1Z13A

Crystal structure of bovine low molecular weight ptpase complexed with molybdate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
b'AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Crystal Structure of Bovine Low Molecular Weight Phosphotyrosyl Phosphatase Complexed with the Transition State Analog Vanadate
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z13A00
1M2EA 2Q5CA 5TQ0A 2HSGA 2WMYA 4OATA 3EAFA 1LJLA 4H3KB 5FBKA 4F06A 3SM9A 4L85A 4RY8A 1JFSA 1APBA 1GUBA 1NXSA 4W5OA 3OLWA 3O21A 2X7XA 2FSPA 4JASB 5HSGA 3DGEC 3IPCA 1IIBA 1GUDA 5DKFA 3TD9A 3TMYA 3LUCA 5TQJA 1HEYA 2IKSA 3RVNA 1VKRA 2NT3A 3BRSA 1LBHA 1BDIA 2AYXA 5PNTA 1OXBB 3K9CA 1QP0A 1Z13A 1YK1A 4LDAA 5CNKA 4LZLA 2RGYA 1NXPA 5TPZA 1A2OA 3F73A 4EVRA 3HUUA 2QVCA 3C3KA 3H5WA 1SD5A 3OMXA 3KJXA 4ETNA 1JF8A 1PNRA 1E6MA 3BILA 4LRQA 1Z18A 1AB6A 3L49A 2IPNA 3EJWA 3QLUC 4RK5A 5HQJA 5JS2A 4TMYA 2LUOA 3BBLA 1YK0A 1J56A 2H0AA 3HSYA 2PUFA 2M1ZA 4EYKA 2FLKA 2F8SA 2L18A 1P8AA 1BDJA 2WJWA 4QYWA 3RVQA 3TO5A 2B4AA 3RVPA 5IX8A 2QU7A 3LUKA 4KPYA 4MQFA 3OO1A 3OQNA 1XWWA 3KLNA 3H5IA 3DLBA 3HDGA 3HJFA 3CFYA 3CS3A 1ZESA 3SNKA 1NATA 5JNWA 2W42A 1ISRA 4QICA 2CWDA 2NUBA 5I4CA 4NCBA 4KQ9A 8ABPA 3GA5A 2MYTA 3B2NA 5EWMA 4OBBA 1QKKA 5EWLB 5GOTA 2HQBA 1NY5A 2I6FA 3T8YA 3QX9A 2L17A 4Q6BA 1FFWA 1SXIA 1RNLA 3DBIA 1XHEA 3TX6A 4CBVA 1JLKA 5TPWB 4P98A 5IUNC 2JVKA 1EWKA 5TPZD 1M2FA 4HNSA 4WUTA 1L5ZA 4RK1A 1JH9A 2FMFA 4D74A 1ZVVA 2TMYA 4YCSA 3QELB 3QLTA 4LDZA 3JPWA 1R8JA 2MYNA 4B09A 1PHRA 5KQPA 5B3JA 1YS6A 1EAYA 4MS4A 4G0OA 5KWSA 2QVGA 5IC5A 4PICA 5TQ2A 1QQAA 4Z4EA 4G97A 4IRXA 4XXHA 1JL3A 3KLOA 2YHBA 3NNDA 3RVOA 4RK6A 3VNAA 3DGFC 4O5AA 2FMKA 2QSJA 5E3JA 7ABPA 5JNUA 1D2AA 3CG4A 3BREA 3RVKA 3JS5A 3HUTA 4MRMA 3FFWA 5KQLA 5KQMA 2JK1A 4Z4FA 3E3MA 4MR7B 1ZH2A 2F8TA 5CNMA 1OXKB 5JNTA 4MR8B 1ZGGA 2LPMA 4QPJC 1P6UA 4G0QA 1XHFA 2FMHA 1PEAA 2R47A 3Q15C 3I5AA 3CU5A 4RU1A 3P9YA 4JAVC 1U0SY 4N03A 4H3HB 4JB2A 2FEPA 3A0UA 1ZHHA 3H6HA 4OLBA 2NZUG 2PKXA 5BR1A 1JHZA 1S8NA 2WRZA 4KFCA 3NHMA 1W9HA 2FXIA 3KG2A 2FMIA 4PZ0A 1CYEA 2PUCA 3LOPA 1ZN2A 3NNSA 5EWJB 1SXHA 2P4UA 4MQEA 1MIHA 4EYGA 1H9CA 1JX6A 4S04A 4RV5A 2PL9A 4LE0A 3HK2A 4OLAA 2ZAYA 4EYOA 1B00A 3MA0A 4QYMA 3RQIA 2PE5A 4GNRA 3RH0A 4P1ZA 1M5UA 1MAVA 3CTPA 3GL9A 1Z25A 9ABPA 1EWVA 1EFAA 1Z17A 3QEKA 4ZMSA 1W25A 3KYJB 4RS3A 1D1PA 3QEMB 4N47A 1YVUA 2E4WA 1MB3A 3F6CA 1Z2DA 3IP6A 1E6LA 4UHKA 4XAQA 4TN5A 1BDHA 3HXMA 2IYNA 4LX8A 3LUJA 3KCNA 3T95A 3OLXA 2FKAA 3HEBA 4D6XA 5DCLA 4G0XA 5BQ3A 1M5TA 3RVLA 1YMUA 4IF4A 4RK0A 4MR9B 4EYQA 2A9PA 2RDMA 5TQ0B 5B3JC 3CZCA 1DBWA 1E6KA 3JVIA 1DCFA 4EVQA 1TMYA 3SQNA 3LUGA 3NBMA 4MS3A 5JNRA 1VPWA 2PUAA 1T34A 3KTOA 5ED4A 1DC7A 4F8JA 1ZITA 4FE4A 2MYUA 4JP1A 1QQBA 2OENG 1JBEA 2YHAA 1A0OA 3Q9SA 2GBPA 2HJ9A 4XFKA 2CHEA 2MSKA 5JNVA 5CHYA 4F12A 1DRJA 3NHZA 2MSWA 2PJUA 2WB4A 5FWXA 2IDMA 4DN6A 2JBAA 4MLDA 4MGEA 3A0RB 3ILHA 4WWHA 1KRWA 3MYYA 3O1JC 4FE7A 2JB9A 5HKOA 1JWLA 3OLZA 2LBPA 2FTKE 1VRVA 3JTEA 3LKVA 3M6MD 4IMJB 1AB5A 1JYEA 3I42A 3FMVA 3RVRA 5F64A 3H75A 3L6UA 3KYIB 4D6YA 4F3TA 2GI4A 2MYPA 1TJYA 1RXEA 1ABEA 2E4VA 2VUHB 1EHCA 3GT7A 3CHYA 1E2BA 3HDVA 1YIOA 5CNIA 5IUKC 1LBIA 3LTEA 4MQFB 1DG9A 3GRCA 3H1FA 1USGA 4Z4HA 2VYCA 1JYFA 2P9HA 4YR7A 3OM0A 3N6VA 4PE5B 1GLGA 2GKGA 3IDOA 4RK4A 3KHTA 2O20A 5GQSA 2QR3A 5T7BA 1ZGZA 1YS7A 2A9QA 3BRQA 3VNBA 4ETIA 5FBHA 4Q6WA 1JDPA 5DGCA 3OO0A 3RVSA 1KRXA 1Z16A 2MSLA 4Z9AA 1C4WA 4JA2A 2PAFA 2ZWMA 4G0MA 3EQZA 4RDCA 2E4XA 5EWMB 1K68A 4W5NA 1USKA 3S99A 4Y9TA 2NT4A 1JFTA 1QMPA 2QV0A 4MS1A 3IP7A 3T6KA 1QO0D 1CHNA 1DCMA 1LJUA 1D1QA 4YRZA 4YV7A 1QP7A 4Z4IA 3D02A 1NXWA 2E4YA 4DQDA 3H6GA 4LE1A 4WXEA 2NZVG 4Z4CA 1Y1LA 3JY6A 4G0ZA 1SRRA 3UKJA 4S05A 3OMWA 1DZ3A 1RPJA 1PUXA 4ETMA 4KREA 4RWEA 6CHYA 4WT7A 3E61A 4MS4B 3N0XA 3FGZA 5FWYA 1DJMA 4JB0A 2WY2D 2V0NA 1P6QA 5IBQA 3HCWA 5TQ2B 4RXUA 1K66A 3EDCA 3IP9A 4MAAA 3F6PA 4KMRA 4F11A 4HNQA 3CLKA 1U04A 1EWTA 2E4ZA 3MIZA 1Z12A 5ABPA 1D4ZA 5TE9A 5IEJA 2AYZA 3MMNA 1YMVA 4WXMA 2HQRA 2ID9A 1QP4A 3N75A 4M88A 3GBPA 4TLMB 4MRMB 3FDFA 2FEWB 1ZAYA 4LE2A 1TM2A 4MLCA 1TLFA 2JVJA 2PUEA 3ROFA 3N8IA 3LUDA 4YP9A 4N76A 3KSMA 4G0YA 1VLZA 1I3CA 1MVOA 2JVIA 2FQYA 3O1IC 3IPAA 2FLWA 5T3YA 3Q7RA 1JDNA 4XLTA 2IPLA 1URPA 2OQRA 1PNTA 2J48A 3K4HA 4KV7A 1QPZA 2IPAB 3IP5A 2ID7A 4RZSA 2R48A 2GWRA 3FFXA 2DRIA 3O2JA 4TLLB 4KK4A 3C97A 3O74A 4YGXB 1BAPA 1ZDMA 2LP4Y 4Z9BA 3RVMA 1U8TA 4ZMRA 2PUDA 4MPTA 2HPHA 4Z99A 3MF4A 3OM1A 2WWVD 4FB4A 3SAJA 1DCKA 3MQ4A 3C3MA 3DZDA 1F51E 2R4QA 6ABPA 1BVHA 3H5OA 4WZZA 3OQOA 5IULC 3LFTA 4OG2A 2L19A 1QO0A 1NXXA 3HVRA 2FEKA 1PEYA 4G86A 1DBPA 2RJNA 3NNNA 4N0PA 1RZRA 2JRLA 1UDRA 5C5EA 1DBQA 2KYRA 3I09A 2CHFA 3ROTA 4ML3A 3GYBA 5BRAA 2QZJA 3HM9A 4MYRA 3D8UA 4RKQA 4KQCA 3QX8A 1MB0A 3JPYA 1GCGA 4O1IA 3Q7TA 2HQOA 4W5QA 3HV2A 3SY8A 3URMA 4MS3B 4HNRA 4RSMA 4E7PA 3G85A 4ZJPA 4HYEA 3Q7SA 3OLVA 2H3HA 4XASA 3O1HB 1FQWA 5KC9A 3R0JA 3H5VA 3LUAA 4NCAA 4W5RA 2L2QA 5EWLA 2PUBA 2A9RA 3GBVA 2FQWA 5BRJA 5DTEA 2PLNA 5FWXB 5TPWA 5C5CA 1JFVA 2FN8A 3EODA 4DADA 3TB6A 2JBAB 3M9XA 4NICA 3KS9A 5DLEA 3N0WA 1KGSA 1TVMA 2VUIB 3JVDA 4GPAA 3O2SB 2FVYA 2FW0A 3QLVA 2PUGA 1LK0A 3FFTA 3H1GA 3QELA 1NXVA 3SG0A 4EY3A 4EUKA 3KKEA 4W5TA 3CG0A 1U2QA 3I45A 4NV3A 2E4UA 3ILYA 1ZY2A 3OLYA 4E7OA 2BGGA 1DRKA 4RXMA 2N9UA 1KMIY 4YS6A 3OQMA 1ABFA 4RXTA 2A9OA 4Z0NA 1USIA 1QNLA 4KNYA 3N0RA 2GX6A 5IEBA 4EGSA 1DC8A 2RJOA 1BA2A 2FQXA 3A3KA 3F7NA 1RZRD 4N0QA 3CNBA 1FSPA 2LIVA 4H60A 2PL1A 4ZPJA 3HO1A 1DP4A 5JNSA 5KQGA 3EULA 3M9WA 3LMKA 4G0PA 3O75A 2IPMA 1RXIA 4MR7A 4PYRA 1FFGA 3EQ2A 4N41A 3Q41A 3LKBA 3H5TA 4RK7A 2WJAA 3LUFA 4MR8A 4ZYLA 2PMCA 3DLHA 2B1JA 3W9SA 4Z4GA 1SXGA 3HS3A 5KI6A 3CZ5A 1L5YA 3T38A 4YLEA 4EVSA 3QLUA 2VK2A 3N53A 4MS1B 3G1WA 1FFSA 4KK3A 3MM4A 1Z15A 1GCAA 2XDYA 3QK7A 1ZH4A 3LUHA 4PEVA 2M98A 4Q7EA 1Z26A 3UUGA 5JS1A 4RKRA 4YO7A 5EWJA 4IMIB 4IGAA 4O1HA 1C0EA 4YWHA 1NTRA 4RY0A 1YTUA 4JOQA 5IUJC 3CKMA 4OTZA 4RY9A 1P2FA 3O2QB 2JCGA 4XARA 1Z2EA 4L4UA 5KC8A 2QXYA 3EGCA 3HZHA 1NXOA 1WETA 5D2CA 5FWYB 2CD7A 3RVJA 3QEMA 4KVFA 4UHJA 3GV0A 1CEYA 3CRNA 1F4VA 2QW1A 4KZKA 3C6QA 5HM6A 2R25B 5CNJA 3UK0A 4KRFA 1NXTA 3A10A 3C3WA 4IILA 3H5LA 1U2PA 4NQRA 3H1EA 2FN9A 2IOYA 3GWGA 3QLVC 1ISSA 1D5WA 4MQEB 4MR9A 1A04A
chains in the Genus database with same CATH superfamily
4Z51A 5ITWA 4GBGA 4NQZA 5H8WA 2HSGA 3WRVA 4GGMX 4J0QA 2G4VA 3FBWA 5LVAA 4C6TB 1N5IA 1Q20A 1B2LA 4IZHA 1ID8A 4NU6A 3TFQA 3O9MA 3VR6H 1A5ZA 4I99A 1CRQA 2FSPA 3A3YA 1FSZA 2OGZA 1PJBA 3EFOB 4KTTE 1RAGA 1GTJ1 1I3MA 1DO8A 1ZP6A 1Z5GA 2GD0A 4KNWA 4YRMA 5B7PA 5M34A 4A36A 1NM5A 1U2RA 1Q6ZA 5BPHA 4B74A 4MWTA 4Q3KA 5TQJA 1HEYA 4URZR 1SD1A 4C21A 5E6UA 1NR1A 1EFPB 4UBNA 4R3UC 4UM8B 2PJDA 1PYGA 4J0IA 1YK1A 1JR2A 5K3CA 1NIJA 1XTBA 2VJAA 2OD9A 3BF7A 3G2KA 4YDSA 1EWQA 2G5CA 4LCEA 4ZD6A 1MGPA 1GL3A 1BOFA 4PSUA 3HEMA 3MGBA 2X1LA 1VIAA 5F2OA 4FS3A 2X2FA 4RAOA 4ENWA 5AXDA 3NOQA 1G5TA 5C3MA 2BN4A 1L4BA 1N0IA 1H4TA 3W3ZB 1GTMA 1Q3HA 3AIMA 3PA8A 2IEIA 1IY9A 1ZM2A 3QKTA 4H35A 4EZIA 1W4ZA 5HM8A 1OGJA 1K9VF 2QX4A 2VP5A 1ACLA 3GUYA 4WJLA 1RPAA 3BBLA 1YK0A 3I53A 3K5WA 4UMFA 4RDIA 5FADA 3A9CA 3F5DA 1BMTA 3HBJA 3ZU3A 3HSYA 1ESZA 5J2TF 1NDUA 3HWRA 2R1UA 3SJCA 2M1XA 5AVQA 1MOZA 1P8AA 3EGXA 1JLLA 2IOHA 3AG6A 1NMZA 3BMQA 2WWYA 2ZDHA 3A9WA 2QU7A 2VRCD 3U1TA 3SXPA 1V1RB 5FL7D 1TAGA 3S2FA 4AUKA 4YREA 4MGHA 2NVWA 3OO1A 3IP3A 5SYNA 3KLNA 4R7TA 2C04A 3C6KA 1UMBB 4TUYB 3CFYA 3KC2A 4BU1A 3UJ7A 4XSVA 1L4MA 3UA3A 1O0BA 4BXOA 4QECA 4R2IA 4XVRA 2R68A 3IT0A 3M33A 4QICA 3VI4B 3W6NA 4EDHA 1C8KA 1HYHA 1LU9A 4AJKA 2H2GA 2CSUA 4DCJA 1ECCA 4QTYA 3AESA 4F3RA 3NAGA 4HN9A 3IELA 4R9UC 3EXIA 5LQDA 2NWQA 5TQVA 2OCAA 3G82C 3PNSA 3JWGA 5EJ8A 2ZYGA 4KTVE 3GLIB 2CDAA 3I6YA 1U1GA 5K03A 3RAGA 2P67A 2M9MA 3QIAA 4CT4B 3SKYA 1E1CB 1UAYA 4RTPA 3WWEA 4QGGA 5AK4A 1DEHA 3D8BA 3QVWA 4RK1A 1JPJA 5AVUA 2X9NA 3TLJA 2BFOA 3D8SA 6AT1A 3IEXA 1DKUA 3RYTC 4UNRA 5DLYA 1ZLYA 2W2KB 4TL8A 2OK7A 4N82A 1KOJA 3O7MA 1R8JA 2NO9A 2WA1A 4BASA 5AJTA 4CBVA 1G8JA 1PHRA 1GG8A 2IXFA 2UZAA 3OTOB 1RJFA 4O4JA 4A91A 5KWSA 1U1DA 1T4CA 3KSRA 2CUTA 3QLEA 4HR7A 2CC2A 1JG7A 1KJIA 1TU3A 1ZNWA 3BXXA 3HLKA 1NJ2A 1Y3HA 1YV9A 4GI1A 5HQ3B 1WXEA 2CMHA 3KT6A 3LY8A 2FG7C 4QNRA 2DSTA 4N6NA 4EO9A 1GY8A 3W5CA 5D7BA 3W5HA 3EZ2A 3R0XA 5AJUA 3LA8A 4KG7A 3DLPX 5J2UF 1BHSA 3RAEC 3PYXA 1W7AA 4JMPA 2CMDA 3F7MA 1LPOA 5CGZA 2BUCA 2EL9A 4Y1GA 3CH6A 3DAOA 4LHVA 2ZXUA 5DWDA 1MLDA 3L84A 1F0KA 4HH0A 4BNNA 3ZY4A 3N2YA 4OXYA 2P9TA 1X8XA 4JI5B 5C51B 2FMHA 3CXUA 1F7UA 3Q15C 2R6DA 3CU5A 4LRYA 4TWRA 3QVVA 5F5LA 5I4KA 2FEPA 1DQYA 3LX6A 1U7PA 3SIWA 3L77A 1PT5A 3E9MA 3WL3A 4LGYA 4UOZA 1M8JA 3HKBA 2A86A 1Y5LA 1Z75A 2G63A 5JBNA 4W7HA 1AHHA 2PBRA 1GG9A 4DSZA 5EWJB 4TGLA 3D8RA 1OIWA 4LE0A 2HBZA 2GTPA 1N4DA 1Y9ZA 4J0CA 4EELA 4EQ6A 4OL9A 3T5PA 1RYDA 4NFLA 4XM1A 1KXJA 4OUDA 3RJMA 3ZNOA 3ZTYA 4C3OB 3I2KA 1IVYA 1KI6A 1RTTA 1D2GA 4IFEA 4NBKA 4PG8A 1RLOA 2JGAA 3THXA 2DGDA 2QVXX 1C1YA 1Y3CE 3NC4A 3SYNA 2QM8A 4A5SA 1NVXQ 3X1ZA 1H1DA 2JGFA 3S2ZA 5CM8B 2OBLA 4XGNA 4XAQA 1WL8A 3A27A 3PFFA 3O26A 4XKJA 2X0DA 4YMHA 4Y1FA 4LJ4A 4GDMA 3JASA 4U8GA 2Q3MA 4CCSA 3UHJA 1H0KA 1F5NA 3PIRA 3KB2A 1PWZA 4KSCA 3ZLTA 4D3XA 3M8KA 4D4JA 4EYQA 1GDDA 3IHWA 3R74A 2DT5A 4ZCPA 5EJEA 3E70C 1PBNA 1F4PA 3GFSA 3I8OA 4MO9A 1NI4B 2PX3A 3A1EA 2G9UA 4EKGA 2ZW9A 5HTKA 5B1HA 1GAEO 2PD4A 4EVQA 4M53A 4KFTA 3A04A 3B1KA 4DQ0A 1JVNA 3UT5B 1PTJC 2ODAA 1D04A 2EOAA 2P5YA 3QU4A 4GLBA 5FPSA 4DC0A 4F8JA 2HBRA 2GN0A 4WBNA 2WAOA 2WYWA 3C3XA 3NTQA 2R60A 1GZDA 4NK4A 2OYRA 4DMCA 1LDBA 3DCIA 3RS7A 3TXYA 4DNOA 2UXDB 1TMGE 2OORA 3O7WA 3OPYA 4ZIRB 5JJBA 4CG0A 3FUVA 4DNFA 1KDTA 3DDWA 5EHGA 3FHLA 1Z4PX 4IYRA 1IG0A 5I9BA 3CT4A 3SIRA 1W94A 1ISGA 2YHIA 4EY6A 3DAGA 1LSOA 1BS2A 1YVPA 1FQOA 3PFHA 4NENA 2ZCUA 5CW1A 5AXCA 1ZR4A 1OWPA 1ZVMA 3E81A 4BPBA 5IKXA 5CDUA 1XA3A 3INNA 3KIPA 5FCDA 5CJPA 3FLMA 3RGGA 3WSWA 1BFDA 3WOHA 2LBPA 4CQMB 1TD1A 1TUBA 3DT6A 1K6XA 2VTKA 2W2OA 4OUKX 5CXXA 3AERA 3NKVA 2MTBA 3LPMA 3PXCX 5DHUA 2O8FA 1XZPA 1RWQA 4DY4A 1BE1A 4RHTA 3TTWA 1FXWF 3FCYA 2HT1A 4QLAA 1E4EA 4AZ0A 4CLHA 3GLQA 4OJQA 5CVCA 1BXKA 4YUWA 2B5WA 2D3WA 3GLSA 5DNAA 1GN9A 4DUGA 1W0JA 2C8LA 5H3LA 3KB1A 3SDSA 4GH5A 3GLHA 1TM7E 4Y2YA 1JYFA 1CUIA 2FR8C 2H5LA 4FGZA 4HO1X 1D09A 3UXYA 1ORDA 3CLTC 4RVUA 1HGXA 1ODSA 4DLAA 1EQAA 4CZ2A 3DE2X 4WKOA 2XNDA 2HRBA 3KEMA 4QQRA 2WVJA 5BUSA 1EE1A 5JFTA 1SCIA 1OREA 1DS6A 2OSVA 4ZT2A 3KETA 2J6BA 2PAFA 4EHIA 3N86A 4DB2A 2RI1A 4U9IS 1OHHA 4F5YA 2NT4A 5CIWA 1QMPA 1WM1A 3IP7A 3P9QA 1U3VA 4GD3Q 3UH0A 4G4GA 4JFRA 3FM9A 4IHJA 1A5TA 1KJJA 1XKTA 2C03A 2K6GA 3O93A 4WN9B 5LBUA 2B7LA 4CTNA 1IH8A 1DV1A 2V1XA 4IQ0A 3AR8A 3HA7A 3D02A 2UUAB 1D2NA 5CK5A 2OAEA 4HDSB 2QF7A 4BVLA 3TW0A 2C94A 4UULA 2P77A 1ZK0A 4TQAA 4PTZA 1TVEA 3AY3A 1AMOA 1GGMA 4X90A 4KREA 4X84A 3DVLA 4WT7A 1N25A 4O02B 4LVNA 1QGYA 2HK7A 3PWZA 4K0KB 3MJCA 4LRUA 3LNTA 5LKRA 1UZLA 1PZMA 2W93A 3JZMA 3UV3A 4NK5A 5ENDA 5AIBA 1RBQA 3UCFA 4EEKA 1K66A 2OESA 3A11A 1BCRA 3EUAA 1Z6GA 4MAAA 4KMRA 2QD5A 2G40A 3NXSA 3TVDA 2XKAA 2J5BA 4ZV9A 1S2LA 4TYPA 3MIZA 3VHXA 3EEYA 1H3EA 3FNGA 4LISA 5KOJA 1CEEA 1K5HA 2W71A 2WIBA 3AF6A 4FFMA 3T7KA 5FQOA 5AW8A 3M4XA 4UVHA 5FYDA 2ID9A 5DGTA 1POWA 1N3BA 1D4OA 4ZAGA 1VLVA 3FDFA 2FEWB 1HI9A 3IOCA 4R9RA 4W7IA 1KTIA 2GNAA 2GSWA 3NDPA 1DJNA 4OGGA 1VSTA 3Q98A 2CCJA 4ZALA 3FZEA 4HXEB 4LDRA 2ZUEA 1N2CE 3WFIA 4A0GA 1PQ4A 1FP7A 3V46A 1V7PC 2JFZA 2I4RA 3B3QA 4UTNA 2AD5A 1TJ5A 2W6QA 3ISVA 2GXSA 4L5JA 3WQSB 4E2FA 2JF0A 4MLZA 5EIBD 2XTNA 4ND8A 1TW3A 4Y2PA 4D8TA 1UMDA 3DG9A 4D4KA 5ILGA 1WY5A 3KTAA 3AVUA 1HSOA 3S44A 1QQ6A 1BAPA 4RUKA 4KBFA 1XNHA 2I29A 3EDYA 1V25A 2OVFA 5IAOA 3C6XA 4Q66C 1NGSA 2I2CA 3OM1A 1C4KA 3PHLA 4LX0A 2GYUA 4Z99A 3RAPR 4CM7A 4E15A 3K73O 1Z6AA 3GLUA 3PDIB 1U3FA 1K7FB 3QJGA 2H65A 3DFKA 5K1ZA 4YONB 3CA8A 3S2UA 1J22A 3ILSA 1Z56C 4L75A 1RFGE 3GRYA 5E95A 3Q7QA 3D6MA 2IW1A 3WBBA 4M0LA 2QMUA 5JQGF 2PS0A 2W2QA 4IMPA 1WVGA 2WYHA 4RM2A 4B79A 2W4MA 4HN2A 4CLRA 4B3RB 3A58B 4Q02A 3E23A 2IEGA 3G8CA 5EXSA 1EXMA 2J30A 1ZR2A 4R31A 3WGLA 3BWBA 2R6HA 4K1LA 1HKUA 2PS3A 5E9JA 1ESDA 3FBTA 1SBQA 1I01A 3WGGA 2VNSA 2XF8A 1RABA 3WBKA 2Z2IA 1CERA 2X41A 4ZHQB 2O7QA 4Q0MA 5DW0A 4D0NA 3HV2A 3EFHA 4OQPA 4JYAB 3SEFA 4NBRA 1Q0LA 2H2AA 4Q1AA 1Y4SA 3RYFA 4WCDA 5JAIA 1FQWA 4UVEA 5JV5A 1Y6QA 2RAVA 5C8XA 1E99A 1X9HA 2G77B 3ZWOA 4AF8A 4BFSA 4C0HA 2JGMA 4K9OA 3N28A 5SY6A 4RA6A 3ZVMA 4J0KA 4B46A 1NVVQ 4RVOA 2PUBA 1OI7A 2G8LA 2Y2VA 2R2GA 3EXHC 1EGAA 1G21E 1I2CA 4KL8S 4DR5B 4HVTA 4PHGA 2ZJ1A 4RHEA 3MOIA 1HZZA 3RK4A 2ZVQX 2ZIXB 3O2SB 2CLKB 1P1RA 3QXSA 2A5FA 2JEOA 3P2JA 5EJFA 1R18A 2N75A 1HDEA 2QNRA 3OD1A 3GRKA 4FKZA 4N5MA 2W11A 5H7XA 1E0KA 2CXXA 2WKQA 3HU5A 4ZC1A 3WKCA 3ZHQA 4KXMA 3FKQA 1NYLA 3WYGA 5JD6A 3TDNA 1CS0A 3S4YA 4UHHA 4AN1A 5B6IA 5IM4A 3FVTA 1NONA 5K8TA 1XZMA 4JT8A 3E58A 2GRUA 3OJOA 1O0SA 3RHFA 4DV2B 4JCCA 1U7WA 3L46A 1RKVA 3IKJA 3NUQA 3OCVA 4IIGA 3RIYA 5IANA 4PS1A 4AWBA 1U0HC 3IAXA 3PPVA 4N7BA 2E3JA 3V4VB 3ZY5A 4HYQA 2NV6A 3DOFA 5HIKA 5BN3B 4GQIA 2XMBA 3OE7A 4V3CA 5F7JA 4JUIA 4LHEA 3KVVA 1Y7TA 3GBSA 4ADSG 3NV9A 3R9XB 3KBBA 2O2IA 1K1EA 3WB0A 2B6HA 3EJ6A 3A4TA 3MMZA 3JALA 2QOEA 1ZZGA 2BGRA 4QUIA 4ZOLB 1FQKA 5T67A 4TRMA 3UJ8A 4P4SB 1AGPA 2C2GA 1HNNA 1JHUA 1PEKE 4WNCA 4I0WB 4ZV4A 3K70B 2AWOA 1U0OC 2YJTD 3B1WA 1GIAA 3T94A 2NVUA 3RTBA 3N59A 4N5HX 1GCAA 2ADMA 3QK7A 2FFRA 4F4CA 2XUQA 3GGOA 4OA5A 1RXYA 3SEQA 4WQMA 4PFSA 1Y1TA 1EHYA 4MW1A 4QHSA 3ZJVA 3NAQA 4RC9A 3EISA 1V5IA 1TC2A 2ZJZA 3HYSA 3TZHA 1YZYA 4O2AF 2RGBA 3N07A 4XCVA 3WJ7A 1WABA 1JR6A 5I7AA 3D1LA 3D5TA 1TIKA 1NXOA 3WMXA 3EWSA 2D2EA 5FWYB 5JXHA 3ND9A 1CLEA 4ER6A 1WWKA 3K09A 3IHLA 4N1AA 4DLXA 1RTKA 1IN5A 1UPTA 3VYSB 3H9EO 2ZZNA 1B76A 2JIZA 2VHYA 3UK0A 5CXQA 2GZ1A 3WWDA 3GGDA 3IE2A 1B8NA 2IOQA 3K0SA 4IKPA 3WK6A 5I8ZA 1H8ED 1HK7A 1M2EA 5C4GB 4G67A 3SS7X 3IAM6 1S3GA 1NAHA 9ATCA 4HDRA 1LBTA 2VNKA 3RV3A 3OZIA 4Q7LA 1Z4IA 2GK4A 3E6AA 2Z98A 1E98A 2EKBA 3D31A 4ENTA 2VYND 3GFBA 5EIWA 1O6BA 2R7LA 4RYLA 1JQDA 1GUFA 4NCIA 3K1TA 4D3ZA 4C88A 5EE5B 4YCBA 4KR9A 5CAEA 3MT0A 1BDIA 5ER9A 2YWCA 3DAPA 3B2EA 1X14A 2GA8A 5FBVB 1J6UA 4LDAA 3IUJA 3V8BA 3PCTA 4JOCA 3H2GA 5CPFA 1U4OA 1PNOA 2R85A 3GN2A 1AHPA 1FFEA 4A26A 1B8UA 5LOVB 3P7MA 3VPGA 1G7CA 2CL0X 3NWOA 1JE1A 4U6SA 1ZRSA 2RCNA 2PIDA 4D42A 2ZR9A 3AHIA 2CLOB 1PNRA 2DKNA 3RREA 3JZAA 1MEEA 2AMJA 3E03A 3FROA 3L49A 3NT5A 3V2GA 3D4IA 4AZVA 2NQ2C 4PF1A 3PX7A 1BVRA 2D2IA 2Y1OA 3EF1A 4YRDA 2PLRA 3L8GA 4LYYA 3T5CA 4YRIA 1BCSB 2IUUA 3W7VA 3K9WA 3KOXA 2ORED 1WZNA 2IYRA 2C7BA 2JZCA 2N0SA 3I9MA 4CM1A 4I1PA 1Z4MA 4ARZA 2W2MA 3AY7A 1S2OA 3VKGA 3H8VA 4TLBA 1TAUA 1MHPA 1HDCA 2BFPA 3AM3A 3HFSA 3KYDB 3QOYA 2CLHB 1N8NA 1SK8A 2CNDA 2XA2A 3BXFA 4DJ5X 2B78A 3IR7A 1XQXA 5CA1B 2FF7A 3PPIA 1SHKA 2AXPA 5I45A 2EW8A 1TKCA 3HJFA 2Q3EA 2LIPA 2AZDA 2XADA 4J6EA 1ILWA 1LV8A 3CRRA 3HCPA 3ON5A 1KH1A 1Y8AA 2HFJA 5AKXA 5AHKA 4QBIA 4OK3A 2IY7A 3U4QA 3I0NA 3E9DA 4L95C 4OBBA 3TZCA 5GOZA 5LMCA 2EAUA 2VT6A 1N0HA 1M2VB 2PSDA 1NASA 1E0AA 1ELOA 3WTBA 2ZSJA 4DLUA 4YRBA 3MWDB 4DIDA 4ID3A 1VJDA 1TTPB 2N3ZA 4U2KA 5CT9A 4DMMA 4QVIA 1T5LA 1VJ0A 1WPGA 3MGCA 1QZUA 1WMDA 2MSEB 2Q4BA 2TMYA 1FLAA 3QLTA 4YPFA 4UOEA 3ZDAA 4DJFC 3WLSA 5KNBH 2AE1A 3EH1A 4M98A 2OM2A 3RJTA 4Y0AA 1JS1X 4B09A 2AC7A 4GYJA 5H02A 1A9XB 4I4TA 4EA9A 2Z1DA 1CZRA 3AYZB 4MYUA 3CJTA 3I01A 5JMTA 4DMKA 2AJBA 1X7XA 2WICA 4A8HA 1KQGA 5AVSA 4MUXA 2QQ5A 2VT7A 3I6IA 3MT8A 4OQZA 5FPKA 2RBEA 3DC7A 3QA3E 1IBKB 2JBHA 1P7VA 2X13A 3EBOA 1G18A 3I4FA 4I5DA 1BA3A 2G9QA 2QSZA 2ZYAA 3TSAA 1W48A 1Z33A 2HB6A 2HNAA 4J7UA 5KMGA 1GZ7A 1N9ZA 1W35A 1RHJA 4FWBA 5FWAA 1T5OA 3PHBE 3ESCA 1Q1GA 1Z8DA 2ISSD 1RLMA 3BQNB 3E3MA 3HXPA 4RPKA 2OTCA 1UBLS 4EWLA 2JNWA 2PGDA 3DSRA 1UF9A 3E7WA 3GCZA 4CUZA 3W5BA 2DUJA 5EJIA 2EJWA 2HQSA 3LV8A 1Z88A 4L08A 1YTLA 3QBVA 5AKLA 4B6PA 1M34E 3A0UA 4UU7A 3I04M 3PD7A 2W00A 5JXIA 2DWQA 3GD7A 4ARIA 2PX5A 3QLJA 3QPWA 3RU3A 1VGVA 3G0GA 4FCVA 5BUZA 2W6NA 4ESHA 2WSYB 2B2XA 1FRVA 2H59A 4FEAA 2ZIGA 4MP3A 2GCOB 4MUAA 4MQEA 3TTUA 4E5VA 2NO7A 3Q9UA 4YQYA 5GJVC 2XUDA 4OLAA 3UJNA 5DHTA 5EMHA 3MBOA 1MX1A 1BE8A 3D6AA 3ZHVA 4BMZA 3K9LA 1DOZA 1AXRA 1SCUA 3MWLA 3PXXA 2DFTA 5CFQA 4P1ZA 1MAVA 4TV8A 2WHPB 3CTPA 4FU0A 2F6RA 1KPIA 1OW3B 3W8FA 3ZBPA 9ABPA 1DZIA 1XTKA 2PLFA 4LOAA 3LYLA 4N47A 4YUYA 1QV9A 2VHXA 1G63A 3D7MA 1CCWA 2IOFA 3NTXA 3HP7A 4OHOA 5CIQA 3A4YA 1Z2DA 1AHNA 3B6EA 3VDNB 2GQ0A 2JCBA 4BN4A 2IYNA 2QLNA 1JTEA 4B3HA 1DB3A 1FBNA 1YI1A 4XWOA 1LK7A 4G0XA 1ESEA 2P69A 4CDNA 3T52A 2BR3A 1NRIA 3TIIA 3LHIA 4IDQA 4DG8A 5JAQA 3E7DA 4NECA 1QF9A 4RK0A 5K6AA 2Z2XA 4FSXA 1HDRA 5F1YA 3V8PA 3R7FA 4JJEA 4LKOA 5DYGA 1UJNA 3T7CA 2G25A 5FOSA 4M8SA 3T9DA 1H69A 2ZXEA 2PGAA 3N2NA 5JD5A 1ISPA 3TLEA 4LVUA 4PIPA 1VPWA 2PUAA 1HT2E 3FPAA 5DM0A 4GDFA 4QJBA 1TVKA 5J1SB 2P2ZA 4RY2A 2R1ZA 2XE6A 3GCXA 1MF7A 4H7JA 3GD5A 3UMVA 1YQXA 1T2FA 5LP6F 4ZTBA 5DHRA 5JNVA 1H2XA 3VQTA 2VDJA 3ZE7A 3U48A 5JEEA 4ZYXA 2OFOA 3DHVA 1PT9A 2CZGA 1P62B 4FDUA 5JVDF 1WW8A 2BEWB 4TYNA 1I2BA 3GLGE 4G0NA 1QHHB 3UBTA 2ZB3A 3RBZA 3ABQB 2JA2A 3I3SR 1SKMA 4YRNA 4QVGA 5I8PA 4YBRA 4ZFNA 5DN6A 3T3DA 1UMCB 5DYWA 4COOA 2BFFB 4G1VA 2WP0A 4GMGA 5LL6P 1JWLA 5CFNA 1ZJ5A 1EU1A 4D82A 2IK8A 3LKVA 2OQIA 4RZUA 4RL4A 1BS9A 4C01A 3FMVA 1O1YA 3NJ8A 1MO3A 3PLRA 4OHWA 2NYUA 2YZNA 2QD2A 3EZ7A 4DSUA 1DG3A 4NDNE 1U4SA 1I7LA 1T6NA 1RXEA 3JTMA 5K4AA 1QQTA 2XZLA 5F7OA 4W1SA 3QWIA 5IBCA 4AJIA 3ADKA 3SHOA 1WD5A 3HFJA 4RLQA 3D3EA 3ZGZA 1G8SA 5CNIA 1A88A 3WC4A 3LBYA 1DG9A 1UBUS 13PKA 2CL6X 5CHEA 5KOYA 4AP9A 2JDID 1N6OA 1XTVA 4PE5B 2P3OA 3L0YA 3T34A 2ZSIA 5ED0A 3KOWA 4XB2A 1GNPA 4A8JB 3LP8A 3S6JA 1WUKS 3KYCA 1C3JA 3OAAA 5A4KA 5JS1A 2I54A 1JDPA 1KRXA 2D59A 3LA6A 4TTRA 3GJ4A 1DAPA 1TEHA 2AHRA 4RFLA 2QMQA 1XDSA 2F43B 2XQKA 4F5DA 1RLIA 2B98A 3OPQA 3PQFA 4QXRA 5H82A 5B1EA 2BLNA 1I4LD 1V41E 2QRVA 3ABRB 2IUTA 1GAWA 2GAOA 1ISFA 4J8PA 4O4IB 4FOLA 4W63A 5J5CA 3VUFA 4BNDA 2ZQYA 1B8OA 1W2WB 3BA1A 3WB1A 4A15A 2SKDA 3KR2A 4CMCA 1G5IA 3TUZC 2IZOA 4FFWA 2RHRA 1Y81A 2B8WA 5I01A 2QTBA 4M54A 4ICIA 2QN8A 2X0NA 4CF6A 2QG6A 3BFPA 3GAFA 4AJLA 4S05A 1VHLA 3OHPA 1S89A 1T5DX 3ZD8A 1TRHA 4ERXA 1ZINA 5CW2A 1SG0A 4C5BA 1C9NA 1QCDA 1RMTA 1GSOA 1V8OA 2GGSA 2UZ4A 1UK6A 4CG3A 3I2FA 4N3AA 4U2GA 9LDTA 2JAUA 2EZTA 2C29D 4JJGA 3VO1A 3ZD6A 1R3UA 4HNQA 3M5PA 4Z9XA 3DKIA 2E0IA 2YFYA 4FTWA 3U3RA 1NVBA 3TTVA 1XN1A 1XEXB 4JBXA 4I1SA 5ICMA 2KWIA 5TV2A 4LDQA 3VGPA 3IHTA 4MV3A 4HTAA 2I0FA 5FOVA 1EDEA 1KI2A 2HTFA 1N33B 4FPXA 1Z3IX 1BE6A 4I14A 1OI3A 5MHTA 4ZO7A 4PC2A 4LQCA 4P4GA 3JZDA 2CLFB 4N76A 3DPIA 1QFJA 1RM3A 3ZS9A 3HBAA 1W2GA 4QT0A 3W04A 4D80A 1EFRA 5GJCA 3RARA 3COPA 4OP1A 2XNDD 2YWFA 3P4YA 2XECA 4OHPA 5KOHA 1TZKA 4PNPA 5EZ6B 4V0NA 1IOWA 1PNTA 1QPZA 4UBKA 2OQVA 2GM4A 3OJ0A 1VG0B 2BR4A 2REQB 3CX6A 3GRUA 2O14A 1KFCB 3DTTA 4CV0A 4ZYYA 4ZZ0A 1C50A 1O77A 1AUPA 1QNFA 4YJKA 5AI9A 4DMUB 5DNUA 4OOEA 1AKNA 3CVYA 2B2CA 4N54A 2W5UA 3HGTA 2E1PA 5A0FA 4BO7A 4HRAA 1W0KA 4KFRA 1XKQA 3V6LA 2Q1TA 2WWVD 2RB4A 1RS0A 1DCKA 3G0BA 2DBVO 3KQHA 3SJ7A 4WKPA 2IFTA 3PQ8A 4HBGA 1TEZA 3NTOA 821PA 4S35A 3ILVA 3WQRA 1N6PA 1RYMA 3SMQA 1VE3A 3PYLA 3EWIA 4G23A 1QH1A 1V8BA 3HVRA 3GHYA 2C77A 3VVCA 1RZRA 1OILA 2WHYA 5DGIA 4WLUA 4GP6A 1PZHA 2IYPA 3PQ6A 5FV7A 5AWFC 4B40A 1PNVA 1ULUA 3V9AA 4DABA 2KYRA 2SNIE 4HQOA 1CB7A 5F12A 1SQFA 2RJ3A 3G2QA 3QFSA 5I9MA 3L0DA 4JKOA 3KKKA 3W9UA 5G53C 4JB3A 4RKQA 4DLYA 4U7FA 1RP7A 2WTNA 4RHCA 5TARA 4LI3X 4IUBS 1H8HA 4YMVA 4IL5A 1Z5NA 2Q2OA 3EA0A 3M4JA 5AKKA 1A9YA 2JJYA 3ETDA 3OCYA 4GGPA 1P1CA 2I7DA 2C92A 3JRNA 1DBSA 1GKKA 3Q6MA 3LUAA 2RHDA 4DV7B 2CV1A 2C54A 3PITA 3L7CA 1JHRA 1WDLA 4F6RB 5FOWA 3GP3A 1VL1A 2FETA 2ZB8A 4PLVA 2CLMB 3T5GA 4BBPA 1XVAA 2IYQA 3AI3A 3MSXA 2FN8A 4M1KA 5CH5A 1Q74A 3I0MA 3O95A 3TW8A 2PWAA 4NICA 2W2XA 3FI0A 2OO7A 3NLLA 2BZGA 2FXVA 3W2IA 3D4LA 1U8CB 1Z28A 4FHGA 5IKPA 2POQX 3IUQA 4UAGA 2C3PA 2NX2A 3RKUA 3WB2A 3IALA 5LN1A 5DHFA 3QELA 3GUVA 3ICPA 4FGSA 4IDDA 1EP2B 5EHNA 1PNQA 4XQ0A 4Q1EA 5AQEA 5A05A 3GPCA 3RUPA 3X1MA 3I12A 1QS0A 1X7ZA 3PXDA 4Y2VA 2C07A 5E9WA 5IDQA 1B8PA 1FDIA 1XJCA 3G6WA 3F4BA 3AESB 5BO5A 2CL5A 3MUFA 3OT5A 4M9UA 4DIBA 2YY7A 1EZ4A 4JC5A 2IHUA 2C7RA 3ZH9B 3K96A 4ISCA 1VIVA 4MQMA 4RKWA 5K4HA 3UAVA 4I9GA 1O03A 4NEHB 1FSPA 1ZM9A 2KS6A 2W6ZA 4H60A 4WV3A 3IBSA 1O6ZA 1XV5A 2ZBEA 1N2EA 1DP4A 4YIKA 1X1TA 2C61A 3DHNA 2Y9PB 4NTZA 3WMRA 1I33A 2C2ZA 4ARBA 4QQNA 1AE1A 3GYGA 3BULA 4ZYLA 4U7TB 2X0IA 5A4DA 2Q5OA 5HJEA 1AOXA 1MRNA 1JVBA 4DEXA 4B4OA 2HBYA 5DLPA 4JWTA 1PGJA 1E7WA 2XLCA 2QENA 4LFBB 3BWXA 1K5DA 3FYTA 2CUKA 2HY7A 4TROA 1P4JA 4PBTA 5FOXA 3DXYA 5HGJA 3STYA 4C6SA 4ZGGA 4JSYA 5BPFA 1K06A 5AKYA 4AZSA 1JIXA 1SG6A 1J33A 2XD4A 3QVMA 3ZKWB 4O1HA 4AZWA 2DC1A 5CLIA 4DCNA 3NEPX 2NZJA 4WOKA 4A8TA 1EMDA 2XNCA 3LL4A 4XYBA 5ECYA 4WDRA 5FBRB 4AVYA 4JBIA 4HTFA 4URVR 3JATB 4AKIA 3IEIA 2AV6A 5ALPA 5CCEA 3EVCA 3GZ4A 3HYRA 4JELA 4EI2A 4DR3B 1GFIA 3R0ZA 1WETA 1OBFO 3B9QA 4DANA 2CD7A 3UO8B 3A28A 4HY3A 3DM5A 3HWWA 3DE1X 3TPFA 1ADJA 1TYCA 5FBLB 2VJDA 5KYTA 4ZZ1A 4EG6A 3GLHE 4HP8A 4IILA 3EPKA 3FNQA 4ZN6A 4FQ8A 4WCFB 1NBEA 4UBMA 2P2NA 2GN6A 2PUHA 1L5KA 5LU8A 1SGWA 2IDJA 1YRBA 2HA7A 1LJLA 1O95A 4HDMB 4BO6A 4G89A 3VOTA 5EMMA 5KVAA 1KI6B 4P54A 3LUPA 1U9CA 2XMPA 1JR3D 4DVGA 2QTFA 1Q17A 2XB4A 4ZU3A 4QU9A 3PNOA 3ZDDA 2F4VB 1QAQA 4J7AA 5KO2A 1AZLA 3BOSA 5AHRA 4AY3A 3RO7A 4FJ2A 1N6HA 1QHGA 3M2TA 1JAXA 4G1UC 4M7PA 3G5LA 4AJ1A 3RLFA 4N49A 4LZLA 2AG8A 4BO8A 1EX1A 3PZRA 3A2KA 2HLDD 1QX3A 1U9ZA 3BA6A 3FSEA 4L16A 2P35A 4J7CA 4IGEA 3V1LA 4EG8A 5D84A 3TEMA 2XE4A 5KOIA 2XIQA 4ZK6A 3R0IA 4JEHA 4HQKA 1AS3A 3QKUA 1G7SA 4IIUA 4IXDA 4LRQA 3FZQA 1I51A 2FWPA 3Q2IA 1Z18A 4P7BA 5EE9A 4DQVA 3ERCA 2AJ8A 3ZY6A 1EK5A 1H2EA 3I61A 2LUOA 1UBNA 5SZJA 5CX1B 1Q3TA 3PF9A 4FW8A 5A4IS 2IZ6A 1QIMA 4V0LA 2OZKA 4CXMA 4X94A 2Z5FA 3I05A 3GDOA 4FUTA 2D54A 4DAOA 5EJAA 2AXQA 4EECA 3HVJA 2X6RA 4M55A 3RUCA 4U0JA 1OYWA 5K09A 3THWA 1JEYA 2HF2A 5EJ4A 3EMKA 2O3TA 1KIMA 4OHUA 4JHXA 1E94E 1QFXA 2RAPA 4V1CB 4CV1A 3OQNA 4LF5B 1JNXX 4NENB 4X7PA 4Y8VA 5EUQB 2PUWA 2EZ8A 1EB9A 4LZAA 2H9IA 4K2AA 4IIBA 4GIBA 4QNMA 4CCAA 3KQPA 1JEQB 4D9MA 4YCNA 2XY4A 3FX2A 3GQVA 4K9MA 3S55A 4QFBA 4RHUA 3RRNA 2V3WA 5FUWA 4TM8A 1E89A 3LHDA 2WNHA 1H66A 1E3WA 4X93A 3HB5X 1JA9A 3K8ZA 3T8YA 3VDXA 1WIWA 2IV3A 2V7QD 1NN5A 3R3SA 1E6CA 1JLKA 2A4KA 2ZGVA 1T8PA 4XDYA 5EFZA 1E3MA 4KGZA 4MTLA 1GILA 1YXMA 3NOVA 1ZJ4A 4K6GA 1Q21A 1PFUA 1O87A 5JCZA 1XTZA 2RHOA 3HVKA 1Q0SA 1GR1A 4JIGA 1KE1A 3WLOA 4D8YA 1VMDA 3FZYA 4PHCA 1SEPA 1YR3A 1GPUA 3BJZA 1GKYA 1QFSA 2ZYRA 1HRDA 3P9RA 4YMLA 5A62A 5AESA 2VRBA 2MYNA 2E5FA 1PJAA 5EPUA 3WLMA 2PSHA 4DLTA 3LCMA 2YWEA 1YS6A 2ZEJA 1OTYA 3ZWCA 3FDZB 4II3A 1YBVA 2OPBA 5FUBA 4ZQHA 1SNYA 3ORSA 5CYFA 2RKWA 3ONNA 1Q19A 2ZUTA 1JFLA 3SHVA 3TQHA 5C7IO 3CNHA 1DMRA 4DBVO 3LO5A 1F12A 1V5EA 4OKNA 1N3IA 3R7BA 3PZBA 3VU9A 2F1IA 2O8EA 2VHQA 5KJ6A 3DGFC 4QU0A 1IXRC 4XRGA 1TZJA 5T4FA 3F74A 4FZ5A 5ALMA 5CLHA 1PZXA 3G13A 3BREA 3H16A 3VAZA 4POOA 2GT1A 4FM9A 3WNCA 3K35A 3NH6A 4GHWA 1S8AA 4F5EA 1TNDA 1G2QA 1O4VA 2V0CA 4J1QA 1JZTA 2J07A 3L6RA 4X9XA 5IHXA 1K86A 4LHZA 5D7NA 3FAZA 4RU1A 3R6TA 5EERA 2E1RA 5AVJA 1RRCA 3LUBA 3F3YA 4BAZA 1D1SA 4BE7B 5T57A 1JHOA 1EUQA 1NQWA 2C4NA 5FI0B 4D8VA 3RC8A 2NSJA 2XH8A 3VPSA 2J08A 3CTMA 2IIBA 1MV8A 3ZHRA 1WBDA 3EUFA 3SDBA 3PUYA 2VF2A 3QPDA 1A4RA 1KARA 2C2XA 5C8YA 3HGQA 3BIWA 4GR9A 1ST2A 1FTWA 2GRAA 3FVWA 4JLSA 4CR7A 4JLPA 4XWGA 1HX7A 3D4BA 3OIUA 2REOA 2QPTA 3THYB 1RQPA 4KO8A 4MEJA 4OGWA 4KXLA 1CZLA 3PGLA 4Q00A 3IBGA 3KYJB 1D1PA 4BLSA 1G6KA 4KUGA 3OWOA 1YRHA 4QARA 1T24A 4G84A 1AK1A 3RDPA 5JE8A 3RBXA 4DDHA 4FE3A 1W6UA 3T95A 1NVFA 3G68A 5KYVA 2J0VA 2Q1SA 5DCLA 3ND6A 5F51A 3WE7A 4F85A 2PIAA 1UZMA 4INAA 1GPH1 5FTKA 1SC3A 1YJBA 2AR9A 1Z0SA 1L6RA 3FCEA 1GQRA 1T1JA 3P94A 4FBGA 4RMHA 4WZAA 5GP1A 3HE3A 4WL0A 1E6KA 3V7NA 1QV7A 2JCXA 3R5JA 5JC8A 5E6SA 1CP3A 2ZSFA 1WP4A 3BRWA 1VL2A 4KQWA 1V35A 2BGLA 1XTUA 2CEKA 4RNDB 5FFMA 4NDAA 4X91A 4CLRB 3A9TA 4BVJA 3BMOA 4GX5A 5CCXA 2BMJA 1U02A 3OU2A 5IT4A 1A7KA 3GPDG 3ZC3A 3N3BC 1Y42X 2Y4NA 3OUTA 3EWAA 2ZTSA 1S8FA 1JXOA 3V4SA 2PZKA 1V11B 2EKZA 3HKEA 3M4YA 4JL6A 4OHVA 1I9CA 5E4FA 5B6PA 1ZMOA 3AY6A 4YT5A 3QWAA 3ST7A 4OU4A 4EHKA 2PVPA 1Q2XA 3I58A 4OI1A 4N65A 1TX4B 1TKRA 3GUUA 1E79D 4OMUA 1DC6A 3EZXA 4IW3B 4PZPA 2DLNA 1J0EA 2REXB 4R3WA 2QHXA 5BSGA 3QF4A 3BKXA 2ROQA 2J5RA 1XT6A 1XQVA 1IHDA 1QYRA 4YJ3B 3C1OA 2LTAA 1YIOA 4P08A 3NJ4A 1WHTB 3W1EA 2QQGA 1NUTA 3K6KA 2J3DA 3HZOA 2CV2A 3CR8A 2EHJA 2DKOA 1DAOA 4LJYA 2AFVA 2EWWA 2FJUA 3GARA 4TV9F 4DR1B 2AMFA 2GO7A 2V0GA 2EFEB 5T7BA 3KUCA 3FTCA 4IKOA 3WWOA 5JDIA 2E9SA 3NI2A 2JRCA 5EEHA 1RBZA 3AB7A 4OFBA 4YRSA 4YPOA 4Q3LA 5E0OA 3HP1A 3M5CA 1SG9A 1OGIA 1WUTA 4GYYA 4KYUA 4MKRA 4QPCA 3M4NA 3CRVA 4QNNA 2ZFUA 4ZZIA 3AUYA 1I6WA 1GKIA 2HH9A 3LGAA 5HJ2A 1CS0B 1F2TB 4BGEA 4MVJA 1S7CA 4B3IA 2YHUA 5K6AC 4MS1A 4BQOA 2OHXA 1XMPA 3ZIDA 2VIIA 5CDHA 4OIFA 2C7PA 5JAUA 4BTLA 3P4UA 3EVTA 1OXTA 3S1LA 2PRIA 2X8WA 4EPTA 1VP3A 2GRJA 4TRJA 2PPLA 5F3DA 2ZRPA 5B37A 2D5IA 2E4YA 5IYZF 4B3XA 5L4LA 3FOAA 4Z4IA 1Q1NA 1E5QA 1Y4ZA 2ODEA 4Z53A 4R68A 4Z4CA 1F3LA 1OAOA 3TXAA 4DMGA 2V6BA 3OZBA 4CWAA 1O6FA 1V9SA 3AHCA 4XVUA 3M1IA 3HJGA 1DSSG 1YAHA 1OLSA 5A71A 2HCBA 4NZPA 4MJ3A 5LC1A 5JPDA 3SNHA 1E2LA 3SYKA 2W6JD 4AKEA 3IQXA 1F6BA 4O4JF 1J00A 4E21A 3PGJA 3PWSA 3IP9A 4ECEA 2CLIB 3O8OA 5FNVA 3AQIA 3TBFA 3HJUA 1G2OA 3WLEA 1TF7A 1D0IA 1S96A 1YCDA 2PYIA 2QPAA 3NPMA 3L43A 2NO4A 2X14A 3HACA 1Z29A 5ABPA 2WT4A 4FYPA 4ZRMA 1KH3A 1PDOA 1V3VA 1EUZA 3K32A 4DA4A 3SJUA 4LF4B 2X5OA 1J7KA 3N75A 4M99A 1E3TA 4PYKA 4QGBA 1HT0A 3MMXA 1LBEA 1FJGB 4FK8A 4LYDA 1T35A 1VC2A 3IERA 3WGJA 4PAWA 4B73A 4F9FA 3DMTA 1KMMA 1QGDA 3HNRA 4M38A 6LDHA 2JVIA 4IUCS 2FQYA 3CYFA 3CN7A 3MAAC 1ORWA 2HJGA 3L7NA 4LQ4A 6REQB 1TYZA 4JX8A 2Q2QA 5FLEX 4HFNA 2OQRA 2Q21A 5UKDA 3ZOKA 2WM2A 3QEJA 1PK8A 3BMCA 1RVV1 1DI0A 4MA0A 2E4AA 1GQFA 5JI3E 3QW2A 1ZD9A 4UD6A 4X6XA 2I6QA 4KK4A 4IH4A 3P20A 1JHAA 5EUCA 5J58A 2FPLA 1DIBA 2OBMA 3PX2A 1YJ8A 2FY8A 4JIMA 4MPTA 4TTTS 1DFHA 5DI3B 1GNSA 1L1RA 1HR0B 1LNQA 3TLMA 1T4DA 2BBWA 3FPSA 4PGAA 3TLXA 5SZIA 2E21A 3B13B 4AJ4A 5A9RA 1NW9B 1QG4A 2DWUA 4UCXA 5DNDA 3RVDA 3TI9A 1E1QD 4MULA 4UEJA 1BHQ1 2CJPA 1NW3A 4JI4B 3MTGA 4PC3A 4D4MA 4M3NA 5DSTA 2GZ3A 2FZ4A 1YL5A 4H3VA 4O4HA 1R37A 4EKEA 5AO9A 4ZAFA 1U2SA 1TQ4A 3ECAA 1JQKA 5CCDA 5IMBA 1AV7A 1MO4A 4R1QA 5FTMA 4GMKA 3A3NA 1PHPA 3HU2A 2VK1A 4FDMA 1Y4UA 2H2IA 4D79A 3WWCA 1OV4A 3D2LA 3TSCA 5E3HA 4TVOA 4CMHA 1QO9A 4BWVA 4DILA 1H0SA 1XYVA 1SUPA 4P2BA 4X63A 1M2JA 5CT6A 1NLZA 2WJYA 3PICA 1FLDA 4OXNA 3HJRA 1LJ8A 3CF0A 3JQCA 3ICEA 1ZRHA 3FNBA 4JBGA 3FVVA 3JPYA 2YY6A 3OSZA 4DV1B 2BYTA 3U61B 2W90A 3URMA 2CT8A 3EVNA 5AW5A 2W4QA 5AUNB 1G98A 3G2HA 4HNHA 2H3HA 3HKDB 4XASA 3PNVA 4MZDA 5KC9A 4IUDS 4JZYA 4X71A 5KJCA 2EXXA 2DB3A 1FZTA 2I7CA 1E2DA 2HIAA 2GM9A 1BC5A 1ORIA 1ZIDA 1VMEA 2DTXA 4J3NA 1DQPA 3BCHA 4P33A 4BKMA 2O8BA 2TMDA 5DGDA 1KVRA 1WMEA 4EQZA 5M29A 4D8WA 5I7VA 3RVBA 3WGKA 2G0AA 4BVEA 4DADA 1P81A 3M7IA 3KS9A 4BFLA 1LNSA 1S2GA 3G2MA 4J0DA 1HYQA 5F73A 3V4FA 4LOHA 4PTLA 4AULA 2QJRA 3UQZA 4Q4CA 1R4MB 4M9QA 1LK0A 2JCVA 2LRHA 1QVAA 3BUSA 4NLLA 5A4MS 2MCFA 1W0KD 2UZ0A 1MO5A 4K88A 3LW8A 3HDTA 3L93A 3PXAA 5EFOA 5HKBA 2NP7A 4EHHA 2QRZA 3G2LA 4IIYA 1CE8B 2JFYA 4BUCA 2GARA 4M87A 4QQFA 1KSHA 2PBFA 5B57C 1HLGA 1GRRA 2BBOA 2FH5B 3LP5A 5H0IA 1VSVA 2FZEA 1GUZA 3H4IA 4B32A 3KQLA 1KDZA 2VTBB 2JFWA 2SICE 4BQQA 1DC8A 4QOGA 1RZRD 2KHZA 3FB1A 1J2YA 2XEXA 3BAFA 2QRGA 1GQYA 1Z0UA 1EUDB 2VYFA 5KQGA 1HLFA 3NQ41 1FRNA 4B81A 4Q1BA 2ZJ8A 3IXMA 1IG3A 1YQDA 1X77A 3FXAA 4DGQA 1PV4A 1I1NA 1R3DA 4HAIA 3DUFA 1UXHA 5CM9C 1RC0A 5IWCA 1SXGA 2VQ6A 5EMKA 1GTL1 3B85A 4CEJA 2EVWX 3CKYA 5TGTA 3H2ZA 1C0KA 2B5OA 1PX2A 2GPTA 3AP2A 3WA7A 5JEDA 2C7GA 4ZQEA 1QB8A 1QYCA 1XO1A 1FNNA 3GOQA 2XB2A 3HY6A 1M67A 2CHQA 4K87A 2V55B 4QDUA 5IUJC 3BRCA 5DH9A 3INRA 4ZCMA 1KS2A 5ERGB 2NU8A 1D6NA 1UFOA 3DULA 1A98A 1L0BA 4WY8A 1HG0A 3HDJA 2X0RA 4B84A 2B0CA 2MINA 2IYFA 1X1AA 3A2LA 3HKCB 4G4IA 4HOYA 5KIAA 4F1JA 1L5FA 3HFGA 2YCLA 3HB7A 1QRSA 4KKVA 1DKMA 2PWZA 4P4LA 3GV0A 3TUJC 2LD4A 3QSYA 5LSAA 1E3LA 3QMPA 3P9PA 5CNJA 5CVTA 4HMQA 5KHLB 2O06A 3LQ4A 4QM7A 1OB2A 2XXAB 5DHQA 3OTWA 4ARAA 3H5NA 4R1NA 5L95A 5CDTA 2NMVA 4Y2UA 2ZSAA 1LSUA 3WMGA 3QWHA 4MQEB 1YS1X 4JC8A 5DT2A 3R5FA 5KYXA 4F1WA 2FOXA 5TQ0A 2YX1A 4F6CA 1Z08A 3ZWQA 4AWAA 4ED9A 1APBA 3QVKA 1GO2A 2A0WA 1NXSA 3CNOA 3N70A 3R1IA 5CYPA 2X7XA 1Y8RA 5JSZB 4W5OA 4ZJYA 3GU3A 1P60A 3E7FA 4RZHA 5F2EA 3MFYA 4NEGA 5CG1A 1DIAA 3TGPA 3K1AA 1OFTA 4HUQA 4CTMA 3NGMA 1NMQA 4MV8A 5E7QA 3EPLA 3B7PA 1KY5A 3MMPA 3AW8A 4Y2TA 1XXHA 3D4NA 5JSKA 2HL6A 3ZIUA 1A77A 2UUBB 2A6PA 2R8RA 3D4PA 3ELWA 3OY2A 4QJ4A 3NHSA 1YL7A 3M1LA 3B78A 3NUZA 3K2QA 4AY4A 5ALXA 3UANA 3EGEA 1ZJJA 3RT1A 3IDSA 2DHRA 3I0ZA 2P0AA 1V5WA 1XD2A 1BU8A 3SC6A 1KE2A 3TQFA 3EFBA 1EYZA 4REMA 1PO7A 4N7RA 4W8GA 1CUWA 2PM8A 1TUIA 1H94A 2VP6A 4EKNB 4ZCTA 3GPBA 5DBEX 1XWFA 4JXXA 1SR8A 1NULA 2ZJ5A 1XQYA 3DB2A 4MV0A 4UAUA 4URWR 5EMNA 1T9KA 3P2EA 5CB4B 4YDRA 4EPXA 3EG5A 1TCVA 2CJYA 4PYOA 3T41A 3O6VA 1I7SB 2R8PA 2Z6VA 5F35A 4QOSA 3RYCA 2CVHA 4HVLA 3RFTA 1U1CA 1FL9A 1EIWA 1WKCA 3TO5A 4JQYA 2XTMA 1ECJA 4AW9A 5KS2A 4GBED 2I7VA 3JWJA 4LJ8A 2JC3A 3G9ZA 1LFAA 5AM0A 3ZK8A 4LY6A 4PYLA 1YU6A 3AKCA 4GYWA 1L7EA 3ULKA 1CZUA 2EBUA 2CCKA 3NHUA 4NNOA 4E1BA 1IWOA 2SHKA 4L2IB 1UC4B 2ACEA 3CLSD 1FVXA 1KO1A 4XGQA 2GZSA 1O95D 4KR7A 5KKCA 5JPIA 2PRYA 4NCBA 1E2FA 4XM0A 3KVYA 4ND2A 1XQ6A 4KPFC 8GPBA 1WQ4A 1GKUB 3F7TA 1R0XA 4MYHA 4Q9IA 3S28A 2I4IA 4RYDA 1QKKA 4O3FA 1L7BA 3HJBA 1NY5A 3ZNQA 2PH1A 2CVZA 1T4GA 3P96A 2EQ5A 4WACA 2H7XA 4RL6A 2VN8A 3CLSC 1EXDA 2XXAA 3IUMA 3OZFA 1XHEA 3G2PA 4NYJQ 1O95C 2QTMA 4V2UA 2I71A 1E7YA 5CK4A 2HJRA 2HMVA 2BZ1A 2BH2A 3W9BA 2RBGA 3OESA 1KYTA 4HNSA 2AI3A 4HVAA 3SSOA 2X0KA 2YJ5A 4EARA 4WMLA 4GXRA 3RUHA 4EHLA 4IO1A 1CYDA 2V74B 4GX2A 4V0RA 4CMIA 1FNSA 4XWKA 1RJ9B 4CFZA 2FSIA 1E0DA 4G4SO 3RI3A 2O52A 3N2KA 2WKRA 2IJGX 2ZT6A 2Z95A 1BIFA 2FOIA 4MQ4A 4DR6B 1R15A 2I8CA 2XNSA 4PICA 4E88A 3SWWA 1W59A 1KWKA 2BDEA 2J7PD 5JCPA 2JGKA 1R0WA 2YHBA 3KPJA 4BZPA 1DWOA 3R44A 1V8ZA 1U8YA 1RMQA 2AC4A 4OREX 2VDOB 2BBSA 4R7ZA 4UM7A 1VHQA 2HMTA 3U6KA 3FAKA 3GVXA 1KMNA 1IQPA 1X1BA 3MINB 1I2ZA 3SYRA 2PWPA 3PDUA 2HT6A 4MRMA 5CP8A 4AXBA 3OJLA 4TL9A 3SCZA 1S2MA 2F17A 4F4HA 3FWNA 5LDDC 4XJXA 2LPMA 1W4BA 2BAGA 3K0AB 4YX9A 2Q6IA 4PLYA 2V58A 3PLNA 4FINA 5DNWA 4JLAA 4KXWA 1XZFA 3LSTA 1J24A 4JB2A 2PKRA 4DW8A 1R0YA 1ZIOA 4EG3A 2AOTB 1JGTA 3AEUB 4KQIA 2PKXA 1C8BA 4R6WA 1KO7A 4Y1RA 1NNSA 1J42A 2ZB2A 4PRZA 4F4UA 3HN6A 3REQA 5DBHX 1ZN2A 5L6MB 3L40A 1SVWA 2GD2A 4PRYA 1LX7A 3TCXB 1M6EX 1WMFA 5LA6F 3STWA 1K7CA 3Q11A 5AI4A 3WP1B 2PE5A 4CIYA 3RH0A 3MYRA 2JHAA 2R96A 3EF3A 2ARKA 2J0UB 4WBXC 3VTAA 6ADHA 4ZEMA 1UWCA 4S3MA 1JTFA 1ZNYA 2MMGA 3A3PA 2QL9A 5KKNB 3W5DA 1TJNA 2OCDA 4B8WA 1TYAE 4NZ9A 2N1BA 1P3JA 2AK2A 2G72A 1M10A 2TMKA 4TN5A 3K9HA 3GC6A 3N2LA 3N9IA 2EP5A 4D6XA 1IB0A 3EB9A 4CEIB 1CRLA 4NJEA 3KEQA 1JP7A 5DBOA 4DWJA 5MF6A 2WG0A 2YFHA 3MWJA 1VKNA 1IK6A 3GP5A 4O0MA 4DRXA 4Z86A 3VC2A 2OYSA 5HMLA 5ALZA 2DU8A 2B4TO 1DV2A 1PCXA 4FZJA 2EV9A 4R2JA 1L5GB 4KQXA 1WHSB 4MS3A 2JGIA 2ZPAA 4LK3A 3RJZA 3OZ7A 1K8QA 2FMUA 2A1TS 5A0TA 1YSCA 3CWQA 3LL7A 1V45E 5CRIA 5ELLA 2WT9A 3CVUA 2CE7A 5DGHA 3KSBC 3M1YA 1PW7A 3WL7A 2QK4A 3UMYA 1BW9A 1ULTA 2AI2A 3K8YA 4FYXA 4QELA 4BGUA 1Z7GA 4F12A 2PS9A 4YAUA 1EZZA 1R0RE 1DFGA 2PJUA 4CKBB 3R5TA 1Z22A 1E9RA 4BKQA 3VYVA 2JBAA 3ZNPA 3LRTA 2EW1A 1UJ2A 1ZOLA 2AB0A 4E32A 1M1NA 4GRAA 4N0EA 4OO3A 2JB9A 3PE4A 4DIUA 2O19A 4IMJB 1YDWA 1FFXA 3I9OA 4UDNA 1ZSYA 1ICIA 1NU8A 4R4JA 4YC7A 3MTAA 5F64A 5HCNA 2CBGA 4BTVA 5LIPA 3T0IA 2ASVA 3UB2A 3LX4A 1MIOA 4F3TA 1UFKA 1OKKA 1ABEA 1JYSA 1E2PA 3HXLA 1L5MA 3VR4A 3X1XA 3X1DA 4BLQA 2Z04A 5KNCH 4Q7QA 1FTQA 1ZH6A 2OBYA 3ZY3A 3LP6A 5A6SB 2HQ1A 3BDVA 1OVMA 3LHSA 1F2UB 4Z8XA 3IQDB 4DCTA 1I36A 5JATA 4BMPB 2I6TA 3OF3A 5DBIA 4BQPA 1L1FA 4A23A 1PQWA 3TQQA 3COYA 4H7IA 1P2BA 4QOEA 2D0OB 4RCYA 4RIIA 5BW5A 1Q1EA 1TQDA 5GQSA 3KHTA 4WAUA 4BLUA 1GNRA 1XZKA 2FZGA 5GGXA 5K51A 5BSTA 5TLSA 2D1YA 2DT8A 3PLAE 1QCZA 1T8RA 1V4BA 1ULAA 1M2OB 1Z16A 3AOEA 3QPCA 5DRTA 4NYIR 5SYMA 3W6OA 5ALVA 5EWMB 1KU6A 1JTVA 2I2WA 4TTVA 5HQ3A 3KAKA 1H9BA 3WJ1A 3ZWWA 1QH0A 3BRWD 1W88A 3D6HA 1BXGA 1QO0D 1AZWA 2YQ5A 4PQEA 5AFSA 4HB0A 2FX5A 5GONB 3I5YA 3UAYA 5JXJA 1XZNA 4JLDA 2ZVJA 1Y7LA 1T2CA 4IJVA 3LOQA 4YRLA 1QRTA 1JE0A 1QBKC 3KQWA 2OFXA 3DTVA 1ZL0A 1R0CA 3HN2A 5E1DA 2ZIEA 5FHQA 2YZ2A 2L42A 3AR7A 3GIDA 2EX1A 4CQLB 3U7HB 2RGAA 2AUNA 5DIZA 4ETMA 4OSEA 2QI9C 2V6GA 3EPPA 3WLKX 1UJ4A 4EBFA 1SQGA 1BROA 2YJ6A 3HXKA 3AHEA 3FGZA 3MN1A 1P4GA 4JB0A 5L3VA 1S4MA 2AQIA 1UKVY 2NUPA 1HUQA 2FI1A 1KMHB 3HL4A 2X19A 3LQ1A 2HDOA 4FZ3A 3A8TA 4MIKA 4DUPA 1OR8A 3GCDA 3VSBA 2E4ZA 4HYTA 4YRCA 2ZBQA 5TGZA 5JD4A 2NP6A 3FYUB 4X1IA 4HBZA 2XCSB 2GF9A 3G2JA 2AYZA 2GEJA 3PVZA 3HM2A 3EA4A 4FIDA 3DFZA 4LDPA 4UPVA 4BRZA 1NLMA 3EEBA 3ODPA 2RGEA 4WXMA 1LK5A 2C20A 5AYVA 2BHLA 3SLKA 4C43A 2H08A 3NAZA 4J4BA 4YACA 4ZGBA 2OZPA 2QIPA 4MLCA 3WL5A 3IIMA 1VP9A 2BKVA 3DBHA 3HRKA 5F3RA 4OQEA 4FT4A 3LYAA 1XEWY 4K9PA 3QVOA 3ZIAA 1JQ3A 3K1YA 1GITA 1II0A 1SPXA 2O3UA 4X60A 3L7KA 2O23A 4OHYA 1U28C 1X9IA 3LK6A 3URKA 3IO3A 2XJ4A 3INYA 2IPAB 4HC4A 2AN4A 3LY9A 1M74A 1VOTA 4QYSA 2C5GA 4RH0A 5H1YA 1UBSB 2DJ5A 1ICEA 1YBFA 3AUSA 1TTQB 3NWJA 2JGLA 1AUVA 3GZNA 3MRTA 3HA5A 3CUYA 1E7RA 3AKYA 3G88A 2WTBA 3QI2A 2G1PA 2ZIZA 5EVJA 5L7TA 2QRQA 4QATA 4GGOA 4ZVKA 2B9VA 2FUEA 2JEYA 3IYLW 1NZJA 2PH5A 4JOSA 4Y2RA 3UOGA 4HMOA 1DWPA 3LT4A 2BSAA 3ORQA 5TC4A 2B8NA 3SAJA 3ROXA 2R79A 2VQSA 4IFBA 1L5LA 4AJPA 3ZK9A 3A6PC 3TGLA 1IBMB 1K7XB 2XZDA 1CJUC 1SOUA 4OD0A 1GTVA 2A9JA 5BSUA 2FE1A 4DLLA 1ADFA 1P9WA 4YBZA 3JQBA 2X3YA 3D3KA 3DJYA 3UCXA 3LWBA 3P9XA 4D9GA 3MERA 1P74A 1W85B 3L8CA 3VKVA 4LSMA 5DM1A 5H9VA 4A27A 1XX6A 2I2DA 1ANKA 1OAOC 2VQDA 4UPEA 1RXCA 1Y0BA 1N1GA 3R7AA 1DBQA 1DIHA 1T3LA 5DBGA 3T7RA 4CMGA 4EJFA 1Q15A 2YWJA 2RK3A 4YH1A 1QZ3A 5AK0A 2AD1A 3AR5A 2RHTA 3JQGA 5REQB 3X44A 2VLIA 4Z7OB 1CETA 4G4JA 4I4NA 1MB9A 2HDHA 1NFFA 4LOJA 5HS6A 5HUQA 3Q7TA 1G3MA 4CDMA 5JW6A 2HA2A 2OB1A 3MK31 4F7DA 2OEPA 3RRZA 3B6IA 2OXIA 4ZVSA 3VU8A 3EGDA 4AECA 4E94A 1GGNA 4D0LB 4CMEA 1ECLA 2JFNA 1MKYA 3LQKA 1SIUA 4EPWA 4XQ9A 3PG5A 1DTWA 2TSYB 1PIWA 3NEYA 1TM5E 2G08A 4L76A 2C3YA 2JANA 5CH3A 3TSWA 1U3TA 1NQTA 4EUNA 4MWDA 1HWYA 1E3EA 2BFBB 1QORA 3OJWA 1R50A 2OWDA 2ATVA 4FFLA 1RAFA 3NOOA 4MICA 2E89A 1QWOA 2HRRA 3K05A 2QEQA 3VOSA 3STTA 4PLZA 4BUJA 3KZXA 4E13A 2DTEA 5KSZA 2G67A 3PFCA 4P5EA 4H15A 1GZ5A 2V3VA 3DBRA 4JXJA 1UWLA 3NBAA 2G9NA 4F4JA 4RO0A 3CVXA 5AVYA 3KU1A 1OLUB 1ZK2A 2FW8A 2V96A 2YUTA 3THSA 2AR7A 2QGNA 4TXNA 4E7OA 2P65A 3NHBA 1OZHA 3AUTA 1P91A 4ZVVA 1XZJA 3MCWA 4AU1A 1K2WA 4FGJA 1Y7HA 3KZCA 2F3UA 4UATA 2E48A 3H97A 3COJA 3AU9A 4LVCA 4WZAE 1ZKDA 3MSCA 1GOTA 5D5PA 3V5NA 1SHTX 4IIDA 1SCNE 4QRIA 4Z9YA 1RZVA 5GAJA 4YRJA 2R6ZA 2P4SA 3GDHA 1F6WA 1LDNA 1WXWA 2UV8A 4MR7A 3TZKA 5IZ4A 2F3QA 2HTEA 3EQ2A 4A9AA 4P32A 3R9IA 1RI3A 5CYGA 3CPHA 2ZTMA 2AEFA 1OIVA 1KI3A 4MLPA 3REGA 2X8BA 2X8LA 3MJ4A 1QPBA 4MB0A 5BN5B 2R1VB 3Q40A 5KI6A 1MOSA 1TGVA 3EG9A 2AOVA 1B0PA 3SHTA 2F48A 4YMWA 1DX4A 2GOYA 3AXTA 4B71A 2Y6UA 4N6OA 2G0TA 5CT5A 1YBAA 3E7PA 2WF8A 1J5XA 3G8AA 1ZH4A 3PDCA 1IDOA 4M60A 3VV3A 2HYIC 2Z6QA 3Q3VA 1KPGA 4IDAA 4R2HA 4XQGA 1G8FA 3RABA 5K0ZA 4HAOA 1AQJA 1V26A 1JSCA 1CY1A 1PZFA 2I8LA 2JIPA 1L5RA 1YNOA 1IN4A 3NBKA 4I50A 5A7HA 4F0JA 1E2KA 1E59A 3U7EB 4C1NA 1A76A 5BSHA 2QX8A 1MTZA 2J0EA 1Z2EA 3B3AA 4C0WA 4DE5A 3P2KA 4Y2HA 4MDFA 2WSSA 5EZYF 4LBWA 2DJIA 3IL2A 3OIYA 4TXLA 2O8NA 5JCOA 1OFGA 1UFQA 1PQYA 4GMFA 3JSAA 4G5RA 3E3OA 3UV6A 1TM1E 4B3DA 4KZKA 4P4TA 1R9GA 2QN3A 4NDZA 5KYKA 1HFEL 1XG5A 3D5EA 1NW8A 3HMKA 4CM3A 2RGGA 5KUTA 4ZCLA 2EEZA 2BSQA 1AM4D 3I62A 3ETLA 5IJ0B 1OFUX 3EPJA 4KR6A 1AGRA 4UTOA 4D4HA 1QIFA 2IBTA 1U7HA 3H9CA 1PUJA 2YV4A 3SBDA 3L5KA 4WFIA 4I3GA 1GNTA 5EKDA 3U4MA 2G7ZA 3DPSA 4X3CA 2Q7OE 1GUBA 2K4MA 2C5SA 2ZS9A 4YWJA 4PX2A 4UE3S 1N9GB 3EVGA 3GLKA 3CVVA 3IPCA 4MVJE 3ZWMA 2WWHA 1ZCJA 1XLUA 2JFQA 4TZKA 5ALLA 2QYHA 5G4KB 2CZCA 2TS1A 5DF1A 4MCJA 4GXTA 2PGNA 5CXUA 1RIIA 3ED5A 3TQSA 1RXVA 1Q7BA 4GWLA 1W5EA 4OVKA 4QPNA 2BR5A 2ZBRA 1LBHA 2E6UX 4PANA 5J5VA 3ADCA 3RYHB 4L8FA 1EVQA 2RGYA 3L1UA 1A2OA 4R0VA 3L05A 5TVKA 4I6EA 1I0ZA 2VTDA 1LDGA 1BFUA 5AQ1A 5ERXA 1XLWA 4DSAA 3ANSA 1OJ7A 2QVCA 4WZAB 1EFVA 4PLPA 1T9HA 3MCTA 5AVKA 3VPAA 1IJFA 1TOAA 3GJYA 2FZWA 2H5IA 1KQOA 5IMSA 3BK7A 2NADA 3ND5A 5AKEA 4XOIA 3Q0EA 3GJRA 3EPHA 2J3LA 3LF2A 2ADFA 4I2NA 3NWEA 2CHVA 4DPKA 5A4FS 2ZQ5A 2G4CA 5JS2A 1XDZA 2C5FA 4N5LA 3UUEA 3ZR4B 2ZDGA 4EPYA 3QNWA 3DE5X 1P5JA 3A1UA 1N78A 1PK7A 3DA8A 4L3WA 3WJ2A 2ZRLA 4NBTA 5CA0B 4KQGA 4N3NA 3UBMA 3CVOA 2FPPB 4TTQA 5I7FA 3RVQA 3KJNA 1KA9H 4PX3A 1HE3A 5LR6A 1R10A 4LG1A 4NONA 1OOEA 4FMDB 4MWSA 3IUNA 3T9EA 1DKLA 1J2JA 3G79A 3PFNA 1N8TA 4MIEA 1CUBA 1AD2A 4HQNA 4L7QA 1K4KA 1PFYA 5EJ7A 4BMCA 4BMYA 4B3BA 1E69A 4TMTA 5HF8A 2YYSA 5LU9A 4AS2A 2VHUA 4YJ2A 5BMVA 2Z8XA 1MG5A 4HB3A 4U39A 4BBJA 2FN3A 1PYOA 4RV4A 3FMGA 4KQ9A 4JSTA 2PSEA 1PL6A 4HNGA 4M7RA 4N4AA 1E96A 3ZJ4A 3O47A 1FMJA 4CM8A 1FDVA 5L3QB 1FPMA 2I7XA 4ZRNA 2QTHA 5EJGA 5FBWB 2V4MA 3FBGA 5LQMA 4XGKA 1FFWA 1IRXA 3A14A 3IQGX 4TSFA 4C22A 1Z37A 5BW6B 3FPBA 3FKJA 2ZETA 3X2FA 3FD8A 1YE5A 2DYKA 3BTSA 5K4GA 2ESRA 2HV8A 2VPWA 4AY2A 3M6LA 2FMFA 2JAXA 4PFJA 2JFHA 2VZ0A 2HDNB 3L7BA 4QUDA 4XFDA 5AK3A 4XE5A 1DMSA 4RFSA 3IRVA 2X8AA 2QE7D 1M54A 3U6BA 1SRQA 1NFQA 4J76A 4ARUA 4R16A 1VTKA 3BFXA 3D0OA 1V47A 1EAYA 4OAOA 2R7MA 4ZOLF 1IEQA 1TB4A 1Z6QA 2ZQZA 3DEYX 3OUZA 4IG9A 3ANTA 1R9JA 5DISB 3IEUA 4M1OA 1XELA 2H63A 3B52X 5IJAA 3F1LA 1GZSA 3H11A 5JC1A 1O3YA 2WF5A 1FVFA 2NUAA 2VVTA 2NQTA 3OI7A 2JAHA 5CYOA 4QDKA 3QQ5A 1EM8B 4DB4A 4X7RA 4ZOEA 2XCOA 1WJGA 1YQWA 2F1HA 1XMXA 3A06A 2BGWA 1FS6A 4FGWA 3Q6NA 3FCSB 3KKNA 4E12A 5CFPA 1MJGA 4HNVA 5ICCA 1SQSA 4OFWA 4A82A 5JNTA 5IPFA 1ETUA 1KF0A 1ZGGA 2Q5IA 3GRAA 1YDHA 2YL2A 4D4IA 3DC2A 5BQFA 2H1OA 2BI4A 3CJRA 4GG1A 3E5RA 3SQLA 5JRZA 2C3UA 4OGFA 1WAMA 3LT1A 1ML3A 2R1TA 3UWSA 3TECE 1ZZEA 1C3VA 2C8VA 1K9SA 2DFKB 4LCBA 1NR7A 2PUCA 2X7JA 3GN1A 1CUDA 2YVUA 4PZUA 2VPXA 5DNVA 4C08A 5KCZA 1Z3CA 4JEIA 4CM9D 2XGJA 1RI2A 1T6ZA 2IA5A 1LPSA 2XUPA 2PQ6A 3M6AA 4FVTA 1XMOB 4QEKA 1VRWA 1V16B 3WKAA 4MVJM 3QBJA 4NESA 1Y9EA 1XNRB 2HCTA 3VPBA 2RHJA 4Q4HB 1EFAA 5GPBA 4DR2B 2RAUA 5H16A 3KR1A 1W25A 5DWVA 1GZHB 1KEWA 3KZOA 4F9EA 2ETVA 3C5HA 3QEMB 2VHVA 4XLZA 3R75A 4FYKA 2REBA 3KUKA 4TYQA 1CK4A 5IDXA 4MPPA 3ZQJA 4CKEA 3KOUA 2OR3A 4LW8A 3BMCB 2QTGA 1GHTA 3ASYA 3OA2A 3DBVO 3H1TA 1MAHA 2XMQA 3G7NA 1B73A 2HFKA 5EOVA 4YJGB 4J03A 3PVCA 3KQQA 1YKFA 2BH9A 3F5QA 1T2NA 4BJ5A 5GZ1A 3ZV5A 2WQZA 1C2TA 5LOVF 1NT2A 2GJSA 2QMYA 2VKQA 1DBWA 3ZXYA 5DRYA 3DAHA 1XL1A 2YRWA 3TFWA 4DLNA 4UTRA 1YA8A 3LUGA 1EXWA 1JPUA 1D4AA 3OFSA 3MTQA 4OI0A 3P5BA 1IN8A 4ER0A 4LIPD 4OYHA 2V7VA 3Q9LA 4FW9A 4IJMA 2ZYUX 2PK3A 4GZ3A 5EJ5A 4HLUC 5J2TA 3FGPA 5C37A 1P9LA 3JYNA 2CF6A 3A1WA 4FNGA 2ZE7A 2MSKA 1F38A 1UPXA 4YNBA 4R5HA 5CHYA 2J5KA 5D5QA 5EIOA 3ZD7A 1DRJA 2ASEA 2BJHA 4M0CA 4D98A 2B6NA 4DMLA 4L73A 5IAKA 1SA0B 1KBOA 2Y27A 5JJIA 3HYNA 2XTZA 3FYDA 2ZU6A 4AF7A 4U2BA 4DA8A 3Q6IA 4DXAA 2OG1A 4EY4A 1MMFB 5CA1F 5KDOA 4DJJA 4US1R 3Q8XB 4EA7A 4LXXA 3UYKA 2R44A 2FW1A 3RS8A 5B2EA 2EATA 1NBIA 1C9YA 4W1QA 1LV7A 5HX7A 1XF1A 4P83A 1SKYE 4KN6A 3T99A 3TVYA 3A4VA 3FMPB 3VO9A 3NWBA 1EKXA 1ZMRA 4ZQCB 3PE6A 4B3FX 4CR8A 3GF4A 3WIUA 2E4VA 2XOKA 4PRLA 1Z73A 4GSYA 3C1TA 4GX0A 3A1DA 1PK9A 1EFCA 3D54D 3RSSA 3F6SA 2BEVB 4MQFB 1SCAA 5L40A 1USGA 1R0ZA 1XFAA 5KYUA 1FFCA 3SD7A 3PCXA 2CVQA 3FPJA 4YR7A 4S0ZA 1T2VA 1GLGA 3KSDO 2EP7A 1H4QA 3IDOA 2ETXA 1BN6A 1OLXB 1O89A 2NO1A 3QFCA 1MEOA 4UCFA 2Q6OA 1KQNA 1EVLA 3IBTA 1ENYA 2EWVA 4H7PA 2DZDA 3DKPA 3OO0A 4ITVA 4Q6WA 1K6IA 2QZ4A 4I9FA 4I19A 4JT2A 5K8CA 1XXHE 3QJYA 1SUCA 2D6FA 2V5UA 1QH8A 4Y9TA 2BGIA 1ZUNA 4EITA 4BO4A 1ESCA 4AO7A 1UC5B 2PRSA 2EG5A 3G02A 3NX4A 2OBXA 4RVCA 1MA0A 2JFXA 4HAWA 3TD2A 2CD9A 5EYPB 5J2UA 3QG5A 3BTVA 2WSLA 3BXOA 4ZVMA 5FUQA 2FGKA 3DOCA 3PUZA 4K8OA 1U7DA 3KRTA 2BMAA 1A27A 3OCXA 1M2HA 1GPNA 3PL1A 1WSDA 4I66A 5B4UA 2DXIA 4DCOA 3OMWA 3K0CA 3UJ6A 4A2CA 5JHGB 3UUWA 1GT91 4QGHA 1N0UA 2CFIA 3M3PA 2QBYB 2R8BA 4DG9A 1B74A 5K3FB 3TIGA 3VH3A 1C2YA 4BNMA 3HWX1 2PGJA 4J16A 1DKQA 4D1YA 5TQ2B 1DO2A 3PK0A 4N40A 2ZAOA 4P34A 2FHPA 4RXUA 4WBSA 4F11A 3H9JA 2H5EA 4DLKA 2AXNA 2BI8A 5J47A 3VR4D 2QTVA 4L8WB 1XRJA 2O07A 3L7OA 1YIDA 3L0PA 3IBCA 1NHGA 1E9SA 2DQZA 2VT3A 4BCDA 2P6UA 4TLMB 4JMLA 1ODFA 1QO7A 2I6XA 4D4GA 1FP2A 3KJHA 1ZAYA 1BMQA 4FHCA 4Q1CA 3RB8A 2ZBGA 2JW5A 1ZA2A 3EARA 1ZA1A 2V03A 4U4AA 2MINB 3KSMA 4HGOA 4WNYA 3WHLA 2GUWA 4E1VA 3I6BA 1ZEMA 4F21A 1R64A 3BZUA 2HZBA 1PSDA 2QP3A 2IGTA 3Q7RA 3VV2A 5JZOA 4TZ6A 2J3HA 4IRUB 1SBNE 4JLKA 3LC1O 5TMBA 4BWFB 4DJDC 5I47A 4C78A 2QL6A 1V8PA 1EGQA 4EEZA 1R6VA 3WL4A