 4G84A 4NOLA 1RWWA 4ZOBA 2ONJA 3GDGA 3ONNA 2Y1EA 1V7QA 5T4FA 3VHQA 3A6PC 1QGZA 1T6ZA 4WWHA 1I6WA 4FU0A 1CV2A 1TNDA 2C8JA 2VXCA 2X3UA 1IXKA 3JALB 3CW8X 3PE6A 2HBRA 3GA7A 3QHAA 5JMWA 3R0ZA 4X3OA 4KNVA 2Z57A 4V1CI 4ZJYA 4C6TA 3VRHA 2RB4A 2C59A 1ZVQA 1EFVA 5LMUB 5TLSA 1YC2A 2IEDA 1GSHA 1UPFA 3C8HA 1H2YA 3ZGNA 2V9PA 5IC5A 2B4AA 3DLHA 4Z4IA 2J48A 3SCZA 2OV2A 1B1AA 3BFJA 3HV0A 4EJ0A 4HCJA 2XMQA 1SK8A 5JZBA 3CHYA 3K92A 3KLNA 4A1FA 1I0IA 2WE8A 3D6MA 3IAXA 1KY5A 5HIIA 2WF9A 4LCJA 4DV1B 3CG4A 1OT3A 1Z83A 1KK2A 2P9JA 3KU1A 2ZWOA 2FGJA 4BN5A 3DD5A 4ZT2A 4H1UA 1ZEMA 2HNAA 2MDTA 3CV3A 5BSRA 1SBIA 3R77A 2AXQA 1OAOA 2P1ZA 1GV0A 1PYOA 3T61A 2QLNA 2D5BA 4R2IA 2BCGY 3TW4A 4F92B 4JX8A 4Y7CA 1ISRA 5K6TA 1AKTA 1VGQA 4PBRA 5CHYA 3QYFA 3RAEC 1T2AA 3HMQA 3IP3A 1UAAA 4UMFA 1X80B 4BEWA 3WLKX 4JI3B 1I2DA 3L4SO 2XBUA 5CDUA 5C53B 1X13A 4N6OA 2VR1A 2HPZA 2HHJA 2ZYTX 3PLRA 4CKCB 2FUG6 5HG0A 2X4LA 3THWA 2DPHA 1A5SB 1JP7A 4HVCA 4PSCA 4M1YA 1JEQA 3IQGX 1KAMA 1J07A 5BYKA 3UJNA 3ELWA 1MA3A 1OKKA 3QBTA 3WIOA 3KZVA 5FA8A 1W4LA 4PZPA 1ODSA 1TVEA 3IO3A 4YRAA 3A6FA 2P4UA 4FYJA 5KVCA 3AIKA 4PIMA 2TMKA 3PUZA 3BZBA 2AV6A 2P2CA 4N0QA 1KDRA 2NO6A 2NNLD 4X54A 3V8QA 1HFWA 3HQ4O 2GFIA 1A9ZA 3FW1A 4DUYB 2WP8J 1A4UA 3EGDB 1VE1A 3QJ5A 1UXOA 3ER6A 4PBSA 2YXDA 1D5WA 4OL9A 4EMUA 5CCBA 1XX6A 1S7GA 1AQLA 1WHTA 4L8VA 4GMDA 3EVEA 5TX7A 2WDPA 4LJ9A 5K0SA 3GBSA 3P2KA 1XQ9A 3RQIA 1Z62A 1UK6A 4XQ0A 1H85A 4DJDC 1S3IA 2H5LA 1KDZA 3IV7A 5AICA 1NU8A 3EWNA 3HVHA 1QG0A 1VBFA 3SHOA 5CLFA 3RIEA 1KAQA 4BP8A 1BVHA 4V0MA 4NG5A 3IUSA 4J3FA 4YJ3B 4CT4B 1Y3CE 3CG0A 4B85A 3H7IA 3QMVA 4JBLA 4B3IA 4UDNA 2YY7A 3O75A 2GCPA 2X41A 3SBOA 1YQDA 1KKMA 3DEIA 1XJ0A 2E4WA 2WFLB 1GD1O 4EATA 1G63A 1PQPA 2FWBA 3IIJA 3WWZA 2OAEA 2PFGA 1FFGA 1XYYA 3JZIA 2HF7A 4IIJA 1AN0A 1BROA 1PX2A 2WZDA 4MLDA 5EE1A 5JCOA 4ARIA 4MZDA 2JJ1D 5GPBA 5B6JA 2A30A 1NF2A 4YWJA 3PP8A 1YZQA 1YQXA 1WBDA 4ZYTA 1NMSA 3LQ2A 1NZFA 4WHMA 5D5PA 2BZSA 5GINE 5D3KA 2I71A 2ZUWA 1VB5A 2BR5A 2C7VA 5SY4A 3IL2A 2ZJ5A 3U1VA 1ZESA 5EFOA 3ASZA 1M2HA 1IPEA 3OJFA 3PHBE 1PR3A 4RNCA 1NT4A 1KHHA 1NNSA 2QV7A 4BV2A 1OLOA 3O4GA 4FHZA 3DMNA 4U6SA 4XWTA 4MUKA 4BO9A 1L8OA 3Q87B 1BNCA 2IHVA 3VSBA 3A9SA 4D79A 4JXXA 2UXBB 4BRSA 4RZ3A 4GC5A 1C9MA 5J9FA 3GT7A 4AIRA 3ZCVA 1UKVY 1HQYE 1R6UA 1TJPB 1U8TA 3UMRA 2W93A 2EBUA 4QPJC 1EP3B 3MJSA 1FQKA 2AZDA 4PS1A 2HTFA 5B4VA 821PA 3KS9A 4KUEA 3IBGA 4QTXA 4C7KA 5CEFA 2ZUUA 3B89A 2JGMA 3SHFA 4EAAA 2ZRLA 4NCXA 3G0IA 2VWGA 3S8YA 3E3AA 3FJ1A 3TTSA 3K1TA 2KYRA 3DDNA 2OCDA 2PMDA 2I76A 3KP1A 3NAMA 4Q1AA 1DBRA 4QFDA 5AT1A 5JVDF 4WNAA 3ZZNA 5C8YF 3UZUA 4YJ2A 1LZKA 4U7DA 3MOGA 4WGGA 3RSOA 4GUAA 1YFZA 1X1AA 4LE0A 3JQRA 1Y5LA 2BC9A 2QT0A 3ANYB 4JNCA 2B83A 4AO7A 3WWDA 2O2XA 2OC4A 1PGQA 4QGAA 2I1VB 2ZVJA 3DHWC 2W6IA 2G5GX 3OH8A 4BNXA 4YJ3A 2AQIA 5DGXA 4MDFA 1GARA 3L5OA 1GGHA 2ZG6A 4RK6A 1UOPA 4C7BA 2F67A 1OZAA 2AMVA 3D6HA 3KPWA 4WNYA 4MP6A 1GRRA 3GCDA 4XJSA 3IKVA 4DLWA 1PGOA 3COPA 3INGA 4RV4A 2V96A 4KDRA 5DNAA 1X19A 4UNSA 4XPIA 2OCLA 2EJWA 5TQVA 3V80A 4LRYA 1V9CA 4NC9A 5TPZD 1PNRA 3QQPA 3ZY4A 1KQ3A 1SKUA 4O1MA 4A0GA 2FPGA 1SU7A 4C7XA 5JAHA 2B8TA 1U9IA 3K9BA 1MC1A 2ZDHA 2OV8A 5TT1A 2EJUA 3VSDA 3W2FA 4IV0A 1CY8A 3KQUA 1AMUA 2XTMA 4QBKA 3TLZA 4R8MA 2G9RA 2NUPA 5LKRA 2OR3A 3KBBA 4BATA 1H66A 1TEZA 2P5SA 3KJIA 1M2OB 1LV7A 1WHSB 1ZM7A 3DP7A 3O9MA 4UEJA 2V7QD 4EO9A 4MWGA 2BCJQ 5A3VA 1BOOA 2RJNA 4NBNA 3SHWA 3GPCA 1QH1B 1ML4A 2IIQA 5AW7A 5KNBH 1QKKA 5FPQA 5CLJA 4RF4A 5D3ZA 5HFJA 5I7VA 4J07A 3TCXB 1IJKA 4JOQA 3RGGA 4ND6A 1SCUB 4BIMA 4WBNF 2BE9A 2WKSA 4ZIRB 1P6QA 3ABRB 3CUYA 1NVEA 1JBEA 1BDMA 2QJRA 3LAWA 4KO3S 4IFTA 5DK4A 5M3BA 5CCDA 3WQHA 4LI0A 3ZWMA 3COJA 1Y98A 1JR6A 1C7IA 3QYAA 1L9XA 3E9ZA 3H2HA 4Y2VA 5DCYA 2FSVA 3NYQA 4L6IA 3VNSA 4KN6A 2PKQO 2JVKA 4WY5A 3FHTA 3FBWA 1D2AA 4MIYA 2VRNA 4CUJA 3V4RA 1VPEA 4EX7A 4LZOA 1LDEA 2GF9A 1KTIA 2VBCA 4J2HA 1P2TA 1NBHA 1Q1QA 5ENZA 5IXYA 4NAUA 5L3QB 2GPYA 3I72A 1WDKA 2GPNA 2QB5A 1VE3A 5HIKA 1IL0A 2F3QA 4QEKA 1RBZA 1BWRA 4YT2A 4TXMA 2FW9A 2WJYA 4B4OA 1CHNA 2JFGA 1PJ4A 4S1PA 4RFSB 3G2PA 5KNCD 1E3WB 2EKLA 3KJZA 2MSEB 4AZVA 1WXEA 1WEKA 3FSJX 4F8YA 1A3CA 1XZEA 5IZCA 3EVGA 3ZXYA 1JDJA 1EXDA 1QHHA 2P6PA 3ST7A 4I3GA 5BV0A 4F5EA 5A4MS 1D5CA 1C9JA 4RXMA 3SNKA 4AJEA 1RZ3A 3IR5A 4R98A 4JY7A 621PA 3IX7A 1NBMA 2D1RA 1FFCA 2QENA 3LECA 2IUTA 2RI0A 1FXWA 4DAEA 4NNOA 2ACEA 3O5AA 3G5MA 5JAPA 1ULUA 3DXYA 3TO5A 5CFNA 3ORRA 1TJ5A 4RQAA 1UJCA 1Z74A 2LXNA 5JD5A 1IWPB 2EBWA 3W7AA 1OCEA 5LFAA 1B0PA 5AVKA 3GUHA 4Y3UA 2RHHA 4M1QA 4N3BA 5GOTA 1VKNA 1KJ9A 1IONA 4Y6OA 4BO7A 1ADCA 1HH4A 4DXHA 2G0AA 4DIMA 3FUCA 2VDMB 2D2IA 3D81A 3BA6A 3IPCA 4U2GA 5IEBA 4MUMA 4TVOA 3TRJA 3U3XA 3ZIUA 5LN1A 4FYHA 2WFMA 3IELA 3I2GA 5BT9A 3X44A 3TQCA 3GRUA 4F84A 2RHOA 1NUSA 2NVOA 3QEAZ 3A2KA 4FGJA 1OOEA 2W37A 4AKHA 1EA5A 4TS9A 1MA0A 3M6MD 5SZKB 1UFKA 3UJDA 3F4KA 4KOAA 3GXOA 1WCV1 4NHEA 1J97A 5IARA 2QKYA 3DEZA 3BWYA 3RFCA 1QYVA 3LT0A 3OKAA 3TIIA 2ZBQA 2CNWD 1G8JA 4M7WA 1P0PA 3ABOB 4TKLA 4AN1A 1FX0B 2Y27A 4GRIA 3L7OA 1KJZA 3BTSA 3QVXA 4YHHB 2A9FA 3QVGA 4YP9A 2AZXA 3BZUA 1ZPDA 4LBVA 1JHDA 4TS3A 2O8EA 1LSOA 2A7XA 1IN4A 3IBYA 4F85A 5DW0A 1G4AE 3ASUA 4MGKR 1GU1A 3UMBA 2AI2A 4NQRA 3H16A 4R1OA 2EBFX 2WNHA 3AQ4A 1U7WA 1CJMA 2RG1A 3KVVA 4QX6A 3ZEAA 2H1CA 3TSOA 3RVJA 4LV6A 1CR6A 2CK3D 3OO1A 4EGQA 3DT6A 1YVEI 5FV7A 1YMUA 1IZ8A 1NN0A 2Q8NA 3DLIA 2CT8A 2JAWA 4KQ2A 3R3UA 5CXQA 1CQIA 1WZCA 1C2YA 1XL1A 3AINA 4ID3A 2X5OA 2QR2A 4OJNA 5HYVA 4C7OA 1M2KA 1NOJA 3VSEA 4XSHA 1YJ5A 1LDYA 3FA2A 2MYNA 2EQAA 1NP7A 4G0QA 3RR2A 5B64A 4J0KA 2AFHE 2J7PA 1QIDA 5JYCA 4EHLA 3RYCB 3NOQA 1KEWA 4CF4A 5CDYA 1QFMA 1TGYA 1YASA 4L3VA 5JU6A 2OOSA 2Q1UA 1E5VA 3COSA 3L8DA 4BLWA 1OTXA 5KU7A 1P60A 1IQRA 2E89A 4ZOEA 1D9ZA 1AZWA 3FZNA 3KHTA 4I4LA 4DXAA 5B57C 4AFNA 3WKCA 2OYRA 1OXVA 2UZ0A 1DDIA 4LQCA 2ZITA 1AY0A 4TLAA 3H4TA 1KR2A 1ZOIA 3EGVA 3RHZA 3VA7A 2JK1A 3B6IA 3CPHA 4AS3A 4BNGA 3HVJA 2R00C 2Z2ZA 3N70A 1P75A 4QBTA 3CF4G 3AR2A 2FZWA 1WP4A 1P7WA 3B9BA 1YIOA 3FUUA 3GFSA 3RUHA 3FPCA 3HXMA 1B74A 3ZGZA 2AG1A 5JJCA 2RGUA 2Q07A 3MWKA 2H9YA 3BD9A 4JLMA 4KLZA 3PG5A 4ENUA 4IF6A 3ZHSA 1JJ7A 1QG6A 5CA1B 3M5DA 2Z98A 3CCBA 1Z5PA 3JY6A 1OZGA 1C5KA 1FRFS 2ENUA 1CVRA 1XEXB 1QVRA 3IP6A 3VQTA 5CDFE 3NATA 2QUHA 1Z25A 4RM2A 2BFBA 2GFHA 3F96A 1R3UA 4EEKA 3L7CA 2NSDA 4IIBA 3WGKA 1G17A 2FF7A 3QU5A 2ACKA 4JV5B 2X15A 2UVQA 3IXMA 4NH4A 1Z4MA 3NHUA 1BH6A 4Z7OB 5BSHA 4DFDA 1U2RA 4LBYA 2X4GA 1C14A 1CQIB 2E2WA 4NULA 3DAYA 4PX2A 4RL4A 1E77A 4N6GA 4Q4LA 4ZZIA 3EGXA 2P9FA 4M86A 5DULA 1ZL2A 2IYUA 1HXHA 1EK1A 5G0TA 4NP6A 1YUNA 2F3TA 1DKMA 1RACA 3M4XA 2O6LA 4Y1RB 1QH0A 4PNZA 4EJFA 1ABBA 1T1SA 4BE4A 1R12A 1ZM4A 2GRUA 4JAVC 3LK6A 3K5HA 4LY6A 1EMDA 4Z86A 2NW6A 3HVKA 4XJTA 3GRZA 5SICE 5DT9A 4F45A 1HDEA 3PIDA 4A8HA 1YR6A 1T26A 4LF7B 2QRMA 1KS2A 4DA8A 5LOVB 4E4YA 1CJCA 1XRQA 1W2WB 4O29A 2V0GA 3JTEA 2DC1A 2NXWA 5J4VA 3T0GA 1IUPA 4H77A 2I34A 1B8PA 4IRMA 5E4FA 4D4MA 1RQ2A 3KXPA 4YACA 2G25A 2A88A 4X94A 2BJHA 2UKDA 2AVDA 1KEEA 2GJAA 4ZV9A 3S8MA 1A2KC 1XLTC 2ZKIA 4A8JB 3RO7A 2FWMX 4E31A 2A1UA 3P97A 1U9YA 4JJFA 3FF4A 4P33A 4UXJA 1JHAA 4GKBA 3UPUA 4FI3C 1ENZA 3IP9A 1U8AA 5JBIA 3A06A 2H4YA 3PFWO 3Q7TA 1NJFA 2PMWB 3LOQA 4I9GA 1EAMA 3GARA 4P35A 3LA6A 1QLWA 3LTEA 3PJDA 4LX8A 4Q7LA 4R8VA 2Z4RA 3FVTA 1XRMA 4ZEOA 3ANXA 2R7NA 3SE7A 5MN5A 2Z4TA 2Z9CA 4WKPA 4ZVUA 1GADO 2RHDA 3EWIA 3NEPX 3K6RA 5I7RA 5KSZA 2OGTA 2YV5A 1ZIXA 2C8KA 2IU3A 5FORA 2FX2A 2JIQA 4EECA 1RRCA 3HO8A 4GGMX 5LP6F 3CRW1 3EPRA 2WJ3A 4N76A 3R9WA 4EW3A 1R0WA 5A7FA 4X1IA 3ZX5A 2V5UA 5ICEA 2MJLA 2LVBA 3NBAA 4WL0A 4QYMA 4Z9AA 4P7JA 3IA2A 2NIPA 1ZD4A 3I53A 4KLCA 3CSDA 1UKZA 4LZLA 5GY7A 5I9TA 3WLQA 2ZRIA 5SZIA 2BFCA 2P9YA 3LSTA 3H4MA 2C04A 1QP7A 4H2DA 2F9FA 1WUYA 3H2JA 1KDYA 1DT3A 2NYUA 5CX1A 5CG1A 1ILEA 3PNQA 4F3YA 1G8AA 1HZZA 1H2ZA 3ZHCA 5KWVA 3QOFA 3OA2A 3WLTA 1Q7TA 3FUTA 4F91B 2HJHA 4M7OA 4U2KA 1IJBA 1S8OA 1CIPA 2H1SA 2XQJA 4RZUA 3WBBA 3WQSB 5LQNA 3OZWA 3TLGA 5DNEA 3V55A 4AMBA 1U3FA 4OLHA 5D01A 4RTJA 5AM5A 3AB7A 4J0EA 3JQ7B 2NM0A 3OLCX 4C3UA 1KPGA 4AL4A 1EAYA 3QZUA 1U2EA 3ZY6A 5J5VA 4FEEA 1GFSA 2GETA 2MYPA 3R6GA 1PNTA 4Q3AA 2ZUTA 4ND2A 4JEUA 1HK7A 4H7KA 2XW6A 4V0OA 5L7YA 3VGJA 3T34A 3DXXA 1DQSA 2YXEA 3RS7A 1I7QB 1SXJE 1X7ZA 4F9TA 2R5FA 3D2BA 4TLEA 4E4RA 1ESCA 2C2KA 2OP0A 2YXPX 1KAGA 3RG8A 3REFA 2D8MA 1VKJA 3AFHA 3W90A 3GPBA 2CD7A 3JXEA 5LKAA 3KT3A 1DOZA 4ZJPA 1W46A 3G0GA 2KB0A 5DNVA 4TMYA 5KU1A 4U9UA 2H9IA 3QOXA 1Q1GA 1QS0A 2CFCA 1SVIA 4PG5A 4TN1A 2NPFA 3VJLA 2FPOA 5I3CA 2ZTLA 4XARA 2G4VA 4PNPA 5KVSA 4G0VA 2HFJA 4Y6RA 2C4VA 4YGXB 2QTBA 1ZVJA 1KERA 5K0GA 3NIDB 4K40A 1AKNA 2A0KA 5BRJA 3TZQA 1AUVA 5H0IA 3SS9X 2PIAA 3OPYI 1CULC 2VA8A 4PX9A 4TTRA 7YASA 5GONF 1KOJA 4V2UA 3Q9UA 3ZKAA 2HCRA 4EGCB 3SMVA 3INYA 5HGXA 4ND4A 4H1HA 1T9HA 2I78A 2DQZA 2I8AA 3HFSA 4UREA 5ENVA 1ZZEA 4BNYA 1TZMA 4D25A 3IVGA 3S0JA 2AB0A 4MQUA 4YAUA 1SQ6A 2FWJA 4A0SA 3G59A 4UPVA 2C0PA 5P8WA 4TVKA 1YVUA 2I6SA 1PEAA 1XZDA 5F1YA 3KJFA 5G0SA 4D5GA 1W5FA 3MWDB 4G5QA 3D3WA 2OBNA 4NARA 1Y3BE 4J94A 2BV3A 3GFTA 1ND6A 3HKDB 4TT3D 5THKA 5ELMA 4AS2A 4E32A 5I45A 1G1AA 1C9NA 4BRWA 1KA9H 1GFIA 4K6OA 1KQPA 3JVEA 2BFDB 1EK5A 1Q3KA 2EKBA 2CCKA 3HNPA 5JADA 4BDTA 5AIAA 1EA7A 2IHJA 1Q1ZA 2R6HA 1XZ8A 3PC3A 4QU0A 4E4TA 4K05A 4WLOA 1QZTA 2KHZA 4Q7JB 1WXHA 2K2QB 1SXIA 5LMZA 1O6CA 3OESA 2Q2NA 2X6RA 2PDAA 2DPYA 3KSRA 3LBFA 3JAMA 4MA0A 3E9CA 3GB9A 2ZBGA 4RELA 4YBRA 5DYGA 3AEZA 1I80A 4IVNA 2IEZA 1N2CB 1KGDA 1AN9A 1AK9A 1YGPA 3E1KA 4OXKA 1RPTA 4FFLA 3MMPA 1CNFA 1TKCA 2DMRA 1SK9A 2Q5LA 4IL5A 5ES3A 4G5HA 1R27A 4Q47A 1J09A 4WCVA 3R3HA 3SYLA 4TWBA 2HHCA 3E6AA 5IPFA 2I87A 3OIDA 5CYPA 1Y3HA 2FFBA 2QTMA 3DKRA 5ALYA 2OP1A 2FKAA 1OW3B 4DLPA 1UIMA 4Y8VA 3T15A 5IJ9B 4WX2B 1FP4A 5H4GA 4E33A 4BP1A 4L08A 1B73A 1EXNA 2QD3A 3GFGA 1E6UA 1MO6A 4F9GA 3BA1A 1JG3A 5HS4A 1T4CB 2X1VA 4F2WA 1XLTA 1BRMA 4J9VA 5TE9A 4BECA 4KQ6A 4WZAA 2FEPA 4Q4DA 4F5ZA 4LOJA 2FPXA 2FDXA 4YAEA 2HJWA 1E0AA 3WGUA 4K6CA 3BH0A 3QEJA 2CXRA 4E5SA 2GCEA 1CEEA 4PPGA 1WY7A 2ZETA 4EZBA 1TJNA 3EN0A 3EXIB 2FEOA 2XR1A 3HE3A 1RYEA 1SCIA 3PWTA 4F5DA 1J4AA 3RI3A 3C6BA 4HDOB 1F2TB 1LQTA 5JJ5A 1LI4A 3EBOA 4B40A 5KWJA 1Z0FA 4DVJA 2EFDB 2LZ0A 3EXEB 4WY8A 2I6QA 3QXXA 4AC9A 1RVDA 2DWUA 2GXQA 1KJQA 2V6BA 1CYEA 1Q83A 2H92A 2WJZB 3QW2A 1JEJA 2B35A 1RS0A 1R4MB 1UBEA 2AF3C 3K1JA 3G23A 3ND5A 1WTCA 2GYVA 1OGYA 3M9XA 4BO3A 2H48A 1EE9A 1G1MA 1NNI1 5JZVA 4QAJA 1VJRA 5D86A 1NURA 4NDNE 2ORWA 3FGPA 3EDCA 4NOMA 4DV7B 1WXDA 2AFRA 3A25A 3QNWA 2CDRA 1GM5A 3A27A 1Z4JA 3OI7A 5I9NA 2QR5A 4EEZA 1XMXA 4AQDA 2BSAA 3HBJA 4JJ8A 1PEDA 4BTLA 1WMFA 3SHVA 5C4MA 3T7KA 1UINA 3LHSA 2UAGA 5DCWA 5A4AA 5JQGB 2Q4EA 1O89A 4HAZA 1NL3A 5E4TA 5L8VA 1VJGA 1JF8A 1AUPA 4INOA 3WLFA 3ZGYA 4CKZA 1HTWA 2X13A 1JG4A 3IEKA 3EA4A 3QRWA 4HZUB 4RVUA 3P9NA 3W05A 2XB4A 3PGMA 3T1HB 2PGXA 3RYHA 1UDWA 4D0NA 1W75A 2OHXA 3VR2D 1F6BA 4B3DA 1WDLA 4ZIRA 2PWYA 1N4AA 1XTJA 2C2YA 5CXUA 4GU5A 4CR8A 3E70C 3KQVA 1KRXA 1E32A 4P4SB 1W8IA 1Z5WA 3QNMA 3EOZA 2Z8XA 4MYHA 1E66A 4Q7EA 4U7HA 4UTOA 5F98A 1LPBB 4IIJF 1YC5A 4EFLA 1W1IA 2KBEA 1T2CA 2DPXA 1WV1A 3BSSA 2E85A 1B3RA 4FFOA 2FR1A 4J0JA 4AZTA 1ZK2A 1RI1A 1P44A 3AUFA 3QM1A 3WJ7A 4KTVE 4YRIA 2E5FA 2I4OA 1I9CA 2GEFA 1B0UA 2PD4A 1NF8A 1X7GA 3ILYA 4LG1A 4F9EA 3I04A 3P45A 1DC3A 2BKAA 1GPNA 3MWEB 4D5EA 4L28A 4TRMA 4EKNB 2IPLA 1ZJJA 4N54A 4RJKA 4M1MA 4EHAA 1MT0A 3K1ZA 3DL7A 2C9OA 4EX6A 5GTDA 2BH2A 1H8EA 2RAFA 4BNNA 3IILA 2Q2VA 1RZRD 2OFFA 1GN9A 4QTYA 3QE3A 4ZO8A 2PU5A 13PKA 4B84A 4ENSA 1YI0A 3L01A 4OUDA 1QAQA 2FPIB 2PH1A 4EUFA 4FIDA 2X7HA 3E3NA 3U39A 2WHEA 1ZGZA 4C9BA 4TL6A 4X6UA 1S7CA 4U2BA 4Z2AA 5LQJA 2F1OA 1SIOA 1KKLA 1X9GA 3DHEA 4ZVKA 2XODA 3EIFA 2O4UX 3UV3A 3UJ3X 4J76A 1IEQA 2AUTA 3U61B