1QRDA

Quinone reductase/fad/cibacron blue/duroquinone complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
AVRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISRNDITGEPKDSENFQYPVESSLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLYWFGVPAILKGWFERVLVAGFAYTYATMYDKGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETVWEESPLYFAPSSLFDLNFQAGFLLKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of NAD(P)H:quinone reductase, a flavoprotein involved in cancer chemoprotection and chemotherapy: mechanism of the two-electron reduction.
pubmed doi rcsb
molecule tags Quinone-reductase (cytosolic)
molecule keywords QUINONE-REDUCTASE
total genus 83
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qrdA00
3K1YA 2BPOA 1WSBA 3NHSA 4M0CA 4QOJA 5A4KA 3U7IA 1SQSA 4CF6A 3B6JA 3N3AC 5EAIA 3O73A 2W5UA 1XT6A 1QRDA 1ZWKA 5TGZA 4C76A 1TIKA 2X2OA 3UXHA 1E5DA 2RG1A 2BF4A 3ESYA 4U7FA 4ZVMA 5LJIA 3W7AA 1YKGA 3UXEA 2BMVA 1CZLA 4QOIA 5NLLA 1BU5A 4DIKA 2OHIA 5FX2A 5B3KA 2ARKA 4BMPB 1TLLA 1RLJA 2QMZA 2A5LA 2QMYA 3OVMA 5F51A 5LLDA 3D7NA 2Q62A 1F4PA 5B3LA 2AMJA 1GG5A 1AKUA 4YAOA 2FCRA 1I1OA 4C0XA 1AKTA 1C7FA 3NHLA 1KBQA 1KBOA 1YCFA 3B6MA 1JA1A 3NHPA 4HEQA 4YAUA 4YQEA 5LVAA 4D02A 3W77A 3K20A 4FGKA 3GFRA 4ICIA 4YAFA 2QWXA 1WSWA 4HS4A 4S24A 1YCHA 1FVXA 3N3BC 4FX2A 4QOEA 2QX6A 1C7EA 3ESXA 3HR4A 2M6SA 4J8PA 2WC1A 1BVYF 2OHJA 3OJWA 1H69A 4QOHA 4Y7CA 3S2YA 3JSXA 3ESZA 5BUCA 2KQUA 3L9XA 1QBGA 2R97A 1VMEA 3OJXA 2GSWA 2OYSA 2XOEA 3NHJA 4GQIA 2QX4A 1RCFA 3QFRA 1AKQA 4LTDA 5FA6A 3R6WA 4GR9A 2FDXA 2FVXA 3NHFA 2KLBA 3F2VA 1FLDA 1D4AA 3GFSA 3NHWA 3SVLA 2Z9BA 2FOXA 3NHKA 4U7GA 2B3DA 2F1OA 4ESEA 4H2DA 1SG0A 1QHEA 2FX2A 1ZWLA 2MOKA 2QX8A 1DXOA 1JA0A 1AKVA 4N9QA 3FX2A 4OXXA 5LMCA 1RTTA 3FVWA 3KLBA 4NLLA 1AKRA 3NFRA 3TE7A 1FUEA 4R81A 6NULA 2HNBA 2HNAA 3EYWA 3OX1A 1FLNA 2BZSA 2HPVA 1FLVA 1FTGA 2D5IA 2MT9A 3TEMA 4H6PA 5ULLA 4C0WA 2V5UA 3NHRA 2OHHA 4N82A 1J9EA 1RLIA 1NNI1 1XYVA 2XODA 1AKWA 1AG9A 1AHNA 1X77A 4LTMA 2V5VA 3ZHOA 2Z98A 3HLYA 4QOFA 1CZRA 4PU0A 1CZUA 4PTZA 1H66A 2FZ5A 1CZNA 3F90A 1XYYA 4Y9UA 2QR2A 1J9GA 1T0IA 2BN4A 1FLAA 1T5BA 2FAXA 4XDGA 3QE2A 5JROA 4C14A 3P0RA 1DXQA 3GFQA 3FJOA 1D03A 2MWMA 4ZVNA 3EDOA 2X2PA 1FX1A 3B6IA 3G5MA 3N39C 3KAQA 3NHYA 3OX3A 1CZHA 2FLVA 4F8YA 4Y9RA 1AMOA 4ZVKA 3F6RA 3O2NA 4CETA 1YCGA 5F12A 2QX9A 3LT5A 3QFCA 4PTYA 2R96A 2MTBA 3W78A 3ES9A 1D04A 1XI2A 2M6RA 1OBOA 3F6SA 3FNIA 4QODA 3KAPA 3L9WA 3OX2A 2N1MA 3B6KA 4ZVLA 5FUQA 3GAMA 1YRHA 5LJLA 4GI5A 4QOGA 1YDGA 4FGLA 1J8QA 1QR2A 5EA2A 3RPEA 4BMOB 4YAWA 1CZKA 3LCMA 4FGJA 5LBUA 1J9ZA 2Z9CA 3OWHA 1AZLA 4U7HA 4LA4A 1B1CA 1V4BA 2ZKIA 4LTNA 4NULA 2Q9UA 5LBTA 3KEGA 3OWXA 4LAFA 5EMNA 5F4BA 1CZOA 5NULA 2Z9DA 4DILA 2FZVA 3NLLA 4XDHA 3U7RA 4YALA 1OBVA 1OFVA 4N65A 3W79A 3HA2A 1DX9A 3NHUA 4DY4A 3FW1A 2V9CA 1YOBA 1ZX1A 3TZBA
chains in the Genus database with same CATH superfamily
4KAAA 1LQTA 5EWMB 4O6VA 2AUMA 1JLKA 5ECYA 1SCQA 1QLWA 1SZDA 5CPFA 5TPZA 3UJ7A 3RBXA 4L0QA 1KJ8A 4PC7A 3MPOA 1I9GA 5AVWA 1E9FA 3AM1A 4DUGD 2OCIA 3IEUA 5EOVA 2H18A 2FN7A 2WSLA 2IRWA 2H2FA 4C3VA 3ZY5A 3K2QA 2HDWA 3WFIA 1TT5B 2ARKA 5BYBA 4BMPB 4JC8A 1KAOA 4LSZA 2AN3A 5JY6A 1S9HA 2BBSA 2HA0A 3SZ3A 1ACJA 4U7TB 4AO8A 4CM6A 1OKKA 1AKUA 2J5RA 3CIFA 5A9SA 4CM9A 1QZTA 2W4QA 2W0SA 3HI4A 1JFRA 1VKOA 3G7NA 1JA1A 2HWXA 2EBHX 3HYTA 4WOBA 3TKLA 3SX2A 4B6SA 1W35A 2ZFUA 5IAEA 3CV3A 4FGKA 4GMDA 4P86A 4FB4A 3ICPA 5KVVA 2O6HA 1Y8CA 4BQFA 4S24A 2FZLA 1ISHA 2WP8J 1KSHA 4IHJB 5JAQA 2CMGA 3G1WA 3EUEA 5I9LA 2GN0A 4XWWA 5H5JA 2KQUA 3ZV7A 4EZEA 3WGOA 2I91A 5IFKA 2EYQA 3B3QA 4C0BA 4YJFA 4AF7A 4TMFA 3P9RA 5ES3A 3KPVA 5TVGA 4HL6A 3JX9A 1SVSA 4BMXA 2GBFA 3MSXA 5ALUA 2Q3BA 2FWMX 2HB6A 2IY7A 3G2JA 1SUFA 3W8RA 1TQ6A 2JASA 4RMJA 1ZGCA 3RRYA 4G5XA 1ZSYA 3IP1A 3HPQA 3IV9A 4LJSA 5AJUA 4Y30A 3S40A 3U61B 4UHBA 5HVNA 1FS4A 1F20A 1E1RA 2WHQA 3PPIA 3VHXB 2B69A 2YNMD 2Z2IA 4NCKA 3WISA 4JC0A 4H77A 4NAUA 1P60A 1J1IA 1FMTA 2GJ8A 4PLVA 4EF4A 1HMPA 3D9QX 4KI0A 5EKXA 4I5EA 4WXEA 4AKEA 4TYPA 3WMXA 4ZDWA 1NFRA 4UEOA 5TDHA 5SYNA 2Y4OA 1LK7A 1PDVA 1DBWA 3DMTA 4UDNA 4EW3A 1A9XA 2QQGA 1C9MA 3LRPA 1JE1A 1V16B 2W6NA 2H1VA 2V59A 2FJUA 2HPHA 3QSGA 4N3GA 5E7QA 4C0LA 3R8FA 4G0YA 2JI4A 4IMJB 3N59A 2Z98A 3W2GA 1CQJA 5IAOA 2FZEA 5AHRA 1COWD 1G7RA 3PD7A 3BZWA 3E5RA 2WT8A 3IMFA 4AF6A 1M2JA 3DAHA 3PZRA 1A1SA 2O2YA 2IHTA 4NBVA 3K9LA 1KDRA 4LF7B 3JQGA 1S8AA 1N0VC 3BMNB 4P7BA 1LF0A 4RD0A 3T8YA 5LWHA 3UJNA 1TZ2A 3QVGB 4M37A 4HPWA 3CXUA 4DJFC 1R0SA 1GA6A 4Q9NA 4OGWA 3HN7A 3LHSA 4OMDA 4JASB 1RHQA 3H42B 3R5FA 4M9QA 4BNNA 5DYWA 1D6MA 2GPTA 1PJ4A 2ONYA 2VPPA 5KTMA 3GLUA 4K9DA 1ZJJA 2WHXA 2VSYA 4LA4A 2B1IA 4FHFA 3U7JA 3TOSA 5BNIA 4E13A 3ZXSA 4C0HA 2ZKLA 2ZYGA 3AIMA 3NWBA 3M4NA 4ACAA 2XRZA 2KBFA 3FPHA 3KOMA 3R74A 3SR3A 3VTAA 3R1IA 2ZK7A 3G1UA 3PGJA 1UZNA 3K0AA 2JCSA 2IHNA 5SY9A 1SPXA 5EN4A 2VBIA 1XQVA 5C2JB 1UZAA 2PJRA 1YNSA 3LTNC 4JVMA 4NZYA 4EQZA 1O94C 4HQKA 2GHTA 5L4SA 5HRAA 2OXCA 2PNJA 1E7SA 1F2UA 2H00A 3VYVA 2C7OA 4FFOA 4BKMA 4D3SA 3ZE2B 1J06A 1FTYA 2BM9A 4KZPA 3K92A 1JXAA 1ZLXA 2QAIA 2P1ZA 3AONB 3V4LA 4BBJA 5LKRA 1P29A 4WBXC 3RYFB 4DCVA 2H2DA 2Q0QA 1TZKA 1V5WA 2ZTHA 4Z9AA 4AVYA 1R37A 1ZVMA 1Y9EA 3WGZA 1GTL1 1T3ZA 2JFGA 5AI8A 3K70B 1JHZA 4P3OA 2P4UA 2W2TA 4KTVE 4X61A 3MMSA 5D6NA 3C7DB 4YCCA 4YQEA 4RA6B 4D02A 1K0FA 2I5PO 3FDFA 3TLXA 3URMA 1FMFA 4ZXPA 3WJ2A 2FYTA 1OWLA 1PQUA 4CL8A 1L8XA 4P53A 3A4YA 3DZCA 1OMOA 4KQWA 4G81A 4I50B 3BEDA 4N4AA 1FP2A 2ZBGA 4IYJA 3TG2A 3NTXA 4GXNA 3ME5A 4CG0A 3NTUA 5E2AA 3OCJA 4Z2YA 1JLSA 4YRPA 3DZBA 1CUEA 4A2WA 2J3MA 1MJHA 1NATA 4G4JA 1N57A 3DV0B 3I6IA 4N54A 5TGTA 4F9TA 4YMTA 4HDMA 4OHPA 1M34B 4BP9A 2AC2A 3PUJA 1ES9A 1UBGA 2KLBA 3FGPA 1L4GA 3UKDA 3BWCA 1UOPA 1V6AA 1GPUA 1OTYA 2D0OB 2FN9A 2XVZA 3A1UA 3NHBA 4HWKA 1N1GA 2AMYA 4MVJM 5EGSA 1LSSA 1W52X 4REQA 3VOBA 1KEWA 3OBIA 2CNOA 3CUWA 4MP3A 3V1UA 5IS2A 1XTUA 3CX8A 5JFTA 1IJBA 3Q7RA 1G6Q1 2N75A 4MITA 1JLRA 4EGCB 4GRDA 3DMYA 2WQ6A 2Q45A 4DMMA 2VYNA 3BIFA 5KSZA 3RVSA 4G1CA 1SR8A 3I52A 5DVZA 1K06A 3D2AA 1M75A 2Q6IA 1G20A 1PRYA 3QBDA 1JEOA 4INPA 4W8GA 3CVXA 4B35A 5BXYA 1S7CA 1PTJC 3E5MA 4QYIA 3HP1A 4R3WA 3K35A 4M86A 1JTEA 1K4MA 4G1MB 4FI3F 4K6GA 4OHRA 4Z4FA 2KM1A 2Y2UA 4MVJH 2F64A 2X4LA 3ZCUA 5FV4A 1XTVA 5BSWA 5CB0A 3RC9A 1ZL2A 4A6EA 3FPJA 5PNTA 1QVVA 3L1IA 1XHLA 1U0OC 3DDCA 1EGVB 4KXNA 2ATXA 4H6VA 4QXOA 2DFLA 1YQQA 1HQYE 1QC5A 2BAGA 2WF6A 4IBOA 3UCXA 4DDMA 3CNNA 4E51A 4HAIA 1QNFA 4Q6BA 2DHCA 4BIIA 4RPHA 3DHEA 5KNBH 1RD4A 3TL3A 2IPNA 4BVJA 3RTCA 4YCMA 2FR0A 3G8DA 2IU4A 1HYEA 1M2EA 2IYQA 2VNHA 3L0DA 1VCIA 4LQDA 1KMNA 3MMXA 5TF0A 2BBTA 2HT1A 1I10A 1AGYA 1U8TA 1ZUIA 4YRBA 1NOIA 1XLTC 2VAXA 2W6QA 4QASA 4XWOA 2J0UA 2Y76A 4GC5A 3QLTA 2WTAA 2WHPA 2OFXA 4Q1DA 5EHGA 4EPYA 2WWIA 2B37A 4PQGA 1YRBA 1B8VA 1RYNA 5JNSA 1FP4A 2W37A 4GOMD 1KI1A 4WZZA 1Z7WA 5F3RA 4EUKA 1EPUA 1GNRA 4ZZ2A 3M89A 4QBIA 5SICE 5HJ5A 1NQUA 3TG8A 2D13A 4JHLA 5I7RA 3EAQA 2F55A 2WUFA 4ARSA 2CVOA 1Z47A 5LZ5A 3JVUA 1X70A 5ED4A 2OHXA 1WHTB 2VUIB 2HPZA 1U9YA 2GA9A 1VCHA 5CGZA 3VSEA 5LLDA 5FO1A 3GEEA 4DCUA 1M9NA 1YR6A 5L53A 3WK7A 3HVHA 1UKCA 3KZMA 2VCEA 3LUGA 4UM7A 1AK1A 1K4YA 2VDWA 2JJ2A 1PTKA 4ENUA 1R12A 1P0FA 4GGPA 3A26A 3GZ4A 1W581 1XG5A 1S3SA 4CCAA 1EGAA 1N77A 4YRQA 2XOXA 2JLBA 4XGNA 1W75A 2D1QA 3CE9A 4M46A 5ALEA 2PLWA 3FXAA 4HSEA 4DBLE 3VQTA 2QWXA 5HOQA 3ESXA 4WNIA 2EBWA 4JR0A 2ZWAA 2OHJA 1MIHA 3DDWA 3IXMA 2PRSA 2VP4A 2Z2ZA 3OQ1A 4X62B 1VG0B 2ZYSA 5IJWA 2ZDQA 2D1FA 2FWPA 1JR6A 4QOSA 3LAWA 1OHHA 1C14A 2VYND 3GN2A 3TIIA 4PWZA 2A0XA 5ARBA 3B6ZA 3H11B 3W1VA 3H1AA 2DFVA 3RE1A 3N2KB 1CJBA 3LMKA 5JXHA 3T1QA 4NQZA 1UXGA 2DBQA 1AXGA 3V55A 1ZHFA 2JKZA 3Q0IA 3KVNA 3RFXA 3LA8A 5D86A 2V4MA 2VOEA 3KKMA 1G20E 1GKLA 1WOMA 1XNJA 4GRIA 4LRYA 4RJJA 2X0KA 3HUFA 2VSOA 4E0BA 1TD9A 1IOWA 1RJWA 2ZUCA 4GVLA 2I4OA 4PG5A 3FFBA 4TROA 4YJ2F 2ZE8A 1VQ1A 3G7UA 1QKIA 3KJFA 3IP7A 3OM0A 2BGWA 3GJRA 3UGQA 4D9FA 1AA9A 2OHOA 1HL3A 4JOSA 1P1FA 2SCUA 2D7CA 3JY6A 4H27A 1WZEA 1PVOA 5CJPA 3OAAD 5L51A 1SURA 1I3LA 2XKKA 2CHEA 1PW7A 4HJXA 1JEDA 3V42A 5IULC 5LXTA 3KRTA 1E9EA 4FU0A 3B9RA 3V9PA 3KFXA 4LVNA 2GN4A 3VDMA 2Q9AA 3B9BA 3JYNA 3SS9X 3KR9A 2B83A 3FZEA 5IJXA 4X3OA 3DDHA 3R4CA 4CETA 2HF8A 5U9CA 1HWYA 3G5UA 4DDHA 3LRTA 1T8SA 5JASA 5ADVA 1KO4A 4DABA 5KHLB 4HNQA 2EW1A 4G0ZA 4Z9FA 3K31A 3ICOA 1YS4A 4AX8A 2R6FA 1M34E 1U9ZA 1XZKA 2Z2XA 3G2MA 2BI8A 2CFIA 2FETA 2MSCB 4TS1A 5COBA 5C34B 4FGJA 3SF8A 2GUGA 3FNEA 3BWVA 4EGAA 4KPEC 1J7JA 3DUFB 1SHZA 4JQOA 4Q4LA 4WNCA 3TQSA 3UO8B 5KOHA 3DC7A 3ZHXA 3I5UA 2BMDA 2XGGA 5CG1A 4DRYA 5J58A 3I5YA 2F17A 3RADC 3LZ6A 2A14A 1DAMA 3AUAA 4U2KA 1NZJA 2HZ7A 4C6RA 1M7GA 4PG8A 2GCIA 1N2EA 2Q5FA 1RJGA 3LF2A 4ZQFA 3ADOA 3F7NA 5LFAA 2HBYA 1T15A 3WGKA 3HEBA 4W5NA 2GZSA 2BPOA 5J63A 3QG5A 3N3AC 4B4VA 1UEIA 1C1HA 3IEPA 1LBIA 3JYPA 2R86A 2VJCA 4OK5A 2X7HA 1KAHA 2XI4A 4LS3A 3E0XA 5AVVA 1GHTA 4DV5B 1NI4B 3U16A 3P96A 1H2AS 2V7XA 5TXGA 5EIXA 1NP6A 3I09A 5DHSA 4CLXA 2UDPA 2EATA 1TYBE 1GFZA 1YB1A 2CCJA 2G40A 5BORA 3GLGE 3NANA 3BDIA 2WFZA 1A9RA 1Z0ZA 3LT0A 4MS1B 4RACA 3NKVA 2QQEA 1J8FA 3DTYA 4MKZA 2Z8ZA 5A5DA 1O95D 1G41A 2Z3VA 1VKZA 2AKEA 4RTJA 3A9CA 5H1YA 4KR6A 2Z5LA 4QFMA 2WJYA 1P31A 5JFGA 1PK8A 2EDCA 2VG8A 5JI3E 1XJ0A 4E4RA 3NW9A 2XB4A 3D4LA 3V1LA 3O21A 1J90A 3D81A 3WQQA 5LN1A 2IQIA 2Q4TA 1ITZA 1RVV1 3GFGA 3QU5A 4RJKA 3RHZA 3E70C 4MLZA 2XIQA 3DEKA 3D0QA 4OYRA 5KTYA 2PA3A 3LBYA 1GUAA 2J9FB 2OGTA 3NRCA 4PRYA 4OF4A 3T3DA 4AWBA 4ALLA 1Z68A 5L45A 1XZMA 4TKUA 1YVPA 4E2FA 1LF5A 3Q6IA 1NW3A 3QFRA 2YV4A 4NJMB 4PGHA 5FIUA 4HRXA 2MYUA 1DHTA 2D3TA 3B7WA 3UW3A 1GAXA 5JXGA 4DUPA 1UF9A 2XTAA 1PE0A 2WIJA 4ZGBA 4V0MA 5IJ0B 5ALGA 2NTYC 5DBIA 1RC1A 4M99A 1K3UB 3SE7A 2GFIA 1VDMA 3QOYA 5IFLA 2O0MA 1EFVB 2CJXA 3MS7A 2VP9A 4K05A 4MDHA 4N5DA 1PS0A 2D7JA 5J4KA 2RDMA 4JEHA 4KIFA 5L40A 4M83A 2O5CA 4TMYA 4R1UA 1WEHA 2FG7C 2EFEB 3MJSA 1PJ2A 1RHJA 2CK3D 5SY6A 5K7SA 4RH0A 1AT1A 5ECDA 5ESWA 5C80A 4EPWA 3F5FA 3QJGA 3EOBI 1QF9A 4NTZA 2OHHA 3A4NA 2QBYB 2C97A 3NNDA 1YV9A 1L4UA 1JPNA 3QEMB 3AVXA 1U5AA 3FAKA 5CG2A 3LBIA 3W8EA 4Y9UA 5A6SB 3OCYA 2P41A 4JXZA 3KKKA 3WC4A 1ISFA 3KXLA 2G0NA 1BMTA 2BKXA 2CVQA 2ZRDA 3RJZA 1Q0HA 1NBIA 2PX4A 2I87A 1FMJA 1BMDA 3BJRA 1Q0TA 3I62A 1KJIA 1MEOA 3BIXA 1YCGA 3GARA 1CUHA 2FN3A 1H05A 1W6UA 4CEJA 2HW8A 3FZNA 1PUXA 4H1HA 5EZYF 5A1TA 1X15A 4D4LA 3WLNA 1OYVA 1ZMXA 2CYAA 2FHSA 2PQMA 2C78A 2DFNA 4NDAA 2B8WA 4E5DA 3MT9A 4CTMA 3K70D 3ZHCA 3OZRA 4R6WA 5EE9A 5E6SB 1WY7A 3QWBA 1R0KA 3ZQ4A 1MGOA 1ZCZA 2I78A 4YA6A 5SYAA 2VKTA 4DANA 2IQ5A 4MRAA 4MA4A 2V55B 3WA6A 2XRYA 4AJIA 4WK6A 1C8LA 3KQTA 5TV2A 1DIRA 1F38A 4X71A 2VPIA 4MULA 1WUJS 4UFPA 2CUNA 2PJDA 3C7AA 2ZXFA 3F96A 4JBIA 4DMLA 3MJTA 1H4TA 3JQAD 3WK5A 1J2YA 3L49A 5IBPA 2IE8A 4MSUA 5TGZA 1JKJB 1Q77A 1QRDA 4X8MA 5A03A 2X6TA 3B51X 3VOSA 3EHDA 3W8NA 4N76A 5C7YA 2XQGA 1J1ZA 5CHEA 2DBZA 4QHTA 1EHCA 2C84A 2PWZA 2X58A 4MKXA 3E03A 3STWA 4FNAA 3F3YA 4L0MA 2Q62A 1L4KA 1OI3A 2QKYA 3ZHVA 1P91A 5B57C 3MLAA 4P5PA 4DCTA 4B3JA 3PI7A 4ERXA 4EH1A 2H2AA 2H51A 3BDVA 2JD2A 4GMKA 4HEQA 3TI7A 4ZYTA 1PLKA 3NTRA 4ID3A 4D3XA 1GNPA 1BGWA 3ANSA 3ELWA 4W1RA 4EJFA 4DG8A 1Y4UA 3P2YA 2NWQA 2DHQA 3JAWB 5GONF 1H2FA 4OQPA 4JODA 3NBUA 2Z3WA 1A77A 4CJXA 1U31A 3UCEA 5C5IA 1ODJA 1C3EA 4OSEA 2GBGA 4NESA 4V03A 1Z6YA 4PXAA 1YONA 3QSYA 1FEZA 1TU4A 1R10A 1VI5A 2Q3JA 2B4YA 2VCHA 3ABSB 1ECCA 1PL7A 3ET4A 4JP2A 1A2KC 1LU9A 2IIBA 4YT5A 2AJLI 4XYGA 5J5VA 3OPYI 5CW2A 5HYVA 2W83A 2OOKA 4JB8A 3E82A 4FMDB 4ZO6A 5H68A 4P4NA 3BRCA 3V7WA 2GJKA 3QX7A 1I3NA 2COEA 4ND3A 2XDWA 4CT4B 4K28A 5JEEA 2OT3B 4HTFA 1F9EA 1TDJA 4RANA 5E3IA 4CVNA 1YFJA 1ORDA 3H2YA 4AZSA 1XDZA 3HWRA 4LHEA 5CCBA 4JLMA 5HBRA 3RC3A 1USKA 4FT2A 5EXPA 1RT9A 1VECA 2X8WA 2I4IA 3RWOA 1F1BA 4AICA 2YFYA 4OQXA 4DSAA 5A9RA 2BP7B 2IA5A 3G0CA 3OX4A 3Q3GE 4N5MA 3C3CA 2NT3A 4MQUA 2RKWA 1FW6A 3UUEA 2JGDB 3GNLA 1M1UA 3P4YA 4JVNA 1EUZA 1JZTA 1XOIA 5JPCA 4HWTA 3S4YA 4TV9B 2W8BA 5BSRA 1G8YA 5BOVA 4Y6LA 1M6NA 3W6ZA 4JT4A 4PSDA 3ZU2A 4X66B 3ZI4A 5FUBA 2DC1A 1JHRA 3OMXA 3OQVA 2BHSA 1JBQA 2YW2A 3DHVA 4NCNA 5C9ZA 1AO3A 5CM9C 4FWTA 1XJCA 3SDSA 1K86A 1ODFA 1YE3A 2W70A 4BECA 1AQLA 2G67A 4J91A 5CX4A 1ZESA 3TXYA 4BMOB 4HY3A 1IK6A 1MA3A 3L6CA 2VQ6A 3GELA 1KTVA 2H5JA 2HQBA 3AJDA 1YI1A 3NDRA 3NDIA 4MVJF 4UBNA 4ABYA 5BSFA 4AQ7A 3UMCA 4EOGA 1CUBA 2GWRA 1X14A 3BERA 3G0OA 1L0BA 5GIOE 3EN0A 4Y1RB 5THQA 1B6TA 1G63A 3FGNA 4B48A 1THMA 3WNZA 4URUR 4TWAA 5J5CA 3CLTD 3IHKA 4HXEB 1FSFA 3ODPA 4KQEA 5LA6A 2QVYX 2VHZA 1CDZA 3R3XA 4IDPA 4PG4A 5BN5A 4MQFA 2ZYTX 2ZUDA 2IS2A 5JNWA 3VJRA 1TC2A 3MYRA 1WRBA 1TM1E 2B82A 4QULA 4FYXA 4BWVA 2WNHA 3KB2A 5LJIA 1I3KA 2FOLA 1OA1A 4NU8X 4LVCA 5H0IA 4ZO9A 4TMKA 4K6CA 5B2FA 1XVUA 3RFVA 3K1TA 4BLWA 2BRUA 3V8BA 5HMMA 1AF7A 4FFDA 2QUAA 1B6SA 1KMHA 4J2OA 2XJ9A 1QHIA 1L5LA 3ZWAA 4NYMR 1ADJA 4HNVA 3HC7A 4RZXA 1OXTA 1PS8A 4GF5A 3EXHC 1K66A 1GU0A 2HEIA 3JWHA 1XZIA 2OWDA 2XITA 5LQCA 5EFOA 3HXQA 3S3TA 3FYUA 1WEKA 4QPCA 4MHSA 3U9TA 4KIWA 4PO8A 3BF7A 4OL9A 2UUBB 3TLZA 4YAKA 3LI2A 5ALVA 1M5TA 4FKMA 1Q0ZA 3HCPA 3D3WB 4F86A 2Q99A 4QKQA 2Q1WA 1ZAYA 4KVGA 4AJNA 3AVYA 1YU6A 3F0TA 2Y0CA 5P8WA 4BO9A 2HRRA 2Q5JA 2G04A 4G1VA 2L82A 1A9QA 2B6NA 2IHBA 2FKAA 2FWNA 3NHKA 1ADYA 1VC2A 2B3DA 2UVDA 1E0SA 1KYYA 2W90A 4MV6A 5HIIA 4ZJPA 2ATVA 4X5OA 3IKMB 1E9RA 5ITWA 5HDQA 4KWIA 4DW8A 3GZTB 3QENA 2VSFA 3VO1A 2HEGA 1GRCA 1UKEA 3FX2A 1LW7A 4G5HA 4TTSA 5JR3A 3COVA 3T7SA 5CLGA 4HWSA 4OIMA 1ZHOA 2RCNA 3OX1A 4Y2TA 3WWZA 3ESQA 1FTWA 1NXPA 1MVOA 3IILA 2EF1A 4BFWA 5EMLA 1JLLB 1XVLA 5I9MA 5AW2A 5JNLA 1FNSA 2PL9A 5GM1A 3A6LA 5EWLB 2P30A 2QTMA 2RGGA 1HYQA 4BNFA 4FYKA 3EODA 2CD7A 1ISMA 3KALA 8MHTA 4YP6A 4YDQA 3CPJB 4WFIA 3GLHE 4EO9A 4RVSA 4XJTA 2ZGVA 5D1NA 2W2QA 3VV2A 4CIVA 4BNUA 2VF5X 1U0FA 3IDAA 4J9VA 3B1KA 3MQFA 1SC1A 3FHLA 3G82C 2C2WA 3U5TA 2GAJA 2YWBA 3AHJA 3ICVA 1G8KA 3OZWA 4P82A 2IJGX 1T8YA 2IY8A 2XCOA 1VPVA 4XVQA 2UKDA 5CLHA 1W96A 1C41A 3A3NA 3V8EA 1C0KA 5IYZB 4WKPA 3MQ2A 1XFDA 2J3QA 3FWHA 1WDMA 4MVYA 3LNTA 4O4IF 3IEIA 2IEBA 1CDDA 4P0PB 4QOGA 4BFXA 1EP2B 2YBDA 1CX9B 4ND8A 1HFKA 2JJQA 3PE6A 4TTTS 2HQRA 4GKVA 4BUCA 4NK4A 1V4BA 4PHGA 1QBKC 5K4AA 5K0CA 4J7UA 1ODIA 1GCUA 2P2ZA 1DAOA 3AFGA 4Z0TA 3ROKA 3RS8A 4DMRA 4DCGA 1VMKA 2NO7A 2X8JB 2QN6A 3II6X 4OH7A 4UHDA 4F6RA 4GOKA 5H3HA 1PNTA 3DFFA 4PG7A 3AVQA 4W1QA 4M87A 5FFNA 2B0CA 3CX7A 5JVDF 5KJ1A 2DLCX 3HK2A 2YV5A 3C4JA 3QUQA 4QUHA 3GVXA 3A9WA 4UDXX 5EIBC 2OGUA 2QN9A 3K1YA 3TLGB 2WHRA 2GPNA 4CF6A 4JBXA 1VHJA 1D8AA 4HLUC 2ZSHA 2GNPA 2IDZA 3UAGA 4CM1A 1DT3A 1P5ZB 2H92A 3HKDB 2JB9A 4YY3B 2PMEA 1WW3A 4V0RA 1F0YA 2W93A 4V0NA 5JI2E 2IP2A 1XO1A 5B3KA 1PSDA 4P32A 3AEKB 1SBHA 4M89A 3VSBA 4MR8A 4LECA 3HA3A 1WXQA 1RXUA 2DU8A 3UYKA 5K3FA 1ODKA 2IHJA 5DOZA 5KO2A 2PWYA 4F1WA 3BGVA 4CNBA 1UOEA 3I9V6 3TDMA 2FGJA 2HAEA 5F1OA 2E4WA 5I7EA 3PHGA 1JU3A 3NB0A 5LYJA 3ZW9A 1F3OA 2PIAA 1HTTA 4P4SB 5CJ2A 5A7GA 5BN4A 3QVXA 1DE0A 4QARA 1W4RA 5EIAA 1Z63A 3PV0A 4G23A 3DTVD 5JU6A 4HS4A 3NHMA 1M6VB 3OQPA 3PVZA 1PJ3A 4PU0A 4QRHA 1XCGB 3DFZA 1GUDA 3IUSA 3NBZC 5K3FB 1M2GA 3EZXA 3ZV6A 4MR9A 5CA1F 6Q21A 4YFYA 4JROA 1U2EA 4ZCIA 4PX2A 5DULA 5IVIA 1LDNA 1ZVVA 2HLDA 1JSXA 1YD7A 3QKRA 4JI6B 4LF5B 3TRDA 4WNYA 1MEJA 3LPCA 4BVLA 4MUFA 2YCLA 5A0FA 4ZTZB 3E0QA 2J32A 5EXSA 2YZMA 1FBNA 2E82A 2RK3A 3SN6A 4H0NA 3GFSA 3KSDO 2AFIE 5DT2A 4JOCA 5T6MA 3KYDB 4J0HA 4JNKA 1J70A 3L3BA 5IM4A 3T4PA 3PFKA 1R9MA 1J42A 3ZEAA 1DKOA 1SOVA 2XMRA 1A98A 4WE3A 3C97A 4NS4A 3ZQ6A 2H5EA 4GWLA 4YI3A 3UK0A 3ZLTA 4BHTA 1G60A 2R8OA 4JJ6A 1MCZA 2VUSA 3TB6A 2QTNA 1R0LA 3MBIA 3K6SA 3JQFC 4B4OA 1BYIA 2FLKA 4RK5A 3RF7A 1JL3A 3W9UA 1YBVA 4AM8A 3MB8A 4G24A 5GONB 1W7AA 3GT7A 4R3NA 1SXJA 2XMPA 4FMBB 3WMGA 3JASA 4P1ZA 5F35A 1H4SA 2IEZA 1L7RA 1SD2A 3LL7A 2G70A 2HJ9A 1Z2NX 2G17A 4BLSA 5BV0A 3KVOA 1Z4JA 1LW6E 3QF7A 5KINB 1T6XA 2FAXA 1SHUX 3OFND 1ONBA 5F7XA 3PRHA 1BVHA 3V7UA 4KWEA 3GJ0A 3EK2A 3B48A 3K5PA 5DI9A 4HGPA 5FWXA 3ZOKA 3D1JA 4MRPA 3HE3A 2J30A 1SCIA 3GRYA 3FTCA 4CFYA 1UPCA 4X41A 1V3TA 4Q1BA 4UNQA 2IYXA 2QP3A 3B13B 2J3JA 5L3RA 4AULA 2BFWA 3P7MA 4WKNA 1PFGA 3CRMA 1Z4IA 1E1RD 1P77A 3MJRA 1QCZA 1K7EB 3PRJA 3EJWA 5EIWA 1E3IA 1QHHA 2JGAA 2VDWB 4LV5B 1PSZA 3H9UA 4N9WA 2IP1A 4J49A 4RZSA 4WINA 4ZT3A 3ZCTA 5B4UA 4P38A 4X3PA 1F2VA 2BEUA 1O94A 4IOJA 4MJXA 1XA0A 3M6LA 1XZHA 2VUTA 3FYSA 4RPLA 4WOKA 2YMMA 5K01A 2ZJ7A 4G0VA 3T3OA 3NOXA 4P54A 3I53A 3HCEA 1AF4A 3HU1A 4RL4A 1U3DA 5THKA 4BX2A 5FWDA 2CJWB 1N2BA 1KK3A 4KFSA 5JDCC 3AFOA 2PWBA 4HAWA 1QDLB 3GJSA 3LBHA 4B32A 1CY2A 4PLFA 1DKUA 1O89A 2FEAA 1TX4B 3H11A 2BMWA 3KB6A 2Q4OA 2XMCA 3CLRC 1TM5E 3KKNA 1P1IA 4NICA 1MPTA 2J0UB 1VYHA 3PGVA 5FLYA 1H6DA 4ZN6A 3DBOB 3PUYA 2FP4B 4MROA 1IN6A 4J07A 1U9CA 4EKYA 4RORA 2I6SA 1ADBA 2BDEA 1OLXA 2CNWD 2WHEA 1V7ZA 1FP4B 3T3NA 2ZSKA 3MD0A 4Z7OB 3WLAA 1JE0A 1U4OA 3OKFA 4RGBA 5AJTA 1QG4A 2RGBA 2VT6A 1TEHA 3RVRA 1WPQA 3T3GA 1KFJB 3V6MA 2E37A 1UPAA 3STUA 4Y3UA 4EENA 2REQA 2R47A 3E4DA 3L7AA 4FUQA 4HT3B 2ASVA 2EL7A 2J85A 4GYYA 2YJ5A 3WE7A 1UAGA 1C7EA 2AXNA 4C4RA 3KEOA 1X3SA 3HL4A 2GYVA 2RI6A 2QW0X 3U7QA 1EUQA 4E2YA 2AOUB 3QWFA 2Z8YA 4RQBA 1CY7A 5HKAA 1D6NA 3FPKA 1TJ5A 1E60A 5HE9A 2PU5A 3PFGA 4UTOA 5TY0A 1IXKA 2VFAA 1FDVA 2IOFA 1GQQA 2PJUA 2QDKA 2IPXA 2ROQA 3PF8A 3RIEA 1YZQA 3TQQA 4IXMA 1MUUA 1PLJA 2RGYA 5IYZF 1XN1A 3CLSD 2FWJA 2NXJA 3O74A 3RD5A 5J2TB 3JQEA 2CDRA 3V8RA 4OXXA 4ETMA 2NO6A 1NAIA 2GNOA 4CTJA 2GBLC 3DAPA 4IGAA 3MMZA 2R7LA 1AMNA 3SEZA 4ZHQF 1P3Y1 4Q21A 3H65A 1J0BA 3EYWA 3G9QA 2JFWA 3F78A 4M1OA 4ZVQA 3WIOA 3BMQA 3ZTWA 3PA8A 4UHHA 1FFAA 3SD7A 1MJGA 1ECPA 2RHTA 4JLNA 2Q8PA 4ZI3A 5JW6A 2Q4RA 1JMVA 8AT1A 4B3XA 1XZJA 3PSHA 4MARA 4GSLA 2Q6TA 1QP4A 3NT4A 3GD7A 3NYRA 4PTZA 1E7QA 3JD2A 1RYFA 3W2FA 1P2SA 4O4HA 1E5QA 1H9CA 1QVZA 1KZ4A 3LFUA 3WZ2A 3LHFA 4O4JB 3EDMA 2XZTA 1GLGA 2FTKE 4PBTA 1IVNA 5E9AA 3WL5A 1UKYA 3RRBA 4P4TA 3RV4A 3EMVA 8OHMA 3TUZC 2JIMA 2QZJA 1EJ0A 2R96A 1CIPA 3C4VA 2PSSA 3KUCA 3KZ1E 4RV9A 5IDQA 1JP7A 3V2HA 1GA4A 1PGQA 4YI5A 2ZVDA 1RYDA 5T57A 4MS1A 1NJ5A 3CTPA 5A3SA 4OM7A 2QMOA 1Z6XA 3T9EA 1FNBA 2Y93A 3ZC3A 3PC2A 4M8SA 2C2KA 2RAPA 3DTVB 3SZRA 2FPMA 1FP6A 1GPDG 2IXTA 1IEXA 3OIUA 2DYKA 2FHPA 4IJQA 3MIZA 4AQYB 3QE9Y 4ZU3A 2I2BA 5HTOA 3B1FA 4MRNA 1OXVA 4Y9SA 2DHEA 1E9SA 4FGSA 5B1HA 2BP7A 1Z7EA 1SC6A 2V6JA 3QY9A 3VISA 2YWGA 2NU6A 4CCWA 3DT6A 3HJGA 3NHSA 3MRXA 1W5AA 1SOUA 1ENZA 2VBFA 4LBYA 1NURA 2F3RA 1ZD9A 1IM5A 1KFEB 3AETB 2CMDA 3RUHA 3DOFA 4QREA 2WAAA 2G36A 2QD1A 1ECJA 2P7IA 3GP3A 5IKOA 2QY9A 5FL3A 2E1RA 2NNWB 3B20A 3CNOA 4BYGA 2Y6UA 1NXVA 3RLFA 4ZMSA 3ZVNA 3K0FA 2XUQA 1QHXA 1SBTA 1VIAA 3FNFA 1N2HA 2VH1A 4LQCA 1IWOA 3F9IA 5ALFA 1YR3A 5HF9A 5IVDA 3T9CA 1FFHA 1JG3A 4BXOB 3BICA 3NHPA 3RKRA 4LDAA 1UMCB 3SKXA 3NATA 3PVCA 5IMSA 1LDMA 3AUJB 3W77A 2FDRA 3WO1A 3K5WA 4BTLA 2FF7A 4NDNE 1I8TA 2BFPA 3GN1A 1V1MB 4J8PA 1XLVA 4Q7KA 4QOEA 4E5NA 3JQ7B 2DLDA 5CDFE 2P6RA 2HWKA 4G0QA 3KVVA 3KSBC 2XKAA 4K86A 2XMZA 4TWIA 1OXSC 2RB4A 1LDEA 4YT4A 2VRCA 4LXHA 4MQBA 2XYRA 5CDGA 1TU0A 1E96A 3LZDA 5IKEA 2FSIA 5F1KA 4GEGA 4UUMA 1GPWB 1X0VA 4G8CA 2QRQA 1I36A 3IAEA 1YQUA 2XT0A 3IDSA 3U7EB 4OHCA 1DX4A 4J0GA 4B33A 4DIBA 1Q0SA 1D9XA 4W7HA 3NMUF 2KYRA 5FADA 1KIFA 2P6MA 4L9AA 3W2IA 4W9MC 1JQAA 1EX9A 1AKEA 2PPVA 4BGVA 3ZOZA 4AN4A 1NPYA 4JJFA 4US2R 3TTYA 3MPUA 2JC3A 2VO1A 2VDKB 5B1EA 4OBXA 3RIMA 3IUPA 3CT4A 3DNMA 1UQTA 3QH4A 1XKXA 4G8BA 2FPWA 4LCJA 4O1MA 4LXGA 1DKRA 2DRIA 3BWBA 2ZBDA 4GRAA 4ZK2A 1J9EA 4CF5A 4PY2A 1DIOB 2VA9A 3FN4A 2OPHA 4LTMA 4DLBA 4IQ4A 4RKRA 1C7RA 1YCDA 2CYCA 2J3KA 1P7WA 2P11A 2YVUA 3J7TA 2CXSA 3NUQA 3QV1A 4UATA 5JXIA 5HX7A 4MHTA 3THXA 1PQPA 2WINI 3AU9A 1ZVQA 4W7SA 2ZRJA 4F1JA 1LJLA 5AQEA 3VNUA 3U4MA 4XW2A 3TZCA 2ZEJA 1DOHA 4TKLA 4EDFA 5F21A 5JAUA 1OBOA 2XZLA 1E61A 3O94A 4G0XA 3PEYA 2HWWA 4MW1A 1D0IA 1GKIA 4J7CA 4UHKA 2VXYA 2NO5A 2WKWA 4L9RA 4OK3A 1TUEA 1YVRA 3CX3A 3FWPA 3WB1A 1ZH6A 2VJPA 2R66A 2R0QC 3UK1A 1XK6A 4C6SA 5AXAA 1X9GA 5BYAA 4QWWA 1CXZA 3TCXB 5CVDA 3FYUB 1M6YA 1P0CA 3F4KA 4LW8A 3BMQB 4LVOA 3ZZ0A 5L3SA 1KXJA 1J0AA 3ECAA 4XDHA 4CL3A 2F4NA 4OXNA 3FBTA 4HWOA 4RL6A 3HVRA 2EJWA 3AJAA 2YYYA 3LYUA 1NIPA 4PRZA 3F8SA 2A58A 2Y92A 3LUCA 1NHGA 1NZDA 4MRSA 5CK4A 5H16A 2GPAA 3KVRA 2RCYA 1SU8A 1KARA 1FFWA 5TMPA 1YL5A 2CUZA 2OCBA 2RG1A 1XQ6A 4I55A 3B53X 1MAWA 5EHXA 3HA5A 3KOZA 2BELA 2RB5A 3ZVKA 4TQAA 2PEYA 3LWDA 3R9XA 4Z49A 2CWWA 3KU1A 2IEAA 3H83A 2O7VA 2A5LA 2V0GA 3JRWA 1J4AA 2QW1A 3WGNA 4B8YA 2G1KA 4CDMA 1Y7HA 2G71A 3ASVA 3BX1A 3IAM6 4X6UA 4BFSA 3SEFA 5C8DA 2W6PA 1Q91A 1MB3A 1NUTA 2OFPA 3WJ7A 3GJ4A 2V7GA 1JIVA 3LV8A 2NXNA 4GR4A 5JDIA 5EP3A 4MEJA 1DP4A 3WLJA 3BFKA 4E03A 1E2PA 1S0UA 4CHTA 5LP1A 3LA6A 3TMAA 2BBWA 4UEWA 2YXBA 5LZ9A 3QLEA 4R1QA 2ZJ5A 5U4XA 3A3KA 5KYKA 3FH0A 1EP1B 1JQKA 3L9XA 1ZI6A 3B3FA 5IASA 5AOCA 4XX1A 1PFQA 4KDCA 4CQMD 3WKEA 3CJRA 3MW8A 3OA2A 3PXEA 1HDCA 2IZ5A 1Q22A 4WA7A 1YNOA 1NTOA 2TMDA 4OAQA 5EJIA 5EZQA 5TQVA 2PGXA 3N2GA 4ITVA 4AW9A 4UU7A 4DBVO 4JX8A 5F9HA 3TAXA 3EEOA 5EZYB 4LV6A 1C9YA 5JNVA 3B60A 2A9QA 3OPVA 4O2AA 1XCBA 3OT1B 2ST1A 4DC0A 1EVEA 1Z0UA 4K9NA 3TTVA 4EMSA 2RK4A 4G5OA 1VL8A 4MJ3A 4OYHA 3SM3A 3LWZA 2B3TA 2ZJFA 1L8OA 5AJHA 1I7QB 3WA7A 2QRMA 3DKKA 3QG1A 1J8MF 1QZ3A 5G4KA 2B1RA 5T67A 3L8YA 3T3HA 4D74A 2Y05A 4N12A 1OASA 2UZ0A 4EHAA 3GP8A 2X6RA 1OAAA 3HU2A 3D2CA 3R9WA 4AJLA 2E85A 4WWHA 5BMVF 2OMEA 1NVAA 5FWYA 1AX9A 3D6JA 3IA2A 1Q44A 1ZK2A 5F1YA 1SVNA 4G84A 3FVTA 3T7TA 2RBKA 2HU7A 1O77A 1T5BA 3EQ8A 4XWKA 2QX7A 3IPCA 4KRYA 5I4KA 1JT2A 3GLFE 1N8TA 2BFEB 4G0OA 3RVKA 3T5TA 5KYYA 5HWSA 1HRDA 3QHPA 3UKJA 3I6MA 5T4FA 5LIPA 1WMDA 3OU2A 1HKHA 4JWTA 3ISJA 3ZIAD 1DUIA 4CF4A 1JDBC 3C24A 3MUOA 1VKJA 2C00A 2E55A 2W00A 1AOXA 3HUEA 4P58A 4Q00A 4PFJA 4DZRA 5A6SA 4TVBA 3PLRA 1IJKA 1T2AA 3JAKB 4TLLB 1U9JA 3LP8A 2VF7A 1NBAA 2JA1A 3JAMA 3A9VA 1XNGA 4S1TA 2CBXA 3M9WA 4JUDX 3JWJA 5DSXA 4NX2A 5EIBD 3G79A 2CE2X 4ENQA 1TF5A 3VZQA 3WL3A 2ZI4A 1BX1A 2JBAB 5GTDA 3P52A 4MV4A 5JS6A 2QTHA 2VQDA 2Q5CA 3IAM1 3HGQA 4RVUA 4CMHA 4I9UA 5CDHA 2D5BA 5TS2A 4ZZ0A 3WSWA 5FT9A 1Z45A 3V2IA 1W36C 3IBTA 4PPNA 1O94D 3P9ZA 4II7A 2LTAA 2EWVA 1XZCA 1WXHA 2MIIA 2ZI7A 1QRAA 1C2YA 3HPRA 3NEPX 4ZHQA 3QXHA 2BF4A 5KBYA 1M8JA 4U7FA 1IU9A 3C45A 2GEDA 3EPKA 3UPUA 3EGOA 4KUEA 5E9WA 4A8JC 1RLTA 2ZB3A 1R0ZA 3DMGA 4O4LB 3FFWA 3OVMA 4NPAA 5JXWA 4PLWA 2X8AA 2ZDGA 4M1EA 5K20A 4IIJA 1C3OB 1RM4A 4KXWA 4EL5A 1WNTA 2XOKD 1ISIA 2WTXA 3PQ4A 3R7FA 3JARB 2NV6A 2P65A 4C1BA 1R64A 3RKSA 2H4FA 4M88A 1VMAA 5KOJA 2PT6A 1ZLYA 2IYVA 3GJZA 2PH1A 1QFSA 1ZA2A 5JADA 1PW5A 5FTMA 3U09A 3RROA 1NVWQ 2AZMA 4JC4A 3EZFA 4EEKA 5A71A 3DLIA 3RJ9A 1NVMB 2ZIGA 3G17A 1T3LA 1W85A 1MLDA 4YJHA 1YL6A 4GQIA 4CQNA 1Z5OA 2LZ0A 3NIWA 5J2UA 3PGLA 1MFPA 1ZJYA 1D1SA 3AR3A 4FIDA 3NC1C 1BU8A 1LVHA 1PP4A 2LW7A 2XNDA 3E9NA 5CT9A 5HTKA 3WG9A 4ADSG 5DP2A 2Q41A 4BB6A 2VTKA 2WPDA 3H13A 2G5PA 4DBZA 1SEVA 2JGFA 3RYHB 4YRZA 1I4OA 3HJHA 1Y5MA 1UK7A 3TZKA 4HV4A 1KY2A 1FSSA 1WXFA 1T9BA 1CETA 1V3UA 2PMFA 2FX3A 2GD1O 2X4IA 4YDHB 4K3UA 4Z4QA 3LCCA 3NHRA 3H3JA 4LQ4A 2YL2A 4N5IX 2FNAA 1XB2A 4P7GA 4DOMA 4ENPA 2P0EA 5JCJA 2QRJA 2VBGA 1H3EA 3MVEA 4FMCB 4PFQA 1U98A 3GGPA 3I0NA 3PUIA 3AR5A 3G0DA 4TLDA 1RIFA 3NC4A 2QTAA 3Q41A 1HLGA 4CDRA 4ZI7A 1TI7A 2FUEA 2PVSA 2QRHA 3RHTA 4F92B 3NDPA 5KCMA 1E1LA 2R1TB 4IUDS 3EJ6A 1AZWA 2X23A 5AOVA 4R1MA 4ECAA 5I9IA 2RHBA 2AD1A 4JXJA 3Q6MA 3L7OA 4EFMA 4XJSA 3W7VA 1NI3A 4JENA 3DE3X 4MR8B 5BW6B 2JK1A 3UHPA 1XK7A 4C04A 3KAPA 1FFYA 1OLXB 5LJLA 4QUGA 4EEZA 2AZ4A 4XYBA 4JQSA 3B82A 3ZDYB 1Z22A 3FKJA 4UUOA 1N6HA 1U8EA 1W29A 3GMTA 2XUZA 2JH3A 3E81A 2VR1A 1O54A 1W2GA 2I3AA 4GXQA 4HLCA 4X84A 2RAVA 2Z57A 3P9XA 1MP0A 4BLOA 1UOOA 1WQ3A 4A0RA 3ENNA 1EM8B 1VE7A 3EUAA 4HEHA 4PQEA 5EHNA 3R76A 4BV9A 5IJ9A 3WAJA 3ORSA 3AF1A 2JEZA 3TIFA 2PSFA 4HX5A 4MHOA 1W6RA 4KIJA 1EVQA 3T4EA 2P90A 2R8PA 4QVGA 1PFYA 1Z38A 2DUWA 3JV7A 4Y6PA 5AKJA 4ZVUA 5TEWA 5JATA 1V96A 5MGBA 3O73A 2R6DA 4Q9IA 1K1EA 1ORWA 3BN3A 1M34A 2FN4A 4N3AA 1WMFA 1AUQA 1DTWB 2H63A 2AG5A 2X0RA 3OLWA 4XB6B 3QVUA 3EISA 4ZVMA 5K0GA 5J3JA 2Z4SA 2GDJA 4UEQA 5ICMA 1B73A 1YDHA 1JYEA 1DZIA 3HNPA 1T8RA 1YZTA 4Q3CA 1P17A 2P4EA 3INNA 3TQCA 3IALA 4LF8B 3M6FA 4NRDA 4CM5A 1HY3A 4GGOA 3G68A 4HQFA 1TMGE 2AFHE 1S1CA 3TLGA 4TQGA 1QVAA 1INLA 1WCIB 4R1PA 4I8DA 3EDYA 2NU9B 4OQZA 1E8NA 4Y2PA 3UMMA 1EWVA 2H2GA 1QLJA 2AOWA 4TQ9A 3ZD6A 2GWHA 3DE7X 1PWZA 3GGSA 5LWQA 1QP0A 2JFXA 3EUWA 3EIFA 2EERA 3REOA 3TLAA 3W6PA 4R8SA 3X44A 1JSCA 1SIBE 1QPGA 1OXXK 4W5OA 2V7VA 2XWBF 5DW0A 3LOUA 3STVA 4HRVA 2H5IA 3PICA 4KXVA 1PK9A 1EKXA 4ITRC 4DM3A 2OYSA 3SS7X 1I1NA 1R5NA 4EYEA 1EJBA 2H48A 2YIJA 3FMOB 1N2OA 1NRJB 3L07A 1T9ZA 3OI7A 1T1JA 1VZ2A 2WYUA 4I4IA 3VO8A 4C0SA 3C87A 2IDMA 4ETIA 1SKYE 4K9LA 2OVFA 3R7WA 5BNZA 4OGKA 2F8MA 4X6LA 2FX2A 1Z56C 3D8NA 4IOMA 3RM3A 5L7WA 2WK1A 1AHHA 1ULSA 3RNOA 1DJPA 3DBHA 3E2PA 3X2FA 1TQDA 1DTSA 3VU9B 2Z43A 3K9NA 4EVQA 4F93B 3DULA 3HB5X 1WTAA 3BE6A 3DZFA 3N2IA 1GG2A 3BMOA 4YPOA 2P5TB 5KWIA 2QMQA 3I64A 1L5YA 3GNTA 2W22A 1U4SA 1GTZA 5FOUA 4OBEA 2Z04A 3ND5A 2FXIA 4WXMA 5CEJA 4EGSA 4L5YA 1PKEA 2I4NA 4JT2A 4KN5A 1GQOA 4UTRA 4TLAA 3ZHSA 3T1TA 4RLQA 4V1CB 3WFZA 4QYTA 5ILGA 1DXQA 1FDSA 4QGAA 4LOAA 4DDWA 4PZZA 4MIOA 2X2PA 1Y3BE 1C81A 1ND6A 3G5MA 4UM9D 1RDFA 3S2IA 4IDHA 2AJ8A 2WRZA 3O2NA 5GJCA 4H08A 2IPMA 2OZKA 4FJ1A 2GD6A 2QTBA 1XHEA 3S5JA 1BQ4A 4EK9A 4KYTA 1CQJB 2ZTLA 5G2OA 3EWIA 2NN3C 4GC9A 4QLBA 2QTCA 2HADA 2ZITA 5EMMA 5TR9A 2JGRA 4O5AA 2MSDB 4U2FA 2ZJ8A 4EB6A 1SCUA 3QTLA 4I1YA 1W73A 4PLTA 4UBLA 4QUAA 5FPPA 1BXGA 3WIUA 1P45A 3ZKWB 4C7BA 3KPWA 2N0SA 3W6UA 1AB6A 1LV7A 1IQ0A 4YB8A 5HEKA 3VBEA 3KEQA 5G40A 3WBBA 5IDYA 3MNFA 1X7XA 1C9JA 1ULZA 3IP8A 1UADA 2JCYA 2MYTA 3BQ9A 4G56A 4CV2A 5HKKA 4M7RA 5IM4F 3U56A 4EABA 2FSHA 5AXCA 1XL1A 3DEAA 1NF3A 5FTKA 3UGJA 1V8PA 1M73E 4YP9A 3Q8XB 3AYXB 4RFVA 2LKCA 3JWPA 5CXSA 1FFEA 2HJWA 3HL0A 3SJCA 1PZXA 2QU7A 3EEBA 3IP9A 3DE6X 1R4ZA 2P3LA 4KIGA 2RGWA 3P2JA 1YK1A 1NX6A 4S05A 4JZYA 2LDXA 1I9CA 3HO6A 2DQYA 3E7DA 3L6UA 3T3PB 4EJSB 1H0HA 4R0NA 3ONDA 4U2DA 2X4DA 3AFHA 5REQA 3T9AA 3U0BA 3QIAA 3KYBA 4B3GA 5BXQC 1WG8A 2QV7A 1RRFA 2G83A 3UMJA 2CFOA 4EG4A 3VAZA 1U02A 1XAJA 4GSYA 1FDOA 1YOVB 4JYBA 4E11A 1G18A 1PQWA 5F5LA 2X76A 2E21A 1JHAA 2IXBA 1E3QA 1KDTA 1TZMA 2RC6A 1L4FA 3RPEA 1PD1A 3PDCA 1JFFA 1ZM4A 2R6HA 4EJSA 3DYIA 4BNDB 1U1FA 2HIHA 1VHDA 4QGFA 1A9YA 3P9CA 4KFTA 1WVMA 1DNPA 3ANLA 3ZU6A 2RE8A 3HLTA 5HUQA 3RTEA 1QIJA 1DKQA 5E3JA 3IULA 1U0HC 5FCDA 4ZDIA 1Z0IA 1FLDA 4XUGB 2D62A 3JALA 2VATA 1XKLA 4V1CI 2WMDA 2WJIA 1L5MA 1YU9A 1EJ2A 3PCXA 1E5VA 4M38A 4H15A 4O1IA 2JLSA 4INOA 1JHXA 2OSBA 1V7QA 4L5CA 1MXFA 3I9LA 2I1VB 6GPBA 3PC8A 1V9LA 4A36A 1Z2OX 2CXTA 2VDVE 3SQMA 3WNDA 1XCOA 5DNEA 3OEEA 3AERA 4RF3A 1X2EA 3JQCA 5EP2A 4V3BA 4C6TA 4RF2A 1VXOA 1MT3A 2OCGA 1USWA 1ONNA 4B80A 1J7KA 3ABIA 2H1LA 3UEOA 3VC3A 1L4YA 2NYAA 1N33B 3OOEA 2DWUA 4EA9A 4JJEA 4YPVA 4N3CA 1JXQA 2HR1A 1T29A 4HQ0A 3G2LA 1AHNA 2B1GA 3MGBA 3QMVA 2NZWA 3QPCA 1ESMA 4PX5A 3IMCA 4QOFA 3AX6A 4Z9YA 4A23A 1NQAO 1OZHA 3NCHA 1YJCA 1U8AA 5MHTA 2WAXA 1E6UA 4RF4A 2Q2QA 4Q5IA 3SK0A 1QIGA 3CR3C 4OLBA 3EDOA 5H02A 1XJQA 3OIDA 4NJMA 5AT1A 5DI3B 3KD3A 1NVVR 1P4AA 3BL6A 3MJHA 1RR6A 1V5GA 5AJXA 2AJTA 4I7EA 4ZAYA 3SY8A 2EL9A 4D80A 3QTTA 1CVRA 4YV1A 5JBNA 4LSGA 4QEZA 4EG3A 4MB2A 3SXJA 4E21A 4IGKA 5IKPA 1RZRD 1IATA 5E9QA 1AH2A 5HKKD 4F3KA 4JLKA 4JGBA 3HI6A 5DXJA 3SXUA 3U3OA 3RTGA 1GCGA 4EGFA 3MTEA 5BN3A 3FPCA 5FBQB 2XXBA 2O1SA 3OY7A 4YRTA 3NJRA 5ERGB 3SYRA 5JSFA 1NJ6A 3CN9A 1W2HA 3MAAC 5CT8A 2QPLA 4C05A 1V1MA 4BLPA 2IHZA 2V45A 4WEQA 3HA2A 2YINC 1Y8QA 2BM1A 3O3OB 4J0DA 4XWTA 5IC6A 1I14A 3JQ6A 5GJVC 1XEAA 2JI9A 2V9CA 5KNDH 2DB3A 2XXAA 1CTQA 3RSCA 3HKCB 1LDYA 2G09A 3DZGA 2WVHA 3H2JA 2AL7A 1A95A 1F1JA 1GG9A 4IQ8A 2HO4A 3IB3A 5KYGA 3CH6A 2X2OA 3CS3A 4IXWA 2ODWA 3FNQA 1A9SA 4R69A 3MJVA 4UVDA 4HRAA 1QYWA 1XQ1A 1NM5C 2C5LA 2J59A 2WSMA 2IC5A 3MT0A 2EKDA 1YGPA 1TAGA 4ROTA 1D07A 4FS3A 4I36A 4I50F 2QTWB 1LX7A 1M54A 3QU2A 4LV8B 2J31A 5EPEA 1RBMA 4C6HA 2P5YA 2DLNA 5KNCD 5BRAA 4KITB 3I9JA 3LGSA 3M5CA 1W48A 3KLNA 1T3SA 4DLTA 5LQSA 1LB1B 2HMTA 4WPGA 3TRIA 3FSGA 3DNPA 4OJYA 2FFAA 4BN5A 3LX5A 4EFKA 1HDZA 2QSUA 3CZ9A 3HSSA 1FVXA 4PR3A 4R2JA 5CVVA 3RSFA 1MX9A 2VH2A 5BWCA 1A5TA 2BHNA 3OAAA 2NO9A 5HIJA 5I9TA 5LKAA 1TO6A 4NU5A 3BVPA 1XQYA 3A0RB 3S5UA 2XSZD 3T52A 2X19A 1LTKA 3PXBA 1D2NA 2Q7XA 3D5TA 1ZEJA 1E2MA 1XVAA 1SUEA 2P77A 2Y1DA 3MGKA 2PL1A 5DGIA 2J7PA 5ECWA 4OY3A 4MUMA 1L5SA 3GF4A 421PA 4YUXA 1P9RA 1REQA 1E1QD 2IT1A 1OUMA 2Q1SA 2PUHA 2OD9A 3BGWA 3DR5A 3C41J 3UIEA 4OQ4A 3BF8A 1P7VA 1BKYA 4K9RA 3DKIA 4XAQA 1AQJA 1PHRA 3N53A 2PO5A 1OX4B 4JC5A 4ZC1A 5DBFA 4E2ZA 5IKXA 3I01M 4CMEA 2ID9A 3C7KA 1UKZA 1PJSA 4P3KA 1CUAA 2I6FA 2JFQA 3AYZB 4EFLA 4L08A 1NXSA 4FR5A 3W9BA 1S2IA 5IBRA 2NACA 4MS4B 1TEZA 1MC1A 2GBIA 3IDZA 4TM8A 4HYEA 2IYSA 1TM4E 4HN4B 3REQB 1BEZA 1XLTA 3T7AA 4ZREA 1HZZC 2V65A 4FGWA 1WDLA 1ZEMA 4IIJF 1VHLA 2A7QA 3L1HA 4IDFA 4U0KA 3Q8WA 4ED9A 4G0PA 1PFVA 2CJPA 5FBZA 3ITNA 4BOYA 4ZVLA 3AHDA 5TIIA 4RIGA 4QQ8A 3SIPA 4YAJA 1THGA 4C5CA 3JSAA 3PNSA 4LZJA 4DZZA 2BE9A 3V1TC 5TARA 3WTCA 2PIDA 1JIUA 1P0PA 3ZH2A 4BY9E 4RHCA 4LUCA 1G2IA 3PGXA 2G63A 1F0NA 4H7DA 2FWBA 1TCBA 4HUJA 1ZR4A 1QF6A 1QV6A 4Q3DA 5TVKA 1IUNA 3FUWA 3KJEA 1KRWA 1KYWA 2QP9X 5AM4A 4AN1A 1A8IA 1EK2A 3C48A 4XKJA 5J4VA 1ORTA 1HFJA 3RO7A 1AC5A 2JAOA 5ALTA 2PX2A 5G53C 4QEDA 1JRLA 3MJCA 3RS3A 3N2YA 4UREA 2FW7A 5EMNA 2QE7D 2NUTA 1XTKA 1H6AA 1S2LA 4REOA 2OO5A 4AYXA 4JV5B 2HXGA 3T99A 4Q3LA 3T0GA 4LWPA 3HDTA 3HDYA 2VDJA 1QV7A 5CD9A 3R9XB 4S35A 1I4DD 1CP2A 2PQ2A 3CEAA 2DJIA 3CF2A 3U3DA 5KDOA 3PWTA 4UMFA 1HNZB 1RNLA 2JD1A 3MFYA 4BE4A 4EP1A 5KTPA 1AIPA 2H8KA 5M7EA 1MA0A 3EOAI 4U3JB 2P3OA 5KOHB 4AS1A 3JZDA 2CKMA 2NUPB 4JYPA 4Y7DA 1N2CE 2WP0A 2NUTB 2QTRA 3ETGA 3I73A 4HB2A 4WACA 2XAAA 5DEIA 3THWB 2JDID 2OXTA 2DH6A 3AINA 3T1HB 4KXFB 4U2CA 3NWPA 3WADA 2I9KA 2EGUA 2ZIEA 3FI0A 4JJ7A 3A9RA 4LDJA 4RESA 4D4KA 1WQ1R 2W0MA 3L0CA 3MTQA 5FNVB 4AY5A 2E3JA 2QG6A 3KOUA 3KQLA 3UHOA 1P4JA 3EZNA 1C3VA 4IDNA 4D26A 4PFSA 4GWGA 3CLUC 1QH9A 1QJ4A 1O6CA 4IG4A 1OFGA 4DNOA 1E3WA 2BFCA 3BS4A 4F0JA 1W36D 5CJJA 2IEYA 4Q03A 5CFOA 1IN7A 3KYCB 3OM1A 4MUAA 3FYCA 4NCXA 4ZCTA 3H5AA 4W82A 2YC2C 1EWRA 1Z75A 4BKRA 3RLIA 2O6LA 3OP4A 3RYTC 4NFLA 3ZTYA 1YS2X 3R40A 2JLAA 1MX5A 2DQKA 2XCIA 4W4TA 3FZQA 5EWJA 4ZANA 3ZLUA 1LLUA 2E6UX 2Q2NA 1GDHA 3M9LA 3GHYA 1JEQA 1EHYA 1RQPA 4H7IA 3DPUA 4Z9BA 3KQUA 2BISA 5IJZA 3N2EA 1RFLA 1SHLA 1W4AA 4BAGA 1SKBA 1Y5LA 2M6KA 3T9FA 1JEYA 1Y80A 4KNVA 5D87A 3O7WA 2C9CA 3H5LA 3N86A 3U39A 3V7YA 2OV2A 3D5QA 5JUWA 1OIVA 2YXPX 2I6UA 4OYYA 3ZHYA 1B16A 2DH5A 1OPRA 3O83A 4FHZA 1N5DA 3O9ZA 4YJ3F 4LF6B 4RPGA 1L6RA 3MBKA 1GIAA 4JJKA 3VDQA 5HUJA 1PR4A 4GP9A 1L7EA 5JZOA 3W3AD 1HLDA 1N3BA 2B9VA 2C42A 4C0JA 3M81A 5H4HA 3HDJA 3DHYA 2WF5A 3M5DA 3WWOA 3SBOA 5DB4A 5BVHB 1L5FA 3H8WA 2GD2A 1UXKA 2FPIA 4NMMA 3HTXA 1RZVA 2XYHA 1MENA 2PMKA 2AKAB 2WIDA 2QR2A 2V1XA 2NT4A 4TVOA 2G1PA 2PUCA 2AYYA 2YHIA 4Q4AB 2P9FA 4RSRA 3ZXYA 2BY4A 3DXFA 4BVAA 1EE2A 4F06A 5CDUA 3CW2A 3RWMB 3WYBA 1AVTA 3RFFA 4CF7A 2WJWA 3KS9A 1JNXX 3RGWS 1KI4A 4IWNA 3F6SA 3EW7A 3ZPXA 5KNDA 2FPIB 3B6KA 2PGIA 5T3UA 1YTUA 1W1UA 2VHVA 1NVKA 3GRVA 2A0UA 4GP6A 4UZFA 5K6RA 3KZVA 1VDZA 4WI1A 1SPBS 3T5AA 2XR1A 4QVKA 4GAEA 1Z18A 4FS8A 4F5WA 4ZT5A 1NIJA 1ACMA 2PUEA 2A5FA 2Q0SA 4LEIA 4H1WA 2DOKA 1T3HA 4G5FA 4A7PA 5ICCA 3VAAA 5E1BA 2WVGA 3A4TA 2X9QA 4D0LB 1PZNA 4N65A 1AGRA 1J2UA 1XTQA 2G0AA 1Z3IX 2NVOA 3EZYA 1I32A 3N58A 2O23A 3A06A 2H1FA 1UBNA 3UOGA 3VUFA 1T91A 1E9AA 2JFUA 2Z0MA 3IUJA 1L5GB 1TLTA 2I7DA 4C4OA 3I42A 1E94E 1V48A 1Y5RA 1BMFA 3OICA 3LT4A 4H7HA 3B6JA 3VKVA 1PI3A 2XNKA 4YJDA 2DQZA 2F1HA 2NPIA 3EB9A 2GM3A 3ZV5A 3CSDA 4X93A 2IP4A 3GUHA 1N7HA 3NRJA 4ZVTA 5LCXA 4C7XA 4WADA 9GPBA 3M1YA 3ENQA 3P5BA 3BSWA 4MB0A 4AMBA 1MTZA 1SVKA 2ENUA 2W4IA 2CCGA 2WOOA 4FONA 5ALWA 1GPJA 1IIBA 3ZIUA 4F6CA 5AVZA 1BFKA 3QU4A 4ND8B 1I1OA 1V6CA 1ORHA 2A0WA 2YRFA 2WIKA 3A6ZA 3HS3A 4LWQA 4B7AA 1VCMA 4GKBA 1FQJA 3OE5A 5FI5A 2QY6A 4B09A 4ZJUA 1Z06A 1T2FA 3P94A 1A27A 2PMBA 4D46A 1Z4PX 4EATA 2EZ8A 3LQKA 4GBGA 2FVYA 5D51S 4ATNA 1QGYA 3WGIA 4RJIA 1XZNA 5DM70 4LYHA 4NXNB 2FW8A 1QBGA 4M0PA 5J2TF 2VZ8A 4YT2A 1P4HA 3NCTA 4KQHA 3FMVA 4C4YA 3FRIA 1EP3B 2FQXA 1N8SA 4F21A 5ALZA 1YQ9A 1XRRA 4B2IA 4BX8A 5AKZA 3SF0A 4ND4A 1F2UB 1C1XA 4B7ZA 4DLLA 2X6QA 1PSWA 3BHNA 3LW8A 2QOEA 3OCZA 3PYXA 2ZDHA 4X7MA 1TKCA 4KE7A 1RWPA 4QEKA 1G4HA 1BC5A 2XYGA 2QX8A 1JXOA 4OA8A 1A7KA 4E5YA 5A06A 3OM9A 1ZQ1A 3DV2A 1Y3AA 4KQCA 3AESA 5FBKA 1V11B 4JP3A 1GDTA 4C43A 2DXIA 2P40A 1HG1A 2YFHA 4RGYA 5JT1A 1XX6A 3V00A 1XD8A 1BO6A 1C2TA 1C8VB 1F5NA 1N6OA 2I76A 1UJCA 2OP1A 4JEMA 3K0BA 4N6NA 6AT1A 3LRXA 3NTOA 4UUNA 3WSVA 4H6PA 1R27A 2RGNA 3C7CB 4MV7A 3VH4A 3WQSB 2D1SA 2FPKA 3EXEA 4G01B 3I28A 4AKHA 1KYXA 1NJGA 1PJZA 1UMDA 3H4VA 1E3MA 1WMSA 3OEED 2GBPA 3TR0A 5G0SA 4ENWA 2QIPA 5F23A 1HQDA 4H1TA 4D9MA 1GITA 1T9CA 3N0TA 3Q7QA 3CZ4A 4JUBA 4HN2A 1CLUA 1LD3A 4JLJA 1KVUA 2HYIC 4ZJZA 3G02A 2WV7A 3SC2B 3ETHA 1TK2A 2H2IA 5F12A 3T7KA 1G55A 1VMDA 2W9XA 4WH0A 1X1SA 2ATIA 3R09A 3VZBA 2HBRA 5DHUA 3U60B 1YVEI 4G25A 4S1WA 5JARA 4G0WA 4DUGA 2ZUSA 5IC5A 4J43A 3TDNA 3T7JA 3ZE6A 2WYWA 3SQLA 4I6JA 3M5PA 2WJGA 3WBFA 1CFZA 2PKWA 4WD3A 3X2SA 5BY2A 4HG2A 4BUZA 1YZHA 4KKVA 3BEOA 1I2CA 2FZVA 3DE0X 2C58A 1QMPA 4YLEA 2Z5FA 1TO2E 2G3YA 3X1KA 2GCNA 2FY8A 3UN1A 4UVGA 3ZE7A 3DKPA 1EEHA 2OM6A 5CA0A 3MJFA 2NXCA 4MKRA 1OZGA 2WB4A 3UXHA 3KSRA 1E5DA 4EL0A 3N5CA 1LTQA 5KSWB 2NU9A 5IDVA 2ZVPX 3AV3A 3L6DA 4R2IA 3FB1A 4Y1RA 3UJ9A 4XCVA 3E9QA 5LP6C 1CF9A 2B35A 1JVNA 5K09A 1WB5A 2AF4C 4DAEA 1NVVQ 1TKRA 3H86A 2QTFA 2FGKA 4JLBA 4GPD1 1Z8NA 1NGSA 2NZ2A 3KNZA 4LYAA 5FR2A 1N6KA 4PGAA 5G1NA 5FI1B 5ILQA 3V4OA 1IY0A 4UXJA 5AI6A 3S2FA 1F8GA 2DETA 3EIUA 3AF5A 3UBMA 4JYCA 4C4XA 5GONA 2HCFA 2OCLA 2FRDC 4IDBA 3PEEA 3T95A 2QM7A 4PSCA 1VG1A 4PPFA 1UEJA 4MZDA 4PLGA 2PBRA 3DZ8A 3JSXA 4QRDA 5EINA 3PWSA 4XQGA 1NG1A 1P7CA 3G2IA 2VQSA 2QAGC 4D25A 2CNNA 2FE4A 1VMEA 2JIZA 4FOTA 1YR9A 4I1UA 4LJ9A 4MS3B 5ITVA 4ARIA 4Z8YA 3T41A 3SHTA 2O8DB 3ACCA 5EL0A 1SKMA 4QAJA 3ELDA 4LTDA 4RD3A 5FL7D 4JT9A 3VC7A 4BO6A 1U6JA 1E3EA 2ZAYA 4WASA 3RYIB 3GJQA 3K7EA 1K08A 2GPBA 2A67A 4Q1AA 4BAUA 4D9GA 1RQGA 2F2TA 3OF3A 4FUTA 4LPSA 2VHWA 1SXJB 4OKNA 1M66A 3FWNA 5FOXA 1D1PA 4ZVSA 1ILWA 2D06A 3NVAA 2VT7A 3KT6A 4KREA 4N8DA 4AMYA 2YYSA 2OO3A 3KTDA 1QO0D 2YRXA 4I9NA 2QV0A 1XMQB 2ORIA 4Z7NB 2D5IA 3MOSA 3VZSA 2JAQA 4ARUA 3D3KA 4TSKA 3LLUA 4C7OA 3RQSA 1NQOA 1DRVA 3CY6A 3P2OA 1XDBA 4HB4A 1KMQA 4QNRA 5FQOA 5BQ5A 4QUDA 2PD6A 3WYDA 4LDZA 4EHHA 7MDHA 3K53A 3TVDA 4EA7A 3TSAA 5CA1B 4I4NA 4O4HF 4LHZA 2WAMA 4C2TA 4A92A 3VNVA 1K5PA 3RYHA 4E5UA 3HB7A 1A69A 3JVDA 4RVFA 1XSEA 3L0ZA 4J6EA 1B2LA 4Q9HA 2B5WA 1FUYB 5CFRA 2QYTA 3FVQA 1BX0A 4U9UA 5L3VA 3V8NA 1DKPA 2PQ0A 3PIIA 2G25A 2G6TA 4UARA 4Y6RA 3DVRX 5F33A 8LDHA 5A0VA 1XKTA 1RKUA 3R5TA 3ZVLA 3RC2A 2C9ZA 4F5YA 2AR0A 1MQSA 4WK4B 3K0CA 2QR3A 3D31A 1O96A 2NPOA 4NE7A 1U7ZA 3GJXC 1CHDA 1XV5A 1BRMA 1DCKA 1W4CA 2GVDC 3QYPA 4GEKA 1UC4B 4AF8A 4DGSA 4DYDA 1KEUA 4M6WA 5LIRA 4C5AA 2BTEA 2JEYA 1UK8A 3F5QA 4K8RB 2R4TA 4DKJA 1WLYA 3MINA 2P4QA 2GEKA 4RHUA 5IYZA 1J21A 3L4BC 4EUNA 2EX1A 4H7PA 1RJFA 2PHZA 2RGUA 2XQJA 4Q7JB 3WGUA 3V2UA 5FOQA 4Y1GA 4YPFA 2CN1A 1XF1A 1D5WA 2AI2A 4RPIA 1SCJA 5K51A 5REQB 2A8YA 4GZMA 4Z53A 1QAMA 1IJFA 4B3BA 3QHAA 1SBYA 1A5ZA 1X8KA 1K3FA 3EAGA 4J9UE 3BGSA 3EULA 3ODGA 1F51E 4FJ2A 4CEIA 3A1SA 2ZQZA 4J0KA 4F04A 2DECA 2UYCA 1XZAA 2R65A 1SM4A 2WF7A 3F3SA 4F38A 1OVGA 2OHIA 3IBYA 3VNSA 4QRIA 1ZNXA 1S4MA 2WJ3A 3IIJA 2VDOB 1W34A 3TJRA 5C1PA 3P26A 4GW3A 1MF7A 5FPSA 4A15A 2FEMA 4KDEA 1E58A 3DPIA 4NZ9A 5GZ3A 4CM4A 3ZGZA 4NV3A 1E64A 1P44A 4KO4S 1XMVA 1EBUA 1P3JA 2YV3A 1QM5A 1FFGA 3IXQA 3OFVA 3FOAA 4RQAA 4L8LA 2BBOA 2C20A 1K27A 3LQ4A 4J94A 1E0KA 3OZCA 2IKQA 1Q92A 3B3AA 1P39A 3K16A 4D8TA 2ACEA 3NASA 3B1WA 7REQB 5GVSA 3JQ8B 4OP1A 1LA2A 4U2GA 2EP7A 1HM5A 3HRKA 4FXPA 4RADA 4EFDA 2NZUG 5IBCA 2BR5A 2PT7A 3PHLA 2HQOA 3R41A 2OMKA 1XC7A 3EWSA 4J03A 1QFXA 1T1RA 1OSNA 2A2ZA 4JT8A 5FORA 2QJOA 4XM1A 4YMVA 2Q2WA 1YHYA 3NHFA 4PPQA 4NBWA 1YZ3A 1D4AA 5G1OA 3WGYA 1L5KA 3SIXA 1XVVA 1ZICA 3OZ7A 1Z83A 3RRJA 4ESEA 1T0PA 2TRSB 5FA5A 3GY0A 1EP9A 2D0IA 2EHJA 2F3QA 4I1OA 4XSGA 2D8AA 5SZKB 1OV4A 2AW5A 2EG5A 2YVKA 1L7OA 3D6FA 4RQUA 3IOBA 2BF7A 2VXOA 3UY4A 3ZE0B 1VB3A 5DTJA 1U6KA 4GBED 1A82A 2YICA 4M9CA 4MXDA 4DIDA 1IQPA 4DA4A 4R68A 1JHDA 3CC8A 3FIJA 3ILYA 5MN6A 2JI8A 2BFAA 1N4AA 1QP7A 1NW8A 5DI3A 4QXMA 3CKYA 2B92A 3UOAB 1HKUA 2JLVA 5BN1A 5EGNA 2JIDA 3AEUA 1Z7GA 2V5VA 2IYPA 1CZUA 4YNBA 3NETA 1D7AA 4ESHA 1WCV1 4MRVA 1QRUA 4NCHA 5IWCA 2JVJA 5CXUA 2ZW9A 4PN7A 1UWLA 4CM3A 1UFVA 3IBFA 3H9CA 3T35A 3OE1A 4WZBA 5ALRA 5BN3B 2P9QA 5C7IO 1AMOA 2JFNA 2X1VA 4B2LA 3ANYB 3CCBA 5B1YA 4GE3A 1E4OA 3B85A 1SXHA 3LP5A 4IOLA 3AH8A 2R2AA 1G9XA 2ZRHA 3GAFA 3K9QO 5F2EA 4BNLA 1TFRA 4QZVA 4NXMB 1C0PA 4F8JA 4TN5A 5ICGA 4HI0E 1ESZA 2NSYA 4WLNA 4BVBA 3K0FB 4QYMA 5DLPA 2R8ZA 4XJVA 3HUDA 2NU6B 3TCKA 5JCXA 5KQLA 5CIWA 1DC3A 1Z5WA 2JANA 4Y0NA 5I4BA 5KTSA 1U1EA 2YX1A 3MCTA 4XX0A 3BQMB 4OUDA 3LK6A 4B0PA 4V2IA 5BOSB 1JAZA 2PL5A 5CH5A 3BKWA 3WMEA 1IMJA 3EUFA 4X9XA 3IB6A 3CRW1 1E2JA 2WNSA 4JEIA 4XYEA 2O2HA 1TT5A 3TLBA 2Z58A 3NBKA 4Q9DA 3ZWYA 2WABA 5KQSA 1I01A 2PUJA 3C3WA 1R0XA 1QHHB 2MYNA 4XTCS 5A4FS 2Q49A 3ABZA 1GZ4A 4WKGA 4FN4A 5FFFA 2QR5A 1RWMA 3KTAB 4DUZB 2J5QA 1AU9A 3DYBA 4IJKA 1KFKB 1L7QA 4V02A 4X24A 2HMUA 3OO0A 3KKLA 1GUFA 2V3VA 2AWOA 3IMEA 2P6OA 4IW3B 1M33A 4J0FA 3THRA 4RSHA 4BC0A 3EWNA 3HCRA 1GSAA 1XZBA 1MG0A 3RS5A 1EFLA 1T13A 3HLKA 1BMFD 5C1DA 1BEEA 4R2HA 1ZA1A 1IB6A 3HBFA 4R5MA 2JEOA 3F4LA 3KTAA 5CB6A 3C8UA 4WZAA 2J87A 3RV3A 4MS4A 3BH6A 3VXKA 2UZAA 3FTDA 4KB5A 2ZJ4A 3P0JA 1L5ZA 4EG5A 2PO7A 1DBPA 4HH4A 1WXGA 2VJNA 4II3A 3WWCA 1XTRA 1QXSA 3GFTA 2EGGA 3LSYA 1ZH4A 2C07A 5AKIA 4B9AA 4ISCA 5E1OA 3CJTA 4CV1A 1ZK4A 3VVCA 4IJMA 2RK6A 3CKLA 4M0DA 4DCMA 2GSWA 3WLFA 2PUDA 4O2BF 4C4AA 4EJ0A 1ZP6A 3P4XA 1QLHA 5GV7A 1D09A 1RM5A 2R8EA 2WUVA 4IH1A 3T1YB 3RYCA 1VYTA 4MV5A 4FZJA 1XMSA 2FVXA 3K05A 4U0JA 4ZAZA 1IXSB 2ODTX 4N47A 2QJWA 4IXDA 3RIGA 1DFGA 4MDEA 1NN0A 2I03A 3TW4A 2QRLA 4CKYA 3S6JA 3VUEA 4F4HA 3FPGA 1ZONA 2B78A 2DPHA 4DVJA 1G8JA 1U8ZA 1TYCA 2O3SA 3EQ9A 3LBFA 4X1KB 1XHFA 2PGNA 1B3BA 3PK0A 5JAHA 3AO0B 1OFIA 2AFRA 3HZOA 4IH4A 2FMFA 4DLVA 1Q2XA 2HQSA 4Q9KA 4Z51A 1XCJA 5L3SB 1DI0A 4DV2B 2QUKA 2OCKA 3SOZA 1IBMB 4R9VA 4O8ZA 4KAFA 4HAUA 1VL1A 1JHOA 2D5AA 4GI2A 1X9IA 5FJJA 4BNTA 1NC3A 1VI2A 1XJWA 1R5BA 3GT0A 4GVPA 1G7CA 1FXSA 1UK6A 5GAJA 5JDIC 3PEWA 4J3JA 4UHCA 2C7QA 1Q7TA 3MWGA 2V8OA 4OD0A 1GZ6A 2ZROA 3EC7A 5EEGA 1YACA 3EF0A 5BPFA 3D2LA 3EY4A 3FVVA 4F5DA 5EG5A 4NBUA 1WJGA 2ZCVA 1S8NA 1YS7A 3L7KA 5E1MA 3VVMA 2PH3A 4EYQA 1SXGA 1EQAA 3L4SO 2RFLA 4L8VA 4Y2XA 4D6PA 3ZHQA 3AG5A 2PUWA 1GPKA 1TW3A 2EEZA 3TJMA 4D9NA 4IMIB 3C5EA 3G0GA 1U0EA 1GUBA 5HQ3B 2D1TA 3B8EA 3OIGA 1QG6A 4PXYA 4WBNA 1X1CA 2G76A 3JQFA 1BVUA 3DMNA 2YS7A 3PDHA 3GLIB 3OWHA 1F5SA 2ERYA 1EFTA 2XDAA 3AEYA 4M0UA 3UJ3X 1JKXA 3RJ5A 2J0EA 1XVIA 2C8KA 3GDGA 4UTZA 4J3NA 5KREA 1IVYA 1BNCA 1CR1A 4EI2A 1UBSB 4NC9A 4Q1FA 5H82A 3SEAA 3WBJA 3FTNA 5JYDA 1YRQA 3ABOB 4PG6A 4W1SA 1YJAA 1SY7A 5E6UB 1W4ZA 3Q9NA 2WFMA 2EBFX 1MV8A 4O59O 5JD3A 3RG8A 3TPFA 821PA 3WLMA 5TRTA 5JSZA 2WIAA 3PA6A 3M2TA 4KE6A 1KJYA 2ECFA 4YEDA 5B1DA 3V97A 5DYYA 4EPRA 5AJWA 4PNZA 2PGJA 4A6XA 5JHGB 1K88A 5F3DA 5KYYB 1JEQB 1O6FA 1K98A 2PRKA 2FPPA 3WHLA 2JCVA 2XTJA 1FNMA 3OTGA 3OCWA 2UUAB 1FJGB 2NOAA 4P22A 3RS0A 4DCSA 4LCBA 4OXIA 3WYGA 1Y8QB 3GCGA 3EGWA 2YMPA 3GUCA 1VGRA 2WAOA 5E95A 3R5XA 4PFKA 1EFRD 1F4PA 1PZFA 1RXCA 1U8XX 1HXHA 2JJMA 1U4NA 2OM2A 1HT0A 1EFAA 1JDSA 1Z4OA 1MJFA 3WICA 3WFJA 1V6SA 3KX2A 4TKUB 4CN9A 3E3MA 1QRTA 1VPEA 1NMYA 1WWKA 2G4CA 3A70A 3O3CA 3GJ7A 3RF6A 1NJFA 2B36A 5BP7A 3IT2A 2E4XA 5KJFA 1EJ6A 1KY5A 3AOEA 4O29A 4OH1A 1CJUC 1VLLA 3QY0A 1XFAA 2IYLD 3G9ZA 4PAQA 4TXHA 3I1JA 3Q3IA 1Y98A 3G85A 5CNKA 3T9BA 2PEZA 1QDUA 2HH9A 3G0IA 4QC2A 4D56A 1DX6A 4MWTA 4EY6A 3ENWA 5F3WB 5HZMA 4Z7QB 1APBA 1FP7A 3K94A 1U2DC 2OGSA 2L69A 3AM5A 4UMDA 5ALMA 2BFEA 4AX4A 1CQIB 4G8JA 3QF4B 2ZIXA 5EE1A 5TQ2B 4BQNA 3AZPA 4L4ZA 4FW8A 3G59A 1P74A 1RPNA 3BTOA 2RBGA 2AQHA 3U19A 1PLLA 2GJSA 2XGSA 3GRPA 1DWQA 1UBHS 4EPVA 4Z8XA 3DBVO 4ARBA 1BMQA 1PGOA 1Z3CA 1B76A 3H3XA 5FP0A 3GZJA 4H7KA 4F6LA 3EMBA 4TTJA 1SG0A 3D3JA 1X38A 3HBMA 2ETVA 1RQXA 2CWDA 4QPDA 3B7PA 3KKZA 3H0KA 1YDEA 5F5NA 4E6EA 1KL7A 4MUNA 2CXOA 2FQQA 4PS1A 1ZIOA 1L1QA 3BPSA 1P7ZA 1W9HA 4RTLA 3UA3A 3JRXA 1Y3HA 5BNFA 1CE8A 1PFKA 3AWDA 3ET5A 3OT5A 5H3LA 1IWPB 5A7HA 3GLVA 2JAPA 3UPDA 3Q7PA 4DJTA 221PA 5CD1A 2BFFB 1UKAA 1E2KA 5B2EA 4G36A 1H9AA 3IVMA 1XCPA 2RH5A 4DA9A 2O2ZA 3NORA 4NK5A 1ZGZA 3MJEA 4Q82A 5DBHX 2VTVA 4FP9A 1P61B 3N39C 3NHYA 4KQ1A 4DLYA 3RBVA 3SHFA 2GAFA 1KSGA 2JGEA 3K8ZA 4UTVA 5EJ4A 4ML3A 3DF9A 3ZW8A 5I7OA 3WMWA 3NBXX 3UHAA 3PUWA 1W5TA 1B43A 3D8BA 5E7IA 2Q5EA 1XD2A 3CF0A 4ZARA 2NU8A 3UPTA 4XQ0A 1NKTA 3G2NA 1CIJA 3R8CA 3WLTA 2JGJA 4ECEA 2BMFA 5DHPA 3Q3EA 1IPFA 1DQRA 2R85A 2XKJE 2JFZA 4P5DA 3H5IA 1X74A 1KO7A 4ZQEA 1CY6A 2BUAA 3G2HA 1LQ2A 3U7RA 4AXBA 3ABRB 4EYKA 3G1TA 5JH7F 1ULUA 4B7UA 4G3XA 4HFMA 5AQ1A 3AR4A 1SQFA 1NRWA 2H4XA 2Q4EA 2W2NA 4PPYA 3TTUA 4A82A 1QUEA 2QQFA 4DMKA 1Y9DA 1V5EA 3EGIA 4V0LA 3EBOA