4CR8A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase with nad
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
b'RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKDGRSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
molecule tags Oxidoreductase
total genus 92
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr8A00
1HSOA 2DFDA 1SZJG 3M1AA 3GGOA 3PLNA 1Z7EA 1MUUA 3HE3A 5BSGA 3ZNPA 2JAHA 2IRWA 5G4KA 2PZKA 3U09A 3GEMA 1IPFA 1IZ0A 5KCZA 1ISIA 2WYWA 1E7RA 4EUEA 1RM4A 2B35A 1D1SA 1E1LA 1M75A 2YV3A 1KVRA 2NTVA 1QYWA 3WYCA 3ULKA 5B4UA 3NGLA 4LSWA 4JIGA 3ZWPA 5GY7A 4UVHA 3VPHA 1U5CA 4IXWA 1O94A 4ONEA 4OQZA 3QE3A 5DN9A 3INTA 5JCJD 2E48A 3OJEA 3OQBA 3GPIA 4LISA 4RPKA 3ZV5A 1NQTA 2HO5A 3GVPA 2VOEA 2NU7A 2XXBA 4R9SA 4RF4A 1PQWA 5ILOA 1I01A 4ZVVA 1AGNA 4I08A 1P44A 4F6LA 1VPDA 3NTRA 2X9NA 4RLSA 5AOVA 4EEXA 1DLIA 3OIFA 2OXIA 2Z95A 3I9JA 1RM0A 4CLRA 4J43A 3QLJA 3IQDB 4XYMA 4ZHSA 3VAZA 5A9TA 3V2UA 3KOUA 2HMWA 3FTPA 3CSDA 1WZIA 1O0SA 2FZEA 1GPDG 3V1UA 3OQ1A 4AJLA 3LF2A 1ADBA 3O26A 3MOGA 3NV9A 4M89A 4J7UA 5DBGA 1DRVA 4B4WA 1NFFA 5HBRA 4CM5A 5ER9A 4YT4A 1PGJA 4XYLA 4BNZA 1B15A 4X54A 4ZD6A 1C0IA 4AJHA 4EITA 4NBUA 3KLPX 2NNLD 4K6CA 2WTBA 2VHZA 4KQXA 3MEQA 4XX0A 2JHFA 3NDJA 4R68A 1DEHA 4AFNA 4RPGA 1XLTA 2X0NA 3TFOA 4J1SA 3KXDA 1F14A 1QG6A 4YBZA 1Y9AA 3SBOA 3JQ9C 1I30A 1LC0A 4N5MA 1ISMA 1M6HA 1E1KA 2JKVA 1PTJA 1ZFNA 3OP4A 3PEFA 1UR5A 1ZMTA 5THKA 4FIZA 4WCDA 2Q3EA 1DOHA 1GZ3A 1QLHA 1ZSYA 2XOXA 2Y1FA 4MIEA 3VVCA 2GYYA 4IDFA 1PR9A 1TI7A 5JYDA 3PGJA 2JD0A 1SNYA 4FR5A 4QEDA 3WMWA 4I5DA 2RIRA 2DFVA 4O63O 3TN7A 1HKUA 4AL4A 2I66A 1DFIA 1VL6A 3LT4A 4CV2A 3FD8A 3KTDA 4MVJM 2E6UX 4YB8A 2P9CA 3BMCB 4GGOA 1QYXA 4A10A 2QRJA 2OZPA 1U7TA 5EQFA 2X9GA 1PJCA 3ZHZA 2GN8A 4U6QA 5A9SA 2GERA 4RVGA 3AUSA 4XZ3A 3FR7A 3GZNB 1Q0LA 3U49A 1A9YA 1NHWA 3DBRA 3UGKA 4CR8A 1VSUA 2NU8A 3H3FA 3QA9A 1UXJA 4DIBA 3JYNA 3JQ8A 4I5FA 5CDSA 4TMFA 1LDYA 4Y6PA 3TRIA 1YE3A 3FR8A 4WLOA 1FXSA 1CQJA 1CF2O 1YB5A 3HQ4O 1E6UA 4HNHA 3E8XA 1U5AA 2PA3A 4IINA 3V2HA 1UH5A 4BO7A 4YJHA 1K3TA 1PGNA 2EIHA 4R5HA 3W4IA 2GD1O 1FMCA 1VI2A 4KTVE 3GUYA 3FTNA 4EYEA 1D7OA 3TZHA 2EW2A 4RPHA 4J4TA 3GR6A 5BR7A 4BO0A 5L51A 5LDGA 1Q7GA 3UH1A 2CVOA 3TF5A 2AQ8A 2C5AA 4XYGA 1NAIA 3EVTA 7MDHA 3ONEA 4DTIA 2AXQA 1EFKA 4D43A 2OUIA 2DUUA 4TSKA 1FJHA 3FWNA 4RO0A 3WBFA 4MIOA 3ZWOA 4LSMA 5EPOA 1RKXA 1XU9A 4F3YA 4NJOA 5JMPA 2I67A 4CMKA 4Z9XA 4CUKA 4NBVA 3IP3A 1G0NA 3S8MA 1LSUA 3KO8A 1C0LA 5LDHA 3UAGA 1NR7A 3QVTA 5C7OO 2EF1A 3GMSA 3ZU5A 8ADHA 1ZH8A 4FFPA 3WGZA 4FS3A 2PY6A 2OBYA 2IODA 3ROPA 2P2SA 3ASUA 4NU6A 3TZKA 2FY8A 3HZZA 3ZV6A 1MX3A 1YOVA 4B7CA 2PH3A 3I4CA 4RZHA 1SC6A 4Q3CA 2X22A 1ZK2A 3GY0A 5TT1A 2Q4EA 5H82A 4OOFA 3A4VA 3HWRA 2EHDA 4L74A 1I5RA 3W6ZA 3GOHA 3M6IA 4WLFA 2PGDA 3MOIA 4GSLA 3VPFA 3L07A 4MKRA 1VE9A 4CL8A 2GCGA 4OM8A 2UAGA 2BI7A 3ZZNA 3H9GA 2GR9A 1WW8A 3E48A 4QUKA 4PVDA 3DTYA 1I36A 3GH3A 1HZZA 1LEHA 2DPHA 3JQ7A 5TGDA 4B8ZA 1C14A 3ADOA 1T2CA 3EZYA 3Q6IA 5L3ZA 1R66A 5TLSA 3F46A 4GX1A 4NR0A 3F1LA 4A03A 4BNYA 5EJ2A 4PLGA 4CV3A 1F0YA 4J9VA 3FNFA 3C24A 1BMDA 2I65A 4CQLB 2VUSA 3AM5A 4W6ZA 4WKGA 2P68A 4R5MA 3WGTA 3D0OA 4GPD1 2QRKA 1P1RA 1QSGA 2E4AA 2JD1A 2QYTA 5COQA 3GDOA 1HTBA 3DDNA 2NVUB 1JAXA 3SX2A 2P4HX 4DC1A 1BVUA 3MJTA 5JY1A 5DOVA 2Q46A 3F6YA 1YONA 3QWIA 3D3EA 5C5IA 3U0BA 4RQUA 1LBEA 2ZTMA 5EIOA 2BMAA 5FFFA 4YAGA 2UDPA 5BQFA 3D1LA 1N8KA 4EBFA 3RC7A 2ZJ0A 1Y5MA 2YHIB 3VOSA 3VZRA 5IZ4A 3AUAA 2O7QA 2VHYA 1ZBQA 3GZ4A 4RGBA 4RDHA 3WWYA 4E3ZA 4DPKA 3H9UA 3WIEA 1Q0HA 4OXNA 3RASA 1P1FA 2ZCVA 3T7EA 2J8ZA 2J3IA 2VYNA 1PWXA 4D44A 1WLYA 2TMGA 4UREA 4RORA 2EWMA 4P8RA 3UKOA 2W2KB 3MJVA 4BVAA 2DBQA 1AE1A 2X5KO 2XXJA 3LT0A 1IE3A 4DUPA 1WDMA 1H94A 3BZUA 4OIMA 1LX6A 3JQFA 4LRSB 3GT0A 3AM3A 4O59O 3RD5A 4UAGA 2OP1A 1U3TA 5H83A 1E6WA 2DLDA 1GY8A 3ZDFA 4F45A 5I8WA 2Y66A 1VJ0A 1PEDA 1PJ2A 3OIGA 3P2OA 5KKAA 3JD4A 3L77A 4FFMA 4ZQBA 5G0WA 1GAEO 1J0XO 1ENPA 3A9WA 3AUTA 3GHHA 4PVCA 1ARZA 3ZWVA 1V3UA 1GEEA 3E9NA 1O95A 2C2XA 4W9NA 5L9AA 1GZ4A 1YBVA 2R2GA 4G2NA 4R41A 3IC5A 2I6TA 2JCVA 5MGBA 5ICSA 2PGLA 3EZLA 2PGJA 2HK9A 1I0ZA 2IE0A 4NH4A 4CMHA 2DKNA 5T64A 4XYBA 3ZGYA 2W98A 3MCVA 1ZSVA 5KVVA 1P31A 1B8VA 1Y8QA 1CETA 1DIAA 1HDCA 2YYYA 4IS2A 4XGKA 2UUOA 3GEDA 1A7KA 4L73A 5G0UA 3BIOA 4JK3A 4FFNA 4KDEA 4PRLA 3I1JA 2RBEA 3Q9NA 3KB6A 1R12A 3F1KA 3AI1A 3C7CB 3H65A 4JLWA 3BTSA 3JV7A 5KJCA 4YRBA 2JL1A 5TJHA 2YV1A 1C3VA 2P4QA 2GUGA 4O6VA 3P19A 1EEHA 1B0AA 1N1EA 5KVSA 4YTEA 4HADA 5JBIA 4ZA2A 1YDWA 4UVGA 1NTOA 2NV6A 5CDTA 1U8FO 2BGMA 4H15A 1N7GA 3W4JA 3PZBA 1ENOA 3GHYA 1W73A 4DLLA 5L4NA 3ENNA 3B1FA 4OJNA 3RFVA 2Q2WA 4LN1A 3OA2A 3FPCA 4AJPA 1ZO8A 2H6EA 4DIOA 3GN1A 4R16A 1KEWA 2VNSA 4M87A 3K2EA 3UFXA 3I23A 1KVTA 3I9LA 1LDEA 3F5QA 3MWEB 4QX6A 5G4KB 4BV9A 2Y0DA 4DL9A 3JQBC 2B69A 1VC2A 1O6ZA 1XA0A 4J3FA 3ZHXA 3UICA 1DRUA 3A1NA 5DCUA 1R4MA 1VRWA 3DOJA 2VRCD 1CEQA 1LU9A 4CMIA 1E5LA 3N7UA 2CFCA 1I2ZA 4F6CA 4R1UA 2O3TA 3PHIA 3WX0A 3Q2KA 1LJ8A 4PG5A 2OGUA 2ET6A 3TZ6A 2W4QA 1EVIA 2EJWA 1B8PA 4MIYA 4E21A 2A92A 2X23A 2YQ5A 4FSHA 5JO9A 1YL6A 5EINA 1WAMA 3WMXA 5HM8A 5JAIA 1HE4A 3VKUA 4EJ0A 4II3A 4MVJE 2O2YA 2QZ9A 2FZWA 5ENDA 1YXMA 2Y67A 5IDWA 3QVOA 4RVUA 4B3JA 3VVBA 4JP3A 4OXKA 5K6AA 1B14A 4Z0HO 2YFHA 4EW6A 2DBVO 2JD2A 1QXSA 4CM4B 3LC2O 5F1KA 1B3BA 3WB9A 3PHJA 4D41A 2RCYA 1GU7A 1EQUA 2JCYA 4BNUA 1MB4A 4UULA 4RJTA 2AQKA 4AJNA 1ISHA 1PL8A 4FD3A 1LXCA 4P38A 4ESOA 2QHXA 3FNEA 2GZ2A 2V6GA 3OH8A 1O9BA 3HDYA 4KTTE 4CM8A 1A71A 4KWHA 1JA9A 1NWHA 1P33A 4FDAA 5L4SA 3IUPA 4MVJD 4YCAA 3ON5A 3IUSA 4XGNA 3WWZA 4XDYA 4Z9YA 4EJ6A 4KDFA 1YB4A 3PYXA 1HDRA 4U6SA 3S2EA 1PU2A 3PRJA 5C7LO 1KC3A 2FN7A 3CMCO 4JNKA 2W2LD 5F21A 4OKIA 3TL3A 4XKJA 4WPGA 1ADGA 4ZICA 1BTOA 3V8BA 4YRAA 4WLVA 3PFFA 4I9HA 1JLLA 2EP5A 5A05A 1MC4A 4CJXA 2FPGA 1H9AA 4QO8A 1LSJA 2JJYA 4IJVA 5K0ZA 1HYEA 1I24A 1X0VA 3KSDO 4BKRA 3RUEA 3RKRA 3KEOA 4HY3A 3DAGA 3AU9A 5JCXA 3DZBA 1EK5A 4LMRA 2CVZA 4QQRA 5U1PA 3BHJA 4EEZA 5B4TA 3H9JA 1NQOA 3GGPA 3PHGA 3RUDA 4BO8A 3LQFA 3RFTA 1T2DA 2FHSA 1YH3A 4IUYA 4ROSA 1PJLA 3VH1A 3VTFA 3WICA 3AUUA 2DTDA 3BTVA 1VJTA 3RIHA 1Z45A 4ZGWA 3DBRB 1TLTA 4HBGA 4CLXA 1JU9A 4UVDA 4E2ZA 1DAOA 4YYZA 2Y0EA 3KYDB 4XIJA 1U1IA 4Z9FA 3KRTA 3JQ8B 4UUNA 4DPLA 2VT2A 3FBTA 4NK5A 3DOOA 3EYWA 5AYVA 2J5QA 1U28A 4MJLA 2WE8A 3TOZA 3F5SA 1UP7A 1Z74A 4PN3A 3D3WB 2AA3A 4NIMA 4YJHB 4NFHA 3WSWA 2HAEA 4BNJA 4CQMA 4HNGA 4E4YA 4JGBA 5KKCA 2AE1A 2VWHA 3GAZA 1PZHA 3I6IA 4J6FA 4YR9A 1QYVA 4S3MA 1DO8A 2GF2A 2WWRA 4IPTA 2BF7A 1R37A 3DBLA 3I9NA 4RF2A 1B2LA 3DB2A 3OBBA 5CEFA 4EUFA 3EY4A 1QR6A 3GEGA 3PHHA 1JW9B 4AG3A 5DP2A 2CDAA 3MJCA 1PR3A 4K28A 1UDBA 3Q11A 4PLVA 3ITKA 5KIAA 2ZB4A 4RPJA 4NJMB 4IGEA 1P1HA 4GWKA 3ZHYA 3KEQA 3K5PA 4PLTA 1VSVA 3SC6A 1EQ2A 4OSOA 1IPEA 1XU7A 3T4EA 1KY4A 5A5EA 3DBHA 1E3JA 4Q3AA 2X5JO 4Y98A 3LC7O 3RCBA 4H7PA 4HUJA 3DZGA 1JN0A 4WOKA 3O8QA 4D46A 3DMTC 1P0CA 4R3NA 1GQYA 3CXRA 2OO5A 4DYDA 3RBZA 5KOIA 5KJEA 1EBFA 5JDIC 3PJFA 4GH5A 2BI8A 2WYVA 4WCFA 2VRBA 3UN1A 1DAPA 1HRDA 3PQEA 4M55A 3DO5A 4PLFA 5AXBA 2PZJA 1LTHR 1TT5A 2CF5A 5B1YA 2JAPA 4E2XA 4I9NA 3L4BA 3JD1A 4U7WA 1UZNA 1DHRA 4CR7A 4DMLA 1GYRA 1DPGA 1NQ5A 4WNIA 5G0SA 4RV9A 1ZZEA 3KLMX 3ZWXA 4E5MA 3OIDA 3PTZA 3ZWYA 3PIDA 1OMOA 3TFQA 3DR3A 2NTNA 1A5ZA 4BMSA 2I5PO 2V6FA 4NHEA 1O89A 4DQXA 2TMDA 3ANMA 3LF1A 2X0RA 4JN6B 2EGHA 1KY5A 1ZW1A 3QY9A 3ROKA 2W8ZA 3H7AA 3PYLA 4P4LA 4J49A 2WMDA 4JXKA 3JYOA 4BIIA 4IJKA 3KSUA 3S55A 2GASA 1DIHA 1E7QA 3KYCA 1JKIA 3SC4A 4Y9DA 4YJFA 4ZRMA 2VUTA 2ZYGA 3QWHA 2A4KA 2X0JA 1Z82A 1AHHA 3B70A 2C54A 4JCOA 5F3RA 3SXPA 4BQRA 4II2A 4MVJH 2FR1A 3O9ZA 3AY3A 4OXYA 5IDXA 1K6IA 3PDJA 3VKVA 1SOVA 3T4XA 1M2WA 1I32A 2UV8A 1PL7A 1K6JA 1NNUA 4KWIA 5JO0A 4PCVA 3HADA 3FCOA 2Y1CA 1XIVA 2Y1OA 1LRJA 3VH3A 4BKPA 4E2WA 4RVDA 2WE7A 2G1UA 3EC7A 4HFRA 2ZCUA 3BYZA 3ZNNA 4TRNA 1X7DA 4XRGA 3CPSA 1F17A 3LU1A 4QSMA 1XQ1A 3NRCA 4IIUA 4BO6A 2VQ3A 1FDSA 4FOSA 4CMEC 4HWKA 1M67A 2B0JA 5IF3A 4DWVA 1KS9A 4LW8A 5AXDA 1BDBA 3RUHA 3EVNA 1F12A 2RAFA 4D42A 2X58A 3ONFA 4RCVA 3GDGA 4GKVA 1P45A 1C1DA 1YL5A 1GADO 4BO4A 2JFFA 2D4AA 1BW9A 5KJ6A 2JFGA 2PFGA 1X13A 2HK8A 3QVWA 3DZFA 3JQ6A 2CSUA 1GYQA 1IB6A 2D1YA 3X2FA 1LLCA 1W0CA 1YL7A 4A0SA 1YB1A 2QG4A 1HDZA 3BMOB 3UUWA 3O03A 1DBVO 2Q2QA 1H6CA 4FJ0A 3TQHA 3QJ5A 3DTTA 4MKXA 1QORA 2PD6A 3W6UA 1Y8RA 3NDRA 2Q99A 4OHUA 3IKTA 3ICCA 1LDMA 2O50A 5CDUA 5DCWA 1TT7A 1WP4A 3PWKA 1GEGA 2WSBA 3I3OA 5IZCC 5KVCA 3PZRA 2Y68A 2X1HA 4BO9A 2AEFA 1R4NA 4J91A 4EUHA 5DOZA 2VYVD 5JE8A 4E5PA 1EK6A 1BXGA 4DYVA 2HKIA 3ONDA 3FNGA 5IDQA 1HETA 4Q3BA 4E31A 4CMCA 1ISJA 3DHNA 4J16A 4HV4A 2ILTA 4CM7A 1RWBA 4C7KA 4E5NA 2R00C 4FFOA 5ITWA 3B1JA 4QO7A 4PIVA 3WGOA 3KZVA 4RVSA 2PTGA 5CG2A 4Y6RA 5G2OA 5ES3A 2P91A 3ZI0A 3H4VA 5G4LA 1RYEA 3BTUA 3S1LA 1HLPA 4IJUA 3CZRA 1KBZA 1WMAA 3WOHA 1XR3A 4CLHA 1N9GA 3M1LA 2WYUA 4BMNA 1NASA 1KEUA 1PS0A 1R0LA 1DJNA 1E3SA 3H9EO 5JDCA 4CM3A 1BHSA 2PD4A 4NK4A 4UVEA 1GPJA 2BRUA 3JQGA 4J2OA 5FEUA 2FR0A 4G81A 1ULSA 1T24A 5JY6A 3OECA 4YAIA 4JBGA 3WQSB 5JC8A 4TVBA 2SCUA 1E7WA 3JYLA 3PQDA 1A9ZA 4G5HA 2B5WA 3M2PA 4MPDA 4EZBA 4IZIA 1U7HA 5JXWA 1Y9EA 3KHUA 3BMQA 3JYQA 2V65A 4NFSA 3C1TA 4EI2A 4AJEA 3ZU3A 3INRA 4RQTA 2ZK7A 4I9UA 1YGYA 4KUGA 2G82A 1EDZA 1IHXA 3VZSA 4Z3KA 2CNBA 1GCOA 3UCFA 1V8BA 1VKNA 4D7AA 5H81A 1BGVA 1IULA 1UXGA 2ZKLA 4HFNA 4L9RA 3A06A 2EEZA 1U2GA 3GFGA 2C82A 3O38A 3IIEA 4UVIA 3Q1LA 3TNLA 2CVQA 4JBIA 5JLAA 1W6UA 3I9MA 2HU2A 3WS7A 2FOIA 4E13A 1T2AA 4R1TA 3P5SA 3BMNA 3ZWNA 5CP8A 4UEJA 1TEHA 1V35A 4OO3A 5J23A 3RU9A 3DWFA 1T4BA 1UP4A 2EKQA 3VZPA 4CLOA 3Q0EA 4LVCA 5A9RA 1WDLA 1J5PA 1MGOA 1RJWA 1JQBA 1FDWA 4L4SA 5IG2A 1K89A 3JQAA 3MJSA 1BVRA 3E5RA 5DBFA 2J5KA 3ZU2A 1E3EA 5A1TA 3C1OA 3KETA 2CMDA 1KOLA 4IDDA 1UXHA 4QT0A 2AE2A 1LRKA 1Z7BA 4JJIA 1NFQA 4KUHA 5TT0A 4M86A 5TNXA 3LZ6A 3ETGA 4N7RA 1JWAB 3OMLA 4U5QA 4IBOA 4LCEA 2AEMA 2YHUA 5HWSA 2HJSA 3TZQA 4WASA 1VL8A 1I8TA 1I3NA 1QV7A 4YQZA 3PVZA 3NDIA 4U0JA 4A73A 4XB2A 3IJPA 4GQAA 4N18A 3T7CA 3E82A 1H5QA 3PQFA 4YRDA 4A26A 4IMPA 1LA2A 3G3EA 5T8KC 1ZK1A 3R1IA 2UUPA 4MVJP 5G0TA 3C7DB 3BTOA 4DLAA 2DBRA 1HLDA 4XWYA 5IFLA 3I83A 4FFLA 1MFZA 2Q1SA 1ZCJA 3PWSA 1ZK4A 1PX0A 3AW9A 4IDEA 4NBWA 5U9CA 1GL3A 1NXQA 1MV8A 3PJEA 4IZHA 1T1RA 2O3SA 5DP1A 4BNMA 3LC1O 3WQRA 1DFHA 5HS6A 3STHA 3KYBA 1G6KA 1HEUA 3PI7A 3U4DA 4CLDA 4CPDA 4OSPA 2VOJA 1Y5RA 4AICA 4CV1A 1PZEA 1CRWG 2J3KA 4YAJA 3UCEA 4CL3A 3MTGA 4FC7A 3PPIA 3R3SA 1PSDA 4WECA 2P5UA 3OJFA 2DQ4A 3NT5A 3VC7A 1IOLA 4MP3A 3GDFA 3H5AA 4DA9A 3CIFA 4RF5A 4C7JA 1OI7A 5JPIA 5A04A 3PFWO 3AI3A 2OOSA 3FPLA 4IM7A 3W8FA 4AJOA 4OAQA 1IHYA 4B7XA 1GQ2A 2ZB7A 4JQCA 1GUYA 3FN4A 1LDNA 1H2HA 4ID9A 1SBYA 1V6AA 5FYDA 3K31A 4AJ1A 3A14A 4R1NA 4CQMB 2DTXA 1NYTA 5L40A 1I3MA 1Q2XA 1QYDA 3H8VA 5L7WA 1CIVA 1UJMA 4GLLA 4XRRA 2QYSA 4KOAA 2DPGA 3DBLB 2BFPA 2NQ8A 1HYGA 3Q2IA 4DXHA 1MXFA 4B7UA 1H6AA 2CDCA 4BNLA 3P2YA 5LC1A 1F8FA 1UXIA 3TJRA 2X5OA 1JTVA 2BHLA 2Y1GA 2D5CA 1JVSA 2PKQO 1CQIA 4JJGA 1R16A 2WM3A 5JAQA 3K2BA 3UXYA 3OICA 3ZNQA 5TIIA 3W8EA 4YDRA 3ZHBA 1P0FA 1A4IA 4R01A 3VZQA 2J3JA 3DBHB 2GZ3A 2P5YA 5ER6A 1UP6A 2C7GA 2EERA 2X0IA 4I8XA 2X7HA 4Q3EA 4ILKA 4BHTA 2Z5LA 3GC6A 2ZJ1A 3BMCA 3ZCXA 2I76A 4XYEA 3ST7A 4MVJA 4OOEA 2I99A 3NJ8A 1PS8A 3QVSA 2JCXA 3OF2A 5B37A 4YPOA 4ZQGA 1O5IA 4RLHA 5CG1A 5BNIA 2DBZA 1G0OA 3H2SA 1E7SA 3LVFO 4WOJA 2AHRA 3U4IA 4IMRA 1AN9A 2W2LA 4YQYA 3U62A 1T26A 4HX5A 2YUTA 3AU8A 5IDYA 3RVDA 3WGHA 4J1TA 1PJSA 1ZK0A 1ZXLA 3GNTA 2BFMA 4JP2A 1AUPA 4U8GA 2YQ4A 1EUCA 1IYZA 3QP9A 1YQDA 4QECA 5A5FA 3TWOA 1JDJA 1E3IA 1GTMA 4WEOA 1E1MA 3UOGA 2IYOA 2O4CA 4KUEA 3WYBA 4W7IA 1GCUA 2ZYAA 3N58A 5JFOA 3JD0A 3D64A 4HKTA 5EQDA 1E7YA 1DC4A 1LUAA 2IYPA 1N5DA 4HFMA 3G17A 1ZKMA 4GL4A 1UDCA 1NVMB 1DXYA 3B1KA 4NQZA 3RQSA 5A3JA 5COAA 2PLAA 3JQ9A 3CH6A 1ULUA 1D4FA 1DIGA 4NMHA 4BKOA 1NVTA 5CPFA 1MG5A 2EG9A 4FBGA 3KUXA 3TDKA 3DAFA 3OA0A 1AHIA 4DIFA 3JQEA 3KSZO 4J90A 1EE9A 1QV6A 1A7AA 2VYND 4PZDA 3FF4A 4BL5A 2D2IA 1LC3A 1QLJA 2NWQA 1WNTA 4JX8A 3K96A 3GGGA 4WNCA 3GUCA 1PIWA 3C3XA 1DRWA 2AQHA 2VZ9A 3PLRA 4CLRB 5GMOA 2OBNA 4TQGA 4JJFA 4NU5A 5T57A 4B4UA 4NPCA 2EKLA 1Z73A 4YT2A 1L1FA 4CM9D 1A72A 3EUWA 2BD0A 2EV9A 1JAYA 2VNAA 3LLVA 5EL0A 5BSEA 2H1SA 2Q1TA 1I3LA 2YDYA 1MFPA 1QRRA 3F4BA 2FPIA 4ND4A 4TZKA 1YBAA 1NBOA 3AM4A 4BNVA 1ZMOA 4GLOA 1PJ4A 1QP8A 4TVOA 3AFMA 4N5NA 5HRUA 4BGVA 5IAAA 2EP7A 4D45A 3RU7A 3VPXA 1ZVMA 2JFHA 2J6IA 3U5TA 3UF0A 4LRTB 1U9JA 1X0XA 3DZKA 3ANLA 4R4JA 3C8MA 3JD3A 1HE3A 2X4GA 2C20A 1E5QA 2UYYA 2ZTVA 4CR6A 3WTBA 4PG8A 2W90A 5I8ZA 2ZB8A 4E30A 2HK7A 3F9IA 4FN4A 2XAAA 1DC5A 2RH8A 1W4ZA 5CDGA 5I7FA 4L76A 3WLFA 1VKOA 1PQUA 1ML3A 1TXGA 2Q49A 4AJJA 2Z1MA 1LNQA 4GAEA 2LDBA 3MJEA 1YVEI 3RJ9A 1Y8RB 5HTOA 3ZW8A 3F47A 4CQLA 3AY6A 3W8DA 3NT2A 4IGFA 1YBMA 1U2DA 1H6BA 4I1IA 4K9DA 1YKFA 3CZMA 4P4GA 5COBA 2IDZA 1F8GA 2NVUA 1HE2A 3RFXA 3WXBA 4BKQA 1P3DA 4GI2A 3KBOA 1I33A 5I7SA 5I9MA 2UVDA 4M1QA 2PD3A 2GRAA 3WBBA 3ZW9A 2BFOA 2QZZA 1BRMA 1P1KA 1IL0A 3HFGA 4Y6SA 1R4NB 4GKBA 3HDHA 2LDXA 2ZTUA 3HFSA 3ZWAA 4NZ9A 1EFLA 1UAYA 4E5YA 1V9LA 3ENKA 5FI5A 4MO2A 2H9IA 1ZSNA 5A9SB 3P7MA 1VLLA 1S7CA 5BNFA 4LGVA 3AOEC 3TOXA 3DAPA 5MDHA 1WXDA 3ZNOA 5DZSA 2O4UX 2I3GA 5EMHA 2J5RA 4WUVA 3RC2A 2D5AA 2G17A 1L7EA 4WLEA 1YJ8A 3JQCA 1DDOA 1E1NA 4HXYA 1B7GO 5JCJA 4B4VA 3ADPA 1VL0A 4RZIA 1YO6A 3LLSA 3AFNA 2BGLA 2VWGA 2W2KA 1LI4A 1UUFA 3PIIA 4BNTA 1Q7CA 5G0VA 2IEDA 3ETEA 1ENZA 3B6ZA 1HZJA 1SEVA 5L45A 1DHTA 1NQAO 3PHLA 4BGUA 4B4OA 5DCYA 1T1SA 4NBRA 2F1KA 2VHWA 4ND1A 1BG6A 1J6UA 3CUKA 3AK4A 4IDGA 3WG9A 5HS4A 4YJGA 3D5TA 1BXKA 1EUZA 1X7HA 4TKMA 3GA0A 3DBVO 4WGGA 3OHSX 4URFA 3WFJA 4FOOA 5FWNA 2NU9A 1V0JA 1K5HA 2A94A 4XEHA 3RUCA 4M49A 4O0LA 5I7EA 2OL4A 1I2BA 1BWSA 4RDIA 2V6BA 2WD7A 4AJ4A 2ZB3A 1S6YA 3HB5X 3FWZA 4OQYA 3NAQA 1SB8A 1OOEA 3UVEA 1NHGA 3GAFA 4IDAA 1ZNQO 4EGFA 5GZ1A 4GVXA 1XELA 1YQGA 4FB5A 2DAPA 1BDMA 2HLPA 4BMVA 3BA1A 3M2TA 3GN2A 3ORFA 4S1VA 1YOVB 5GZ3A 3OEYA 4E33A 1V3VA 1NR1A 1HDGO 1PJTA 4NDNE 3LSYA 4A7PA 3AY7A 4DBVO 1GV1A 3EAGA 4WJZA 1GR0A 4YA6A 3DXFA 2PK3A 5DT9A 1U3UA 4TRJA 5TX7A 3G1UA 1T2EA 4MOWA 5U4QA 4C4OA 4CLOB 4D3DA 4BNGA 1CYDA 3OJOA 1X14A 1DJQA 3JQFC 4B3IA 1SOWA 4CMGA 2E49A 2VUUA 4R51A 2VYVA 2O23A 3IMFA 3JQ7B 4R69A 4WEQA 3LT1A 1GQQA 5FI3A 3I52A 5A3VA 3C85A 1PL6A 1P1IA 4E5KA 1NX6A 2EXXA 1PGOA 2DU8A 2POQX 1FK8A 3I6QA 4P4NA 3NKLA 3D4NA 2VZ8A 5AQ1A 3G1TA 1I10A 3SLGA 4W4TA 4K26A 4W9NC 4E0BA 3OJLA 4UUPA 2GN9A 3TSCA 4TKLA 2Y1EA 3NGXA 5AXAA 5IXSA 2RHCA 5A06A 5L95A 4AJIA 3WLEA 4QTZA 1TB4A 3WNQA 5JS6A 1X1EA 4XR9A 1Y1PA 3W1VA 1GFSA 2E82A 4IQ0A 4I5GA 1RPNA 4L0QA 4L75A 1K0UA 3AI2A 1SAYA 5ENVA 4EJMA 2FRDA 1E3WA 2PZMA 1YWGO 3WJ7A 5TS3A 2FSVA 4R1SA 4DLBA 3BAZA 1MG0A 1LLQA 1NFRA 1WWKA 3Q9UA 3X2EA 4BNFA 1EVJA 4MINA 2CUKA 3SEFA 1R0KA 1QYCA 1ZEMA 4B8WA 5EERA 5TC4A 4INAA 4DREA 4YEDA 3WYEA 1WZEA 3IS3A 4L8VA 1DB3A 3NX4A 4CQMD 1U3WA 4YT5A 4E6PA 4GX5A 5A4DA 5TJ9A 3ZH2A 2NM0A 1YDEA 3JCZA 5F5LA 4ALMA 5BNTA 4XQGA 1NPTO 4YACA 1JKJA 5JNLA 3RI3A 3EMKA 4CM4A 2QW8A 4BGEA 4N5LA 1QKIA 2Z1NA 2DC1A 4O5OA 3MJ4A 3G49A 2D0IA 2VTEA 3R0IA 4OKNA 3WGYA 5CFZA 4FJ1A 1A4UA 3S2FA 3RUIA 1DIRA 3JYPA 4DGSA 5FF9A 3DL2A 1HDOA 1XEAA 1C0KA 1ISGA 2GNAA 5DBIA 5KVQA 4XGIA 5IN4A 1I2CA 1OZAA 3EW7A 3HHPA 3WSVA 3VPGA 3AJRA 4HFJA 5C7IO 1T4DA 1XGKA 2WEKA 3ROMA 4CLEA 2GGSA 2HMSA 4DMMA 1U4SA 1HT0A 3CEAA 3JQDA 1E77A 1KVUA 3IDSA 2P9EA 3ZWBA 3C1AA 1E6EA 1CDOA 2OP0A 3JQBA 2X86A 4MVJI 1ONPA 3WTCA 4YXFA 2ZQYA 4GMFA 3TZCA 1ONOA 9LDBA 1H0KA 3H2ZA 3PDUA 1Y8QB 1EUDA 1C1XA 1E0DA 2VZ0A 3LT2A 5I9LA 2X9VA 3QHAA 4PZEA 2B36A 1MP0A 2GN6A 3GG2A 1O8CA 5CEJA 1SPXA 2O3UA 1EVZA 3RJ5A 2IXBA 5B4VA 5L4LA 4KMSA 3HN7A 3ZV4A 2WJPA 2B83A 5CDYA 5C37A 1BXZA 2XPCA 1U4OA 1YS4A 2O3QA 2XF8A 4Y8VA 4E2YA 3HN2A 1PZFA 4W99A 3H5RA 3QIVA 2O48X 5K6AC 3KVOA 4MKZA 1ZIDA 4TWRA 4ALLA 1C0PA 1N1GA 1BSVA 4A27A 3MZ0A 4NFYA 4ZU3A 4MP6A 3KYDA 4J0FA 1SCUA 4R3WA 3TPCA 5I7VA 1HDYA 3E1KA 5JW6A 3PWZA 2BFAA 1ZJYA 1AXEA 2HUNA 5L53A 1EMDA 4J2HA 3RROA 5IJZA 3IOYA 4OH1A 2DT5A 3D3WA 1FDVA 1WPQA 2G5CA 1KC1A 1TVEA 3DFZA 4GMGA 1JWBB 4MVJG 2VWPA 3E9MA 4J4BA 3JSAA 3E6AA 2NADA 2NTJA 3V2GA 1WDKA 4QXMA 4GX2A 2Q2VA 1IZ9A 4BOYA 4IIVA 2C5EA 4Y67A 2AEJA 2Y1DA 3FRJA 3GVHA 1ID1A 2HCTA 2OFPA 3HNPA 4PFJA 4XJTA 5T67A 1R4MB 4Q3DA 3VDRA 1VJ1A 2EKPA 2FPPA 4BNKA 4CMIB 3IJRA 1P1JA 4NJMA 1HSZA 2RHRA 2IZ0A 1LLDA 4PGFA 3VH2A 1EZ4A 4EDFA 3INGA 3TL2A 1KEVA 2IXAA 5B12A 5JAMA 3K73O 2FP4A 3DFUA 4PLCA 3FI9A 4UEOA 1CJCA 1UDAA 4D79A 4J1NA 4HP8A 3DQPA 3H9QA 4ZQHA 4CMJA 3U9LA 4DRYA 1EVYA 1IUKA 3I4FA 2CF6A 2C0CA 4M54A 4XA8A 2B37A 3G0OA 3N74A 4RF3A 5BSFA 5BSHA 2A9FA 2NLOA 1HF3A 1TA4A 3VTZA 3EDMA 3ANNA 1E7MA 3I9KA 1GD1O 3CTMA 2VN8A 5C3MA 4OYRA 2Q4BA 1RYDA 2FSSA 2HDHA 3AOEA 5ADHA 3PK0A 3DOCA 4YWJA 2AQIA 1G1AA 2VHXA 4BNWA 2AG8A 3GK3A 1NPDA 4IY1A 3ZN2A 5T6BA 4AVYA 2PV7A 3ITDA 1M66A 4QFCA 1ADFA 1LRLA 3WJAA 1T25A 4TRMA 4ZQFA 3RBXA 3AWDA 1WVGA 2C59A 1NPYA 4IDBA 4MVJF 3CKYA 1Q0QA 2EJVA 2HMUA 3HUDA 4FC6A 1NWCA 4CM8B 1XWFA 2VCYA 3R6DA 5CHEA 1YQXA 4ZN6A 3ABIA 3WIDA 4IQ8A 3U4HA 1OAAA 1PS9A 1PGQA 5DNAA 2GPTA 1LLUA 2IEBA 3SLKA 1LDBA 2VHVA 3U4CA 4LVUA 5F1OA 3WQQA 4BNXA 1M76A 3V1TC 4IQGA 5K9ZA 1HE5A 2F00A 2VWQA 2Y0CA 1K6XA 3L6DA 2OORA 3K92A 3D4PA 3G79A 2B4RO 1NVGA 4BB6A 2EW8A 4TROA 1H9BA 7ADHA 3RSHA 3QRWA 4BQPA 4WLNA 1OBFO 1FDUA 5F5NA 5T5QA 4DC0A 1D1TA 4E32A 3VH4A 5EN4A 1OFGA 2PNFA 3E5MA 4WCFC 4K1LA 2QRLA 2JHGA 2ZTLA 3DMTA 5CAEA 1GV0A 2HJRA 1L7DA 5JDIA 4D3FA 1B26A 4ND3A 2NVBA 3BXXA 4RPLA 1E92A 3L4BC 3HB4X 4BGIA 3QWFA 2VRCA 4NI5A 3IL2A 1XDWA 1R15A 3HDQA 4ZRNA 8LDHA 1KYQA 2I9PA 3BHIA 3L0DA 2PKQP 3E03A 4PLYA 1X15A 1EBUA 3HDJA 3PP8A 4CMAA 1Q7BA 3ZWCA 1LQUA 4H16A 4CUZA 3GVCA 1P9LA 3IKVA 3QSGA 1LSSA 4XQCA 5CEEA 2BH9A 3HSKA 4CUJA 4D0SA 1YRLA 4DQVA 4BV8A 2CY0A 2G0TA 3WNVA 5TQVA 5A03A 3OETA 2YV2A 3DZIA 3RUAA 5BT9A 2AMFA 3CE6A 3ZWMA 4IXTA 3NTQA 2C07A 3I5MA 2C2YA 3DHEA 3L6OO 1PJQA 4KQWA 4B3HA 3GNSA 4BB5A 4TZTA 1N7HA 1J4AA 2IZZA 3BMOA 5AVOA 2Y99A 1SMKA 2NSDA 4Z0PA 4CM9A 3W4KA 4AJ2A 5GZ6A 4DVJA 3EHEA 4YJGB 1PJBA 2NQTA 4JBHA 4AJKA 3H3JA 5DULA 3WFIA 4YAKA 2V6MA 2HRZA 1Y81A 2J3HA 1U8XX 3A28A 1EE2A 1HYHA 3V1YA 1CERA 2GO1A 6LDHA 1GUZA 1DC3A 4KP7A 3E9QA 3GNQA 4E12A 5KJ1A 1ZXBA 3O8QB 2WD7B 4W7HA 3JQAD 2A35A 4ITUA 1JKFA 2ZIZA 2GDZA 3SJ7A 4WCFB 1KVQA 1YJQA 3GFBA 4K6FA 4F46A 2X6TA 4R9RA 1Y7TA 4W82A 3WGIA 2BKAA 2O3RA 1TT5B 3B20A 2EGGA 5L7TA 4CODB 3GZNA 3DEYX 1NM5A 4DBZA 3GLQA 4PLZA 5ICMA 3ASVA 4WLUA 2O7SA 1PGPA 4CMEA 2HMVA 2GZ1A 4N54A 4OMUA 4J4HA 3QWBA 4BNNA 1ZEJA 2QQ5A 3HG7A 4UEKA 4YT8A 4ALKA 4J0EA 4J1QA 1B16A 1IY8A 4ALJA 1OC4A 1Q1NA 2FR8A 3EGOA 4U0KA 1UXKA 3D7LA 1MXHA 4QFDA 4Q9NA 3D5QA 3NUGA 2P9GA 3K30A 3ICPA 4BO3A 2Q1WA 4Q39A 5THQA 2B4QA 4RVHA 2O3JA 2PR2A 4BUCA 3E18A 4BNHA 4DQUA 3DZHA 4Z0TA 1RM5A 1U3VA 1SB9A 1ISFA 1XSEA 1PQPA 2FWMX 1P74A 2YJZA 3IP1A 3KYCB 1B8UA 1Y6JA 4YJFB 4XJSA 1XQ6A 3NJ4A 4GVLA 1P77A 5KNLA 1DIBA 3GVIA 2YY7A 2O2SA 3NEPX 1XCBA 2V7PA 4O1MA 1H6DA 3WGQA 2NACA 1FF9A 3OEWA 4R54A 5CPBA 1H93A 3PXXA 1QMGA 1ZJZA 4BO1A 4TRRA 4JROA 4BO2A 2AG5A 2Y93A 3CMMA 1SEPA 4A2CA 5IZCA 3GF4A 1OC2A 1GZ6A 1W8DA 2QIOA 5AXCA 5HA5A 2YZ7A 4FGSA 4CV0A 4IDCA 1LSOA 3MWDB 3ZWWA 2RH4A 2E37A 1E3WB 4FGWA 3DHYA 4XDZA 3GVXA 3COSA 3KV3O 1LQTA 3C7AA 1F06A 2C7VA 4J7XA 4CM6A 2HSDA 4XR4A 4PG6A 2CZCA 1T2FA 3GQVA 4Q3NA 4XB1A 2R00A 4GBJA 4KZPA 1HXHA 4PLHA 3VPSA 4CMBA 4XIYA 3QWAA 2B4TO 4BNIA 3LDHA 2YFQA 2X8LA 1R6DA 4XCVA 4GGPA 2IZ1A 3D4OA 5IXYA 2YW9A 2HQ1A 5I9NA 1C1DB 4IS3A 1ZK3A 3U3XA 4XQ9A 3L9WA 1BW9B 4LMPA 1KVSA 5JDCC 1XG5A 1EDOA 5JC1A 1X1TA 4P22A 1NAHA 3FHLA 3ZV3A 3CINA 1KIFA 3RKUA 3RWBA 2R6JA 1HL3A 1CWUA 5L7YA 4CM1A 3PJDA 5LCXA 1DC6A 4RVFA 1DFGA 1DSSG 2Q50A 3LYLA 4J9UE 2PWZA 1ADCA 5TSDA 2NU6A 4YAEA 5KTKA 4M8SA 1X7GA 4FPXA 1NP3A 1FDTA 3L6EA 3UW3A 1XHLA 2ZATA 3H6KA 3UCXA 4ALIA 3GMDA 3AOGA 2BGKA 1XKQA 4MDHA 3I9OA 2DUWA 5EESA 4YVFA 1K2WA 2C29D 5JSFA 5KJFA 3QVXA 2I3AA 4D0RA 1ONNA 2VTDA 3DONA 3O4RA 3QW2A 1UZMA 3K6JA 4LCJA 2ZQZA 3QQPA 4UUMA 1BXGB 1C1XB 5JAZA 1XYGA 4PZCA 4ALNA 5F1PA 3RC1A 2BLLA 3K8ZA 1B3RA 2YHIA 3OFSA 3OSUA 9LDTA 1UZLA 4ZJUA 4H3VA 1I3KA 2NVWA 3ETDA 3GG9A 4Z3DA 1GUFA 4D3SA 4OGWA 3WGGA 6ADHA 3QV1A 4J7CA 1WMBA 5ITVA 1MA0A 2DM6A 1DLJA 3FSRA 1HWYA 2H5LA 4RL6A 1KEPA 4BS9A 5A02A 2ZYDA 1HDXA 2GLXA 5JMWA 5TF4A 1KETA 3JTMA 1N2SA 1E3LA 4XQEA 1PZGA 3H5NA 3R3JA 4WE3A 3UHAA 4BKUA 1N9GB 2YDXA 5KWEA 2OMEA 1ENYA 3F3SA 3PJGA 3DMYA 1GYPA 4XD2A 4NG5A 1MC5A 4L4XA 3FNHA 4FQ8A 2GN4A 1AXGA 2DVMA 2HRBA 3GRKA 3L9XA 3OJ0A 3JQGB 5JYEA 4PLWA 4GSKA 3ZU4A 3WDSA 3NYWA 2AW5A 4IJWA 1SO8A 3Q3CA 1RM3A 3WR5A 4PG4A 3S2GA 4A5OA 3MTJA 3FBGA 1KERA 2NUAA 3SJUA 5DF1A 3V5NA 3SVTA 3BMQB 2CD9A 3PGXA 2Q1UA 3LK7A 3RBVA 2CDBA 5DDIP 3PYMA 2HMTA 1H2BA 1R0SA 3EK2A 4L4RA 4NBTA 2GSDA 1V3TA 1A27A 5T8KA 4FW8A 4ND5A 2BELA 3VHRA 3VDQA 4WK6A 4LK3A 4FCCA 1ZUD1 2D3TA 4I5EA 1Z6ZA 2Y05A 4GX0A 2WD8A 1M6WA 4ND2A 4G65A 2D8AA 2VT3A 1VM6A 4B79A 5ILGA 2H63A 4GWGA 3RC9A 3K9QO 3BMNB 3IAHA 3NT4A 1ORRA 2PH5A 3JD2A 3GRPA 2PZLA 4NNJA 3DZJA 3OM9A 3RAJA 2Q45A 4OL9A 3DC2A 3S2IA 1PJ3A 3KM0A 4FFRA 2DTEA 1Z75A 4DPMA 1JVBA 3JQAB 3RUFA 1UAGA 1PWZA 3F4LA 3OQ6A 4PG7A 1D8AA 4MP8A 1N92A 5TRTA 1J49A 2OHXA 4Z6KA 2QX7A 2FMUA 1LDGA 4UUOA 5IN5A 3L4SO 4YJDA 3GPDG 1D3AA 4PRKA 4ZQEA 4BO5A 2B5VA 1MLDA 3NTOA 4FJ2A 4PLPA 2PKRA 2D59A 3HJAA 1GDHA 3ROQA 2WDZA 3BHMA 2G76A
chains in the Genus database with same CATH superfamily
1TM4E 1HSOA 3M1AA 4AN4A 2JAWA 4HGRA 5EIEA 4E88A 2PZGA 1Z7EA 3B7GA 3HUEA 2YXEA 3S29A 1V8ZA 2JAHA 3ZNPA 2OO7A 5BV7A 2IRWA 1NONA 2RAUA 1E1QD 4V0OA 1ZYUA 1OI3A 1E7RA 2EKZA 1ILEA 3OKPA 4YMHA 3S8YA 1RM4A 1HBJA 1MORA 2G3YA 2YV3A 4AY6A 3AB3A 1QYWA 4PAGA 3NIGB 3R7BA 4DBLE 3NGLA 4LSWA 3ZWPA 4AMGA 1XNQB 1FA9A 3ZY4A 2W2MA 2R68A 4HPXB 3GJ8A 2GEJA 3K0FA 3QE3A 3ET5A 3LHFA 3OJEA 3OQBA 3ZV5A 1TYDE 2NO1A 3JWEA 4CFZA 4ZIRB 2ATVA 1NSYA 2PU5A 4RW0A 4Q82A 2OM2A 3CLTC 5B3KA 3OJXA 4IXNA 4QATA 5D1HA 3V4LA 4ZVVA 1AGNA 4I08A 2AFIB 1W0KD 2PT5A 1U8AA 5BN4A 3WRVA 5C5EA 5JCZA 2ZRPA 5CAEB 5JNUA 1PX2A 1KJJA 3R7FA 4EEXA 2CJFA 1YS9A 721PA 3MIZA 2VJLA 4ACBA 5IK2A 3B5EA 4UU1A 2ENWA 3IQDB 5AUNB 4D96A 3I9FA 3BZBA 3V2UA 1JG1A 1OX6A 3VAZA 3ZJVA 2PV0A 3V1UA 2QSZA 2QIPA 1K6EA 3HXTA 3ISTA 2YXBA 1VSTA 3MOGA 1NXSA 4D9FA 1PLKA 5DBGA 1DRVA 2GS9A 4NV3A 3U4GA 4B4WA 1NFFA 5TPWA 4CKXA 3GLUA 5CHYA 4YT4A 4EA6A 3U4QB 2JW5A 3HU5A 2HT6A 1XMVA 2EEPA 2LCIA 5I3CA 2GZAA 3OCJA 2HF2A 4EITA 3TZBA 2JHPA 1VFNA 3GCDA 2H7CA 4II7A 2HRRA 5IF9A 1ZD9A 5EI5A 3TR5A 5LWQA 3O75A 4M6WA 3MEQA 1EHYA 3IT1A 3T61A 3EE6A 1V8OA 2JHFA 4WZZA 2GJSA 3MFQA 2Z0MA 3NFRA 3PCRB 3F6BX 3QJGA 2V96A 3LXRA 4JLOA 5C4GB 1VHWA 3QX9A 2DSNA 3VHLB 3KWLA 5T4BA 3S81A 3U7GA 1G64A 5JMTA 3KXDA 1F14A 4OHRA 1EFVA 2PJUA 4LV5B 2V7XA 4TYPA 4YBZA 5J2TB 5GGYA 5IMBA 3JQ9C 3NBUA 4ZI7B 5KTOA 3C3MA 2AFVA 3FDJA 1E1KA 2QUHA 2JKVA 4PSVA 1PTJA 1HLGA 3CWCA 3OP4A 4R40A 3H2JA 1XVIA 1UR5A 2DHCA 3V4OA 1CQIB 3WWPA 1W5FA 1THGA 3CKKA 4FIZA 5M3BA 1SIWA 3IUEA 5IJ9B 4RTKA 2E0IA 2XNHA 3IEUA 1N2ZA 4MIEA 3T5GA 1XQYA 4Q48A 5LXTF 1U0GA 1PR9A 1K88A 3IX7A 3OURA 1Z0KA 4QEDA 4N5HX 3R5KA 1M6NA 1W0JA 4LC0A 3WB0A 3HYSA 4MWOA 3U13A 3AW8A 3NOVA 3W05A 2ONCA 5DPMA 4YRKA 4TV9A 3LT4A 3TXXA 2E6UX 2XA1A 1YHZA 3PGA1 2QRJA 4YV1A 3SQOA 3QYAA 3VJMA 2PUFA 1P8AA 2ZIVB 4WZAE 1ZU4A 3N0WA 1JEJA 2WWGA 2X9GA 3FKJA 3PNVA 4NV0A 5D85A 2XB4A 2ZZMA 3BGDA 2IIBA 3CZCA 2GN1A 3D2LA 3OM1A 1ATIA 2OCIA 2B3TA 3BJIC 3F5DA 1F48A 3GZNB 3NWOA 1W4CA 2HWYA 4PO1A 4XZ3A 3SHFA 2F8TA 3SZGA 1P61B 1JDBC 1UMDB 3C6XA 3IP9A 4CR8A 1GZ7A 4AB1A 5JZ9A 3H3FA 5B55A 1F8YA 3IQWA 5CDSA 4MRAA 2W58A 4IMJB 4EL0A 3GV0A 4YRGA 4OQFA 1SKMA 1CF2O 1YB5A 3WGVA 1EUCB 4HNHA 2XGJA 3R5FA 3E8XA 2H4HA 2PA3A 4IINA 1RXUA 3V2HA 3AVUA 4YJHA 1ZH2A 3QE2A 5TPZA 2P90A 2X0KA 4MWZA 1SKAA 2H8KA 1QGAA 2RI6A 2X14A 4R5HA 1J7KA 2GD1O 3QU4A 1VI2A 5BVHB 1JQKA 3RTGA 1RPTA 4M1SA 4Q03A 5GQSA 1D2CA 4WXYB 3KQPA 4K9OA 4L6AA 2QTGA 3FVTA 1FLDA 3CV3A 3PQ5A 3R3YA 4HGZA 4MHOA 4S1WA 2EW2A 1G19A 1MB9A 2V97A 1CEEA 3A7EA 5BR7A 4DV7B 4IL5A 2RG1A 4DT1A 1U90A 3OESA 5LDGA 2BM0A 2Q5HA 5KTTA 1Q7GA 1ILWA 5EKTA 2ZI5A 2OYRA 5BMVB 2M6RA 2C5AA 1FXUA 1TKBA 4Y2XA 7MDHA 2JIOA 2F43A 1EFKA 3QMWA 4IV8A 4D43A 4TSKA 1VZ3A 2AC7A 4OAPA 3NVKI 2HTEA 3V48A 2GBPA 3RVSA 2ESRA 4QOJA 3G59A 3DZDA 2H52A 5BQPA 4LTMA 3MVEA 2B25A 4IJ5A 3FCUB 3IP3A 1KRXA 4GHWA 5FA8A 1OT3A 2BM9A 2QTHA 3UAGA 2QLLA 2FLKA 4KBFA 4S0XA 4Z1MD 1NR7A 2FPKA 2EF1A 1RQLA 3G13A 4LYHA 5HKOA 4L07A 3VBEA 3U61B 3WGZA 1YZ3A 1C4WA 5HKLA 2WHQA 1FSFA 2OBYA 2VTVA 2IYRA 2P2SA 3ROPA 3WHKA 3NTLA 2FOLA 2BFEA 3HZZA 4G84A 1P2SA 4H6XA 4C20A 1U6JA 2GBGA 4MUJA 1ZK2A 5CXSA 5TT1A 2NO6A 3OX2A 4NVRA 5EE1A 3SC3A 1XLWA 5LQJA 4CIXA 4L74A 3UUGA 1JDBB 1JLHA 2OM6A 4KR9A 5JHHB 2ZAGA 4WLFA 1PVDA 4L7QA 3EZXA 4FMBB 4MS4A 3UWOA 3ZE6A 3EIQA 3RQIA 3VKWA 2QWXA 4B35A 4V1CA 1VE9A 3BEOA 3CZQA 1YE8A 3SIRA 5JSZA 2I2BA 1RRVA 4MKIA 1A8IA 1NLFA 2B78A 3ZDDA 3ZJUA 2IV2X 2EDAA 5LUBA 2FJ0A 4EL5A 4H17A 4IIJF 4EB3A 5FLEX 3KLNA 1DQNA 4KPUB 1F6DA 1L5FA 2AFHB 2QTAA 4FCVA 1HZZA 1E2LA 1U2ZA 1O9HA 3LQQA 3V80A 1Z8NA 4KVFA 3MHPA 1CS0B 3K6RA 2WZBA 2PUTA 3KLOA 3EZYA 4ZXFA 8MHTA 1E4OA 2WQ7A 1A4RA 3URMA 3OUZA 4GBMA 4NR0A 5CVEA 1KYVA 2C92A 3DVSX 5D6NA 1CRQA 1GPAA 5EGNA 2YIVX 2PXXA 1D03A 1ZVKA 1II8A 1KZGB 2HHAA 4QDZA 2P2GA 3UM9A 1E96A 4P3KA 3S4YA 2PRKA 2FZVA 1TEVA 3GW8A 4JB8A 2HF7A 3NIBA 3H5IA 1BVYF 1THMA 3IQIX 4NESA 3EPPA 1THTA 3D0OA 2BP7A 2LIPA 1BDJA 1P1RA 3BIJA 2OAQ1 4GI7A 5K8VA 1LB1B 2WWVD 4ZMSA 3K3PA 1JAXA 2RFLA 3OQJA 3UT0A 4K6KA 2ONZA 4TV8F 4X71A 4KXFB 5DOVA 1TZBA 3QVVA 4EI9A 2CJWA 3SIPA 5BUQA 3F6YA 3LP6A 4NZNA 1SUIA 3PR2B 3WP1B 3EXG2 5L3QA 3OI7A 4RQUA 3O4FA 3PFNA 2ZTMA 3L5OA 5EIOA 5LZ7A 3UQYS 2WKQA 3F49S 4BQNA 2BMAA 3STTA 2UDPA 3QUCA 3KPYA 3WIOA 4HEA6 1YTLA 1CUYA 1Y5MA 4FIDA 1DKRA 5AVSA 2OHOA 2VHYA 1Z39A 4RGBA 4Q9KA 3TDMA 4DQKA 1C29B 4FHCA 3WWYA 3I09A 4DPKA 3PLAE 5EJIA 1VMDA 2Y1KA 4ND6A 3TNJA 4PO3X 1BFDA 3MRXA 4X7MA 4D44A 2XMSA 3ML1A 1R0ZA 2W2KB 1KMQA 2PBLA 4M0DA 4MIKA 4EVQA 2DBQA 4BTVA 5BN1A 2TYSB 3Q10A 1AQYA 3LT0A 3ZCPA 4XEUA 5FQOA 2HQRA 2R6ZA 1H94A 4JT9A 2BEUB 2I1WA 4OIMA 1HURA 1ULTA 3QBDA 3GT0A 4GRAA 4NPAA 1PHRA 4UAGA 1U3TA 2HQOA 1GY8A 3IVMA 2O5EA 3L8GA 1WW3A 4O2AF 3VU9A 5I8WA 4JI3B 2Y66A 2FMXA 1W93A 1PEDA 4KYUA 1GU1A 3AI7A 3GGCA 4TL9A 5IKEA 5ALQA 4ETWA 1AKVA 2OG2A 4LVOA 5G0WA 4KX5A 3VYUB 4ZDKA 2XUPA 3SC2A 3WLRA 1YR3A 1IB0A 1GEEA 3PUXA 3QPAA 4NMWA 4MHSA 3RVLA 2NU9B 2C2XA 1TAGA 5DN6A 5KINB 5L9AA 4B3MB 2HSGA 1YBVA 4ER7A 2JCVA 3BQ9A 5ICSA 3EZLA 5JZSA 2PGJA 1ZGCA 4ZYTA 1I0ZA 2FVXA 5JS2A 3UQZA 4AW9A 1T34A 4X5OA 1MEEA 1VQ1A 4MS3B 4NH4A 5LP6A 3TEFA 1CUZA 1KQGA 3ZS9A 5T64A 2W98A 4QGFA 4BDSA 1BJRE 4U7GA 1WVIA 4EQ6B 3DLAA 1T10A 2HQBA 2ZAOA 1MOQA 1Y8QA 2FRDC 2LCFA 3ABOB 2EU8A 4YO8A 3SR0A 1V4NA 4CTKA 4DCOA 2FSVC 4DTCA 4J7AA 1VE6A 5AKEA 5ELMA 1EUQA 2CV2A 4XGKA 1XZLA 3H87A 1EFDN 1EBBA 4RVCA 821PA 1V5FA 2OILA 1A7KA 3CS3A 3EXHA 3GEDA 3BIOA 4MB2A 4P2BA 1BS1A 1KU6A 1Z83A 1ZUNA 2J1LA 2QR3A 3H18A 3P9KA 4KDEA 4LOLA 4O4LF 4YIHA 3IAEA 2XMPA 2QVYX 3AHJA 4LA4A 3UW1A 3VSCA 3NR2A 1LWOA 2V1XA 1OFUA 2W43A 4FUTA 4Q4HA 1EEXB 3BK1A 3D2BA 4JLKA 3NXSA 1UC4B 3BJMA 3H65A 4R9UC 5DISB 1B2RA 1FRZA 4DW8A 1I13A 2PSDA 5ALEA 1JMYA 3CEHA 4U9UA 4Y2VA 5DNWA 3W7VA 3JQQA 5ALZA 3Q8KA 2AV6A 2Z43A 2I6QA 2GXAA 1B0AA 3OLVA 4PSAA 4EPYA 1EM8B 4LQ4A 3THXA 1MO5A 3BM5A 4OEHA 2KI5A 5AI8A 1EA5A 1MGPA 3I53A 4PRYA 2ZRJA 4JKYA 1W59A 2PX3A 2FTKE 1YA8A 4LZPA 2BGMA 2F59A 4H15A 2D1QA 4WKCA 2YKGA 3UK6A 5HIAA 2PU7A 5GWXA 4NBLA 2GYVA 3SZ3A 3W4JA 4K46A 3A4TA 2PT7A 3BKXA 1KEZA 3BCSA 2CFSA 4DLLA 3B1FA 3F8WA 1TKCA 1EG2A 4Q21A 2VI5A 3P9IA 4LN1A 1HFEL 2ZVDA 2QUJA 3OA2A 4M1KA 3T7AA 4AJPA 3AR4A 4DIOA 3PC6A 4ENRA 4GVPA 4FXOA 4R16A 1KEWA 3PXDA 1EK0A 4X7BA 3VKGA 4E08A 3GMIA 3I23A 3ASYA 3NQ41 3SHOA 2JJ2D 1KVTA 1X1AA 4LJ8A 1RQGA 1T9ZA 4Q7QA 3F5QA 1EWRA 4OHPA 4P82A 3D6FA 3IEKA 2DETA 1XA0A 4B81A 1R6TA 3FGZA 5KYXA 3C7KA 3OY2A 3K9FC 1R4MA 1VRWA 1Z15A 3IOBA 1H22A 3DOJA 4YDSA 4ZVOA 5A4IS 2W7TA 1USWA 5AJWA 3ZZ1A 2K5UA 3N7UA 4XM1A 4OA8A 4C07A 1IHOA 2OCPA 1OLSB 2CFCA 3S6JA 2WF9A 3ELUA 4KO8A 2O07A 3O5AA 5DYIA 4EMBA 2MSWA 1QQAA 4LF8B 2HC9A 5BQXA 1KO7A 1D4OA 2HSWA 1KMHA 2A0YA 4RQAA 3HRIA 4LHYA 1DAMA 2W4QA 5IYZB 3K6SA 1EVIA 2EJWA 1B8PA 2FWJA 2BZGA 3P9RA 4MIYA 2XWBF 1J20A 4RFLA 2AT1A 1XCOA 3ZHUA 3HXOA 2D2FA 3JASA 1DJPA 2D2EA 2J7PD 3GLIB 3BGSA 1X7ZB 3GRRA 1T1IA 4PGHA 1K1EA 4KV7A 1J0CA 1EGAA 1NXVA 2VYFA 3A3KA 4Q7MB 5C52B 3C5HA 1YI0A 1POWA 3A3OA 2BFBA 2R7MA 5F35A 4II3A 3I6ZA 1YGPA 3MQFA 3RODA 3U4MA 2O2YA 3VDNB 1RWKA 2V0NA 2ZREA 1P9OA 4RVUA 4FLEA 3ZQ4A 2X2FA 2A1TS 4IKPA 5TY0A 2I7TA 2BRUC 4QEZA 1NRXA 2MSDB 2DBVO 2JD2A 3BWYA 4Z0HO 1KE1A 3FPAA 3ZXUB 5F1KA 2IUYA 3ABQB 3AEXA 3PNKA 2BWJA 3PNQA 3PHJA 1T6XA 2GOYA 1YS6A 1GKLA 4RJTA 1YS1X 4DV4B 5DO9A 1GVHA 4FD3A 1OIXA 4P38A 1NUUA 3EWSA 2O8DB 2NAFA 2QYHA 2G77B 3QV2A 4UFNA 2IL1A 3P52A 1O9BA 3WWEA 3W8NA 2ZIUB 4CVNA 5A6SA 3D4IA 2YWHA 3NVDA 3HDYA 1NW9B 5DLPA 2JA2A 4PNPA 4INPA 3NC4A 1JA9A 1NWHA 2PZFA 2ZETA 1PWHA 3IUPA 1BXRB 3DVQX 4RSGA 5JEDA 4TVSA 4LGMA 3O82A 5JD5A 1LWNA 2C1XA 5F2KA 4Z9YA 1VKHA 2YJ6A 1Q22A 5KYUA 1YB4A 4G41A 4JOCA 5KOYA 1KOJA 2PO5A 4JT2A 4TN5A 1NF3A 3KOWA 2GJ8A 3X2SA 4N40A 4XKJA 2V0GA 4AUEA 2ZBFA 2B4KA 5DASA 3O1IC 1PNOA 3KTAA 2FUCA 4DSNA 4F9GA 4LJSA 3CWQA 1GHTA 1NXXA 1LSJA 4EF4A 3MBOA 2XOKA 4INZA 2Q7XA 1E89A 3UAWA 1HYEA 1X0VA 3LXUX 2RGCA 3VYTB 3RUEA 2XZOA 1Y6ZA 1X19A 1YZUA 1EVEA 3DNPA 3EAFA 3CC8A 2NX2A 3DZBA 1CDEA 4IH1A 4DLYA 2YN0A 2NYUA 4KAJA 4QQRA 4MITA 1ST3A 3H9JA 1K66A 3GGPA 2AJTA 2ZYTX 3LQFA 2PMCA 3MBIA 2FHSA 1YH3A 4ROSA 4FYIA 4QXOA 3W2GA 3M4NA 1QIJA 2L69A 1FW8A 1CY4A 3RIHA 1U0HC 3EGDB 1WY5A 4ZT5A 2Z2ZA 1IHDA 4E2ZA 4YYZA 4NTZA 2PX0A 3FZYA 3KYDB 1U1IA 1ZCAA 5KQGA 3LY7A 2QJTA 4N65A 4DPLA 3VZDA 4RGYA 2VT2A 3EYWA 1CP3A 4MUIA 4DGQA 2YY6A 4G5SA 3UZUA 1WXIA 3CRMA 3EXAA 3FVQA 5H80A 3KKMA 1Z2AA 2WE8A 1XJQA 3TOZA 3VO8A 1KK2A 1M2VA 3HZRA 3IBSA 3ICVA 3Q87B 2YWJA 3B3FA 4IDHA 5G1OA 1QGED 5BW6B 4JGBA 3EVFA 4E5SA 4ZU6X 3T4PA 1Q15A 2NO5A 4B3BA 3GAZA 4HD8A 5ERYA 2GEKA 4YR9A 4N48A 1MPTA 4YP6A 2BH2A 1CJBA 4RIEA 2BF7A 3I9NA 1MB2A 1MBZA 4R2IA 1B2LA 3OBBA 5CEFA 2XBLA 3I2HA 4EQZA 2JFZA 3O9MA 3PHHA 3OOJA 1M72A 4Y2TA 1Z4JA 3Q11A 2FPPB 1GXSA 2ZB4A 3IQEA 4JLUA 4F8YA 4NJMB 1SVOA 3AR5A 5KIAA 2JIBA 5FDFA 4P84A 4GWKA 4RKEA 3KLBA 4PLTA 4LQCA 2G06A 3JVUA 3QUTA 1VSVA 4PAMA 5GVRA 2W8BB 4CF6A 1JFRA 1J09A 4OSOA 1PI3A 2B98A 2PUAA 2WABA 1E3JA 1ECGA 3BCRA 1K63A 3LOUA 2A2ZA 5CCDA 4H7PA 5FEMA 2IW1A 1JU4A 1J7JA 3O8QA 3U3DA 4EF5A 5FPKA 3MT0A 4ZEOA 1VYUA 3CXRA 1DBWA 4P5DA 2WMNB 2BI8A 4KQ9A 1P5FA 1B4DA 1HRDA 3PQEA 4M55A 3IURA 4PLFA 3WL7A 2PZJA 3FB1A 3RYHB 4AP9A 1RPZA 1LTHR 1TT5A 2WU8A 2XKBA 3TRKA 3OF3A 1Y7LA 3CLSC 3ILYA 3L4BA 2WF8A 4C78A 3K0EA 4NMMA 1EDDA 1UZNA 2HA5A 3T3EA 3W04A 3EODA 1N25A 4HVCA 4JQOA 1JILA 4WH0A 1IONA 4V0QA 5G0SA 2B5OA 3X0DA 1Z0UA 1GU0A 3AWIA 2ZSHA 4D8WA 3ZWXA 1MENA 1GCIA 3OIDA 5GPBA 1GGVA 5EZYA 4YR7A 4YRNA 2C7QA 3PTZA 1XAGA 4TTTS 1OMOA 2XMDA 1U0NA 1KHHA 3P9ZA 2NTNA 2JBWA 4D9KA 2QNRA 1FX0B 4X45A 4NHEA 4IIEA 1O89A 2HX1A 2RBGA 5LXTB 1P1BA 1AN0A 2AHOA 3GBVA 3PUHA 1SHKA 4HLQB 4C76A 2GM3A 4CCYA 2EGHA 3GLKA 5CFRA 1GTVA 1I4WA 3WMXA 3QY9A 2GBLA 2W8ZA 3H7AA 3PYLA 4NC9A 5AD1A 5CA0F 3UMJA 2D54A 1NMYA 3EQ7A 4I4LA 3T5DA 4BIIA 2YBEA 3PB3A 3JWHA 4LZOA 4MMZB 1Y3AA 1GPNA 2GASA 2VK4A 4OHWA 1DIHA 1GLGA 5EWJB 5THXA 2JFQA 3S55A 1E7QA 3WAJA 4XWWA 5EG5A 3DOHA 4YJFA 2C3UA 1R6AA 3NFYA 3BL6A 2X0JA 4OY3A 2EATA 1Z82A 1TPYA 3BS4A 4FOPA 3LM8A 4F4FA 4JCOA 3A6KA 4TM8A 4BZPA 4F96A 2W2VA 4II2A 1WPRA 3O9ZA 1SHUX 2I2AA 2BMFA 5CVVA 1I3OA 4OXYA 4X8MA 4O8ZA 1LVHA 3VKVA 1C8KA 4ZCLA 4JJEA 5IULC 2WPDA 1I32A 3UIEA 2PUGA 1LK0A 2YS7A 5H0IA 4OLAA 1PL7A 1K6JA 1NNUA 1UT8A 4DRXB 1OFTA 3WADA 1ZESA 4PCVA 5I47A 2Y1CA 1XIVA 3EVGA 5JIBA 3VH3A 3DD5A 4EWLA 5CX1A 3QOYA 1FNCA 2WE7A 4NAVA 4S1NA 4N7JA 1R4ZA 1XD2A 3EC7A 3AEZA 4JYPA 4JLVA 3FYTA 3UT6A 5ED0A 1W25A 3JVIA 4PC7A 3U39A 4XRGA 3K8YA 3T12A 5KU7A 1PW5A 3EIOA 4GLJA 4LWPA 3LU1A 1MJGM 2MYPA 1F2UB 1GKKA 1XQ1A 2QU7A 2NO9A 2OLJA 1SU4A 4QSMA 5AHRA 2FUG6 4ENWA 1PR1A 4BO6A 4B7ZA 1R8QA 2B0JA 4F2HA 5IF3A 2IS6A 4BLRA 4DWVA 4LW8A 4D25A 4PQEA 3RTCA 1FRQA 1XA4A 5BMOA 3SP1A 1J8DA 3VNSA 5EY5B 2J59A 2X58A 3RAPR 3ONFA 4CQJA 3DDOA 4GKVA 1YL5A 3RRMA 1EH5A 1GADO 3TEJA 4BO4A 1HOTA 3I04A 4PX9A 5BSWA 2XKKA 4LXGA 1U7UA 1BW9A 5EKSA 1FRFS 4TWBA 2HB6A 2R8RA 2JFGA 3IV9A 5FV7A 4Z1MA 3J80A 3OP1A 2PFGA 1PBNA 1X13A 3O95A 3CKMA 4IDOA 1LBSA 4U2CA 5IC5A 3MRSA 2CLLB 1GYQA 2JBAB 1QIFA 1W0CA 1P5HA 3GD7A 2F8LA 4DIKA 1R27A 1YB1A 3LX8A 1RRMA 1KDYA 3PE3A 3GLFB 3I8SA 3UUWA 3O03A 3RIXA 2Q2QA 1H6CA 3A1TA 2FGKA 1X87A 2BHTA 3DYBA 3EVEA 3QJ5A 4FJ0A 4PXSA 5EP1A 3TQHA 1EFPB 2YWEA 1A8PA 2H65A 2ZVJA 4QLAA 3W6UA 2OC4A 1W9HA 1Y8RA 3D6NB 4MCAA 4H1UA 3B9QA 1KJIA 1WOMA 2ZUUA 5K03A 3HM2A 3NU1A 4N0DA 4B6PA 3RSLA 3IMCA 2X6RA 1C81A 1CUJA 1ZKDA 3QUSA 4HDOB 5DCWA 4JJ8A 1AV6A 3NORA 3RVNA 4M9XA 2AKYA 5J4YA 3ZE7A 4FYXA 4C5AA 4MS1A 1U1DA 2VXOA 3I3OA 4Y2JA 4E5DA 1R10A 3PZRA 1GZHB 3LHDA 3H8JA 2A14A 1FP6A 2HI0A 1GAXA 3CLRD 2AEFA 1X2BA 5IWAB 2O57A 3UOAB 1Q6ZA 1GCGA 2CLCX 3F78A 3IBYA 2F1JA 4G1UC 4TLEA 1H3EA 2WF6A 5A3QA 2LWIA 4IIJB 3GAAA 4LRYA 2HKIA 4BLVA 4M7RA 1DWPA 3R3WA 1JJAA 1MCZA 1V2HE 4G56A 1QLWA 3BORA 1XF9A 2ATEA 3KV1A 2R4UA 2RGUA 3LBIA 1R0WA 3VKHA 3PL1A 1W6RA 2R00C 1VXRA 3LW7A 2Q6KA 3B1JA 3WGOA 5ITWA 3G8BA 1TYZA 3RRJA 2IYXA 1RJGA 2ZFUA 4FT2A 2A0UA 4HQNA 5ES3A 1WMDA 3QVGA 2IBSA 3UC9A 1UADA 3V1KA 5K0LA 2ID8A 3WL6A 1RYEA 4M2LA 1AZSC 4DABA 1KBZA 1WUIS 4LHZA 2FUG1 1OH6A 4EVSA 4QT4A 3BCHA 3BJZA 4MPTA 3VR0A 1DZ3A 3HYRA 3WBJA 3T0FA 1Y4DE 3AL3A 4H3KB 2E5WA 1XN1A 3HU3A 3RH0A 1NASA 5CYGA 4CTMA 1MC8A 1DJNA 4Q4AA 4RHXA 1N2GA 1D04A 3H9EO 3K1ZA 3QYPA 5JSHA 1BHSA 1FFGA 3DVAB 4X61A 4UVEA 3JQGA 1CKEA 3ZUGA 3BIXA 1ULSA 4KFUA 1T24A 4MXDA 1SXJB 1JJBA 2PL9A 3OECA 3GOQA 4O2BA 1TZJA 1MAAA 1ZJJA 5FWYA 1DEAA 2B94A 1LJUA 1X7WB 4I6GA 3HKEA 4TVBA 3W5UA 2DFKB 1QB7A 1RHQA 3FSEA 2SCUA 3JYLA 3E05A 3TQCA 1RXYA 1SUAA 5KWIA 4AT1A 3ETJA 4EZBA 2J31A 5KU1A 5DEIA 4FEEA 1U7HA 4NOJA 2WOOA 5AVVA 2BUAA 1Y9EA 3N2KA 3BMQA 4HN2A 3JYQA 2ADMA 2FKNA 2IHYA 4MA5A 3C1TA 1RC8A 4AJEA 3ZU3A 3J7AC 1COWA 1DBSA 4RQTA 6REQB 4O4HF 1KTVA 4HQLA 4KUGA 1EDZA 1UMCA 2ADFA 2VYCA 2CNBA 1YUBA 1GCOA 3LQYA 1DTEA 1V8BA 2GILA 5A0VA 3IOCA 2JKZA 4Q05A 1HUQA 2IHBA 3OT4A 4X1YA 3ISJA 1IULA 3ZEIA 3ZDCA 1S01A 1UXGA 4X3OA 4MVCA 1VJCA 3IUJA 5JQGB 3TBKA 3IGFA 3O38A 1UPBA 1Y34E 4UVIA 3NCHA 3OPNA 1RAHA 3TNLA 5KYYB 3GNLA 5JLAA 3ZDEA 4YCSA 1W6UA 1SVMA 3WHIA 2FOIA 4C2AA 1T2AA 4R1TA 4M76B 3W9YA 1XQ9A 3NVAA 1E2DA 5E4FA 5JVDA 1RHJA 3BMNA 5MGNA 5CP8A 1CUIA 4UEJA 3EVDA 3VUEA 5BR8B 2ZSKA 5EFOA 4OK6A 4L02A 4J75A 3DWFA 3DC7A 1H1LB 3NHWA 3PA8A 1E0SA 4KOEC 2EKQA 4WZBE 3T34A 3VZPA 5A9RA 1FMFA 3CN9A 4LDZA 3I32A 3IRUA 3IDAA 4KLZA 5FBRB 1MGOA 1RJWA 1JQBA 1S3SA 1GZDA 3ZUPA 4DANA 5A4FS 4MYRA 3JQAA 4OFXA 3C5CA 5FO1A 2OV4A 2GKSA 4L1KA 1J07A 2RBKA 1QRSA 1DT3A 2H59A 1QRTA 4HQRA 3H6GA 4OHVA 2Q5IA 5EMNA 3ZU2A 2ZJYA 5K8LA 5C7YA 2PGIA 5AJYA 3AF6A 3CCCA 4DCGA 1F5SA 3WGNA 3VU1A 3RYIB 4DIDA 5DNYB 3KETA 4OHXA 2CMDA 2FVYA 1Y3FE 4QT0A 4Z4GA 3IAUA 4WY2A 1NLUA 3LYAA 4H6WA 1LRKA 1Z7BA 1SCIA 5JQGF 5TT0A 1XD9A 3TNYA 1W581 4M86A 2WUVA 2IIVA 1JWAB 3ETGA 5LU9A 4KR2A 1ORWA 1EP3B 4RV5A 3QKRA 4C6TB 2AEMA 3ANYB 4Z2AA 5HWSA 3M70A 1YKSA 1QGYA 2HJSA 3L0IB 2B6HA 1VDMA 4KNWA 3M1IA 4O4LB 2JLXA 4Y2YA 1QGDA 3FA2A 2QE7A 3PVZA 3B1WA 3P9SA 2JDID 3I61A 3NBAA 4JR1A 3ZHSA 2QUIA 4FFVA 2IOFK 4X8HA 1L6IA 3WZMA 2ZI9A 1H5QA 2PLNA 4I1OA 3WO1A 1BE6A 1Z7WA 5T8KC 3CUUA 2OK7A 5BOSB 2UUPA 1KJZA 1XTVA 3ELBA 3QQ5A 1XTUA 3PA6A 1WXGA 1V3QE 2YV4A 3DYVA 3VVMA 1XT6A 3Q7QA 4QUIA 3BTOA 6PFKA 4DLAA 1HLDA 2D7DA 4B17A 4QREA 2A5DA 4EMSA 1SU6A 3VNRA 4XX1A 2ZUCA 2BW0A 5JS8A 2Q1SA 5KYWB 2W11A 4PPFA 2VF5X 4KN9S 5FTMA 3UWDA 4ZIRA 2CHFA 5ALLA 2H7VA 3AW9A 3PPYA 1GL3A 2O5CA 3CTPA 4IIFA 2GCPA 3PJEA 2O8NA 1FFEA 3GRAA 3A4IA 3IQXA 4D4MA 1ATZA 5E4TA 4BVJA 5DMXA 2AFIA 3OLXA 4G3XA 1DFHA 5HS6A 4DM7A 3RIMA 2P1RA 3BOSA 3QPVA 1G60A 1G6KA 3S2SA 8AT1A 4UDOA 5M5BA 2YVLA 3HCPA 4ZJZA 3L41A 4TXMA 4CLDA 4CPDA 3E3AA 4BCDA 4MV7A 4C4XA 1VKJA 2GDJA 3GX1A 2JIMA 3L04A 1QU2A 1XZFA 2R6CA 3H1TA 3HVIA 3KL2A 2DQ4A 4WD3A 2GSWA 3L0PA 2GXUA 2WPNA 3GDFA 2GB4A 3GJRA 1U9YA 3L84A 1T15A 1OFVA 2A0KA 3C3CA 3ESAA 5DIZA 5SY6A 3UAOA 4CZ2A 2O8FA 3U4QA 3W8FA 5DWVA 1A5SB 4AJOA 3R23A 5FWAA 4OAQA 1S5PA 4R9NA 4B7XA 5BRNA 5EP4A 3A0UA 1TUBB 3G5MA 3W8RA 2J7PA 3RRNA 2QSUA 4EY7A 3I5AA 4LZAA 1JECA 3MS7A 2Z04A 1V9SA 1XAJA 4J0JA 3F7OA 5L40A 3H5LA 1I3MA 2ZWPA 1L5KA 1WZCA 2DHDA 4XRRA 2CXHA 2DUMA 3KFXA 3IEPA 3EH1A 3DBLB 2H7YA 3LPMA 5J2TA 1PV4A 1LY1A 1JPUA 3G2JA 3OUTA 4MAMA 1A8HA 1NYLA 2H31A 2YZGA 4OBWA 4YROA 1KQPA 4C3VA 4ZI7A 5AR1A 3P2YA 2ZXEA 2X5OA 1JTVA 2ROQA 2FQ1A 1N0HA 2PKQO 4UHEA 4X85A 1CQIA 2Y1WA 1H05A 1NE2A 1QDUA 2WM3A 3C3BA 3LW8A 3OPYB 4JJGA 5IJ9A 5JT1A 2XQJA 5A7GA 3FETA 5EQJB 3G9XA 5TIIA 1JEOA 4OV6B 1LZLA 1U0FA 1KIAA 2H4XA 5C1IA 3DCYA 1A4IA 3RVKA 2BR4A 1RFGE 3VZQA 1Z0SA 3DBHB 3GFSA 3M1YA 4OK3A 5REQB 4CTOA 2HCRA 3UUEA 2H2WA 3OZ7A 2O8CB 1XZ8A 4NCJA 1Z0ZA 3BRSA 1FYEA 5CK4A 1I6LA 3RT9A 4R0MA 4I8XA 2X7HA 1OIWA 4BHTA 2ZI7A 3GC6A 4G0OA 4OTZA 3FLEA 3CM0A 3ST7A 2ZR8A 4D9BA 2AZ4A 4X65B 3NJ8A 1PS8A 3EZ9A 1E9EA 2J3LA 3OO0A 1VCIA 4U4AA 4WOCA 1F7VA 4RU1A 2FZGA 1L1RA 1P72A 2X2PA 1NSTA 4Q19A 1G0OA 5JH7F 4EHFA 4YQYA 4ZCRA 3DEJA 1KYTA 2XLBA 1AN9A 1UMDA 3JR7A 4B7AA 2WHEA 5B3LA 1GTSA 4UTZA 1TLFA 1U1CA 4JVLA 1A97A 5EIWA 4BECA 1HC7A 5FI1B 5IDYA 4W5OA 1D2MA 3LAWA 5EAIA 1L5OA 4KRYA 3HV0A 2WU0A 5ULLA 4UARA 1RRGA 2VHJA 5IAOA 2ZT7A 2VNJA 1AUPA 5AK4A 1G3QA 2XRYA 4F3NA 3ZDRA 4HT3B 3AVYA 2YQ4A 1IN4A 1EUCA 1OHHD 4MR7B 4M1MA 1XEXB 4JA2A 1E79D 2B34A 3AERA 3TWOA 4LXIA 3W5BA 3IVCA 1E3IA 4GIBA 2JIRA 3CB2A 1E1MA 1M5TA 2C9BA 4PU0A 1Y9DA 1SG0A 2O4CA 3BFPA 4P98A 9MHTA 2A9PA 4KAXA 2H2DA 5DVZA 4KUEA 1GAQA 1V45E 4EHNA 3LO5A 4ZI2A 4W7IA 2H4ZA 3PD1A 4DDMA 1AGXA 1TIKA 4MHTA 2IYPA 2WA1A 3ND8A 4KFTA 3NIFB 3G17A 4XGQA 4RTPA 1RHRA 1S89A 1DXYA 4NQZA 1WS6A 2FX2A 5A3JA 3A9UA 3QXGA 1AA9A 3VHXB 1JDVA 2GYWA 3D4LA 4XFKA 3ZBTA 1J5EB 3JQ9A 1YDHA 1VIDA 3CH6A 5BMVA 3BD7A 2QN6A 3E70C 3GRCA 2IH5A 4NMHA 5DHPA 3LUHA 4H7IA 4I3FA 5JPCA 3OA0A 1AHIA 3O1LA 3WLKX 2JFPA 1X38A 1SFRA 1PNTA 1QH8B 3K1TA 3WZ2A 3KSZO 2V7UA 1P4SA 1EE9A 5EPUA 1A7AA 1WXXA 2DERA 1E2KA 3U9SA 1DVRA 2BMDA 3FNIA 3EZ6A 4ZI5A 2QLBA 1PDOA 4FEAA 3PC8C 4BL5A 1OI2A 2D2IA 3HACA 1NMEA 4TTJA 1T3HA 4TLMB 1QFJA 2H9AA 2YJ5A 4PAWA 2OYSA 4PHTA 2L19A 3N2GB 5E4YA 2FPSA 1YCDA 3K0SA 1UZAA 2AQHA 1EXNA 4CLRB 4DDHA 3QEMB 1K7XB 2A67A 1XDGA 1YI8A 2EKLA 3ICEA 4RXUA 3DE7X 4DF3A 4DXDA 3EUWA 2EV9A 1COZA 3T94A 1JAYA 1X8XA 1SUCA 2VNAA 3LLVA 5BSEA 7MHTA 2Q1TA 1J33A 2HQSA 4UM8B 5CD1A 1QRRA 4M37A 4KG7A 1O03A 4TZKA 4TYYA 1YASA 2BI4A 3DLCA 3P0EA 3AM4A 4GLOA 1PJ4A 1QP8A 4TVOA 5JZBA 3AFMA 1UMKA 3S2UA 3C6MA 1SG9A 1T9KA 4JUCA 1T8UA 5M04A 1P29A 2AWNA 3PNBA 4E94A 4AO8A 1DV1A 1OT5A 4KPUA 4MI1A 1N8TA 3UAVA 2QPOA 1EESA 2AFHA 2VATA 1S2MA 4HGPA 1Z13A 3U5TA 3V97A 3FMIA 4DADA 3PPWA 1DKUA 1W44A 1CS0A 1U8UA 4KNYA 5ALGA 2UYQA 2ZE6A 3FHOA 2UYYA 3Q7IA 3KJEA 2W6ID 4KWTA 2R60A 5FOVA 2HK7A 5JAIA 3SF8B 1Y9ZA 2C2HA 4RETA 2IS4A 1SUDA 3JWGA 4L76A 3RKSA 1SXPA 3WLFA 5HE8A 2ODWA 4QE3A 2VSOA 1CQPA 1ML3A 2Q49A 4A6EA 2IUFA 2HSJA 1RJ9B 3PGVA 3MJEA 4X60A 2KX7A 3L46A 2W71A 3CVOA 4QQKA 3IE1A 3AY6A 2DX7A 3MB5A 4FN5A 4XUDA 4FZ5A 3NT2A 4OLFA 2LE0A 3NP7A 5CU7A 1XB2A 1YBMA 1TO6A 4UPDA 4K9DA 1F4VA 2COUA 5TQ0B 2IP2A 5COBA 1YB6A 3AHIA 5TMPA 4BKQA 3EAQA 2YZMA 4N6NA 2PGNA 3IJEB 4ZQCB 5EP3A 1I33A 2WY2D 2QD3A 4U2FA 3PUZA 2PD3A 4M1QA 1O4WA 2D00A 5DHUA 4ZALA 2BFOA 4GUAA 4PZLA 2QZZA 1B6GA 3CF4A 4GKBA 3R44A 1QF9A 2LUOA 2ZTUA 3ZWAA 3V4VB 4NZ9A 4JV5B 2R44A 4ENQA 1PJ8A 1SXJD 3ENKA 4LE1A 5FI5A 4HQKA 4NQRA 4GMHA 2G28A 4CG2A 2VDNB 5BVGB 3TOXA 2MMGA 2QP9X 3AOEC 1UDXA 5FA5A 5JYBA 3HUUA 1FMTA 4FE7A 5CA0B 4LF4B 1M6EX 2NP7A 3NAZA 1QFZA 1R64A 5A5DA 4UAUA 4HXYA 1B7GO 1H2YA 2YMQA 4B4VA 3UMRA 2W48A 1VL0A 1CQJB 1YO6A 3QZUA 3B6EA 2CYBA 4KBGA 4D8TA 3L1VA 2Z08A 4QOIA 2VWGA 3LX4A 4LAFA 2W2KA 4B2YA 1ZXXA 1RLTA 2YWFA 2OBBA 4X0EA 3KP1A 2Z56A 5G0VA 4CBVA 5C8YF 2IEDA 5HZHA 1ENZA 5JAHA 4DV0B 1IWOA 4WK2B 2Q6OA 3R0VA 3H16A 1DHTA 5CT5A 3QFTA 4JSRA 4A2PA 4F9EA 5HX7A 1KO5A 3AEKB 1E9BA 4BB9A 1HNZB 2A4MA 2ERCA 2AWOA 1BG6A 2BCGY 2QJWA 4B76A 3EPRA 4PBSA 3PNPA 2EAUA 1GJRA 1KDPA 3HCCA 4YJGA 1PLJA 2H2AA 4QRHA 3TNFA 3U7FB 5C34B 5AI4A 5EZSA 3IAXA 4JLJA 4NZYA 1X7HA 4MKGA 1JB9A 4Z7QB 3LK6A 1CYEA 3GA0A 5KTPA 3DE6X 1RJDA 2NU9A 4FWTA 4JLDA 4A5SA 2A94A 4I4IA 4RZ3A 4UTOA 1Q0PA 5EJMA 1AMOA 3KB2A 1NV9A 2OL4A 1I7NA 1Y33E 2W6JA 5DGXA 2JAQA 4MS3A 1A95A 2QL6A 2PS1A 2WD7A 4RDIA 1UIRA 4HJXA 4HH3C 4U02A 2AMLA 2ZB2A 3DUFB 4OQYA 2P9FA 4M22A 3U31A 4EFMA 5EIAA 4W9MC 2DQZA 2MR6A 1YIOA 1MOSA 1K7EB 1KKLA 4FGJA 4LHSA 4F60A 1RCFA 2H4WA 3FPEA