1QRDA

Quinone reductase/fad/cibacron blue/duroquinone complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
AVRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISRNDITGEPKDSENFQYPVESSLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLYWFGVPAILKGWFERVLVAGFAYTYATMYDKGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETVWEESPLYFAPSSLFDLNFQAGFLLKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUINONE-REDUCTASE
publication title The three-dimensional structure of NAD(P)H:quinone reductase, a flavoprotein involved in cancer chemoprotection and chemotherapy: mechanism of the two-electron reduction.
pubmed doi rcsb
molecule tags Quinone-reductase (cytosolic)
total genus 83
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qrdA00
4LAFA 4YAFA 3UXEA 3F6SA 1CZUA 3F6RA 4FX2A 3D7NA 3QE2A 1QBGA 1FX1A 5EA2A 1F4PA 3UXHA 4F8YA 1J9ZA 3NHSA 3OX3A 3SVLA 5LJIA 2Q62A 1FLDA 3OX1A 1CZHA 3QFCA 3QFRA 4U7GA 4C0WA 1RCFA 4ZVLA 3R6WA 5ULLA 2M6SA 4QOFA 4BMOB 4LTNA 2X2PA 4QOGA 3GFSA 1AKRA 4LTMA 1J9EA 1OFVA 5JROA 3KLBA 5LMCA 1AZLA 4PTZA 5LVAA 1AKWA 3W78A 4Y9RA 1XYYA 4H2DA 3OWHA 2XOEA 3HR4A 1T5BA 1GG5A 4DIKA 1CZKA 3G5MA 3GFQA 3GFRA 2R97A 3NHRA 4YQEA 1XT6A 3JSXA 2Q9UA 2HNAA 2M6RA 1FTGA 1XYVA 3EDOA 1FLVA 5B3LA 2OHIA 1AKUA 1ZX1A 5FUQA 3K20A 2F1OA 2BPOA 3OWXA 5F51A 3W79A 1JA0A 1OBVA 1FLAA 3FW1A 1BVYF 2Z9DA 2RG1A 1J8QA 3NHFA 1ZWKA 5NULA 4U7HA 1CZLA 4ICIA 1D04A 2ARKA 2BN4A 2OHJA 4DILA 4ZVNA 2QMZA 3O73A 4YALA 2FZVA 3N39C 4S24A 5FX2A 1D4AA 2WC1A 1CZNA 4HS4A 4Y9UA 3B6KA 3F90A 5TGZA 2OHHA 3ESYA 3NHPA 4FGKA 3TE7A 2FCRA 3B6JA 3KAPA 3NHWA 4U7FA 4CETA 2ZKIA 3FNIA 5EAIA 4YAWA 3LCMA 1YKGA 1AKVA 2V5UA 1B1CA 4BMPB 4N9QA 2R96A 1DXQA 4XDHA 2V9CA 1FVXA 2D5IA 4LA4A 4C0XA 4GR9A 1FLNA 1D03A 2QWXA 4J8PA 5EMNA 1NNI1 2FLVA 2FAXA 2MTBA 1OBOA 4YAOA 3KEGA 2N1MA 1AKTA 4QODA 4HEQA 5F4BA 3KAQA 3NFRA 1YCHA 2X2OA 4Y7CA 3ESZA 1C7FA 1SQSA 4QOEA 1H69A 4ESEA 1DXOA 2GSWA 2MOKA 4N82A 3NHKA 4D02A 3S2YA 2BF4A 4GI5A 3FVWA 2MT9A 4FGJA 1YCFA 1J9GA 1I1OA 3N3AC 2BMVA 3TZBA 1V4BA 2FDXA 2FVXA 2BZSA 3EYWA 2Z9BA 3W7AA 2Z9CA 2QX4A 4PTYA 1RLIA 3L9WA 4R81A 1YDGA 4PU0A 3HLYA 3ES9A 4OXXA 5NLLA 2HPVA 3N3BC 3L9XA 4NLLA 5LBUA 3U7RA 1YCGA 4M0CA 3K1YA 4XDGA 1CZOA 2QX8A 6NULA 2FX2A 4DY4A 3ZHOA 4NULA 2V5VA 5LLDA 1AMOA 3W77A 4LTDA 4ZVMA 1RTTA 3GAMA 4FGLA 4GQIA 1WSWA 1X77A 2MWMA 1VMEA 3OJWA 2OYSA 3OVMA 5FA6A 5BUCA 1JA1A 1KBOA 2AMJA 5A4KA 3RPEA 2FOXA 3B6MA 2QX6A 2W5UA 1SG0A 4ZVKA 1C7EA 2QX9A 5LBTA 1T0IA 2A5LA 3TEMA 3FX2A 2XODA 1TLLA 1E5DA 3NHJA 1FUEA 5F12A 4C76A 4C14A 3U7IA 4H6PA 1AKQA 3HA2A 3OX2A 5LJLA 1QRDA 3F2VA 4YAUA 1DX9A 4CF6A 2FZ5A 4N65A 2HNBA 2Z98A 1CZRA 1AG9A 2KQUA 3NLLA 3ESXA 3B6IA 4QOHA 4QOJA 4QOIA 2B3DA 3OJXA 3NHYA 1XI2A 3P0RA 3NHUA 1RLJA 2KLBA 1YRHA 2QR2A 1BU5A 3NHLA 3O2NA 1YOBA 1AHNA 5B3KA 3FJOA 2QMYA 1ZWLA 1TIKA 1WSBA 1QR2A 1H66A 3LT5A 1KBQA 1QHEA
chains in the Genus database with same CATH superfamily
4KWIA 3Q9NA 2C98A 5F35A 4Z3DA 3UMRA 2A94A 2QXTA 1EZ1A 4FSDA 2WNIA 1SUPA 3HSSA 1ADYA 3AF5A 3K6RA 1FTQA 2PMFA 4RIFA 3TUZC 3FRHA 1C1HA 3Q10A 2XMSA 5CBPA 3CHYA 1CJVC 4XWWA 3M9WA 1BE0A 4F12A 3WL4A 2DQKA 3E1GA 1JXMA 5EIOA 3FOAA 1YC2A 1I36A 2VP3A 2OSBA 3TTSA 1OLOA 3E9DA 3KCQA 3A3YA 1BCSB 3ANNA 4JWTA 4PSDA 5CPFA 3WNBA 3QEJA 1WPGA 3DBRB 4JP8A 2XAAA 3VAZA 4BZQA 2RIRA 5A2GA 1W1WA 3DE5X 2DBRA 3IKVA 1VFPA 1Q0ZA 1I2DA 2CF6A 1IQ0A 1KS2A 1Y4DE 4WBSA 2W43A 3T1VA 5CD1A 3T3OA 3HU1A 2NADA 4KUEA 3PG5A 2DU8A 3W3AD 4BAUA 5H3LA 1C8BA 1BXRA 1OGYA 2XQGA 3HFSA 1E0SA 1L4MA 1E9DA 3SYRA 4DV1B 2PSHA 1EE9A 1GVNB 3GEIA 1SUAA 4MYTA 4CM9D 2ICAA 3M4XA 4M1YA 1MAUA 3D6UA 1JHXA 3T7RA 1J0AA 1ODKA 4XWOA 5BORA 4X1YB 1ISGA 2YXLA 2Z2KA 3JASB 3T9CA 4H7FA 1N2OA 4MA0A 3LQ4A 3CF2A 4OGKA 3T99A 1ZFNA 2FXIA 5CDSA 2HRDA 1WA5A 3DDUA 3N6VA 3DOOA 3RIMA 2CFTA 3K71B 4RPKA 2RGYA 4CTMA 3JQAD 1U94A 4BVEA 3A6LA 3ZXIA 5IVDA 4EX7A 4N40A 3FPBA 4YJ3A 1A8PA 3V32A 4MTLA 4Q9NA 1EE2A 5K51A 4DVJA 3OZAA 1XDZA 2Q3DA 2TECE 1K88A 4B3FX 3CW8X 1RI1A 3G0BA 1JKJA 4HADA 2R8XA 4ENUA 3VR1A 4O5OA 1CS0B 5KHOC 1VHQA 1L7EA 1WUJS 4OVKA 1UBEA 2FFBA 3QU4A 1UK6A 3GLIB 1JP7A 2JJQA 1V6SA 1GPWB 1P4HA 3HYNA 1AKRA 5HRAA 3AMVA 1PEKE 2AFVA 3EMVA 4GVPA 4RKQA 5BMVF 4IF6A 1KO8A 1C30A 1P7PA 3NWOA 2I9PA 3NZEA 2QSJA 5U1PA 1AZLA 4O5AA 2WWYA 5IKMA 2BCGY 3EAGA 1WP4A 3OOYA 4LOIA 2VEDA 1CULC 4L0MA 2GWHA 2CNBA 4LYAA 1E18A 4OP3A 2W8BB 1Q21A 1ZIXA 2DKFA 2FEMA 3Q41A 3MJHA 3W78A 1XL1A 4RTLA 1BXGA 1U6JA 2ZU6A 3LWZA 3KEFA 4F3YA 1VBKA 2Z1DA 3Q3GE 4RZHA 1VPVA 2C78A 1TM3E 2BKXA 3CEMA 1CJUC 1A1VA 2RBEA 4MO9A 2O8NA 2KI5A 4DM4A 4PYJA 4QU9A 3MYYA 3QQ5A 4YQFA 1T29A 4Z99A 4YAKA 5C81A 2R9VA 4GG1A 4R1QA 2F43B 4OYHA 1KL7A 1IYZA 1A8IA 3DT8A 4G5FA 4YMWA 3FCXA 1RWVA 4RH3A 5L9AA 4NWIA 4EG7A 4FN5A 1U28C 4XJVA 1Q74A 4G0PA 2VRWA 2GJ9A 3W6UA 1NOKA 3AEXA 1OH7A 4QJ3A 2G0TA 1H3EA 4DMRA 2JGNA 3L8ZA 4N0QA 4KR2A 4RZ3A 3FYHA 5K0SA 3VKGA 1NX9A 3BGIA 5EP1A 4ZAWA 4AQDA 3AUXA 1XT6A 3K9FC 2O2ZA 3NR2A 4O4JA 3AR6A 3UHAA 2I9KA 3G0GA 3TDKA 2AKYA 2VAVA 2UVPA 2W90A 1J06A 2VP4A 1XSEA 1XCLA 4DTIA 1ZRHA 1I10A 2BKAA 2NO1A 5SY6A 1FFGA 1YB4A 1HYGA 1S0UA 2FGKA 2OHIA 2QT0A 3EGEA 1BHQ1 3E5HA 3MJRA 3NJ4A 4ZJZA 1BEEA 3IPLA 3JQCA 1X7WB 3AP3A 1NQXA 1F2TB 4E1BA 2HK6A 1I4TD 2ZUTA 3AFOA 3IKJA 3OEYA 5HR5A 1M6NA 1W5AA 3CU5A 1RXUA 1UMDB 2X2FA 2YNMD 1JAZA 3G59A 2HYDA 3A1SA 1MNQA 3ADPA 4QVKA 4AJHA 5EXEA 2Z2YA 3PGKA 3ADDA 4OPMA 3U31A 2RG1A 5HX7A 2O3TA 4TXHA 3ND9A 3OZCA 1PUJA 3DEFA 5FEMA 1J99A 1JKXA 4FYXA 1UAYA 4GF5A 3ZZTA 2DR2A 1SXGA 2AI1A 3LM8A 5BSTA 3TEFA 1N5JA 3SYKA 3RFCA 1GPAA 1NLUA 1WCV1 2YV5A 3OFJA 1ZMOA 4QIHA 3JQ6A 4BMYA 1AHPA 2QYSA 3C43A 2PQMA 3ZE0B 3RBVA 5ADHA 1X7YA 1LVUA 1JQ3A 2FF7A 1RKVA 2OECA 1F12A 2XSZA 3D6HA 3PWZA 4FMCF 5AVJA 4B74A 1H2HA 4QQFA 4IVPA 1KK3A 5C0OE 1OXTA 3P9SA 1SCUA 3SC2A 2GPNA 1FMCA 4YMVA 5LMZA 1OA0A 2BMJA 4JXXA 3GDFA 3VR6H 1XEFA 3ITNA 3U61B 3ZBQA 5I7SA 4TRMA 1EFRA 3ZQKA 4PC7A 4C0SA 4IJVA 5K0ZA 4LF4B 1L2TA 4ZTZB 1KXZA 2DLDA 1T2AA 3F67A 4FU0A 1D4AA 4GZ3A 3VOSA 4XVCA 2I91A 2C4MA 4LFBB 3JQPA 4XCXA 2IFTA 4FBMA 1Z29A 5AI5A 1CIJA 4RQAA 3COPA 3KD2A 4QA9A 4GMXA 5CT8A 3T9DA 1QYRA 3Q88A 2CNLA 4FCVA 3QIVA 4F2GA 1GEGA 4NECA 4RIIA 3IUYA 4TYWA 1E32A 3ZD7A 1TCBA 5BWBA 4TUYF 4YK7A 1RYBA 3BSYA 5HVNA 3EVBA 1B73A 1GADO 2XUQA 3CUTA 2VSXA 3DV2A 4BGVA 3ZDAA 2WLSA 4GVXA 2A0WA 3S2SA 3MXTA 1WSAA 3AEQA 4L6CA 4R2XA 5JNUA 1D1TA 5I47A 2JGMA 1FYFA 4POOA 1EESA 1KE1A 3S2ZA 3PFIA 1B6GA 4ETIA 1GRRA 4JC4A 4TSFA 5JBQA 3STVA 1NNEA 2HCTA 4OBXA 3ZJVA 1QIMA 2TRSB 3FNIA 1N5OX 3GJ8A 1S2DA 2GTHA 2VHJA 4ZCPA 4OGFA 1H4TA 2V4MA 2PMCA 4BE4A 3ONFA 2PSDA 4BMPB 1DXQA 1M6EX 2Q5EA 4RVFA 4XDHA 3AUYA 2V9CA 2R86A 4U39A 2V5AA 3U1VA 3WYEA 1F6WA 4EH1A 3QUSA 5F7ZA 3MQFA 1SAYA 3F97A 4FR0A 1EI9A 2WAAA 2X6QA 3UNXA 1YB2A 4AMZA 4BLOA 4WE3A 1MXFA 2WSLA 1Z0ZA 2COKA 3A25A 3NHMA 4IO1A 2JHGA 4FDTA 1M9NA 1UBJS 2QN9A 1QKKA 4EKYA 4AY3A 3UMMA 4LOKA 3OZWA 2BD0A 3RQSA 4YFVA 2CJXA 3QKWA 5LDDC 3L1KA 4TTPA 3RS7A 5C3MA 4D98A 4U0KA 1CF4A 3WFIA 2WF9A 1XZIA 5KTSA 2W22A 2RGDA 4RTNA 4HH3C 1VZ2A 4IEFB 5DM0A 4L4SA 1K6EA 1M2OA 5JD3A 2X7XA 4GWGA 1QDEA 6REQA 2B5WA 3HN2A 1E1LA 1FFWA 2JD2A 5I9LA 2J3QA 1ZZEA 5CFLA 5T41A 5TT0A 2NVWA 2VK8A 4AG5A 2B1IA 4MQFA 1NQ5A 3ESAA 5LP6F 2QVYX 5KWJA 1VSUA 3G9TA 4YCMA 2JAHA 4ZXFA 3EAFA 1Q1GA 3OQ1A 2P75A 5CX1B 3ZW9A 4LDPA 3VPFA 2CNNA 2I7CA 2YZ2A 4Q1CA 3U3MA 1NE2A 3WZMA 5AW8A 1S96A 3Q3JB 4XGIA 2ZM6B 2DBQA 3OF5A 2X0NA 3QOXA 4NU5A 2WTUA 3QVTA 2YZ7A 3FMGA 2O57A 5A4JA 2J0QA 4EGSA 2CZCA 3LDUA 3GARA 4QXMA 2RGAA 3ZYCA 2BF4A 1UDXA 4YAGA 5G0UA 3MCTA 1G7RA 3ANXA 4LQLA 1XZQA 4L8YA 1QRRA 2X22A 5B3JC 1A9XB 4ZV7A 3A1FA 1MT0A 2FK8A 1ORDA 2H0AA 3ZWPA 1U5AA 4BLSA 3EXHB 1V4BA 1YO6A 1NN1A 1PVVA 4DR2B 1DEAA 1WU7A 4TYPA 4WNAB 2VP2A 3IR5A 3IUQA 4Y2JA 1I7DA 4XI9A 1N6LA 3V4FA 3EYWA 4C88A 5JDCC 3ESCA 1QHFA 1S89A 4HXYA 1SOUA 3WLOA 3V1TC 5C5EA 1KTIA 2CE7A 2XUGA 3GBVA 1KZYC 3LC0A 2B36A 3G9UA 4GDFA 2X9LA 3D8RA 4TT3A 4EDHA 5KNCD 2B4KA 3A7EA 1HDEA 1PFKA 4XFKA 3FUUA 3VFDA 2AXPA 1S2IA 2WU3A 2JJ8A 2WF7A 2GFQA 3ID6C 2OXFA 1QC5B 1SBCA 2ZVJA 5FKJA 5LQAA 3VPCA 2MSEB 3WVNA 2PD3A 2YJGA 2ES4A 2CXNA 1NVAA 2XIJA 2W00A 2N9UA 1AVTA 1FDIA 1KI3A 1EJ6A 4EZIA 3IVXA 3I5YA 3RUFA 4KI7A 4BVKA 1DV1A 4LNUA 3TW8A 3QOYA 2H54A 4OAPA 4OQQA 3VYWA 4QDJA 5BUSA 1U98A 1O6FA 1RZVA 2X4IA 3K1YA 1BJRE 2DPYA 1YQWA 3CFYA 5AR1A 1YR9A 3VPSA 5MGBA 5IXYA 4MV1A 5AKEA 1JVSA 5DDIP 3DXZA 3QKUA 3QKIA 1P5ZB 4UEWA 4ER3A 3OC6A 5C4MA 4DGQA 3LVFO 4LTDA 2JLQA 1ZBQA 1IHXA 1DTWB 4CKWA 2RHRA 2VQFB 2ERXA 5K6AA 4E46A 1QP4A 2F90A 1GYPA 3R7DA 1RQRA 1WG8A 1JSRA 2OZVA 3QWAA 2RH5A 1KMCA 1DINA 1LI4A 4MRPA 4PRKA 4BBZA 1DTSA 1DWUA 1S3FA 3AY6A 5GJCA 3G8DA 1MEJA 3L7OA 4GBED 3UAOA 4TV8F 3UGKA 2XT0A 3OJWA 4RS4A 2PTGA 4YP1A 4R83A 4BYGA 2AZTA 4DREA 5FTLA 1GTSA 1GLGA 3EHDA 1ZONA 2HBZA 4UKDA 1DUVG 1Z38A 3HY3A 4CKEB 3N7AA 4LK3A 2PX0A 4P7FA 4RHXA 4NQRA 5CJPA 5T57A 3GLRA 4QQNA 4A0SA 5CB4B 2PUFA 2JI7A 2PUCA 3MQ2A 2LV8A 5KOJB 3PPVA 1B0AA 1EDZA 2WIJA 3W8DA 1QGUB 1E0AA 3HS3A 4PGMA 2H2HA 3B60A 5AKLA 3ILYA 3UJDA 3NBFA 4MRMA 1OI7A 1FYVA 2V7VA 4Y6SA 3WGMA 5GJWC 3SBXA 2JS7A 5LUAA 2VSQA 2XW6A 1WUIS 4NPAA 2GR9A 3C5EA 3KYDA 4JQOA 5J9FA 5CH3A 3RQIA 3QXHA 3W5HA 3DAYA 5C8VA 1QU3A 1Y1RA 1Z4NA 5IC5A 4JL5A 2PIAA 2RC6A 1IEQA 1FUKA 2HQOA 2VTDA 3B8EA 2EJVA 3FCEA 4O2AF 1PSDA 5ANRB 1A2KC 3RFXA 4EO4A 3WLIA 3NT2A 2WG1A 3G5TA 5KOHA 2C94A 3UC5A 1ECBA 4O3MA 2Q21A 5D6OA 2J9FA 5SV2A 3ZQUA 1E58A 3DMTC 4C76A 5FPTA 2QYOA 2IV2X 1HYQA 1YHYA 2FSVC 2BBSA 1P6QA 4A0GA 2Q3HA 3RC3A 1F51E 1JZQA 1MD9A 1HLDA 3I2JA 3QX9A 4KPGA 4BNMA 2PVSA 4REQA 3VHRA 1VBFA 5LOVA 3N75A 3KQUA 1EK6A 1SUWA 4R2HA 1NGSA 3QUCA 1NUAA 3QU5A 3QNUA 3BN3A 3AHFA 1EVZA 1TB4A 3BWCA 1QYCA 2CLCX 2PUJA 4GBJA 4UJ5A 5E7MA 3USZA 1JTVA 3V97A 1Z5OA 4BMVA 4JBXA 5CA0F 1V35A 3K16A 4NZPA 2V7BA 3WSWA 3A0UA 4ZQFA 5BWNA 3A2LA 2QRVA 2R6GA 1FP4A 3O26A 1G21B 3O8DA 1FMFA 4LRSB 3DL4A 1SELA 2GPWA 3T3GA 1T4MA 1K5HA 3NHUA 4RDHA 3BOSA 4C30A 2WUDA 2VXYA 2XYGA 3CUVA 1ESCA 4UBJA 2AOUA 3PLAE 1NF2A 1W0JD 3LHFA 4N5LA 2WABA 3GFPA 1DX4A 1L9KA 1C1DB 1N6HA 4CEJB 2NVBA 3MSXA 5ALIA 4WZBE 3GNSA 3O94A 4ZQBA 2JANA 3AHEA 3NMUF 4GQBA 2HADA 1F1JA 2Z5FA 3PIIA 2CVPA 10MHA 2NUBA 4OL0A 2C1ZA 1X9HA 1GFZA 2EDAA 2ZSBA 3FBTA 4JR0A 2PKCA 2EJWA 1E2MA 5D7BA 4D6XA 5KVSA 3OQIB 2QMYA 1G41A 2W2LA 5KYYA 5JBIA 3T4EA 3DQQA 3GVPA 5KIAA 2FQ1A 2F64A 4ZT6A 4UVIA 5JYEA 4RK1A 2IX9A 5JYCA 2C2BA 2BRUA 3K72B 5JNVA 5FQNA 3B2NA 1OI3A 1JQAA 3QG1A 5JI3E 1OC4A 3UMJA 3KXLA 1Y33E 3Q5EA 3L43A 1S3GA 3ETLA 4J3JA 4DB2A 2P6MA 3B85A 3HCRA 1EZZA 1II8A 4U6NA 3EBLA 4BLUA 2ZCJA 1XXLA 1P91A 2GMWA 4W1PA 4W9RA 5E1BA 3PQFA 5TV2A 2F1KA 2CKDA 2BFBB 5KJ1A 3ER8A 4ECEA 2HCBA 4B71A 1ZN2A 2JGIA 4BFCA 4DG8A 2A5YB 1XR3A 1J6UA 2NVOA 3CEHA 4OMDA 3SEQA 1EB8A 4YAFA 5F7JA 5FO1A 3ZCQA 1L6RA 3QNWA 1XO1A 1COWA 2FPGA 1CRLA 3SNHA 4W1SA 2Z5GA 4G65A 3NJ8A 4YAJA 3A6KA 5DHSA 4Q3DA 4F0JA 4FX2A 4R98A 2IIVA 4J1QA 4Z0TA 1U7HA 3I5AA 1BKYA 1T9HA 3EZ7A 3H9UA 2O1XA 4JENA 5B58C 1QLJA 4JLDA 3LCCA 5H5JA 1HBJA 1QP8A 2BI8A 2OHGA 4QBHA 2X0EA 4EAQA 4ZDKA 2RE8A 2GXAA 3M81A 1M1YB 2DKOA 1FX1A 3P2YA 3V2IA 5FAKA 1KYWA 4TKZA 4O2LA 4RTMA 4K3VA 4OI1A 2Y0DA 2NM0A 3PFBA 2QAJA 4PRLA 2ZIWB 3FB1A 1WXQA 1C29B 3OFVA 4TV9B 5DOVA 1KDVA 1MZVA 1R0ZA 2AN5A 3WO0A 4RULA 1JXAA 1EMDA 1EA5A 1X8JA 1FNCA 2FZWA 4H59A 3BWVA 3EHEA 1QKIA 2ZWOA 3E9MA 1RLOA 1UOQA 3ZD6A 1XZHA 1X3LA 3TLYA 3RU3A 3WRXA 4AB1A 4WXMA 1KRXA 2C5FA 3F4LA 4AKGA 1TA4A 1ABBA 1B0UA 1A27A 2E4ZA 2FJ0A 2HUPA 2P0YA 3L04A 4MW1A 4NZ9A 3WKBA 4ZVLA 3P5SA 5ULLA 4GLOA 4NNJA 2Z83A 3KB8A 1JIQA 4AO6A 2BEVB 4WXRA 5AW7A 4NL4H 5HHTA 2B8EA 4HLNA 3VV2A 2CMGA 1LNQA 2IY9A 3LQYA 4PPQA 4DEXA 2V6FA 3SIWA 4H15A 1SWWA 4MR7B 3H2GA 4NH4A 5KNBA 1LEHA 2QU8A 1GZ3A 3GELA 2BFCB 3P2JA 4RFSB 3SC3A 5K0CA 2QTCA 3Q5DA 5DWDA 5G2OA 4TZ0A 2HWYA 5AUPB 3B1YA 4K9MA 1Q84A 2YHIB 3WLRA 4UQPA 5AIAA 3TNYA 5M29A 2FEPA 4GWLA 3IJEB 3ISJA 3R9XB 1R6AA 3CF4G 5K0EA 1RS0A 4IO0A 2FEOA 3VH1A 3UCEA 2LCIA 2WM3A 4E5DA 1A82A 2P67A 1TEVA 3LP6A 5FOWA 2WTMA 4DADA 2BEJA 3CVUA 3AERA 3B9QA 4FC7A 3WQSB 3SVTA 5EPOA 2CJPA 5B4UA 3Q4GA 2R8PA 3ZZNA 1G8FA 3TSWA 3H2SA 3AHGA 3PS9A 4WK0B 2N42A 2EAUA 4IDDA 3DNMA 3VSEA 5JRJA 2O07A 4RTKA 5E6UA 1RAAA 2W2KB 821PA 1OI2A 1SZDA 2B5VA 2H1CA 4MV3A 4V0OA 5FUBA 4DR5B 2QN8A 2BP7B 3ZIAD 1JI0A 1ADJA 2Q6VA 1XQ6A 4I4IA 4LSMA 4GOJA 4QELA 3H1PA 4TKUB 3GLHB 4IXWA 1OFTA 2X8AA 4FYPA 2C96A 1I9GA 2PGIA 3WV5A 4H27A 1UODA 4EFKA 1NN5A 4QUHA 1F06A 4JDPA 4M0FA 1IDN1 2HPAA 3DSRA 3GYGA 2EIXA 4JELA 3KLNA 2Z8YM 3MNFA 1K8QA 2O2XA 2X5KO 3A8TA 3I4CA 5HIAA 4OQDA 3UKDA 2QM8A 1PLJA 3MA0A 3AM4A 4CIXA 1L5HA 4LS3A 1ZA2A 2R6FA 1GHTA 3IDQA 5TPWA 3NKLA 2BGIA 1PJZA 4G9EA 3GPLA 4XXHA 2AKEA 3PSHA 2ZGVA 3NWBA 4URFA 4X6YA 3ZX5A 4KL8S 2V0CA 4ER5A 2B8WA 5DGHA 1SOVA 1VPLA 1C9DB 2PYIA 4HYTA 4JEHA 1ID8A 1K8RA 3IT3A 3NHBA 4DLSA 3T1NA 3KXDA 4RS3A 4X8HA 3ULKA 1FS4A 5C3UA 1U1GA 3CPJB 4N7JA 5LQJA 4OKIA 4HPXB 1V26A 4D43A 1YR3A 4WOPA 1JXOA 1F1BA 2O7QA 4LNAA 3VOTA 5JC8A 5LNK6 1J24A 1B2RA 1YMQA 3KQOA 1ZKDA 4G1MB 4IIHA 4XQCA 4XWTA 3I8OA 3PGXA 5KAMA 2ZDGA 3PBKA 5DTRA 2GVNA 2FG7C 2Y1WA 3LP5A 3TO5A 3WKCA 3RG2A 4C87A 4X97A 5FULA 3WGHA 4J0EA 1C4OA 1PJCA 2BGTA 1TYAE 5KVCA 1W49A 4DN6A 1F7UA 3LPMA 4P22A 1CZLA 2B37A 4ICIA 4J0IA 3Q3HA 3MJTA 1ZVJA 4KRYA 1VGRA 1C1XA 1P17A 4NTZA 4Z4EA 5DFAA 2HLHA 3IV7A 2ARKA 2QRQA 2YXBA 2RHOA 3BFVA 4G8JA 1JJBA 4LYEA 4PYMA 3NO4A 4M36A 2A0FA 3N1UA 3ZK9A 4DZTA 1DGQA 2HSEA 4L8GA 4Q4HA 1PFGA 4HNUA 1QG6A 2BH9A 2OESA 2G1AA 1N2IA 3Q11A 5CXSA 2BM9A 4MVJF 1C1YA 1ZY2A 1YASA 4ZO6A 3U7FB 1B00A 2C7VA 3I45A 4LRQA 1R4ZA 1KEEB 1N1GA 1UDWA 1E4YA 3EZNA 1VKNA 3O4VA 4YALA 5FWXB 3DHYA 4FKMA 1OI4A 4FIZA 1U2ZA 4EFNA 4JJIA 2QTAA 4ILKA 1WTCA 4JFAA 2O05A 3VJMA 3DXFA 2GZAA 4LJ6A 2W8ZA 1SU8A 3KB6A 1EFTA 2JDID 2Y71A 2YRFA 3OHSX 2FW1A 2CC2A 4D7AA 1E69A 3KIPA 3AVUA 5K3DA 3EB9A 4E3ZA 1J2YA 4BMXA 1T8PA 4U2FA 4QFCA 1ATIA 2HRCA 5IMBA 3CS3A 3GOHA 1IC6A 3VZCA 1Q0TA 3OZVA 1DC8A 4JQYA 3CRQA 4V3BA 4EG8A 3AWIA 2I7XA 2CNWA 3B70A 3RDPA 1VLVA 3GG9A 3H1AA 3QV2A 2AEEA 4ZKDA 4KLZA 4C3VA 1D2MA 2N46A 3IX7A 4YAWA 5TQJA 2P4QA 3RSSA 4PV7A 4QGHA 1H2FA 2V5UA 3H65A 2OGSA 4PPNA 3FKJA 3M2PA 4Y1FA 5BT8A 1I1QB 3KJIA 1VL1A 3I9MA 4ZT7A 2EARA 4TT3D 1VI5A 4HQKA 1K9SA 1FVXA 2OVFA 1ZKMA 3DKVA 4YJ2A 4DXDA 2E4WA 2OD7A 3C7DB 4L6IA 3VGJA 5EZ6B 3NHZA 3UFXB 3ZK8A 4ARUA 4DIUA 5J59A 4NCBA 3ILXA 3I1IA 3U17A 4G5GA 1PHRA 5K3EA 4JI8B 3PVSA 3CLRD 3DV9A 4MGHA 1R4AA 2WWHA 4V2UA 1N6PA 3EUEA 4WK6A 6YASA 2OLEA 1LZKA 4GH5A 4Z54A 5CK5A 3RIHA 2OG1A 4Q7LA 1I3CA 1YU6A 2V8OA 2JZOA 4LK2A 3I0MA 3GZ4A 4O8ZA 4RFLA 2FAXA 3GT7A 3HNOA 4XDYA 5LQUA 4Y30A 2Z57A 4EPYA 3CSSA 5E3JA 1K3UB 3G0CA 3THRA 2G1PA 4J4BA 1FX0B 1F4LA 3K0BA 1O95D 4JSTA 1XTVA 5HKKD 5IRCD 4Z9XA 1PWHA 4KO2S 3ZW7A 4Q9JA 4MI6A 1TYDE 1MW8X 3FYUA 3JPWA 3JXEA 5GV7A 5TQVA 4UEJA 4KXXA 4BMCA 3NIBA 4N49A 2FWBA 4H17A 1G5PA 3UF0A 5TQ0B 4R40A 1CY2A 1PK9A 2GJKA 2A3RA 2QRKA 5FLKA 1ZMRA 4L73A 4C78A 3M3PA 4HR7A 2CXOA 1IVYA 1HY3A 4M9XA 5DNAA 1RXWA 2CJFA 3ROTA 3B7GA 2AR9A 4IUYA 3ESZA 3O03A 3QMWA 4IH9A 2KMLA 4L0DA 4RM2A 4YV0A 4M88A 4A36A 1RQ7A 2IOQA 3TR5A 1BTOA 4J90A 4YAEA 4W8GA 1JB9A 4Z4IA 1DXOA 3AY3A 5CCBA 3AM1A 3FFWA 3D3KA 1JVBA 3G23A 2QP4A 4EABA 5BNIA 5I3ZA 2RCNA 2WIAA 3ORYA 3ZV6A 4RK5A 4KSCA 2OY0A 4RAQA 2MDTA 2EWMA 3FSRA 1CSEE 3MQ4A 1GU7A 3F3YA 4FT4A 3GUZA 4PG5A 4Y1EA 4CLOA 4RTOA 4MKIA 4D4JA 2GN6A 1QGDA 5BOVA 1CS4C 3ETHA 4J2TA 1D1QA 2ID8A 1TEHA 3QPBA 5BW6B 4W9MC 3UW3A 4WN9B 3DZBA 1L4KA 1P4GA 2ZBGA 4B33A 3VJKA 3QEAZ 3NIDB 1D8AA 4IIFA 3UB2A 3FFBA 4N3AA 4G37A 3ZTWA 2HTFA 2W98A 5KTPA 3U19A 4EENA 3T7TA 3PPIA 1VIAA 1CIPA 1VG0B 1W4BA 4KV9A 5GONB 1Z08A 3HJCA 3U3KA 3W0LB 3R8CA 1XLTA 2W0MA 1P5FA 5DPMA 3T1QA 3ZWMA 4EFLA 3E22A 4L02A 3GK3A 4XD7D 2J3MA 1T8RA 3BL5A 3EISA 2D5BA 3JD1A 5IDXA 1PJRA 2IF2A 4K26A 4M7PA 1BCSA 4Q21A 2ZSUA 4LQ4A 5TMPA 3AL3A 4E30A 4UMEA 2FPWA 2PKEA 4C7OA 1A96A 3CRW1 1OZAA 1DMRA 3CUUA 4NPHA 4R05A 1R6BX 3NEPX 4FMBB 4RH1A 1D1PA 1M2WA 1HI9A 1XIVA 3SKYA 3GUVA 1NMQA 3TBKA 1V7QA 1WTAA 4HRAA 2HF2A 1KZ1A 3LMKA 4PG6A 1YUNA 3C3DA 4PQYA 5JVDF 2QVBA 1LPAB 3JQ7B 6NULA 2WFZA 3V00A 1CDEA 4BGDA 2FDRA 3ZZ1A 1NT2A 3ICVA 3ZCTA 2C4TA 2JH3A 2YTZA 4TL6A 5IJ0B 4X1YA 3N0VA 3CPSA 1BA2A 1S1MA 2WPDD 5A7GA 4L5BA 2G0NA 4KK4A 5DRTA 3R3ZA 1X1TA 1UKYA 4CBVA 4F06A 3CQ9A 3QSGA 1HO3A 1WCWA 1VSTA 1DKPA 2ZWMA 2MWMA 5DYWA 1VMEA 1P4AA 3C8DA 4M9CA 1AM4D 2FRVA 5B2FA 1JV2B 1QF6A 2AG1A 2XYHA 1VE6A 3CZCA 3ND5A 4YRQA 3RADC 1XTKA 1IG3A 2Z08A 1S6YA 3VC3A 5FA6A 4EI7A 4ALNA 1IMOA 1CS0A 4BNUA 1MPXA 3ZDFA 3C7CB 3UBTA 2J1LA 3O2JA 3GLIA 4N6OA 1PDWA 4M1MA 5CHEA 4RD4A 5CLFA 3O4IA 2NU6B 2QSZA 3UK0A 5E3IA 3WNZA 3DKKA 1NI4B 4FXPA 5TS2A 2A0XA 2P1ZA 1RNLA 2VDWB 3SX0A 2W2LD 1P7CA 1YNOA 5CLLA 3PKJA 2JJ2A 4H1UA 1DCFA 2W8BA 3GCWA 4WT7A 5EIWA 3PXGA 1QYDA 3RU7A 3VSAA 5CXQA 1Z63A 3FX2A 5BXQC 4JKOA 4K46A 1MGOA 2BJHA 1DEKA 4DIOA 1JLMA 2GF2A 1JWAB 2JCBA 5J40A 2BYTA 4LKRA 1RSZA 3IIKA 4CM5A 2C57A 1DBPA 1JRLA 2DF8A 4QAJA 1JHUA 1PDVA 5BN5B 2P2ZA 3ZU6A 5HJ7A 1TFRA 3B6EA 2KW5A 1AZSC 4EJSC 1EJ0A 2O20A 4CHTA 4P7JA 3LL4A 5CNKA 4J16C 5LIRA 4JYBA 1C9KA 2DJ5A 3O3NB 2GPBA 3OQOA 3BHNA 2XKJE 3COWA 2E5WA 3QU2A 2C7RA 2OO7A 4FHGA 1AV6A 1L7NA 1W34A 3OX2A 4UBKA 3BGSA 3DH0A 3KKZA 4M55A 1X7XB 3W8EA 1H6DA 1TD1A 1QOZA 1W0KA 1BIFA 2XNSA 2UV8A 3P2IA 1LD3A 4P33A 4TTSA 1ABFA 3KZNA 4KVGA 1OGIA 4KN8A 4BNJA 4CL3A 2R3SA 4HQNA 1PJLA 1Z73A 2Q2WA 2DLCX 3LI2A 2J9ZB 5IKXA 5C51B 5DSZA 5REQB 4BEVA 1OFUX 2I87A 3JD0A 4FINA 3QLTA 4UHFA 7GPBA 1CR2A 5EEGA 5HIIA 1KU6A 1ZRNA 4I50A 4G1VA 1ND5A 2C2ZA 2OOKA 3EC1A 3RJ5A 5CW1A 1DHRA 1F2TA 2X1VA 3I04A 3MTIA 4WEQA 3HJTA 3R5KA 3HSKA 5G0VA 2GEBA 1WCIB 3NHYA 3I30X 5DASA 4EEXA 4GEGA 2NGRA 3FXAA 1UMDA 1KAQA 1XC7A 3DOEA 1LI5A 1WDLA 1PL6A 1EP3B 3ETJA 3QZUA 1B42A 4K3UA 5EXDA 4ZHQB 1QIGA 1ZQ1A 2CLKB 4BNLA 2JFXA 4AT1A 3V1LA 1XRRA 1N7IA 1ZGHA 2HN9A 4LFCB 4XRGA 4WUVA 4IX9A 1BU5A 2PFKA 4TLMB 1EQ2A 1ORHA 1XLVA 2B3TA 3NHLA 4MV7A 4Y0VA 5BWCA 2QLBA 2IHUA 2VDRB 2AV6A 3GEEA 4BMDA 3CIOA 4RSHA 1GVHA 1M8PA 4IXDA 3SHWA 3HI4A 4DDWA 2I1QA 2WKSA 4X6XA 1GQSA 4JU8A 4MCHA 1WLSA 3TM5A 1WB5A 4OFXA 5KS2A 3GWZA 5KNBD 1L8QA 1ZSYA 4OFWA 4EY7A 4UU7A 1Y4AE 2PO5A 3KT8A 4WZAE 1WSBA 4HFMA 2AOWA 1QBKC 4D74A 1I5OA 4UNPA 1ETHA 4CLDA 4QXAA 5TEWA 1VP9A 2P69A 2HU7A 1EEXB 3VI3B 3STYA 4UM7A 3GRKA 4K9NA 1HE3A 2HHCA 2M98A 2HV9A 2OFFA 2VHUA 3INNA 2Y1EA 1Q57A 2WJPA 2PX3A 4LF9B 3EQZA 3SMQA 4ZGGA 1CY1A 3SFZA 5TIIA 3AB8A 2X58A 1YV9A 3CXUA 2MMGA 1SU7A 4H18A 3RJ9A 2FN8A 3EOBI 3CNQS 2LTAA 3PZRA 1QMPA 3SQWA 1BU8A 2KX7A 5BW8A 4FR5A 1M76A 4LDRA 1QGAA 3WMXA 1NXWA 1JXQA 2GN0A 2JGEA 1CZUA 1JAHA 3DCNA 3ISTA 2OK8A 2DKNA 3I92A 4OSOA 2FN7A 4UJ3A 4XSVA 4UNQA 4ZO8A 2PMEA 2GPAA 2VO1A 3E03A 3FWPA 3HBAA 4WCDA 5EZQA 4MWGA 1W7AA 4L5IA 3ORFA 1M8GA 1T9KA 1WS6A 3M33A 4X45A 2O59A 1MB4A 3D6FA 2OHVA 3VZDA 4J9UE 1WDWB 4D26A 1GL3A 3GD7A 4WHMA 5EA2A 3S2EA 1JNYA 3UUWA 4HGQA 1DWQA 1NVVR 3IAM1 4MUYA 2FR8C 2JKZA 3K70B 4WCFC 3B51X 2ZRQA 1C3LA 3WWEA 1KQPA 1YXMA 4NJMB 2PJRA 3OKCA 3RLFA 3QSYA 2F4VB 2CXSA 2ZIFA 2P9HA 3FPEA 4HXFB 2C9OA 4NFSA 1RM4A 5DW3A 1AQIA 1VL6A 1A69A 1SC6A 1IM2A 3QMPA 3BRWA 3UG6A 4RTJA 3NX4A 4JOBA 5KNDH 2O0KA 5SYNA 4UEOA 4BFUA 3C4JA 1RI2A 2FYTA 4OV6B 3T4PA 3LRXA 5JY6A 4OXIA 3G3EA 4ZCLA 4DJJA 3L8CA 4QQKA 3NBQA 1VLQA 2BE7A 5FR2A 5T3UA 1QP7A 1N6NA 5C5DA 2KS6A 3KJQA 3ELWA 3HPQA 4DCGA 3K6SA 1C14A 1SEVA 2N1BA 1BOFA 3NH9A 3KZOA 1JEJA 4OP2A 4JH0A 4OLJA 1OPXA 1PI3A 3E48A 1V2GA 3P7MA 1T26A 2JH9A 3A04A 2W11A 3GFSA 3UMFA 1ISHA 1TUBA 4US1R 3DOCA 4JLJA 4UBOA 3HYRA 4LTMA 4ZRMA 2H4YA 1KYIA 4ITVA 5AHRA 4U6SA 4HWPA 5LMCA 1SUBA 3TMAA 3BRQA 4H1VA 4TOIA 1FTYA 4NJEB 3WRYC 4B45A 4D4GA 2YINC 1GITA 1MV5A 3C5CA 3DUWA 4HP8A 2OB2A 5JMPA 1RC1A 5DSTA 4X7BA 4QNMA 4GLLA 2PU7A 3C4VA 3RU9A 5IVKA 4Y9RA 4EY4A 3IXQA 2JBHA 2YN2A 2G9RA 3GEBA 5ALDA 5K0NA 4PY2A 3JQBA 2DHDA 5LZ2A 3EA5A 3M2TA 1KNXA 1SKBA 1XDDA 1ISMA 2DWCA 3CX4A 3PRJA 3WGOA 1TCCA 4DJDC 4EDFA 3C3BA 4KE8A 4EVIA 4G5SA 2Y1GA 2X9GA 3G49A 3L2OB 3NUQA 4JC8A 4ON9A 3C4QA 5ILGA 2R0QC 1SVKA 5A5VA 1I4OA 5IZ4A 4X1IB 3EXHA 5SYAA 4C5CA 2VTVA 4BZWA 1MAAA 2EW2A 4ROSA 1R0LA 3IP3A 1AF7A 1N9GB 1WV0A 2P9CA 3DTVD 4IR7A 4WNAA 8ATCA 1LX6A 1MEEA 3QTTA 4XX0B 1FXWA 2F55A 4JOQA 4KJXA 5TGDA 2N75A 2VT3A 2NU9B 2GEJA 2D2FA 3RVSA 4CEHA 4X93A 3D2CA 4G4JA 4QREA 3OSZA 2R6DA 5J1SB 2CNWD 2R751 2QLNA 4XYBA 4V0ME 1DAFA 1JMKC 1XMPA 2RB4A 3QLVC 2C59A 2WNSA 2WSBA 2PWPA 3E35A 4D9BA 5JARA 1JGTA 2DQ4A 3KJHA 5E0KB 4TVOA 1QRUA 1H3FA 4UE2A 1YL5A 1QC5A 4WACA 2AR0A 3FTEA 5L45A 1VHLA 3C8MA 5HF6A 3RRYA 1TO6A 1AC5A 2ZIVB 1J42A 1H8EA 3RT7A 3TMKA 1DJQA 1C81A 1RYHA 5DT9A 4NAUA 4EVSA 4XPIA 4CHGA 1MG0A 1QTNA 1NBHA 4XOIA 1Z26A 2OV4A 1CP3A 1U3TA 1WW2A 3L6BA 3EZ6A 4L75A 4U3JB 4WZ6A 4ZXPA 2H3HA 3IE0A 1RXYA 2FNAA 4XR4A 3QE9Y 4G0MA 2F1OA 1IBKB 1RQPA 1YQGA 2WTAA 3QVSA 1NBEA 3KZKA 3HNPA 1IEVA 2CD7A 3CF4A 3L8HA 4KTTE 4X6UA 1N0VC 3ZEIA 3ZQ4A 1DTWA 3OZRA 5GIOE 2FKNA 4U4AA 2ZBQA 5IT5A 5PNTA 1SIOA 1L0BA 2QTTA 2ZULA 1M2EA 4EYQA 1DCTA 2MINA 1PS9A 5FBKA 1S01A 4OA5A 1Y81A 5ELMA 2XCRB 1X6VA 2RBKA 2G71A 3ODPA 1S4QA 2IP1A 4OJMX 3RIGA 4FSHA 4HI0E 5JT1A 5HZMA 5BR1A 1QU2A 2PSFA 3R0ZA 2XBMA 1DIRA 1NM5C 1MEOA 4DV7B 2GEDA 3L77A 3SGLA 4BWVA 3IMGA 3JZFA 4QLAA 5CB4A 3AVYA 4ZDIA 3G8AA 5KCZA 1XQWA 3HKBB 1TZMA 5KOJA 4EQZA 1C3XA 4FZJA 4X62B 1E8NA 2FJPA 3ANTA 3KVVA 1BG6A 4X41A 1QGUA 5INTA 2XUPA 2NTEA 5EHNA 1NTOA 2EEPA 3TE6A 5KINB 4YRRA 1YA4A 3Q9SA 3T3DA 5IBCA 5BRAA 4JIGA 4KU4A 4DJ5X 1PTKA 1C4XA 1KPGA 5EJGA 3RKRA 1JS1X 2PD6A 4HS4A 2B6HA 2WFMA 2P7IA 3D2LA 1SY7A 4TKLA 4Y9UA 2O50A 3B2EA 1U0RA 1SFRA 1CERA 2X0KA 4XSHA 4ZOLB 3SX4A 4G8BA 4F86A 4Q4LA 2MSWA 1EHCA 4CF4A 1ST3A 4MUMA 2P65A 3W90A 1YBVA 3A6PC 2ZYDA 4IHJB 1Y4SA 3VMMA 3ZLUA 1H1LB 2QRZA 2NYVA 4GAEA 4MROA 2J0UB 2ZRNA 4IYJA 1YHNA 3UUEA 4ID9A 5AW6A 1FP6A 3MWGA 5LZ5A 2VC2B 5COBA 4YEDA 4RM3A 2DHRA 3FZGA 3I83A 5A3SA 4DPMA 3QX3A 2OKGA 2AHOA 3C15C 5GVRA 1FDSA 1QB7A 3GLKA 2XGJA 4ZKEA 4N39A 4BXOA 2FCAA 1WDTA 2YY6A 1H5UA 2DQYA 3KT6A 4B17A 2QPAA 4F2PA 2EGUA 5T7BA 1FLNA 2C2GA 4K6KA 2WNHA 4O4IB 3W6PA 1JE1A 1GQRA 1E92A 2C2MA 4ER0A 5BR4A 5FTKA 4BVJA 4DLVA 3PENA 2AE2A 1X87A 3N2LA 4CKCA 4AWAA 4LV5B 3ZI7A 5HOEA 1DQPA 2ZYUX 3AKZA 2MSLA 4DV2B 1TZKA 4EMSA 1YU9A 1PQ4A 4ZCSA 5B57C 1Y98A 5F3WB 1O2DA 3U4MA 1CE8A 1FFHA 1UADA 1FB5A 1GAJA 1NR7A 2Q4EA 2P0AA 1ZISA 4G36A 1P39A 4IINA 5JAIA 2GNAA 1G5QA 1G21A 3EH1A 3IUJA 4XFDA 1K5GA 1L5QA 4PQEA 5E8JA 1QMGA 3H3JA 3A4YA 1RE1A 4DSUA 2BFDA 4TMWA 1ZINA 4C04A 2FI1A 3N8NA 4TTIA 4TS3A 2O8CB 2QJFA 1TK9A 1WQ1R 2WHPB 3SQOA 4YRIA 3MB8A 4ATNA 1P44A 3CWZA 3ECAA 3EJWA 3BD8A 3WKDA 3VNRA 1KJWA 2ZRLA 3IQDB 4L4UA 4MWCA 4UHHA 2QA5A 4BZZA 3BORA 4MV8A 1CY4A 2OP0A 4HLCA 1T34A 4W5WA 4NYJQ 1FTWA 3TKLA 5K8VA 3TX6A 1A4UA 2HH9A 5SZKB 3P2KA 2GB4A 2QTHA 3KR0A 1GKLA 3AR2A 3EGWA 4DUPA 3DMGA 4DJEC 3L6UA 3LBFA 1EUCB 1R15A 1LW6E 4NH0A 5IAEA 3PEYA 2FDCA 1Z68A 3I1YA 4CIWA 3JCZA 1KK0A 1Z8HA 5JCOC 1K9VF 1XMSA 3A6EA 4PSVA 5ILQA 4PCVA 3N2GB 3RE1A 1MPTA 2J5QA 1TC1A 3RWOA 3SHQA 5M7EA 1A8SA 3HR7A 2QXYA 2VZEA 4MUGA 5G0SA 4JJKA 5HBGA 3U44B 4ZTUB 1MJNA 3LFHA 4FGJA 5C8ZA 2XKAA 1U2PA 1E2BA 1IZ8A 2JJ2D 4C89A 3GQVA 3HWX1 2ZUFA 1FJXA 3IBGA 1L5VA 2XCLA 3RVKA 1Y6QA 1KEPA 3GUUA 2FDXA 2V6GA 2XQKA 1XAHA 4MW5A 4RC9A 1KO7A 5AKIA 3TZLA 4JBNA 2YC4C 1FU8A 4P4LA 4CM4B 4X20A 2C3UA 2ODQA 2VJPA 2Z9CA 3G2OA 1SKQA 2QVCA 3AF0A 4F4CA 3TBHA 4RETA 4YMHA 4XM1A 4DTCA 4OK5A 3F5SA 1NJ5A 4WKOA 2GAFA 3I53A 1O08A 1R9MA 4C5BA 2PBFA 1U80A 1LQ2A 2QLFA 3SSOA 5C8YA 1L5SA 3CZ5A 3JVVA 2IXEA 1G20B 1ATZA 3OQHA 4LBYA 3UWKA 5THQA 3NORA 3ZDCA 4Y0AA 3OSUA 4WNYA 3WDSA 2I3BA 1B3RA 1M1YA 1NLFA 3VH2A 4E3WA 2E5LB 1B4DA 4R5MA 1AK2A 3RBAA 5DHUA 1J8VA 4DJAA 3ZLTA 3P45A 1YQQA 3RJMA 3OD1A 4TV9A 5FEUA 4V0QA 1DOZA 2V7GA 5D01A 1IWOA 1OWNA 3V34A 5HF5A 1MH1A 5LLDA 2G1UA 3HTXA 1SCQA 4F93B 1SCDA 1FK8A 4UAJA 3LCVB 4NBVA 1D5WA 1XMJA 2P5SA 2J59A 2PUDA 4HGOA 4LOHA 3CVOA 2JVKA 1Z62A 4HLQB 3N0XA 4EARA 3IGFA 3L0CA 3PHIA 1GG8A 4G3XA 1DAIA 1JAIA 2VPTA 3BL6A 3K1ZA 4DHEA 1EQUA 1Y9ZA 2RG7A 5LC1A 4L3WA 5FOSA 2Q1XA 4PZUA 3TCXB 4CKYA 3BMXA 3K0HA 2BGGA 2X4GA 1SULA 4QYWA 1T9BA 1Q91A 3OUZA 4WLUA 3H5VA 4MR7A 2VATA 4FPXA 4YRFA 4KBFA 4RFSA 2IEZA 1J49A 1IE3A 1VYUA 2O19A 3H19A 4TS4A 2GSDA 2HK9A 4YDHB 5JO0A 3V4ZA 1CUZA 1QIJA 2Y9MB 4XARA 3C70A 4CTNA 3PXCX 1DC6A 3IO5A 2XE6A 4YS6A 1BYUA 2EFGA 7ABPA 1U4NA 3I32A 1JHQA 1T0IA 2D0IA 1IB6A 2VHVA 5P8WA 3V42A 2IZ7A 1XQXA 5JYBA 4G97A 2VPZA 1N9KA 3PL1A 2CVZA 4UU1A 1KJJA 1KZGB 1S4MA 4Z8YA 3F8SA 3AR8A 3COVA 3M6LA 1WMFA 3NALA 5C80A 5CBKA 3JSAA 5JSKA 3ICEA 4YJ3F 1IRXA 2IHKA 2CF5A 1ZM4A 2J33A 1E5DA 3RYCA 4Y6GB 5E4FA 2W6IA 3KQSA 2BP7A 5HA5A 1SOAA 1V5IA 1NBIA 3LTEA 4KYUA 4TKUA 5KEIA 3GLHA 3U7IA 4KXMA 3MHPA 3QJ5A 3P4YA 3WLPA 4RK4A 1EG7A 4BC1A 4ND7A 1L4BA 3AZPA 4EUHA 1ST2A 1YZLA 1W2HA 1L5WA 2H2IA 3GEPA 4IDEA 4MRVA 4D3DA 5KJCA 1GG2A 4HK4A 4Y1RB 4ZD6A 3SU8A 3WR5A 3RUPA 4LC0A 3ZHSA 3G17A 2FP3A 4PZLA 2WSSA 3U39A 2H9YA 4FOOA 2HEIA 2ZM5A 2EWVA 3H4MA 3VV3A 1QGOA 4HAZA 2VUUA 1YFLA 5A62A 3L0BA 1ZVVA 3F4KA 5KYUB 1Y9AA 3BHIA 2GBFA 1MTOA 1SBTA 3ESXA 2D2XA 3AWDA 1PR3A 4P7BA 3BTUA 2GTPA 1AKNA 2PXXA 4QOIA 5AKZA 1Z0FA 1AQYA 1SG6A 3GGPA 2IUTA 1NUTA 1F20A 2B4AA 3K2IA 3RVNA 3ZWOA 4XIJA 1VMIA 2D0OB 3G2IA 5TPZA 4INPA 1UEXC 3CLVA 5DXFA 3HDGA 3A3OA 5L3SB 3FR7A 1UWLA 1CQIB 4QBGB 2GCOB 1J22A 1LDGA 3GYBA 3H5AA 3HB1A 2C7PA 3Q40A 2H1SA 4HQ0A 3CRNA 2A9OA 4ALIA 4O4HA 4O4JF 4CUZA 2PMWB 3RYTC 5K7SA 2CBXA 2Q5FA 1TQ4A 2NZ2A 3CE9A 1QHIA 1U8CB 3R23A 2CUZA 4HKTA 4KIFA 2BLNA 2X0IA 4B85A 2ZBFA 9ABPA 3DFUA 1W5TA 1HTWA 4HGRA 2GZ2A 1VFNA 1ZWLA 2GYVA 3IPXA 3T15A 1UMBA 4DY6A 2OSVA 4I4LA 4J75A 1XCPA 4A2QA 1F8YA 4Q1EA 2IOYA 4DIMA 1KEEA 1C8LA 1HLFA 2Z58A 3O5AA 4OHZA 1T8WA 5FWXA 3ZBUA 5EMJA 1M0SA 4PYRA 2W6NA 1QIEA 4BNZA 4ECAA 1R8QA 2WF5A 4HN4B 4Z1OA 1M6YA 1TNDA 2JAWA 4M37A 3DOHA 3V1UA 3GNLA 4ENTA 3LA6A 1FBNA 1Y5RA 4PAGA 4QEDA 3VR5H 1A8QA 1R4NB 2VSOA 3F5DA 5BR8B 3H5NA 4KI0A 5HE8A 3VC2A 3QEBZ 4C4TA 4KQKA 1ECPA 3P0IA 3WXBA 4X8MA 3KFXA 2KBEA 3PDIB 4J0DA 1CUAA 1OC2A 3EEBA 4FBGA 3EGIA 1DG1G 2YOFA 1N8SA 4M98A 2H1LA 1TAQA 1B14A 2EL7A 3GNTA 4EL5A 4GD3Q 2ODTX 4IGFA 4N3GA 1ZJZA 2H57A 4OGLA 1SQ5A 4PAQA 5CTJA 3VPHA 4Z7QB 1ZH4A 4JC5A 4K9KA 4WSOA 3UMVA 2POCA 4M7WA 1LNZA 4R1OA 4F4FA 1I0IA 3P9ZA 4JP3A 2AT1A 2FX3A 3EMDA 3RTCA 4ZIRB 3QE2A 1UEJA 4EL0A 1SA0B 4J6FA 2CN1A 3Q7TA 2L69A 5F5XA 3RG8A 4V0SA 3JQ8A 2I3GA 2PKYX 3AR7A 3BWXA 3LYHA 3MMNA 3OETA 3QKSB 2Q3JA 4IMJB 3P94A 5EI5A 4I4TB 3OT4A 4A8JC 1UQRA 3OF3A 1YTUA 2NQTA 1SQGA 3SVLA 4MP3A 5KNDA 2R79A 2XWQA 1VECA 1I7LA 2AVDA 3O3CA 2E1PA 4N7RA 1M6HA 4NY1A 5AJWA 3U4IA 3QLUC 3V5NA 4DDKA 3THXA 2IOFK 2BJWA 1XEWY 3GBSA 3DEIA 4BN5A 5I4BA 1QDUA 4OAOA 1L7RA 2XB6A 1JQBA 1MX5A 1XAGA 4HPWA 4IJQA 3TFQA 1J0EA 3DUFA 4TQUS 4CXMA 5A05A 1GQOA 3DL0A 5A4MS 1X15A 2C54A 4GZ6A 2XA9A 4QNRA 3R6WA 5DYYA 1N0HA 1I4LD 3PFKA 2Q2VA 3GDWA 1F6DA 3U4QB 4PQFA 4QOFA 1IIBA 2D3WA 2ECKA 3AFNA 4RORA 1KYVA 3CLTD 4RY2A 3EDYA 1GKUB 3N9IA 4MV6A 3KR2A 2XOKD 3OPNA 4PCLA 5C4GB 1KAOA 5TQ0A 4EUEA 1IOVA 4D9IA 1A9ZA 1WXGA 3DR3A 5C53B 1DBQA 2P78A 5EKTA 3F3KA 1HFWA 4J6EA 4MVXA 1AO0A 4LRWA 3WGUA 3TR6A 3G5LA 3WP0A 2X6RA 3X1MA 4IDQA 1L1QA 3MJEA 5T64A 3EVDA 1YCDA 3K6JA 4JLSA 1OXXK 2ADOA 2CDAA 1N2HA 2FWJA 5GWXA 1XZDA 2R6R1 3JRNA 3KL2A 3WL6A 3WY9A 1FUYB 1H2RS 4GOLD 4BO1A 4CU5A 5JJBA 2NSJA 2CT8A 1E6EA 2O8VA 4NCIA 1LK5A 2P27A 2W6CX 2HMSA 9GPBA 3FROA 4HLUC 4KVZA 3G88A 4L4ZA 4ZYWA 5M34A 2ZJBA 3IFSA 1DG9A 2B8JA 3RJZA 5JS8A 1KJZA 2WM2A 2I62A 1OFHA 4QTTB 4WMLA 2EFHB 3PF9A 4I3GA 3UJ7A 1C0IA 2APJA 3IIEA 4LRTB 4ZOEA 2C2KA 4C7JA 4TKVB 5M2QA 4CQNA 3OBBA 5EJFA 2FFJA 1YQ9A 2Q3CA 1ZITA 1XZJA 2ZYHA 4HUJA 2PEYA 4ND4A 1UUFA 3A58B 4QX6A 4BC0A 4XQGA 2VDKB 1ULBA 3ER9A 4AK9A 4AI6A 1LPSA 1VLLA 1N2ZA 3BS4A 3M34A 4DRYA 1DSSG 2WWWA 2ZYVX 5LMNB 1DOAA 1KI1A 5LD2C 2WRZA 2Q1SA 1L5ZA 1LWNA 3KS9A 3ME5A 4G89A 4LISA 1F14A 1BMQA 1EPUA 1T6BY 4V1CI 1SG9A 3LYLA 3HEBA 1K06A 3TPFA 3NHRA 5GONA 3BMQA 1T9DA 4I5EA 1U2GA 4YQEA 3V46A 4BFLA 3HP1A 4CM6A 1I7QB 3DZ8A 1DL5A 2D4AA 3KUUA 3M5PA 3RSFA 5I7WA 2R4QA 1CY6A 1WVIA 4WFIA 5BSEA 4I8DA 1FSFA 4ZU1X 4L9AA 2COUA 4G67A 2D1TA 3HXKA 1CNMA 4Q48A 1V3VA 1XKTA 5IYZB 2HMYB 1TTHA 2OBXA 1NVKA 1DX6A 1MQAA 3C24A 1MAHA 1JLRA 4G85A 4RK7A 3AY0A 5EGNA 1JQ5A 2QN6A 2FQQA 1VP3A 1DV2A 2H00A 1V11B 3I58A 1K7CA 6GPBA 1UJ5A 1MVNA 5KYXB 3W2HA 3IR7A 5KUTA 3WE7A 2PFSA 3MTEA 5D2CA 4ZREA 3K9NA 1D2HA 2ZPTX 4QPJC 1FFDA 3V1KA 2ZB7A 3W79A 1JA0A 2CDRA 4FE7A 1UP4A 4PVDA 3UN1A 3VJLA 3BM5A 3AVWA 1FS5A 4MS4B 2NUAB 3TNDA 4E14A 3UEOA 2HBRA 4LOJA 4CDRA 2E37A 2G63A 3TQOA 5HJEA 1VJRA 1GTJ1 1QVZA 5EE0A 3GLGB 4KREA 1V2HE 2PUHA 4GECA 2HA2A 1VMKA 5THKA 3IPRA 2VDJA 4NKRA 5A5EA 1L4HA 2DUUA 5CT9A 3H5OA 1I1NA 3GGGA 2LCFA 1PFVA 2OHFA 3OICA 2VDOB 1D6NA 1ULHA 3F2IA 4M46A 5KNLA 3AY7A 3K32A 1D6JA 4NMXB 5AJZA 1QO0A 4L9WA 1GSHA 4DRZA 5TDHA 2EFEB 1SBYA 2C4UA 4FQ5A 4G23A 1WJGA 1F3OA 3P9RA 2YBDA 5AOCA 3AZOA 2YFYA 4BQEA 1O89A 4GPD1 2PVCA 2FF5A 2NU6A 4OQMA 1NI4A 1H2WA 2ZYWX 3FH0A 2FPPB 2GARA 2YQ4A 3BG5A 1RP1A 4HGPA 5HPYB 2VDWA 2X5JO 4TX1A 5EZYB 3Q0EA 1BRTA 2G40A 3TUIC 2G76A 4RADA 4FFBB 5JFOA 3C8UA 5JS6A 1V4VA 3WYFA 2WMOB 1UXHA 4HDKA 2YFQA 2CDBA 3I5MA 4IM7A 1P5JA 5TGZA 2I8AA 4RMIA 1QH8B 4GO1A 5B4VA 3NEYA 2XB8A 4MDYA 2O3QA 2HX1A 3SVZA 3TH5A 2IBMA 2EX4A 1G5HA 4G24A 3ORQA 3R0IA 4MEJA 3UKJA 3UJ9A 4WKNA 1SC4A 3U81A 5EHXA 3TJMA 4MV5A 1DLJA 4JXKA 2R00C 4NDAA 2O6HA 2Y0CA 3KOXA 4HT3B 2Y1CA 3WGQA 2DOKA 3FI0A 5EMMA 1KRHA 1RQGA 2FFHA 3LCMA 4M1WA 5EIFA 1EWQA 1NMYA 1R5NA 1P0PA 2I6UA 5JDIA 5KSWB 2DTXA 1XJWA 3F5FA 5JPIA 5LYJB 1XPOA 3CKMA 1DT5A 1QCDA 3L6CA 4YV1A 2YVLA 1S1CA 2I03A 1SVNA 2AXQA 2HRZA 3OE5A 4MRSA 4ZPJA 5TVKA 4I5FA 3TKAA 3V7FA 5FFMA 1YI0A 4DLTA 4BO3A 4E03A 4N76A 4GVLA 1IBMB 2ZJ6A 2BHRA 1X9GA 1Y63A 5J58A 2R68A 4JBLA 3FD8A 3ISVA 3L7AA 3QVVA 4ZCMA 4LXTA 2H16A 2BY4A 1K8XB 1QB8A 3E58A 5EMNA 3DJFA 2NMVA 2FH5B 5AHOA 3FN4A 5A3VA 3OZIA 1IHPA 4RFVA 5EHGA 4L7QA 1UZMA 4W99A 3DVRX 3OY7A 3KDSE 1GT91 2H1IA 3QOFA 1N4AA 2BGRA 3LL7A 4EG3A 2W2XA 1UOPA 2G04A 2V6JA 3GW8A 4OHUA 1UFVA 1WCIA 2C2HA 1KI6B 4HDAA 5DX0A 5KYKA 3OQPA 4HEQA 4R9NA 5H4HA 2LCQA 3RK4A 2Q3EA 3JATB 4H16A 1MVLA 1TADA 1W87A 2CFSA 2JL1A 3IB6A 1ZLYA 3IDSA 3PC2A 3P4UA 1ECLA 1T2DA 2VJDA 4JLVA 4KOAA 4MKHA 4QXQA 3PEUA 3ZVKA 1Q7TA 4N9WA 4MUAA 5A6SB 1ISIA 1SQFA 2I4NA 4DR6B 1FYEA 3SZMA 2M2IA 2ERCA 3EVEA 3I0ZA 2QK4A 3CVJA 3MMPA 1J1UA 5LOVF 5TE9A 4ZEXA 3VDQA 2HA5A 1IHOA 1UBRS 2VOEA 3RM3A 2ZRPA 1MFZA 3DYIA 3KUXA 5KJ6A 3L8FA 1NC1A 3IAFA 3A32A 4AUMA 4ESEA 4AROA 3KPJA 4IH4A 3ZYZA 2UUOA 3GD5A 4I8XA 5BQ5A 1TI7A 2Z8YA 1DWPA 3UK1A 1Z4QA 2MOKA 2NT3A 3AR4A 4NK4A 1QRTA 2RKBA 2IYLD 1ZUHA 4ETWA 3OTGA 2H2AA 3DKPA 2QPTA 4GC5A 2Z4RA 2GO1A 4BNTA 3KQVA 3S68A 5AVWA 3G6KA 2B6NA 4G1CA 3UJCA 5IAOA 2VYCA 4LWPA 4ZT4A 4UUQA 5GM1A 4F8EA 4LF7B 3E8MA 4D4LA 2IBTA 4KO1S 3U7JA 1I94B 1U3VA 4Z0HO 1L4LA 2BGNA 3GOQA 5I6DA 1N5LA 4EITA 3FZYA 3NYIA 4FK8A 3PXXA 3BSSA 3OCVA 1A2QA 3V4PB 4F1WA 2X1HA 3LX4A 5ES3A 4F38A 1UK7A 1YH3A 3W2FA 1H3NA 2EW8A 2QX7A 2ZAYA 3H75A 3LPLA 5I51A 1RPZA 4RENA 4IFBA 3FBGA 3HXMA 1H4SA 1OILA 2JFFA 4S35A 3IQHX 3QVOA 1NOIA 3QPWA 4XLZA 3OJEA 5ALSA 3ZXXA 2K5UA 4ZVOA 1ENOA 3PNQA 3WBFA 4QFMA 2CEKA 4M76B 1N2SA 5ECGC 3V8MA 4NBUA 1HA3A 2RC5A 3PXDA 4DWOA 4MLPA 4WK2B 1XROA 3EIEA 2JHCA 4EPWA 3MM4A 1X39A 2D4HA 1P72A 3DEZA 4GU5A 4RL4A 3R6GA 3ESDA 3EYAA 3HQ4O 3DMPA 3C98A 4OHRA 1NWHA 3N2ZB 1JBQA 3FVTA 2B1RA 2OCAA 5DM4A 1NJ1A 1YCGA 4YRAA 4B6OA 5LZ4A 3LO5A 1CZOA 3DDWA 4I55B 4CTOA 3BD7A 1L1FA 2BDEA 4NJMA 4LGCA 3WNDA 1CUIA 1CB0A 5BSGA 2VQDA 3N2EA 5EJ4A 1V48A 3B9BA 1FDOA 3U9SA 1MO5A 2WUGA 2EVWX 4TLLB 5BWLA 1ZYUA 1ISPA 1UOEA 1TIPA 2ZTLA 3DZFA 3HA3A 4P8RA 3WX0A 5I7RA 1V3QE 3LCRA 1W36D 2ZJ0A 2A30A 4G4GA 3LC2O 3MGCA 3O9VA 4NHEA 3DYVA 2PH3A 4AJ4A 4R8VA 5IDWA 2JBWA 3RAEC 3N5KA 2PXAA 4I5DA 521PA 1NVUQ 4ZOCA 3EF3A 2QJOA 4CE6A 2XKKA 1KJ8A 3QLJA 4MPDA 1ZOPA 1B23P 1DIAA 3R7WB 5FV4A 1G17A 3OPMA 1HYEA 3RUCA 4FWIB 4QM7A 1FPMA 1EFVB 2JNWA 2QTRA 2OBLA 3R77A 1R6UA 1Q5PA 1Z0IA 1MC8A 2CNKA 2Y1LA 3GJ4A 1TVKB 3DBHA 3F9IA 4NMWA 5FADA 5TMDA 2RGNC 1TK3A 1HMPA 1X42A 1YOVB 4I9UA 4BUCA 2O7VA 3L46A 3RTGA 2VPQA 3W5UA 2OG2A 1VE9A 1RKQA 1VJGA 4XGKA 5B30A 2FMXA 4H7IA 1JEAA 3NDRA 5FPHA 3MCVA 1Y8AA 1O97D 2A5LA 4UEKA 4R9RA 3ZHBA 1W85B 4TWRA 1I5RA 5JAZA 1WD7A 2HU2A 2WJJA 3Q9UA 4GSKA 1J09A 4LHZA 3LJKA 2H4HA 4AKEA 4RWZA 1PEDA 3FMIA 2C3PA 4YHHB 2PX5A 3IODA 4QE3A 3H11A 2BDTA 1TLLA 3ZCRA 2HJRA 1IN7A 4DM7A 3CLSD 1EVEA 3PNBA 1P1CA 1NWCA 3HLTA 4AF6A 2WSIA 2R8BA 2HRBA 3ECCA 5FAXA 4DLPA 4L9SA 2IQ5A 4ND6A 1N9GA 1YKFA 4JYMA 3LKDA 1VKRA 4LHVA 2HY7A 3PICA 3PHJA 1HOTA 2XOXA 4XX0A 5DCYA 5AVRA 4V1CA 4MZDA 5HFNA 4J76A 3RRNA 1WW3A 2NU9A 2WZBA 4LYGA 2CHUA 3F2VA 3T4XA 4XSGA 3ILHA 2Z1NA 3BQMB 2Q4RA 4GMDA 4JJAA 1J0BA 2Y0PA 4KW7A 4KITB 4DMLA 2BZ1A 5EJEA 4F5YA 3S29A 2VDQB 4GBGA 3NTUA 2P2YA 3H8WA 4IIVA 4QC2A 4TM8A 1KFBB 1W52X 3BTSA 1IFXA 3H84A 3W5JA 5GZ1A 1CQZA 3JW8A 4UUBA 5BQ3A 2NPFA 2PO7A 4AZWA 1KI8A 4GT1A 3LZCA 1W1UA 3DE3X 3X1WA 1Q19A 4YI3A 1X8LA 1TCVA 5CGQB 1E60A 1OX4B 2KWIA 4U3JA 5K3FB 3ZDRA 3Q12A 5IT9A 1G2QA 4UULA 1BQEA 1M2VB 3ZD9A 1RLJA 1VHJA 5B5SA 1ENYA 3QWFA 3H2KA 4RZ2A 1W36B 4L8WB 3HDYA 3QMVA 2RBGA 1MOPA 4OJQA 1OGJA 2BGUA 5GTDA 2UYCA 1GZ7A 1Q1ZA 2PKWA 3LU1A 4ZMSA 1ODLA 4REOA 4A0QA 1EGMB 1JPVA 1O94A 1PX2A 4ZA2A 1YFJA 3HN6A 4B75A 1KJIA 1X1QA 3LBHA 1JHDA 2WJZB 3C3EA 3LZDA 3ZGNA 2D8MA 4EVQA 5LU8A 3R5HA 1I7SB 4MEBA 2AJBA 1M75A 3CBQA 1K08A 1P74A 2J87A 1HQYE 5EE5B 1TTPB 3N2IA 3SM3A 3B1JA 1WDKA 2J5BA 3WGLA 4EG0A 3OKFA 3HUDA 4BRUA 4D0SA 3REGA 3PUHA 3AKCA 3G9QA 1H66A 1KVQA 3E9EA 3L7KA 5EQFA 3VR5A 5B7NA 2QBYB 3RRXA 3OCJA 3H5IA 1ZUIA 4MLCA 3LT5A 3WADA 1KEVA 1WETA 3EASA 3ZE9A 2O06A 1VRCA 3BCHA 1OHHA 3DFFA 1BMFD 1C0KA 4BQFA 2CEAA 4UASA 1V37A 4L7VA 5LQSA 2I1WA 1GP2A 4OYLA 2EFYA 4B81A 5IN4A 1XCGB 1HDCA 4ZOLA 5F3RA 1S8NA 5HZGA 4YIKA 2ZSEA 4KSBA 3E9RA 5AK5A 2G8LA 2A88A 1UKBA 5AP9A 2EBUA 4QASA 5CCDA 1B93A 4EG4A 5IEBA 3Q3CA 3ZHCA 1AF4A 2J0UA 4GM1A 4I1UA 4UZFA 5BW5A 4DOMA 4RV4A 1CY7A 5DT2A 1TM5E 3ICQB 4E2FA 4JEMA 4EGAA 2X8LA 3HY6A 3ZE8A 1AY0A 4OY3A 1U8EA 4N0PA 4L8LA 4QUJA 2AS0A 5JSQA 5IASA 4PPGA 1SKYB 1ONPA 3PC8A 4Q3CA 4XUEA 1FW6A 1TJ4A 1A9PA 221PA 4DFDA 2QB5A 3AJ9A 2WQ7A 3E61A 4O4IA 3O90A 3Q72A 3FG9A 1QIDA 2CJYA 4XPZA 4PW0A 2IYQA 4IVRA 1IOLA 3TR0A 3KOMA 5AXDA 4UCWA 3COZA 1UP7A 2VS1A 3G8BA 3NC0C 4IH1A 4JGGA 5JQGA 3VH3A 1TZBA 4C07A 3C6MA 4W1QA 2JHAA 4HEHA 4LVOA 3FYUC 3JTEA 1P1IA 4GX5A 3E15A 4BTLA 3K1TA 3EG9B 1JLHA 1EFAA 2YRXA 3X0DA 2IZOA 3A26A 1GV0A 2K7ZA 4HXEB 3C3YA 3NAGA 3GMSA 3PFFA 4Q34A 3PRYA 4OCZA 4ARZB 1LBHA 1Q11A 2WHPA 3OJOA 1G4UR 3FNBA 2PRSA 1YB5A 2JGAA 3QPVA 3TYXA 4MWTA 2PQ0A 2PGAA 5F33A 4BU1A 3HGMA 1FSGA 4LI3X 3CJQA 5FNVB 3ROPA 1GA4A 2GKSA 5ERXA 4YJ2F 4BLRA 1BDJA 2C5LA 2Z1MA 4CGZA 3EQ6A 1IJBA 1FNBA 1RXSA 2GM9A 2XVYA 4H0FA 4JP1A 4LC1A 1ZD4A 2X6TA 5EL0A 1EZ4A 3UCXA 1H2BA 4ZAGA 1FNMA 4JITA 5H70A 2Q07A 2A4KA 2OEPA 1P4JA 4Q18A 1EUCA 4Q4DA 3CVVA 2DUWA 2QUAA 3O1IC 3U40A 1RPAA 2B4TO 4ZGBA 3Q2OA 2GA8A 5C5CA 4YY3B 5G0WA 2YYYA 3N2GA 8GPBA 2V97A 4EBFA 3S28A 3L01A 4QECA 1ZUNA 3HG7A 2OQ2A 3VUEA 4EW6A 2ZXUA 3NG1A 4PNPA 5HK8A 3NBKA 3WOVA 1XJQA 3KG2A 2FUKA 3U44A 5DHAA 4E22A 4R3WA 3EF1A 1WQ4A 2PLRA 1JIJA 3IVMA 4JJFA 4KGDA 3ZEAA 4EQ6A 4MVJG 3GIWA 1OKKA 3FOCA 4KFRA 4HQ6A 2A57A 5DBOA 1E3EA 1C0EA 4K6CA 5L3RA 2XEXA 4X54A 1J90A 4XUCA 2WYUA 4D9CA 5JC1A 2GI4A 3S2UA 3JVEA 3GV0A 1LLFA 2QG4A 1CZKA 3AI3A 3JX9A 3LX8A 3AFMA 3G5MA 4CM4A 2AN1A 2WWXA 5EWJB 2NSLA 2FP4B 2C1EA 1LPBB 1P19A 2Z3ZA 5BN4A 2WIBA 4IV0A 1X3SA 4PZZA 4ZAZA 2PRKA 1HNZB 3T5DA 1M54A 1KY4A 2FRXA 2Q9UA 2V55B 3GLSA 1EA7A 3JS5A 3RS4A 3MCUA 5JJLA 1EXWA 2QRUA 1G20A 1XOIA 4U02A 1KMQA 1KZ7B 3NAQA 1KOLA 2OZLB 5ELXA 4BN4A 3A1DA 3BXZA 1TZJA 1B7GO 3JYOA 5DN6D 1AQJA 1SXPA 2Q9AA 3KLMX 5CNMA 3TEJA 4RV9A 2RB5A 4MS3B 2IUUA 2GASA 1NMZA 1LVGA 2YASA 3K94A 5FI3A 2IWRA 3V6LA 4HV4A 2Z43A 5DB4A 2XI4A 4EYSA 5LM3A 2JEZA 3RWMB 2WFAA 3HDVA 4F6CA 4NZOA 3ADKA 1PSZA 4LXYA 3K73O 4EJSB 5F51A 2ZQYA 2FZGA 1Y1TA 2LUOA 2X9QA 1NZDA 4LJ5A 4NYIQ 4RE6A 3WQBA 3SYLA 5DE3A 1KH3A 2O9JA 1XJCA 4BV9A 3LQ2A 2Q2OA 1WM1A 2XRYA 2OORC 3TLZA 1OAAA 3P96A 4LZLA 4EA8A 4RGYA 2DCMA 5AM3A 1EXMA 3DBVO 1MXHA 2WJGA 3K1JA 3EFOA 3OG9A 5FP0A 5I8ZA 3SSNA 5FA5A 5LXTB 4PRYA 2R84A 2YRWA 5FPSA 4KMSA 5FA8A 1ESNA 1D04A 2ZJYA 4L8FA 2IPXA 1GLVA 1N7HA 4PS1A 4AVYA 1C50A 4HNAB 2G9ZA 4D9KA 2FN3A 3LDGA 5FBHA 1QAMA 3V8VA 3D3EA 1HEIA 3OP4A 1V1RB 4RA6B 5KQPA 1KI9A 2FMFA 2PHZA 4GZ5A 4JKYA 1KH1A 5U4QA 5IDYA 3L82B 5EWLA 1UPCA 1CJCA 1E79A 4MJXA 4CCSA 1TKBA 1NZFA 2GBPA 2I8LA 4GKVA 3KPWA 3HUUA 1R9JA 5IBRA 3RSHA 3LPAA 2VYQA 4N3BA 4KB5A 4B76A 3NCTA 1NVEA 5EXSA 2OGWA 1EE1A 4CYMA 4OLFA 2IY7A 4BJ3A 5KU1A 2EIHA 1U4OA 4CMBA 5CDHA 5IFKA 2IZ5A 2XMZA 3OLWA 1O4WA 1D2NA 4BCCA 1U63A 2I33A 1BEZA 1NF8A 2V7PA 2ZEJA 2WD8A 3UA4A 1BS2A 1P81A 1EK5A 3ZX4A 3ESYA 2DWOA 3ZWKA 3CO0S 1CCWA 1CD5A 2O5VA 2ZKLA 2VJNA 5DU2A 4O6VA 5IMSA 1X1BA 4OBBA 4PFSA 3K9HA 5BNFA 2ORVA 5CP8A 3RH0A 3WIOA 2JB9A 1LBIA 5EPUA 4CV0A 3B5EA 1YS9A 3CUKA 1SD1A 3GVXA 1V8DA 4X90A 3HU5A 2HHHB 4JYAB 1NRWA 2ZANA 1Z6PA 4IILA 3IS3A 1RCTE 1AGPA 2MSCB 3LLMA 4Q1BA 3ZY3A 5K20A 4DUZB 4L22A 4OKSA 3L7CA 3DMDA 1UKAA 3JZMA 2QE7A 4II3A 4NDNE 5LB2A 1DFHA 1WMSA 3RGWS 4AUEA 3GDGA 3WNCA 3RAFC 4BDTA 2C97A 3WA7A 2R96A 2H31A 1Q0SA 1B8NA 2YS7A 3IKLA 4N3CA 4X5OA 4XX1A 3KQLA 4FYKA 2IYZA 1IZZA 3KFLA 5CNIA 3S3TA 2HWWA 3MZ0A 4XQEA 2DG2A 2ZSHA 3RREA 1VHWA 1T10A 3QW2A 5I45A 4DNXA 1DELA 3W4IA 1T1GA 5AJTA 1IQPA 3GEDA 4LBWA 2IHNA 1Q1QA 1RPNA 4FFLA 4K9LA 2JFQA 1YI8A 3OIVA 5LSAA 4G0UA 2AUMA 2VRBA 1H05A 4LEIA 1ZK2A 4WBXC 5HOQA 4IIEA 4OXYA 2P9JA 4ZTBA 2PWAA 1N0UA 2VSFA 2C9MA 5FUVA 3QPDA 2FTKE 2QQGA 1GZUA 2WHEA 2AJLI 2IOFA 1LTKA 2I4IA 4G0OA 5IU6A 5BN4B 2X7HA 3SS7X 4B6FA 2Z6QA 4AZTA 4ARIA 2B99A 4P80A 5JZ9A 2UUPA 5EMHA 3W8NA 4B9AA 3H42B 2W6JA 1TPZA 3CVYA 721PA 4EPRA 3RKSA 2HREA 3W9YA 4DT1B 2WI8A 5FV7A 4MIKA 4C9BA 4ERXA 2ZUEA 1DKMA 3C3JA 1ZL2A 1H2XA 3TNFA 5L3SA 1CQIA 4KZPA 1C5KA 4EKIA 1NBWB 2GCOA 1G291 2D1YA 3A6JA 3HKEA 3LLVA 2XZLA 1P5HA 3WYBA 5DHQA 3F96A 5IJZA 4LJRA 1NJ2A 2OWDA 3DMRA 1EVQA 4FWBA 1M1UA 1NW5A 1GCAA 3ZJ4A 4ZI3A 5A4DA 2YV4A 4LDZA 2J85A 4WCFB 5EERA 5K1ZA 4IJ5A 5DBIA 3TQIA 4ZK2A 1Z45A 1B3BA 4BX3A 1N2CA 2GSWA 3VO8A 4C2TA 3L6OO 1O58A 5ALUA 3INGA 3BFXA 4LSWA 4E4RA 2AFIB 3RR2A 4B2IA 1WXEA 3GN2A 2HU5A 4I50F 5K09A 2WSMA 2DUNA 3BXEA 3S2YA 2UUBB 3JZAA 2MT9A 4XLLA 3A9WA 5CB8A 3R3YA 3NP9A 3UH1A 4DF3A 2AC4A 4BIMA 2DFNA 5KQSA 2V9PA 5D51S 2ENUA 3Q0IA 2IS4A 2X8BA 2FVXA 2PXHA 3LXMA 1R9NA 1R4NA 1HRKA 3D0RA 1JSCA 1M2HA 4JUIA 2AN3A 4JBYA 3IVAA 3A3PA 4G5HA 4JI1B 4BX9A 2ZDQA 3PDIA 1Y3AA 4WFJA 2DFTA 3ZV7A 5A3JA 1VMDA 5CNJA 2CCKA 3KKMA 4OBWA 4MKFA 2C9ZA 3LLSA 1D2CA 2WYWA 3TZ6A 1KWGA 2CSUA 1ULUA 3GI1A 4HDSB 1SU6A 1UC9A 1CW2B 2N0SA 4XRRA 2XGSA 3MAJA 2PL3A 3HLYA 5HP4A 1TX4B 4DLWA 4WH0A 3HL0A 3VYUB 3Q7PA 2I6XA 3TW0A 4TRRA 3LOUA 3SEAA 3NTXA 2J8ZA 4K40A 1SA0A 1PZNA 4KN6A 3TSYA 1I24A 1JZSA 3O83A 3AKEA 3P26A 2QTMA 4G56A 4B84A 2AH5A 4UBIA 3QKSA 4OHFA 4MLDA 2C61A 1UANA 1XHFA 3MSCA 4J4HA 5ER9A 3TLBA 1YVUA 4KH1A 3I9NA 3OCZA 3O8OB 2ZI5A 2R1TB 3EQ8A 1N3LA 1MO3A 4UAVA 4WOBA 3AR5A 1VKZA 4TMTA 3SM9A 1LPNA 2YVQA 1FVFA 1IULA 3WLMA 3BZUA 2JFYA 4RD6A 2ADMA 1O6GA 3QG5A 3SDBA 4B80A 4KNYA 1AK9A 1B74A 2DPHA 2HIAA 2I6GA 3AUKA 4HJXA 4CL0A 1UPAA 4ESHA 4EVRA 2H2WA 2E6KA 4CLHA 2XQJA 3I2HA 3AU9A 1WSWA 3LSYA 3HZOA 4I9GA 4J7UA 3L8GA 1SC3A 2DPGA 1RP7A 2BGMA 3ORHA 1CVRA 4QTXA 4ANFA 2IHZA 1W581 1XU4A 1K7YA 2WT4A 2HZBA 4BMZA 4E21A 5L51A 5K2OA 4LBZA 4D9GA 3U4QA 4AW9A 2A67A 1M8KA 1HEUA 2C5EA 2YDXA 3AQIA 2O5CA 1IN1A 2XNKA 1ZM9A 2IXGA 1A98A 2RAPA 1M6VA 5C32A 2WU0A 4MVJI 3WWOA 3OIDA 4UM9D 3VGPA 3M82A 4AYXA 4YMSA 4OHWA 4Q3LA 1QK4A 1DRUA 2QX6A 3G7UA 3ZNOA 1IWPB 4CL2A 2GQ0A 2QNRA 1CUCA 1G5FA 1WHTA 1XD8A 2FEWB 3MWYW 4ZRNA 2PL9A 4DQLA 3MF4A 1JVNA 3S2FA 5IBQA 3K09A 3PHHA 3JQBC 3BMNA 1OH6A 1K89A 4LXXA 4YB8A 3NM4A 2W37A 4OXKA 1BVRA 2OGTA 3BB4A 5TT1A 4S05A 4I1IA 4R0NA 1Y8RB 3FMVA 1DRVA 3MWJA 1THGA 4FW9A 4X3CA 3TZQA 4U9IS 3QOWA 1CDZA 1L7BA 3EIHA 1UAGA 1M3SA 3EXHC 4RYDA 3HCBA 1RYNA 4CQMA 4CV1A 1ND6A 2V58A 1OHHD 2CDCA 2QE6A 2E0IA 3KVRA 3IP8A 3WIVA 4AYWA 1XQVA 3ZD8A 2ACKA 3G7SA 3O9MA 2W2MA 4DLNA 2AJTA 3VNBA 2BSAA 1O87A 2R1VB 1HOXA 1YQTA 2WWTA 3EG5A 3I34X 1SEPA 3A31A 1MDBA 3D6JA 3IBYA 3KHSA 4B7ZA 4X9XA 3GQBB 2CHGA 2H8GA 2A9FA 2I4TA 3M89A 3PITA 4I2VA 2ZS7A 4WXEA 5T6BA 1F8UA 1SN7A 4J03A 4BNDB 2GH1A 1E94E 2FZ5A 4S2EA 2P2LA 1BDHA 1RYDA 1L3CA 1GRQA 2KE5A 1UT8A 2R60A 4TSRA 1X8KA 5EHZA 4M9SA 2X76A 3B5IA 1QXSA 3CC8A 2K87A 4LPSA 3H5RA 1JU9A 2R4UA 2H9IA 2JASA 1E5QA 2P9GA 4DA0A 4FW8A 4R54A 2ZQ5A 4MJ7A 1PGJA 1PR4A 1V8ZA 3A4VA 4N03A 1V11A 3SFVA 1R6XA 1T43A 5CAEA 1C9EA 2C82A 3OJXA 1FJ2A 4UTPA 3Q8KA 1SUSA 2GDJA 3IP1A 4BO2A 5ITVA 5CLJA 1RAIA 4TN5A 3CVXA 1RHUA 3THOA 4DQ0A 3MS4A 5EPEA 3VO2A 1KIFA 2NUAA 3DMTA 3EXG1 1XDSA 4MS4A 3RNLA 4UHCA 1FXWF 5C8XA 5MN6A 3BMOA 2ZIZA 2PZAA 3BJZA 4TTAA 1NX6A 4BJHB 3GLGA 1G7CA 3A9CA 3OOJA 4U9HS 4MUFA 3R6LA 4U7JA 1KAEA 4J0FA 4QULA 3UANA 4QTUB 3O2NA 4RVHA 1Y6RA 1UZLA 1OJ7A 2V03A 5HGXA 1RWOA 4DCNA 1J5XA 2MYNA 3PHLA 4X1KB 3JQRA 4QEKA 4MAMA 1HGXA 1RIFA 2QN1A 1XL0A 4C20A 4PGGA 4JGBA 1Z25A 1VDZA 3D7MA 3I2GA 3MGGA 3DT9A 5JJ5A 1TYBE 4Y2QA 2J9YB 5DTEA 1Z5ZA 3L1HA 4AS1A 1JWBB 2QL9A 1IXRC 1HTBA 1P7ZA 1AURA 3JYLA 4HFNA