4CR8A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase with nad
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKDGRSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
total genus 92
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr8A00
4IDGA 4KDFA 4OMUA 4J4TA 2UUOA 1MFZA 4LISA 2C2YA 2Q1SA 2NQTA 2D5AA 2Y1CA 4FJ0A 3NUGA 4OOEA 5L3ZA 4XQCA 3DBLB 5L40A 2QYTA 2ZTUA 4NJMB 4PFJA 5G0TA 4U7WA 3GMSA 4ZRMA 1JAXA 3BMCA 1JTVA 3MJCA 3PQEA 4Q9NA 5JDIA 5GZ1A 1HE5A 1GZ3A 3R3SA 4Q3BA 5CDUA 4BGEA 4GVLA 3ENNA 1U3UA 5KJFA 1ZCJA 2AE1A 1ZMTA 3I9MA 3OQBA 1YXMA 3FSRA 4OH1A 1KOLA 2XXJA 3I9OA 1KVTA 2HRBA 2YHIA 3H9GA 4X54A 3SLKA 4ZJUA 4HXYA 4ID9A 1DIRA 5JCJD 2ILTA 5K9ZA 3B6ZA 5TIIA 2J8ZA 4YYZA 1D8AA 4U6QA 1Q0LA 4KMSA 1N5DA 3CZMA 3I6IA 2Y1DA 4EJMA 1Q1NA 4P22A 5A9TA 3ZI0A 4W99A 3BMQB 3JQBA 1E3SA 4DRYA 3SVTA 3GUYA 4AICA 3G49A 1NPYA 3CZRA 1KS9A 3Q11A 1ZJZA 5JMPA 1DC4A 1D4FA 2Q1WA 1QYDA 3JQ6A 3PZBA 3V1TC 4RPHA 5A3VA 3WGYA 4YT2A 2WYVA 1E3LA 2VCYA 4BNGA 4E4YA 2WYWA 4INAA 5K6AA 4I9NA 3HDHA 4OXYA 3IKVA 3RU7A 1ZH8A 4I1IA 3PQDA 4K1LA 1OC4A 1E3EA 1KC3A 3LC1O 2OGUA 5TNXA 1DB3A 2Y93A 4GSLA 4PG4A 4BNKA 3JQAA 2NVBA 3ONEA 1MX3A 3B20A 4CV1A 1JW9B 3SJUA 1P0CA 2WYUA 3M2PA 4XWYA 4IJKA 3EW7A 4F3YA 1J5PA 3ZWMA 1P1RA 1BRMA 3ZWVA 3DQPA 2FR8A 5ICMA 3EHEA 3DTYA 1XSEA 3WMXA 3BTUA 3QIVA 1Q7GA 4N5LA 2DUWA 3GOHA 1GEEA 3LQFA 2C54A 4I9HA 2P2SA 3BMNB 4BIIA 4FSHA 2Y1GA 3KSDO 4IDFA 3FN4A 3NEPX 5DP2A 3VH2A 3WLEA 2Y67A 3F1LA 3OA0A 4E13A 3KSUA 4Z0HO 4IGFA 1K6IA 2Y1FA 3VAZA 3WQSB 4CQMA 4CQLB 1VLLA 2ZIZA 4O0LA 4YCAA 4QO8A 5G0UA 2JCXA 4CM9A 3GNTA 2BFPA 2QYSA 4J49A 2DPHA 5GZ6A 1EZ4A 3RVDA 4FOSA 3WTCA 4ZA2A 2Q45A 4BKPA 3FRJA 1JA9A 4UUOA 1GCUA 3DOJA 4EI2A 1GZ4A 1QLHA 2O3RA 3IQDB 1WVGA 3HUDA 1U1IA 1R4NB 3CUKA 3D7LA 4K9DA 5BT9A 3ZWPA 2DVMA 4BNTA 1B26A 3I5MA 1LDBA 4RGBA 1U8FO 9LDTA 4RQTA 4RVFA 4BQPA 5L4SA 5TJ9A 1E0DA 1DO8A 4L74A 5A9RA 4YACA 4YRDA 3O03A 3COSA 3DZBA 1R4MB 3DZGA 3ZNQA 1A9ZA 3RJ9A 1DXYA 2D0IA 2EWMA 2JJYA 5C7LO 4XJTA 4MOWA 2NU7A 2EW2A 3U0BA 2YFQA 4MPDA 4B8WA 1N2SA 3NDIA 1M6WA 3JD4A 1WMBA 4WCFA 4CM8B 3ZDFA 1LX6A 4WPGA 4J16A 3HE3A 3W8FA 5A04A 1Y6JA 1U3TA 4O59O 2PLAA 3RUEA 3AY6A 4IQ0A 4PLZA 3V2HA 3FR8A 5EESA 2G5CA 4KQXA 4O6VA 1LDMA 1ENPA 1F8GA 2J3KA 4DLAA 2J6IA 1NYTA 3BMOA 5IZCA 2J5KA 3HHPA 3GN1A 5FF9A 3ZV6A 1XU9A 1G1AA 2E4AA 4HFJA 1NTOA 4QFCA 3PIDA 4ALKA 4PLCA 2O7QA 2A35A 4CMHA 5JDCA 4GX1A 4CR6A 3AM4A 4ZQFA 4UUPA 3RJ5A 3C24A 4IJWA 1LUAA 1Q7BA 2VHZA 3K2BA 2AG8A 3PIIA 4CR8A 1U7HA 4R5HA 2BRUA 1GTMA 1LRLA 3R6DA 4NK5A 4XDZA 3RUAA 4YJFB 4DYDA 3AU8A 4LCJA 4DVJA 2YDXA 4P4LA 4JBHA 4UVDA 3WGTA 4OJNA 1HDCA 2O7SA 2OMEA 4BNMA 3CSDA 4NQZA 4A5OA 3HWRA 3IS3A 3GGGA 1VJ1A 3PHJA 3KLMX 3V1UA 4E2XA 5CDSA 4IDDA 2RCYA 3FCOA 5I8ZA 3K31A 3GPDG 3OA2A 3JD0A 2O3SA 2B4QA 1O95A 2Z5LA 1KVQA 3IMFA 5COAA 3JQEA 3MTGA 1DFIA 2X86A 1ZIDA 3PVZA 4BNVA 5KCZA 1YONA 3O38A 2CDCA 2ZK7A 4GAEA 5U4QA 1W0CA 1PQPA 4C7JA 3EMKA 2D5CA 4YJHB 5DBGA 2W8ZA 2E6UX 4D3FA 3WWZA 1EE9A 4CMIA 3T7CA 1R6DA 3AW9A 5HS6A 4D79A 4BO8A 1RM5A 1VC2A 3ZWOA 4B79A 3PHLA 3HJAA 1VL8A 3OJLA 3D4OA 3CH6A 2BF7A 1D3AA 3FWZA 3GH3A 4CL8A 3ENKA 2HQ1A 3G79A 3GQVA 4GBJA 4IDCA 4RCVA 4LRSB 4R3WA 4BNFA 4AJPA 3DMTC 1ZZEA 1ZJYA 4HFMA 1PZHA 4WEQA 3CTMA 1QLJA 3H6KA 3QWBA 1PGJA 2C5AA 4OHUA 5JBIA 3BXXA 1IPFA 5JY6A 5EQFA 1K6XA 3X2EA 4KWIA 5KVQA 3H8VA 2X9GA 5DNAA 1I36A 2RHCA 1QORA 4ZICA 3ANLA 3C3XA 5BSHA 3R3JA 1NPDA 5TT1A 1PL6A 1I33A 4B8ZA 2B0JA 3MOGA 2VYVA 3C7AA 4N18A 1GFSA 3Q0EA 4PG7A 1RYDA 1X7HA 2CF5A 2W2LA 4GX2A 1K89A 1XWFA 3LF2A 5ILGA 4BO0A 3PWSA 2HJRA 1EVYA 4EUFA 3KRTA 5IDXA 3GHYA 1SCUA 2X8LA 4F46A 2HSDA 1I5RA 1A72A 4NFYA 3JQ8A 1C0IA 2PKQP 2RH8A 4TRJA 1YS4A 1K3TA 5EINA 4E5MA 3QWHA 4IIVA 1MXFA 3PK0A 4QUKA 3FD8A 2PFGA 1I8TA 3OHSX 4IJVA 2GGSA 1XYGA 4IZHA 5F1KA 4ALIA 3OMLA 2ZB3A 1AXGA 1PJCA 1WXDA 2H63A 2JAHA 3DFUA 4FPXA 4R1TA 5F21A 3RFTA 4AJ2A 5JY1A 4XQGA 3I52A 3L6EA 2VRCD 4OXKA 4ZN6A 2O3JA 3PGJA 5G0VA 1DIBA 4R51A 3PXXA 1LC0A 4DXHA 1LDNA 3IUSA 4OL9A 4BNXA 3DBVO 2EEZA 5G4KB 3TL2A 5B37A 1ENOA 4WOKA 1U5CA 4ZVVA 5FEUA 4FJ1A 3L6OO 4A03A 1P77A 1VPDA 4D46A 4I9UA 3HQ4O 3DWFA 4W9NA 2BHLA 1PJSA 4Y9DA 5JCXA 3V5NA 1J4AA 2PGJA 5CEEA 1BGVA 2C7GA 2GCGA 4DLBA 3PHHA 1D1TA 1XLTA 4BO5A 1DPGA 1XHLA 2FOIA 1SZJG 1GAEO 3TNLA 2P9CA 3GZ4A 3C85A 2Q2VA 3K6JA 5HM8A 2VN8A 3MJTA 1M2WA 1VM6A 1ZXBA 3TRIA 4FR5A 2G1UA 1HE2A 1HDGO 2I6TA 4BO6A 5KVVA 1Z82A 4GPD1 3U62A 3W6UA 4MVJE 3GAZA 5JMWA 3DZFA 1O6ZA 3DC2A 5DOVA 5L4NA 3W1VA 2DLDA 2QG4A 1ONOA 2O4CA 1SEPA 1ID1A 2ZJ0A 3UXYA 5EL0A 4RVSA 1EUDA 4JJFA 4TKMA 1NP3A 4IINA 3WLFA 1LEHA 1RYEA 3SXPA 2CVQA 3E6AA 1WZIA 4HKTA 1TLTA 2ZATA 1PJBA 4GI2A 4ESOA 1IYZA 5JYEA 4DWVA 3RCBA 3MOIA 4H3VA 1YL7A 1YKFA 1VL6A 4M87A 3ZWXA 4Q3DA 2TMDA 5EQDA 1GUZA 4JCOA 4QO7A 1FXSA 3JQAD 3D0OA 3H9EO 4P4NA 1CJCA 1HLDA 1ULUA 1NX6A 4B4OA 3E9QA 2PZKA 3M1LA 3T7EA 3O4RA 4J9UE 2O23A 4CV0A 4IS3A 1V3TA 3V2GA 2EF1A 2Y99A 1H0KA 3GMDA 5F1OA 4I5DA 3RU9A 1VL0A 1JU9A 2D1YA 5A03A 1ENYA 1JWBB 3SBOA 2B35A 2W4QA 1QMGA 3MWEB 3ZWBA 3LC2O 1O5IA 3M2TA 2X22A 2G17A 1ZK1A 5I7SA 2OO5A 2BFOA 5TJHA 1W4ZA 4YJGA 4CQMD 1R37A 4HY3A 3G3EA 3D3EA 4BO4A 1MC4A 4HUJA 2V6FA 4NJOA 4W7HA 4CM9D 4E5YA 1CQJA 4ND3A 1CRWG 1J6UA 5ENDA 1KEUA 1EVJA 1MP0A 4B3IA 5G4LA 4EW6A 9LDBA 3WDSA 2GR9A 3HFSA 4BQRA 2OORA 4BMVA 5JS6A 4IM7A 4NU6A 1C0KA 1MLDA 2Q2WA 3MCVA 1U5AA 4YVFA 1IHYA 3OJEA 1W73A 5KTKA 2X23A 4YAJA 1V3VA 2LDBA 1DIHA 1YOVB 4GMFA 2EXXA 2NWQA 1E7QA 2V7PA 3GZNB 1NFRA 3BTSA 3F5SA 2P5UA 1H6BA 1CEQA 1X13A 2NADA 2UDPA 1SB8A 1VSUA 2VQ3A 4G81A 4DQUA 2NVUA 1TVEA 4EZBA 4D3DA 1PQWA 3JYLA 4J0EA 1VE9A 3IAHA 5G2OA 4J0FA 4ZQGA 3WGIA 5JC1A 1E3JA 1I3NA 4AJIA 3GRPA 1CERA 3JYPA 3RKUA 8ADHA 2WTBA 4UVHA 3T4EA 3ZZNA 4Q3AA 2YV1A 4XJSA 4BNLA 1JLLA 1LDGA 2HMTA 3F3SA 2FHSA 3UFXA 3HG7A 4ROSA 3PYLA 3RIHA 2JCVA 1KERA 1E1KA 5FFFA 1GQQA 3H5RA 1ZNQO 5GY7A 1IB6A 3L6DA 3X2FA 1SC6A 4ONEA 1EEHA 4J7CA 3CE6A 3AUTA 3CIFA 3WXBA 1OMOA 3W4KA 4RO0A 4XYBA 5JE8A 1B7GO 3KOUA 3W8EA 3DOCA 1JQBA 2GN4A 4CLRA 3RFXA 3GEMA 1LI4A 3N7UA 2IEDA 4QX6A 2EG9A 3RSHA 3RI3A 4OQYA 3JSAA 4IQ8A 2DTDA 1K2WA 2B37A 3GK3A 5ENVA 1ZBQA 4J7UA 1VI2A 2I9PA 1PR3A 4WASA 1I30A 1QG6A 5KJCA 4FFLA 2NU9A 3QP9A 5B4VA 2B83A 1XQ6A 3PJDA 3WB9A 4FB5A 1NQOA 2IZZA 3GVCA 1K5HA 3WJAA 1HE4A 2NTJA 3RUDA 3AOEA 4E5NA 5L9AA 4BL5A 5DP1A 5L51A 3S55A 4JJIA 5DCWA 1P74A 3H5NA 3ZU5A 1HYGA 2B5WA 4YJHA 4CODB 1MUUA 4E3ZA 4IDBA 3K30A 3F6YA 3BYZA 3OH8A 5IN5A 1A27A 2VZ9A 2EJVA 4Z0PA 4E0BA 2YQ5A 4FJ2A 3ADPA 4PLWA 5A9SA 1NR7A 3WFJA 4DIBA 1EDZA 4IXWA 1T1SA 4RZIA 1FDSA 1K0UA 5COQA 5CHEA 4GWKA 4YTEA 2VNSA 1X1TA 3ORFA 1B15A 3A9WA 2ZTVA 4QT0A 3G1TA 5CFZA 1ZK0A 3OF2A 2X0NA 4XYEA 4KDEA 4IMRA 4RVDA 1ARZA 1DEHA 4CLHA 4IPTA 1MFPA 1UP7A 2VOJA 1Q7CA 2CVZA 2YDYA 2VZ0A 3TDKA 4NU5A 4MDHA 1KYQA 2EKLA 3L07A 3SEFA 1YRLA 5CDTA 3WOHA 1E3IA 2F1KA 2AXQA 5JO0A 1N7HA 4ND4A 4OOFA 3PJGA 2HMVA 4FC6A 5EN4A 1UR5A 1ZSVA 2JHGA 4FD3A 4HADA 4IS2A 1Z73A 2IDZA 2X0JA 2OOSA 4DC1A 3OETA 2POQX 3ZW8A 1GR0A 4I5FA 1QXSA 1ULSA 4UUNA 3UW3A 1CYDA 4JIGA 4JK3A 3RC1A 3WNVA 2P9EA 2VTEA 4R9RA 3U09A 2H1SA 2X5OA 4B4VA 4MP8A 5FYDA 4WLFA 5MDHA 2VYVD 4B3HA 5L95A 1F8FA 5TQVA 4EDFA 3EVNA 1H9BA 2CF6A 3MJSA 4LGVA 3OJFA 3ROKA 2W2LD 3KYDA 2I3AA 4YWJA 2HUNA 3DB2A 3QW2A 3KV3O 1NHGA 1X0XA 4IGEA 2GF2A 1I2BA 1E5QA 5FWNA 4E5KA 4WLVA 2OHXA 1T2CA 1E3WB 4DLLA 3DO5A 2A94A 5G0WA 5IF3A 4DPKA 3JQCA 3BHIA 1W6UA 5CG1A 1BXGA 1ZKMA 5AOVA 3QSGA 4GKVA 4HWKA 1PGQA 3ZU2A 2FP4A 2HK7A 3RKRA 4O1MA 4XGIA 3U4CA 4RVUA 4M8SA 4W4TA 5C7OO 4DMLA 1Y8QB 5H81A 2QRKA 1Z75A 4U5QA 1P3DA 5TT0A 1W8DA 2QW8A 1DIGA 1JAYA 3AI1A 4XQEA 4DPMA 1A5ZA 3OSUA 2AQKA 4JJGA 2IXAA 1EVZA 2CSUA 4CMCA 4Z9XA 2WM3A 3CMCO 3IIEA 3HADA 3TFQA 1E7MA 3JQ7B 4CL3A 2VHXA 2PD3A 2PH3A 4Z9FA 4BNHA 2GO1A 4GGOA 3MTJA 2JAPA 2GUGA 2I67A 4BGUA 2NU6A 4YT8A 3C1TA 3HDYA 3K5PA 5KWEA 1YWGO 3LZ6A 4BMSA 5L7WA 5LDHA 4CPDA 2YYYA 5F1PA 1DLJA 4BNIA 2P4HX 5L7TA 1LSUA 3AI2A 4WCDA 5CG2A 1RKXA 5KOIA 4HX5A 4B3JA 2H6EA 2QZZA 1PJ4A 3NTRA 4QFDA 3WBBA 3VZRA 3L0DA 1GUFA 4MIYA 1BXKA 1EQUA 2B4TO 4YJDA 1VRWA 3RC7A 4LVCA 3WX0A 3PDJA 5IDQA 3FBGA 3LYLA 1Y81A 1BWSA 2YHUA 5CAEA 1I0ZA 4RLSA 3AFMA 3B1KA 4ND1A 1E7SA 3NV9A 3NYWA 2WD7B 2A9FA 3K2EA 3DMYA 2DBZA 1BW9A 4CV3A 3DL2A 5F5NA 3IOYA 2DM6A 3QVTA 2D3TA 5EIOA 3WNQA 3FWNA 2B5VA 5B1YA 3GAFA 1P45A 5JDIC 3K8ZA 2C20A 4UVIA 1PX0A 4BKOA 4MJLA 4E6PA 4IXTA 3ZNOA 3N74A 2Y0DA 2V6MA 4IQGA 3UUWA 5J23A 3DONA 4AL4A 2GZ2A 1GUYA 3U4DA 2BELA 2HO5A 3ABIA 3VOSA 4JP2A 1F14A 1GQYA 2NNLD 1Y5MA 2AEMA 3JQBC 1XR3A 4CM6A 1E7YA 5KVCA 3PTZA 2W90A 4KP7A 2WE8A 2VWPA 4WLNA 2XOXA 1QSGA 4WK6A 1PSDA 4DUPA 1TT5B 4MVJG 4N7RA 1H6DA 2E48A 3DBRB 3ETGA 1BMDA 3I1JA 2Y05A 3P2OA 4D42A 4EGFA 2DKNA 1UAGA 1S6YA 1R0KA 1DBVO 2PNFA 2ZCUA 2I5PO 5K6AC 3GNSA 5IN4A 4FC7A 3I9JA 2X5KO 3HZZA 1LLQA 4RDIA 4E2YA 3RROA 1UUFA 1ML3A 4ZHSA 5CDYA 4II3A 3IUPA 3DBHA 1YB5A 4RVHA 2H9IA 2RHRA 4TVOA 4EEXA 7MDHA 3VPSA 1DJNA 5B12A 1ISFA 1C1XB 1IE3A 1Y8RB 4P38A 4OIMA 3DEYX 3OEWA 3U4HA 3C7DB 1KVRA 1UZLA 4YQYA 4BO7A 1YDEA 1N1EA 3EZYA 3NRCA 4BNJA 4PG5A 3GDGA 3TZKA 2G76A 4AFNA 4K28A 1WDMA 4AJJA 4IDAA 5DOZA 5IXSA 4NBTA 4CM4B 1B16A 5JXWA 4CM7A 4XD2A 2ZTMA 4I5EA 5FI3A 2OL4A 4MVJI 3RAJA 1DIAA 4PGFA 1IZ9A 3D4PA 3IP3A 3S2GA 1AXEA 2WEKA 4WGGA 1I3KA 3RQSA 2EERA 1ZK2A 2CNBA 4YAEA 5TC4A 3SX2A 3JTMA 2P68A 4UULA 4HFRA 4AJKA 2X9VA 4WLUA 4TSKA 4NNJA 3JCZA 2JFHA 3TZHA 3ZU4A 1BVUA 4BNNA 3I3OA 2HLPA 4QEDA 3DXFA 1HSZA 3OM9A 4FW8A 4NDNE 1D7OA 1EVIA 1WZEA 1LLDA 3EDMA 1XCBA 2OZPA 4XR9A 2GNAA 4J4HA 3TF5A 4L73A 3TN7A 1AHHA 3WIEA 2GPTA 2NUAA 1BG6A 2V6GA 4AJ4A 1P9LA 1M66A 2G0TA 4DPLA 1MG0A 4CMEA 5F3RA 4FIZA 5ITVA 1DHRA 1E6WA 3HB4X 4KOAA 5KJ1A 1MC5A 2WD8A 4YR9A 4UEJA 4Z6KA 4KUEA 5TGDA 1LSJA 3INTA 3E48A 4BS9A 3PYXA 3JQGB 4JGBA 3VKVA 1AGNA 3E8XA 3TSCA 1ISIA 4WCFC 1I3MA 5JW6A 2Q99A 4NBWA 5JAIA 2JFFA 4R69A 4UREA 2CDBA 3AUUA 5CPBA 3VVCA 4Z3KA 1U9JA 4XB1A 2IZ1A 1PQUA 3A06A 4S3MA 5LDGA 2ZB7A 2O2SA 2XXBA 1HZZA 3KM0A 4ZRNA 4IBOA 2EKQA 1XQ1A 3GFBA 3A28A 3KVOA 4UVGA 4L75A 4EJ0A 3AOGA 1IY8A 4CLOA 1E1LA 2X4GA 4U8GA 3NAQA 2ZKLA 4DBVO 3UICA 1PGPA 3C8MA 4J9VA 1DC5A 3RFVA 5IZCC 3Q1LA 2P4QA 3FPLA 2F00A 2VHWA 4PLTA 4YA6A 3HB5X 4FOOA 1UDCA 2B69A 2R00A 3WFIA 4RPJA 2WDZA 2GZ1A 2VYNA 1T4BA 3O8QB 5JDCC 1DOHA 4IDEA 4GMGA 1GZ6A 4BKQA 2OP1A 1WAMA 1YE3A 3D3WA 2DC1A 5T67A 4AG3A 4MVJA 3F4LA 5A05A 4YBZA 4CM5A 2HAEA 1UXGA 3RBVA 4BNWA 3H65A 3MJEA 4PVDA 2FZEA 4PRLA 3NGXA 4XCVA 4GQAA 1SEVA 2X6TA 2DT5A 4ND2A 3MZ0A 4LK3A 1Y1PA 1TXGA 1AE1A 1HRDA 1N1GA 2HMUA 4GL4A 3RD5A 4FGSA 2JD2A 3DOOA 3PZRA 3VH1A 2GN8A 2HK9A 1HDYA 4Q3NA 3UCEA 5HS4A 2YFHA 5AXCA 4J1TA 2FMUA 3BTVA 4BVAA 4NI5A 1T25A 4EYEA 4CUKA 4TROA 4CMEC 3S2EA 3GN2A 1B8VA 2I66A 3LT2A 3WGGA 3TZ6A 2TMGA 3E9MA 4PLPA 1V6AA 2RBEA 1TI7A 2CY0A 4YT5A 1NBOA 1Y9EA 3MJ4A 4CMAA 2VHYA 1GL3A 1JVSA 1XIVA 3PGXA 1YB4A 4W82A 1X7DA 4JROA 2LDXA 3DBLA 3BMCB 2JKVA 1NWCA 1HZJA 4NJMA 1A7KA 4RF3A 1A7AA 5T8KA 1GD1O 2PZLA 1V0JA 1O9BA 3W6ZA 1P1FA 1ZEMA 3IJPA 1KVUA 4FFOA 1VJTA 3Q3CA 4II2A 1I32A 3KO8A 4MIOA 4PRKA 4E2WA 4Y6PA 3GA0A 3IKTA 1T2AA 2YHIB 3LC7O 4J2HA 4KUHA 2FPPA 5CDGA 1T26A 3Q9UA 4MKZA 3PHGA 4QECA 3L4BA 3ADOA 4XIYA 5EPOA 3WBFA 1A9YA 3EAGA 3ZWWA 4MIEA 2D8AA 3ULKA 1PJ3A 5AXAA 2VUTA 4AVYA 2VOEA 4Q3CA 1WNTA 4OSPA 2I3GA 1UZNA 3HFGA 1FDUA 4WKGA 5DZSA 3BMQA 4ND5A 1HETA 3GHHA 3BHMA 1I2CA 2A92A 3JYQA 3NX4A 1R12A 3NT2A 4YQZA 5ER9A 4D7AA 4GSKA 2BH9A 1BTOA 2IRWA 5KKCA 4OKIA 3WGZA 4KZPA 2G82A 3WG9A 2GASA 1B2LA 4GX5A 4XX0A 1R0LA 1QKIA 4F6LA 3BIOA 2AQIA 3FNFA 3H3JA 3HNPA 4D3SA 1T24A 4PZCA 1MV8A 5T57A 3OP4A 2B4RO 1NQ5A 1Z74A 5B4TA 2NVWA 4M49A 1ZW1A 2VRBA 4FN4A 1PU2A 5K0ZA 4RORA 5BQFA 4YEDA 2FPIA 3JQAB 3PWKA 1B3BA 2HCTA 3JQFA 2GERA 1YB1A 3G1UA 4J7XA 3TFOA 2IE0A 3TPCA 1K6JA 5ADHA 4DYVA 5A1TA 4DA9A 2BI8A 3Q6IA 4NBRA 1ISHA 1OI7A 4WNIA 4PLVA 2PKRA 3BHJA 2C59A 5DN9A 4Z9YA 3S2FA 1M75A 1EQ2A 2UV8A 4FGWA 1QR6A 4R68A 3BMNA 1FDWA 3KEQA 4W9NC 5DCYA 4FQ8A 4RPGA 3DZKA 5TS3A 4LMPA 2PKQO 4TRNA 3ZHBA 4RVGA 3HN7A 4CQMB 2FRDA 3LLSA 1KETA 1SNYA 1O8CA 3EGOA 4CQLA 1NR1A 1JDJA 1E5LA 3H9QA 3BZUA 1R0SA 4MVJM 2UUPA 4TVBA 5KKAA 1H94A 1KEVA 3WMWA 4E2ZA 1FDVA 1B8PA 3ANNA 4JBIA 3WYCA 1OOEA 2ZB8A 1FMCA 2DBQA 3F1KA 1HTBA 3FNEA 3OQ1A 4XGNA 1ZSYA 4AJLA 4Q3EA 1R4NA 4HP8A 3AUSA 3DR3A 3AWDA 3ZWYA 2FZWA 5A3JA 3ZWAA 3CEAA 2HMSA 1TT5A 4XZ3A 2P9GA 4R41A 5JSFA 1DLIA 1PJ2A 4RF2A 3AFNA 1ONNA 4DQXA 1H6CA 3H2ZA 5T5QA 1R4MA 4ZD6A 1V8BA 3M1AA 4B7XA 3GEGA 4PLFA 2IEBA 2C82A 2GZ3A 2WMDA 4WCFB 4TRRA 4E32A 3Q2KA 3H2SA 1HDRA 4D43A 4CM8A 3TJRA 3UCXA 2W2KB 4BB6A 1KY5A 2UAGA 2PV7A 2WWRA 3E9NA 1B8UA 1ZMOA 1AHIA 2AQ8A 3D1LA 1ENZA 3JQ9A 1C0LA 1YQXA 1A71A 3VZPA 4DQVA 4K26A 4XQ9A 2EKPA 3H5AA 1LDYA 3BMOB 1BDMA 3EY4A 3PI7A 3ZV4A 2IYOA 1ORRA 1PR9A 4D44A 5MGBA 3O26A 4R01A 1EDOA 2SCUA 2X9NA 1F0YA 3KSZO 5I7EA 1VSVA 3PJFA 2AE2A 3I23A 4NMHA 1XKQA 1QYVA 1HLPA 5ER6A 1UDAA 1Q2XA 2VT2A 1PWZA 2E82A 4F6CA 4EJ6A 4I5GA 1IULA 3NTQA 4FFNA 1DRUA 3TL3A 3E03A 2OBNA 1E7WA 2JCYA 1IOLA 4ZU3A 4B7UA 1NWHA 1X1EA 4S1VA 3BA1A 4Z3DA 4YJFA 4WLEA 1X15A 2BI7A 1S7CA 4LN1A 1EE2A 3JD2A 3WGHA 3EYWA 3ASUA 4PLGA 3I9KA 5I7VA 4KWHA 3ROQA 4EUHA 1MGOA 1PTJA 3WTBA 3UKOA 1A4UA 4N5MA 3ROMA 2OFPA 5JO9A 3VH4A 4K6FA 5C5IA 1O0SA 4DTIA 1E1MA 5DDIP 3C1AA 5BSFA 3AY3A 2A4KA 2AEJA 2C07A 1N92A 1UXIA 2PZJA 1P1JA 1C14A 3GY0A 4I08A 2NQ8A 3F4BA 1NVGA 3EUWA 1NFFA 2Z1NA 1PWXA 2EP5A 4JX8A 4CMIB 4XYMA 4LRTB 2CUKA 2HK8A 2YUTA 1EUCA 2YV2A 3RC9A 3E82A 3ETDA 2D4AA 3QVOA 3AU9A 4ALJA 3DDNA 1MXHA 1V35A 3ONDA 3P2YA 1PS8A 2NTNA 2QQ5A 3VTFA 1M76A 2CMDA 1CIVA 1EK6A 2Q1UA 2AMFA 1PJLA 2JD0A 4IUYA 3GGPA 1IHXA 3NT5A 4PVCA 2Y1EA 4L9RA 1QYWA 3CXRA 4RF5A 5FI5A 1G0OA 4TWRA 2VT3A 4QTZA 1U28A 3IJRA 4XGKA 3ZNPA 3P7MA 1FK8A 1NAIA 4J4BA 1H2BA 2H5LA 4GGPA 3QWFA 1LLUA 2RIRA 1UZMA 1J49A 4LSWA 4R9SA 1U2GA 1DSSG 3VH3A 3L9XA 3RWBA 4XA8A 2FN7A 3IC5A 4L8VA 5AXDA 3INRA 3UGKA 5ITWA 2ZB4A 1R16A 1GEGA 1OZAA 4IY1A 1NVTA 1WW8A 2AG5A 2BFMA 3P19A 4J91A 4OQZA 3WIDA 1EBUA 3MEQA 2EIHA 4MVJH 2O2YA 2P91A 2Q49A 4L4XA 2EW8A 4GLLA 2PD4A 3PFFA 4N5NA 3ETEA 5CP8A 4Y6RA 4ALMA 2VYND 1N7GA 3HDQA 5I9MA 1LJ8A 2O3TA 2Q1TA 5T6BA 3SC4A 4E30A 2I99A 2PTGA 1T2DA 1C1DB 1YO6A 3AY7A 2BGMA 4LVUA 3UVEA 2CZCA 2VNAA 3GVXA 1DC6A 1FF9A 1U4OA 4MVJD 2GD1O 3JQ8B 4J6FA 5A4DA 2CDAA 2PK3A 1PZEA 3H3FA 1UXKA 2WSBA 3I9NA 1WWKA 2D59A 3QVWA 2HRZA 1DHTA 1TA4A 2VTDA 1O94A 4LCEA 4MKRA 4NBUA 3VPFA 1CETA 1FJHA 4TKLA 4J90A 4MO2A 3VPHA 3AOEC 2VWGA 3K96A 4PN3A 1MA0A 5IXYA 4CV2A 2X1HA 4AJ1A 4U6SA 1N9GB 1ZSNA 2DPGA 4CMKA 3GUCA 1JKFA 1LA2A 1NFQA 3V2UA 3ZU3A 3ZN2A 1FDTA 1YGYA 4OXNA 5HRUA 1LQTA 4YAGA 3DHEA 3KB6A 1HT0A 1Z45A 5T64A 5G4KA 3I6QA 3JD1A 2AA3A 1GYPA 3U5TA 1LBEA 1JWAB 1DC3A 5JNLA 3AI3A 3OICA 1XDWA 4YDRA 3VVBA 1ZK4A 1NHWA 3JQDA 1I3LA 4BO9A 5BSEA 4PG8A 1PEDA 5BNFA 2V6BA 4B4UA 2ET6A 4GKBA 4M1QA 5ICSA 3JD3A 4A7PA 2JL1A 3KUXA 4FBGA 2EHDA 1YQGA 1E1NA 1V9LA 4PIVA 2EV9A 3U49A 1HXHA 3HDJA 4DBZA 5BNIA 4NPCA 4CLEA 4RQUA 3GF4A 4J3FA 3TOZA 2OBYA 1QP8A 3U3XA 1Q0HA 3BTOA 1A4IA 3RUCA 4QQRA 3GRKA 4KQWA 3C1OA 1IUKA 3P5SA 4D41A 3B1JA 4JQCA 2QRJA 3I9LA 3PQFA 4TQGA 4A2CA 1CQIA 2CVOA 4RPKA 3WGOA 1UP6A 3FTPA 1I2ZA 3ROPA 1HYHA 1X7GA 1DRVA 5GMOA 1AUPA 4URFA 3ZCXA 5AVOA 3VTZA 3DAPA 1IL0A 3KLPX 1ZUD1 4Z0TA 4D45A 6ADHA 1F12A 1U4SA 1CF2O 3WQQA 2IXBA 3WWYA 3VPGA 5JYDA 5H83A 3KYCB 3PHIA 4RF4A 1IPEA 3TWOA 4GWGA 2HU2A 3WYEA 3ZWCA 5A02A 1RJWA 4RV9A 4R1NA 3TOXA 1ZVMA 2YV3A 4EEZA 5LC1A 2FR0A 3ITDA 5L7YA 4CUZA 3FI9A 3E18A 1JKJA 3KBOA 3D5QA 2X0IA 4U0JA 1NPTO 4HV4A 1SOVA 1YJ8A 4W7IA 4BV9A 3E5MA 5JAQA 3OIDA 4HFNA 3ZHZA 3VZQA 3GVIA 4ILKA 4QSMA 4XIJA 2HJSA 1WLYA 5DT9A 3VDRA 5HWSA 3GVHA 3QWAA 1E6EA 1PS0A 1UJMA 1T2EA 4JN6B 1HL3A 2RH4A 1OAAA 3AUAA 3AM3A 1GCOA 1Z6ZA 4DC0A 5KJ6A 4PZDA 4YJGB 1LC3A 1WPQA 5L4LA 1I24A 1BVRA 4A27A 1I01A 4MP6A 1GV0A 3ZHYA 1WDKA 2FPGA 3KZVA 3OJOA 3INGA 3R1IA 5F5LA 3VZSA 1P0FA 4P4GA 1ONPA 1V3UA 2Y1OA 3ANMA 3PYMA 1TB4A 4G65A 4JLWA 1BHSA 3DAGA 3S1LA 2O48X 3GDOA 3SC6A 1DFGA 2UYYA 4NG5A 4R16A 1HEUA 4TZTA 5KNLA 4KTVE 1Q0QA 4BUCA 4NIMA 2GN9A 1XA0A 2Q4EA 1E92A 5DULA 2QZ9A 3H4VA 1KY4A 4JNKA 5KJEA 1ZEJA 1NNUA 4HNHA 1UDBA 2GDZA 1NQTA 1NM5A 5L53A 1YOVA 5EERA 2GYYA 4CUJA 3GZNA 2NVUB 3F5QA 4XB2A 3K92A 2FR1A 5G0SA 4NK4A 4E31A 1NVMB 1H9AA 2W2KA 3DMTA 3RUHA 2HMWA 1PJQA 1LQUA 2NSDA 1H2HA 4DGSA 1JVBA 2BMAA 4NFSA 1NASA 4A10A 4BO1A 4PZEA 3GPIA 3ZGYA 3R0IA 3DTTA 2PGDA 3FPCA 1DDOA 3GR6A 1ISGA 1U7TA 2P5YA 4CJXA 4YT4A 5C3MA 3E1KA 4XR4A 2J3JA 1QRRA 4B4WA 1QYCA 4ALNA 3WS7A 3KYBA 5IFLA 3D5TA 4R1UA 3RC2A 5DF1A 5DBFA 1KEWA 2Z95A 2DAPA 1ADFA 1PJTA 2YQ4A 4TMFA 5ILOA 2JHFA 2OP0A 3N58A 5C37A 1HKUA 3PJEA 4YXFA 2DBRA 2DU8A 2Q4BA 4CLRB 2JD1A 4J1SA 1GDHA 4GH5A 4M86A 1WMAA 1ISMA 2ZTLA 4XDYA 1YL5A 4KUGA 3RBZA 5DBIA 1UXJA 2Y0CA 5DCUA 1J0XO 1LDEA 2Z1MA 4LW8A 1ADCA 4DL9A 5I7FA 3DHNA 1GADO 4YAIA 4NH4A 2FSVA 2VUUA 5IJZA 2PR2A 3IDSA 1YBVA 3JYNA 1U3VA 5CEFA 2W98A 4XEHA 2AQHA 3ZV3A 2NV6A 1XEAA 3G0OA 2YW9A 1T4DA 4TRMA 2O4UX 2O3UA 3NDJA 4D0SA 5AQ1A 4M55A 3UHAA 4EITA 2DFVA 1QV6A 2ZJ1A 4YRAA 1WDLA 3I4CA 1BSVA 3W4JA 3GLQA 1PL7A 4XRGA 2NU8A 4YPOA 4PG6A 4RJTA 4ALLA 2NACA 3BAZA 2J5QA 1RM3A 4UEOA 5A9SB 3O9ZA 3ZV5A 4D0RA 3ST7A 1QYXA 1ADBA 4NHEA 5JPIA 2VWHA 1DAPA 3DFZA 3OQ6A 3PDUA 2Q2QA 4C4OA 4L76A 5I9LA 4HBGA 1ADGA 1OFGA 4GX0A 3WGQA 4QXMA 4CR7A 1I10A 1GU7A 4JBGA 2RAFA 1HDZA 3K9QO 1HDXA 1U3WA 3K73O 3I4FA 2C0CA 1CWUA 3CKYA 3OFSA 3UN1A 3NKLA 4K6CA 4IJUA 2C7VA 4AJOA 3FBTA 4J1QA 1YH3A 2CD9A 3OECA 4G2NA 1M67A 1G6KA 3OIFA 1ZFNA 1PGOA 4F45A 5CPFA 1B14A 1PIWA 5AYVA 2WE7A 3NDRA 3CMMA 5C7IO 3UF0A 4BOYA 1JKIA 2GSDA 5A06A 1AN9A 1OBFO 3HSKA 3ZH2A 3D64A 4J43A 2PD6A 4UEKA 1L7DA 4A73A 4AJNA 1PL8A 2QRLA 3SJ7A 5IDWA 1F06A 2ZYGA 3ONFA 3PP8A 4L4RA 3UAGA 5B4UA 1CDOA 6LDHA 3A14A 3DZJA 4FFPA 3EVTA 3NGLA 1HDOA 1NXQA 1VKOA 2X0RA 3DZHA 2IZ0A 3EZLA 4MP3A 3ZW9A 4RDHA 4R1SA 1YL6A 3KYDB 3U9LA 1C1DA 4DREA 2OUIA 1B0AA 1KVSA 4M89A 3W8DA 4CMJA 2BLLA 3GVPA 4CLXA 2DQ4A 1HE3A 4BHTA 3KXDA 1YBAA 2Y68A 4MVJP 1ISJA 3M6IA 4OGWA 1E7RA 1P1HA 4ZGWA 1C3VA 4AJHA 4CMBA 3GT0A 2PWZA 4FFRA 1KIFA 2DUUA 4PLYA 4CMGA 3RUIA 1E3WA 3NJ4A 1EFLA 5JCJA 3PWZA 4HNGA 1BXGB 3L9WA 1YVEI 2R6JA 4FS3A 4L0QA 3GFGA 1F17A 1VKNA 3B70A 3F9IA 1SMKA 5HBRA 4WJZA 3VHRA 4YB8A 1RM4A 4N54A 3SLGA 4YRBA 2JFGA 4FFMA 4WEOA 5HA5A 3H9JA 4EUEA 1N9GA 3WR5A 3WYBA 1SO8A 1GYQA 1Y8QA 4RZHA 3QJ5A 1KC1A 4DIOA 3F47A 3ASVA 2FSSA 4JP3A 2R00C 2EP7A 1L7EA 3ICCA 2BKAA 2X7HA 2D2IA 3D4NA 4O63O 4Y6SA 5BSGA 1HSOA 3WJ7A 3IL2A 4FDAA 3DHYA 3GG2A 1SPXA 1ZO8A 2YY7A 3RASA 5U9CA 2O3QA 3JQ7A 3L77A 1NAHA 2X58A 4PCVA 5L45A 4E21A 2NM0A 3QV1A 4BNUA 3QA9A 2BFAA 1ZK3A 5BNTA 5IAAA 4Y98A 3STHA 5I8WA 2Q50A 4LMRA 4WOJA 1Y7TA 2AW5A 3FTNA 2GN6A 2NTVA 3TQHA 1LXCA 3S2IA 4DIFA 3RBXA 3FF4A 1XU7A 2ZCVA 2BGKA 5TRTA 2HDHA 1MG5A 2B36A 1P1KA 3ITKA 4MKXA 2EJWA 4BMNA 2HKIA 3TZQA 1P31A 2C2XA 1LRKA 4PLHA 1XG5A 1X0VA 2CFCA 2DBVO 5I9NA 1LNQA 4WECA 1BW9B 1LRJA 2WD7A 5JAMA 5ES3A 1RM0A 1Z7BA 3DZIA 4EBFA 4BO3A 1UP4A 2C5EA 3U4IA 1U2DA 3PLRA 4H7PA 4UVEA 4ZQBA 2EGHA 1Y5RA 1H6AA 3Q2IA 1T2FA 5A5FA 2XPCA 4O5OA 5T8KC 2Q46A 3QHAA 4XRRA 5BR7A 4ITUA 3H7AA 2E49A 4R3NA 1YDWA 3LLVA 4IZIA 1HWYA 1T1RA 1GV1A 1LSSA 4H15A 1QV7A 3GEDA 3OEYA 4M54A 3ZWNA 1BDBA 4WLOA 3QY9A 3AJRA 3RUFA 1G0NA 3PLNA 1SAYA 3KYCA 3L4BC 4CM1A 5A5EA 3B1FA 4LSMA 1DJQA 5IG2A 4GLOA 5COBA 3WSVA 8LDHA 1PGNA 1GPJA 1EUZA 2QX7A 4BKUA 3EC7A 4MINA 4E12A 4ZQHA 1M6HA 2GRAA 4NBVA 4OAQA 3JV7A 4P8RA 4BO2A 4I8XA 3MJVA 5EJ2A 3PRJA 4Y8VA 5KIAA 3DBRA 1YJQA 4CLDA 1RPNA 2VWQA 5JFOA 4OO3A 4TZKA 2AHRA 2VHVA 2ZQYA 4H16A 2IODA 3KTDA 1TEHA 1R15A 3LT0A 1MB4A 3OBBA 4C7KA 2J3IA 4Q39A 5TF4A 3DBHB 1Z7EA 4BGIA 2ZYDA 3L4SO 4YAKA 3S8MA 5JAZA 1HYEA 4BNYA 1PS9A 3ON5A 2ZYAA 3JQFC 3MWDB 1DRWA 1TT7A 2FWMX 3A4VA 4IMPA 3JYOA 3PEFA 3KEOA 5AXBA 1C1XA 3QRWA 3I83A 1B3RA 1Y8RA 2J5RA 3GNQA 1PZGA 1N8KA 3DAFA 3OJ0A 3FNGA 4L4SA 2FY8A 4WUVA 4NFHA 3WICA 3TZCA 1Y9AA 3LVFO 4FCCA 2BGLA 2WJPA 2DTEA 3ZHXA 3V1YA 3UOGA 4CM4A 2EGGA 3T4XA 2VZ8A 3FNHA 5EMHA 4J1NA 1EBFA 4RPLA 2C29D 2PH5A 3WQRA 2BD0A 3PFWO 1HF3A 3NTOA 3Q9NA 3H9UA 3NT4A 3G17A 1GQ2A 2PY6A 1L1FA 5U1PA 1H5QA 2ZQZA 3GDFA 3QVSA 4AJEA 2Q3EA 2R2GA 1LU9A 3OIGA 2V65A 1X14A 2X5JO 3CPSA 1UAYA 5H82A 5THKA 1RWBA 3UH1A 2XF8A 1OC2A 3AK4A 4OSOA 3VPXA 2GLXA 2O50A 3QWIA 3V8BA 1P44A 1GYRA 3PPIA 1KEPA 5JLAA 2PA3A 1UXHA 2J3HA 1NQAO 1YBMA 1SB9A 2Y0EA 1BXZA 4OYRA 2PGLA 4U0KA 4CM3A 2QIOA 2DFDA 2PZMA 1VJ0A 1SBYA 4KTTE 5CEJA 1C0PA 4Y67A 4DMMA 4NZ9A 1YQDA 3LU1A 1DFHA 1U8XX 3E5RA 3F46A 3QE3A 1H93A 2VUSA 1E77A 3LF1A 5IDYA 3GC6A 2UVDA 4XYGA 3GG9A 7ADHA 4E5PA 2YJZA 3JQGA 1EFKA 3LT1A 4MVJF 4UUMA 1EMDA 4WE3A 1ZXLA 5KVSA 4W6ZA 4B7CA 3A1NA 1WP4A 1SOWA 4OKNA 3ZNNA 1JN0A 1XELA 3VC7A 3JQ9C 4GVXA 4JXKA 4CLOB 4R4JA 5TX7A 2Y66A 1O89A 3W4IA 5IZ4A 3UCFA 5TLSA 1DAOA 4G5HA 1LSOA 3QQPA 4BKRA 3AM5A 3GGOA 3VDQA 2DTXA 3IP1A 4NR0A 4A0SA 4WNCA 1UH5A 5LCXA 2I76A 1E6UA 1LTHR 3HN2A 1R66A 2AEFA 4RL6A 4E33A 4BV8A 1KBZA 2NLOA 5HTOA 3FHLA 3D3WB 3O8QA 1GY8A 3WSWA 3QVXA 3C7CB 3CINA 3EK2A 3LSYA 4A26A 2QHXA 4BGVA 3KETA 5TSDA 5JC8A 2YZ7A 1LLCA 2IYPA 4UAGA 2I65A 1GPDG 3KHUA 4XKJA 1PZFA 3LK7A 5GZ3A 1XGKA 4OM8A 4R54A 3VKUA 3FR7A 1D1SA 1P1IA 1EK5A 3LDHA 1P33A 4R5MA 3ICPA 4ZQEA 4J2OA 1IZ0A 2VRCA 4IIUA 3NJ8A 2XAAA 5THQA 4BNZA 2OXIA 4RLHA 4BB5A 3LT4A 2E37A 3QLJA 4XYLA
chains in the Genus database with same CATH superfamily
4ZYZA 2C0QA 4KDFA 4JBWA 4J4TA 4R1PA 5KPJA 1MFZA 1YULA 1RWMA 3ADKA 1ZC4A 1NSTA 3BKWA 4PO3X 2Y1CA 1G5IA 3RHZA 1FTWA 3EFHA 3L7CA 3F7OA 4FJ0A 4OOEA 5CDHA 1KI9A 1BOOA 4JL8A 4D82A 1EFHA 2H59A 3BK2A 3C5VA 1PG5A 2IU3A 3DBLB 3FAKA 5FNVF 5BW5A 5AW6A 2V9ZA 4PFJA 3EYAA 4RZUA 4K3VA 1JAXA 1M6VB 3BMCA 1M0TA 1Q0TA 4X41A 4TTRA 2QR2A 5FBQB 2JVKA 3EWSA 3PDWA 1DAFA 2VKTA 3VR3A 3ZHSA 1SK9A 1TGYA 3A7EA 4Q6WA 5JSYA 3MT9A 4GKKB 2BY4A 3ENNA 4IJQA 5KJFA 2QXUA 1ZCJA 1XZJA 3NBYC 4Y2SA 1FDRA 3I9MA 3DEAA 2HPZA 3OQBA 4D81A 5FHRA 1KOLA 1CVIA 2EYQA 3VR4D 3L6CA 2QVLA 5CLFA 4WESA 2XGJA 3ZQKA 4DLXA 3ONWA 2HV8A 1IM2A 2ILTA 4QDXA 5JCJD 2PZEA 4MYUA 3HBFA 3UJNA 2J8ZA 4QQ8A 4WK0B 2NYRA 1D8AA 4U6QA 4F4DA 1KR5A 4XWKA 1QAOA 1HNZB 2WVGA 2Y1DA 1Q1NA 3GBPA 1P1CA 4RFVA 5FBWB 4C0HA 1IN6A 1RI5A 1HMYA 1KOJA 2P9BA 4LG1A 4RPIA 4TMTA 5ERYA 5ADVA 3CLVA 1Y89A 2XR1A 2GKOA 2G25A 4IEEA 1ZY2A 3U17A 4G6ZA 4AICA 1C8BA 2O05A 1WETA 3BDAA 3CZRA 1QG2A 3VVMA 4QU8A 4HDAA 2JLRA 1LK0A 1RRPA 4MQFA 5IC5A 3I76A 4X71A 1NKVA 3S2UA 2XWPA 1UBHS 3FCAA 5IANA 4LYAA 4JITA 4RPHA 5A3VA 3WGYA 4ARCA 1Y42X 1QNFA 4B9AA 2GTPA 2WWWA 2PKEA 4Q00A 2YS6A 2AK3A 5A6SB 2G70A 4CFYA 5IVPA 1NJ5A 2GILA 5K6AA 1VLZA 3ZXXA 3MGBA 3JATA 2IYNA 1Y1KE 3JRXA 4OXYA 1KOGA 1NBMD 1W85A 1X1QA 2ZRAA 1EGMB 3V4ZA 4AZSA 1BEZA 2XBMA 4IG9A 3VQTA 3N2YA 1WDTA 1CX9B 1WZCA 3I2GA 4K1LA 2AR0A 3PD0A 1Z3CA 2IYEA 3AEKB 2E87A 3U44A 1E3EA 5DGTA 2OGUA 3BQMB 1O94C 1ZDMA 5DMXA 2FEPA 2FOXA 2GEBA 2B92A 3BL8A 2XUKA 3F6EX 4GSLA 4RHTA 4FOTA 5IULC 5IM4F 3KHTA 5CXSA 4CV1A 5KSOA 3NO4A 2O2ZA 2UUAB 3AC0A 3UKDA 4IJKA 2NZYA 4BFZA 1K2VN 4N01A 1QTNA 1S2LA 4MR7A 1I6MA 1NRJB 1Y48E 2D3WA 3OQIA 3V7YA 3WYGA 3ZR4B 5ICMA 3EHEA 3BTUA 4U2CA 3C4QA 3QIVA 5DIFA 1Q7GA 4S2EA 2DUWA 3GOHA 2AC4A 4KR9A 2G9VA 4DR3B 3HCFA 1QH0A 2C54A 3LBFA 3LQFA 3OHPA 4OQDA 3VR2D 4Z5XA 1WA5A 1PNRA 3CUYA 4YP0A 1GTG1 3IE2A 5DP2A 3ELWA 2HPVA 3OZGA 1MW8X 4YP6A 4ZHQA 1P81A 3KSUA 3NNDA 4MQEA 2GYUA 3EF0A 1P2BA 2RH5A 4IRUB 1K6IA 1IN7A 1XK7A 2XHEA 1JEAA 1G8FA 4CQLB 2Q29A 4NENB 4XPZA 5H02A 2VDUE 3MQFA 1NVAA 3R8XA 4FKZA 3B82A 5CVEA 2WJAA 2HLHA 2FW7A 3RVDA 2E7ZA 5GZ6A 4QZVA 2JHPA 3Q3HA 1LBSA 1N2CA 4MQBA 4MV6A 3ZHVA 5CXXA 4EKGA 2VFAA 3FRJA 3SIPA 4UUOA 3G1WA 2QTMA 2W6ZA 4JP1A 1QLHA 3VAYA 4KXVA 4PANA 3PUVA 3IQDB 3L0ZA 5JD4A 2ZE7A 3A6FA 1XDUA 1NN1A 3V8QA 1R4NB 5BT9A 2DVMA 1B26A 1UK8A 1LDBA 3EGVA 4LRWA 5J5AA 4AB1A 1B0PA 1BHQ1 1WEHA 2AHOA 2HUPA 2Z8YM 3I1FA 4IIJF 3RVKA 3WL4A 4ZEMA 1GDTA 1NBAA 1E0DA 4OBBA 1DO8A 2O57A 2UVQA 2R25B 3A0RB 3IX7A 3NEJA 1SH7A 3IVCA 3ISJA 1AUQA 1GFWA 1TK9A 1UIRA 2PT9A 3O03A 3NYRA 4NCHA 5AJWA 3RSQA 3H8WA 5C52B 4AO6A 1VP9A 2QN2A 5C7LO 3PLAE 1IJKA 5CTJA 4MOWA 3GB9A 3B5IA 3L8DA 2EBFX 3DFFA 2IWRA 4F21A 1P4RA 2XDQB 1Z6QA 5ELXA 4HWOA 1VCIA 3R3VA 3JD4A 5D7NA 3LHDA 2BP7B 1DX6A 3ILVA 4HMQA 3BJMA 5B64A 1ZD9A 3JTEA 3GRCA 2RHHA 1RJFA 1RAIA 5CLHA 2Z2IA 4MSUA 4CDNA 1K4YA 1NL3A 1MQ8B 2A5LA 1L3CA 1A8UA 4UUQA 2BZ0A 3V3KA 1U3TA 4PZ0A 1YNOA 3RUEA 4AS2A 2XCQA 4IQ0A 2JC3A 3FR8A 1YZTA 4PLZA 2XSZA 4Q9KA 1XT6A 1PYDA 2XE4A 2G5CA 4KQXA 3WQBA 1LDMA 1AHPA 3ADDA 1F8GA 4X62B 3EOAI 1TQDA 4DLAA 3DG9A 3MNFA 3E7XA 3FNBA 1TU0A 3LXRA 5IZCA 2IKQA 1J8VA 2SCUB 5FR1A 3B13B 1G1AA 2VEOA 2R6GA 2YL2A 4JBNA 5JH7A 1MO6A 1JIQA 3QU2A 3ZYZA 1TTTA 4Z53A 4Z4IA 3K0HA 1EXNA 4KG7A 4ALKA 1AS3A 2YIMA 3ZE6A 4TSRA 5FHQA 5D3MB 3DLPX 1L7RA 2X8WA 4Q47A 2IK8A 2VHCA 1WF3A 1BOFA 4CR6A 2RGDA 4RTOA 1N75A 4ZQFA 3RJ5A 3O1JC 1JEOA 3C24A 4HBZA 4IJWA 1J0DA 2GFQA 2PJUA 1L1QA 4MHSA 1Q7BA 4V38A 2B9VA 4KRXA 2J3DA 2PRKA 4WD3A 3PIIA 5GGXA 1U7HA 1V26A 3RJTA 4AN4A 4HX9A 4NK5A 5G41A 1Q44A 4YJFB 1G3RA 1Z2PX 4LCJA 3RS5A 3V4FA 4P4LA 4EKNB 4KPUA 4FMCF 2HWYA 4GECA 4TV9A 2RAVA 4BZXA 4F12A 1OYOA 1T3TA 5AKGA 3IS3A 2IY9A 1IEQA 1VJ1A 1XLWA 3QVGA 5FR2A 3UV7A 5IJ0A 3OM0A 5LBTA 3LY5A 2RCYA 4OK3A 5I8ZA 1SBCA 3K31A 4IHJB 3IAM6 2B1JA 2FXVA 1T91A 2YWBA 2VXBA 3ICEA 2QTVB 1KVQA 1M33A 2OD7A 3GLKA 3E15A 3HJUA 3MTGA 4RWZA 3TTYA 4A8PA 3CRRA 5KCZA 3AEZA 2QJRA 3DMPA 2CDCA 3O38A 2ZK7A 4YRKA 4GAEA 5U4QA 1PQPA 4HNAB 1EUCB 2EWVA 2W8ZA 5DRYA 4ZK6A 2BEVB 4KXXA 3RFUA 1PEYA 2VKQA 1BGWA 3FHJA 3PGLA 1SXJA 3AW9A 2SNIE 3EF1A 3WL7A 4D79A 3HXLA 2FPLA 1RM5A 1VC2A 3DEIA 4BO8A 5IXJA 4XAQA 3ZWOA 4YJ3B 4BLPA 1WOMA 5J58A 2AFIE 5CJJA 4UE3S 2ZR8A 1E9AA 2D7CA 4RTRA 3IOCA 2FUNB 5IWCA 1YFJA 4QYXA 1D3AA 4LI3X 3D3JA 4QPNA 1SQ0A 4MKIA 2D1FA 3GH3A 4GBJA 2HQ1A 1AVTA 3N75A 1X7YB 3AUFA 4OQ4A 4R3WA 4G01B 1CY8A 3S27A 4Q7KA 1L3BA 3VX3A 1PZHA 4WEQA 3H6KA 1QLJA 1PGJA 4MEBA 3AX6A 2YWEA 1U8YA 2C5AA 2WF8A 2ZSEA 3C45A 4OHUA 4Q0MA 3WDKA 4Q7QA 5FULA 5JY6A 4A91A 3O0DA 2QAIA 4DFDA 1Q84A 5TPWA 3T4PA 2ZRKA 4EB3A 1L5HB 3NU1A 4PZYA 2AOXA 2P7IA 4LY6A 3D2CA 3LHSA 1MX9A 3EFBA 4FFVA 1RLMA 3VO8A 2X3FA 2QV0A 3NM5A 1EZZA 4J94A 3HRHA 4MWSA 3QUQA 2WLSA 5BSHA 2WUGA 1PL6A 1ZN9A 1I33A 5DX0A 2I8LA 1QGOA 1U1CA 4UCQA 4PPGA 3QVMA 4HN2A 3OZVA 4DMGA 1AQ6A 2GEUA 5ALXA 4WY8A 1H65A 4N18A 2YJ3A 2KBFA 1GFSA 3S5UA 1JXOA 1IBSA 3M4ZA 2CK3A 1Z6TA 2W2LA 4WKBA 4DJDC 1R8JA 2QF7A 1K89A 2C9BA 3ZCUA 1WZ2A 3I3SR 2WUDA 4C3ZA 5K09A 2QT0A 4C2TA 4ETNA 3THXA 1KAQA 3WV4A 2OESA 3GT4A 4EUFA 1RZVA 2D54A 3KRTA 1A7UA 1RXCA 3O8OB 2HQBA 3GHYA 5IDXA 1D4AA 1WB5A 4Y6GB 1SCUA 4QICA 4Q4CA 1EB9A 2HSDA 2WWHA 4NFYA 4EMSA 1G4AE 4QUAA 2RH8A 1VPLA 4PHTA 1O57A 1K3TA 4M46A 2V5AA 3QWHA 1N2HA 4IIVA 2C4MA 2V1UA 2VF8A 3PK0A 1P60A 4DTCA 4XSVA 3GFSA 2INGX 2ZDQA 3DTVD 3IOMA 1XYGA 4WXHA 1UC5B 3W05A 3OMLA 4W5WA 4LGMA 2DWQA 2CV0A 1TO2E 2JEOA 2JAHA 5FTWA 1XRSB 5AVWA 3HSSA 2VRCD 3R7FA 5CD9A 1C29B 3CBGA 1RRMA 1GQOA 3D02A 1T9ZA 2HU5A 3PGJA 5G0VA 4UOEA 3WK9A 5J2UF 1QHEA 1DELA 3FCYA 5J63A 3BL6A 1E18A 3B9RA 1LD3A 3IUSA 5G4KB 4L8YA 3WLKX 3H13A 3SYNA 5ALMA 1N34B 4ZVVA 5CFPA 3VR5H 2W93A 2LIPA 2BHLA 1MTZA 2PQ2A 5KNBD 4DCUA 2Q0SA 1PFKA 5I7AA 4DOMA 3CXUA 2C83A 1MIOA 2CLMB 1XCPA 1TQ4A 2GCGA 4M1EA 4QBTA 4V0OA 1VIDA 2JI8A 2FVXA 4MTLA 2QRMA 3VPBA 2GXQA 1DDIA 3E9YA 3IERA 3Q5EA 1V7PC 1XHLA 2CC2A 4II7A 2GEFA 1RQGA 3G89A 1FLDA 2W0SA 3OZXA 3EXG1 2XMCA 4NTZA 4F4JA 1B74A 1XZAA 2Q2VA 2DMRA 1QO0A 1M2WA 1IC6A 1N5JA 1VM6A 4B6FA 4FDTA 5KQPA 4RTSA 4FR5A 5G3YA 3BCUA 4EHJA 4YWHA 4K6KA 1HDGO 4R8RA 2XVMA 3G23A 5ESRA 4L6AA 4BO6A 4IVPA 3MF4A 2H48A 3T1NA 5KC9A 5EWLA 1JV2B 3OJXA 1YKGA 4B80A 1X9GA 1GFIA 4MVJE 2DWCA 4E94A 3SEZA 3UHOA 1P5ZB 2RJNA 3FKSA 2ZRFA 1UM8A 4ILEA 2HQOA 3B6IA 1DJMA 3WKEA 3NNSA 2J9YB 2R85A 3RYHB 4E4RA 4B5KA 5DYIA 3NGXA 5GOZA 4WV3A 3GROA 3BPSA 2J87A 1X80A 4PXAA 1Q1EA 1NYLA 2MOKA 1XZBA 3HEBA 4MAFA 2VP9A 5ARDA 1Z6XA 2ZJ0A 3SIWA 5ITZB 4WTOA 4ANFA 1TCUA 1CQIB 1L4HA 2WOOA 3ISVA 4M8KA 1U8AA 4NFLA 4B6JA 3ER9A 4PNEA 4L5AA 3UAVA 3ZUPA 4JJFA 1NW4A 1NMQA 4CG2A 2ZETA 2ZTSA 1RRVA 1LEHA 3RKSA 3L49A 4OI1A 4NEGA 2P2DA 3CISA 3FGNA 4TLBA 4HX2A 4K6HA 2XBLA 3HU2A 1XTSA 3MTBA 4CIXA 4ESOA 4HDSA 4UTRA 4DBLE 3A1CA 3GWGA 1NOKA 2TYSB 2WIGA 5DTJA 1YKFA 1LI5A 3ZJ4A 1B4DA 1T15A 2ZYIA 1GTJ1 3G8DA 3GLSA 1T9AA 3I1IA 3OF3A 1UBGA 1W35A 3H19A 3QEOA 1FYXA 2AWNA 4Q3DA 2QMHA 1TMYA 3TVDA 3ZGOA 4EG1A 4F6RB 4IDQA 3GV0A 3KT3A 3Q0TA 2JGFA 3PXDA 4YXWD 3WLOA 5AW3A 3RV4A 4G9GA 2FSGA 4HQKA 3PXGA 4ZOCA 4QHYA 4BDSA 3N2LA 1NX6A 2FW1A 3E9QA 5JD6A 2H29A 2BEKA 2FDRA 1CUJA 1SUWA 1BFUA 3KT0A 1LBTA 2G1PA 2O23A 3HRIA 1QK5A 3ABSB 5ALUA 4ZI3A 1INLA 2FGJA 2QE7A 3O8LA 1YK0A 1RBMA 1VL0A 1JU9A 1RWKA 4OCZA 3LZDA 1JWBB 3RWOA 3II6X 2Z9DA 3SBOA 2HSZA 1JXQA 3N5KA 5IYZA 3MWEB 1YQEA 2XA9A 2PT7A 5L3RA 2LCIA 3W5AA 1AF4A 3MIIA 2G17A 1ZK1A 1V1JA 1B1AA 1YJXA 2IXDA 1EVKA 2YZMA 3KVVA 3NWJA 4M7PA 4WKOA 4YJGA 3RRNA 1QNLA 1QRTA 1DPFA 1GGEA 4NMMA 5ECYA 5ESDA 1ZJWA 1EDBA 1K4KA 1QE5A 4AWBA 1C41A 1FTSA 4O33A 4CM9D 5FUBA 1OB5A 2F55A 1CQJA 2AZTA 2IHNA 1NULA 3VNRA 2FI1A 2XTMA 3N39C 4ZTUB 2ZJ5A 4C7OB 9LDBA 1MP0A 4B3IA 5FCDA 2LCQA 4JA0A 3R20A 2ZVDA 2VAXA 2B8EA 2Q8NA 4J3JA 2Q5HA 3T0FA 3ROGA 3TAXA 1U7PA 3DE7X 3GBVA 3Q8MA 1MLDA 5JADA 4S1OA 2A9KA 3IQFA 2O5CA 1GL7A 5BN4A 3I6BA 2H51A 1C8KA 4PBSA 4TQAA 3A37A 3ZWKA 1J07A 4AUKA 1W73A 1E2KA 1L8OA 3TBHA 2X23A 5KTKA 4YAJA 1JKMA 1JPNA 1V3VA 2LDBA 1QB7A 1DIHA 1YRWA 3RSZA 1FTQA 1MAWA 1Z4PX 2EXXA 4ABYA 1C3OB 1E7QA 2JNWA 4XI9A 5A71A 3QFSA 3V8EA 2L19A 2ZBGA 2BHRA 1H6BA 5B55A 1YGPA 1X13A 2NADA 3BJRA 2UDPA 3GRYA 1VSUA 5ANRB 4CCAA 5KPDA 5LQDA 1SUIA 2NVUA 1TVEA 3H05A 5AKXA 4D3DA 1E2DA 4D4HA 1PQWA 3JYLA 1AKRA 1R0WA 1QZTA 1UMDB 1ZITA 1NMYA 3IAHA 3KLOA 4IOKA 4J0EA 1RXEA 4I81A 1Z5ZA 4ZQGA 5JC1A 4AJIA 4IEFB 3GRPA 7YASA 2QROA 2FSIA 3RABA 2FGKA 3T3MB 1DQRA 4BFLA 4CXMA 2H2IA 4L5YA 4Q3AA 4U7GA 4GYJA 1SCQA 3F3SA 3GFFA 3UFXA 2WJHA 4RHFA 1RFGE 4JSRA 3RVQA 5CD1A 2P1ZA 5AKJA 1LK5A 1PR2A 1BHJA 4MX8A 4ROSA 4BDTA 2IYAA 1E1KA 4YRTA 4QTYA 1GQQA 1ZMBA 1ZNQO 3H5RA 3X2FA 3K9GA 1SC6A 2ZI5A 1H5UA 4I66A 4W5HA 2L17A 3SC2B 3GJ6A 3CE6A 3CIFA 4WZBB 1OMOA 3T34A 3WXBA 1REQA 4RO0A 1Z6GA 4F3CA 2GQ0A 1XQYA 1W4LA 5CW2A 3Q3VA 5EQJB 5EFZA 3DOCA 2II6A 2R1VB 4B6EA 3RFXA 3RVRA 3JX9A 2VNHA 1R5JA 4D3ZA 5FTMA 4KFCA 1FE8A 1UPFA 2EG9A 4B82A 2REBA 3R5TA 3OOJA 3SM3A 4CNQA 1W4BA 4L4UA 3TPZA 3DMRA 1IUOA 4QGSA 4YP1A 1FXWF 5B1EA 3GK3A 1JTFA 3I45A 1QFYA 3GJ8A 4LZLA 4N6GA 4J7UA 4RLFA 2TMYA 1TUEA 4HTAA 4WDRA 1I7QB 2I9PA 3IEXA 1A1VA 2H1OA 2YCLA 5KJCA 1VE7A 1NIPA 1SIBE 1KI2A 3QP9A 3WAGA 1D4ZA 1XQ6A 3D43A 2W2OA 3NOQA 4TLAA 3AFHA 1WZUA 2QEQA 3OZFA 5IAJA 1K5HA 2JIMA 5AM5A 1CEXA 3GA5A 1YUMA 4XVUA 2OORC 2R6ZA 3BE8A 4NICA 5KYTA 2ZRQA 3KSAC 5L51A 4RABA 1U0NA 1Z4IA 1KI8A 2HYDA 3MYRA 1K8QA 4TXNA 5G02A 3WKDA 5BVGB 2GN0A 1EWKA 5E0OA 1DINA 3ZU5A 5CFMA 1ZI9A 1DRKA 2PTHA 4E3ZA 4IDBA 3F6YA 3BYZA 2H9YA 3CM0A 3OTHA 5CT9A 3P27A 1N2GA 5IN5A 9MHTA 3K2QA 2ISCA 2EJVA 3G0BA 4R8SA 4E0BA 4R71A 1T3SA 1H05A 2WF7A 3L8YA 1GUAA 3WFJA 4MAAA 2IHKA 1EDZA 3ELYA 4KDRA 4U3JB 4UM8B 3M7IA 3EPHA 4Q3OA 1T0IA 4O5AA 5IAKA 2OD9A 1X1TA 3AR4A 3IUEA 4HPWA 3ZQUA 2MCFA 5G1OA 3G1TA 4L5BA 3IUMA 5EJAA 4U39A 4XYEA 4KDEA 4IMRA 1ARZA 2ZI3A 4BWVA 2GBIA 2WIBA 4PS1A 1VLMA 2R79A 2H0RA 2PKWA 4QNMA 3L7NA 1P5JA 2D1QA 2QTGA 4LZNA 3GLHE 1NXVA 3CUTA 2DT8A 1Q7CA 1K75A 2A9RA 2VZ0A 1JILA 1LWNA 4ND8B 2EIXA 1N2BA 1TMGE 3SEFA 2I7DA 5CDTA 4Y2GA 1E3IA 1AIPA 2QX9A 2QSUA 2YCBA 3GLTA 3FMPB 1N7HA 1YIOA 1YS1X 5EN4A 2HA5A 1UR5A 521PA 1Z8DA 2XE6A 2A9JA 3T54A 5KYGA 2QVYX 3KQMA 1AURA 1GR1A 1C4WA 1HQYE 1OYYA 4BE9A 2HIMA 1ULSA 3V7FA 1U0EA 3U9SA 3UW3A 5L6LB 2XRYA 1SOUA 2QN7A 4XSHA 4DLPA 1NJ1A 2WPDA 3TRDA 2KYRA 3LA6A 4C0BA 3G9QA 3UW1A 1NGSA 2X5OA 5JI2E 3HP7A 2VJMA 3GLIE 1O7JA 3SQMA 3L6RA 2FDCA 4JT8A 1QPGA 4B17A 4B3HA 5L95A 4TLDA 3KXIA 5JJBA 3OT1B 4QVIA 3NHPA 4QM6A 4M37A 4H1TA 4TTQA 2CF6A 3NYQA 3TLCA 1QRAA 1CQWA 3OJFA 4ENVA 1GL9B 3ROKA 3UIEA 1QC5A 2ZVPX 3X0DA 2WJGA 3ZE2B 1N4AA 4W5NA 1T9BA 2XUDA 3KV3O 4DXAA 4K46A 5LZ7A 1FZQA 1NXSA 4RMGA 2LE0A 3H1FA 2YWCA 2OHXA 3SYRA 5AW5A 4ZI7F 4HGRA 2PMEA 2A1IA 4DLLA 1CP3A 2BFNA 4RA9A 2H1LA 2CHGA 5FUYA 5IF3A 1OT5A 3W04A 2J08A 3JQCA 5FORA 1V7ZA 4GMHA 4PICA 4B3FX 2RBKA 5K4GA 4FFSA 4FEEA 1CD5A 1ODSA 3S6JA 3SS7X 5CG1A 4HWKA 4WW0A 3QLUA 1SCAA 2FP4A 3I6YA 4G8JA 3AFIA 5T4EA 1TJNA 4KKVA 4XGIA 4YRFA 3U4CA 2H65A 2R1UA 1NRXA 1KSHA 2XI4A 1X1CA 2C2ZA 4M0DA 3MRSA 3NEYA 4TV8A 1JDBC 5BSWA 1Y8QB 3MQ4A 1P8JA 2QP3A 4U5QA 3KD3A 3SPXA 1W8DA 2QW8A 1DIGA 3QV2A 3ZIAA 5TMPA 1JAYA 4E6EA 4DADA 2RH9B 2CEAA 1UPAA 4XQEA 3J80A 3DNFA 4GO1A 4JD5A 1GNPA 2IUFA 4D9JA 2W42A 3FHOA 4IZ6A 4JJGA 4ZOBA 2VPQA 1IU9A 1CLEA 1FPQA 4JQZA 4M8NE 3RYCB 3EZNA 1FUKA 3ZOKA 4UHFA 2OZVA 4P3NA 3MCZA 3ZQJA 3IGFA 5IT4A 2FPXA 2GA8A 4NV1A 3GGCA 4B84A 4CL3A 13PKA 2VHXA 4C5CA 1ZAYA 2FK7A 1GNSA 3G5TA 1QTRA 1AQLA 5EZYA 3MTJA 4ZCLA 5JPDA 1OPXA 1USKA 2I67A 4BGUA 1DWOA 4K9RA 3CZPA 1LF5A 1QYIA 1HTTA 4NJEB 1APBA 4CPDA 2WU4A 3OCUA 1FX0B 3TXAA 2CT8A 1LSUA 1XCOA 3AI2A 4WCDA 4WXPA 1XRMA 3VI3B 4DA8A 5KMGB 2HEIA 1CY7A 1LVUA 1TAHA 4JELA 2H6EA 3DZ8A 2QUIA 3NTRA 1UMCB 3LUPA 4G4JA 4MR8A 4JHLA 4RJJA 4Y2RA 3SE7A 3VZRA 3WMEA 1BXKA 1EQUA 2WYOA 2XMZA 4CKBB 2B4TO 1OXVA 1H8ED 1O4VA 4N3AA 3TG8A 2ORIA 1CY0A 4LVCA 1HG0A 3PNOA 3WX0A 4DIEA 2ORED 2W6MA 2FFJA 1W47A 3FBGA 4EJSA 3D7RA 5IMSA 4C04A 3W79A 4BQQA 4FGKA 5CAEA 3BFVA 1ILWA 3E0XA 3C3CA 3AFMA 1XXHE 3ESXA 2GJ4A 4DC9A 4EY8A 3WRWA 4YRGA 3KSBC 4P98A 3RS7A 3ZBUA 2R8ZA 4US1R 4XEUA 1S9HA 3GUHA 4QC2A 2Q1YA 3K7EA 3WLRA 3A9TA 4XCXA 4G25A 3FLBA 4R9UC 3TQQA 4Y1FA 1Z4KA 3DL2A 3TIIA 1DOZA 2BDEA 3E7PA 3PHBE 5C8YA 2R8XA 4CNBA 4UQLA 4MWOA 5K8LA 3FWNA 1OFTA 1DCTA 1FNDA 3GAFA 1Q11A 3MAAC 3O2NA 4X1IB 5LQCA 1P45A 4JYZA 3KKLA 3N2KA 4YMGA 2DOKA 2C20A 3B3QA 3CNOA 3FHCB 1TC2A 3UXHA 4INPA 3U6KA 4M1SA 3TNYA 4BZZA 1ECBA 4K9SA 2AV6A 4URZR 1X9IA 3PEWA 1KZ1A 2IF0A 3DW1X 1US8B 4RK7A 4K0RA 3H6HA 3RBAA 1FU4A 4DDKA 1ZM7A 2JLUA 4EG7A 3QZUA 4IQGA 5IF9A 4RFLA 1N3BA 4MGIR 3U3OA 4TZ0A 5BN5B 2GZ2A 1Y37A 4YHBA 4FYPA 3TRKA 5CA1A 5C34B 2B1IA 2BELA 1NIJA 3Q9LA 1RAAA 2HO5A 3G6WA 5CITA 1O87A 4DNPA 1G8SA 2VJOA 4ZFNA 1C4KA 1Y5MA 1UJ2A 2PBZA 2HNBA 1UZUA 3C43A 3CKKA 3ENQA 3B6JA 3PTZA 2FLWA 3FVVA 4FS8A 3W1WA 4EYSA 1UCFA 2UVPB 2WE8A 4WLNA 2D1TA 2XOXA 5DHPA 1OIXA 1QSGA 2MT9A 5IKMA 2C9DA 3IAXA 3UYLA 1F5SA 1ATIA 1PWHA 4RA6B 1V4NA 4AX4A 3I1JA 3DBRB 4D42A 4DILA 5KWJA 1CXZA 1E8NA 1C30A 2WG1A 1L5OA 2DKNA 2Y05A 3P2OA 3VMFA 3A6PC 5KSZA 4TPKA 1YA8A 2AJDA 1S6YA 4NBKA 5ABPA 3F6RA 2WP0A 4WN3A 5K6AC 5KAPA 2E0IA 3CUWA 1Y9ZA 1BNCA 3FFTA 1WR8A 1V43A 3I9JA 3TI9A 3RYIA 2C8VA 4RDIA 1PVVA 3BXGA 1BKSB 3LXXA 1JQJC 3OUZA 4ESHA 4ZZ0A 2WIFA 2N0SA 2AFIA 2XUPA 4QPPA 2F59A 3IUPA 1YB5A 2IA5A 3LM8A 4HYTA 1J0BA 1R0XA 4PYMA 1RQ7A 3TLJA 2JGIA 2EX4A 3RTAA 5K0FA 4BASA 2RE8A 3VPSA 1DC8A 1DJNA 1H2YA 1KJQA 1RJDA 2V54A 2ZJ8A 3IUBA 3QPCA 4MUKA 5E8JA 4OIMA 1ORVA 3DEYX 2E18A 2OXRA 3T5MA 4YQYA 2R65A 2EU8A 1IHPA 3EZYA 4RK0A 3DCYA 2JAQA 1E58A 4BNJA 1NSFA 1KH3A 3K1AA 3S7TA 1Z4MA 2RHDA 4G5QA 5IXSA 2FQYA 3HVUA 2GFHA 3KCNA 2FMKA 4UC0A 2A5JA 2PYZA 4CM7A 3IV9A 1VB5A 4XD2A 1ELOA 3P0RA 2ZANA 4FU0A 2DHQA 3EXEB 4BFUA 5AWFC 2ZR9A 2ZJ2A 3AESB 5BXQC 3B7GA 3DE0X 4I8IA 1TZBA 1QTQA 1I3KA 1R4AA 1B2RA 1WB4A 3SSNA 1ZK2A 3R5FA 4INJA 1KR2A 5CX1B 3U3KA 4QJIA 4YAEA 3G2JA 1ZKDA 1P2SA 3BRSA 3OZUA 4EA7A 4PPFA 3SDZA 3C6YA 4ERXA 4B32A 4V1CA 1M3SA 4NNJA 2JFHA 1ZZGA 3F49S 2O7NA 3K5HA 3ZI4A 4AXBA 4DR6B 2WM9B 2YR0A 2WHRA 1RPJA 1OLUA 4JI8B 1JHQA 1OVGA 1S7GA 2FK8A 3DXFA 3IA2A 3MCTA 2OV8A 2G36A 3GARA 4CF5A 4FW8A 1B0ZA 5EXEA 4L02A 1D7OA 1Y8ZA 1E96A 1HK7A 4A4DA 1PR4A 1GGKA 2JFQA 1ZM9A 3EDMA 4YRNA 1FX1A 2OZPA 3BFKA 4XR9A 3ZHCA 4A92A 3MWGA 5BYBA 3HCRA 2GPTA 4OJYA 3AXSA 3HS3A 3OWHA 5ALFA 5FI0B 3S4YA 3ZE7A 1P9LA 1M66A 4AJ4A 4EHBA 1MG0A 3U3RA 2O2DA 4MUEA 4A10A 2VTBA 4TMKA 1N2IA 3HB4X 3W3ZB 3PD7A 1YAJA 4DN6A 1ZJ6A 5I3ZA 1XTVA 5KNCA 5DF1A 4A6XA 2HOQA 2MYNA 1W0JD 1ESDA 1X1BA 2ZU6A 3KLBA 4KHPB 2HIGA 3KB2A 3JQGB 1KTVA 2FETA 2G08A 2IEAA 1CR1A 2QBYB 2GCEA 3I34X 5C51B 1N6KA 3R9XB 5KTNA 1KJ9A 2QZSA 5LN1A 3HVRA 3TQIA 4B71A 4XPIB 3AUUA 3QYAA 5FUVA 2ZSAA 3VVCA 3O3MB 1OWLA 4M6WA 4XB1A 4Z1MA 2BZSA 1PLJA 2C8KA 5LDGA 2ZB7A 4ZRNA 1HZZA 3TNFA 3I1YA 3MUOA 5DSTA 5ELMA 3R09A 3W5VA 4OHMA 2O5EA 4L75A 5CTAA 3K53A 3OESA 1JDBB 1IY8A 1DO2A 2QXTA 1E1LA 1T0JB 2ZJOA 4U8GA 5EHQA 4EQZA 4CLOA 4DBVO 5KKNB 2G77B 3SIRA 5JZVA 3KKQA 2G06A 4Z4GA 3NXSA 4J9VA 2QRZA 1GG2A 4TYYA 5IZCC 2JIRA 2XMSA 5A7GA 5DM4A 5JQWA 1P2GA 3IAUA 2J6HA 2CUZA 3TQOA 4Z86A 5BV2P 1PLLA 1YASA 4FOOA 4H1VA 2F90A 2V58A 4KGDA 5FQNA 4K8OA 3CR3C 1T4BA 1FRFS 3O8QB 1DOHA 1GZ6A 4BKQA 2AXEA 4PYOA 2BMJA 2OP1A 2BFCA 1YE3A 2QM8A 1SURA 1ZJ5A 2PX5A 4G4SO 3Q8XB 4I0WB 4OXIA 5DXAA 1I1QB 2ZUWA 5JG7A 4EVRA 2RHTA 4MVJA 1D6SA 5ESXA 1BH2A 1HORA 2C2MA 1MZVA 2HAEA 3HYNA 4U7TB 1PR1A 2L2QA 2WUVA 4C21A 5MN5A 2ZSDA 1H0SA 1Q1BA 3D6HA 1O96A 2DULA 3H2KA 1VSQA 3FLAA 3I9V6 3KPVA 3KOWA 3PC8C 1XALA 1SEVA 2DFKB 1IG0A 2PV0A 1QK4A 1YUNA 4TS4A 4KLAA 3OFJA 2DT5A 5EIHA 1YZQA 2ZWAA 2O8EB 3QPDA 1ORHA 1Y1PA 4GL4A 1HRDA 2HMUA 1RABA 4QODA 3RD5A 3D59A 3VH1A 2EX0A 2GN8A 1V5FA 2HK9A 3IXLA 1HDYA 4NU8X 4ZYUA 4Q3NA 2CV1A 2ZRDA 1RKQA 2YFHA 1TLFA 3N0TA 4J1TA 3VUEA 1M5RA 5JJ5A 1CUDA 1ZNXA 5ECDA 4BVAA 2C7BA 1JEQA 2JW5A 4NI5A 3OQPA 3NBQA 2X0FA 1I1NA 3WIBA 1Q3TA 3A9CA 5KTRA 1YR3A 3BAFA 3S2EA 2FTKE 4EJ2A 1H0HA 3LT2A 1B8VA 3WGGA 3WZMA 2P41A 3TZ6A 3VPDA 3E9MA 4WOBA 1TI7A 1WCWA 1YQQA 4YT5A 4AUNA 4DVGA 2IS1A 2CHEA 3ANTA 1GL3A 1X7DA 2HB6A 1XZPA 3HVIA 3A6HA 3OSZA 3UMBA 3UNXA 5KTMA 3BMCB 1OLXA 3IP9A 4NCJA 1JSLA 2A0YA 1IAVA 3IAEA 4NJMA 2BZ1A 2OCDA 1A7AA 1YFKA 3K6RA 2EZTA 3RODA 2F8SA 3Q0IA 4HAZA 4ZU6X 1O9BA 1RAHA 2P9TA 2B9EA 3D31A 1SG9A 4H3KB 2XWBF 1EX1A 3PQ4A 3W3AA 3SZ3A 3UK7A 1KVUA 2XE8A 1VJTA 4E2WA 1I32A 3KO8A 4PRKA 3CPHA 5EKTA 3WKCA 1U1EA 3NI2A 1PL0A 2ZI7A 5ALJA 3I6ZA 1XNJA 5EY5B 3LC7O 2F1RA 2VHJA 4PHCA 4WESB 1IY0A 3OKPA 2ZSJA 4MKZA 2X3UA 3L4BA 3MSXA 4XIYA 2DBYA 2XZDA 3STXA 3EAGA 2D8AA 1SZDA 4UM9B 3RSCA 4AVYA 2VUTA 4TTAA 4D99A 1GRQA 1UQTA 1XZ8A 4FGJA 4MYCA 4OSPA 4Q02A 4Q3CA 5TDHA 4R2LA 3LD9A 3G5UA 3EG9A 4WFQA 4WKGA 5DZSA 1YMUA 4AD8A 1HETA 2CFIA 2J09A 1TCAA 4XXHA 5ADUS 3D6UA 4EPVA 3JYQA 1KDTA 2VRNA 3NX4A 4MQFB 4EI9A 4GSKA 1GCAA 2JG3A 3RT1A 2Q0QA 3TOCA 2G7ZA 2IRWA 2M9MA 4Y7CA 4BVFA 1UOEA 3FCCA 5KKCA 2DLNA 4KZPA 4ARIA 4ZYVA 1W34A 4GIBA 2C1EA 5SYAA 5AK4A 1B2LA 1P9RA 1ZNZA 2WBLC 3N5CA 2YOGA 1XZGA 4ZVQA 3H3JA 3JATB 4NS4A 4GUAA 2YYZA 1JLSA 1KZ9A 1G4UR 3V6LA 2H5IA 2AOTA 4M21A 2P27A 1YQWA 4LF7B 2Z5GA 1LPBB 2VJBA 3K0EA 3U44B 2FZKA 2ZYTX 5B4TA 2O06A 3OFND 5EKXA 4FN4A 3NR2A 3RRXA 3UB4A 1ATZA 1PU2A 2P2CA 4I6JA 5K0ZA 4E70A 2FPIA 2V9CA 4KO2S 2HW8A 3VISA 3E70C 5A5FA 2HCTA 4C07A 1T5OA 3SMQA 2F8TA 3LBAA 4KK3A 4R0MA 1W88B 3PE4A 3UG7A 4HAWA 4J7XA 1GA4A 1ZIYA 2IE0A 4MR7B 4CIAA 3OQIB 5A1TA 2H16A 4FI3C 2ZEJA 3KTAA 5A0TA 4W5RA 4HWGA 5ECGC 1TF5A 1USUA 4NBRA 1OI7A 1GG5A 3T6KA 3MPUA 2CW5A 4WNIA 5D01A 4QPZA 2PKRA 2C59A 4Z9YA 4JI1B 3S2FA 2CV2A 4IQFA 2RDMA 4MI9A 4FGWA 1QR6A 1A96A 5DLDA 5EZSA 4Z0NA 5JAPA 1GAXA 3PE6A 3BMNA 4HQRA 4OM7A 3IP6A 1R8YA 2M98A 4ARBA 4N3GA 4ZHQB 1TVMA 5DWVA 2A33A 1G8AA 2VF7A 3AP2A 3DZKA 1FNBA 3KS9A 4LMPA 4MQEB 4TRNA 3ZHBA 2WF5A 4UBIA 3UK1A 4DA6A 4DEXA 4M1MA 5FYQA 3K9HA 4K6MA 3FDXA 4MQ5A 2Y27A 1F5NA 3HY3A 1O8CA 4PEVA 4IH9A 1JDJA 5IM4A 3BZUA 1R0SA 3G2NA 1N2CB 2JK0A 2UUPA 1H94A 3MHPA 4Q9JA 1KEVA 3WMWA 1NXPA 2FRVA 4E2ZA 3ANNA 3GUVA 4YDSA 2B21A 2O2EA 3GMTA 4RHYA 4JB3A 5EHIA 1I5EA 3GJTA 4QE3A 4Z7NB 4B48A 3U3JA 3WZ2A 1P6QA 4B2LA 3B48A 3Q85A 3Q15C 4DLVA 4G41A 4GR5A 2EKZA 3TTVA 1NBME 4OP3A 4BX9A 4JP8A 5FPSA 5EQTA 2CLIB 3TZLA 5AW0A 3VU0A 2L18A 5EWMA 1HFWA 5KNDD 3ZWYA 5JXIA 4OQQA 3OJCA 5ELLA 1VSTA 5DYYA 3G13A 3VC3A 5JSFA 3EX7C 4G3XA 2HLDA 4D0LB 4MROA 4AZTA 1ONNA 1L7PA 3CCFA 1AJEA 1CRPA 4LDZA 5J2TF 2NX2A 5FTKA 2AZMA 4DJAA 1TDJA 4FEYA 3TCXB 1OBOA 1PLKA 3M1AA 2IH2A 3RW9A 3ZDAA 2RKOA 2CHUA 3FOZA 2GZ3A 3DKKA 3IIJA 4IV8A 1OR8A 2VXYA 1ODTC 4QDOA 4D2IA 1KI4A 2JCSA 2W7TA 5IKPA 2YFYA 2OPBA 3F90A 3ZWMA 2V7WA 5M5BA 2W2KB 4BB6A 2VDOB 4GLJA 3TB4A 1DNPA 1W5BA 1X8JA 1OWNA 4H27A 2IBTA 2R8YA 3D1LA 1ENZA 4I9FA 5F78A 3HVJA 1A71A 4NYMR 1QRDA 3QU4A 1D7AA 4LX8A 4Q1AA 4TWZA 4DQVA 4N48A 2FNAA 1A9PA 4XQ9A 1MEEA 4IIJA 4NL4H 1YE8A 3INYA 5KYUB 1BDMA 1TFUA 3GLHA 3KQQA 4RD2A 5A3SA 4C0QC 3I28A 1KWGA 5JH7B 1FUIA 2EHJA 3WO1A 3H1BA 4YIKA 5HCIA 5LZ5A 1FDOA 1E2FA 3O26A 4DJTA 1XLVA 4EA9A 4F2PA 4DUGD 1Z16A 2BJVA 2Q21A 2ZBPA 3VNVA 1D2AA 1VSVA 2VC2B 4R1MA 1NLZA 3KZ1E 3PJFA 5CB4F 1PFWA 1XKQA 4M9CA 1IOWA 3Q3GE 1ZPDA 4ZT3A 1EWYA 5ER6A 3UV3A 1Q2XA 2VT2A 2YW2A 3K4QA 4EJ6A 3DDUA 4I5GA 1T5LA 4FFNA 2EDCA 2QTTA 3FVTA 3TECE 1XEWY 1E7WA 1I3CA 5D2CA 4ZU3A 4B7UA 1BA3A 1X1EA 4LAFA 3JS5A 3BA1A 4KPUB 4TV9B 1A2BA 4DRXA 5M2QA 3GLIA