4CR8A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase with nad
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKDGRSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
molecule tags Oxidoreductase
total genus 92
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr8A00
1YB5A 2I5PO 2HJSA 4NFHA 3GNSA 2R6JA 5FYDA 4Z6KA 4KQXA 1C1XA 3EZYA 4TRJA 3WWYA 2BGMA 4E4YA 1SEVA 4PGFA 1NM5A 3ZDFA 1F12A 3LF1A 1LQTA 5A5FA 1NP3A 5JDIA 4D45A 3OICA 4PG5A 4DLAA 5B4UA 4OKNA 1PGQA 3UW3A 3DQPA 1NXQA 2HRZA 3ZZNA 3UICA 4OOFA 1IE3A 2ZJ1A 3ZGYA 1AXGA 1YWGO 3JQ6A 4L4SA 1RM3A 2DTEA 4NPCA 3MEQA 5G0SA 1D4FA 1NVTA 3DOOA 4GLOA 3GUCA 4F45A 3BTVA 4CMGA 2GSDA 1C3VA 2BFAA 4PZDA 5DT9A 2Y1FA 2J3HA 5MGBA 1Q1NA 3H5NA 1YQGA 3MTJA 5TLSA 3E48A 3CUKA 4W9NC 3NKLA 1U5CA 4BNWA 1PJTA 4NK4A 2B37A 4HNHA 2RHCA 1I2ZA 1DRVA 3JD4A 3PQFA 2NLOA 4GWKA 4B8ZA 5J23A 4E2YA 3HADA 4BNIA 4WLNA 5EMHA 3RUFA 2FOIA 1E3IA 1LDMA 3AM5A 3QVXA 4A73A 1ENYA 1BG6A 4GX2A 1KC1A 3C8MA 3NEPX 4CM4A 1UXIA 4HFJA 1V35A 3MJVA 3QWIA 4ONEA 4UEKA 2Q2VA 3N74A 1NQAO 4YT5A 3JQCA 3OIFA 4ILKA 3LLVA 5COBA 5EERA 4CL8A 3EZLA 4WNIA 1GV1A 4BNTA 3VPFA 5GZ3A 1V6AA 1I3KA 5I9NA 1PU2A 2NWQA 1ISIA 4HV4A 2OBYA 1KS9A 5CAEA 3KUXA 2YYYA 2QZZA 2FR0A 3TOXA 5F1PA 3JSAA 4DREA 3M1LA 4AVYA 4Z0PA 1NQOA 4PLYA 4R3NA 1QR6A 3PIDA 4WOJA 5TS3A 1PWXA 2W4QA 4TRNA 4XRGA 2NU8A 4I9HA 2G17A 5U9CA 4J6FA 3VPGA 3EYWA 2ILTA 3GN2A 3FR8A 1N2SA 1PL7A 1LJ8A 4FPXA 1DLIA 3KVOA 4R4JA 4RPHA 1WVGA 2A4KA 2E48A 3H8VA 3TQHA 4YTEA 3E9QA 4L76A 4E2ZA 2HO5A 4G2NA 2VCYA 2J3KA 1W4ZA 5I7EA 1KY4A 2GN4A 3DOJA 2HU2A 3GPIA 1LU9A 3DMTA 1KIFA 3TL3A 3X2EA 3RI3A 3G79A 4GVLA 1UAGA 3O4RA 1I3MA 5T8KC 2E4AA 4CQMD 2B5WA 3S2EA 2D2IA 5KJFA 1RJWA 3NV9A 4ZQBA 3FBGA 5IZCC 2GD1O 3FWZA 3KM0A 4XGIA 1E3SA 1DFGA 2X22A 2YQ5A 3QWBA 4B3IA 2E49A 3G1UA 3OA0A 4JX8A 4OXYA 4B3JA 1Y9AA 2Z5LA 3ETEA 2PTGA 3H6KA 3C3XA 3HB5X 1EVIA 4GSLA 3JYPA 3H3JA 4KP7A 1NNUA 3MJSA 2RBEA 4MP8A 2UAGA 1C0IA 1HWYA 2EP5A 3WSVA 2Y05A 4IDDA 4L8VA 5HBRA 3K96A 1DBVO 5JY6A 1LLQA 4DA9A 2AXQA 4U7WA 2VOEA 4BIIA 4I5DA 3A14A 5IDQA 1H2HA 2Y1DA 2Q99A 3PFFA 4BB5A 2UUOA 1K89A 2GF2A 3BHMA 5IXSA 1WXDA 3B1FA 3K30A 1Q7GA 3ETGA 4IDCA 3AW9A 3VHRA 3VPXA 5IZ4A 2D4AA 5G4LA 4BGUA 1VPDA 1H2BA 2Y1OA 2W90A 4ZGWA 4KMSA 5KTKA 3FNEA 2EW2A 1T2FA 3NJ4A 3D5TA 4J1TA 2D1YA 1A9ZA 1N9GA 2PGDA 4AICA 4Z9XA 4MJLA 2DFDA 4NJMB 1QORA 3PYLA 5F5LA 1DDOA 3QVOA 4RPJA 4J0FA 1PGOA 2D5CA 4A0SA 1W6UA 3ITDA 1YJ8A 3DC2A 1E6EA 3O9ZA 2IZZA 2PY6A 4ZD6A 4OXNA 4EI2A 3PZBA 1BMDA 2I65A 4YT2A 1QRRA 1OC4A 3I9LA 1ZBQA 3QVSA 5K6AC 3ZN2A 4E5NA 3ZV4A 3I9JA 5HWSA 3KLMX 2Y0EA 1WWKA 3PGXA 1IHXA 4I5GA 4HADA 1PGPA 3DZBA 3FHLA 4YEDA 1U3TA 1J4AA 2GRAA 4J3FA 2YZ7A 4LMRA 4AJJA 1NR7A 1GADO 1LLUA 4BO0A 2AE1A 3COSA 4Q3DA 5DF1A 3NDIA 4YT4A 3I9NA 1PSDA 3ZNPA 3I6QA 1UDBA 1VKOA 2EGHA 2PR2A 3IC5A 4TSKA 2PWZA 3WXBA 1GUZA 4RVSA 3GAZA 1OOEA 2H6EA 5JSFA 4XEHA 1M66A 2BI7A 2Z1NA 4CV1A 1FDTA 2VNSA 3LC1O 1F8GA 2I3AA 2VHXA 2B83A 2WEKA 3D7LA 3ICPA 3GGGA 3KSDO 4EEXA 3E9MA 5BR7A 5F21A 2GR9A 3JQBC 4D7AA 4UREA 1DRWA 2EWMA 3HG7A 5DN9A 1E5QA 1GAEO 3F9IA 1FJHA 3H9GA 4LMPA 3C24A 3ROPA 3QY9A 4WLEA 2D3TA 3PYMA 1QKIA 5ITVA 1B2LA 3HB4X 2HMVA 5THQA 3Q9NA 2BF7A 4QX6A 1BDBA 2WTBA 3MOIA 4ALJA 1UH5A 3MJEA 1YXMA 1B15A 4YQYA 4OQZA 4BNZA 2VYNA 4ALKA 5CG2A 4YJFB 4CLEA 3GFBA 1ZK3A 4CMIB 3BHIA 2UV8A 4TVBA 1GQ2A 3KHUA 4YQZA 3RC2A 3PXXA 2XAAA 1P1IA 3GEMA 5FEUA 1I3NA 1PS8A 1BRMA 4IZIA 5JC8A 1P3DA 2P9EA 3F46A 5LDGA 5ICSA 3DAFA 4DQVA 4PLTA 1Y9EA 5THKA 3WFJA 4CM9A 1NQ5A 2X0NA 3ZWVA 1KEWA 4I8XA 1LDEA 1Q7CA 4ZHSA 3I4CA 3ZWNA 3SX2A 1H93A 2O3QA 1ENOA 2H63A 4BS9A 2EHDA 1X1TA 3Q3CA 1DAPA 1KVRA 4RORA 4RGBA 2IXAA 1OBFO 3K2BA 2UUPA 1J5PA 2Y0CA 2R00A 5G0VA 3ZU2A 1SNYA 1XR3A 3B20A 3BTOA 4YJFA 4Z0HO 3O03A 3DEYX 3H9JA 1SOWA 1GPJA 1ISHA 4R16A 3VTZA 2PD3A 3FSRA 3UAGA 1WZEA 1CETA 5I8ZA 3ZWXA 1BDMA 2Q1TA 5KJ1A 3DOCA 2HMTA 1QV7A 3GY0A 2P68A 3UCFA 2EKPA 3K31A 3RD5A 5K9ZA 1RPNA 4CLRA 4XB2A 4PLGA 1V3VA 4R3WA 1UDAA 1HLDA 4B4WA 1E7QA 3F5SA 3FNGA 3QVTA 4A03A 4PG8A 1KEPA 2O2SA 3KO8A 1MP0A 3I5MA 5JDCC 4J49A 1ISGA 3DDNA 2G5CA 4IJUA 5A3VA 5L7TA 3MCVA 5KVSA 4PFJA 5G0UA 3H5AA 1CDOA 2EXXA 5CP8A 5L4SA 1H9AA 2O3UA 2HMSA 2X7HA 3PEFA 4IS2A 1SO8A 3BMOB 1GZ4A 3JQ9A 3L6DA 5G0TA 3DL2A 1JA9A 3OBBA 5AXCA 4IQ0A 4EJ0A 5CDUA 3DBLB 2BMAA 5F5NA 2O4UX 2WJPA 2X9GA 3BMQA 3GA0A 3CZMA 4JNKA 3WJ7A 4TWRA 2C5EA 1NX6A 4F6CA 4BMNA 5DP2A 3EHEA 5ER9A 1WDLA 2O3RA 4NBUA 4TRMA 1TT7A 5KVCA 3I83A 1NWCA 1T25A 1YGYA 3W4KA 2JJYA 6LDHA 1HDOA 1DRUA 1R6DA 4MVJE 1X7GA 4BQRA 4FFMA 3GGPA 3V2HA 3HN7A 4J4HA 1UDCA 1RM5A 5FF9A 1EK6A 5T67A 2JCXA 1RKXA 1KEUA 3Q2KA 3K8ZA 3RCBA 3KRTA 1K6XA 5CEEA 4GQAA 3WSWA 4BO1A 2VZ9A 1H5QA 1A4UA 2YFHA 3B1JA 4GAEA 4IGEA 4AJNA 1TVEA 2C59A 4RZHA 4KWHA 3WGHA 1JQBA 1DC4A 3WMXA 1UXKA 4CR6A 2OFPA 1MB4A 3TZ6A 2PD4A 1RYDA 2Q50A 1MV8A 2BGLA 1MC5A 3CPSA 1E1KA 2AEJA 1I8TA 3JQ7B 1E7SA 3WR5A 1C1DB 4XQEA 1LI4A 1P1JA 1HEUA 4UAGA 4KTVE 4NI5A 1K6JA 2IODA 1EBUA 1F0YA 1DHTA 3GH3A 2IXBA 4O0LA 3C7AA 3OM9A 1QYVA 5BNTA 4CMBA 3PPIA 4A7PA 2X58A 2ZYGA 3GMSA 1A5ZA 4OL9A 5IDYA 2VNAA 5ILGA 4CM3A 1GV0A 4YACA 4PZEA 3TWOA 1L7DA 2XXJA 2WE7A 4YAIA 1HE2A 3RU9A 3RU7A 3BTUA 4CM6A 1BW9B 1D8AA 3E9NA 5JYEA 1TLTA 4WECA 1PIWA 2ZB4A 4B8WA 1ENPA 2QYSA 4QECA 1ZVMA 4E2WA 1GQYA 3AOEC 3UCXA 4FFLA 3C85A 2JAPA 3JQ8B 4DIFA 1VSUA 4OMUA 4WLFA 4R54A 5L53A 2AA3A 4LSWA 3E03A 3JQFC 2VWHA 2CUKA 2C20A 3UF0A 1CQJA 4AJ2A 3D4PA 3RJ9A 1EE9A 1ID1A 4M86A 4D43A 1O8CA 2VWPA 3PJGA 3LLSA 4JROA 1ZO8A 2PKQP 1XIVA 2W8ZA 3GVXA 1DB3A 2Y93A 5I9MA 1R16A 1BW9A 2CDAA 3RFTA 4OSOA 2VHYA 2H5LA 4IJVA 5KVQA 4WKGA 1UZNA 1B14A 2W2LD 2NTJA 4Y6RA 3ONDA 3SJUA 3VDQA 2AG5A 4EUFA 1DFIA 1T1RA 4W9NA 4NJOA 3HDJA 4CMAA 4R5MA 1R0LA 1E3EA 1IZ9A 2VRBA 5JO9A 1M6HA 4WPGA 2HRBA 2EJVA 1EVYA 4ITUA 2EJWA 4FJ2A 4CQMB 4D79A 3AY6A 1QYCA 4HP8A 4NDNE 3KBOA 4GPD1 4D41A 3D1LA 2GCGA 5F3RA 3WMWA 1LUAA 3H9UA 5IN5A 3U4DA 5ITWA 1NHWA 3WWZA 2ZIZA 1E3JA 3HWRA 4LW8A 1HZZA 5DBIA 2FP4A 1X0VA 4GX0A 1EFLA 2YHIB 1U9JA 4W4TA 1DIBA 2Y1CA 4B4UA 1OMOA 5G4KB 1ZW1A 3IUSA 1I2CA 1KBZA 1U8FO 1XKQA 1PJLA 3GDFA 2HAEA 4R5HA 3TOZA 3BHJA 4NMHA 1P1FA 4IM7A 1MG5A 2OP1A 4OGWA 4XYLA 4L9RA 3O38A 3PFWO 4M87A 5JMPA 3SVTA 5KKAA 3G17A 2ZB8A 3QJ5A 3CTMA 5G2OA 4A26A 1GEGA 4LGVA 1Z74A 4QQRA 2QZ9A 3OETA 3RUEA 2QW8A 5IXYA 3ROQA 1MXHA 2AQKA 3HJAA 1A7AA 1LC0A 2A9FA 3BMCB 3PJEA 1DC6A 3E6AA 4XDZA 4Y8VA 4A2CA 1ZZEA 1PL8A 2DUWA 2WDZA 2V6GA 3NT5A 5TSDA 3RKRA 4JBIA 3TPCA 4HX5A 4XZ3A 4MVJI 2DPHA 1U4OA 2NVWA 3KLPX 4YJGB 4BO5A 1QSGA 1YQDA 5C7LO 3UH1A 1QG6A 3TJRA 3VH4A 1CIVA 3JQAD 2TMGA 3PHHA 2NVUB 1NYTA 1ISJA 3ROKA 1LSUA 4WLOA 1I33A 4DPMA 1LBEA 1TXGA 3DBHA 2EW8A 2YQ4A 1N1EA 5ES3A 3WNVA 1NFFA 3EY4A 5T8KA 2DPGA 1E3LA 2OP0A 3Q6IA 5C7IO 3AJRA 4XGKA 2DTDA 2D59A 3TFQA 3A4VA 1ZK4A 4HFMA 3I6IA 4KUEA 4NBRA 5IZCA 1KVSA 1U4SA 5GZ6A 1B16A 5BT9A 3BMCA 5DCWA 2VTEA 4QXMA 4E0BA 4NH4A 2C54A 1PJCA 2FR8A 1E1NA 4M54A 3LC2O 3B1KA 3AU9A 1LDGA 2VRCA 1BVUA 4IGFA 4U8GA 2ZK7A 1Z75A 1UZLA 2WM3A 3LU1A 4GL4A 4IIUA 3WGTA 1DPGA 4RO0A 1SMKA 2IE0A 3JV7A 3ZI0A 4DXHA 4Q9NA 1SC6A 1FDUA 3QLJA 5JE8A 2VYVD 3RBVA 4PLZA 3PQDA 1PS0A 3QW2A 1I0ZA 2BFOA 3NGXA 3EK2A 1PJ3A 2YFQA 3OF2A 1RM0A 5F1KA 4ZU3A 3CMMA 1YO6A 2B69A 2JHGA 1NFRA 4TQGA 4L4RA 1GUFA 1WZIA 1EQUA 2DAPA 5JCJD 4C7KA 2Y66A 5CG1A 2VT2A 1GTMA 5JS6A 3MWDB 2BELA 3AM3A 5LDHA 4EDFA 5HM8A 1IHYA 2FPGA 4EZBA 1GU7A 3ASVA 3OEYA 1AGNA 1U3VA 5GY7A 2C07A 4DQXA 3D5QA 1X15A 4U6SA 4Q3NA 1NPDA 3S1LA 4XR9A 1E0DA 3HHPA 3RUAA 3DO5A 1SOVA 1HF3A 3JQDA 2P5YA 4UVGA 3C1TA 3C7CB 1HL3A 2EF1A 3HQ4O 4LSMA 5TGDA 1KY5A 1T2CA 4J16A 4MVJF 4PLWA 1C0KA 5A04A 1JWBB 4TMFA 1U1IA 1E5LA 2JAHA 1OFGA 1WDMA 2RIRA 1W8DA 3QWAA 1B7GO 1VRWA 3QP9A 3CZRA 4RDIA 3VZRA 4ZA2A 4D42A 4A10A 2FSVA 5L7WA 5K6AA 3KYBA 1VJTA 2J5RA 4DRYA 1N1GA 4PVDA 3ANLA 2Q45A 4D3FA 1F8FA 2F00A 2OZPA 4TKMA 4AJOA 3WGOA 1HDYA 1PR3A 1R4NB 4FC6A 1EVZA 5KKCA 3Q0EA 1X13A 1V0JA 3S8MA 3VKVA 4DGSA 1ZFNA 3G0OA 3W4IA 1Z82A 5C5IA 4B3HA 1HSZA 4QEDA 1ZSYA 5U1PA 5IDXA 2DBRA 4XYBA 3GVCA 4MVJA 4BO3A 1YQXA 4OIMA 5DBFA 1SCUA 4KDFA 5JMWA 4L0QA 3S2FA 3A1NA 3ZNQA 1G6KA 5JO0A 1ADBA 3VZSA 4F46A 2CF6A 1UR5A 4ZRMA 3W6ZA 1DAOA 4CLOB 3NJ8A 2Z1MA 1R4NA 3DONA 3TF5A 2A35A 1CWUA 2PKRA 4J9VA 5TT0A 3JQBA 4IXTA 1R15A 1P0FA 3VC7A 2B0JA 4AJKA 2VWGA 1T2AA 2O7QA 4J7UA 1KVQA 3OMLA 1W73A 4LRSB 3M2TA 4FIZA 5TF4A 3PK0A 4CM7A 2IZ0A 1TI7A 3JQGB 3R0IA 3F4BA 5EESA 4KDEA 3PTZA 5KWEA 3H3FA 3N7UA 4R68A 5DCUA 1JLLA 3NRCA 3VVBA 1QYXA 1XG5A 4CMHA 3FF4A 2BGKA 4YAJA 4E33A 3L07A 1LLCA 4L74A 3W8FA 3ZWPA 1EUCA 1A9YA 1X7HA 2P91A 4D0RA 2EKLA 1WMAA 1EVJA 4JCOA 4DBVO 1NQTA 2X5OA 4J2HA 1ZK2A 3H2SA 4EW6A 1BTOA 1ENZA 4ZQFA 4YJDA 1T1SA 1ZEJA 3TZKA 3NTRA 3UKOA 2JKVA 1DIRA 3EW7A 3ROMA 2GLXA 4P8RA 1DHRA 3H4VA 4FJ1A 4GX1A 1GCUA 2I6TA 1NBOA 3F3SA 4O6VA 3KTDA 5EQFA 1GEEA 4O63O 3IS3A 2HCTA 3GOHA 3WTBA 2IDZA 2Q2WA 5EPOA 1FDVA 5BSGA 3CIFA 3R6DA 5HS6A 3OQ6A 2WYWA 4DPKA 3AM4A 2ZATA 1PQWA 2VUTA 1AUPA 2X9VA 4BV8A 5DDIP 4JXKA 1ZSNA 1UJMA 2GN9A 1U8XX 3PZRA 1Y81A 4AJHA 2HDHA 2WE8A 4MVJH 3LDHA 3RBXA 1HSOA 2VN8A 1UP4A 1CJCA 2GZ2A 3OEWA 4CM1A 1JW9B 4XQ9A 5BSFA 1I10A 1JDJA 1HDZA 2P2SA 3JYQA 4BMSA 5JDCA 3HDHA 1PGNA 2V6BA 1OC2A 3EUWA 3FR7A 3LQFA 4NFYA 3ZH2A 3ZV6A 3KEOA 3E18A 1M2WA 1MC4A 3E1KA 4XYGA 3GZNB 3TSCA 3HDYA 4O59O 4P4GA 2IRWA 3K2EA 4YPOA 4CM5A 4XQCA 1PZEA 4PLVA 3RUIA 4BKUA 3NTOA 5HA5A 3BMNB 2BRUA 6ADHA 3LT1A 1BXZA 2PA3A 4GVXA 4NG5A 1R0SA 2PZJA 2NUAA 3EDMA 1U28A 5AXAA 2FPPA 4FFRA 2VWQA 3C1AA 4BNJA 2Z95A 3EVNA 4D3DA 4QO8A 5IAAA 4J1QA 2GGSA 2GZ1A 4FS3A 4E5KA 3F47A 3QV1A 2VRCD 1ZEMA 2YV2A 2TMDA 2FWMX 1VL6A 4RVFA 4HNGA 3L4SO 2PGLA 2O7SA 4D0SA 3LZ6A 5KVVA 1IUKA 3M1AA 4C4OA 3MJ4A 1E7WA 3SLGA 1VLLA 1ZXLA 2C0CA 4RVHA 4YWJA 1H94A 4IJWA 3ZHBA 4BNYA 4HKTA 3CEAA 3VVCA 1MFZA 2DQ4A 2JFFA 4NJMA 4GX5A 1E77A 1IYZA 4HY3A 1KVUA 2WWRA 3KOUA 3PWZA 4MVJM 3VOSA 1JKFA 4N18A 3GMDA 5GZ1A 3F4LA 3HDQA 2J5KA 1XU9A 1EEHA 4PLPA 3CE6A 4PN3A 1YB1A 2BFPA 3GF4A 1DEHA 5B37A 3IIEA 1Y8QB 2Q46A 5A9TA 4YA6A 2JFGA 1O5IA 1GQQA 1LA2A 2V6FA 1NVMB 3GVIA 2D5AA 3DXFA 4GI2A 4CUJA 2UYYA 5AOVA 2FZEA 4YB8A 4PG6A 7ADHA 3NGLA 3LSYA 1BXKA 1WLYA 4U0KA 4IDFA 2Q2QA 1SEPA 4Y6SA 4FJ0A 2YDXA 1ADCA 1Q7BA 4MKXA 4EJMA 4QT0A 3FPLA 3WG9A 1XLTA 3QRWA 4AG3A 4QSMA 1QLJA 3RIHA 5DP1A 4XB1A 4PLFA 4J1SA 3SJ7A 5DOZA 3ZWWA 4DL9A 5C37A 4OH1A 1H6DA 4ZRNA 1P0CA 4E13A 1P74A 5T5QA 4G65A 1XYGA 5DZSA 3W6UA 3PGJA 1HE3A 3AWDA 3T7EA 2J6IA 3NX4A 3SEFA 2HQ1A 2ZJ0A 1B26A 1I3LA 1ORRA 1GYQA 5T64A 4IQ8A 4FB5A 2XXBA 4OKIA 4PRKA 1X7DA 1I5RA 2OGUA 1H0KA 4CV0A 2Q4BA 1P1KA 3ZHYA 3JQFA 5IJZA 3E5MA 4BMVA 1PX0A 3JTMA 4XJSA 1G0NA 3N58A 1U5AA 4J4TA 4CM8B 4ID9A 4IXWA 1U7HA 1J49A 4ZICA 4CUKA 1VJ0A 4WCFC 5B12A 4BKOA 1R4MB 4NQZA 2QX7A 4XQGA 4CMIA 3WTCA 3T7CA 3RFVA 3A28A 2DVMA 4OOEA 5LC1A 1GZ6A 5BSHA 2CZCA 3CINA 1WDKA 4H15A 3I9OA 5L45A 4ND4A 4R1NA 4O1MA 4Q3BA 2WD7B 4YJHB 4ND3A 3D3WB 3OFSA 1DC5A 4BO4A 2C29D 4OQYA 4ZQEA 2PFGA 2X5JO 5JFOA 1UXJA 2DKNA 1ZJYA 3OA2A 4U0JA 2VUSA 1VC2A 3AOGA 3UCEA 2ZTVA 1MFPA 4BNNA 2QIOA 4N5NA 2JD2A 3ZV3A 4IDGA 4FGSA 5BNFA 3DHYA 3GUYA 3HNPA 1A4IA 4KUGA 4LVCA 1YL5A 3NT4A 1R4MA 4P4NA 4DC0A 5JYDA 2EG9A 3PI7A 4MP3A 3TN7A 4JIGA 1K0UA 4W82A 1ONOA 4J0EA 4NBVA 4GMFA 4K9DA 1RWBA 3P2OA 5DCYA 4QUKA 3M6IA 5CDYA 2O2YA 4YT8A 3RROA 4E6PA 2WD7A 2YHUA 2J5QA 2Q3EA 2I66A 3DHNA 3L9XA 4ND1A 5AXBA 4E31A 5IFLA 1BWSA 1I30A 5KJ6A 5CDTA 4BUCA 4F3YA 4TZTA 3KYCB 3INRA 3PDUA 3TZCA 4BVAA 4UUPA 2DUUA 3UFXA 4NU5A 4WE3A 3TRIA 5TIIA 4RL6A 1IOLA 1ONNA 3OJFA 3GK3A 5COQA 1UAYA 1LLDA 4INAA 3OHSX 3ZU5A 4AJ4A 3PYXA 2QYTA 2WD8A 2YUTA 3ABIA 4MINA 2QRJA 1LDBA 4BGEA 3BMOA 1L1FA 1NAIA 1FF9A 1GR0A 4PRLA 1TB4A 1PQPA 3QIVA 3IMFA 3SBOA 3DBLA 2NQTA 4CPDA 3ZU3A 3KYCA 2EEZA 1BSVA 5L95A 2POQX 3NYWA 1XU7A 4M8SA 2X1HA 1VI2A 5L4NA 3INGA 5A4DA 3PHJA 3PDJA 3WNQA 3BYZA 3U4IA 4BB6A 3AFNA 4MKRA 4GBJA 3PRJA 1QMGA 1SPXA 3DMYA 4FCCA 2UDPA 4YXFA 1B8UA 1AN9A 1QV6A 3K92A 4C7JA 4YBZA 2O50A 3IJRA 1K2WA 3BIOA 1UXHA 4WASA 3ENNA 3GEGA 4ZQHA 3GDGA 5A5EA 2C7GA 1DOHA 2VQ3A 2P9GA 3WS7A 1LNQA 3ASUA 3ON5A 2GUGA 1B3BA 4YAEA 1N7GA 5TNXA 1ULSA 2EERA 3HFGA 3DTTA 4IMPA 1E6WA 4J2OA 5GMOA 5I8WA 2B35A 5KJCA 3EGOA 4PG4A 3I52A 2Q1UA 5ENDA 3ZWBA 1UP7A 1IPEA 3ULKA 1VJ1A 1EUZA 3FTPA 1FMCA 1HDGO 2DU8A 4FOOA 4PZCA 2PH5A 1GDHA 4FC7A 1V3TA 4J4BA 4AJLA 1LC3A 2JD0A 2Y68A 5EINA 3R1IA 5TJ9A 2CY0A 3JQ7A 4O5OA 3ZNNA 1EMDA 2ZCVA 5CPFA 1C1DA 3LK7A 1E1LA 3Q9UA 3ZV5A 4BKQA 2B5VA 4XJTA 1NPTO 3E5RA 1LQUA 2Y67A 3IJPA 4QO7A 1Z7BA 1ADFA 4XD2A 4CMCA 4YAGA 3ENKA 4CMJA 4IDBA 2NSDA 3TL2A 1JTVA 5G0WA 3UHAA 3X2FA 1X0XA 1NHGA 4GKBA 1ML3A 3ST7A 2X23A 3VKUA 1PJ2A 3IAHA 4WUVA 1JAYA 2F1KA 1MX3A 1N92A 3UUWA 2FR1A 1C0LA 2CNBA 4BNVA 2E82A 4NU6A 4KOAA 4II2A 5JNLA 4JBGA 2IEBA 3JQ8A 2DM6A 5KOIA 1ZNQO 5A9RA 2B4RO 3QE3A 3BAZA 3PLNA 1KEVA 5HS4A 3HFSA 1JVBA 4J90A 4IY1A 5CDGA 3NDRA 5ICMA 1QYWA 2R00C 4EGFA 5K0ZA 1JAXA 1YONA 1K3TA 1LRKA 1LX6A 2LDXA 4Z0TA 4PLHA 3GAFA 3ZNOA 3O26A 2P9CA 4NIMA 3STHA 1AXEA 2D0IA 2NTNA 3A9WA 4RLSA 4Y6PA 3WYCA 1F06A 2VYND 5MDHA 1GL3A 3LF2A 3RJ5A 3C1OA 2CFCA 2O3SA 3Q11A 4Z9YA 1EDOA 4R1UA 4TKLA 1HDRA 4DQUA 2GDZA 4XIJA 3ZHZA 2HK7A 4W6ZA 4DWVA 3V1YA 3GQVA 1LXCA 2XOXA 1UP6A 3GLQA 3B70A 4FFNA 3PHGA 4L75A 3WYEA 4YR9A 4CM9D 4CQMA 4MDHA 2PZKA 4ND2A 2DBZA 2O3TA 1Q0QA 2E37A 4RZIA 1ZK0A 3H2ZA 5F1OA 3FD8A 3WQSB 3GVHA 5L4LA 2YJZA 3QVWA 5ADHA 3WJAA 2FN7A 4GMGA 1D1TA 3ADPA 4EYEA 1Y7TA 3PHLA 5C3MA 4XCVA 2I9PA 3PJDA 2CMDA 1HYEA 2YHIA 5A9SB 4KUHA 4UVHA 3UXYA 3Q2IA 3LT4A 1NR1A 5G4KA 3JYNA 2X8LA 4XX0A 2X5KO 3GT0A 3V2UA 4EITA 2QHXA 1DO8A 2VUUA 3G3EA 3IL2A 4URFA 4BNXA 4OAQA 4E30A 3BTSA 1JWAB 5CPBA 1CRWG 5H83A 3KXDA 4RCVA 2V65A 3P19A 5ILOA 3VZPA 3OIGA 2EKQA 4BNUA 1TEHA 5I7SA 1YDWA 1BGVA 1P44A 3GHHA 2ZB3A 4CLDA 2C5AA 4JJIA 1YL7A 1EFKA 2JFHA 1M67A 2X0JA 1HXHA 5A9SA 5C7OO 1R37A 2LDBA 4DPLA 2AHRA 3G49A 2IYOA 4R01A 1YBAA 2OO5A 2X9NA 4R69A 4FFOA 2G76A 1P9LA 1KYQA 2GZ3A 4YJGA 5L7YA 1IULA 2P4QA 1MA0A 1LSSA 2NVUA 4R1SA 2DLDA 1EUDA 5IG2A 1XHLA 2CDBA 1P31A 3FTNA 1XQ1A 1DC3A 3CSDA 3LT0A 4UVIA 4ALMA 5JAQA 5A3JA 4W99A 4XIYA 1YB4A 5I9LA 2OMEA 3I4FA 4DYVA 2P4HX 2ZB7A 4QFCA 3ZWMA 1VSVA 1GCOA 2RHRA 1C1XB 4WJZA 1D7OA 1KC3A 2Y1EA 4MOWA 4CMEC 4E3ZA 3MJCA 4U6QA 3LYLA 1PR9A 1WW8A 2E6UX 2J3IA 3WLFA 4ALIA 2EIHA 3JYOA 3GGOA 4H3VA 1H6BA 4XGNA 2PKQO 5A02A 2DBQA 4U5QA 1ONPA 4XA8A 3WLEA 4OM8A 4WLVA 4TVOA 1F14A 4WEQA 5EQDA 2V6MA 1R66A 2AW5A 5EN4A 2WYVA 4XYEA 5I7VA 3IDSA 4IPTA 2HLPA 2VOJA 4IBOA 4UVDA 5IDWA 3MOGA 4CQLB 2I99A 2DBVO 3FNHA 4UUNA 5JAZA 1Q0LA 3FRJA 3FCOA 5CEFA 1B8PA 4FOSA 3U49A 3NUGA 2C7VA 2WYUA 1IY8A 4JK3A 1M75A 1LEHA 3QQPA 4NHEA 4MIOA 3RUDA 1JKJA 3CH6A 3JQEA 5BQFA 4YAKA 3OQBA 2WSBA 3NT2A 1O89A 3AY7A 1DJNA 4PG7A 4LVUA 2G82A 1LSJA 4R9SA 3GRKA 3AY3A 1GUYA 4PVCA 5TQVA 1ZH8A 3GC6A 4JQCA 4FQ8A 1FXSA 3W1VA 2C2YA 4AL4A 4CQLA 5B4VA 1ZCJA 3PQEA 4NBWA 3WYBA 3SXPA 4CM4B 3L77A 3WGYA 4B4VA 2OORA 3WX0A 2FZWA 3JD1A 1EE2A 5EJ2A 3S2GA 1X1EA 2GN8A 3SC4A 2ZTUA 2HMWA 1U3WA 5JLAA 5TRTA 4LCEA 2O48X 2V7PA 4X54A 3DZIA 4M55A 9LDTA 1XQ6A 3OP4A 2JCYA 3ZHXA 9LDBA 1GYRA 4GGOA 1F17A 4DTIA 2VHZA 4D46A 2XF8A 1VL0A 5BSEA 3VH3A 4B7XA 3L4BC 2ET6A 1NVGA 1KERA 3V5NA 2PH3A 3JD0A 2Q1WA 2RAFA 1AHHA 3UN1A 4N7RA 1A71A 5JCXA 4LISA 3GG2A 4XDYA 4WCFB 2RH4A 1M6WA 2PGJA 3W8EA 4CLHA 3DZJA 4CLOA 4ROSA 2AEFA 1A7KA 4J1NA 1DJQA 4B7UA 2YY7A 5FWNA 2EV9A 3R3SA 4IZHA 1HT0A 3DHEA 5JC1A 1VM6A 4W7HA 1ZXBA 3ONFA 1T26A 4JN6B 1T2DA 3D64A 5BNIA 2G0TA 4W7IA 2AE2A 5JAMA 3OIDA 3JQGA 4R1TA 2NU9A 3P5SA 2JL1A 4NK5A 1P45A 4Q3CA 2NU7A 4ND5A 2ZTLA 5A05A 1OAAA 3VPSA 1V9LA 1S7CA 4WCFA 4WK6A 3ZU4A 5LCXA 3IKVA 1FDWA 4KZPA 4EJ6A 4R41A 1PZGA 3F6YA 4TRRA 2FHSA 4AJ1A 1FK8A 4BKPA 1Y6JA 1I01A 2GNAA 4OO3A 3F5QA 2X0RA 1O95A 4IDAA 4EBFA 4ALLA 1XGKA 1I24A 1B8VA 4D44A 4BGIA 4IS3A 1H6CA 2WMDA 1LRJA 4HWKA 2CVZA 1EK5A 4UEOA 1GD1O 4H7PA 2I3GA 4IMRA 1YL6A 1ZMTA 3QWFA 5DULA 5A1TA 1C14A 3QSGA 3K9QO 4ZQGA 3VAZA 4E5PA 3EMKA 3VH2A 5KNLA 3SLKA 2GO1A 4Q3EA 1VE9A 3OSUA 3TDKA 4RF2A 3FN4A 2AEMA 4I9UA 2BH9A 2VTDA 5DOVA 3HZZA 4BNGA 3GN1A 5HTOA 4RDHA 1XEAA 1N9GB 4F6LA 4Z3KA 2HSDA 3DZFA 1DSSG 4G81A 1O0SA 1HDCA 2W98A 3IP1A 3DBRB 3GEDA 2HUNA 4BHTA 4K1LA 4YDRA 4AJIA 4BV9A 1DFHA 4RVDA 1KETA 2ZKLA 1NFQA 1O94A 3UGKA 3F1LA 4OJNA 5AVOA 5A06A 1V8BA 1HYGA 1AHIA 1D1SA 2O4CA 1J6UA 2AQIA 2BLLA 5KCZA 1BHSA 1OZAA 4WCDA 5JDIC 1I36A 2EGGA 2HK8A 3GNQA 4RQTA 3PIIA 4Q3AA 4B79A 4DBZA 5CEJA 2UVDA 2RH8A 4DIOA 2BHLA 1GYPA 1ULUA 5I7FA 3D4NA 2YV3A 3WICA 3ANNA 4XWYA 3UVEA 3U4HA 4FR5A 2C2XA 1S6YA 3GZNA 3DBRA 4FSHA 4XYMA 3ICCA 3OECA 4GSKA 2A92A 4I08A 4FGWA 3RSHA 4S1VA 3BMNA 2GPTA 3AI2A 1YVEI 2OHXA 2HMUA 1AE1A 2OL4A 2X4GA 4OSPA 1J0XO 4HXYA 4WNCA 3WDSA 1XSEA 5B4TA 1U2GA 2FRDA 3H9QA 1EZ4A 3CKYA 3PHIA 3R3JA 1Y5MA 3U4CA 1ISMA 2NNLD 3ZWCA 4XR4A 1SAYA 2OUIA 1U2DA 3NAQA 4CR7A 1Q0HA 2VT3A 3HUDA 1ZKMA 2FSSA 3BA1A 3AK4A 4IQGA 1CERA 4BO8A 3IOYA 1QXSA 1U7TA 4NZ9A 1MXFA 1PTJA 1FDSA 4MVJG 4BKRA 3RKUA 3U62A 3I1JA 1JKIA 1M76A 1LSOA 3EVTA 4DVJA 2Q49A 4BO6A 2H1SA 4LK3A 1GPDG 4MIYA 4BQPA 2ZTMA 2B4QA 3U3XA 4I5EA 3VDRA 2VZ0A 4WOKA 4BGVA 3AFMA 4BNLA 3GNTA 4CL3A 1UXGA 3I9KA 2PZLA 3PVZA 3L9WA 4Y9DA 4OHUA 1Y8QA 1YBVA 3AUUA 4E5YA 2HKIA 1Z45A 2W2LA 5COAA 3KZVA 2O3JA 5A03A 4L4XA 3I9MA 2CDCA 4WGGA 4G5HA 3RC7A 4YCAA 4IINA 3OJ0A 1MUUA 1VKNA 3PJFA 4JLWA 4LCJA 4Y67A 5TJHA 1I32A 2P5UA 1Y5RA 4Y98A 2DFVA 3AOEA 3F1KA 1LDNA 3VH1A 1ZSVA 3DWFA 1HYHA 3RBZA 3VPHA 3KV3O 4I9NA 1DIHA 2J8ZA 3WFIA 2Y99A 1HTBA 3RC9A 2Q1SA 2HK9A 3DR3A 1T24A 3E82A 5AYVA 3DFUA 1E7MA 4R51A 4UEJA 2Q4EA 1XA0A 4JP3A 2VHWA 4BO7A 2VZ8A 3RASA 1SZJG 4MVJD 3ADOA 4E21A 1XWFA 5FI5A 1I2BA 2NTVA 1WP4A 1PQUA 3JYLA 2IEDA 4YRAA 1RM4A 1DIGA 1PJBA 4KWIA 3WQRA 3DMTC 3WIEA 3WGIA 1PGJA 4CR8A 3AUAA 4MPDA 5KIAA 5IF3A 1U3UA 3S2IA 5JAIA 1YS4A 3JQAB 2PD6A 3H7AA 4NR0A 4QTZA 4YRBA 4CLRB 1X14A 4RF3A 1GFSA 3RWBA 4CM8A 4BOYA 2VHVA 3ANMA 4WEOA 2DT5A 3TZQA 1OI7A 2QQ5A 3ZW8A 2NACA 5L40A 4RVGA 4ZJUA 3ZWYA 1ZK1A 4J7CA 3WBBA 2GERA 4JP2A 5U4QA 3U9LA 2JHFA 3ETDA 4IDEA 1PS9A 3JCZA 2R2GA 4FW8A 1VL8A 2ZQYA 2JCVA 3GR6A 3GZ4A 1YOVB 4BNHA 4I1IA 3U09A 1L7EA 3H5RA 2I67A 1YJQA 3OJLA 1ZMOA 1E7RA 1W0CA 1XELA 3JQAA 4ZVVA 1HKUA 1O6ZA 4NNJA 4GLLA 4YJHA 3D3WA 1T4BA 5T57A 4MO2A 3BMQB 3LC7O 3G1TA 1HE4A 3UOGA 2O23A 4RF4A 1DXYA 3O8QB 4QFDA 5EL0A 5HRUA 3FWNA 1PZHA 2ZYDA 1BXGB 2FMUA 1Y1PA 3GFGA 5TX7A 3PWSA 3ZWAA 4K28A 4PIVA 4BO2A 4P22A 5JY1A 1ZIDA 2EP7A 2QRLA 1PL6A 5L3ZA 1E6UA 2J3JA 3INTA 4AJEA 4DYDA 5CFZA 1YOVA 5ER6A 2CSUA 4XRRA 3OH8A 3L6OO 4BO9A 3CXRA 3PP8A 4RLHA 2VYVA 2Y0DA 1H9BA 1G0OA 5B1YA 3GRPA 2OXIA 5KJEA 2BI8A 4Z9FA 3RFXA 2NV6A 2SCUA 4FFPA 1ZJZA 3DFZA 5T6BA 1EBFA 3O8QA 1TA4A 1T2EA 3A06A 2B4TO 3OQ1A 4MKZA 3DTYA 1BXGA 4CJXA 1H6AA 1NAHA 2CD9A 5JCJA 3ZCXA 1WNTA 3FBTA 1LDYA 2PK3A 2DC1A 1NWHA 3V1UA 3V8BA 3C7DB 5JXWA 5JW6A 2ZQZA 4EEZA 4E12A 1O9BA 4B4OA 3IKTA 4YYZA 1DIAA 4MVJP 4Q39A 1E1MA 3D0OA 3ONEA 4CV2A 4CODB 4K6CA 4RJTA 2JD1A 1N7HA 3L6EA 3AUTA 5JPIA 2W2KB 4OYRA 1NTOA 1B3RA 4MIEA 1YDEA 1ADGA 4N5MA 1PJSA 3I3OA 2PV7A 1PEDA 1R12A 4DIBA 4GGPA 3D3EA 3W8DA 3MJTA 1K6IA 3PLRA 4LN1A 3TFOA 2AQHA 3T4XA 1K5HA 1MGOA 2QRKA 1MG0A 1Y8RB 2FPIA 4JGBA 3IP3A 4FN4A 4CMEA 4RV9A 3SC6A 2PZMA 4JBHA 4YVFA 2NADA 3K73O 4UUOA 4D3SA 4CLXA 5TC4A 1PJQA 4EUHA 3JD3A 2BFMA 2ZCUA 2W2KA 5H81A 2X86A 3U0BA 1KOLA 1PJ4A 5FI3A 4H16A 4GH5A 2CVQA 3DZKA 4TZKA 4RPKA 1Z73A 2GYYA 2Y1GA 1IB6A 8LDHA 5EIOA 3MZ0A 3E8XA 3OJOA 1Q2XA 1D3AA 4N5LA 2X0IA 4A27A 5CDSA 1HETA 2C82A 3DZHA 4P4LA 2PLAA 1Y8RA 2DTXA 3HSKA 4NBTA 4NFSA 5DBGA 1TT5B 4RPLA 1HDXA 2B36A 4K6FA 4M49A 3GVPA 4DMMA 1Z7EA 4DLLA 1QLHA 1SB9A 1V3UA 1CQIA 3VTFA 3HE3A 4J43A 2GN6A 4I5FA 3K5PA 3WOHA 4UUMA 4JJGA 3IUPA 3W4JA 2YDYA 3VZQA 2IYPA 3AUSA 3KETA 1E92A 4TROA 1SB8A 1YE3A 1P1HA 3RC1A 4P38A 3ITKA 1NPYA 1YRLA 2XPCA 3PWKA 4IIVA 2D8AA 5JBIA 3AU8A 2PNFA 3FI9A 4MP6A 3HN2A 2GASA 1TT5A 3DAPA 3BZUA 1KVTA 3P2YA 1LTHR 4M89A 4LRTB 4BNKA 3K6JA 3RUCA 4EUEA 2NQ8A 3DAGA 3V1TC 3L0DA 3KYDB 4J9UE 1GY8A 2QG4A 3MWEB 2AQ8A 2BD0A 4RVUA 3KEQA 4HFRA 1WAMA 1BVRA 3ZW9A 4OXKA 2YW9A 1DLJA 1P1RA 4E2XA 4Z3DA 1XCBA 2BKAA 4J7XA 2OOSA 3LVFO 4S3MA 2AG8A 3GHYA 1ARZA 1EDZA 3KSZO 1B0AA 3FNFA 3H65A 3L4BA 3GDOA 3WBFA 3LT2A 1NASA 4RPGA 3DBVO 1YKFA 1YH3A 1CEQA 3I23A 4XKJA 3FPCA 4DLBA 3KYDA 1IZ0A 1ISFA 3JQ9C 4FBGA 2OBNA 4R9RA 1JU9A 3ZWOA 1YBMA 4FD3A 1PWZA 3WGGA 1A72A 4A5OA 2I76A 4UVEA 4E5MA 3WIDA 1IPFA 3TZHA 4CUZA 3ORFA 4L73A 4RQUA 4YRDA 2NM0A 3KSUA 1CF2O 3RVDA 3OJEA 2A94A 3RAJA 4N54A 2YV1A 1HLPA 3DBHB 1RYEA 1HRDA 4BNFA 1EQ2A 3NDJA 3JD2A 1E3WB 4M1QA 1A27A 1CYDA 4KTTE 3DZGA 3T4EA 2CVOA 4UULA 1UZMA 1SBYA 2HJRA 4K26A 5AXDA 4ZN6A 3WB9A 1GZ3A 3BXXA 2H9IA 3AI1A 3EAGA 5TT1A 4HBGA 4E32A 1P33A 4ESOA 4RF5A 3CMCO 4KQWA 8ADHA 3P7MA 1R0KA 1UUFA 3Q1LA 4DC1A 1QP8A 2RCYA 3RUHA 3WGZA 4FDAA 1QYDA 3NTQA 1JN0A 3B6ZA 3TNLA 7MDHA 3QA9A 4II3A 4IJKA 2IZ1A 4BL5A 4IUYA 5ENVA 1E3WA 4J91A 2NU6A 2ZYAA 3U5TA 3S55A 4B7CA 4ALNA 3DB2A 1Z6ZA 5H82A 4PCVA 1HZJA 3IQDB 4AFNA 1LRLA 3QHAA 1E7YA 5DNAA 4BNMA 5L9AA 3AI3A 4AJPA 5CHEA 4CMKA 1HE5A 3GPDG 1G1AA 3H9EO 3MTGA 3V2GA 2AMFA 2NVBA 3D4OA 1JVSA 1MLDA 1N8KA 1XDWA 5L51A 4PLCA 3RQSA 2G1UA 3KB6A 4DMLA 5AQ1A 1WPQA 2X6TA 4GKVA 3GG9A 4HFNA 5IN4A 5FFFA 1ZUD1 4JJFA 4DUPA 1WMBA 1P77A 4HUJA 2CF5A 4GWGA 3QWHA 1T4DA 1N5DA 1IL0A 3EC7A 2FY8A 4CV3A 4WLUA 1C0PA 1PZFA 3M2PA 3WGQA 3WQQA
chains in the Genus database with same CATH superfamily
2I5PO 3E61A 2JLYA 2HJSA 2B9VA 4J6EA 4NFHA 4ZRDA 3CGWA 4AG6A 4DLKA 4WN9B 5DTQA 2H8KA 4B6EA 1TNDA 4EL5A 2RAUA 3CW2A 1IXRC 3EZYA 1RKQA 1FEZA 2AFVA 4LXUA 1G21B 4NBLA 5DLEA 3UB4A 3ZZ1A 4E4YA 1NM5A 2ZSEA 3ZDFA 2UYHA 3OPVA 3FPBA 4NWIA 5KDLA 1PZXA 1VYTA 4D45A 4DLAA 4AWAA 3D7NA 3UW3A 4OU4A 1YZGA 4P35A 4EHNA 4F04A 1S2OA 2JFOA 3I6YA 3MN1A 4J3NA 3EISA 3ZZNA 3EFOA 4G8CA 4N49A 7REQB 2QUZA 3AZQA 1I4DD 1M1YE 2NVOA 4L4SA 1U7ZA 1RRVA 2DTEA 2TMYA 1E2GA 2GVZC 4NPCA 4OP3A 1RAEA 1M83A 2WP0A 2Q21A 3DOOA 5G0SA 1P91A 1T1JA 3A8TA 5ED0A 4F45A 2ZJ6A 1SVIA 3OT1B 4I1YA 5GTDA 3FTQA 1C3VA 1CC1S 2O52A 4KLCA 4CTJA 1D4AA 2BFAA 1L1RA 2R6FA 3QYFA 4UXHA 3T54A 4X8OA 2GJ8A 1O4WA 4TZ0A 1YQGA 3RWMB 4FE4A 1BMQA 3ZHRA 4IFEA 3E48A 1SCUB 1ZN7A 3T61A 3D8TA 1PT5A 2B34A 4G07A 2OAGA 2E18A 1PJTA 3CRNA 3F5FA 3PFKA 3O1LA 1HV8A 1GCGA 2HJGA 3DKRA 3Q5EA 4MWOA 5LOVA 3NXSA 1NBMD 1NONA 1Z8DA 3E9CA 3JR7A 4QTTB 1HMYA 3OPYI 3FPEA 3PQFA 1R6VA 1UK8A 1FU4A 4ZANA 3Q87B 4B4KA 1R4AA 1UCFA 2Q07A 4G0VA 1YOBA 5SZKB 3SCZA 3HADA 2BGWA 4PHCA 2H54A 2XRMA 5JCPA 1EU1A 3QIAA 5KU1A 4BMOB 1LDMA 2X0KA 1M34A 1AK1A 4LHVA 3KTAA 2ZAOA 3HPQA 2HNAA 3WRWA 4CF6A 4EO7A 6REQA 4BN5A 1KC1A 3H1EA 3VKFA 4HFJA 1HZZC 3E23A 4GR5A 1JI3A 1LK0A 2YWJA 1CT9A 3IEUA 3MJVA 3QWIA 4UEKA 5FLYA 5GPBA 1UT5A 4FYPA 4N39A 4GP6A 1AGPA 4ZCIA 5BWBA 1E96A 5FD8A 1K06A 2ZRJA 3ZOKA 1QVVA 2LKCA 4OG2A 2WPDA 1W36D 2XVZA 1KXZA 4U2EA 4QBTA 3WHIA 1PU2A 3OQIB 2EAUA 4HV4A 2AD1A 3P0HA 2GNOA 3U9TA 3U0VA 2YYYA 2PLFA 1NYLA 4DREA 3BH6A 5F1PA 4A1OA 3LMKA 3BJMA 3ZE6A 1DEAA 4RJJA 3TB4A 3UJ7A 2VJMB 3NNDA 3UXEA 2HJ9A 1CUUA 5F2OA 3SZ3A 4AIRA 3AVTA 1FY2A 1S1MA 4JI1B 2ZRDA 1GZ7A 1GQFA 3L92A 2RKBA 4R3NA 1XRSB 1U6KA 1N2CB 5CITA 1VI5A 3L40A 4KDRA 5CJPA 2QMZA 4TKUA 4UHCA 1NI3A 1UOPA 3QTTA 4QPPA 4I9HA 3EQ8A 4KGVA 2K2QB 2PKYX 4DUGD 3D9QX 1QCZA 5EIBD 4E5MA 2ID8A 3NDPA 2EGUA 1Z2OX 1Z0ZA 4EELA 5GIOE 2ILTA 2O57A 1HG0A 3FR8A 3WB1A 4EFLA 2RMKA 5K4HA 4WDRA 1I80A 4YRPA 4KRYA 5KYUB 3GGCA 5KTRA 3MWLA 3TQHA 4LFBB 4E2ZA 4G2NA 3PITA 4CEIA 1XAJA 2VBCA 3L0ZA 2Z3VA 3EF1A 4GR9A 1XCPA 4KRXA 3WFIA 5CBPA 5I7EA 1XCGB 4JP1A 5DW0A 1GGFA 3VU1A 3X2EA 2VT6A 1V5EA 3TL3A 3WNCA 3FI0A 1AKMA 3G79A 3RABA 3RI3A 4C78A 4GVLA 5K09A 1UAGA 1DCKA 4MPRA 5T8KC 3GYBA 4NYMQ 3GGDA 5IVIA 1Z18A 2D2IA 3S2EA 3NV9A 3FMGA 5B30A 2EYUA 3HO6A 1TEXA 1U2EA 2IDKA 2QNBA 1Z56C 3RRNA 2V6IA 2IH4A 3I8XA 3UG6A 2BY4A 1JSCA 3G1UA 4LJ9A 5KZMB 2C3OA 3GZJA 3IDOA 2OO5C 4KE8A 1KI6A 4EDHA 2QTGA 2R84A 4B3FX 1TM3E 2XKJE 2H1WA 2ZPTX 2ODNA 4IYJA 1EZZA 3RV3A 3RYCB 3JYPA 4KP7A 1QQ7A 4R1OA 3LI2A 4UXIA 4R6WA 2C5GA 2RBEA 3DOEA 3EMDA 4O33A 3VISA 3F3KA 1C0IA 4BJ6A 4DLXA 1GAXA 2JZNA 2E9SA 4O4HA 2Y05A 1DBPA 4JFRA 4JXJA 2J6BA 5IP5A 1E9AA 1XA4A 2HJVA 4IDDA 5HBRA 2FZGA 5K8TA 3P8ZA 1SBNE 2BIFA 3T3DA 5JY6A 4Z4QA 3P2IA 1ZOOA 1DU4A 2PX4A 3A10A 3CX4A 4M8KA 1DAFA 2VOEA 3R7SA 1TRKA 1N5IA 1RQNA 3NHSA 4DC9A 1NRIA 3EGWA 5EEGA 5JSZB 2Q99A 2ODAA 2IU6A 2QQFA 3OE5A 3KU4A 1W2GA 4WDQA 3SR0A 4ENWA 2GF2A 2CWDA 3O8OA 3KX2A 1TZBA 1H05A 3K30A 3ETGA 3AINA 1Q7TA 4L72A 3VHRA 4Q7JB 1M2OB 4PPGA 3ROTA 3OPYA 4R9VA 1GNPA 1WSAA 3O0DA 1PFQA 1TU3A 3FUXA 4KE7A 2AMJA 4PBRA 1PLLA 2NUTB 3IDQA 1YMVA 3ORRA 5BN4A 1QRUA 4BFLA 3WLOA 1AUOA 1GZVA 1TAGA 4Z5XA 2ANBA 2YYSA 3ZD7A 1T0BA 2CK3A 3BH0A 3TQQA 1PL0A 4UTRA 4JQSA 4YLEA 1XB2A 1Y5IA 2BCGY 2YNMA 3VYSB 3MJDA 1BEZA 1QORA 1FOEB 2JIZD 1DDOA 3RLIA 4D9IA 3OEEA 1PGOA 2D5CA 2O2XA 2D1TA 1BDHA 1YJ8A 4N4AA 4MR8B 4RIEA 1RE1A 1TCAA 1E6EA 1CZKA 1P9WA 1V48A 1PJZA 2IZZA 2PY6A 2R7AA 3A37A 3O9ZA 1YUMA 2PSFA 4FFSA 3GRVA 1EP2B 3THXA 4WN3A 1EHYA 1U90A 1MEOA 1V7ZA 3EIHA 2J4DA 5E95A 5FCDA 5BR8B 1I94B 2IBSA 3LP5A 4RMHA 4GE0A 4HNAA 4C5BA 1CJVC 1Q3KA 4GP9A 4ZO6A 1KHTA 2YHBA 3I9JA 2Q5LA 2GM4A 1NXVA 2C4UA 2Y0EA 3CLTC 3KLMX 4QOSA 1GLNA 1JHMA 1IAVA 2FN4A 3C4QA 3DZBA 4I66A 5FAKA 1QDEA 4PONA 4YEDA 1MT0A 5SYAA 1J4AA 5HR5A 3GLFA 3NVDA 3ENZA 1BC5A 4C3ZA 5JZBA 1IHPA 3D8SA 4E14A 2B20A 2QLJA 4RFLA 4RTSA 5TMBA 1ELOA 1NR7A 1AC5A 2PBLA 1E2FA 5LVAA 5D6NA 1JIKA 3COSA 3QBJA 4RZUA 5DF1A 1CB7A 3NDIA 2Q2OA 3CJRA 2PMKA 2IXDA 4AN4A 2EATA 3SZRA 4F8EA 3I6QA 3UMRA 1VKOA 2PH7A 4G4IA 2LWIA 1LBQA 1USKA 2QD4A 3PNYA 4MUJA 4QXOA 4DLPA 3OD1A 3HXQA 2HQRA 1YBFA 1FP6A 4TSRA 4AO8A 1NUAA 3FHJA 2HNKA 1OOEA 2H6EA 1LD3A 3GAZA 3H86A 5JNRA 4Z4GA 2C95A 1X70A 2Q3DA 4CV1A 4R71A 2FXIA 5KDDA 2YBDA 2Q4DA 1S3SA 5HKBA 2A14A 2WEKA 3D7LA 4RLFA 3H5WA 3P5BA 5EY5B 3VBEA 5F21A 4RFVA 3DMNA 1W19A 1JKXA 2HLDD 4D7AA 5LMUB 2EWMA 2QE7D 3EUAA 2NZJA 3HJCA 3MINB 3OKCA 1GAEO 1D9ZA 1IMOA 1IHDA 3KHKA 4EKGA 3QMMA 1AMOA 1MTOA 1BZYA 5AHWA 1XOIA 4B6RA 4F9EA 3H9GA 4B3SB 1VLMA 4RH3A 5J4YA 4FMDF 2PGIA 5ITVA 4AWXA 1VXOA 3EDRA 5C5EA 3OCUA 5THQA 1RYHA 2DUJA 3UJCA 2WSSA 4TKVA 4XB6B 4XM2A 4K8OA 5EFOA 1YXMA 2FRXA 2I7TA 2QRGA 3BILA 3CZ9A 3SC3A 4OQZA 2VYNA 3VO9A 5CG2A 1ZK3A 3M70A 3PKIA 4ARVA 3S8YA 2AVDA 4BZWA 5ENZA 5A4AA 1XHEA 4OYLA 4TVBA 3LRXA 1Y3DE 2JB9A 3PXXA 1KAEA 4WKBA 3N2GB 4WZAE 5B7PA 2WU3A 2IWRA 1HQCA 2Q9UA 5FEUA 2QBYB 1XFDA 3TDMA 4EJSC 3D6AA 2I8AA 1M1YB 1W44A 2JH8A 3CVWA 2V7EA 5ALKA 2VJDA 4DJ5X 2P6UA 4K40A 2OLJA 3EULA 3AP2A 1G4UR 4I8XA 4LE1A 2BTQA 3BRCA 3FVWA 3I4CA 3TECE 4OQQA 4QELA 2AJTA 3U37A 4C6TA 3KJQA 1ENOA 1BN6A 4G8BA 2FN9A 1ZCFA 2EHDA 1XAGA 4HL6A 4RGBA 1OBFO 2ZS9A 2Y0CA 4EGJA 2IYNA 3DYIA 2VCHA 1SNYA 3AEYA 3B20A 3BJZA 3HA5A 3A0RB 1A4XA 3L18A 4JYMA 4R98A 1RI1A 3I45A 3AV3A 5CM2Z 5I4KA 5K7SA 3SJAA 1JXAA 1VLHA 1KU0A 1Z0UA 3RRFA 4B71A 4OMFG 4A6DA 2QLBA 1JHUA 2CZGA 3ZS9A 5LQKA 3H9JA 1SOWA 1GPJA 5DFAA 1O95C 3A31A 3COZA 2BBOA 1T29A 2RGEA 1QHIA 3P4XA 4TWIA 2B82A 1Q22A 1E89A 4BUJA 1R8XA 3W04A 4FN5A 1UK9A 3D02A 1Z5ZA 3F78A 3O3OB 3GUUA 3DLHA 5JQGB 1QV7A 3MTQA 3RLFA 5FPPA 2JH3A 4KQJA 5IAKA 3TCNA 3MCTA 4IW3B 2ATCA 1IXYA 3S1AB 4WESB 1RPNA 1WXEA 2WD9A 1SQ6A 1DTSA 4XB2A 2A57A 3ZXXA 4Q9JA 2YIMA 3LPAA 4PLGA 1PSWA 4F7DA 4NG4A 1UDAA 1Y7IA 1Z8FA 5K6TA 3N9IA 3LJKA 2ZJAA 4MH0R 2ZAGA 4PG8A 1FS6A 1F2TA 3FH0A 3F96A 2QNRA 1MP0A 3GRZA 5JDCC 4YJ2A 3BD9A 2J09A 1ISGA 2LPMA 4IJUA 4J49A 4MAFA 5IKEA 2D8MA 3MCVA 5KVSA 3H5AA 4JUCA 1O03A 2HU5A 1T0HB 2HMSA 3I9V1 1JEQA 5JHGB 3DUFB 4OBBA 4KB5A 1WUIS 3QH4A 2EFEB 3L6DA 1W581 4MQMA 5CURA 5D51S 3ZUPA 4CKBA 5BV0A 2ZRAA 3DL2A 2BTOA 1RYFA 4IQ0A 2NZYA 1GCAA 3HYLA 3GROA 4RJLA 1U2RA 1T91A 3RKSA 4EZEA 1GGNA 4TWRA 3D6JA 4B3GA 4QDKA 4EB3A 2MT9A 3NNNA 1U80A 2D0DA 2XE4A 1NX6A 4GC9A 2E87A 4C5AA 2AFIA 5CX1B 1SCJA 2EFYA 3UTDA 3EHEA 5ER9A 2DLCX 1Z26A 2DJ5A 3M1IA 4NBUA 1RRFA 1RWXA 1YGYA 3I83A 3CNBA 3UXHA 3E8MA 6LDHA 3BS4A 4M3NA 3RE1A 1LPMA 4N40A 4EX7A 2IEYA 4J07A 1X7GA 1VRCA 3ETJA 5KU7A 1CZUA 3P0JA 4FFMA 2X0EA 2FFRA 3IHWA 2JIMA 3B6KA 4J0JA 1GA4A 3Q8XB 3HN7A 4MS3B 1EE1A 2WAOA 3TTVA 3UENA 3V2HA 4BU0A 3AKYA 1E0AA 2A0UA 2VKTA 2A88A 3FA2A 1UDCA 1RM5A 4IV5A 4J4HA 4X85A 1G16A 3W0LB 2AOUB 1RKXA 1S2GA 1U0NA 2B1QA 1OHHD 1DTEA 2JAQA 1O4VA 3OCZA 4E11A 3PIRA 3ZKWB 3UEOA 1TZKA 4ZZ0A 1U2GC 2XB4A 5IF9A 2JJ2A 2R87A 3E8SA 5KQRA 1P4SA 3WSWA 5FLXA 1K7YA 3AJAA 1JQAA 2B3DA 2LCIA 1W59A 4RCZA 2NSJA 2YFHA 4MPPA 1WETA 1MAAA 2OHFA 4KQEA 1M10A 4IGEA 4QRHA 1QVZA 1YUBA 4QRDA 3WGHA 3NWEA 2QL7A 4HQKA 4YUAA 1XMOB 1VMAA 1SXJB 4C2AA 1DC4A 3W5JA 1KI9A 2QX4A 2OFPA 4BX0A 4BZQA 3OZRA 3W7AA 2XXAB 1FNMA 2PD4A 3IOEA 2Q50A 3I9FA 1TUGA 4L5YA 3SJCA 3ZJTA 2RBKA 4FT2A 4EYGA 2AXPA 4H4EA 3BFPA 4LC0A 4ZARA 5YASA 1TTQB 1NBIA 2PJDA 3AVYA 2WKRA 3G8CA 1FUUA 2O8DA 1X80A 2CLEB 4M4SA 2MHCA 1G8KA 2W6JA 3RAGA 1PJ8A 1HEUA 3THYA 1JSRA 1K6JA 3LVBA 4IOLA 3TOVA 5ESXA 2R1VB 2LV8A 1F0YA 1AZSC 3PFCA 4LJAA 3M4XA 2GAIA 3ECAA 1MJNA 2PN1A 4TV9A 3ZR4B 5BNTA 2P8JA 2F62A 2ZYGA 1A5ZA 1SBCA 3UKDA 5IT4A 2VNAA 5ILGA 3WO0A 5EIAA 1X1RA 2PS1A 1L7DA 4GOOD 5E6RB 2OC4A 4AU1A 3C6BA 1GNLA 1HE2A 3S7TA 4QBKA 3FW1A 1QIIA 3KKKA 1YNOA 1ZMXA 2CLCX 4P3NA 3D5EA 1A8QA 1DJPA 1EP3B 2ZUTA 2ZB4A 5H4GA 1ENPA 1KMQA 1T8UA 3M49A 1EWTA 1ZVMA 2ZJ2A 1JU4A 2H85A 2CFRA 4U2CA 3I58A 4YUVA 5BYKA 4R54A 3N76A 5L53A 2RFLA 3GWGA 4BXOB 5IRCD 3ASYA 4RCYA 1BHQ1 2LR0A 3AHGA 4AJ2A 4IXMA 3AB3A 4R2JA 3OX1A 2BJHA 2J3QA 3N70A 5EUMA 1UPUA 4JUAA 2EBUA 3C7TA 5KYWA 3IAAA 1QH1A 4MWSA 2J5BA 1IJEA 1N2BA 1YKGA 1ZO8A 5T4EA 4A4DA 5I9MA 4KR9A 1XTUA 2FUCA 4WFQA 3A70A 1KAOA 4Q15A 2PXCA 4DZZA 1J7JA 1Z6XA 2FRVA 2IEAA 3OZWA 1EGAA 4KXWA 4LI0A 4OSOA 4RANA 4XJXA 3SEAA 5KVQA 2EC5A 4WKGA 3PA8A 4LDAA 2NTJA 2PX6A 2DQSA 4JB3A 3VDQA 5KDOA 4WKOA 1DFIA 3EBLA 4W9NA 3ZIUA 4KYTA 1FX0B 4R5MA 5FBQB 2ETVA 4ZMBA 2NT4A 4C89A 2VRBA 3FDXA 4H18A 4IOJA 5C1PA 4KLZA 4G5QA 2XCIA 1T5BA 2IV3A 3CYFA 3E58A 4WPGA 1IJFA 1X1SA 5FFMA 3E0QA 4ITUA 1FTQA 1WP9A 1B6GA 1KMHB 2VDMB 4H4DA 4I1OA 3SOPA 3ZY2A 4M0KA 4C43A 4HP8A 4CIWA 3KBOA 3NALA 1FXUA 2H1CA 4DR5B 1CY8A 2GCGA 3D1LA 3IUBA 3R2JA 4GDMA 4CIVA 3U4DA 1NHWA 3ZIAD 5HUQA 4TYYA 1XDZA 1N4AA 2O8FB 1SQFA 2OAP1 2QTBA 3IUYA 3EXEA 5LXTF 3M4JA 4KN6A 4OQMA 1SXHA 1EFLA 1SH7A 3QJGA 1J00A 1XPOA 1KIAA 3GRYA 1OMOA 3AW8A 1O2DA 1ZW1A 2P9TA 2BBTA 1U8FO 5IJAA 2KSQA 3GPLA 3GDFA 2VL7A 3BHJA 1P1FA 4DDHA 3OZAA 1MG5A 1LPOA 2OP1A 1T4GA 2GYWA 4GBGA 4MQ4A 4TS9A 3WSTA 4YLYA 2XDYA 3O38A 1N2OA 4RETA 5KX5F 2H7YA 1X87A 5KPDA 5CB0A 1T35A 3G17A 1PEYA 3G5UA 4EABA 2ZJFA 2E0IA 1A2KC 2XTAA 1PSZA 5HFJA 2H2DA 1KSHA 1VBNA 2VC2B 1W5AA 5JWHA 4A26A 3KXIA 4LGVA 3R7WB 4PYMA 4GYWA 2XMZA 4QQRA 1MA3A 1RRKA 1VJCA 4X0EA 1G8MA 5IXYA 3RUEA 4BLSA 1NT2A 3W7VA 4MEJA 1OJLA 2B94A 3IUNA 4V0KA 2QTLA 1GDDA 1JPNA 1WHSA 2ODTX 4PZAA 4XDZA 3ER9A 3RS5A 2G9QA 2ZYUX 3PHCA 2PIAA 2VHEA 3BD6A 5CK4A 3B89A 1C9JA 2GK3A 5TSDA 3ZJUA 1XC7A 1GTG1 4JBIA 4NBSA 5KBYA 2ZR0A 3B5EA 5FHQA 1RR6A 1CNMA 1RS0A 1RD4A 5DX8A 1WPGA 4BLPA 2NVWA 2GXUA 3KLPX 1S3IA 3FLAA 5EUQB 3T8YA 4Q9LA 4BO5A 3QY0A 1YJ5A 4D9HA 5CDHA 3VNRA 2NVUB 3JQAD 1EK1A 3ROKA 1CJBA 2SKEA 4G86A 4KSBA 5D86A 1KSFX 3D6UA 1K0FA 3GFVA 1EDEA 2V7TA 3T5BA 3M9WA 3PB3A 3PT5A 5ES3A 2ZSKA 3UT6A 3WAKA 3WNVA 5K8UA 1NFFA 4WQMA 2H4ZA 1E3LA 1MX5A 2OXRA 2GAJA 2OP0A 3Q6IA 5C7IO 3AJRA 3T4UA 4FWIB 1MNQA 2GZRA 4NBRA 3QEAZ 1KVSA 3E7WA 2P6OA 1CSEE 1N2EA 1ZD3A 2VTEA 1S2NA 3BMCA 1T0IA 3E05A 3NVAA 3UMCA 2XZTA 4DQ0A 4E0BA 1PJCA 3NG1A 3GT7A 1E1NA 3T94A 3LC2O 1XRQA 2WF8A 3CLKA 3HB0A 1Z75A 5AW9A 3H0CA 4CKEB 2I4NA 2FPGB 3REOA 3V3TA 1II0A 5BSWA 1HX7A 5IJXA 1WPXA 1ZS9A 3JV7A 4I1VA 2CXNA 3WZLA 4R31A 2VPZA 1KSJA 3CZAA 4IIGA 2A33A 4NEGA 4Q9NA 4DXHA 1L5MA 5KNDH 3SM9A 5H9WA 1PS0A 1I0ZA 3LUJA 1GKIA 3NHZA 1TVMA 5C8DA 1DAGA 1SQ5A 2PQ2A 4AQYB 5F1KA 1CUJA 2HA4A 2IE8A 2XAUA 2E3JA 4I8DA 1Z06A 3KFXA 1XXHE 1ECCA 1RQPA 2C4KA 1GUFA 1T9GR 3B82A 4L4RA 4NCJA 2RC6A 1JJFA 3KE8A 4IQFA 1CVLA 3E70C 1F9EA 2JK0A 1UKYA 3CO5A 1Y7PA 2OSVA 2ZWIA 4MW7A 1D1PA 5AVWA 2BFDB 5JS6A 3WO1A 1W0KA 3AM3A 4BAGA 3HCWA 4XSHA 4EDFA 2ST1A 3F67A 1P1BA 4EPXA 4FVTA 2H07A 2ODPA 3STWA 4EZBA 1BCRA 1GU7A 3BRQA 3FPAA 3EPHA 1AGNA 4M8LA 1U3VA 3PUHA 4DQXA 4DNXA 1OZGA 5A6VA 1SBTA 1X15A 1ULHA 3LDFA 3PL5A 4Q3NA 4ZJZA 2VQEB 2AOTA 3CVOA 4NZPA 2G71A 4QAQA 4XR9A 3OTOB 4I4TB 1SOVA 1N78A 3EQ6A 2PUJA 4NOMA 3MTEA 1HL3A 2EF1A 2GEFA 2HY7A 3FYCA 4AMVA 4IDOA 3M89A 3O74A 4MJ3A 3MLBA 5AW6A 1ISPA 1X19A 3RRJA 2FK8A 3R8CA 3UWSA 3ZDDA 5DEIA 4D9FA 4BCCA 4FS8A 2JCSA 2JAHA 3QJYA 4FFWA 2HPZA 3Q85A 4P1ZA 4WN9A 3T38A 3TQIA 3IQWA 4YNBA 3W9BA 1AK9A 3NU1A 3RSZA 1NLUA 1T8WA 4I2VA 2GUWA 2GRUA 2R65A 3SE0A 1L9XA 4OLHA 5I9TA 3IERA 1B7GO 1MB3A 3QP9A 3E35A 1JHYA 3CZRA 4D42A 3T9CA 3QEOA 3WYNA 1LTKA 1JJBA 5G40A 121PA 5K6AA 3BUSA 4S12A 4KK4A 5DM60 4RY9A 1N1GA 3MG9A 2E85A 4D3FA 1XK6A 2YOGA 3W7BA 2F00A 2OZPA 4X95A 4AJOA 2DERA 1PR3A 2G9RA 1G5QA 2JK1A 3C3KA 3LE8A 4I5IA 3SMQA 4RDCA 2PMEA 3I2YX 1QH9A 3I2JA 1UDXA 4FBMA 5DXAA 2G77B 3PC8A 4IFBA 1KJWA 4A6XA 4DGSA 1ZFNA 3O8CA 3E1SA 3L8MA 3NYIA 3OCJA 3SHVA 4DCJA 3HEMA 2ZIGA 4P5PA 4MX8A 4PANA 3DCIA 1A5SB 1HSZA 4H1UA 4MVCA 3VR1A 4DMUB 3TMKA 1JDBC 2GK4A 4BO3A 3AR5A 2HBRA 1SKQA 2BKUA 3B3JA 1UM9B 3C6QA 1SD1A 1SCUA 1JLLB 2VNKA 1CQZA 4RK7A 5JMWA 2YMQA 5JZVA 3VX4A 3ZNQA 4A2WA 4OMCA 1WEHA 2D4HA 5HQJA 4ZI3A 1R50A 5JO0A 2REQB 3Q9LA 2F3QA 1FVHA 2IKQA 2C2WA 1UR5A 2QRPA 4ZRMA 1DAOA 2XTMA 1NF8A 3H2IA 2Z1MA 1Z33A 4DCGA 2A35A 1A7UA 1D2CA 2AMYA 4HQ0A 5TT0A 4EWLA 4KMOA 4MAAA 3RTEA 3NHYA 3FHTA 2Q5JA 4MWZA 3SFZA 4XH9B 1W73A 4A0GA 1OWNA 4EJSB 2XUIA 4W5OA 1GOTA 1XAIA 2P35A 2UZAA 4FIZA 4ZXFA 3VSDA 7YASA 3S2UA 3W5DA 2PL5A 3PK0A 3RYHB 5A3RA 1MBZA 4E4RA 1ULTA 2VSOA 2I7CA 1JJ7A 2XSZA 3EASA 3IVRA 3JQGB 4LQDA 4N6OA 3RTGA 4AURA 2ZSDA 4CKEA 3N7UA 5LZ2A 3HJGA 5DCUA 4XWTA 3CURA 2NYAA 1CUDA 3IQGX 1G41A 3W6PA 3KL4A 4CU2A 1XG5A 1QK5A 1N7JA 3FF4A 4O4HF 4OHPA 2HRRA 5ALWA 4RSRA 4Q4CA 3PQ4A 4FKZA 2NSHA 4YAJA 3OQIA 4G4SO 2PRYA 3W8FA 3ZWPA 1AHPA 4CZ2A 4LE2A 2WT8A 2F48A 4G1UC 2V7QA 5LB4A 2R6R1 3LK6A 5KNDD 1X7XA 221PA 2VJMA 4D0RA 3A6ZA 1RVDA 4JCOA 4YRMA 1BD4A 1C9KA 4B7ZA 4LYDA 4MA5A 4BJ3A 4O08A 1N2CA 2QLTA 2C4WA 2WILA 1CCWA 3HNOA 5TVGA 4EW6A 1ENZA 1T43A 1M0WA 4YJDA 3BQ9A 4X7RA 1T1SA 1P2SA 2C1ZA 3NTRA 3UKOA 3ROMA 1DIRA 4TYNA 2GLXA 3FWKA 4Y2UA 2LNDA 1NXWA 3DKKA 4G4GA 1I7PA 3H4VA 1FVFA 1GFZA 4PGAA 2BSXA 2VPPA 1SELA 1GCUA 1QTIA 4MUHA 3JZMA 3TCKA 1AIPA 5KYUA 3TTWA 1TEZA 1BA2A 4MZDA 3ZBPA 1U63A 1YRQA 1A77A 1AS0A 1Y9DA 4GOJA 4O6VA 5EQFA 4D82A 3NS7A 3FZGA 1OU4A 4O63O 3IS3A 3KB8A 2IDZA 1TF5A 3NZEA 3D7SA 5EPOA 3CF4G 5BSGA 5DM1A 2BFNA 2H2HA 5GWXA 1SCQA 4F1WA 2ZJ3A 4X6YA 4B2IA 2GEVA 2E5WA 3BCSA 2VNJA 3T06B 1WSDA 1CDDA 2VUTA 2X9VA 4FZJA 4IJMA 4ADSG 3TW8B 1J8QA 1W0JA 1VPEA 2PKEA 4JXKA 1XZPA 2BUAA 3PEUA 4YGXB 1U8XX 3PZRA 3EEBA 4HZIA 1E9SA 2FPPB 1Y6ZA 5IVHA 2OGWA 2QXTA 2JIQA 2Q27A 4B6GA 1UP4A 1YU6A 1DKMA 1TM4E 1PVOA 4Q7LA 2J0SA 2ZSAA 2VA9A 1JDTA 1VL2A 3E22B 3ESYA 3OEWA 1I10A 3RHSA 1E79A 2AKYA 2B6HA 2P2SA 2Q8QA 2X4DA 3HDHA 2XI4A 4BMSA 3RYCA 1DO0A 1PGNA 1OC2A 2V6BA 3FR7A 2PSHA 3C87A 3RC3A 3RU2A 3OU7A 3ZV6A 3KEOA 3SXUA 2JFVA 4LAFA 1Y1TA 3E18A 5AM0A 1BS9A 4YRNA 1C9MA 3I39X 4AUNA 1CZOA 3TQTA 3KSBC 1NTRA 3K2EA 4YPOA 3CLUC 3BK7A 4ZTZB 3K4HA 1L5LA 3S40A 1TF2A 2V3VA 2HWYA 3ZK7A 3NR2A 1KZ7B 4ENUA 2PS0A 4JDUA 2PA3A 1GDTA 4RGQA 4C21A 2PZJA 3EDMA 1QIFA 1U28A 3SDZA 1AMUA 4XFJA 2GF0A 2C3MA 3GJXC 2VWQA 3C1AA 1XWWA 3EVNA 1L4EA 4F2HA 1OH5A 1M2OA 4J1QA 3FNQA 4NU0A 1LNSA 4ZI7B 1GPLA 1RT9A 2DOKA 2FOXA 4FS3A 2X76A 4LDZA 2OMKA 2VBFA 4ERXA 2YV2A 2JBWA 4FIDA 5FAXA 5K3FB 3IBSA 2VVTA 1O6CA 1NKTA 5IEBA 1EHCA 1V8DA 2ZP1A 5EIFA 1G7CA 2O7SA 5AI5A 4D0SA 1QZTA 3IAUA 3VNUA 1QQTA 1VCIA 3SLGA 5AHXA 2COUA 1KJJA 2HQSA 5J5VA 5K8LA 4DGQA 2WQZA 1FW6A 2APJA 2NO4A 4RD2A 4Z7OB 4ABYA 2A9VA 5IC4A 3T7SA 1JKFA 1Q0PA 2G0AA 4YMVA 4N18A 1QLWA 2VXYA 3GMDA 1TZ2A 4MR8A 3CU5A 4MRRA 1F6BA 3B9BA 4CDRA 3GMTA 5IC5A 3PFBA 3UC5A 1RQGA 1YB1A 1YV9A 1X1CA 3HBAA 2Z8XA 3FM9A 1ES9A 3CF2A 1GL7A 1W0KD 5K0JA 5A9TA 4DV7B 2Q0XA 1M2KA 4URXR 4CKWA 1WM1A 1P9NA 1U0LA 1MO6A 4D0NA 4LVNA 5BSKA 4JB8A 3SYKA 3B8EA 4YFVA 1S5PA 2FZEA 4O4LF 4PG6A 3LSYA 3RIXA 1KP3A 1Q91A 4PE5B 1KFKB 3GJZA 1GUDA 4NLLA 4U7FA 1HNNA 1Y7HA 4DE5A 2YDXA 4MKXA 4TGLA 3OO1A 1KJIA 4A8TA 4EJMA 2O59A 1XXHB 1HLGA 3GXOA 4H7HA 4AG3A 3QEMB 4QSMA 4GS5A 4F3CA 4F9FA 4Q1AA 5HKOA 4HWGA 1E9EA 1TM1E 2D00A 3HKBB 3PRYA 4XB1A 2G36A 4GPTA 1PHRA 4LXTA 4PLFA 3SJ7A 3ZWWA 5DOZA 3A0UA 1T13A 1W93A 4DLRA 4BWVA 3VR2D 1EJ0A 2V3CC 1JAIA 2P9ZA 4X24A 1G5PA 2LP4Y 4UMFA 4ZRNA 3ZE1B 2X14A 1NJSA 2BC9A 3TE6A 4B9EA 2O5CA 3CZQA 4IDPA 5T5QA 3V6MA 4F72A 2YJ3A 3WYGA 3Q4GA 4JXZA 4EM6A 3DL0A 1G6Q1 3W6UA 3PGJA 3WLSA 3NX4A 4MEBA 3SEFA 2HQ1A 2HX1A 4NCHA 3HBLA 2R96A 4JQZA 4OHVA 3ORQA 1I3LA 3K0EA 3VOBA 5T64A 4D02A 1L4FA 1TMGE 1Z62A 4YI3A 1SRQA 3UMJA 3KTOA 2QQGA 1HQDA 4RX1A 3WKCA 1NY6A 2OGUA 4QXQA 2QJTA 2IA5A 2Q4BA 2N1MA 5DHUA 3PJRA 3JQFA 2RGWA 1PX0A 4ZHQB 1G0NA 1U5AA 3IEPA 3VZDA 5JTTA 1GPYA 2Q0HA 4DADA 4Q4HB 4YJ2F 1QRDA 1U7HA 1V43A 3OHPA 1J49A 1XCLA 5ANRB 4XJVA 1EFRD 5FBRB 4QODA 5EWMB 2DFPA 4P2BA 3JVVA 3GBSA 4BKOA 1R0BA 6YASA 3O83A 1U2PA 5FBWB 3ESDA 2RIPA 2QSZA 3A28A 4G0PA 5BSHA 3N2GA 5BQPA 1J06A 1Y4DE 4H15A 2HEGA 4DIUA 1IN6A 2QBYA 3I9OA 2ZE7A 2XVYA 4R1NA 1M1YA 3B3GA 1N5MA 1U9IC 4O1MA 1XJ5A 2WD7B 3KJNA 4HMQA 4Q3BA 3W1WA 5J43A 3P71T 4I81A 4JOCA 2OPHA 3KOZA 2PFGA 2IYAA 3P2JA 1UXJA 1BDIA 3S68A 1XMXA 2FP3A 1ZJYA 2WFZA 5EHXA 3AOGA 1SUBA 3EEIA 2I87A 1H5NA 2ZTVA 1MFPA 4V3CA 3IQZA 4RDXA 4DMGA 1W4LA 4IDGA 4FGSA 1JPUA 2J9GA 2YXLA 3DHYA 3GCWA 4KUGA 4J94A 4L8LA 1SU8A 4LVCA 1SKAA 3NT4A 3QVMA 4RNDB 5JYDA 2EG9A 1MPTA 1TFUA 4O4IB 1RXWA 5FNZA 1ZXXA 5JS8A 2BHSA 1P75A 5FJIA 4W82A 4JT9A 4KAJA 2ERXA 3ORSA 5LQJA 1RWBA 4YREA 1M73E 3SSAA 5DT2A 4XIFA 1EJ2A 4QUKA 3M6IA 4BP1A 2A1TS 3BIWA 3FGPA 3R5TA 5B1SA 2XCQA 4HLQB 3RROA 4YT8A 4MI6A 2FWPA 1N2JA 4RH0A 3DE5X 2J5QA 1UFQA 5CMLA 3DHNA 4P98A 2GBFA 3MPOA 1SUIA 2WSMA 1O94C 1QRTA 1BWSA 1I30A 3S1AA 5CDTA 4BUCA 1X94A 2SNIE 2RGNA 2I8LA 2JJMA 3AFGA 4PYRA 1KWGA 4MUBA 3MMXA 4LV5B 2IYZA 5HBGA 1HFJA 3JY6A 3MJFA 3R8FA 4UUPA 2DUUA 4JQOA 4C0SA 1MB9A 2J07A 4KG7A 4WE3A 3TRIA 5TIIA 4D99A 1YKSA 2X3UA 3AHIA 3L6UA 2HJHA 2XWJI 1Y3HA 2QL9A 5F7XA 3ZGOA 1DBWA 2OPBA 3FYDA 1MHPA 4DCNA 4INAA 3MERA 4EHHA 3RG8A 1M8KA 3A1TA 4IIJB 1KYWA 3PYXA 2QYTA 4ZAYA 1E2NA 1QYIA 2YUTA 1R9JA 1PR2A 3I30X 4HDNB 1Z0JA 1LDBA 2V1XA 5FQNA 4RQBA 4LTMA 1NAIA 4CYMA 4ZMRA 3ZXSA 4PRLA 3FNIA 1I7DA 4LZWA 5DE3A 1CY6A 3QIVA 4WL0A 4TV9F 4I0WB 3UTCA 2ZIVB 4GNKA 4MQEA 4CPDA 1OYOA 2DMRA 2MYPA 5FWDA 3CX6A 4UAUA 1O97C 2BM0A 4UU0A 5BN3B 1XKTA 2VSNA 1EXDA 1YIDA 3UC9A 1YCGA 3LV8A 1Z0FA 1R6UA 1SUEA 3DB1A 3NPMA 2X3FA 1RWWA 1DINA 1CZHA 5CX1A 5E1MA 3TIXB 4JL8A 5KHOC 3W5IA 2QX9A 3EFEA 4JWKA 4P80A 5JVDF 4GKKB 4XLLA 3EPKA 2ZRBA 3U9SA 3OZEA 3A9UA 1OT3A 1RAFA 2IYVA 2CEAA 3VVMA 2PZEA 4MW2A 3PQ5A 3A27A 2TECE 4C7JA 3A04A 1IJKA 2P3SA 3DEAA 2ZFUA 5EHIA 4MV6A 1T0JB 1DXOA 4CL2A 3AY0A 4D8WA 3GEGA 1HOTA 2AOUA 4DBLE 2C7GA 3HVUA 2FUG1 2D5IA 3G0CA 4F71A 4JJAA 1K2VN 3ASUA 3USZA 4DA4A 3D43A 3AUKA 1OW3B 1JGTA 4B3XA 5I7WA 5TNXA 1XCJA 1ULSA 3HFGA 1FCJA 4GXQA 3H87A 4ZTBA 3VYRB 1E6WA 2XOKD 5I8WA 4KLNA 3KR0A 5BXQC 5IVKA 1H3NA 3EGOA 1D2RA 3RIYA 1SXJA 4I6JA 3VVLA 3IUMA 1KAHA 2VNIA 1UP7A 3LX4A 3BKXA 1VJ1A 2JKZA 4FOOA 2Z4SA 1HDGO 3U31A 3ULKA 4NAVA 5DB4A 4J4BA 1G291 4AJLA 5K3AA 4BU1A 2QIPA 4IRUB 3GELA 4DHEA 5TJ9A 4ZDKA 4B6PA 4O5OA 1QPGA 4G0OA 2BJVA 2B7CA 1EH5A 3H75A 5CPFA 4ZOAA 1TU0A 5LQUA 2IDMA 1VJ5A 3EEOA 2B5VA 4M8NE 3VZCA 3ESQA 3EUEA 4R8SA 4ID3A 2PWBA 3GNLA 2IZOA 1TPZA 1AKNA 1Z7BA 2R1VA 4LF6B 3THSA 1JFLA 1QDLB 1SA0B 3SR4A 2UUCB 4WNYA 4HWOA 4LXQA 4CMCA 4ZEWA 2W6OA 2VK8A 3IOMA 3PCRB 3NYQA 4P5DA 3QI2A 4XIIA 3TL2A 1Z63A 3TSAA 2W5UA 4GKBA 2ES4A 1CHDA 3SPXA 4KHPB 1Q7EA 5E6RA 1M1NB 1YA4A 2OV4A 1FVXA 1KRWA 4MCHA 2F1KA 3O92A 3RDPA 3WRVA 1N92A 2QMOA 1KK0A 5FUQA 1PBTA 5CVEA 2CNBA 1FLVA 2VSFA 2GJ4A 3I04A 4N0QA 3TS1A 4BNVA 5J1SB 1JDBB 1P7ZA 2E82A 3BL5A 2R7MA 5FOWA 3C5CA 4KW7A 4HLCA 2IEBA 3SF8A 2DM6A 1FFHA 1RHQA 4R7GA 4NICA 4BXOA 2PX3A 1I7LA 2IHVA 3Q3EA 3PLNA 1JS1X 4NBNA 1ZRNA 1UBMS 4J90A 1BFDA 4V3BA 1XEXB 3S2ZA 3G6KA 4LRQA 2J0UA 2WTAA 1QYWA 3KJEA 1JAXA 1YONA 2XNJA 2P2ZA 4HXGA 1LX6A 2G4LA 3EQ2A 2LDXA 2Q4RA 3ILVA 5ISMA 4N7JA 4JU8A 1PFUA 5CXUA 2N47A 3DM5A 3GAFA 5JSYA 3ZNOA 5HM6A 5J4KA 2NTNA 3A9WA 3IMCA 3FVQA 4FGLA 1OY1A 4Y6PA 4II7A 2ZUCA 1CPYA 3RJ5A 2JF0A 3PA6A 1MQ8B 1IBCA 3Q11A 4R1UA 1I7NA 2O8NA 1O6GA 2VAMA 4XIJA 4Y0AA 1FX0A 5AUNB 3UXMA 4W6ZA 3ER8A 1GZHB 3BXGA 5KINB 2DPLA 2YJ6A 4US0R 5IUKC 1UXOA 4DWVA 5AW8A 1E8DA 1ZGJA 3G68A 5ERYA 1BX0A 4PC3A 1AZWA 2IV2X 4UPEA 3PHGA 4UU1A 1KYTA 4YR9A 1EHIA 1B73A 4DG5A 4YWHA 5C31A 3EHDA 1IATA 4YXWA 3T3IA 1CS0B 4J29A 1Q0QA 3IMGA 4EG7A 4PFKA 2X7JA 3PNKA 4RZIA 5C3UA 3WQSB 2OUKA 3EGXA 3FD8A 3W3AA 4YR7A 4PSUA 2DQZA