1QRDA

Quinone reductase/fad/cibacron blue/duroquinone complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
AVRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISRNDITGEPKDSENFQYPVESSLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLYWFGVPAILKGWFERVLVAGFAYTYATMYDKGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETVWEESPLYFAPSSLFDLNFQAGFLLKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUINONE-REDUCTASE
publication title The three-dimensional structure of NAD(P)H:quinone reductase, a flavoprotein involved in cancer chemoprotection and chemotherapy: mechanism of the two-electron reduction.
pubmed doi rcsb
molecule tags Quinone-reductase (cytosolic)
total genus 83
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qrdA00
2Q9UA 1WSWA 1V4BA 4HS4A 3R6WA 2BN4A 1RTTA 3FVWA 4Y9UA 2FAXA 4LTDA 2V5UA 3D7NA 4HEQA 1CZOA 1CZNA 2QMYA 3FW1A 3NHJA 4ZVMA 1CZUA 4U7GA 1I1OA 5F51A 4YAUA 4CETA 3JSXA 1CZHA 3OJWA 3W79A 5FUQA 3FJOA 4M0CA 3W7AA 1DXOA 4YAOA 1C7EA 3N3BC 2ARKA 1X77A 1QR2A 4FX2A 2MT9A 4GI5A 4D02A 1FLVA 1GG5A 5LLDA 2FOXA 3HR4A 3K1YA 4R81A 4YALA 2MWMA 2V5VA 4CF6A 1YCFA 3F6RA 5LBUA 1CZKA 1JA1A 4C14A 4PTZA 2BPOA 3NHRA 4QOIA 2FVXA 2F1OA 4QOGA 2BMVA 3S2YA 3FX2A 4C0XA 3NLLA 3NHWA 3SVLA 4GR9A 5A4KA 3NHKA 1XI2A 1TIKA 2QX9A 3OX3A 3ESXA 5FA6A 3ESZA 2QX4A 1XT6A 4DILA 5NLLA 1DX9A 3ZHOA 1AMOA 1CZLA 1OBOA 1SQSA 1AKWA 3NHSA 1FVXA 1FLDA 3N39C 3OJXA 2HNBA 2N1MA 3RPEA 1RCFA 1AKTA 2GSWA 3NHPA 4C0WA 2FZ5A 3P0RA 1C7FA 3F2VA 3NHYA 1T5BA 4LAFA 4FGKA 4H2DA 2FX2A 1FX1A 3TE7A 5F4BA 1RLJA 1F4PA 3LCMA 3W77A 1FLNA 1YCGA 2OHIA 4F8YA 4QOFA 2X2OA 3OX2A 5B3LA 1FUEA 3O2NA 1AZLA 5B3KA 3W78A 1XYYA 3NHLA 5LJIA 5ULLA 1J9GA 5LMCA 4OXXA 3U7RA 4QOEA 1YOBA 4DIKA 3FNIA 2AMJA 4XDHA 2W5UA 4ICIA 5TGZA 3QFCA 2QMZA 1J8QA 3B6KA 3NHUA 1J9EA 4YAFA 4ESEA 3TEMA 4U7FA 1DXQA 3GFRA 2XOEA 2Z98A 3F6SA 3K20A 3OWXA 2BF4A 3HA2A 4ZVNA 4N9QA 2ZKIA 4U7HA 1J9ZA 1CZRA 2X2PA 1BU5A 5NULA 4LTMA 4QOJA 1AG9A 5LVAA 3QFRA 2HNAA 4N82A 2Z9DA 1OFVA 1YCHA 2M6RA 1B1CA 3HLYA 4ZVKA 4GQIA 3EYWA 6NULA 5EA2A 3NHFA 1QHEA 3GAMA 1YKGA 1D04A 1VMEA 2Q62A 1OBVA 5FX2A 3LT5A 2MOKA 3ESYA 2XODA 2R96A 5LJLA 4H6PA 4YQEA 3F90A 1ZX1A 5EMNA 3ES9A 1ZWLA 3EDOA 5LBTA 2KQUA 3QE2A 2MTBA 1WSBA 2R97A 4LA4A 3G5MA 1YRHA 1QBGA 3KEGA 4YAWA 3KAQA 3N3AC 5JROA 3TZBA 1H66A 3GFQA 2B3DA 2BZSA 1FLAA 4S24A 4XDGA 1AKQA 3KLBA 1YDGA 2QX6A 2WC1A 2RG1A 4LTNA 1AKVA 2HPVA 1BVYF 1RLIA 4QOHA 4N65A 3L9XA 2D5IA 2V9CA 3B6IA 2Z9BA 4FGLA 2FZVA 2FLVA 3UXEA 4QODA 1D4AA 3OVMA 3U7IA 2OHJA 2OYSA 3L9WA 1KBQA 3OX1A 1FTGA 1TLLA 1AKUA 4NULA 1E5DA 1SG0A 2QR2A 1QRDA 2M6SA 5EAIA 1T0IA 3UXHA 3O73A 4NLLA 4J8PA 1AHNA 3KAPA 4C76A 4DY4A 3B6MA 1NNI1 1JA0A 4FGJA 1D03A 2QX8A 4PTYA 1KBOA 2A5LA 4Y7CA 1AKRA 4ZVLA 3NFRA 2QWXA 3OWHA 1XYVA 3GFSA 4Y9RA 2FDXA 2KLBA 1ZWKA 1H69A 4PU0A 3B6JA 2FCRA 2Z9CA 5F12A 2OHHA 4BMOB 5BUCA 4BMPB
chains in the Genus database with same CATH superfamily
2ZS7A 1ISGA 1TJPB 3KKOA 4ZZ2A 3GT4A 3DZFA 4N0PA 3QLUC 2GCIA 3RSCA 1IMOA 1WXHA 5DNUA 1XHEA 1NJ2A 3PKJA 4LY0A 4RE5A 3T9BA 4I5GA 1RIIA 2V55B 3DONA 3S7TA 4UAJA 3ZKAA 1DJNA 1JS1X 4Q66C 4XQ0A 1NXQA 1MXHA 2CWWA 5JADA 1SKMA 2OSVA 2I66A 4H1TA 3U7EB 2AZDA 4YT2A 4O1HA 3OG9A 1Z4IA 4WA8A 4IRMA 4Q7EA 3IURA 4V0RA 2XUPA 1TD1A 3RRFA 3W8NA 1RR6A 2P9FA 3BXPA 4KQJA 4RSHA 1OI2A 3WLTA 3BE4A 4OYLA 4XFJA 2R84A 4UD2A 3BN3A 4FW8A 2EZ8A 4M86A 5AHOA 3VDXA 4QLOA 1E3WB 3FW1A 1KZ9A 3KZCA 4MO9A 3RR2A 3LL4A 4TTJA 3V8VA 2NYAA 5JPDA 3EVEA 5D5PA 2NZUG 2C94A 2ZJFA 1WDMA 1GZ3A 4BAZA 1AGNA 1XAIA 2I7VA 1LI4A 2GFHA 1UFKA 3VR2D 4WZAE 2IY9A 2MYNA 2O3QA 4II7A 3NDJA 4Y6SA 3OJWA 3SR4A 4XUDA 1LC3A 5ALZA 3ORRA 4QBKA 1DT3A 3BAZA 4AK9A 3SC2B 3FZYA 1G7TA 3VKFA 4HGYA 1CDOA 1F2UA 4RK5A 2XOKA 4M0CA 2GD2A 4HG2A 4D6PA 1M6YA 2YWHA 4MHSA 4MCJA 1QAMA 2G28A 2VUIB 2IBSA 4GW3A 1KO5A 4YQFA 1Z38A 1U8ZA 4F4FA 5F23A 2V03A 4UBOA 3T8YA 3EA5A 3DKRA 4FEAA 4PY2A 3QNWA 1K8XB 2FR1A 3GPLA 3ZH9B 1JQLB 3LCUA 4L6CA 4Q6WA 4G5HA 2SHKA 1DUVG 4BJ3A 1FP2A 3CBQA 3COWA 3H2KA 4GI5A 4NOLA 1E7WA 4O2BB 2PKWA 1KO8A 4Q12A 4P5PA 4WN9A 2O0LA 4TROA 3TKAA 4PGAA 3HVKA 1SG9A 1NAHA 4DJDC 1Y8ZA 3VV3A 2QROA 4ZXFA 3RVNA 4MP3A 3FCYA 4JYCA 2QRQA 4MS3B 3AUXA 3NNSA 5C8YF 3HR4A 4KXXA 3EN0A 1R16A 2GB4A 1XLUA 5EKXA 1V95A 2B20A 1H2RS 5BWNA 2IPMA 5HVNA 5E38A 2BGGA 3ELDA 3FBWA 2V4ZA 4DJEC 3IKVA 3HZZA 5LBUA 1QK3A 1ULAA 3MRVA 4M8NE 1YVDA 4MW2A 1RLTA 2HU7A 2P6MA 5G4KB 3PHLA 3I5YA 1N2IA 2LXNA 3BWMA 2UXDB 2VDJA 2C9CA 1ZIYA 3IMEA 3NHRA 4OFBA 3TQFA 4BV8A 2DWCA 1NTRA 2F1OA 2Q5QA 2JIMA 3S55A 3H97A 5ESXA 2X0FA 2L0XA 4NZYA 4V0KA 3OD5A 1B42A 1SXIA 4R7GA 4B33A 1GCOA 3WGTA 5B57C 1X19A 3JV7A 4MVJE 3N2GB 4QATA 2NV2B 4JOBA 4LYFA 4OHBA 3O9ZA 2C5SA 3P9QA 4HAIA 3RU3A 2W6NA 3BHMA 2Q46A 4HDMB 3N2LA 2X0EA 2GM4A 3EVTA 5EE3A 5E6SB 4JBHA 5FT9A 2XAAA 4AJ2A 2VT2A 2GWHA 1DBQA 2MJLA 3FCUB 3I1YA 3NLLA 4HDSA 4LQCA 1D0IA 3GLGB 1ZD4A 4WY2A 2FI1A 4E1VA 2WPDA 4EFNA 3EZFA 4KO1S 1RKBA 4NQZA 1RJDA 1JU4A 1L0BA 4TV9A 3IOBA 3OE1A 2G70A 1KE2A 3T0GA 2VYVA 4EMBA 4QYWA 2ADOA 1Y6RA 4OTZA 1EB9A 4YP7A 3UH1A 1UDXA 3G9ZA 5JLAA 2IOFA 4BIMA 3MEQA 1AKNA 2KB0A 1UZAA 4I8IA 4GMGA 5FORA 4WXRA 4HTFB 2EWVA 4LV5B 5C1OA 5KHLB 2C7RA 4LV6A 1DWPA 3EGEA 3K4QA 4W8GA 1FNMA 2YNMC 4Q03A 3P9SA 2F1RA 1ISPA 3ZIAD 1F3LA 2BONA 4LK2A 3PLNA 2FP4A 4PSCA 4HPJB 5JVDB 1T3ZA 2X4GA 2GNAA 2G72A 2ZITA 4X20B 3EVAA 3LTEA 2YS6A 5FI5A 5NLLA 1OBOA 3WDSA 2AWOA 1KZHA 3ZHOA 2VJNA 2O6HA 4MR9A 1Z68A 3PICA 1QC5B 3X2SA 1C4KA 2FFHA 4H4CA 1PDOA 2GPJA 4OFZA 3N39C 4Z49A 1IJBA 3KZMA 1WPRA 2ZPTX 1JNYA 1RCFA 2HJ9A 2HJVA 4G67A 3RIGA 2ACKA 1ZGBA 3ZE8A 4D57A 1F8XA 3PL5A 1A88A 4BKQA 2ZBVA 4F71A 2YFQA 4U1RA 1MB0A 4DC9A 1NLZA 2R48A 3EW7A 3PUIA 4KIWA 4ZOLB 3RH0A 2WJJA 3WWZA 4C01A 1N9GB 4L8GA 5K5EA 4NBVA 2HB6A 5K0JA 1XVLA 3NWBA 1Y3CE 3WSVA 4M46A 4HUQA 4H2DA 5BXQC 1T15A 2ZIWB 2CHUA 3ZEAA 3RAFC 3VKUA 2A5FA 1DKMA 3G49A 3H1AA 4FEYA 1V9LA 5L4SA 3IERA 5HF6A 3HKCB 3I09A 2QAJA 3W5BA 1K6XA 4YMIA 3VPSA 1HNZB 4PSDA 1QLJA 2IX9A 3VZCA 1AXGA 3KNZA 4LJKA 3AFGA 3K94A 3DTVA 4JR0A 1T26A 3OIGA 3UFXB 2F90A 3HV2A 3IE0A 3ONVA 2ZLBA 3DEJA 4DAOA 1ZMOA 4L8LA 1F2TA 2G5TA 3JYNA 1BS1A 3Q1LA 3QBDA 4UFNA 1M72A 3K0FA 3VYTB 2W2LD 5KYNA 1P1KA 4K9PA 2VWHA 1FF9A 3DZGA 4L4RA 4J16A 2R8OA 4RMJA 4DIDA 2XCQA 4YH1A 1GZ4A 2VKQA 3K6JA 3OF3A 5D5HA 2WG0A 2YN0A 5DK6A 4EVRA 3GLGA 3F6PA 3EGDB 4WQMA 1SXJA 4PBRA 3HHPA 2M98A 4FD3A 1CUXA 3P9CA 1IG0A 4CNBA 1T9ZA 4MCIA 3T9FA 1Z47A 2VT3A 4IG4A 5A62A 3W5UA 4RJ2A 4DQXA 4FZRA 3SJBA 4OHKA 3S5JA 2X8JB 4TTQA 3D0KA 2FWRA 4GRIA 3KR9A 2DUWA 3JQ7B 4ZPXA 5BR8B 5FOVA 2ATEA 1NIJA 3ZGZA 2PH1A 1LX7A 1O6CA 1ODLA 1BEUB 3EQ7A 3GXOA 3I8SA 3OPYA 1II0A 1PS9A 1O87A 4O2RA 3DZ8A 1PFVA 1FQKA 4BN0A 2B1GA 5E7QA 4B3HA 2PGJA 4I5DA 4D99A 2Q7XA 5G4LA 1JQ3A 2FXVA 4WVFA 2ZIFA 4U9HS 4ISCA 2H9AA 2P6OA 2J0SA 1J8QA 2A2ZA 3FZGA 3STVA 3W2FA 1AKMA 1P45A 1Q1QA 3IMKA 3PHIA 2DFKB 1IDOA 4KLZA 1Z45A 1PR3A 3LAWA 3ZGNA 1R4NB 1M2OA 4CLRA 2VPZA 2OD7A 1WNTA 2CB0A 3CRMA 3O0TA 3TGPA 1OPXA 3U31A 1JG1A 4FFNA 2Y0DA 3B51X 3N76A 4NR0A 2VTBB 2W6JA 3T9CA 1E2GA 4JFAA 4DCTA 4R0NA 1JFRA 1ZJYA 1LUAA 2FN3A 2PKXA 2HXYA 4O4LF 4GX5A 1H0SA 1FDUA 3IOEA 3E2MA 5FI3A 3T1VA 1W73A 2IJGX 2WKQA 1UMDB 2QVZX 4TLMB 3WYGA 5IBRA 4WEQA 3AP3A 2BI7A 2HHCA 2FN9A 1XWWA 4LDZA 4LNUA 2X8WA 1QO7A 1SBYA 1YZGA 3B82A 5IG2A 1GQRA 1AHIA 4CTJA 3KQWA 2C7VA 1K4MA 5THQA 4EZBA 1RU3A 5FWAA 5LKAA 4KSCA 1FTYA 2H2AA 1Y3DE 3WZLA 3AM5A 1W4RA 3GG2A 3H13A 3LXMA 2B2CA 4KPFC 2WUGA 2YVUA 1GUAA 2M6RA 3QG5A 4P4TA 3GPDG 1UINA 3HLYA 3HZHA 2AQKA 4JZYA 4ZVKA 2D00A 2IOFK 1JIIA 3BJIC 5EUCA 4ZC1A 1STOA 3HKEA 5FEMA 3GOHA 1QO9A 3CX4A 3IODA 5T6BA 3VAZA 4CZ2A 3CUUA 2PT6A 3DMTC 1M0TA 2M1XA 4KWIA 1GQSA 4MUHA 5GPBA 4PSVA 4RQBA 4E2FA 4JQOA 4B6GA 2HR1A 1AQUA 3B36A 3HHEA 2H9YA 2FCAA 3OHSX 3U44B 3ICVA 4J7XA 3K70B 2QLJA 1T2CA 1ZDMA 4AG3A 3FAZA 1KEWA 1JSXA 3QPVA 3QVVA 5IS2A 4X6YA 2D54A 4Z1MD 1GZ7A 3K53A 3I76A 3AHEA 5JDIC 4HB4A 4BMVA 3EFBA 3KSDO 3MBIA 2AHRA 2IHZA 4X8HA 4YHHB 4DLRA 4I9GA 1M2KA 1HE2A 1CUIA 5KWVA 2C0PA 1HLPA 3H8JA 2AYYA 2PKCA 2R96A 3FSRA 3FYCA 1ICEA 4OQXA 4P1ZA 1SBTA 4GR5A 1USUA 3EXG1 4DSOA 2KWIA 3BD8A 3F90A 1GPKA 3WTBA 1JILA 4GNKA 1AZWA 4CKEB 1OAKA 3NASA 1M1NB 1OAAA 3KKQA 4LXXA 4Q05A 1QYIA 1LJLA 3QKSB 4OBBA 3QX3A 4X7PA 2X2FA 1O96A 1MOZA 5GM1A 4L95C 1VJGA 2LIPA 2XE7A 4RZIA 5C8XA 5DCYA 2OBYA 1JWLA 3IQFA 1CEQA 1L4YA 1CSEE 4S05A 3L4KA 4QYXA 3TF5A 1UC5B 4F7WA 1LFAA 3PJFA 1P29A 3ESRA 1PSDA 1NW6A 4KBGA 4LSWA 3SSOA 5F9FA 4C0LA 3OCJA 2ZRMA 2CLHB 3IALA 4NU0A 3VU9B 3CF0A 5LQNA 1CW2B 2H4XA 3F7MA 3DKVA 3BULA 2JCVA 4JENA 1P9LA 3RBVA 2WA1A 5DHTA 4B75A 3D3NA 2ZRPA 1X7WB 5FPQA 4JUIA 2X8BA 1QB8A 2G4LA 2CXXA 3HBFA 1ZD9A 3UQZA 2CMGA 2PMWB 1LB1B 2BZSA 2QUJA 3QE4A 1PNRA 1FYVA 2YMPA 3CW9A 1NBAA 3EMDA 4ZYYA 4R1LA 2VUSA 2HCBA 3GJTA 5CM8B 3GJYA 5LPNA 1Z08A 4ID9A 2B5VA 3WNBA 1V3TA 2YRXA 4DMGA 4OIFA 4YMLA 2P9TA 5M29A 3C41J 3K9LA 1UZLA 1WWKA 2C83A 3RBXA 4X5OA 1KFBB 3CG0A 1YZKA 1U0FA 4DA0A 4DA6A 2CUNA 1K63A 4FX5A 1I4EB 1OTHA 2XUGA 4JP2A 4J1TC 5ANRB 2WIKA 2SECE 2V5AA 3VNQA 5GIOE 1M33A 5FPYA 5TQ2B 2Q4TA 1JX6A 2JATA 3OQPA 4MJ3A 3VR4H 5CD1A 3PEYA 3VKHA 1N2HA 4KIGA 2NW6A 3ZY5A 2R79A 1E18A 3N8IA 2C54A 2DERA 4MMYB 2HREA 2VHXA 1Z3IX 2RH8A 1YH3A 3A0RB 1CTQA 1GFSA 1PTJC 2R60A 4LGMA 4DV4B 5KWSA 2ZJAA 4DV6B 1MUUA 1P6QA 3N7UA 4CM3A 4RTKA 3LTNC 2XUQA 3CLTC 2FJUA 1IQRA 2RK3A 4LY6A 5AOAA 1LQ2A 2AXQA 5K3EA 1TLLA 2ZDQA 1VJ0A 3EIWA 1UQUA 1AKUA 4GD3Q 4NX2A 1FTWA 1WW2A 2VJPA 3D9QX 4RD1A 2PA0A 5DIZA 2AMFA 2QIOA 1FP7A 4Z4EA 2OCAA 1P7YA 5EKDA 4I3FA 4OSEA 2GOYA 1VHLA 2AS0A 2QDKA 2V9PA 3QV2A 2TRSB 3O73A 3T3GA 4WKOA 3ZTTA 1HG1A 4ZI7A 1ULUA 4WAUA 2BKXA 3G5UA 3I37X 2AN1A 2UUBB 3DC7A 4R5MA 4G26A 3EDCA 1I2BA 4AKTA 4LY9A 3RTCA 3UTDA 5TIIA 4KVGA 4WOBA 1BO6A 1T10A 4NJMA 2IS4A 1DO8A 1RLOA 1ORIA 1D03A 1PGPA 3QZUA 3B5EA 1GGKA 1EB8A 2H65A 4LC9A 1A9QA 1NQWA 2MMGA 3PF8A 4MCHA 1AA6A 1CX9B 1Z0AA 2RCNA 2VUHB 3PQ5A 4D4JA 5A2GA 3HBJA 4K6KA 4GZMA 5BN1A 2OCYC 4KQMA 3PNOA 2O2JA 3QNUA 3EF1A 3D4NA 1HT0A 3N7AA 3DL7A 3ZEIA 1EVKA 1A1VA 2FPSA 3FHOA 1FDOA 4YCJA 1OZGA 1SMKA 2I99A 5JAIA 1AKRA 1MLDA 2IKSA 4ZVLA 4FOLA 4X24A 4M21A 1GYPA 2C82A 1V1RB 3QG1A 3IUJA 3KAKA 2PNFA 4HD8A 4WBXC 5DOZA 5ADHA 4LF9B 1T4GA 1AUXA 2AL7A 3FSGA 1Y42X 1E3DA 1ORVA 2H31A 2Z1DA 1PYDA 4LRYA 4OGLA 5TX7A 3SZOA 4ZVOA 4ZYTA 1N9ZA 2JH8A 2VAMA 2GPYA 2Q0QA 4XRRA 3QHPA 2COUA 5ETJA 3TX2A 4E33A 3URMA 3ZJUA 4FYPA 4KQIA 1V9SA 2AC4A 2QY9A 1AB6A 1VLZA 2FW1A 3CWZA 3INYA 4CT0A 1KRXA 1Y4UA 2X9GA 4M8SA 5AVJA 1L7XA 2JGEA 3FFXA 4JA2A 1PX2A 1DADA 1U9IC 3BGVA 1M5UA 2EP8A 2OCGA 3GUCA 2VTEA 4Q4CA 1QV7A 4WZBE 2QLNA 4RZUA 1FQOA 5DN9A 3TDNA 1ADCA 4PC3A 1Y7LA 4AO6A 1GFIA 2ERYA 2OUIA 1N9KA 4M9UA 3L4BC 3FCCA 5FAKA 3VR5H 1G4UR 4HN2A 4MUXA 1RTTA 3HB7A 4DR4B 1C8LA 5M2QA 2OXRA 3SJUA 3ZV5A 2OCBA 4HGOA 4BWVA 3GCWA 1EXNA 5TEWA 2Z5VA 2DZDA 5B1HA 2HBYA 1E89A 3W06A 3M6LA 2GXUA 3Q0IA 1HE5A 4FT2A 2YS7A 4IICA 1P9NA 4J4HA 3PQ3A 2GEJA 4UBNA 1TMOA 5JAQA 4E4RA 3X2EA 2VZLA 4DRYA 4QICA 2Z2JA 1P0IA 5JCJA 4CCAA 4ZALA 5JATA 3CE9A 2HSDA 4EYSA 4RLHA 5IJ9B 3K0AA 3PGXA 1A50B 1Q7GA 2VDMB 5AKYA 3WNVA 3BXZA 3KM0A 4BTEA 3C6KA 3OA2A 2C77A 1KEPA 4B5LA 1Z8NA 1DC3A 3P1JA 3ST7A 1T5DX 2Q2OA 1YGYA 3D4PA 3GJRA 3EY9A 3LI2A 1BAPA 1XDZA 1EUDB 1VE9A 3N59A 2A1IA 4GXRA 2YIJA 3NT5A 2JJ2D 1QRSA 2XDQA 5EJ8A 4MOWA 1FVFA 2MINA 3MN1A 1JDTA 3H04A 3ISJA 1U0GA 1VE6A 1OMOA 2TMYA 4CETA 2JIZD 1TRHA 3O7WA 4BATA 3A3PA 2XQFA 3A70A 1B0ZA 4NY1A 3T3MB 3WWCA 4ENTA 3VC2A 2DLCX 3KU1A 4QDJA 4AB1A 4B2LA 5EIXA 3FMFA 2G0NA 1V8BA 2XQKA 1JMVA 5AM5A 3OCCA 1GD1O 1E4EA 3HB1A 5J58A 1L4FA 3AILA 2K4MA 4IDFA 4LRXA 4BVJA 5KVSA 3O8RA 1LC0A 1HE4A 2BGLA 4LNAA 2P78A 4NYIQ 4C3VA 2VP5A 4BVKA 4YAOA 4XWYA 1XE3A 3OOEA 4RHCA 2I9PA 3QEOA 2XCSB 3WY9A 4B3JA 4E5MA 1P18A 1Z2OX 2JEYA 1K9SA 2Y1DA 4LXIA 1CDEA 1IK4A 2Z3WA 2JZOA 4BJ5A 5EIHA 2ZRKA 2R1UA 1WM1A 2AN3A 3FROA 4F7DA 4YCMA 3ITDA 4EPVA 5LLDA 4YMHA 5SYNA 4Q1VA 1ZY2A 2QMEA 2C3MA 5P21A 3NEJA 4U9IS 3ILYA 2WILA 2Y4NA 3EHDA 3O8QA 1H05A 1XRLA 2WLTA 3R0XA 4DJTA 1T1EA 3OIVA 2V7QD 3QVKA 2ZANA 4XGQA 5I9MA 1VLQA 4PG7A 4UNSA 1M1YA 1N1EA 3E58A 4Q3EA 2L69A 3GZNB 2P75A 1KQOA 1VE3A 2Y92A 2BPOA 2PX2A 3IBGA 3P9PA 5G53C 4B43A 4C4ZA 1WBDA 4ZIRB 3Q3GE 4H1UA 1M54A 3QVOA 2FK8A 4WK0B 3KG2A 1U1IA 3Q2IA 4Q7KA 3D5QA 4ZMSA 1Q0QA 1BS9A 1XXLA 4UM9B 1WB6A 1J90A 3BIOA 3TFQA 1KFEB 4YONB 2VDKB 3D1VA 3U26A 2YXLA 2ZTLA 3LQQA 3NAMA 4RK0A 1WSDA 4QPCA 2Q0HA 3CLKA 2Q45A 5JSUA 4Q9DA 4C6TA 2BMVA 2R6GA 3KTFA 1KDYA 3OO1A 1KS9A 1E4YA 4L3OA 1DCFA 4GP9A 3OPVA 1KDOA 4AS2A 4R2WA 5A4AA 1L3BA 1QFYA 2DFVA 3AEQB 1GLVA 3K1ZA 2OOSA 4K9DA 5FUMA 2MCFA 1KEUA 1OZAA 3NHWA 1E1LA 2OZLB 2D1RA 4MVJP 5P8WA 1VGQA 3ITEA 1NW4A 2GO7A 1VIAA 4XB2A 1ZBDA 4UPDA 4WGFA 3ROTA 1ZU5A 2GLUA 2W90A 1QWOA 3QBTA 2HJRA 4MA5A 4N3GA 5A4KA 5BV2P 5J2UF 3K70D 3DHEA 5K8CA 5AVRA 3G2OA 1KQ3A 1M34E 1SHTX 3LX4A 3QJ5A 4MYSA 5JZOA 1HZJA 1DINA 1P91A 4O63O 4H7KA 4JBLA 4MI1A 1T1RA 1WD7A 2WSBA 4WXHA 3UWDA 5K0SA 1NURA 2MSLA 5I9NA 1HKUA 1HMPA 4UFOA 1EG2A 4EQ6B 5JV5A 3RYCB 1Z0IA 1NJ1A 1ZK3A 3BCSA 3S1AB 2QX4A 3ZW8A 2R1VB 1RI4A 3VR6H 4W7HA 2B82A 1U7OA 1E3MA 4V0OA 4BX9A 3RRJA 1C0PA 2IQIA 5FOSA 1HDRA 2RSLA 4B3DA 4YJ3F 3CZCA 3GT0A 4PYMA 5KAPA 4A2CA 1Q1BA 4A6DA 4FBGA 1MIOA 1IN5A 1QTQA 3ZE2B 1NATA 2IKQA 2LCFA 5G1OA 4AJLA 3ADDA 3NTQA 4JJ6A 1XRPA 1ZK2A 4ME6A 5ELLA 3PHBE 1AKTA 4RPGA 3MNFA 2HV9A 1H65A 4O4JA 3DTYA 4C0WA 5HUQA 1W4LA 3I30X 3D8UA 3AI2A 5FOWA 1GAJA 2A5DA 1XJCA 1SUWA 5FULA 2HY7A 3AR6A 1ZRSA 2A3RA 4O33A 4GUDA 5JECA 1KEKA 3C6MA 2WT4A 1SK8A 2BFMA 2WTEA 4EKEA 1B8NA 5TQ0B 5H68A 3OZRA 3R2JA 3I83A 3M1LA 1TVEA 4L15A 4X91A 3VX3A 2X3YA 2VR1A 3WLEA 3GNTA 2GN9A 4PYJA 3VSAA 3ONWA 5GQSA 5JHGB 5JJIA 3M70A 4O2AF 1W25A 4NNJA 3H9CA 1UZUA 1XRQA 1G0OA 1WR8A 1YS7A 3LCVB 4RY2A 3X1YA 1CUEA 1VC2A 3DBRA 2QU7A 1FCJA 5F4ZA 1P77A 5CB8A 2WFLB 1Q7EA 2W8BA 3T5AA 2BH9A 4Q01A 3CSUA 3RJMA 4FCVA 3L8GA 4OQNA 1MZPA 5DCLA 4B44A 2ZPAA 2VSFA 3INNA 3K1JA 3QPBA 4E1BA 1XYYA 1C9JA 3E5HA 3QEMB 3TFWA 2P35A 1L8AA 1ADBA 1U80A 2R3SA 2FRDA 4K8OA 4EYOA 4HNVA 5LJIA 3CVUA 5LMUB 1BROA 3BF7A 3HU2A 1W34A 4B35A 2C61A 4GG1A 3AR9A 5A9RA 4QOEA 4DUZB 4AZSA 3LDGA 2C4UA 4UBMA 2VLIA 4ZK2A 3FRJA 3BFPA 1U2RA 2BUCA 3FNIA 2IZ0A 2QLTA 4LJYA 3GJ3A 2RHOA 1ZEMA 2WIGA 3QIVA 4RQUA 3CEPB 1BMFA 3ADPA 2JFNA 2RGNC 1T36B 2CNLA 4RF2A 2CXRA 4FYXA 3BCRA 2BBOA 3C8HA 1NKVA 1T6XA 1ZGZA 2XYPA 2H5JA 2CMKA 4MAMA 4OJYA 4IMJB 4TTAA 4YAFA 5LZ4A 3JYHA 2OB1A 1HEIA 3HRHA 5CT9A 2CDCA 1BD3A 2YASA 1J24A 2B1QA 1ORTA 1TO6A 1T0JB 2EDAA 4BNDB 3KQPA 1TTPB 1BH2A 2ID8A 1XX6A 5BUZA 1A5TA 1EWTA 2B8NA 3HA7A 1SZDA 5EVJA 5IAGA 5CDFE 5DNWA 5JLJA 3RKRA 4IHQA 4LJ7A 3G8YA 5E2AA 2P2GA 1R27A 3EA0A 2PS9A 4X1KA 3D59A 5JJKA 2F48A 2X0NA 4ZVNA 3M6WA 3I0MA 4KHPB 1CVRA 1PGQA 3A9TA 3BRSA 1D6NA 2NUPA 2RAFA 2X2PA 4RD2A 2WHPB 3WYNA 4EZEA 3T1OA 5H83A 5LZ7A 3GLFA 5GONA 4L0DA 4XUGB 5H02A 4ZYXA 1AO3A 5EZ6B 5HP4A 2OFOA 1IY1A 3CZAA 1R0LA 4IWNA 2GXQA 1N0WA 2IYUA 3HYCA 4RXTA 4EYEA 4FNAA 1AH2A 4V0NA 5HQTA 1H2HA 1WCYA 2PL9A 2Y1WA 1CB0A 1TYCA 3B70A 4EY7A 2YV4A 3B1FA 5DLPA 2GMWA 3RYIB 1J70A 1V7QA 1LF0A 1B6SA 1MV8A 1H6AA 4NK5A 2OMEA 2QQ5A 2O2HA 2BFAA 3EGIA 2Q3EA 4KQ9A 4C0SA 2FZ4A 4DAEA 7YASA 3OLCX 1JKJB 3ORYA 2JBAB 3DQPA 2OZPA 2QS9A 1XVIA 2H51A 3EVCA 1AOXA 4JT2A 4OKSA 1INLA 1Q91A 1Y4SA 4LYDA 5CX1B 3U3MA 2VXCA 3WIUA 4BAGA 4DNQA 3PNSA 3ICWA 4O4HB 1D0SA 3MOIA 1GTMA 1E1QD 4Z4CA 5LLTA 4XOUA 4DG8A 4R8VA 2ZI7A 4F2PA 2YQZA 5CB4B 3ELUA 4MITA 3VISA 3SNKA 5JJCA 4AQ7A 2GJ8A 3O4RA 3PC3A 4RNDB 3ZS8A 5C35A 2HPHA 1CVIA 2P9ZA 1F2VA 1ULSA 4GDMA 3EDMA 1CYEA 2ST1A 3O4VA 1LPSA 1SXJD 1YMQA 1DARA 3H3XA 4NONA 1G5HA 1ADJA 1AT1A 2J9RA 3CUYA 4XTRA 2AFHA 2QDXA 2R6CA 3WMRA 1HDZA 4OP2A 2QG4A 3R7AA 2ZXUA 4FIZA 1IEXA 4CN8A 2HBZA 1ZWLA 8OHMA 4J1QA 4GVPA 4BEJA 1JFTA 1WCWA 1X80B 2FPGB 3RJ9A 1DI0A 3MELA 3BVPA 2WDPA 3BHNA 2ZRQA 2MTBA 3DDWA 3QVSA 4FC6A 4QDTA 4DBLC 2ONCA 2NZVG 2I67A 4FZVA 2OO3A 5JNLA 4YDHB 1JIVA 1RYHA 2Z4RA 1NI4A 3WFZA 2FGKA 1Y1SA 3GEEA 1LVHA 2VJMA 2P4QA 3GAAA 4G8CA 1H42A 4PRZA 4NFLA 1GVNB 4WY8A 2JLRA 2JJ8A 3CPHA 3AR2A 4TV8B 4UHCA 3U39A 2PMFA 3CINA 3HBLA 4H3SA 2FSGA 1NRJB 3R3HA 3E7FA 3TLZA 4DDUA 2DTEA 1KXZA 4Q1AA 3MUFA 4G0OA 2BFBA 3GZ4A 2XA2A 4IRUB 1N0IA 4QTYA 1CEEA 1BCRB 5LB4A 1FFCA 4PHGA 1KFJB 3OLQA 3U40A 3LXUX 3C97A 4N18A 2GESA 2ATXA 2PT9A 1E6EA 5H82A 4WJZA 3ICOA 2IXAA 1QF7A 4JNKA 3RUDA 2BH2A 2Y0BA 1TF2A 5ALSA 3WDMA 3AX6A 5EE9A 3UWMA 1IONA 3WLNA 4ND5A 4CL3A 2WIJA 5CNIA 2PU7A 5AI5A 2FFRA 4JYMA 1AGYA 2HNKA 2I34A 3UW3A 2I3GA 2NSHA 4R2HA 1LDGA 1E3LA 4DY6A 4YCLA 2I4LA 1BVYF 3QU7A 1N92A 3W4KA 4H0CA 4K9RA 3FSJX 4DFDA 1VPWA 3LUPA 5HKAA 1R8SA 1W6RA 1FP4B 4CKWA 4RANA 5EZQA 4HRAA 4BJHB 3WB9A 3SU8A 1SULA 3HJRA 3AJEA 3KV1A 4CKCA 4RZQA 5TVKA 1QFJA 1P39A 3UM9A 3P9RA 5ICCA 2JD0A 3L0ZA 2WHEA 4XLZA 3CLSD 3HL4A 4DLYA 5K0FA 3JTMA 1QQ5A 4KK4A 2PX5A 5LP6F 2IH2A 3EXAA 1K8YB 1U31A 3OQIA 4ZI5A 1F6WA 2D2EA 1UXIA 1X86B 2CJYA 3G5AA 3VPGA 4B2IA 2B61A 4EAAA 3LNTA 1SUFA 2NNWB 2UXBB 2YC2C 1FTNA 4IGFA 3B6ZA 5SZIA 1IOVA 4WOPA 4CW7A 3QYJA 3EAFA 5HF9A 1L5WA 2QN3A 4H7IA 5REQB 1QRDA 2D1SA 2FEOA 3EG5A 1TC1A 1S4QA 3OMLA 4F4HA 1JVSA 1DG9A 4UM9D 1JECA 4U5XA 1KAMA 5FJIA 3I2HA 3GUYA 1XPJA 2WIBA 1YRLA 2BDEA 1PU2A 5BT8A 3SIWA 4RYLA 5CIWA 3MXTA 1NQUA 3V4FA 4JC8A 1KDRA 3T6KA 3HO6A 5TS2A 3EZ7A 3OLZA 1RFLA 3BFXA 3QTTA 7MDHA 2AVNA 3GVHA 3RSLA 3ELWA 4EKIA 1UIMA 4HEA6 5LP6C 1AHHA 3JZFA 4WD3A 5D01A 4GI7A 1TJ4A 2Q6TA 3NTXA 4YV7A 4OQPA 2X1MA 2BMFA 4QYIB 1XL0A 2DE0X 3O5AA 4C4XA 1AA9A 3ODGA 4TRJA 1QDLB 4RY0A 1C7QA 2I6UA 2TYSB 2X0JA 4OD0A 1BJRE 5JH7A 1D5WA 4BX3A 4DZTA 5CGQB 3LUAA 2VDNB 3I9JA 2I55A 2QNRA 3QXJA 4R16A 5JD5A 1OAOA 2CUKA 3VPBA 4LDNA 1SWWA 1XYVA 4OEHA 4P3YA 4R3UC 4XPIA 5ER9A 1Y6FA 1Z0UA 5SZHB 1Z2CA 2WB2A 4MW4A 4IFIA 5GM2A 1TZKA 1YAHA 1UK9A 2EFGA 3NIFB 4XB6B 3MYYA 4N7BA 4E3WA 4G4SP 3ACDA 4M1TA 4W8OA 2OQVA 3G8BA 4O8ZA 3G1TA 3EIXA 5HXAA 2NP7A 2I3BA 1MRZA 1O3YA 4JI2B 1MO6A 3RQSA 2F00A 2CNBA 3PT5A 2B94A 4X66B 1XJQA 3H83A 2JB9A 4BZWA 3OM1A 1ADYA 3VBCA 1AUQA 1IOWA 1NVKA 4PLVA 5DK4A 2Z2ZA 1YASA 3R3WA 3ZXYA 1Y1QA 2HMTA 1JLLB 3P2OA 1J0CA 3OOJA 4JHXA 4EW3A 5CA1B 1U2GC 1MOQA 4O4IA 4WCVA 2Y76A 2ZCVA 3G68A 4GX0A 4KUHA 4PV7A 5K8JB 4QQFA 1A9RA 4Y2UA 4RKRA 3QBJA 2O5CA 3CNHA 4ZO4A 2CYAA 3GW8A 4UCFA 1RLMA 3K9QO 3BORA 1DUIA 4YEDA 1RTKA 4WNIA 3IEIA 5DXAA 4BIIA 4OBEA 2ZJBA 1C3XA 2OG1A 2VC2B 2FW8A 5FAXA 2V5UA 1TT7A 1SB9A 1XD2A 3A1SA 4BGIA 2DH6A 2EGGA 3LSYA 3LYHA 5FUYA 3WAKA 5C81A 1NFRA 3MGBA 5INTA 2PKYX 3CR8A 3R0VA 4CMIB 1DBRA 4PLWA 2KS6A 3JZIA 3STXA 2GX6A 4Q4HB 2WRZA 3H8WA 5IEBA 4OHOA 1TU0A 4D0SA 5IPFA 4LZAA 1XKTA 5HCIA 1X8XA 3A1VA 1J2JA 3JSAA 2QTLA 1REQA 2A92A 2OHOA 3JYOA 3PA6A 4IY1A 3T7JA 3TLXA 3TLBA 3BB4A 1OX6A 3HJNA 5F3DA 1I7QB 2OO7A 3TL6A 4N5MA 4Q02A 3VDQA 4TT3A 4KGDA 4DW8A 2IEZA 2HMUA 4PEVA 3GJ4A 1NU8A 2VDOB 4CODB 3E1SA 5JYEA 1XU9A 1PWYE 3VC1A 3N2IA 5FPTA 3TSWA 4P5DA 5KX5B 3ZYZA 4EJ2A 1MIHA 1U7XA 4R1TA 5BNTA 2BZ0A 4QRHA 4D56A 1FMLA 4TSKA 4E6EA 4A8PA 3FJYA 4XM1A 1PFUA 4MV8A 4DV0B 3GBPA 3EUFA 2AX4A 1RW4A 1NM5A 3PA8A 3PQ2A 3H3JA 2J6BA 4F84A 4HDCA 4QRIA 3PQ4A 4Y0NA 4CM8A 2C5FA 1AF7A 3L77A 3DHVA 3GDGA 2X19A 3W6PA 3GVXA 4RIIA 4LSMA 4IZOA 4OJTA 4KOEC 3D81A 1E5TA 2VXYA 3BFVA 1X8JA 5MF6A 2DUJA 1VTKA 1ZK0A 2W2NA 4OI4A 2IYQA 2V74B 1SC9A 2FE1A 3KELA 1J39A 3LPNA 1EBBA 3O3MB 4WFKA 5C0OE 1K7EB 4N41A 4B3XA 4N5NA 4ZVQA 4LF4B 3RRXA 3FOEC 3REOA 1LNSA 2M6KA 3N87A 4TZTA 3G0HA 1MNQA 1P8JA 1U3DA 3FSGD 3B13B 2I9KA 1TZ2A 3QVXA 2FH5B 1RKQA 3FYSA 1RWMA 3FMVA 5CCBA 3A6ZA 3IDFA 4UMVA 1TEZA 4JJ4A 2ZTVA 1GL7A 5CFLA 3GDFA 3KT6A 4AF6A 4YUAA 5F2EA 2Z08A 5CFRA 4NARA 3WXMA 1T3SA 2W6QA 4RA6A 5CJJA 5IJXA 1Z5PA 2FSSA 3LWBA 5EWLA 2J0QA 1PNOA 2V0CA 4O2BA 2YW9A 1H3FA 1AQLA 4ZCPA 4ITVA 1VL0A 3IESA 1CQIB 2PEZA 3ND5A 3NETA 1RQGA 3E8XA 3JVUA 4WSOA 1S2DA 3P2JA 3BKWA 3EB9A 1NW8A 2C3OA 3FUUA 3H1EA 3NGXA 3RE1A 2QHXA 2RKWA 4RWZA 4XGKA 3ZTWA 1JR3E 1NW3A 2Z3ZA 3AEZA 4KWCA 4MX8A 1NNLA 1BNCA 5JQWA 1T5HX 5L3ZA 2WK1A 4FYMA 2I80A 4PLGA 3TECE 1M73E 2G25A 4FNGA 4LGYA 3KPJA 1XAJA 4CF5A 4WXEA 3TLJA 1QU2A 5G4KA 3JQPA 3MGGA 4JBNA 4PZLA 2GA9A 3V34A 4RTLA 3ZE1B 5AOVA 3ZCVA 1G20A 5JC8A 1E5LA 1USIA 4D9HA 1PEDA 3KZNA 3VYRB 1TJ3A 4PZPA 4MTLA 4AFNA 4BQRA 1K97A 3LGXA 1YJQA 4IDCA 4LS3A 2FUEA 4B9AA 3G89A 2W11A 1RDFA 2CMDA 1F7UA 1LPNA 4YQZA 2E4ZA 3V55A 1B43A 7REQA 2Z83A 4B7CA 1BWPA 1LQUA 4GBED 5AVUA 5E6SA 4PBTA 4RM2A 2PWPA 4QXRA 4DV7B 4MQBA 1WXWA 1J0DA 4N0DA 4QRDA 5DYWA 3UMYA 1N1DA 3P2YA 5CM2Z 2Q4BA 4J49A 2OYCA 1U3TA 1CULC 4RIEA 1DX9A 2BI4A 3Q7RA 2NAPA 4DWVA 4F2GA 1UOEA 4TL7A 3TKYA 3HFGA 3HKDA 1FW6A 2YZ2A 1EXDA 5ENDA 2WF8A 1RWQA 3MTIA 3WHKA 4O8CA 2X9VA 2Y0CA 1K86A 3FDZB 3KJXA 4HQ0A 4KNVA 4LXQA 3RU7A 5IANA 1VG1A 1VCOA 2OV1A 1EE2A 3VNVA 3D1LA 2D2VA 1NVBA 2Z5GA 2ZTMA 1ZFNA 3CX7A 3V7WA 3THYB 2EIXA 2BFOA 4QL3A 2JKZA 3JX9A 4FE7A 1EIWA 1HV8A 3UMFA 3K72B 5HE9A 3SXPA 3X1ZA 1I7PA 4NNOA 2CN1A 3CLUD 2IS1A 1ULBA 2GD1O 1Y1LA 1SCAA 3DH0A 3QEBZ 2FETA 2VK1A 3F97A 2ZIXA 4X20A 2W37A 3JD4A 1N6NA 2FX2A 4DMUB 2OL4A 2J45A 3WK8A 2GKSA 2VH5R 5JMOA 3HU1A 2P4HX 4KR2A 4L7QA 3PGLA 3TWOA 2R6FA 4LOIA 5CFPA 4MRVA 4Z2AA 3LCMA 1QDEA 3RFUA 4M8LA 4QO8A 1VI2A 3RUEA 2DR2A 4N76A 2BFEB 3P5BA 4IDGA 3DL4A 3WB2A 5K05A 4QJBA 2X40A 3PPYA 3THSA 4D9GA 1DIOB 1B0PA 4H77A 2J3EA 2CHQA 2FZCA 1KY4A 1JRLA 2I3ZA 1C0LA 3ZY3A 1OB2A 1PWEA 1VB3A 3MJRA 4JQYA 5ERXA 3VO2A 3D4LA 4LMRA 1YMUA 2JKVA 2IEAA 2OQ2A 4NBKA 1QH0A 5ITSA 4UVGA 4F3RA 3CT4A 1XZKA 9ATCA 4OXRA 3V4ZA 3SFTA 5JXHA 3QUAA 3R76A 1NI5A 1YJXA 3TNFA 2R8PA 3MQ4A 4I08A 4LXUA 2Y6VA 2HMSA 1QCDA 3G0GA 3HJHA 3HMKA 4MUMA 3A6EA 4QAJA 5EIAA 1QVWA 3BYZA 1G8YA 3ZY2A 3U7RA 4XA8A 1YVEI 4KR7A 2EP5A 1NJ6A 3NIDB 3S2GA 3GNSA 4L9WA 4EHFA 2YQ5A 2DEUA 1UQTA 4EFKA 1P3Y1 1YZVA 4EGSA 4ZT5A 3U7HB 3M3PA 4WI1A 4YMSA 4X00A 1LLCA 1OWLA 1RWXA 2RJ3A 4DLZA 3DL0A 5C18A 1AQNA 3G13A 2CXUA 1OH6A 1FQWA 2HT6A 3ANLA 3LRXA 2DCMA 3I2FA 4QYTA 5K0EA 1W47A 2L42A 2BMWA 2W2TA 1RQPA 2GN4A 4A1OA 2P68A 4B8YA 2Q4RA 4R9RA 2KM1A 3W8DA 1KBZA 1VOTA 4RZXA 4TYNA 1W85A 2PL5A 5AI8A 3BWDD 1UC9A 3OCXA 4DCOA 4LJ4A 2UUOA 4CFZA 5CDHA 4WJLA 3GFRA 2ZUCA 1P72A 4F5ZA 2O5VA 3JQ9A 3UOWA 3OLXA 4BGVA 4YCDA 3AKCA 3DPUA 5B1SA 3H18A 1TOAA 1F0NA 1U1EA 2UZ1B 4YJ2B 2JFYA 4IDDA 4IFBA 4UXIA 1PNTA 3IAAA 4JUAA 5BSRA 3GAFA 4XVQA 5L3QB 1U04A 2JHPA 4ZPJA 4AKHA 4ERXA 3RRNA 5CHEA 4TKVB 2BHRA 4NTZA 3T7EA 4EYQA 4YP9A 3CRQA 1XNQB 1WV0A 2ICAA 3AY6A 4OHYA 3O8DA 3DCNA 4GRAA 1EGMB 1VBMA 1ZHHA 4LFBB 2HJSA 3LBFA 4WV3A 4ZI7F 1JHVA 5FQOA 3FLMA 3MK31 4IIXA 3OZVA 3AFOA 1NXVA 2HF9A 3EXHB 1UKZA 3IHKA 1IIBA 3D7KA 2Q8QA 3VPDA 2C2GA 5CLLA 3PUJA 4M3NA 4N82A 2P9YA 2SBTA 3P0HA 5C37A 4XIGS 5L40A 4RCVA 5BO5A 4J3FA 5DWDA 5A6SA 4MV1A 1KK3A 2QTGA 3N0TA 4WOJA 3TR6A 1X1SA 2DBQA 3K0CA 1I7SB 2XECA 3PNBA 3SGLA 1PT6A 3LCJA 3PX2A 1AXRA 3A6FA 3ESQA 5KREA 1KZ1A 1YI0A 4UAVA 1P4SA 2BLNA 2MSEB 2Z1NA 3WP0A 5EFOA 2QQGA 2PWYA 1LQTA 2CNDA 3CZ5A 3DDSA 1XZEA 3ADOA 3H8SA 4FEGA 4RQAA 3OCWA 3C1OA 4DCPA 2YWDA 4FSDA 3WL5A 1KJ9A 1LLUA 2FDRA 2WM8A 2PUJA 3GEBA 4LOKA 1TEVA 1GL9B 2WG1A 3JQBA 3T5DA 3NCHA 3D54D 4IJKA 3LT5A 3QVLA 4FMCB 3IAXA 1ZM2A 2VDPB 2CXPA 4FYYA 5EMMA 5FUVA 1D4ZA 5HILA 5KAMA 4H17A 3HTXA 4JQSA 4HWTA 4JITA 1WOYA 1XJWA 3P96A 4H6PA 4YQEA 2OR3A 2OKGA 2YYYA 5A3JA 1IEVA 3A31A 2QUKA 2K5UA 1DRKA 3C1AA 1EX9A 3WSTA 4BNYA 3U44A 1GKKA 3PNKA 3FAKA 3TIXB 1XAGA 3YASA 4BP8A 4Z3KA 2A1TR 1U0JA 2VQ3A 3D4BA 3ZWWA 4ETIA 3JATB 1DCTA 3A25A 3BXFA 1VCIA 3L7IA 1EA7A 1L7DA 4D5EA 2WNSA 4J0HA 4PN3A 2WYHA 2QM7A 3JQFA 5AHKA 5ALPA 1L5GB 2HLDD 3U4DA 1GPAA 3CMMA 1GKLA 2FU5C 4PZDA 2YUIA 4E21A 4EGCB 1PYOA 4WNYA 2ABWA 2FKAA 4JLWA 1DO2A 4P36A 4D3ZA 5AKEA 2I22A 3I6MA 5D1NA 1I5EA 1WMFA 3H4VA 1KEVA 1H23A 3WQSB 3H9BA 1MP0A 3AGQA 4E4TA 2ZJ7A 3CE6A 4DR6B 4RHTA 4RPCA 4IXNA 4Q4AB 1OC4A 2P9GA 4NAHA 2XMRA 4YJHA 4YRJA 1AXEA 1JDBC 3L7AA 4TLDA 3T4PA 1RYDA 4PINA 5AJUA 4DREA 3LBYA 1WULS 3PWZA 5KNCA 2QAGA 4U2CA 2XQIA 4EPRA 3ED5A 4NEQA 1VPDA 2XUOA 2NTYC 3IXLA 1XTRA 5EXTA 3V80A 2AX3A 4ARSA 1U3WA 3I4CA 2ZRNA 3MA0A 4B6JA 5FFNA 3VZRA 3DLCA 4OJKA 3ZLBA 5CVVA 4L3VA 3SS7X 4JC0A 4BNJA 2J0UB 3CKLA 2AQIA 1T2DA 5BQXA 3BRCA 2OY0A 3P20A 5HNKA 4AF7A 2RG1A 4JCCA 1P8AA 4G0UA 4BZQA 4RW0A 2VHVA 1VCMA 4L0CA 3VU9A 5LIRA 5FV7A 3C48A 1JEOA 4XASA 5JNVA 5AVSA 1GHTA 4L6IA 1M7GA 3T7AA 4Y2XA 4ALNA 4US2R 3VPAA 5IK2D 5ERGB 1XFDA 2QTZA 5LMZA 2ODTX 3AI7A 1LW6E 5IKEA 4NMXB 3F7NA 2HQSA 1BXGB 1EUCB 2VO1A 3O26A 4A0RA 3NX4A 1IPHA 1JHMA 1VSTA 2JAOA 3ZHTA 3MHPA 4J76A 4AKSA 5KSZA 2ZYDA 1YVPA 5D6OA 2FZVA 3KWJA 3E9RA 2YHSA 4FGWA 3UXEA 2O59A 5HE8A 1BG6A 2ZT5A 4AZVA 4R6XA 2EEZA 3VPCA 1EK5A 3G2PA 4RPHA 1OJ7A 2PXXA 2ZVDA 2ZB8A 4AP6A 4BFYA 3WV5A 3IKLA 4F2HA 3NM5A 3EXG2 1SG0A 3LFUA 2ZE8A 4WKBA 3WIBA 3ITKA 3L7MA 1UBLS 3QELB 4YAIA 4EKNB 4KBYA 2HA5A 1BE0A 6Q21A 1VPVA 2JZCA 2EVWX 1E9SA 3VQTA 3U3ZA 3IAS6 2D5LA 3DBOB 1S01A 3NDBB 1U0TA 1W52X 5B6JA 2YBDA 2P9BA 3O03A 1BDMA 3QFHA 3OPYI 1K6MA 3G1WA 1V7CA 3P0FA 4IM7A 3NRBA 4PX9A 1I2AA 1MV5A 4I6EA 5F98A 3ROZA 2IOQA 4Q1FA 4IIJF 2G1UA 5K6TA 4JUDX 4W5HA 3U19A 2WZCA 4IJQA 1ZJ6A 3ZPXA 1XQ9A 4V0MA 1NDUA 1G6KA 3D5TA 2REXB 1KR2A 3V5NA 4NICA 1DS6A 1Z0JA 2XXAA 1Q22A 1U81A 4GIBA 4YT8A 3U4CA 4TQ9A 1SUAA 2KSQA 2UVDA 3REGA 3BEOA 2HRZA 4DVGA 5FO0A 4X93A 4XAQA 4EI9A 4B84A 2WU3A 5ALXA 1TLFA 1PT5A 1G7RA 2V4UA 3L7BA 5F1YA 1A9TA 2J9ZB 1XZHA 2XEXA 3W5IA 2JKYA 4Z2YA 3S28A 5C7OO 3CW8X 4A6XA 3UZUA 3BSYA 1Y8RA 3FRHA 4PRYA 3O1HB 1VKOA 1I2DA 1D2EA 1NJGA 1JG3A 2KMLA 4ZGWA 2WABA 3SEQA 1LBEA 1YBFA 3LWDA 4LW8A 4RVUA 2GCEA 2BKEA 2BCGY 2BUAA 2GRJA 3NTUA 4U3JB 2AR9A 4B7XA 3E4CA 1GILA 1Y6JA 5I9BA 4DLNA 3GD7A 5CEJA 3D3WB 3VR1A 4BMOB 5HKKA 2JGAA 3HCCA 2ZIAA 2XMPA 3RF6A 3S8MA 4CUKA 3AVOA 4TS9A 2PRIA 2C4WA 3L6OO 3T61A 4YBRA 3IDOA 4W1QA 2GBLA 2YOGA 4BBZA 1SCDA 3IQWA 1THTA 3FMIA 1ADGA 1WSWA 3ML1A 1AQJA 1H2EA 2OCLA 3KYCB 4DZRA 4X1IA 3TE6A 3DOCA 1IQ0A 1T5SA 3SDSA 5TV2A 3FDXA 2FEKA 1SPBS 2Y3IA 2NSLA 1YRYE 4MKGA 3TTUA 2FAXA 3NTOA 4I1PA 3PUYA 4UHBA 3I9OA 1L7RA 3E9QA 3HPQA 5DTRA 1RRKA 4OK3A 4S1NA 3TK1A 4HF7A 2OXIA 3WHPA 1TK3A 1TKBA 5J5VA 2EATA 7MHTA 3TDKA 3IOMA 4Q15A 5EWMA 2CVPA 4EBBA 2DQSA 2J41A 4IH4A 3LK7A 3DDNA 3I9LA 3ZXXA 1ISIA 5FTWA 1IEQA 5FNVF 4FVTA 4HB3A 3TQIA 2FN4A 1A4XA 1R0BA 3FKSD 3NHJA 4IUCS 4BBAA 1UDWA 2F3TA 1LZLA 3RUFA 3S1SA 4XM2A 3SYKA 1E2IA 2XCLA 1GPDG 2IZ5A 2FRVA 1QHXA 3PB3A 4N49A 3VHXB 4AJJA 3K73O 2VJBA 4QXPA 1IWBB 1RJWA 1TIBA 1IOLA 3H1GA 3T99A 1H93A 2EJBA 2FQWA 4KN6A 4YRMA 1W0JD 1KARA 1L5MA 1N7IA 2MR6A 3DB1A 5AESA 5IJ9A 3KETA 4K05A 3HI6A 3H7IA 3WNQA 4FYKA 3AB8A 2A3NA 1Y4ZA 1Y9AA 2CHFA 1TM7E 3L5KA 3SVTA 4CMBA 2YZNA 1TD9A 3GK3A 2GDJA 3HY4A 4KC0A 3KXPA 4OUDB 4A8JB 3E2PA 3TLEA 5JISA 1YVRA 2Q2WA 4R6WA 4GEKA 5GAJA 3RARA 6REQB 1E92A 1UFQA 2I4MA 1DAOA 2ZBGA 3ZV6A 2P69A 1MCZA 4TKUB 1GGNA 3BUSA 4KQHA 4FHZA 4P4GA 5B3JA 2H4FA 3BA6A 4FX2A 4R8SA 3KVNA 1HPLA 2PX0A 3SMVA 4V0LA 2QN1A 4MUGA 4DL9A 3JVVA 4KO4S 3W4IA 1Q7BA 4JLUA 2OAEA 1G16A 3H5NA 2VQSA 4MV4A 3IQIX 5JPCA 4J4BA 2P90A 2QVXX 1Y5IA 5CT8A 4UXJA 5KJEA 1ZMBA 1XDUA 3OFNA 1UUFA 2RHBA 4B6FA 3K0KA 5DMXA 1TM1E 3DG9A 1JE1A 4PSAA 3SEAA 1V8OA 2NZJA 3TPCA 4KNYA 1OIVA 1FFYA 2IPAB 2DT5A 3I1FA 4OGWA 4PGGA 3T3DA 1IXYA 3NYQA 4B3MB 4XZ3A 3OZFA 2B8EA 2GYUA 4G89A 4PAWA 1L8LA 5J2TA 3SC6A 4NCIA 3UW1A 3SWWA 4RTNA 1NW7A 1P7PA 3FN4A 3GAZA 3RVDA 1DXHA 4LN1A 2WG2A 1YIAA 2Q41A 3AG6A 1C4OA 1JJFA 1WEKA 4D3FA 4D0NA 4DEVA 2HRQA 2OP1A 2EHJA 2HCRA 1WW3A 3KD2A 1M76A 4AWAA 4H9GA 1CEYA 2VS1A 3QE3A 1FB5A 3C8MA 4PX5A 2O2XA 1NNSA 1XG5A 1EGVB 3JAWA 4B1FA 2AC2A 1N5KA 4G0QA 1SUPA 4RMGA 1K0FA 1PV1A 5BPFA 3GZNA 4Q21A 4DYDA 4ZICA 1N33B 3OU2A 4F93B 5KQPA 1YA6A 2QF7A 1BDHA 1GTSA 8MHTA 4DTIA 3KFVA 1WZUA 4I66A 2XF8A 4KV7A 1B76A 1U1FA 2PKRA 1KZGB 4M1MA 5DZSA 2FMIA 3KS9A 3DDZX 5GONF 3HMQA 3NBUA 5IT4A 1NVVQ 5BORA 4IIBA 3FUCA 3QWHA 1R8QA 1T6NA 4RIHA 2AFVA 1EINA 1SCQA 4KGXA 2QLBA 4MULA 3D6NB 1KOGA 3RF7A 1EFRA 1QJ4A 1X7YA 3U4IA 2ZAIA 4WCFC 3C3CA 5J4YA 3T1HB 3A6PC 2W0MA 1YR9A 4II3A 5EC8A 2WQ6A 4M87A 2EIHA 5K8IA 3VMFA 3C15C 2HH9A 1ZN7A 1M8GA 4MKRA 4UDYX 1M66A 3T5BA 3LVFO 4BVGA 2QM0A 5KYKA 2XBLA 4KDEA 4L51A 4YCSA 5T4HA 1CZLA 3A9UA 2Q6VA 5KYWB 1E1CA 3LZ6A 4C6RA 2QTVA 2FY8A 2KLHA 3SQOA 3WKEA 1MENA 2PL3A 1Q1GA 3KWLA 3CNOA 5M7EA 3GJ6A 1SN7A 2CMHA 2XNKA 1CUFA 3A9WA 2ETVA 3F7OA 3FLBA 3IPLA 3ILVA 4KE9A 3V8MA 3IUBA 4GS5A 3ZZNA 4WZAB 2C9BA 1SIUA 3FHJA 3P0JA 1MOPA 3WK5A 5IZCA 4ZWNA 4EGFA 1Z2EA 4EQ6A 2PCLA 2WDZA 3RYCA 2MSNA 1QCZA 2FMXA 2QNBA 4JD5A 1VHTA 2FWBA 4FGKA 3D6AA 2WSSA 4G1BA 5I7WA 5KYYA 4EPWA 3RWOA 4CM4B 1HDGO 4QKQA 3L92A 4CXMA 4ZYZA 1YZNA 1G64A 2OENG 1JJAA 2YMLA 2FWPA 1JAIA 2JFHA 1M2GA 1MH9A 5A4JA 2Z5LA 4Q0MA 3ECSA 1RLJA 3PWKA 1TJYA 1R4ZA 3ABIA 5F4BA 3V2GA 3WLQA 1TCCA 1KI2A 5IXJA 2NU6A 1L7QA 5KQRA 3DO8A 3MTJA 2ZTSA 2YYAA 4H7EA 1E4VA 3ENNA 2EBHX 3I53A 2JEOA 2IODA 4Y6RA 3HLTA 4DIUA 4Q48A 3BGDA 3WGKA 3MJFA 1E58A 4CQMB 3CPJB 3LP5A 2YJ4A 4MIEA 4S04A 1F5NA 3RLIA 4BUZA 2YC4C 5K8UA 1BFUA 4ZOBA 5DEOA 1G7SA 3JR3A 1B00A 4LXGA 1F2DA 2LE0A 4EY8A 1XFAA 3QOYA 3SQNA 1PUJA 3MB8A 2DP4E 2FZLA 1ZYUA 2A59A 3IA7A 4EI2A 2PY6A 4YVFA 3EEIA 3SI7A 6YASA 3Q8XB 3ZDDA 2AFIA 3MQFA 2CFIA 3C98A 3EASA 2HMVA 2YN2A 2Z3VA 2R5WA 3A4NA 3IULA 5ULLA 2IVZA 1WQ4A 2JCGA 4Z6KA 3G5TA 5H4GA 4CMEC 3WQQA 1TZBA 2RH9B 1UP7A 2SCUB 2RJOA 2QTTA 1QYRA 1XC7A 3LKVA 3MLAA 3OFVA 2XYHA 2PO7A 4KQXA 3W6OA 1SCNE 3ZJVA 2W2OA 2X7HA 1Y33E 4MUEA 1RC0A 1VDMA 4IIVA 4S0ZA 1NZJA 1BC5A 3QFCA 4ZDWA 5GP1A 1YF3A 3DZDA 4HC4A 2VCHA 2HHAA 3PNLA 4IL5A 4N6OA 3E4DA 3OY7A 4DDMA 1JVNA 1RE0A 2FG7C 3TTTA 3UAGA 1XPUA 1IDN1 3QEMA 4Q9AA 3T4XA 4JXXA 4MV6A 4K03A 1O6GA 1XVVA 4XIIA 3DUWA 1XZMA 4GOXA 4LOAA 2CJWB 1KSHA 1MA3A 4YNBA 3U3OA 1VJ5A 4R54A 1EHCA 5CFMA 1GGHA 2XNDA 3G2QA 5DX0A 1DAMA 1SQ6A 1PGOA 1NLMA 2XWPA 4HH0A 1ZO8A 3DA8A 4M98A 5HKBA 3IAS1 3FMGA 1ACJA 4FMDB 3ZQUA 2P5YA 1I3NA 5KBYA 1P1FA 2BKVA 2CXTA 3CGWA 4L8YA 3QNMA 5LQCA 1T36A 1QF9A 5EE1A 3ZJYA 4N9QA 4YJGB 4GL2A 1XWIA 3E22B 1EEXB 1FRQA 1JXMA 4I36A 4XYLA 1OXKB 1N57A 3PBKA 1VL5A 3ZWQA 3CT6A 3IPCA 4N39A 1MB4A 4GI3A 1EMDA 2A9KA 2SKCA 2G9QA 1SHZA 2IXTA 2XHZA 4O6VA 1V48A 1FSSA 4CV3A 2Q2NA 1ZRNA 4K6OA 4V2IA 1ECCA 3CUTA 2VSXA 1MR3F 1ZJWA 1QYVA 2P9CA 4FNMA 4OBXA 4OP1A 2QX7A 4I55F 4EJ0A 1M6NA 3S1LA 1JU3A 1SBNE 1NQOA 1T6YA 3E9NA 5EIBD 4FR0A 5KYTA 5PNTA 2GFIA 5TVGA 1EFKA 3HWWA 2QP3A 3QLVA 1VYTA 1V5IA 2C5BA 2W00A 4ND8B 5ALDA 5IN5A 1G41A 4K81B 4ZQHA 3UHAA 4BQNA 5A5EA 1DRWA 3MLEA 3ZWOA 1WVGA 4X6XA 2Y68A 2HU8A 3DAFA 1K8RA 4MWCA 4MYUA 4MTCA 4QGHA 4YCBA 3SVZA 2WHPA 1Y7PA 5BPHA 2R4UA 2ZW9A 3EUEA 4RM3A 3K6SA 4N5DA 4E1AA 2OAQ1 5IYZF 3IEXA 3P9NA 2KBFA 4M88A 4URXR 1VMEA 4M54A 1WXQA 4J0IA 3WGNA 1IZ0A 1IHPA 4JBIA 3EXFB 3MJSA 4N9WA 5LUAA 3GB9A 3DWEX 3RYIA 4GPIB 4BX2A 3R5KA 1SBCA 4QGBA 1MX3A 3CO0S 1RRGA 3GV0A 4R3NA 3IP8A 1Z4LA 5KKNB 3DR3A 3AESB 3DV9A 3GFFA 3PEVA 4PC2A 3WO0A 2H1WA 2RKBA 1X15A 3GLIE 3KJHA 3BB3A 4LK3A 4W5JA 3MRXA 3BT7A 4PANA 1TL7C 5I4IA 1AMNA 3KPVA 1KY2A 3VU0A 1ZX1A 2F59A 2JBAA 3ES9A 1U65A 1GKYA 1UPBA 4EITA 3N2KB 4POOA 1MTZA 4EUHA 3A37A 1XRMA 1YQQA 2OXEA 1RAIA 4IO0A 4O4HA 5AKKA 1Q84A 3WRYA 2HSWA 1YJBA 3ILHA 2VDVE 4HLCA 1RBQA 1VIYA 4QAQA 1N3IA 3F67A 5CB4A 3EIQA 2WYWA 1RC8A 1IB6A 2QTHA 4D43A 2V7XA 3K0BA 1UKAA 2OB2A 3LO8A 5BWMA 3IJRA 4NCAA 3V3TA 3N5KA 2NV0A 2B30A 4H31A 1G60A 3KEGA 2ON6A 3BE6A 4FYJA 3VO1A 3L8EA 4HUJA 3E8SA 4FWIB 3KAQA 5DP1A 5JROA 4QG3A 4G9EA 3KKMA 2Q3DA 2V65A 4F85A 3G2LA 1E9CA 5CJPA 5BRNA 3CNBA 5C34B 2FPGA 1E7SA 4JGGA 3VV2A 5C7YA 4B3TB 3N70A 1QRAA 4LI3X 1IM5A 1EM6A 3M1IA 1TU4A 3RYHB 1SHJA 2UXCB 1WDTA 4DYHA 3AVWA 2FEWB 4I1UA 4C06A 4O0LA 2QR3A 1MA0A 1ZH4A 3H86A 3PYLA 4FI3F 3JPWA 5JWHA 2PZEA 5BT9A 5HTOA 3ABOB 3G1UA 1S1MA 4LF5B 2HWWA 1QP7A 2EP7A 4MQMA 3AP2A 3O92A 1AC5A 4D4GA 1C4WA 2GCNA 3FUVA 3HYNA 4KO8A 4NZPA 1Q44A 2J87A 1XCMA 3ORQA 3E48A 5D85A 2PSJA 3N05A 1HRDA 2XWJI 1NUUA 5HF8A 5K1ZA 3RHFA 3GBVA 3ZHUA 1C4XA 2BKUA 3F9CA 3L8FA 5B1DA 2CLDX 3D2AA 3FWZA 5TPWB 2I4TA 1A9PA 1XLWA 1XTUA 3UK6A 3AFHA 1JDUA 1MC4A 3S4YA 5MGBA 4CGYA 1E7QA 2CHVA 4JOQA 3FPCA 3ZE9A 1AQIA 1Z5UA 1QFMA 1TMGE 2VYND 1NJ8A 3H2BA 3RSHA 3UUWA 4BE9A 4HUTA 2AKYA 1E2JA 2JJMA 1A2KC 2ZYWX 3V4PB 3QEAZ 4FDTA 5ECGC 1KBQA 2Q5OA 3D7LA 2ZSKA 1DQYA 2QYOA 2YX1A 4FI3C 4NULA 4PS1A 4ZJYA 5AVQA 1OILA 4OO3A 4AMYA 2O54A 4LXHA 1SR8A 2ZDHA 2M6SA 1F1BA 1V37A 4XGNA 1DGQA 1R37A 4HQKA 2C4MA 4C0BA 3R3SA 1D8AA 3W9UA 1H4SA 2AZXA 3CKMA 4DCUA 1JAYA 1Q1AA 1YBHA 2Y1EA 2XTAA 2C92A 5T41A 1E98A 4C76A 3NHAA 4K2HA 2FPKA 1PKXA 1ULTA 3F0TA 2GN2A 4KTVE 3K2BA 3NKFA 4TSFD 4L4YA 2XUAA 2H3HA 2WUWE 4UUPA 2CL7X 1NR7A 3WL8A 4D9EA 2CXHA 3KYDA 5KUTA 4HAXA 4ARBA 3OZIA 4QDOA 2ZUSA 1GPNA 4GGMX 4O2BF 1PQ4A 5JWRA 1RRCA 4EHIA 1ZA1A 4RGQA 10MHA 1VBNA 4QNNA 4G36A 1R00A 4D7AA 3HVJA 4FLMA 5K6AA 1W5SA 2AJCA 1IHXA 4L76A 1MO5A 1MU0A 1V3VA 3LQYA 4ALKA 4DA8A 1CY4A 1PCXA 3TI9A 2LGJA 2W43A 3EMBA 3P27A 3NFRA 3T3PB 2FWJA 3OTOB 4J3JA 1QLHA 2NT3A 3D2BA 3EEBA 2AXNA 4GLOA 4I4TB 4G6ZA 4GPBA 2JFUA 2RONA 3OT1B 3QWAA 3T35A 3VH2A 5L6MB 2HK8A 2R0QC 3KWFA 5D1HA 2C20A 4XCQA 2FPLA 2GYYA 1JQEA 2EF1A 1Z75A 1TK9A 2GPSA 1UEXC 1NBWB 1CG6A 2NSYA 3MFYA 4D9KA 2H11A 3TMYA 1LJUA 1Q83A 3UPUA 2M9MA 3MTGA 2DX7A 5AI9A 3OSZA 3QFFA 3CTMA 1Q5PA 4BNLA 1CJTC 5DGHA 2WMNB 1GPBA 8LDHA 4QU0A 3UMGA 1MT0A 3RQIA 1H2ZA 1SXHA 5TMDA 4F46A 1Y9EA 5BWCA 3KHSA 2Q9UA 3SHQA 4CDNA 3G2KA 4ZEWA 1IBRA 1YZTA 4X6LA 4A91A 4H59A 5HWSA 5K0GA 1NY6A 1RCUA 4BO2A 4PWYA 3E84A 3P32A 2E4XA 3AHGA 2GPNA 3LDUA 1BXKA 4HLDA 5BW6B 4ECEA 3EE6A 4CU5A 3FVWA 3GA5A 1E9RA 1T4CA 2QN7A 3I28A 2IGTA 5KKCA 1RYMA 4LTDA 4EO9A 3JYPA 2B2XA 3KSBC 3ORFA 5MFZA 2PXAA 4LHEA 1ELOA 5J1SB 3ZW7A 4CI9A 3Q5DA 5WRFA 3GROA 2BCEA 2QZ4A 3D7NA 3DFZA 4D4IA 4KGZA 3F47A 2J4DA 3NPAA 3NBYC 2OHFA 3K3PA 3IT2A 3LW7A 1UC4B 3TNLA 1D1QA 2PLFA 1L1QA 2GR9A 5CA1A 1QH1A 2JFVA 3NAZA 3S8YA 4AY6A 2F43B 2PK3A 3BM5A 1NVGA 2CWDA 4K8RB 3CVXA 4CEJB 4YRDA 3BH6A 2A0WA 4U7GA 4EECA 5JVDF 3TOZA 3ET4A 3BWBA 1TYZA 1EP2B 2FPOA 2JJ1A 3AUAA 4IG9A 4DRXB 5GIPE 2RFLA 3HVRA 1GR0A 3SFZA 2BTQB 2O4CA 3ZGVA 2CGEA 4PC1A 4EGAA 1NVEA 5LQAA 3SPXA 3UEOA 4CF4A 5JTUA 5EKSA 1G21A 3KPUA 4PONA 5D7BA 1W44A 1H9CA 3GEHA 4OM7A 4BFTA 5BW4A 4N03A 4LDQA 3L79A 1PEKE 2DY1A 5BSTA 4HBZA 1M0EA 1XXHA 2ONJA 3O8LA 1GPMA 2FSFA 3E2IA 2AZ4A 2I2XB 2X0KA 3DWIA 3F9IA 3H6KA 4KV9A 1V0JA 1CUHA 4ZOLF 4X7MA 1MX9A 3MTDA 4RH0A 5EMHA 5DN6A 4Q4HA 3NBFA 4OYHA 5IULC 2HIGA 1C8VB 1VL1A 3DL2A 2LDXA 2ZE7A 4IDQA 3R1IA 3OQJA 4G97A 4XARA 4RULA 1JFLA 1G8AA 2D3WA 4Y2YA 5EZYB 1TF7A 1NA5A 1KP3A 1X77A 2QJTA 3H5TA 1E9EA 1XZCA 3M6FA 3E27A 1P7CA 3ASUA 4MVJD 4R8LA 4WMLA 4W8HA 1Z39A 2Y93A 4TQUS 3JQ8B 1IZYA 4D41A 3C3YA 1KI6B 4ALMA 4TWZA 4I4IA 2N1BA 1XDDA 2P11A 4HJRA 2W2PA 2DHQA 1IWPB 4BEVA 3C6YA 5C8DA 5KTPA 1JXAA 5KX5A 3JAKA 1C41A 3EDRA 2BM8A 1YI1A 3NKLA 4HFJA 1HQCA 4JELA 3RFCA 4EG3A 1KTIA 1OI4A 5IWAB 1M6VA 3STUA 2PIDA 3EGOA 3K5WA 4HNAB 3U0BA 3J81A 2VJKA 1OLSA 2J31A 1TAUA 2OGUA 4TVBA 2QN6A 4Q3LA 3DD1A 3UH0A 2FEXA 2X6QA 4CTOA 3G3EA 1ZH6A 3DFFA 1HTTA 4MWTA 4ZVPA 1RQ2A 2PQ6A 4ROTA 3MC1A 4CDGA 4UPEA 2TSYB 1QO0A 1UODA 3L7NA 4BU0A 4UHHA 3WLAA 1GLNA 3L5OA 1NDHA 3PTLA 3TGLA 3IAFA 4X8MA 3W9BA 3WISA 5HKKD 1FSZA 4B6OA 2B5OA 2AE2A 2WV7A 3N2EA 2XCIA 4JEHA 3A6JA 4IUBS 4R1PA 5F2KA 2IV7A 4F04A 1UAYA 3NAGA 2WHQA 3VJRA 2W6CX 1Z5NA 2AHOA 1N78A 2G88A 5B7GA 2FG6C 4R40A 2ZS9A 2PUWA 2O8BA 1XCPA 2ZRHA 2PMDA 2IOHA 3N6RA 3KU4A 4ZGGA 4DDWA 2XKBA 4U8HA 4OF4A 4HDOB 2XYGA 5BR1A 1OV6A 3WNDA 4LPSA 1V5EA 4J7UA 1O08A 5HOEA 2EQ5A 4ZRDA 1FFXB 4DR5B 4WZBB 1NV9A 4HVLA 1HNXB 3K1TA 2VHQA 4NC9A 3SVLA 1Q7CA 4TXMA 4JLJA 2HZ7A 1VIMA 2JC3A 2O7RA 3FNGA 2ZSAA 2D5AA 4UVIA 1NN3A 4HLNA 2GYVA 5L45A 1UXGA 4KR9A 3IOYA 3D8SA 4D80A 1Q0RA 5FWXA 3HNOA 4MQFA 4QD3A 4Q3CA 1YBAA 5DNYB 3CC8A 1I0ZA 3H4TA 2VAPA 5BY2A 5JCZA 2BW0A 4IWYA 1JAZA 4UVDA 4AWXA 4CE6A 1YC2A 2H7VA 1DPFA 3LWNA 3E9ZA 4NMMA 2WFZA 1XMIA 4X8LA 2PG3A 5YASA 5CFQA 3JQ9C 4RFSA 1CC1S 4HL6A 1E3QA 3GN2A 4OK5A 5J63A 5BSWA 3ASZA 4G81A 4YJDA 4ZVVA 4IQ4A 2WVJA 4YS6A 3HI4A 2P4SA 1JW9B 2I6FA 2NZWA 2ZT8A 4ARCA 1NW5A 2HMAA 2ZROA 1QSGA 1TECE 2Q1TA 4G2NA 4ACAA 4KE7A 3FWKA 1Z4JA 2BMJA 5AKLA 4Z9BA 2WUDA 1UAAA 2RGXA 4ND2A 3DP7A 3NHPA 4JI5B 4AZWA 3UGJA 4OQYA 1G59A 3VKGA 1G8JA 1ZJZA 2CZQA 3E7XA 4Q9HA 3GEIA 1P73A 2J67A 5K0NA 3NAQA 1TIPA 2EKPA 3NHYA 1AURA 2PH7A 1NW9B 2AD1A 3A3NA 3KPYA 3AY3A 4TWJA 4PRLA 3ZCTA 3ET5A 1KFKB 4FDUA 4RHFA 2WY2D 1KH3A 2CFRA 1YWGO 1CRLA 3DYBA 4L6AA 4KOAA 3FDZA 1QNLA 4ZAXA 3IBFA 3INRA 1DELA 3C7TA 3EZ6A 1JDSA 2D2XA 1W1WA 1AS0A 2J5RA 4ASUA 3QVWA 4DQ0A 4PIPA 1C9DB 1V1JA 4MRMB 5DB4A 4CKEA 4P7JA 4P80A 4MW9A 4QOFA 2VBIA 1PFYA 2WWWA 3JQBC 1H94A 5LDGA 3JS5A 4QE3A 4ZREA 4UE6A 3GLGE 1DWUA 1SXJE 3C4VA 1R5BA 3CA8A 4PPYA 2HD4A 2JI8A 1I4LD 3D0QA 3DWGA 4LE2A 2I7XA 4WLEA 4CQLA 1I1HA 4M4SA 5BV7A 1L4EA 3QVJA 3BJRA 3GCGA 3R0IA 3EGXB 2OK8A 4C2BA 1FIUA 1J9GA 4HB2A 1ZRHA 1I6WA 2H8KA 5AVZA 3DPSA 1JG7A 3ANSA 2J48A 3AW8A 3CEMA 3ISTA 3X2FA 4R1OA 5IVDA 1R0ZA 3ZNPA 3K70C 4TTTS 2UZAA 1I1NA 2IYAA 1UXKA 5KEIA 3U0VA 4JKYA 2H1VA 2XGGA 3ACBA 4BFWA 2QTCA 2G09A 3L07A 2EQAA 4FC7A 4RVNA 1FU4A 5I9IA 4R8KA 4KXNA 4C7BA 1JEEA 1U2QA 2PZGA 4K7JA 3GU3A 5HK8A 3ASVA 2O2GA 3WOHA 7GPBA 1MQAA 4CKZA 2JLZA 1JI3A 1G4AE 1DEHA 2PR7A 4CLXA 1KFCB 1J9EA 1I6KA 2V7VA 3I2GA 3PI7A 3VRHA 4YR9A 5EHXA 3EG9B 1N3LA 2OAP1 1NBOA 1TQ6A 4HN4B 4J0KA 4KXWA 4RD4A 3ZGOA 1QU3A 4HEJA 2VHTA 1DXQA 5EOVA 1DIHA 1KJ8A 1IJFA 1SU4A 2VP9A 1XKQA 2M32A 2QAGC 2Z98A 5LLSA 3BMOB 3MPUA 3RO7A 3LM8A 3K20A 1ETUA 1LLFA 3EXIA 4CFSA 4UNRA 1KAOA 1OXTA 5BMVB 4ZODA 3GBSA 5C4IA 1ZUD1 1E8MA 4CV2A 2H4JA 1YA4A 1ZIDA 4A27A 4I5FA 3B8EA 4L75A 1RKVA 4M1SA 5CYFA 4GP7A 1V41E 2K6GA 1M34B 4PXAA 5LKRA 4U4AA 2J9XB 3SZUA 1FBTA 1HO3A 1NLYA 1JT2A 5ER6A 5IUKC 3V7NA 3ZC3A 5B7NA 1LJ8A 5CRIA 3LXXA 5EWJA 5DFAA 1MW9X 4UMFA 3Q88A 4L5IA 2LD4A 2GZ1A 2X13A 3ZWDA 1D7OA 1E8NA 1AG9A 2ZJ0A 4AWBA 1FYDA 3A2LA 4IILA 3RKUA 1GTRA 1AS2A 5JMPA 5ADVA 2FWMX 2G1AA 2PVCA 2UZ1A 5JEEA 4MS1B 3VO8A 1RP1A 4RMHA 3D8BA 3ZK8A 5KYUB 3DMFA 4V1CI 1UBHS 5L3QA 1RZRA 2OMKA 1I51A 1ATIA 3M4NA 1DQZA 4TM7A 3TD9A 1TTQB 4O5AA 3L1IA 3WBKA 3ACCA 5CVCA 3EYWA 4BMZA 4QUHA 4JLNA 4EARA 4IYRA 4EA6A 2CSXA 2FZGA 3E9EA 3D43A 3CZ4A 5DNAA 5KMGB 1DZ3A 5LXTA 3EEFA 5BP7A 2UZ0A 1OOEA 3BCUA 4JN6B 4WE3A 1YKSA 3Q9UA 1T29A 3X0DA 1TPZA 2P2CA 2Q5FA 3HA5A 2HHJA 4N7RA 4IIYA 3U3RA 5ALKA 4NJOA 2XRYA 4OHVA 4RJIA 4UTZA 1F1JA 1EHIA 4UU1A 5AUOB 5K0ZA 3LCCA 4KO3S 1A96A 3CZMA 2QRKA 1YZLA 2HWYA 1AN0A 2VK8A 4WKPA 3ESYA 4JB8A 3PGA1 2XODA 3LA6A 3VHRA 3KB1A 1O57A 4J75A 4YREA 5AVTA 2IUEA 3K0EA 3KDPA 1MPTA 2G0AA 3ANNA 5G41A 4KPYA 1YRBA 2WF5A 5CFNA 4WN3A 4ZVTA 1DJPA 3CRVA 2ZWAA 4XD2A 1DKPA 3U9TA 2RD2A 4WADA 3WFIA 2VNKA 3AFNA 1XOIA 4ZD6A 2PU5A 4RS3A 1IN7A 3U5TA 2WU0A 3EISA 3FZNA 4P92A 1VE5A 5LZ9A 7AT1A 2YJ3A 4AG6A 2RIRA 3B9PA 4LGCA 4X54A 3SJCA 3DE2X 3TAHA 3BD7A 2HRRA 4BFUA 1ZMRA 1N6LA 4JSYA 1KEZA 2VHEA 2JBWA 4NWIA 1CRZA 1RYNA 2VF8A 1K7FB 2AG5A 4WK6A 5AHWA 5KQSA 3PFWO 5MN5A 4AKGA 1S2NA 3HVUA 4L02A 2CNOA 2WWVD 3H4IA 1D6JA 3WWEA 1EVEA 2BY4A 2JVKA 3KQMA 3OIYA 5G0UA 3NXSA 1L5LA 3NQ41 2QM8A 1NGSA 5J43A 5JAOA 1Y48E 1FU8A 3FNRA 3UENA 1JJVA 1MRSA 2IYXA 1QDUA 4ED9A 5DDIP 1PJ2A 5EKUA 1Z6YA 3AF5A 3KSAC 3BSFA 3QOXA 5EEHA 2DBYA 3I42A 3P71T 2I91A 4BVBA 5JI2E 3SBXA 2I6SA 4LKRA 5TMBA 4Q3NA 1HM5A 3BWXA 3OOHA 5DBFA 3H9EO 3KJIA 3VTAA 2D5CA 4DLAA 3HH8A 1G2PA 1JQ5A 3AY0A 4GPAA 5ALYA 4YRQA 2GZRA 3PEUA 3LC0A 3P5SA 1ZKMA 4BRZA 4EH1A 4KRFA 1W5TA 3G7UA 3GC6A 2ORIA 4HDRB 1UWCA 2GBLC 2J08A 3VAAA 3VDMA 5TDHA 4GPD1 3B1ZA 3RTEA 1U9ZA 2RHJA 1A71A 4LWOA 1CR0A 3WQRA 1M5RA 1FDRA 3N58A 2WYUA 1T2EA 4RMNA 5L51A 4OQZA 2CSUA 1JBKA 1W30A 4N3BA 3UC5A 4C08A 1PJ3A 3H7AA 3LQ2A 3O7MA 4LYAA 4PQFA 4QVIA 2SKDA 2QRVA 4XSVA 2Q6LA 3AT1A 2WU1A 3KZVA 4K6CA 3V8RA 1Q6YA 1QH8B 5F1KA 4Q18A 5J9FA 2I6QA 5AUNB 3E35A 1SCUA 3AJRA 3JU3A 1J42A 5DM0A 3PUKA 3AM4A 1A04A 3O4FA 3DWFA 4TMWA 1CJUC 5KZMB 2BJWA 3PQ6A 4A0HA 4EDFA 4PR3A 4QYSA 4QGAA 1YONA 1ZOIA 2YMMA 3FFBA 4GKAA 3TMKA 1Y1RA 1C3OB 1UDAA 4XE5A 2QA5A 4TXNA 3C5HA 1FTGA 4PGFA 2APJA 2WR8A 3CQ9A 3ZDEA 4W9NA 2ZK7A 2A35A 3M5PA 2V98A 4J0QA 1N6PA 5AFSA 4JP8A 1MZVA 5EJAA 4G37A 1WVMA 5DHPA 4ZKEA 3RT1A 4Y7DA 4F11A 5EAIA 2FHPA 1BXGA 5JNWA 4WDQA 3RRMA 3PGJA 4XQ9A 3B1VA 4OXKA 2P41A 4HNSA 1ZC4A 4DV3B 4DY4A 2CYCA 3FB1A 1AVTA 3N28A 5DGDA 1E5VA 1TFUA 1ZGJA 3WJ7A 4EHHA 1WSAA 4F06A 3FOBA 5HR5A 4FB4A 1WKBA 3DBLA 2JFBA 4MWOA 4MRAA 1U8UA 3U49A 1SKQA 3S40A 1FP1D 5AW1A 5CEFA 4I6GA 2FW6A 2Z2YA 3WRWA 3CX3A 4PF1A 1J8DA 4IINA 1E0JA 3M0EA 1CQJA 3QKIA 5T6MA 1H8EA 1URPA 2FQ1A 2RHGB 3KB8A 3ZHBA 1EGAA 2X0IA 4G1EB 1GG8A 1THZA 2G40A 3BILA 1QG2A 4FE4A 1LK5A 2MSKA 3B3GA 5KS2A 4LYGA 5FBKA 2G08A 3GO4A 5DW0A 5CPFA 1L4NA 2DVMA 1BE1A 1NC1A 4W5NA 4PXYA 4U5QA 5JSZA 3KQUA 1FRNA 2DLNA 5FTKA 3QUBA 2ZETA 4Q7JB 2NU8A 3GUHA 1KMHB 3TG2A 2NO0A 2Z58A 3S44A 1FA9A 3E81A 3E9DA 2R00A 2I7CA 3OTGA 3OURA 5KNCH 1XA0A 1Z3CA 1AJEA 4NP6A 5AQ1A 5JXWA 4OU4A 1C9MA 4AUKA 3GFSA 5HFAA 4G4SO 3T3HA 2G6BA 4JUFA 4MUBA 4H7FA 1HDIA 3PC6A 3GVPA 3JZMA 4JU8A 2YH2A 5F52A 4BN5A 2FPWA 4LBWA 3EZLA 3GARA 4A92A 1KGSA 1P7VA 3IV6A 3LV8A 4PICA 2B4RO 2CV0A 4K6GA 3SX4A 1KYVA 5K9ZA 3PK0A 2DMRA 2DHRA 3QLJA 2L82A 3TVYA 3UT5B 1FUYB 2BGUA 2EWWA 3UBTA 4BB5A 4M60A 1QMGA 1QR6A 1UP6A 1KPHA 2BSXA 3DAGA 2BE9A 1V4BA 1Q12A 1SBHA 2OWEA 4QREA 5CT4A 5HZMA 4HS4A 1L5KA 3GP8A 1LVUA 2RK4A 3X3HA 4FB5A 2J59A 3F2IA 4KPUA 3EDQA 3ER8A 3EOBI 3C85A 1JB1A 2X77A 4QQNA 1O95D