4PGAA

Glutaminase-asparaginase from pseudomonas 7a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
330
structure length
330
Chain Sequence
KLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAMTKTQDSKELQRIFWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion binding induces closed conformation in Pseudomonas 7A glutaminase-asparaginase (PGA): crystal structure of the PGA-SO4(2-)-NH4+ complex at 1.7 A resolution.
pubmed doi rcsb
source organism Pseudomonas sp. 7a
molecule tags Bacterial amidohydrolase
molecule keywords GLUTAMINASE-ASPARAGINASE
total genus 117
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1997-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pgaA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4pgaA01
1HG0A 5K4HA 5F52A 5CBPA 5I48A 5DNEA 4RA9A 5I4BA 2P2DA 1HFWA 4PGAA 4R8KA 5K45A 1JJAA 2D6FA 2JK0A 3PGA1 1HG1A 1IHDA 1DJPA 2HIMA 1JSLA 3NTXA 5CBPB 5DNCA 1O7JA 4NJEA 4RA6A 1NNSA 1DJOA 2OCDA 2GVNA 1JAZA 1WLSA 2WT4A 1ZQ1A 3ECAA 1WNFA 1ZCFA 1HO3A 2P2NA 2WLTA 5HW0A 5K4GA 4ECAA 1AGXA 1JSRA 4RA9B 4R8LA 5I3ZA 1HFKA 1WSAA 4Q0MA 5K3OA 5DNDA 2HLNA 3NXKA 1HFJA 4NJEB 4RA6B
chains in the Genus database with same CATH superfamily
3LA6A 1GQYA 3RVDA 1J97A 3FLBA 2Q1WA 1VJDA 1HT0A 2XRMA 1KOFA 4Q7MB 3RGWS 2IDKA 1FBNA 3SHOA 5B6PA 3PUIA 1JFLA 4P80A 4PXAA 2VTBA 1NY5A 2PKWA 3KOWA 3TW8B 1FW8A 1UP6A 5LDHA 2GAOA 2I6FA 1VJGA 2AE2A 4HADA 3A10A 2GHQA 4IMPA 3VYUB 2DQ4A 3HFSA 3T06B 3L02A 3IVRA 4YJHA 2VP5A 1PSZA 3V48A 2J31A 2IY9A 1UFRA 2JI8A 1NMSA 1T43A 3HM2A 3VZRA 3IULA 3TN7A 2EC5A 3UAYA 5CA1B 4HH3C 1TYBE 3IB6A 1P7ZA 3WFZA 5EHGA 1OXKB 4WI1A 3L8ZA 3HBMA 3OCCA 2A59A 2H1IA 3PDUA 4RMGA 4G09A 2RB5A 1G21A 5F23A 2ZBUA 2MHCA 3WRYC 2B7LA 1X1AA 1NASA 3U0VA 4RTOA 4E1BA 5ILGA 2Q4DA 1Y6QA 4HWGA 3RU9A 3MNFA 1NLFA 5EIOA 4W7SA 5FHRA 3GLKA 1Z56C 1E2KA 3BIOA 1E2IA 1NYLA 2J6IA 3G6WA 3LU1A 4UDNA 1UAYA 4NP6A 3FYCA 1RHJA 4G0NA 1FSFA 3R7BA 1R37A 4YY3B 3PNSA 1P0CA 4F91B 1BG6A 1NF3A 4NG5A 4HYYA 1GAEO 4UVDA 1GILA 4NSNA 1LPPA 4QUJA 4J90A 4URHA 3F7OA 1AK2A 2G67A 2IZZA 1J8QA 1VMKA 2NVWA 3D54D 3H5AA 3VSCA 1WDLA 3DL7A 1IB0A 1CULC 1WUIS 1ZP6A 2B94A 2R4TA 3ACBA 5EFZA 4DABA 3QKSA 4U7TB 1HFWA 3L07A 4I4CA 4NCNA 1CUYA 1Y1LA 3NAGA 3P9SA 5LUAA 3T7SA 1ECPA 4P38A 1AY0A 1W2HA 2ZQ5A 1MF7A 5ESRA 4EH1A 1FNBA 4KIJA 1LFDB 3G9UA 3PR1A 2R8EA 1LBHA 1KY3A 2TMYA 3H8JA 4CV1A 4X6UA 3WGJA 3RIHA 3IT0A 4MV1A 2CUNA 1OFGA 1EJ0A 4IQ8A 5FWXA 5BRNA 5LYJF 1CUVA 2Q7DA 2VBIA 2H5EA 3KQOA 1H9AA 1VE5A 2ZTSA 2XLBA 2J7KA 3P32A 3FPEA 1ZINA 2AS0A 3HWRA 4PANA 2JCBA 1M1YB 2CV2A 2O7QA 3IOBA 4JP8A 2Z4RA 1M1UA 2L2QA 3GRZA 3K9LA 3OJOA 4JASB 4U6QA 3RVLA 3RHTA 1LFAA 3H2GA 4GPAA 4HQ6A 4MWSA 3NTXA 4MUFA 3CT4A 1R8XA 3KSBC 4M0KA 2A9FA 1S8OA 2FR1A 4RU1A 3TSAA 4LYFA 2C98A 2A1IA 4PVCA 3A70A 1O4VA 1RBMA 3A1SA 2C2XA 1PJ2A 1H2FA 2XJ9A 3Q85A 1QHHB 2FPSA 4B43A 2D54A 2ZT8A 3NJ4A 1ENPA 1NW8A 3OZEA 4FGUA 5C34B 3T9CA 1X42A 4HAZA 1SGWA 2IODA 2CD9A 1SCBA 2I80A 2P30A 4OK3A 4R8RA 3S2YA 4BVEA 3ZWYA 5I7VA 3TTSA 1XYVA 3AHJA 4HNQA 2C2WA 4IJUA 1P4JA 1OXVA 1OFTA 5FPHA 3FMVA 4JJFA 3DFIA 1QYCA 5THQA 4PNPA 1B3BA 2ZVPX 3GGGA 5KU1A 4M1TA 2Z1MA 1YRBA 3M7IA 3H99A 4CKWA 1D4FA 3SPXA 1EWKA 3PDWA 1OV4A 3ZY6A 1KPGA 4RQTA 5LBUA 1U0EA 2BZ1A 3LUCA 4TKUB 5HZMA 3DC7A 1W30A 1YHZA 1ZLYA 1XZJA 3AU8A 4RVHA 3ZWWA 4CL3A 1I36A 3RVSA 1A5AB 2IZOA 4P4SA 3QXHA 3ZU3A 1X7YB 1G55A 1M2KA 2VYVA 4IXTA 4JGIA 2VJDA 2REQB 1JYEA 1OXUA 1CR0A 1EZ4A 1WAMA 2PKYX 3GJYA 5FTLA 1BVUA 1N6RA 2X8LA 3DOUA 1IRIA 4M36A 4R1SA 4DYDA 4L9AA 1U0SY 4FMCF 4KPEC 4MYHA 1SUEA 1JLSA 2IF2A 2TYSB 3KFLA 2AXEA 4HGYA 4IXDA 1JFRA 1DAKA 4R7GA 4F1WA 1E32A 3C3BA 5E6UA 4OVKA 1NLMA 1YNOA 3AUFA 1IULA 3JQGA 3KZXA 2VUHB 2IU4A 2IL1A 2LV8A 1L8AA 2H51A 1AUXA 1DRKA 2W2LD 4R8MA 5DBFA 4U7HA 3ST7A 1XNGA 3S5UA 2X1HA 1AQ6A 3TRIA 3MCTA 5CMLA 4RE5A 1FX1A 4GU5A 3PEVA 1ODSA 4J7AA 1EVIA 3C2QA 4BJ6A 3K5PA 3TJZA 4CLXA 3B7PA 2X9NA 1XZKA 1EK5A 1WSWA 3ITKA 1AKMA 5GZ6A 3ZBQA 4ZK2A 3QXXA 3BIFA 4ES6A 4O5AA 1DXYA 1KZ9A 5E0KB 4LX0A 2W98A 3LDHA 1MO3A 4U7PB 3L0YA 1JKIA 4ZT7A 1WMFA 5DN6A 3F90A 3AVYA 2YBDA 3ND9A 3OA2A 1R6TA 4YS6A 1NBOA 1VSQA 3IP3A 4FGZA 1NMEA 1PR6A 5PNTA 2AN5A 4KQIA 1BROA 2KW5A 1HDIA 1LVHA 1Z5PA 1RAEA 4O4JA 2QVCA 3A04A 4KRYA 3R8CA 1Z6TA 5JSZB 4ND8B 5E9JA 1VLJA 3MF4A 3JWGA 3VZPA 5B12A 5KNDH 4G0UA 4GOLD 2P2YA 3TR0A 2QVZX 4IH9A 4WOCA 3U3RA 3W8RA 4E32A 1U7UA 3TECE 2O8DA 1QXSA 1QGZA 1QQ7A 1YQDA 2JK1A 1VE3A 2LCQA 3LK7A 4FEEA 4Y6LA 3VH3A 5JBNA 2FUEA 4R8SA 3ZCSA 1KK0A 4A2QA 2B0CA 2OHIA 1Y6FA 2KQUA 2WUDA 3E9YA 3QITA 2FOLA 1O08A 2UZ0A 2WJWA 4LF8B 1E3EA 2ZI4A 2K2QB 2OV1A 3AOGA 1F2TA 4EGAA 5C8YF 2BEVA 1M72A 1T6BY 4R3WA 4QRDA 4YPVA 4IIYA 3DR5A 2ODBA 3MWDB 1G20B 4HWPA 4ZJUA 1SB8A 1ZOOA 2WMDA 3BQ9A 4ZCPA 3GJXC 3BIJA 2VYFA 3O9VA 2AFIA 3SKVA 4JLAA 3JD4A 3RVQA 2D74A 1G8GA 3ABRB 5DO9A 4FSHA 5EJ6A 1M7GA 2OWDA 3EGDA 4XVHA 1IY2A 4Q4HB 5THXA 4X6XA 2FU5C 1Y6ZA 2FQQA 2Q99A 4QXOA 1FVHA 4N3GA 2EBUA 1MX3A 1JKJA 1AUOA 2BLNA 2QJFA 4N12A 3DQQA 1TO2E 3B6EA 3G13A 4LOKA 4O08A 4YXWD 5JMWA 5LL6P 1A9RA 1BMTA 1CB7A 1SJ9A 2J1LA 4Q24A 1CQZA 5EZQA 2F3QA 4MP8A 5JARA 2EJUA 3AFHA 3EIWA 3FYUA 5FV7A 3ZIAD 4WKPA 5AVQA 2FUNB 1FMLA 1S89A 2IQIA 3N2NA 2RGNA 4HX5A 3C3KA 4NYJR 1I01A 4PLWA 3MUOA 3VKWA 2RGBA 3E27A 3NVKI 3C7AA 2VAMA 3UAGA 1M2NA 3N39C 1YR3A 3FGZA 3ZK7A 4HUQA 3AIMA 3QF7A 3W5VA 3FVWA 2B98A 4M1EA 5BW8A 1PYDA 3FX2A 2ZBQA 2HNKA 5AK3A 4AS1A 1CIPA 4TUYB 1DELA 3E5RA 3FWHA 2Q1XA 2YWBA 3GBVA 1OIWA 3VU1A 2NSLA 2Q9BA 1Y4ZA 2YXEA 2XYGA 3CMCO 1FTYA 4OJYA 3VXKA 3IXQA 5EWMB 1UJ5A 1KI1A 3IALA 2CFRA 2GSDA 3NHSA 1WU8A 2CL0X 1UZMA 3SVTA 1JPUA 4RL4A 1POWA 3STTA 2ZXUA 4BXOA 3CTPA 3THRA 4AQDA 4TROA 4C6TB 3AM3A 1D1SA 1RI2A 4GO1A 4WY8A 3ZUPA 2FQYA 1EA5A 1N5RA 1NVTA 2XUQA 1RWWA 5F1KA 3ZDFA 4YCMA 4YCLA 3BGVA 4TUYA 3BXGA 1EVKA 2V6BA 3QLEA 2EFEB 2XD4A 3V2IA 2LZ0A 5CFPA 3HUTA 2Z5GA 3CZMA 2QU8A 4BEWA 4P0QB 3HSYA 5DLQC 1KP9A 1G8MA 3PTLA 4LISA 4R69A 5E2BA 3NBXX 3VZCA 2O5EA 1SBIA 2Q3HA 2BBOA 4WLFA 5BXYA 2W9XA 4QBFA 3B60A 1HZZC 1R1DA 4R7TA 1KEWA 4FYIA 1TXGA 3SJUA 3WKBA 2BI4A 3TOXA 5G4LA 3KELA 2UXBB 1AKYA 2P9BA 3D8NA 1LI4A 4QHYA 2J5BA 1D2MA 2UV8A 4R0NA 4UHHA 1WSBA 1YBHA 2ZKIA 3CLVA 1M2OA 3DZIA 3OUUA 4XRRA 1YOVB 1XQYA 4XPIA 4MV6A 2HV9A 1YZ3A 4II7A 4YCBA 2AX4A 3U16A 1BHJA 1QH8A 3TDKA 2YRXA 3TR6A 1R5BA 3UG6A 3DZFA 1UL1X 1CDOA 4UUQA 4ZAZA 3LHFA 4ZCQA 2R66A 1NHWA 5DNEA 4G81A 2Z6AA 1Z29A 4LMRA 4IDFA 2IV7A 5K8TA 3G89A 5AICA 3BB3A 3VR6A 2YRFA 3VNAA 1Q91A 3PQFA 4FT4A 1U94A 1UMDA 3L05A 4PAGA 4PGAA 4TMWA 3LUJA 4LZJA 2NPFA 4QJ3A 4L78A 1I94B 1PNQA 2Y3IA 3KZMA 4LNAA 3G02A 4I5IA 1GR1A 3PUVA 3VZBA 4GZMA 2OFXA 3FIUA 5KYVA 3SY8A 4EUSA 3LSTA 5JZOA 4BVBA 1SCQA 2O52A 1GKYA 4IDGA 3EEQA 3LX8A 5LZ2A 1JBEA 4PG6A 1E9BA 1CZLA 2VXCA 2BUAA 2PZAA 5G41A 4LFAB 5FOXA 1CRPA 1C3VA 2AWOA 3CPHA 3DE4X 1CV2A 3T7DA 5LBTA 4YCCA 4UMFA 4Q3AA 2FZKA 1DTEA 1SUSA 2VNSA 2ZJ2A 3EVTA 4QGHA 2AOTA 5AVUA 2IOFK 4ERXA 2C78A 1D6MA 1YE5A 4YUZA 1K0UA 2GN9A 3ZQ4A 3S70A 3F6SA 2PE5A 3HRHA 4RXTA 3GPIA 1V16A 3CRRA 4OHUA 5ALZA 2B4AA 1XPRA 3H1AA 2FP3A 3H4VA 1KYVA 4DWVA 1IJBA 1KMNA 2DCMA 4X71A 3KOOA 4UHKA 5GY7A 3SX4A 2PYIA 3WADA 1JPNA 3IP9A 3OFJA 1EFPA 2QW8A 1IYZA 2G0NA 5CDHA 2FUG6 3FH0A 3I32A 2AI3A 4B0OA 1CF2O 4FDAA 4MLCA 3ER6A 1L7MA 4BKMA 3H9QA 1TYZA 5CB0A 4D6YA 4CETA 2F67A 2XUOA 3FPHA 4UEJA 1MJGA 5JY6A 5KOHA 3U49A 4YN3A 1MFPA 1UC5B 4G56A 5CCEA 2EBHX 4RV4A 1Z6YA 1P44A 1YMQA 4IDNA 1I1QB 3T4EA 4ZO8A 3CXUA 3IPYA 5DEOA 1PX2A 4LXXA 1E61A 5FORA 3WR5A 1C30A 1ADCA 1UM8A 1VMAA 3BRSA 3R5HA 3U81A 1IOWA 3P0HA 3PHJA 2GUGA 2JFFA 4DXDA 1QP8A 3L0SA 2AMLA 2PCLA 1GWNA 1CVRA 2VATA 3KQWA 2GR9A 3PD0A 4J6FA 4K2HA 3JQ7B 3UHJA 4EB6B 3U1TA 4Q0MA 5F3DA 4TN1A 3JVVA 5IDYA 1R50A 4YK7A 1LSJA 3R1IA 6YASA 3RVMA 3EXIA 2Z6QA 1XZGA 3SIXA 4F1KA 4D4HA 2A33A 5A5EA 1MRZA 2LTAA 1F5NA 2P9JA 4MYUA 2C9OA 3A36A 2WV9A 5CNMA 4O8CA 1NRJB 4KRXA 3AM4A 1G6HA 3PENA 3DOHA 3IAUA 4MVJI 2ET6A 1SXIA 3ISTA 3C4QA 3M9LA 4EHFA 3H8SA 1N8SA 1B0ZA 4LS3A 2R8ZA 1QWSA 3CRQA 5DWQA 1JVBA 3M6MD 3P2OA 2RGRA 1J2UA 1LQTA 3WB1A 1DV1A 1L7XA 3ESQA 3AKCA 3HR7A 3RFTA 5LJLA 3D2LA 2B82A 5K6AC 2YNMA 3R0ZA 1V7CA 1U2PA 4J3FA 4JQCA 4J7CA 3MTGA 3T9EA 3OM8A 3O94A 2A67A 2PPVA 2DUMA 4E3WA 3H1PA 1IBLB 3LYHA 2W2NA 3IH5A 4HLNA 2X0EA 4D3SA 5JSUA 1RFLA 4WL0A 3L1UA 3INNA 1Y81A 2JGDB 4YJFA 1Z3CA 5H68A 1EPUA 2Z8YA 4K88A 1TPZA 1JLRA 2GT1A 1SVLA 1HMYA 1RMYA 1GQFA 1U02A 2J3QA 2YZGA 2Z2JA 1D2NA 3CW8X 1I10A 3GFBA 5L51A 3ZDAA 3PXCX 4PC1A 4YNBA 5IF9A 2ZI7A 5TDHA 5BOSB 1WMDA 1T1SA 4KMMA 5BR1A 3OQVA 1AV7A 2P3LA 5B4TA 2VWQA 3JRNA 3IAFA 2QAGA 2WM9B 3KX2A 2M6LA 4KR3A 5DNYB 1AB5A 2HK6A 2OCAA 4A10A 5JI2E 2HBQA 1ENOA 1OMOA 1M67A 2DFTA 1RTKA 2RGUA 3PQ4A 4ZOLA 4J2OA 4RK4A 3VV2A 4BWYA 4C3ZA 4EJFA 4LVOA 1HQDA 3JCZA 4JC4A 1QLHA 2NZJA 2WSBA 3DTTA 4R0VA 3D3KA 1MX5A 3ADOA 3BERA 1PX0A 3C1UA 1V8BA 1CZNA 4Q9KA 5B2ZA 4EHDA 2FZ4A 4IX1A 3DVAA 4XD2A 4P34A 1A71A 5CLQA 4G86A 3IUYA 2BFAA 3UCEA 5CDFE 1C1DB 4TL9A 1WF6A 4GX5A 1ZM2A 1XKLA 1GQRA 1KR2A 3UO8B 3HJRA 1OTHA 3IUPA 1XZMA 3WNQA 2FFRA 1P19A 3GUHA 3D81A 3E9RA 5LQNA 4CKCA 1UZAA 2ZJ5A 2A5JA 4M1ZA 3W7VA 1FX0A 2OCLA 3T35A 5EIWA 1R0YA 1V8OA 2RONA 3PHIA 1I7LA 1MP0A 2VZEA 1JTVA 2FSSA 2ZIZA 1C8BA 1AN9A 1DDOA 2C99A 4Q7LA 1YNSA 2EP5A 3FF4A 4ZC8A 4B40A 4BFCA 3ELUA 4RKEA 5BR7A 3TYXA 3WYGA 1KBOA 5HJ7A 5I8PA 5ILOA 1WZIA 2JIBA 4BNWA 1C7JA 4MHSA 4DSOA 3O5AA 1S9HA 4AX8A 4LZOA 1EX9A 1NMZA 3MAAC 2G40A 3NT5A 1Y37A 3A2LA 3KLNA 4PBSA 3REQA 3PC6A 3HKCA 2CHGA 2J0UA 1T2NA 3ELYA 3LUDA 2Z30A 1KI9A 4RELA 3AI2A 1YRQA 5G0UA 4GICA 3ZOZA 1CBUA 5ALIA 4W1RA 3WL6A 1BQEA 3OHSX 3QE0A 4WFIA 4UUOA 1WVGA 3TXAA 4JX8A 3TLEA 4AMUA 4HNTA 2IGTA 1ML3A 2NZXA 2ZROA 3LLSA 4F2DA 5EJEA 2QJTA 5KOIA 1N2GA 1O6GA 4OI2A 1KP3A 2G77B 3CISA 4L5CA 4QX6A 1TVEA 4BWVA 1WV0A 4DAEA 4EO9A 5CG2A 4D92A 5FAKA 1ECLA 3H0EA 1BJRE 1G7SA 1ZA2A 3AUJB 3KTAB 1YMVA 3J7AC 3I4LA 4UQLA 5EXDA 4LVUA 1I5EA 1Y5MA 5K01A 1M8FA 2HA3A 4Q3KA 4E46A 2QGNA 3ROMA 5FNVF 4CG1A 4DIFA 5JJCA 4M76B 2WWIA 4UASA 3ZTTA 1WCYA 5JDCC 4A8JA 1P4GA 4CBVA 4G5RA 5BSGA 5FLYA 4EYKA 3IAM6 4C0LA 3PDCA 1F2TB 4IQGA 1DB3A 1GNLA 3W6PA 1DBQA 1DX4A 2V0NA 4AX4A 3PHBE 3EN0A 3AY0A 4K1LA 4L74A 4KPFC 4BP9A 3ZU2A 4E94A 1U99A 2WICA 1TAGA 3OJWA 2OZPA 2KBFA 3PWKA 4ZI7F 5CIYA 1JEAA 1KVSA 1ONNA 2GLUA 1V95A 3P97A 1OT5A 4C4XA 4YHHB 4KNWA 2PR7A 2C03A 2IHKA 4OL9A 3A1DA 4IV5A 1U8XX 2CEKA 2DOKA 3ZNOA 2IA5A 4D3XA 1M8PA 1W29A 1PTJA 1ESDA 2IDZA 2P3SA 3GNTA 3C4JA 1ZR2A 4BYGA 1W88B 3CUKA 3FTQA 3HWWA 1HMPA 1XALA 2WHPA 1H6AA 3BE6A 2BMWA 4XJSA 3SHWA 2CVQA 3T5DA 1PFKA 1JQ5A 4FR5A 2GYVA 4J0FA 4K9LA 5AUQA 3TFOA 2PX0A 3DAOA 3QLVA 2O8EA 1H0HA 1L5MA 1HOXA 1T6ZA 1ZYUA 3B53X 3DMRA 2IHVA 4FEGA 3RTAA 2BOVA 4J4BA 1KSHA 4MW9A 5FFNA 4AF6A 2YJNA 2Z6UA 3KR2A 3HJFA 4IQFA 3GLGA 1D1TA 1XPUA 2H4FA 5GM1A 4KACA 3V8PA 3PLAE 3U44B 5AVVA 2FZGA 4HAUA 4M89A 1P9WA 3KVNA 4M1QA 1U4SA 5CJJA 5FNVA 5A5VA 4MPDA 4C7BA 3E4CA 5FQOA 2G88A 4UC0A 1G8PA 1WVIA 3EDOA 4Q03A 3QU5A 4TV9A 1LGYA 4UE6A 1G6Q1 4R40A 1KGDA 2BRUC 4G1MB 4LMBA 2DPYA 4DDTA 1VMEA 1BEEA 4N5NA 5ALSA 4ZV9A 1R18A 3T5BA 2QMUA 4P36A 2XCLA 4U5QA 4C2UA 3CZRA 3MEQA 3QKRB 2LNDA 1JXQA 2ORED 1KJWA 1N6HA 1ZW6A 2R8YA 4N9WA 3TQCA 2JGAA 3BXHA 3K2IA 4CFZA 1I4EB 4K03A 5LOVA 3KQSA 5K0BA 1N34B 5B6IA 5B64A 1RNLA 4XYMA 5IMSA 3D7SA 3GD5A 4X62B 2FA9A 3WDKA 4JI6B 2ID7A 4B44A 4GZLA 3GJ0A 3QFCA 4LVNA 4Q1DA 4TVBA 2GVNA 2WVJA 3EASA 3KQQA 2QTZA 2WJJA 5DLEA 5C35A 4JI0B 1SWVA 2XIJA 3HKDA 4I14A 2Q9UA 1PNTA 1I13A 1BGWA 2XMZA 2YQZA 3COJA 2EX1A 1E77A 1E94E 1VGQA 4EPTA 3CLRD 4MQ6A 4DEXA 2I62A 4WKBA 3NS7A 2AIRA 2IGBA 5DLYA 1FS6A 3TB6A 5JO0A 4R83A 2EIXA 4C1BA 5IJWA 2IZ6A 4ABYA 1ZC3A 2VLIA 3RWOA 2QVLA 3ZW9A 1L5KA 2R11A 2ZIEA 4RVFA 2AT1A 3HM9A 4DR4B 2ODQA 2FPLA 5KTYA 1RAHA 4MV3A 3CZ5A 2HDNB 3EGXA 4Y9TA 3ROFA 2WEKA 3U4QB 1E0KA 5G4KB 4AL4A 3V1UA 1W19A 1Q3KA 3FOCA 5FF9A 3FXAA 1KU0A 4V3BA 5E6SB 4QD3A 4JQYA 2OMEA 4X97A 3TXXA 2RH4A 5ALRA 1V5GA 1T5IA 2PIDA 5A0VA 4UZFA 3GUYA 2J0QA 3ABZA 4PICA 5IFLA 2O3JA 3ZZUA 3R3JA 2WTBA 4UFOA 4JR1A 1U8TA 1XPJA 2JB9A 4JQOA 1OH5A 2E2WA 1EEXB 2JIRA 3E22A 3KUUA 3QMWA 4ZAVA 4DM3A 1ZD1A 5AXBA 4D79A 2O06A 4YLGA 2HHJA 3I3OA 5LP6C 5IASA 2CZCA 1TJ5A 3CEAA 3AHFA 3LGSA 4Q3NA 1OHHD 1U7ZA 3JYHA 3K4PA 3LUAA 3Q9LA 1ZJJA 4U6NA 3IPLA 5H5JA 3I6MA 1B4DA 1RWVA 2ODEA 4MOWA 4NE9A 5EWJA 1XEWX 2PNJA 3NWOA 5KINB 3FWNA 2HXSA 1M5TA 5GONB 3R7NA 2UUAB 1WBBA 1TD9A 1WZCA 3AUUA 2BTEA 3TS1A 4XH9B 4ND5A 5AOAA 5KSPA 6AT1A 2F3RA 2GD0A 3OVMA 4P8RA 3IPRA 3CT6A 4QEZA 5JY1A 1WY5A 2LWIA 3N86A 4ZDJA 3LHDA 2I2CA 1N8KA 1AO3A 3H97A 4NOLA 1K4YA 4RCZA 3WBKA 2WPNA 3T41A 1WMEA 3Q2IA 4E2ZA 4UD6A 4AZSA 2X77A 4YECA 1M8GA 2EG5A 1YZYA 1DLIA 1VCIA 3C97A 4Y2SA 5FA5A 5JALA 5JUWA 1NW7A 2BE9A 1MQ8B 1DC4A 3WLEA 3DYVA 5GIPE 2JH8A 3KEMA 4FOSA 5B53A 2ODPA 4NCHA 3B6ZA 2AQHA 2XSZA 2QWXA 4CLHA 2QL9A 4BMCA 5ADHA 1Z12A 4RSGA 4HB2A 2RHLA 4TT8A 2PJRA 1JBQA 3CUVA 4QEDA 1J1UA 4HDRA 2F3SA 1CU1A 2FR8A 4PCAA 4BLTA 2CNNA 2P78A 1J25A 1Y5LA 4CDMA 5CFMA 3JAKB 4KBGA 2M6KA 5IEJA 5CDSA 2FMUA 2R1ZA 3FOWA 4KPUA 3NI2A 1BAPA 2AC4A 4RABA 2XGJA 4J9UE 1WD7A 3HDYA 1M54A 1R6DA 3A8TA 1VA5A 1XLTA 1Z6PA 2HRCA 2H17A 3HR4A 1PD1A 4NBLA 2FHSA 3EWAA 3QLUA 1MJNA 4Q3OA 4E12A 4FB5A 4YUWA 2BE7A 3SGLA 1ADBA 4G5YA 3VAYA 5JASA 4WCFA 4YP0A 1VCMA 3LO5A 1WP4A 1QCYA 1P1IA 4JB0A 2CF6A 3P5BA 3EXIB 1NM5A 4NYMR 5SV2A 5ADVA 1T8WA 1ZI9A 1YL6A 2E4XA 3M83A 2QN7A 3OCYA 4BMZA 5CBPB 4ZWNA 4JXXA 4HRAA 3P2IA 3R24A 1XT6A 4PSUA 2HZ7A 4N8DA 5CA1A 3GNSA 1EFLA 5LU9A 2MINB 4JYBA 3RS3A 2GASA 2QRJA 3V9PA 3BWDD 3BL8A 5FEMA 2NNLD 2XJ4A 4QARA 4D9JA 1K6XA 3CM0A 3W34A 1NP7A 5BV1A 4UHFA 3U60B 1J24A 1WZEA 4WCFB 4CIWA 3FGNA 4O5OA 5CA0B 2HA0A 1YR7A 4QXMA 5K0NA 2PMDA 3FAKA 4ZGGA 4IUBS 2C2HA 1KXZA 1CUCA 1JKMA 5DTQA 3BICA 3K0AA 1OXBB 1YDWA 4WXYB 4UTOA 4MRRA 3F6YA 5AESA 2JJ8A 5JDIA 1IDN1 1VMDA 5AJXA 4FYJA 2FRDA 5TE9A 3WMFA 3IOMA 2XNDD 4B3XA 4D4GA 1SNYA 4YAOA 3LSYA 3FOFC 3M5PA 3QSGA 2D2EA 1O96B 1N2SA 2F8LA 2HTFA 5KVQA 1BDIA 5MGNA 3JVIA 3AI3A 4I50A 3VPBA 4G5HA 3AR9A 4ARVA 2BM9A 4NYJQ 3LXXA 3G0BA 3PITA 3OU2A 4ZZ1A 5JOQA 4KH1A 4UTXA 4ZC1A 1G7RA 4QIHA 1NG1A 1U90A 3T7AA 4EJSA 2CKMA 1JDTA 5CDUA 1QHGA 1TM1E 2GPAA 2NUAA 4DCGA 2A3RA 3IE2A 1O0BA 4OHCA 1I3KA 4TMZA 1OWMA 3MAGA 4I9NA 4CI0B 4CIDA 1TUGA 4GLOA 1TVMA 4EFNA 1VLLA 3I8OA 4E5DA 1QAQA 5TSDA 2X0JA 2WD7A 2WMNB 1Y3DE 5CFRA 3RYHB 4DGSA 3AMVA 2DPMA 4GXRA 4Q3CA 2FWNA 2VR1A 1CUFA 1F8GA 1OD6A 2I1LA 1NQXA 1DVRA 1VM6A 1F9EA 3HCFA 3P0IA 4K1XA 4AP9A 4GF5A 4D9NA 3KEQA 1UMKA 4ZAFA 2IDMA 4AU1A 4N49A 1GNVA 1PW5A 4MRSA 2Z8ZA 3ZKAA 3KT6A 3FGPA 4UNIA 2X13A 3K15A 3PDIA 1EM8B 2WWVD 2E1RA 5I4CA 1YS2X 1Q95A 1QTRA 2ZDHA 1H2BA 1EZZA 2P11A 5TS2A 1RWOA 1AZTA 4NFHA 3SZMA 3GXBA 3WVNA 4CHGA 1KVTA 1EZ1A 2VWHA 1T36B 1C0EA 2BHSA 4RJIA 3C8HA 4TKVB 1QLWA 4NH4A 2NWQA 5AVKA 3WWEA 1Y3BE 4R05A 1HYEA 3O8OA 4EARA 1YQWA 3AG6A 3PFHA 1TMOA 1PDOA 3CVWA 3GL9A 3LOUA 3U40A 4BTVA 5K45A 4GHWA 3NO4A 4C08A 5FUQA 5DVZA 2QQ0A 1DKRA 4XIGS 2XE7A 4HWSA 2C1XA 5D51S 2JS7A 3UH1A 3STXA 4RLSA 3YASA 1L4YA 1FB5A 4A82A 1FJ2A 3VUFA 2PUWA 4JGBA 1X6VA 3KAKA 3G2QA 2WYUA 1JQJC 1ST3A 4I1SA 4WZZA 4Y1RB 1VL8A 2JGJA 2NTYC 4B35A 3OLYA 3HJGA 1BFUA 4MVJE 1Z8NA 3PFCA 1X9IA 1DC7A 2BPOA 5KWIA 3K6SA 4FFPA 4S2EA 4F9FA 2CN1A 5I45A 2ZSAA 3DS8A 3P9CA 4G5FA 5EOVA 3OZUA 4FS3A 4MCHA 3SFVA 4TQGA 1BQ3A 5HIIA 1RPNA 2PGNA 4RBNA 5BV0A 3U6BA 3HO1A 3IMFA 1XRMA 1TZ2A 5EPEA 4RK5A 4H3VA 2XXJA 2W6OA 1J33A 2M6RA 4A9AA 3C3JA 1YC2A 2YBEA 4NQRA 3WZLA 3SHVA 1Z0AA 2I66A 5CX4A 2ALJA 3ETLA 2VAWA 4KVGA 3VR1A 5IT0A 4DLZA 2OPHA 2R6ZA 3M3HA 3MGGA 3PI6A 4QXAA 2F64A 3MWEB 3JAWA 3KZVA 1YS7A 4NZOA 3HFRA 4PTZA 1ZSNA 1ULBA 1Y3CE 2YMMA 5BQXA 2YQ5A 5JECA 3O8DA 3TMYA 1FDTA 4FZ3A 2JHCA 2AVNA 2QE7D 1E98A 2OAEA 2CDRA 1KYWA 3F6EX 4FHZA 2IUEA 4UKDA 4X8OA 3T99A 2P9YA 3ZEIA 4CUJA 2YS6A 1MHTA 4BQNA 5JFTA 1C7FA 2FSGA 2PUJA 3AR8A 3VAAA 3VHXA 1UINA 4PN7A 4FCVA 3BS4A 1EWRA 3AR7A 3JALB 2AFIE 4R8KA 1V43A 3A9CA 4QM6A 4B75A 1GNTA 1YB7A 2Y0PA 1QYRA 1PJQA 3L43A 2QPTA 4NE7A 4DR5B 4YRBA 4MEAA 1NR7A 1YBFA 1OX6A 2JFBA 2W4QA 3QOYA 4KP7A 1DINA 4FLEA 4KCGA 4QHSA 4GXNA 3ROKA 3AJEA 4RPCA 3WMWA 3QPAA 1TMGE 2P5YA 4FZVA 4LJKA 1RWXA 2Z5LA 2XYQA 5ICSA 5TMPA 4DZZA 4HGPA 3MRTA 4OUDB 4BVHA 1NUTA 1V26A 2I3GA 5JQGF 2W4MA 3K0SA 2C07A 4X1YB 2W6JD 4CTOA 5HMMA 5D7BA 5FPKA 1UOPA 2UVQA 1U0FA 4U9IS 3B51X 2O7NA 3C6ZA 2DMRA 3FNGA 3P8ZA 1FIUA 3O4RA 3CNOA 3LWZA 4H31A 2JHPA 2J5QA 2C8KA 2NOAA 1NZFA 2WY2D 3AVUA 1MZPA 1CQIA 5COAA 4KBYA 2OMKA 3LO8A 1X9HA 3LP6A 3ZQJA 1DAGA 3M5CA 4KAXA 1FQJA 2V7UA 5D7NA 3THOA 4M53A 1T9HA 1BW9A 4EKGA 1A77A 1HT3A 1ODFA 2IP1A 2R47A 2V7GA 3LDAA 3TNJA 5HUHA 1YSCA 1V1RB 3LY5A 4G85A 4LGYA 1BX0A 4PZEA 1NI3A 4C76A 1YCGA 1U0RA 2ZT6A 4M7RA 4PZPA 1D8AA 3L4BC 5MHTA 3FPCA 3P4YA 3LBFA 3Q3JB 3ESBA 2ID9A 3R20A 2O4CA 3B3GA 3CSUA 5HILA 4KITB 4G07A 5FOWA 4F0JA 4X8MA 3BT7A 3HYTA 1Q44A 3LLUA 5JFGA 2LKDA 3VU9A 2HRDA 3IUMA 5TRTA 2JF0A 2KHZA 2GNAA 1E1KA 2W2MA 2PXHA 4IYJA 3FY4A 3W5UA 3MILA 3CB2A 4CV2A 3HZHA 1G20A 3OT4A 2GCGA 4LSMA 1FUKA 3N7AA 5AM4A 3RTCA 3UOWA 4BO0A 5IHPA 4FGKA 4BFZA 3MRSA 2GA8A 1BXGA 3FWYA 2I2BA 3P19A 4K3VA 3T95A 5HGXA 1CFJA 4HDQB 5C4GB 3BULA 3W1EA 4URUR 4GMHA 1KARA 4M98A 5A03A 2DJ5A 3N2ZB 4PSAA 1MIHA 5EESA 1XRJA 3WYEA 1RCFA 3UUEA 2I29A 4U5XA 5JEEA 4TYPA 3TFWA 2V9PA 1RYFA 4GPEA 3F8TA 3LQ4A 4EAQA 2JLQA 4X61A 3RASA 4H1TA 1L8LA 1TB4A 4ECEA 3L6EA 1NM5C 2C9CA 3NVDA 3FHJA 4TWJA 4WGGA 4M3NA 2ZIWB 4BFWA 4Q4CA 1UBUS 1A2BA 2WV7A 3LY9A 3LPMA 3VYSB 2BKXA 2ZI5A 3E2PA 2HAEA 1KZ1A 1P2UA 5SYNA 2VZ9A 1I2ZA 5F33A 4DJEC 3ZK8A 2WSMA 5MDHA 5CVDA 1K3FA 3HHEA 1GCOA 3T61A 2KLBA 1PJRA 1KORA 3IMEA 4CQJA 2I4RA 3PGXA 3ZYCA 4HDAA 2IYTA 2XA2A 1P4SA 4RO0A 3W6OA 1IBRA 4EHNA 3KHUA 5JJIA 1GU7A 1GCUA 1F8FA 4RMHA 3ZU5A 2OVBA 3ZE9A 4TMVA 3QEMA 3RR2A 1JQKA 2IP2A 2PJUA 3AG5A 5JXIA 5JS2A 3B48A 1NX6A 3HHPA 2J9ZB 3OM1A 4WH0A 2Y99A 3SKXA 3W9BA 1G21E 3PF8A 1ZCJA 2Y1LA 2IH5A 1W4LA 1XD2B 4RMJA 2CLEB 2QD2A 1J5XA 1GZ3A 2O8EB 2IYQA 3FCAA 4R31A 2IZ1A 1MOZA 1FFBA 3RS2A 3ZGNA 3D8BA 4M9ZA 1MB4A 1SOUA 3O92A 4DCMA 4EBBA 2QRMA 4B47A 5AHOA 5ELMA 4MB0A 1CP3A 4GM0A 2JFQA 4B4UA 3G2HA 4TXHA 5AH0A 3OQOA 3HADA 2AG8A 3ZVRA 4K8RB 2E0IA 4M8IA 3PE4A 3H7IA 3L41A 5E9WA 3IXMA 4L6CA 3EZNA 2W2TA 1ZXXA 2WWXA 4M7PA 3A4IA 2E49A 1FS5A 1GGHA 3CWCA 4F9GA 1Y80A 1JG2A 2JI9A 4GMKA 4EITA 1XROA 3RKSA 2X40A 3RVPA 2PDAA 4MLDA 4IIJA 4XB6B 4FW9A 2C9DA 3LUHA 3WFJA 2YINC 3T9BA 2LRHA 3QZUA 3I0NA 4MW4A 4I55A 1ZBDA 4RA9A 1CETA 4S1WA 4OBWA 1QE0A 4JLMA 5FADA 3U5TA 1PP4A 2WWFA 4LXQA 4AO8A 2PAFA 3ZHXA 1Z06A 1W85A 2JEYA 4BU1A 4CEHA 4B9AA 2R2GA 3I1JA 3IPAA 4A03A 2GJAA 2QT9A 3D3QA 4QBHA 3UMMA 1A8HA 4O3MA 1LLUA 1KOLA 4QPDA 4X3CA 4C43A 1WBDA 1RXIA 1J7KA 3JYOA 4WACA 1RXVA 3FSRA 4TV8F 3AEUA 3PC8C 4KUHA 2NPIA 5TT0A 1K6IA 4YJHB 2C2ZA 1RKXA 2WLSA 3OTHA 4LWQA 2FXVA 3GLFA 1QYIA 4JSYA 4RDHA 1N5JA 4GQAA 2BDUA 5K3BA 1XTBA 3CXRA 5IK2D 2I7XA 1H2ZA 4BLVA 4ZV7A 2FW0A 2Q5OA 3HKDB 2YZNA 5AI4A 4QWMA 3BSSA 2WUWE 4J0IA 4QDXA 1KP2A 1TCCA 4FEAA 2P62A 4P4UA 4TZTA 2XQJA 2GZMA 3DE2X 1RYHA 3Q6NA 3Q5EA 4D9GA 2CFOA 1ZAKA 1BYIA 3BN3A 2V65A 1A9ZA 5HF5A 4HMPA 2W0MA 2MMGA 4BV9A 3ODPA 3TAUA 4KO4S 3OOYA 4B2IA 4QA9A 5EZYB 3ZZMA 4BQFA 1ISPA 3V34A 1XTQA 2Q27A 3GEGA 4B8ZA 4F3TA 3L84A 1TW3A 1WA5A 4D56A 5JV5A 2IHBA 2PEZA 2W2PA 3JWEA 4JLSA 4KU4A 3T8YA 5HPYB 1X7WB 1RZRD 5TEVA 3HL4A 3F47A 1J5PA 4IXMA 2IH2A 1BIFA 1M3SA 3GFVA 3DH0A 5BXQC 1CJBA 4C0SA 3JVUA 3NLLA 3J80A 4N0PA 3SD7A 1GAJA 2AG1A 1E2EA 4I1VA 1Z22A 3U4CA 3ICVA 3LWDA 4XGRA 3OJCA 1T2VA 2YHIB 3OM0A 3RE1A 1DJOA 2JZNA 4IGFA 4EATA 2LPMA 3ZBTA 2INGX 1CUAA 1JDUA 1F4PA 1JB1A 2V4UA 4GR5A 4PHGA 4R81A 1NVWQ 3K9BA 4PWZA 4ZDWA 3ZGLA 2QM0A 3SIRA 4BFYA 1VHTA 5JW6A 3EG9A 3HU5A 3MWFA 1B16A 3FG9A 2IJGX 4YQFA 5DB4A 5JS6A 3WFIA 2P75A 5KPJA 1UEXC 4NESA 2PKQO 5J4HA 1S5PA 1OR8A 2YFYA 3IB3A 2A2ZA 2LP4Y 2F17A 2QROA 2ZWOA 3KLOA 1ZOIA 3UJ8A 5B1EA 3NCTA 2WBLC 2XMDA 1KO7A 4XARA 1VHLA 2I99A 2H8KA 3NWEA 1N25A 1FP4A 2GVDC 1JXOA 4J8PA 4YC7A 4DJTA 2HHCA 3O8LA 5ALFA 5J43A 4AUNA 1A95A 3HPRA 1E3IA 4DYHA 1UAGA 1T5SA 2IYFA 2BONA 3DPUA 3QUAA 2IE8A 3B8EA 1TA4A 1U5CA 2WM3A 1T9BA 2JFWA 1PG5A 2OBYA 3QQPA 3WL5A 4F2HA 4B2PA 4FFBA 1J0CA 3HYNA 1X0XA 3ANLA 3QV1A 1AZSC 1E20A 1JDBB 5ICFA 3SZGA 1TVKB 1EX1A 1RQ2A 1Q0UA 5F12A 5FBLB 1A04A 1MH9A 3VSAA 3TOVA 2C31A 4G1FA 4DV1B 2QI9C 3DAGA 4LJYA 3U4AA 3H17A 4EKEA 2PRKA 3LHIA 1T1EA 2OCXA 2DPGA 3IQDB 4JUDX 4NONA 5JH7B 1V0JA 4LY9A 2PS9A 4GUDA 5TIIA 2X4LA 3B9BA 2XRZA 2IHNA 1IXSB 4XIJA 2VP2A 3OD1A 5KKCA 4BMOB 2AW5A 4GBED 1P62B 1EFDN 1PRYA 4KWCA 4H1WA 3UJBA 5KQGA 1SB9A 2R8BA 1SZDA 4QREA 3CSDA 4RFSB 3UMGA 1P6UA 1KNQA 1KI2A 1T5DX 1WDTA 4I08A 4KLNA 2CWDA 1NWCA 3HBNA 5FJIA 4L95C 4E4TA 4MRMA 4Q93A 2X22A 1S7GA 5EEHA 3QWIA 1ZWKA 1Z2NX 1AOXA 3N2IA 3KKLA 3IMCA 2HXGA 4NHOA 1TM4E 4QODA 3WE7A 1L7PA 3ZWKA 2MYNA 1FDRA 5EQFA 1KTVA 1SO8A 2Q07A 4N0EA 4C87A 5JLJA 1K8ZB 5LIPA 2HBRA 3C3EA 1F0NA 4K9MA 5FXMA 3LVRE 2ZLBA 4QASA 1G5TA 1U28A 1IVYA 3PNOA 1T2AA 1BYUA 2EL9A 4OU5A 4OFXA 4QDZA 4NMWA 3LRTA 2QTNA 1GNSA 4Q9JA 3CN9A 3HKCB 2YWFA 4N41A 13PKA 5DMHA 4DBZA 5JH7F 1YZNA 4OP3A 2QX8A 3KDPA 4LZLA 3VPFA 4A8TA 5ABPA 2KB0A 1O96A 2JEZA 4PLHA 1KQNA 5IAOA 5IZCC 4UBOA 5EIXA 3WKAA 2R84A 1XTKA 4A2CA 4M0PA 5CVJA 1IM5A 4CMAA 2IZ5A 3CX7A 1H8EA 2CLMB 2PD3A 2E4ZA 3B1FA 4F06A 5KJ1A 1N36B 1RWQA 4YMUA 3QUQA 4PFJA 4R51A 3RUDA 2Y71A 1CHDA 2JLSA 3VGPA 3R6DA 4NBKA 3BE8A 5CDGA 1HYHA 2VDJA 2VK8A 4HNGA 2BR5A 4V0SA 4I4TB 5AK0A 2Y1GA 2O59A 3QM1A 1DBPA 4RKFA 4M4SA 5JNVA 4BTEA 1IC6A 4F38A 3DV9A 3CBGA 1U0GA 2PYDA 5HUJA 1KPHA 5HFAA 6NULA 3A4VA 3OZFA 3L0DA 2D2IA 3HS3A 4PYOA 1R4ZA 1U3DA 1ZVVA 1SUCA 2GD2A 3OC6A 1A27A 2IHJA 3QPWA 1L5NA 1W6UA 4D0NA 4ZZIA 2BGMA 1KZGB 4Q18A 1CY1A 2WT9A 5JBIA 5EMKA 1C1XA 2O0KA 3NNDA 1KAHA 4LCEA 4MROA 1MC4A 1K08A 5EA2A 2UVPA 2FN3A 2JFGA 2YUIA 3GMSA 3RJZA 4BO5A 4K9DA 2BI8A 2ZM5A 1N7IA 1JEDA 5L8VA 1HEIA 1QP0A 1N2CB 2JHGA 1JXMA 1QYDA 3FW1A 4F04A 4DV6B 3D2AA 3NKVA 2QSZA 5EIBD 5TQVA 2Q3MA 4ZYVA 5CCDA 2FSVC 5JCOC 2RD2A 1WSAA 4MW0A 3FPSA 4U3JB 4E5SA 4OLBA 3U3JA 4A1OA 1FPQA 1VSUA 5HFNA 3KYIB 4LXTA 2Q5QA 4HJXA 2FK7A 2GH1A 3FNBA 3WGTA 5CA0F 3DUWA 5AW2A 3GAZA 5H4HA 3LNCA 5KNCH 1ZGBA 2OXRA 2FPWA 1TQ4A 3NTRA 3QX8A 4HRXA 4XEUA 4ZT6A 4B79A 7ABPA 1K9VF 1VI5A 3E7FA 4BNLA 5IJZA 4IRXA 1FFWA 4Q9IA 1V4NA 4AS3A 1OBFO 3I6IA 1NDUA 1GEEA 1RLTA 5B4VA 3F73A 1O9HA 4KZKA 3WYAA 4A0FA 3QF4B 1XAIA 1A0OA 3UFBA 1FSGA 4NZ9A 3OX1A 3OMLA 4LNUA 3QKSB 4QFMA 1KE1A 3OIYA 4CKBB 3T5AA 1T5TA 4YAWA 3WA6A 4JJKA 4CIBA 1XCGB 3CPEA 4KO2S 4W1PA 4M0CA 3LUBA 3ONFA 4REOA 2OLJA 2EFHB 3K2EA 5BT9A 5TQ0A 2X7JA 2RGNC 1SA0A 2XEDA 1RAAA 1E3WA 1XNJA 4K3UA 2OHOA 1DBWA 2OESA 1W4CA 3DZHA 2NSDA 3OOEA 3TINA 3W8EA 4LWZA 4EBFA 3UJCA 4CRWB 1AU9A 2NNWB 3B36A 3TTWA 1VHWA 5EZSA 3ILSA 4ARSA 1V45E 4GSLA 2X8JB 1LX6A 3K8YA 3L8MA 5JQGA 3F6RA 3HLYA 4NKRA 5EWMA 2O5VA 3RYTC 2PMCA 3U7FB 3EE6A 4DS3A 2HCTA 2V0CA 4NECA 5BWLA 1I9GA 1TNDA 4JI8B 3VU9B 4BY9E 1VHQA 1QVAA 1DQZA 4PS1A 4LRYA 3WQSB 1ODIA 1GKLA 3GGOA 2POQX 1J20A 2IPLA 1QHHA 3GYBA 4B85A 1C50A 4GXQA 4Z4FA 1XK7A 3Q7PA 1AKWA 3HCCA 2C2MA 3TCXB 3RIMA 3ZYZA 4K28A 3IDFA 1NNEA 3QTTA 2E9SA 1O54A 1LV7A 4XI9A 2G8NA 1KK2A 1P81A 3KRTA 4LJ6A 1FXWA 2G04A 1X7XA 4I19A 2XHEA 1NW9B 2Y1DA 3KOMA 3MPOA 2H1LA 4EOGA 1PN3A 1HF3A 5ITSA 2IYWA 4DMUB 4DV3B 4GOOD 5FFMA 4MVJP 3ZHQA 3DL4A 1JMYA 3A7DA 3OBBA 1KSFX 3MERA 2L42A 3PUKA 1CRLA 1YL5A 5M34A 3W8FA 1FLAA 3RF6A 4S2UA 1ZGGA 2ZIVB 3C5EA 4TZKA 1WQ1R 1X7YA 1N2EA 1Q3HA 3LBAA 4OQEA 2QTAA 2GJ8A 2I2DA 4FR0A 5BN4B 3VTFA 4EG6A 5LQUA 3I9NA 1IWOA 3HKBA 3CHYA 3LE8A 4CM5A 2YL2A 5HM8A 3GLGB 3SBDA 3CEJA 2J07A 3KSZO 4F97A 1UMDB 2IXDA 2VF8A 1P5ZB 4HZUB 4TTVA 4YAFA 5DBOA 4ZRMA 4XFDA 4PCVA 3MAJA 4ECAA 2YV5A 1CPYA 3Q0EA 3WWYA 4EEXA 2BKLA 2XITA 2CSXA 3QYPA 5J63A 2QTFA 5CLLA 4CG2A 3T3PB 1Z16A 3ZGZA 1WF3A 3EPHA 3SC3A 2CB9A 3VTAA 1A4RA 2NO7A 1HUQA 2O2JA 3IUEA 4TV9B 3A4LA 5CIWA 2VPQA 3RC3A 1FUIA 1UFKA 1WX1A 3G1TA 5AVXA 5G0TA 4MR8B 3MCWA 1XZFA 4FP9A 5L95A 2Y92A 1EFRD 1F38A 3JZDA 4MR7B 1YI1A 2WHQA 4HDKA 3MYYA 5F98A 4FD2A 1SELA 1CUWA 1MRNA 4FWIB 2BEWA 2ZULA 3BF8A 1IEQA 3BMCA 2XT9A 2FETA 1NPYA 2FEKA 1DHTA 4DUGA 4JCCA 2FZVA 4XQ0A 5I9LA 3QVWA 2Q8NA 2AB0A 3QLVC 3I4FA 4GX1A 4N5DA 4UCXA 5ILQA 1IXRC 2XF2A 3FJYA 5DCWA 1GG2A 1BN7A 3PYLA 3CG4A 1PYGA 4CMBA 3VPAA 2EFDB 2OO7A 1GU1A 2QJRA 2VF7A 3KR1A 3EF3A 4K6MA 4U2BA 1A8PA 1N4AA 4DLRA 4EIWA 4Q82A 1WJGA 4ME6A 4IIEA 3D3EA 5C0OE 2VNAA 5LYJA 2P5UA 5C7IO 3H11B 1PT9A 1FF9A 3PUJA 4BNGA 1M74A 5E4YA 1G98A 1SKBA 1UQTA 1V5EA 4UAVA 5F76A 4JKYA 2CMHA 2WQ6A 4Q9DA 2GBLC 1THTA 2VH1A 3SN6A 3TNDA 2FY8A 3E1KA 4LSWA 5AUNB 4CEHB 1YRLA 1QO0A 1GL7A 4K6CA 4L50A 1ZNQO 1QTIA 2NYRA 5JVDB 3VOBA 1IN1A 2NVBA 1ZNZA 2GO1A 2RHCA 1GTSA 4FBLA 3SJCA 5IUJC 3OPQA 3IAS6 1WVMA 3K5WA 3UMCA 2AWNA 2WWWA 4A15A 1X80B 3Q1KA 1XD2A 2M98A 3T7EA 1AS3A 3KEFA 3I4CA 2AFHB 4E1VA 2Q9CA 1TLFA 2EJTA 1UADA 1YDEA 1Y63A 3RBZA 1NN3A 3DTVB 3I2GA 5AVOA 2Z4SA 2BBTA 3M4YA 2EGUA 1S3IA 2BGUA 2ATCA 1P17A 2GPYA 1UJ4A 2O2SA 3KE9A 4QTTB 5L7YA 4EENA 3OPNA 5ITWA 4KXLA 2BBWA 3BTUA 1TE2A 3H5RA 4OIMA 3ZIDA 1V2HE 4LGCA 4EGFA 4TSRA 1YRAA 1ZK1A 4MWZA 5JSYA 1C3JA 4L2IB 2PUHA 2V7EA 1XBTA 2FWMX 2XMSA 1ZJ6A 2ZYHA 4MI3A 1HT1E 5FI0B 3HB0A 3GLTA 2PRIA 2ODTX 3GFPA 4Q48A 2I33A 1XD8A 3U39A 5C4MA 7AT1A 3OEHA 2H4ZA 5LFAA 4DG8A 3FNRA 4BGIA 2GBGA 1EM6A 2OR3A 4Z8YA 2P2LA 2KBEA 1IMJA 2PAAA 4QU0A 4C0HA 5H3HA 1LEHA 2AG6A 4RVDA 4P7GA 4ZVRA 4I9FA 1QVWA 2GJ4A 2ZYDA 3B13B 2QYTA 4RZHA 1RZ3A 2AFHE 1QIEA 3INTA 1P7YA 5H3LA 1TZBA 2PY6A 4I6EA 2J0VA 3Q5DA 2NUAB 3W6UA 1XEFA 4UDXX 5CVTA 2F1RA 4IGKA 5HOEA 1QUEA 2BEUA 1ZIPA 2AOUB 2PHZA 3C7DB 4JJIA 1BS2A 4U6SA 2C0CA 1VDZA 4WUVA 5M3BA 1AKQA 4KDEA 3B8HA 4G4JA 2OYSA 3FPKA 1ENYA 4TT3D 4LGVA 1LW7A 4XJVA 3EA5A 3P9KA 3R0JA 4QDOA 2GI4A 2OORC 1XF9A 3E1GA 3IBGA 1T9GS 1SCIA 1WPXA 2I4LA 2VKTA 5A04A 1JPJA 3AIKA 2B8TA 3AJAA 3AIIA 4TRJA 3EVZA 2FDCA 1HNNA 4H1VA 2I1QA 2W6PA 1DJNA 4DKXA 3V4PB 1SG6A 4V24A 1FMJA 1Y8RA 3B2NA 3VOAA 1USGA 1EMDA 1M83A 2HDOA 4XVQA 5EWLB 2HEGA 2QTLA 3EF1A 3PXBA 4ZXPA 3TEMA 3ZXYA 4LF7B 1OX5A 1DPGA 2C4WA 5K0CA 4DLUA 1R0SA 4DJAA 1L4GA 4RIFA 5MFPA 5EZYA 3R5TA 1HDEA 2E1PA 3FTDA 2EX4A 2A0YA 1NJ1A 4G6ZA 3KSMA 2FW9A 4LI0A 3QUSA 1AD2A 4HBZA 3IE0A 4MA0A 1NR5A 4PR3A 2HQ1A 3TSOA 3O95A 2OGSA 1DRVA 3CW2A 4FMDF 5FT9A 4CCYB 1GAWA 1L1EA 5L45A 4ISCA 4W5QA 3DDZX 2FKNA 2H1CA 4M54A 1AKVA 3FYTA 5KTNA 4MUJA 2F8TA 1LLDA 3CU5A 2ZUBA 2BTOA 3RHFA 3RT7A 5K4HA 3DMGA 2GZRA 2HF9A 3AY6A 1C9DB 2D0DA 2GUWA 3DBLA 1HETA 2CNDA 3J7TA 3QFRA 9LDBA 5FOTA 3V5NA 3T5MA 2RKOA 4GMFA 3WGOA 4KFCA 3EFHA 2GXUA 4V1CB 3PE3A 4PIVA 2PFKA 1X7DA 2GFIA 4HOYA 4D98A 5AFSA 3WLHA 5KWEA 2WJ4A 2FRXA 2GZ1A 2FPPA 3HYSA 3OT5A 2O8BB 3P4UA 2PSSA 3SZRA 1U98A 4CCYA 5EJ5A 4IBOA 2GCOB 2HDHA 3K0AB 4XLLA 4AJ9A 2ZUEA 3EYAA 1PNOA 1EX6A 4N03A 4Y6OA 4EABA 2Y1KA 2CHVA 3AHEA 4M8KA 3TTVA 2A1TS 4IDDA 5LP6B 2Y05A 3QEJA 5ALUA 4PGGA 2AJDA 1R66A 2W6JA 5EMJA 1P5JA 2O23A 1N2OA 4MYRA 2OO5A 1PV1A 7REQA 1G291 4MWOA 4XX0A 1KC1A 2RARA 2OYCA 1N3BA 1YJ5A 2V4MA 3F8WA 2JCVA 4DQUA 1XZNA 4QUKA 3OEWA 4ILEA 1EVQA 2DHRA 1W5AA 4G8CA 4A6PA 4RXMA 4EUHA 4Q16A 1YDMA 3IIIA 2P4QA 4F4JA 1ZOSA 3FETA 3IAXA 4CODB 1Z17A 1MJGM 4D0GA 1N75A 3WNCA 4XDGA 1AQUA 4H4DA 4OTZA 4V0LA 3V00A 4DQDA 2AR9A 2QYSA 2AI2A 2UU9B 4QYSA 3RYHA 2XB8A 1NUSA 2ZBFA 5C80A 1DNPA 2GESA 3T1YB 1AQIA 3C14C 1M34A 1GFSA 1D4AA 1V4BA 1IE3A 3QVMA 1KO1A 2PUFA 1J2YA 1FRVA 1N2IA 4PY2A 4GKKB 1Y1KE 2GHTA 3S2SA 4JJ4A 3RDPA 3GGCA 4IQ4A 1HNZB 2HGSA 1SBQA 1J8DA 3K20A 3Q41A 1PL8A 1Q0RA 4IH4A 5G3ZA 4DJ5X 4Z4CA 1EI9A 4BO8A 3CH4B 2RE8A 3NB0A 4UU8A 1GPAA 1L1RA 1FC0A 4FDLA 4KXWA 3AEQA 3N8HA 5AK6A 4XWWA 4M1OA 4Y0AA 4RV9A 2BKAA 2NN3C 4JV5B 5B7GA 4UUPA 2P2NA 1KMHA 2GFHA 1I2CA 5CBKA 2VK1A 2ZYWX 3MWGA 4M60A 3SBXA 3U19A 2V1XA 4F6CA 1U3WA 2AG5A 4PZAA 3Q6IA 5IC5A 3UOAB 1QOPB 4DF3A 4XDZA 2SKDA 1UANA 1O94A 4HXYA 4XD7D 2EZTA 4NABA 4WVFA 5LC1A 1N2HA 1BDJA 3C5HA 3QVJA 4XIFA 1I3NA 2C4NA 3PUXA 2CYAA 1ZD4A 4N7MA 2WTUA 2FN9A 5LN1A 1E62A 4N5HX 2IHZA 1RWKA 4U0JA 5GJCA 1JIKA 1LQ2A 2EP8A 3EGDB 1MVNA 2WFMA 3H3FA 1DI0A 1XVLA 3ZY4A 4RVNA 1G0NA 3GD7A 1DAIA 2C92A 1TKRA 2YOFA 4NL4H 1I51A 4BYMA 3DF9A 1T0BA 2AK2A 2VT7A 1E3LA 2JJYA 3IAS1 3IEKA 2QNRA 3IFSA 3KT8A 5FP0A 4RKQA 4J9VA 2Z8YM 1KF0A 1ZISA 1JHDA 3PNVA 1J2EA 1FTNA 1V3UA 4QUGA 5E6UB 1XE3A 4GOJA 1MXHA 3WZMA 2XTZA 3TVYA 4FMPA 2GEVA 3COWA 2GXSA 2IEYA 1LPSA 3ECCA 4FOPA 1A4IA 5E3HA 3T7RA 2ZJBA 4A4DA 4E13A 2PIAA 1ADGA 1UBSB 1BVYF 1YJBA 2RBEA 4DIKA 1ZGCA 2VYVD 3BAFA 4DC9A 1U2EA 2ZK7A 3FM9A 5JADA 4JC0A 1ND5A 2XT6A 4HYEA 4MCJA 2JGRA 4X8HA 5CUQA 2FN8A 1PUJA 2X6RA 4IV8A 1LJUA 3T4XA 2E55A 5ALHA 3RI3A 2Q5EA 4DZRA 3C3YA 4WA7A 1SVWA 1QU2A 3ZE1B 3BK7A 4NOKA 1SH7A 3RIGA 2VN8A 4TS4A 4QYIA 2YOGA 5DNDA 3PJEA 5G0WA 4CV0A 4F5WA 2RC6A 3ED5A 3EWNA 4ZO6A 4CF5A 4O02B 1S2NA 4OD0A 4Y2HA 1JHOA 3WGLA 3ITDA 1V3TA 3ZWDA 2Q45A 4JU9A 4HPWA 4WKOA 5HK8A 3S3TA 5IRCD 1NURA 1Z34A 3IEMA 4NBNA 2KI5A 1L4NA 2YXPX 4BUZA 1RZUA 4TRMA 3QW2A 3IEIA 1F1BA 3D59A 1WXQA 1OU0A 2C94A 2WAMA 1DKUA 1CYEA 2VSOA 5BVHA 4H17A 1ZX1A 1LX7A 1KH3A 1ZK3A 2XDAA 2GJKA 4JITA 1RRCA 1BFKA 1DXQA 2X86A 1P33A 3HL0A 4JL5A 2M2IA 3I64A 3OOWA 1CCWA 4CVNA 4RGBA 3U9TA 2BGNA 4MVYA 5F9MA 4OAPA 1Q7CA 1N9ZA 1TECE 2BFDA 2PTHA 5H81A 2WMOB 5AI8A 2YV3A 1DUSA 4JSRA 3JARB 3A1TA 4OQLA 3ROZA 4L3WA 3OLQA 3HVHA 4LN1A 4ACBA 1DQYA 2G9VA 1NW3A 3OQPA 4K9KA 1KTIA 1VL5A 3AOEA 1E6WA 1LPBB 1LF5A 2WA2A 3JATB 2WYOA 3JWJA 1FP7A 1NA5A 1SPXA 1XVTA 2Q41A 4OH1A 4IFEA 1K88A 1R8JA 3N05A 2SICE 4PLVA 4AWAA 2XEXA 1Z0ZA 2PPLA 2XNSA 1SOMA 1EFTA 2G5GX 3EMKA 3HA2A 3H0CA 5DHPA 1O94D 2PH3A 3KB1A 5CX1A 5CEEA 4IOKA 1TEZA 2VT2A 2A30A 2OZKA 3FVRA 3HP1A 3MOGA 3PDJA 4TMTA 3G1UA 2VOEA 4WLUA 1XG5A 1QGOA 2Q9AA 4M1KA 5IVDA 2JA2A 5EE1A 1YR9A 5GIOE 2H65A 5DGCA 2XRYA 4NCIA 3CRMA 1NRXA 3QE3A 2PL5A 4PLGA 2DBRA 1L2TA 1MV8A 3DLPX 3JQGB 3WOVA 4YROA 3H83A 1IQ0A 2AOWA 3UWMA 3BFXA 4YIKA 2ZRHA 4JUCA 3HXKA 4IXNA 3NBYC 4KR7A 4HFMA 5DNAA 3RNOA 3SU8A 3MWEA 3WNZA 1BXGB 1XLVA 5A5DA 4ZI3A 2IXAA 2Y1OA 3I2HA 1ZH6A 3QELA 4ZJYA 1A1VA 3OCVA 1ES9A 4TGLA 4MP6A 1HL7A 2GK3A 1U2GA 3FRIA 1SC6A 2N46A 4GSKA 4HUQB 2P91A 1CZOA 3ENKA 4ML3A 4YJ3B 4D82A 2ZRBA 3P7MA 2EZ8A 3DBRA 1GTRA 3UPDA 3DHVA 1PD0A 1DRWA 1EAYA 4D2IA 5J1TB 2DHQA 3C8DA 3R6TA 2HF2A 3Q7RA 4JELA 3NJRA 3KAPA 4Q6WA 5KQPA 2VC2B 5HSGA 1X13A 4NZYA 3BRCA 1EK1A 3NBAA 5TT1A 3NYRA 3EMBA 3OFNA 2QUKA 2X9LA 3Q1LA 3M2TA 1LUAA 3FKSD 4HZGA 1HDRA 2QB5A 4HXFB 4URXR 4RTJA 2AKAB 5HBRA 3OHMA 4PTYA 2ASVA 3EGEA 1B0PA 2J85A 1EIWA 5TS3A 2A5GA 2ZZKA 1PZXA 2ZR9A 3GUCA 1HTWA 3IP8A 3NH6A 1NC3A 4LY3A 2O19A 3BG5A 3ZJ4A 1GTG1 2PS0A 2QRKA 1B6RA 5JQWA 3I2YX 3KTDA 5F1PA 3L92A 4DR2B 5LQMA 3IJRA 3HNOA 3TO5A 1GZVA 5DTRA 3C7TA 1G8KA 1QFXA 4M2LA 2REBA 4EHHA 1ZVKA 3VNUA 3VPXA 3JQAD 2P6PA 5JVDA 1MPXA 1KDTA 3STYA 1G5FA 5GPBA 3ZR4B 4D9KA 4CM7A 1SD5A 4JZYA 1A9TA 3PG5A 2JAQA 1V5FA 2MIIA 4ND7A 4E2WA 4MB2A 1T0PA 3ORFA 1N1MA 1X80A 4KN9S 1QFSA 4BMYA 1XMOB 3B52X 3CF2A 5JXJA 3QFFA 3T9AA 2CNLA 1KXJA 4L9WA 1RQGA 2FFBA 1UDAA 3HDTA 5IAAA 4TTJA 2WD8A 1XN1A 2WKRA 3K32A 5AXDA 1A9YA 2Q5LA 4C7OB 3KKZA 1S3SA 1SHZA 3FR8A 4QATA 1EE9A 1SCUA 2Q3JA 2YHSA 5FNVB 4CQMD 4G5GA 2HY7A 3ET4A 4JVMA 4MR7A 4OYYA 4W5HA 4EG8A 3GJ6A 3HXOA 1RQNA 3MTIA 5IAEA 4NRDA 5HZKA 3R0QA 3ZBPA 3A3YA 4EI7A 4KNVA 1ICEA 4XQGA 1E5QA 3OFND 2JFXA 4JBLA 4EJSB 1LNZA 3OE1A 3PNYA 1JFTA 4EA8A 2VZ8A 5D6OA 3QY0A 4WECA 1PKEA 1ZMRA 2PVCA 3G5UA 4Y6QA 3WRXC 1CVIA 3GT4A 1Z88A 4B5LA 1KI8A 3PE6A 4DQVA 3ZHUA 2F7SA 2NPOA 2YHUA 1M8JA 1JAHA 1PQ4A 1MJFA 3R7WA 2QMEA 3C45A 5LOVB 3I53A 3ETCA 3ZY2A 1MHPA 1M5RA 1T0HB 3TL6A 4IRUB 3O4FA 4C0QC 2NLOA 1UBKS 1QPBA 1EVJA 4GI5A 2Q62A 1FFEA 4N7RA 3ZDQA 2FUKA 3V2GA 5EJIA 2BBSA 2LDBA 1EJ6A 2RHHA 3GH1A 3TW8A 3RRJA 2NAPA 3K73O 5SICE 1J09A 1JV2B 3FMGA 1ZH0A 4UVEA 5GMOA 2WWTA 4F71A 2RDMA 3AOEC 3ZHRA 3H3JA 4L8GA 2ZG6A 3C3AA 5F1YA 3SYRA 1RXUA 2PT5A 1FTWA 1Z38A 2QR3A 3IT2A 5LB2A 4Q7JB 4QQNA 5CLFA 1XWIA 1A8SA 3REFA 1XP8A 2QSUA 3OG9A 2FLVA 5DHRA 5J2TF 1LWOA 5BYJA 2DF8A 4C4SA 1VG9B 4MAMA 4WZAE 3JY6A 4B33A 1OLUA 4KR2A 4P3KA 3RU3A 4A0HA 2UYGA 2WIJA 3W90A 3A6ZA 2O0HA 3AP3A 4I6GA 4MB6A 2RAFA 4LBVA 5DX1A 3SNKA 3LLCA 2O3UA 1R4AA 3R3SA 5JWOA 5L3QB 3OLCX 3PFIA 5JCZA 5JCOA 3C85A 3I2KA 1F8YA 2QF7A 3EJWA 1FP1D 2YC2C 4K7JA 2QRVA 4N5LA 4UTVA 3DJFA 3DOCA 3LS2A 3VR4D 1OOEA 4EF6A 1HZZA 3LMKA 2QJWA 1HTBA 3DXXA 4UMDA 1FFXB 2J3JA 4UM9B 4DIMA 1E3SA 4UBKA 1QS0A 5DP1A 5E6RB 2HPZA 3B5IA 5F2EA 1P61B 2OCDA 3K8ZA 2Z43A 4OHZA 3HBLA 3R3WA 2A57A 4W8GA 5BW5A 3UT6A 1Y7PA 4R6WA 1EGHA 3TIVA 2EKDA 3MTAA 2IUSA 2GN2A 2GRAA 2XAUA 4BU0A 1PK8A 4ZO4A 2L19A 3E9EA 3LYLA 1PJBA 4B34A 1UPXA 1M2JA 1Z2EA 2IUUA 5ES4B 3K4QA 2CVZA 1ICIA 5A3JA 1NXPA 3IBCA 3OOHA 1E1YA 5HKAA 1E9FA 1SKAA 2AFVA 1K2WA 2OE2A 1N0VC 1CY7A 3NEYA 4DB2A 5IYZB 1QS0B 3B1WA 3HCNA 1GPBA 4WDQA 2GHRA 1FY2A 1XMPA 4QGSA 4KHZA 2AJLI 4FZ5A 4MKXA 5J2UA 2F8SA 5DBEX 2W8BA 4NX2A 2XAAA 2WUFA 2ZW9A 1KWKA 3SR0A 1PDWA 1RCUA 4EF5A 1PDVA 4BPBA 5JD6A 2CYCA 1DMSA 1UPBA 4GOND 1H6CA 1LA2A 2X4DA 3EUAA 2O2HA 1WPGA 4KR9A 3UTCA 1GCGA 2W0SA 3QVSA 3ASVA 3U3DA 1CE8B 4H1HA 2PD4A 3PFNA 3U4DA 2XZDA 1HYBA 4TL6A 5B3JA 1XLTC 4WY2A 3RFFA 3TZKA 1SC9A 3LVQE 2ZJFA 4H3HB 4ENVA 4XVUA 1ZA1A 4YP6A 2WM2A 2ZRNA 4JLKA 4BJ5A 3NCHA 3A9SA 4XSVA 3DT6A 3LOPA 5E8JA 1JIIA 2ESRA 2QAGC 2I5PO 2HA6A 4JLNA 2W71A 1RI4A 4KN6A 3IBFA 4E5YA 1UWVA 4O2AF 5EPOA 4YV1A 4HYQA 3TRFA 1UC9A 2BUBA 4WNCA 1Z15A 3GI1A 1NNUA 2R44A 1JKXA 1GARA 4A92A 2ECOA 4AYTA 4ZCRA 2XCIA 4KMSA 4DCCA 5KTKA 2Z5VA 4ZRNA 2DWUA 3OZVA 4IEEA 4CMJA 1MO4A 1WMAA 4K40A 5L4SA 4GSYA 3Q9NA 2XMPA 3VA7A 1JJ7A 4WKNA 1IB6A 2J9YB 3W5SA 3L8FA 5ALEA 1T1JA 4YI3A 2C8VA 2DP4E 4NDAA 5FIUA 2NZYA 1L9XA 1VKZA 1T3TA 2NO4A 4M0MA 3LQKA 4CKWB 2WHYA 2FZCA 4ZQFA 4RTNA 1JJVA 4IF4A 3BCUA 1G8HA 2ZAOA 3N0VA 4GRIA 2O8FB 4CM9D 2C8LA 4NBSA 5EJFA 4DJDC 4YACA 2DKNA 3UMVA 4KRFA 2DWOA 3O8CA 1JIQA 4J94A 3WHKA 2JLUA 1PGNA 3QEKA 1PS9A 4CLDA 5FUYA 4D9IA 1TFUA 1U6JA 3OY7A 1X70A 2VHZA 1MJ5A 4QNMA 3K0BA 4OATA 4WX2B 1RZRA 3I5AA 4MWTA 3QHAA 3HA3A 4Y2RA 2NZVG 4E51A 5GP1A 4A3SA 2DUNA 2UYQA 3ZH2A 4P5EA 2ILVA 3H4TA 2XUDA 1PE0A 1YB4A 1IN5A 2IPOA 2C9ZA 1KHTA 4ZHSA 1ZL0A 2YJ4A 2ZWVA 2H06A 3ICOA 4G9GA 1J70A 1I3LA 1VE6A 4PPYA 3UHOA 4R9NA 2Q5IA 2GWHA 9GPBA 3W9UA 2O2IA 4NCJA 2UYOA 2CL6X 4GZ6A 5L4NA 3O4IA 1UBJS 1V3QE 3BJRA 1E59A 1P2SA 4TLAA 3WAGA 4QRHA 1KMQA 4MHOA 3E2MA 4Z9XA 3GRUA 1KAMA 1WHTB 3NHZA 1QVRA 4PC7A 5EQTA 1NBHA 2B21A 3EEFA 2B3DA 2HRRA 3VH2A 5AWFC 2GD1O 2XBLA 2GSWA 2C77A 4Y6PA 1WUYA 3PPIA 4H15A 4DMLA 4A27A 1WM1A 2VNHA 4DQLA 1JG6A 4IIGA 4EPRA 3MHTA 2NU9A 5FL3A 4GM4A 3H5NA 1OX4A 4FFWA 3RS4A 1TF5A 4G4SP 1K8YB 2IP4A 1GVHA 1E92A 3G2LA 1OHHA 1R88A 4AZVA 1YCDA 4JJ7A 3T1NA 2FVYA 2IOHA 2AQ8A 3DDHA 5K3FA 4DMMA 2RH5A 2XT0A 4TMXA 2R00A 1I3MA 5ERGB 3GZTB 1ODCA 5CAEB 1MD9A 4MUBA 3WGQA 2R87A 4L15A 3FKQA 1KYYA 2P4EA 2R60A 3BKXA 4ALJA 5KWSA 2Z04A 2UKDA 3DO8A 2QMOA 1DP4A 2JLYA 1X1DA 2ZDGA 3QBEA 5AKXA 3GGPA 4C4OA 1VG0B 5SZJA 4NICA 4UUAA 1J22A 4B9EA 1C3EA 2XKAA 1OI2A 5JCJA 3NONA 4AKEA 2SKCA 3F3MA 4LXYA 4KHPB 1G4HA 5KNBH 1VJ5A 2NTNA 5REQA 4BGEA 2IX3A 1N0WA 1YZHA 4IXWA 2FE4A 3Q3CA 4X7BA 4ZGWA 1QH8B 2Q1TA 3LY8A 1QRUA 3KPYA 3PVCA 3DOFA 2Y0CA 5LVAA 1L4HA 1GAQA 1QK4A 1YS4A 1GU0A 5CGZA 4DM4A 1MG0A 2WZDA 1ESEA 1X1EA 1TCVA 1ZRMA 4LTNA 3RGGA 4H16A 1A82A 1W0JA 3L7CA 2OZLB 3V1TC 3P1JA 5HW0A 2FW7A 3WGMA 1ZIXA 5TQ2A 5T67A 2PEYA 3Q40A 4JDUA 1CX9B 1J6UA 1UMCA 3H1TA 3K1JA 1UH5A 3DTNA 2NT4A 4INAA 3B3JA 1GJRA 2IEZA 4EJ6A 9ABPA 5LZ7A 1XIVA 5AM1A 3QVLA 3BWBA 3ET5A 1NONA 3TKLA 1RHMA 5CFZA 4MSUA 1RQLA 2FHPA 1WULS 4NIMA 4X93A 3F6CA 1VSBA 4HXEB 5LP1A 1ZEJA 4QYMA 1CR4A 2OENG 1OAAA 3DV0B 4KDCA 2V96A 3EUEA 4K0RA 3RARA 5TJ9A 1K98A 2JA1A 2JLCA 4DOMA 3U7QA 3ILHA 1C7QA 4RZQA 2PH1A 3AVVA 1MMFB 5GVRA 3DT8A 3JPWA 4RLHA 1QHYA 1TGYA 2H11A 1BHQ1 5KJ6A 5EXTA 1XU4A 1E5TA 3TZCA 5E7IA 4HTFB 1U3TA 1IHPA 4R5HA 4UZSA 5CK4A 5LLSA 3WYBA 1T5HX 1NC1A 2I34A 2WVAA 3LQFA 3H05A 4TWBA 3VISA 4HSGA 3H65A 4PX5A 2DWPA 5JSZA 1BS9A 2GTHA 4HL6A 1TEHA 2GBCA 4DT1B 2PA0A 1VDMA 3A6EA 1Z47A 5J5VA 1R6XA 1SPBS 3KU4A 1EHCA 2XNDA 3ZX5A 4Q1BA 2HU8A 4LXIA 1N3YA 3V1NA 4ZV4A 1C3OB 3Q8MA 3S8YA 4U9UA 4JFAA 4MQMA 1KQGA 1T9DA 2WZBA 4YAUA 3RK0A 2RGCA 4PSKA 1Z2OX 4LJ7A 3L1HA 5A4MS 3QNMA 5DYTA 1F3OA 3TDNA 5KJFA 1UKYA 2H2WA 2LW7A 2CT8A 3FTPA 3DL0A 4MH0R 2H7XA 3OTIA 1SVSA 5KNDA 3EDRA 1CQIB 1O58A 5KKNB 2WVGA 1SAYA 2Q21A 1R3DA 1T2EA 3RODA 4YT4A 3DVQX 2JH9A 4D41A 5U9CA 5KNBA 2C0PA 2DFLA 3ANSA 2KLHA 2IYSA 4XM1A 1BMDA 2GF2A 3K9QO 1XTTA 4TQ9A 1E1QD 4Y1GA 5CM8B 5AIAA 3TL2A 5LQJA 2EHJA 5IW8A 3A1CA 1EU1A 1CUIA 1U5BA 2H08A 1HR0B 2J9FB 3KOZA 3N07A 3KD3A 3MUNA 4QQRA 5DYWA 5BPFA 2R7AA 3O75A 2DE0X 1RHQA 4PYNA 3UW1A 2CDBA 3V9AA 2PNFA 2R5WA 3QQ5A 1AM4D 4B3FX 4GBJA 4L1KA 4MS4B 5DKFA 3ZLVA 4YT2A 1W2WB 2HO4A 4JL6A 1PTKA 2XOXA 2CCKA 4DCVA 3GCWA 3OQIA 3RF7A 1P7VA 1F14A 1ZUNB 3AKYA 1E79D 3BMCB 3NDBB 4DY4A 1TW2A 2CUTA 3GEBA 3UWPA 2VDKB 3ZDEA 4NK4A 4H27A 2P2SA 5ECDA 1NN5A 1P0MA 1XCLA 3QU2A 4HB4A 3E81A 4WFKA 2F62A 4Y2XA 4BE4A 1OVGA 2VFAA 4QELA 5CH5A 3O1JC 3DD5A 1RHRA 1XTIA 3OJ0A 3V80A 2V97A 4B6JA 5FPTA 1AB6A 3S5JA 5K3AA 4FC7A 2XDYA 4FBGA 3H1FA 3E7WA 2I71A 5KB3A 4WDRA 4ENRA 4JC8A 4ZOCA 4FD3A 1E2NA 1C0IA 3GVHA 1SOVA 5LUBA 4YVFA 4UHEA 5IXSA 4REQB 1UK9A 2ES4A 4PW0A 5KSWB 4GZ3A 4DCNA 2GMWA 4OLJA 1VLZA 4S1PA 5JJKA 2FF7A 4WFJA 4JNCA 3VYTB 4M7WA 1A69A 1U0HC 1YK1A 2QAGB 1GLNA 3GRAA 3HI6A 3IHLA 3RS8A 2D5CA 1U3FA 4GI2A 4BX2A 3S8EA 4OXRA 1JNYA 1UOOA 1DAPA 2O3TA 4ZVKA 1EBBA 3BEDA 1GGVA 3DEIA 1FDWA 4CMEA 2D62A 5JSFA 4RWZA 1CUGA 3ANTA 1VLVA 3C6BA 3FHCB 3V1LA 5LLDA 1BN6A 5KTTA 2DCUA 5C8XA 2PFSA 1KJZA 3NW9A 2NU6A 4GFDA 2AR7A 4YUVA 2H7YA 2Q2QA 4QTUB 1TF2A 3WB2A 1FFSA 2K87A 3LD9A 3ZS9A 1C9JA 4KN5A 3EB9A 4MW5A 3CLTD 3WLLA 3BIXA 4MHTA 3RD5A 2GCOA 2RHOA 4KLRA 2JAXA 4MS3A 4BIMA 4E7PA 5BV8A 1G66A 3OJXA 1MU0A 2H1WA 2NVUA 4UJ3A 5B57C 1JEYA 3BA6A 5HDBB 5B1SA 4PLTA 2YN4A 1QANA 2HSJA 4ZOAA 1ULTA 3TTTA 1GP2A 1KPIA 2QM8A 1QIIA 1KGSA 1EK6A 1SRRA 2OY0A 4MR9B 4X3PA 3S2UA 1U9ZA 2JG3A 2BGLA 3CIOA 3C4VA 4K87A 1HG1A 5F73A 4AN0A 4ZCSA 2WQ7A 3IDQA 3SC2A 3EFOA 4ZVMA 3WRWA 3FRHA 3FCXA 5C8DA 2CXUA 3OZWA 1PJSA 1WG8A 4GGPA 1WNTA 1JHYA 3NT4A 3D5EA 1P45A 2CNWD 2JPDA 3VR5D 4EKYA 4HDMA 5B1IA 4RJJA 4Z2YA 1YQ9A 4KQXA 2HIAA 2P2ZA 3NOVA 3P45A 1XDBA 3W2FA 4H4EA 5JMOA 4DSAA 3CWZA 3GVCA 4RJKA 1ZMOA 3BD6A 4OI1A 5EUMA 2EATA 4AMGA 4MGZR 2GEKA 2HX1A 3FLMA 1TTPB 3FYUB 1HGXA 2WK1A 1UKAA 3L4KA 2QW1A 4BKOA 3OWXA 3AUXA 1JA1A 2QRNA 1NF9A 3GFRA 3H11A 2YC4C 4MYSA 1AURA 2B8WA 4F6RA 1TPYA 5A4JA 2B1RA 1H93A 4C06A 3OIFA 1ZN2A 2D8MA 1ANKA 4AKIA 2ADMA 5B37A 3NV7A 5KOJB 4GW3A 4QJBA 1HYQA 2X14A 4C3VA 2XW6A 3KQKA 3AERA 3OU6A 4NPHA 1S2GA 4EMSA 3KWJA 3WK7A 5DPMA 4DDUA 5HKKA 1JYFA 3OPVA 1NG9A 4KO1S 1Y7HA 2NV6A 3GOQA 5ED0A 5EQDA 5IX8A 1ZCBA 1E1DA 1HG0A 1QZXA 2FEOA 2O48X 2QIOA 2WTMA 4GLLA 5IVPA 2ZP1A 2XHZA 3MRXA 5IKXA 2GBPA 3FTNA 1Q57A 4Q3EA 4XM2A 4HH0A 3DL2A 1R0LA 2VI5A 4IDHA 4UVHA 1USKA 5T4EA 1TCBA 2CLOB 4TWAA 2BJWA 1G3QA 2ACVA 3CE6A 3ELBA 4R16A 2ZSUA 1DWOA 3CUSA 3NHYA 2FFAA 3QOFA 5G1OA 3X1KA 1C2TA 5EVCA 3QKWA 2QJOA 3G88A 1E8NA 1BH2A 2QKYA 3GCDA 3D0KA 3HNRA 4FQ5A 1QZ3A 2QN2A 1T4DA 1W88A 1ZR4A 1ONOA 4LXHA 4EQ6B 3VR5A 4Y6SA 1N2XA 5KO2A 3F5QA 2QZJA 1EIZA 1NJFA 4X6YA 4X84A 1T9GR 1NMYA 1QIKA 1SHLA 2FPPB 2QTTA 3AC0A 4G8DA 2DPHA 2LE0A 4LV8B 2QZSA 5IKEA 4H60A 4RF4A 1ID1A 3RIXA 4CMIA 1GZ6A 3L0CA 1D2CA 4FYXA 5BN5B 4YUAA 2H48A 5FL7A 2PWPA 2YWRA 2H4YA 1X1QA 1U2GC 4DCUA 3AR4A 3NOXA 4YJKA 1HKUA 2OHXA 4JC5A 3A2NA 3D6AA 3QSYA 1B14A 3OTOB 3BSYA 4IIBA 2HF7A 3FCEA 4KG7A 4P92A 2PBFA 3UT0A 1ZJWA 1JS1X 1TM2A 4LY6A 2WTEA 5JSQA 2ZRPA 2GTPA 1GFIA 4CR8A 4I5FA 5AVRA 2IC5A 2OGWA 3THYB 5IJAA 1GT6A 4N3AA 7MDHA 4EY8A 3S6JA 5ITZB 3P9IA 1J1IA 3KLMX 4CKEA 1ZOLA 4ZKDA 4GNKA 2BKUA 2A9OA 4E11A 4AY2A 4N5IX 3V8EA 5JYDA 1U0BB 1SHJA 4DADA 1DC5A 4YLEA 1VCHA 2QL7A 3FZNA 3AY3A 1PFWA 3WGYA 4BV2A 2XXAB 4NARA 1N1EA 4B4DA 4TYQA 5K3FB 5DM60 4ZZ3A 2F55A 3DMNA 1RYMA 2F3PA 4LV6A 1UPAA 4KFTA 1KFKB 4E5NA 4NAHA 2ZR7A 3BM5A 1YUNA 4DDMA 1RKUA 3AU9A 3I8XA 3MIIA 5CLHA 3GR6A 2I6SA 5GONF 3N28A 3M4JA 4E5VA 2Q4EA 5K0GA 4DMRA 1PW7A 4YX9A 3UCFA 2XR1A 4G1UC 4GVPA 4YH1A 3SAJA 1ODLA 2HPHA 2W2XA 4FMDB 3I28A 4W1SA 5IBCA 2VJCA 1V7ZA 3GO4A 2G06A 4E88A 3ESRA 2DWQA 4JUAA 5CT5A 1SQSA 4BB9A 4C0JA 4EPYA 4PG7A 2NZ2A 3ZWVA 1AGPA 2VCYA 3Q11A 3TLGA 2ZPAA 3IVXA 2DM6A 2DETA 3JWPA 3QLUC 1C9EA 4FJ0A 1YH3A 3X1JA 1C1DA 5KSOA 4EJ2A 2DRIA 1NVKA 5AP9A 5AJZA 5FJJA 3VKUA 4ZVPA 2G9ZA 3HDVA 4JZKA 2JAOA 3WNBA 5HQTA 1Q15A 3CUYA 2NZUG 3IUSA 1J49A 5FWNA 3L6BA 1U7TA 4I5GA 1CZKA 2VNIA 1RJGA 4I3GA 3ETDA 2XCRB 3TIFA 1F2UA 1EFVB 3HEBA 3LYUA 2CLFB 3NP7A 5KCMA 4C20A 3H9EO 3SEFA 2F00A 4BVAA 4E5UA 3ZU6A 2CLLB 1DZ3A 4C05A 3PCTA 4MUKA 1UBGA 2I54A 3WC4A 5ALVA 5IJXA 3VV3A 2ONKA 4H3KB 3X43A 2C7VA 4NXNB 5H80A 3S4YA 3T1VA 2OHVA 3KLPX 5E7QA 4CU5A 3VR0A 1UJBA 3WLAA 2VRCD 4KJZA 2Q3EA 2D1QA 3RSQA 2HRQA 3TUZC 2AMJA 1Q83A 4DR1B 3GN2A 1FJGB 1M0TA 2WSSD 3KKOA 3MJCA 3NPMA 1LBEA 1NKVA 4HWKA 1RVV1 1GZHB 3FROA 1U04A 3UJHA 3PT9A 2FGKA 2R0QC 1P31A 3NHUA 1J00A 1XN4A 1CUEA 1XNHA 3EARA 4JKOA 1YZQA 2REOA 1ZH4A 2VVTA 3ASYA 3IYLW 5AOCA 1BVRA 1Y1SA 3K6RA 4Z3DA 1MTZA 1Z08A 2VDQB 4N6GA 5DM4A 1BXRB 4RANA 5IVIA 3UXEA 2FQ1A 4OQPA 1WV1A 1I7QB 3IQFA 4R1LA 2V6JA 4X00A 4Y6RA 3OFKA 3ZGYA 4HGZA