1Z13A

Crystal structure of bovine low molecular weight ptpase complexed with molybdate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bovine Low Molecular Weight Phosphotyrosyl Phosphatase Complexed with the Transition State Analog Vanadate
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z13A00
4S05A 3ILHA 3N0WA 2RJNA 3LUAA 5JNSA 1KRWA 3HJFA 2FMIA 3IP7A 2LUOA 3OLWA 3GV0A 3QX8A 4F8JA 3FDFA 3GWGA 4H60A 4YGXB 4XAQA 5FBKA 4Y9TA 5TE9A 7ABPA 3Q7RA 1P6UA 3L6UA 3DGEC 2OENG 2LP4Y 3SNKA 1D1PA 1CYEA 3TX6A 1C0EA 2JCGA 5IUKC 4RY8A 2MSKA 3FFWA 2CWDA 2YHAA 5JNWA 4Z4FA 4RZSA 2AYZA 4QPJC 1ZITA 2GX6A 2VYCA 2A9RA 4EYQA 2IPLA 1RPJA 2ID7A 3KCNA 2FEWB 3GBVA 5KQGA 2PUAA 2FLKA 3VNBA 3O21A 1PNRA 4G0OA 3K9CA 1ZHHA 4RV5A 5TQJA 4FB4A 4RKQA 5GQSA 5ED4A 1DCMA 3N75A 3QLUA 1P2FA 1ZDMA 2E4WA 3H1EA 4DN6A 4ZYLA 3OLYA 1EHCA 1YS6A 1A04A 5IUNC 4N47A 5HSGA 1C4WA 3RVKA 4N0QA 4H3HB 3KSMA 4YLEA 2PUEA 1DCFA 2CHEA 3LTEA 2F8SA 1URPA 4RWEA 1MB3A 4KNYA 4Z4EA 2HPHA 5C5EA 4NQRA 3EJWA 2WWVD 1JFSA 3SM9A 1Z2DA 4XARA 2A9PA 4O5AA 3N0RA 2QV0A 2FEKA 5E3JA 1K66A 1M2FA 2I6FA 4RK1A 1KRXA 4QYMA 1D5WA 2M1ZA 1USKA 2GKGA 3T95A 1EWVA 1XWWA 4Z4IA 4WXEA 2XDYA 1WETA 2PJUA 3M6MD 4ZJPA 1LK0A 2FXIA 2GBPA 2LIVA 4EUKA 4Z4CA 3LKBA 4LX8A 5HKOA 2E4VA 3OMXA 5DTEA 1NTRA 4ETMA 6CHYA 3GYBA 3H5VA 4KK4A 4EY3A 1DJMA 3QEKA 2IYNA 2QZJA 3A0UA 4RY0A 5GOTA 3HZHA 3SG0A 4ZMRA 4W5OA 4N76A 5F64A 4MR7B 3KS9A 3HCWA 2JVKA 4MS3A 4RDCA 5BQ3A 3UUGA 4G0ZA 1VRVA 2QU7A 4DADA 3P9YA 3CFYA 1P6QA 1EFAA 4O1HA 2N9UA 4MQFA 3C3KA 4W5NA 4E7OA 1HEYA 5KWSA 4KV7A 8ABPA 2MYNA 3BREA 1M2EA 4MS4B 5HQJA 3N6VA 4EYOA 3MF4A 1IIBA 3B2NA 3JTEA 3DZDA 3MQ4A 3DLBA 3RVSA 3LFTA 4PEVA 4EYGA 1ZN2A 4EGSA 4MS1A 3HK2A 3JPWA 1TM2A 3H5IA 2PE5A 5DKFA 2IKSA 5JNTA 3Q7TA 2B4AA 3GL9A 3RVMA 4Z9BA 1GCAA 4EYKA 5TPZA 2IPMA 2RJOA 3CRNA 3FGZA 1FSPA 5EWJA 2Q5CA 4M88A 1U2PA 2MYUA 1DRKA 3NBMA 3OQNA 3JVDA 4G0MA 4ML3A 4ETIA 2IPAB 4WZZA 1H9CA 4KQCA 1DBQA 3LUDA 2B1JA 1JLKA 5CNIA 4F11A 1D2AA 4YV7A 3EULA 5FWXA 1QPZA 3EQZA 2IOYA 4LZLA 1U2QA 2QSJA 4RKRA 1RZRA 1Z25A 3BILA 1LJLA 1PNTA 3GT7A 3O2JA 2RDMA 3EGCA 3H5WA 4RK6A 1RZRD 3G85A 3H6GA 1DRJA 4KRFA 1JBEA 1VKRA 1SXGA 3HSYA 4O1IA 1QO0D 4RU1A 2MSLA 1ZGZA 5JS2A 2VUHB 1Y1LA 1JDNA 3Q15C 5CNMA 3UKJA 4CBVA 2QVCA 1BVHA 1TJYA 3RQIA 4WUTA 2RGYA 3L49A 2P9HA 3LOPA 2CD7A 3HS3A 3I45A 3SY8A 1OXBB 1GUBA 2PUBA 1M5TA 4OG2A 1BAPA 1Z16A 3RVNA 2NZUG 3MMNA 2X7XA 4EVSA 5TPWA 1JL3A 2JK1A 1P8AA 1M5UA 2E4UA 3H5LA 4Q6WA 5CNJA 3H5TA 2PMCA 3F7NA 4LRQA 1ZVVA 1Z17A 4RY9A 4ZPJA 1APBA 1GLGA 2WRZA 5B3JC 5T7BA 1E2BA 3HV2A 1YK0A 1TVMA 3TMYA 4XASA 2PUFA 1LJUA 4YS6A 3CHYA 1FFWA 5TPZD 2PUDA 4MR9B 3OM0A 4G0XA 3IPCA 2A9QA 3D8UA 1JYFA 2WB4A 4MS1B 3OO0A 1JF8A 1Z15A 4MQEB 1Z26A 4IMIB 4RSMA 1U8TA 2VUIB 3KJXA 1FFSA 2DRIA 1QKKA 4N0PA 2HQOA 4ETNA 1Z2EA 3G1WA 1E6KA 3FMVA 3QLTA 4KMRA 4D74A 2E4XA 4QICA 5IEJA 2JB9A 1NXVA 1YIOA 2NT3A 1GCGA 4EVRA 4YCSA 2PUGA 1VLZA 4HNRA 3D02A 4MLDA 1AB6A 4G86A 2FN8A 2FKAA 1QP0A 4F3TA 3F73A 4G0QA 4KFCA 2MYTA 1BDHA 1MIHA 2JBAB 1USIA 1U04A 1ZESA 2LBPA 4P98A 4HNQA 1DBWA 4WT7A 4YO7A 3OLZA 3HEBA 1NY5A 1MAVA 3DLHA 5IBQA 4KZKA 3Q7SA 5IEBA 4Z0NA 3CG0A 2L2QA 2JBAA 5ABPA 1Z12A 5I4CA 1QQBA 5EWLA 1QP7A 2WY2D 5FBHA 5JNUA 3F6PA 3KYIB 1KGSA 2R48A 5TQ2A 3CZ5A 3LUHA 3H75A 1JH9A 4KREA 1DCKA 1XHEA 1E6LA 3LKVA 4MGEA 5TQ0B 4IF4A 4MR7A 2FEPA 2QR3A 4RS3A 4YRZA 3MYYA 3HO1A 4N03A 2ID9A 3O1JC 2HSGA 1PUXA 4RK0A 4LE1A 2KYRA 5TQ0A 1CEYA 1BDJA 3RVJA 2TMYA 3LUCA 3QEMB 3Q41A 1JDPA 3GBPA 1ABEA 3RVQA 3HUUA 2PAFA 2ZWMA 3JVIA 1K68A 2W42A 1SXHA 3LUGA 4MS4A 2A9OA 2IDMA 3N53A 2H0AA 4XFKA 4N41A 3BBLA 4TN5A 1ZAYA 4S04A 5KQMA 3TO5A 3HXMA 2CHFA 3O1IC 5EWMB 4G0YA 2M98A 5IUJC 3QX9A 1CHNA 3QLUC 4HNSA 5BRJA 3IDOA 4YP9A 3KYJB 3NNDA 2FQXA 2ZAYA 2QVGA 4OATA 1GUDA 1QP4A 3KHTA 3UK0A 3R0JA 1RNLA 4KPYA 4GNRA 4KVFA 1OXKB 3I5AA 1DZ3A 2YHBA 3RVOA 3N0XA 4L85A 2L18A 4JOQA 1USGA 1LBHA 1YK1A 2FTKE 2FN9A 3CLKA 1DC8A 4PYRA 2L19A 4FE7A 4IRXA 2WJAA 1FQWA 3OM1A 3KG2A 4E7PA 2HQBA 3K4HA 4Z99A 3Q9SA 3T6KA 1DC7A 4B09A 1BDIA 3MA0A 3FFTA 1QQAA 4Q7EA 3A10A 2FQWA 1L5ZA 3M9XA 4MYRA 3O2SB 3RVPA 1EWKA 3IP9A 2LPMA 2JVJA 2V0NA 2FSPA 3LUJA 4JASB 1ZH2A 3A0RB 2OQRA 1ABFA 3IP6A 4LDZA 4PICA 4G97A 3FFXA 5D2CA 3QEMA 3VNAA 2PLNA 2IPNA 3EAFA 5CHYA 3TD9A 4KK3A 4MPTA 3H6HA 4NCAA 2E4ZA 3I09A 3NNSA 1MVOA 3HDVA 5FWXB 1PHRA 1TLFA 4JB2A 1ZGGA 3CS3A 4XLTA 2HJ9A 1L5YA 2QW1A 3MIZA 5C5CA 3LUFA 3NNNA 2O20A 1U0SY 3JS5A 3O1HB 2FMKA 1D4ZA 3QLVA 1B00A 1NXXA 1JFVA 1T34A 1NXTA 4PZ0A 4XXHA 2J48A 5KC8A 1NATA 2PL9A 3TB6A 2WMYA 2FQYA 2QXYA 4JAVC 1W25A 4JB0A 4LDAA 3S99A 4H3KB 1I3CA 5JNRA 3NHMA 4RK4A 3O74A 3F6CA 4W5TA 1YMUA 5IC5A 2P4UA 3QELB 4IGAA 1RXEA 1QNLA 3EQ2A 1W9HA 1VPWA 3I42A 1BA2A 3H1GA 4W5QA 3T38A 1J56A 1SRRA 4IILA 3BRSA 4RXTA 4RK7A 3E3MA 4GPAA 4EVQA 4UHJA 3T8YA 2FW0A 3CKMA 3LMKA 2L17A 4MAAA 2NZVG 1EWTA 2PUCA 6ABPA 1F51E 3C6QA 4MQFB 3C3MA 1NXOA 1SD5A 2GI4A 4RXMA 1JHZA 1TMYA 3URMA 5T3YA 5TPWB 3DBIA 1RXIA 5DGCA 3O2QB 1XHFA 3OQOA 3BRQA 2R25B 1DBPA 1Z18A 3HVRA 2HQRA 2R4QA 3ILYA 3RH0A 5HM6A 3ROFA 2PKXA 3OO1A 4W5RA 3GRCA 3NHZA 4MR9A 2AYXA 5FWYB 3SQNA 3IPAA 3H1FA 2NUBA 5PNTA 4WWHA 1FFGA 3OLXA 2WJWA 3A3KA 4ZMSA 3OQMA 2JRLA 5KI6A 4MQEA 4JP1A 3RVRA 3QK7A 3HUTA 4L4UA 1Z13A 4Q6BA 5EWMA 3MM4A 3EODA 3HDGA 5KC9A 3E61A 2GWRA 1QMPA 4MS3B 3N8IA 3CU5A 3C3WA 3M9WA 1YS7A 3KLOA 3SAJA 4WXMA 3EDCA 3KTOA 2FLWA 3GA5A 5BRAA 3DGFC 4MR8A 4NV3A 4IMJB 4D6YA 3IP5A 4UHKA 1JWLA 4RXUA 3CTPA 5DLEA 5EWJB 4LE0A 5CNKA 1YVUA 4RK5A 2VK2A 1ISSA 5EWLB 4TLLB 4OLAA 3OLVA 3H5OA 1NXWA 5TQ2B 2BGGA 4D6XA 1PEYA 1S8NA 2JVIA 4MRMA 4PE5B 1A0OA 1NXSA 2PL1A 3QELA 4G0PA 4F06A 4Z9AA 4OTZA 5DCLA 3KKEA 4LE2A 3CG4A 4MR8B 1ZY2A 3LUKA 3RVLA 4MLCA 4F12A 1DP4A 1DG9A 4Z4HA 4P1ZA 1JYEA 5FWYA 5IULC 5JNVA 3ROTA 1LBIA 1D1QA 3KLNA 3JY6A 4HYEA 2FMFA 5IX8A 5B3JA 4DQDA 1PEAA 4TMYA 5BR1A 1YMVA 3JPYA 5JS1A 1NXPA 4NCBA 4MRMB 1A2OA 4KQ9A 1JX6A 4QYWA 1E6MA 4YWHA 1ZH4A 2H3HA 3W9SA 2F8TA 2NT4A 1SXIA 2FVYA 4NICA 2MSWA 1EAYA 1ISRA 4YR7A 1UDRA 9ABPA 4OBBA 5KQPA 1JFTA 4OLBA 3OMWA 2MYPA 1MB0A 1R8JA 1F4VA 1AB5A 2E4YA 5KQLA 2FMHA 4JA2A 2R47A 1YTUA 1QO0A 3CNBA 3HM9A 4Z4GA 4FE4A 1KMIY 3CZCA 4TLMB 3C97A 3QLVC 3O75A
chains in the Genus database with same CATH superfamily
1VJTA 2CVQA 3WKCA 4YCDA 5EE0A 5JS8A 4JQOA 3ETDA 4RH0A 3NG1A 4G8BA 4HGNA 5WRFA 4N3GA 3T0FA 2ZU6A 3PXBA 3QX8A 2IQIA 5EA2A 1OBOA 1HWYA 4CMIB 4G4GA 5B58T 1P3DA 2O8DA 1E5XA 3CH4B 1O4VA 4CKXA 2BM1A 4HTAA 4S3MA 3AR8A 4C05A 2OHXA 3NATA 4CM3A 4CKYA 3D6NB 5IUKC 1G8KA 3D4NA 3MAGA 2XUQA 2ZQYA 2WE8A 4DJFC 1KFCB 3ELYA 3GVIA 3JQDA 2R65A 5JCOA 5IC4A 2ZCJA 1RPJA 3VU9A 4I6EA 3O21A 4D45A 4RIFA 3U3KA 4EATA 5FLKA 1CRLA 4LGVA 4K3VA 2CFIA 4DMCA 3PEUA 3N75A 1QFYA 1ECJA 4MTLA 1GPJA 2VF4X 2Z5VA 3K1ZA 2HMWA 2YH2A 4H18A 5FNVA 3PVCA 1FDSA 1N0VC 2WJ3A 3AHDA 4RMJA 4PLPA 5CFNA 2AF3C 3E3OA 4PAGA 2GK6A 5IAJA 1OVGA 2CHEA 3ABRB 1ACMA 1T3HA 4U8GA 2WTEA 2HPHA 4PSAA 5DI3B 5D5QA 4GMXA 2VWGA 4MH0R 1Z4PX 3Q1KA 3QRWA 2BAGA 13PKA 2VC2B 1CRPA 4XGIA 2JIDA 3BC1A 1PL6A 2BJVA 4QGBA 4M54A 1K9VF 3N0RA 3MJRA 2OAEA 3JQ6A 1V5GA 1CQZA 3K30A 4CZ2A 2BFCB 3FBTA 4ZTUB 2FEXA 4G8DA 3QX3A 1N4AA 4L9SA 3PJDA 1A4UA 1E3TA 3C5WP 1YZNA 3FROA 3NXSA 4WXEA 1LK0A 5K0GA 2FPPB 1S7GA 2G8LA 2JHPA 1RKVA 3LHIA 4N3BA 4M38A 4OV6B 5BWMA 3Q9NA 1LS6A 1UT6A 3AY0A 4B34A 1TAQA 1XNHA 1OB5A 5GOTA 3LT5A 4UULA 3KZOA 3V7YA 2IH4A 4KUGA 1YGPA 4WNAB 4AFNA 2P67A 4N76A 4Q9DA 2BGJA 1M10A 2WFLB 1PT5A 1YULA 3BXEA 4X97A 5HWSA 1L5SA 3JD4A 4R1NA 2D5LA 1JT9A 2V7BA 2P77A 2WSYB 3C5EA 3SQXA 1KAMA 4MIEA 4BNXA 1JW9B 1CB7A 3G2IA 4P4NA 2C4HA 2X9LA 1CVRA 3F46A 3N6VA 4C30A 1RU3A 4XX0A 3GRAA 4ALMA 1BHO1 4QM6A 1BGXT 1I0IA 4IJVA 3NUZA 1EFPA 4GP9A 3WKEA 1YDHA 4GNKA 1ZGHA 4Z9BA 1V41E 1QFMA 1WDLA 1C1YA 2IPMA 3GN2A 1TI7A 3GUYA 2D00A 4IXMA 4JC0A 4NEGA 4OK6A 4OHMA 2AN5A 4HH1A 3SBXA 1Z6XA 2I2CA 4GLLA 2Q0HA 1ZPDA 2Q5CA 4I1VA 3DDSA 2RC6A 1JVSA 1MJ5A 1L5VA 1NLYA 1SOMA 1X92A 3IDZA 3TW8A 1UBUS 2JLSA 4KCGA 2PWAA 3L0OA 4G0MA 1D4FA 2GHTA 3NHUA 5DMXA 3SC2B 4YCCA 5KOJA 2C3MA 5ETJA 2H1OA 2B1JA 4B3GA 3IP8A 1M67A 4B3IA 2RFLA 2BFOA 3LM8A 1Q19A 3UANA 1FDWA 2W71A 1O6GA 4A0RA 3B20A 1DFHA 5JLJA 1U2QA 4EJ0A 2VQEB 5F3WB 5B2FA 3BIWA 4B6JA 1R0WA 3HWWA 3GCGA 3WIBA 1P9OA 1FFDA 3EFOB 1Q44A 3OMLA 1JP7A 4AY4A 4YXWD 4NCKA 1XAGA 3CSUA 3QGMA 3RVBA 3TSYA 4ZV4A 4PLTA 3SSNA 1WZUA 5BNTA 2R6AA 4HN2A 5EHXA 4C1BA 1HFKA 1VE7A 3BD8A 5EZQA 4GD3Q 3DAFA 3F0TA 4NFLA 4XYMA 3TKYA 1LBEA 2AMFA 2QDXA 3LPMA 4NDAA 3LH5A 5FKJA 1MO4A 2HJWA 2C57A 3K8YA 3I2JA 1IBCA 2EDAA 1K7CA 2A0WA 1NKSA 1WUJS 3SEFA 4IO0A 4MPPA 1EFLA 1NQXA 4NRDA 4BKQA 4C0HA 1KMNA 2P9HA 2WYUA 1R4NB 1Y5MA 4OFXA 5BQPA 3SY8A 4AL4A 2HUPA 4D9FA 1SKMA 3PDIA 1Z34A 1VBFA 3BGWA 4R54A 5EP2A 2PUBA 1CS0B 1A8PA 3A9UA 3FUXA 3FYUC 4LWQA 4NHOA 3RVNA 2KI5A 5COAA 1E18A 4MWBA 2AVNA 1PUJA 3WLLA 5JAQA 1Z4IA 3VU8A 2GAFA 3LWBA 3RYHA 5REQB 3T9BA 1E66A 1A2KC 4ZVKA 3PT5A 1GG8A 5CHEA 4QUJA 1BVUA 2P91A 2PMCA 4NJOA 4GECA 3DM5A 4IV5A 5G0TA 1ZJWA 4A4DA 4W7SA 4AJIA 3U4MA 1AK2A 3WLOA 4AO6A 1FRZA 3N3BC 1XQ1A 4MP3A 1V4NA 3QU9A 5LUBA 2DX7A 3G49A 4L02A 3IVMA 3PYXA 1U1FA 3T5BA 1P31A 3TSZA 1A9XB 1CT9A 3QTTA 2O1XA 2REOA 2GN1A 5AW9A 2HSZA 4B8ZA 2EHJA 1XQYA 3K05A 2ZYRA 2WSLA 5AHKA 2FWIA 2EV9A 3HLKA 3WDMA 3L05A 5IJ9A 4MS1B 2WJJA 3OO0A 1SG0A 4LQDA 5J59A 5FOQA 2PUWA 1FOEB 2BYTA 1L3CA 1YE5A 2HSWA 2WW8A 1ZR2A 3LVQE 4Y18A 4TL9A 4URXR 2G4CA 3B8HA 1TCUA 4F3CA 2JD1A 3EVEA 3ILSA 1TDJA 1OV4A 1N3YA 4D74A 4KKXB 5BV2P 2DAPA 1I80A 5AVQA 4RGBA 5F2OA 2C4MA 1N8KA 2NYAA 3ELBA 3OSZA 1PWZA 4X20B 1JG1A 5KYYA 1N6KA 1KI8A 3NVAA 3G3EA 3UICA 4GXTA 4R2WA 4PF1A 3KB2A 2B36A 2HK9A 3JR3A 1NBEA 2VTDA 1KVSA 2XNDA 3NUQA 3OFNA 1ZESA 4M1YA 4NBLA 4XSGA 5I9BA 3T35A 4XCVA 2YRWA 5CVJA 2X8BA 1WAMA 3HEBA 3HXPA 4Y6LA 2RC5A 4DIUA 1K2WA 1XCMA 1QIIA 3T3NA 1HKUA 2W11A 3DZHA 3CG0A 3FIUA 2AWOA 1NP6A 4XVRA 3MMXA 4URFA 4UOZA 3K2QA 3TLBA 1F06A 1YBFA 5CDTA 2QTZA 3MTEA 3KYIB 5CT8A 4TMFA 3ZZNA 4IH9A 4DWJA 3UJNA 1KR5A 1Y5LA 3BMOA 4RL6A 5DHTA 1XVVA 3A1WA 2H63A 3M6FA 1GJRA 3ESDA 3IRVA 3LKVA 4LWOA 1R50A 1XOIA 5INTA 3QP9A 5DXAA 4QXRA 3B8EA 2J4DA 3AK4A 1DRWA 1N5IA 2Z83A 3CZQA 4U2FA 1KFKB 3TZ6A 3BMCB 1K7XB 1DLIA 2YVAA 2AG8A 4MHOA 3WGTA 3ZYCA 2ZSIA 3F8WA 4B6QA 3QEMB 3WADA 3HBJA 7REQA 3WRWA 2IXBA 4XR9A 1TZKA 2A30A 1EGAA 3F7MA 5TMDA 4DAOA 2YHIB 1OZ0A 4II7A 3EXHA 4X3CA 5IG2A 3I5XA 3IEVA 5LQMA 2HF2A 4GBMA 2AJTA 4TRJA 1JI3A 1I5OA 1JSXA 1DIOB 2RHBA 4TN5A 2HHHB 3A58B 4TYYA 2IKQA 2CLIB 5EG5A 5LZ4A 5BQFA 2GAJA 2RONA 4V3BA 5JI2E 1KETA 4G5OA 2Q3BA 1FLVA 5CT9A 3ANNA 2P2ZA 3QJYA 4MJ7A 1V1RA 3REQB 3ZHYA 3LXMA 5T57A 1QG4A 4AP6A 1XCJA 2FQXA 3ZU2A 2QRZA 2MMCA 4LHEA 4LVUA 4MLZA 3FOBA 2ZBUA 1VDZA 2BMVA 3QTLA 2IYRA 3WNVA 5HK9A 2EWMA 1U4SA 1RE1A 2GDJA 4LXUA 4NOJA 1DZ3A 1G5PA 2OTCA 2YY7A 3HDTA 4ZTBA 4WEQA 2VO1A 1MTZA 2XUIA 3CUYA 1LPMA 3JWPA 3IO3A 4EITA 4ED9A 3E7WA 2H11A 1HE2A 3TM4A 5HJ7A 4F46A 4UNIA 3FTEA 1Q0RA 4QHYA 1SB8A 4I1SA 4QLAA 3T3HA 4YQFA 1C5KA 3PNYA 3IB6A 1V2GA 2W8BB 4O63O 1DC7A 1QCCA 1I7NA 4BPRA 3VH4A 3MT9A 4KAFA 4JI4B 3DZCA 2VRWA 5EXPA 1ADJA 1Q77A 4P36A 2ADMA 2I2FA 1MO2A 1KE1A 3CCFA 4HNVA 5CYOA 5EQTA 4DLXA 1VQ1A 1NMXA 3PUXA 5TLSA 3IRUA 1Z0AA 2B8NA 3OEHA 5IP5A 1CLEA 1BWPA 1TLTA 2XKKA 4G97A 1P73A 2PZLA 1OX6A 2PYZA 4C6TA 1YIDA 1RAGA 2PLNA 2WAXA 2V7PA 3JX9A 2B3DA 1IONA 4BNTA 2RHHA 2DXIA 1UADA 1WCIA 1VGRA 1PO7A 2ODEA 3OM8A 3SC4A 2J3KA 3WGLA 1DTWB 3MB5A 2ZSEA 2V65A 3CNLA 3HWSA 4IBOA 1GZVA 1E58A 2HJ9A 2PD6A 1M9NA 5FJJA 3THSA 3VHXB 4QTXA 1SBZA 3IC5A 4PYMA 1P7ZA 2BEUA 1PYOA 3MSCA 1IULA 1ZNYA 2O20A 2VXBA 3R7FA 3OOJA 5IT4A 5CFLA 5JXIA 5GTDA 4MWGA 2IHBA 2DC1A 3IEMA 2WOOA 1TA0A 3NV9A 3CXUA 3UMYA 4Y6OA 3GFFA 2OO7A 2CEKA 2CSUA 4XXHA 3RRXA 2DPGA 4JT4A 4X64B 1QO9A 3AV0B 3NEJA 4LV8B 4MP8A 4LZJA 2P1ZA 4NARA 4ZAFA 5FF9A 4B6FA 2C9YA 1WX1A 1W25A 2QXYA 3CRZA 2KW5A 4CUKA 5BYKA 1T8RA 2BKUA 5A7GA 4QKQA 1ZJZA 2AK2A 3KZMA 4TYQA 3F96A 3GEDA 4HNGA 4N0EA 5BSVA 3GJ5A 1W9HA 2IYQA 3H1GA 1EJ2A 1WU8A 3O9ZA 1J56A 1BG6A 2QF7A 1LEHA 1V9SA 2EF0A 1Q1EA 2G40A 2GK7A 3DPUA 3FH0A 3MMZA 3BVPA 4PSUA 4CTKA 4AJKA 4IHAA 1P7CA 1ZL0A 5EKTA 5NLLA 1EE9A 1KI2A 2J6HA 3JQFA 3LRXA 2H85A 3VSCA 5JHHB 4MWTA 3OE5A 4H0NA 4OHPA 3L93A 4MVJP 2H0QA 2H2GA 4D57A 3C6QA 1NXOA 4R1MA 1JHZA 2KS6A 2NUTB 2TYSB 4XGQA 4TQ9A 2OBMA 2PV7A 3SYLA 4GQBA 1RXIA 5DGCA 4MROA 1RZUA 4BC1A 1V2HE 1QANA 5BYAA 4HI0E 3U0VA 4BRUA 2RSLA 3KAQA 1HYHA 4RCZA 2GB4A 3CLRC 1M0SA 2OGSA 4J16A 1F4LA 1L7MA 4YQEA 2ZTLA 1ITZA 3RJMA 5LYYA 3AOEA 3U4AA 5LJLA 1A5ZA 1FU4A 2J9GA 2LZ0A 2NUBA 2OBBA 1ZCFA 4M49A 3A2MA 5CLQA 3R3HA 1AMOA 4JP5A 2A92A 4I7EA 4JL6A 1GUAA 2ZI6A 5I7OA 5CCEA 1V3QE 4HDSB 4JP1A 4K46A 4QOEA 4TXMA 4DA7A 3GMTA 3HUTA 4ATNA 4MUBA 4Q6BA 4JP3A 2NZWA 4E1BA 3QWIA 4A3SA 2I34A 1OFHA 4HDNA 1TM7E 2BBOA 1HG0A 3LUPA 2XB2A 2D7DA 4WFJA 5DGTA 2ECQA 4OSEA 2HCBA 4XW2A 1SVWA 4XDGA 3W1VA 2QENA 3M9WA 2D1TA 3UUEA 5HZKA 2X6TA 2QLLA 2X9GA 4ZVVA 4URYR 3RASA 1KU0A 5BVHB 3L8ZA 3ZJ5A 1NN3A 1U0NA 2O8BB 3K4QA 4UUQA 2P9GA 3OCWA 4DXDA 2J87A 2HLNA 2IPXA 1U0HC 2YWBA 1UEIA 3CLTC 5FLEX 1Y8CA 1XQ6A 5DLEA 1KZHA 3VOAA 4ENRA 1JWLA 1MN6A 4BO8A 3FPSA 1GDDA 4U7HA 2CNWA 4TV9B 4BWVA 3UAVA 3B70A 3BA1A 4OLAA 4Y2VA 1NNUA 2YJ4A 1MO3A 2A35A 3EOAI 2ODAA 3QE0A 4AUEA 2HN9A 1M1YE 3ZV5A 4MUNA 1Z9BA 2ZWIA 1IUKA 3HP1A 3KJGA 3R3YA 4MRNA 2R2AA 3MRTA 1OASA 1W5EA 3A25A 1DAIA 1NPTO 5ILOA 1U8ZA 1XLTC 2B4QA 4KQMA 2B6HA 4FDAA 3KKEA 4LE2A 1NF2A 3PTAA 4YMVA 2IELA 4DSOA 1QVRA 2R44A 5A4AA 3N2LA 3NVKI 4O59O 4EZBA 3TI7A 3ZU5A 2WF8A 2JEYA 4EBBA 1SPXA 3BMCA 1DEXA 2QN3A 2JBWA 2XAUA 3NWBA 1U1GA 2BF4A 5DISB 1IPFA 2SECE 4INJA 1BRMA 2V4MA 4KQWA 5JYDA 3LL4A 1XRLA 3V6LA 1YHZA 2BZGA 4ENWA 3SHTA 5JV5A 2C04A 3B6JA 1TRHA 3P45A 4V24A 3P5BA 2HYIC 2QL6A 2ACKA 2EFEB 2V7GA 3LBAA 4RPIA 2H1CA 4ZQCB 1KEKA 2OBXA 3N0TA 1DBSA 4JWTA 3PFCA 3UWSA 1X7XB 3U7HB 1F7VA 4ZVRA 4PGGA 4ZJYA 3VNQA 2JAQA 4GQIA 4NV1A 4BX2A 2JLQA 2ICAA 2Y93A 5JCJA 5IF9A 4KAJA 5JR3A 1DKQA 5DIZA 4JIMA 3FOEC 1A98A 1M8PA 4E70A 4D9GA 2JFUA 1EVEA 3FSJX 3O4VA 4DJEC 1FUIA 1JTFA 1I2CA 4AQYB 4TWZA 1H23A 2O3SA 3D8SA 2H4HA 5TEWA 1BFKA 2B7BA 1YL6A 1S2MA 4CTMA 5FPKA 1TKRA 1ULZA 1K7EB 3JAWA 3N0WA 1EUCB 2I3DA 3A1FA 3I2KA 3Q7EA 1ESEA 3CVYA 2R84A 3RVDA 3ENZA 5DHRA 1P2UA 2QN2A 4ND2A 1HTWA 4YRRA 3E4DA 4A27A 5LUAA 4CM8A 2IYFA 4QEZA 2LXNA 4WKNA 3Q88A 3K3PA 4PHHA 3DNMA 2WYHA 3FGNA 4HBGA 3OTOB 4PYKA 1YR2A 3MQ2A 2CL6X 3D4OA 2G0AA 3MVEA 3PYLA 3DE2X 3AINA 5CDFE 4XJVA 1GPYA 1DRUA 4RPCA 1JPNA 1UJBA 3BXFA 2FLKA 3GG2A 4E0BA 2XTZA 3PPVA 4YHBA 1EXMA 1FTWA 3QJGA 1U65A 5C7LO 2I99A 3DVLA 1G3QA 5F73A 5A03A 2FZVA 1LX7A 5C7OO 4K9MA 3GUCA 3D2CA 4IJMA 3UZUA 1EHCA 1M2KA 2VOJA 3GLSA 2HRCA 3HCDA 3TAHA 3DMYA 4DDHA 3VHXA 1U99A 5LYJA 3KJEA 1N8TA 5EIEA 4ANFA 4ROSA 3LBIA 4FC7A 5LJIA 5EJ4A 1M72A 4YJ3B 3QF4A 2Q9UA 2EW8A 3P5SA 3RYCB 1H1TA 2V6GA 5CXUA 1EGMB 2XECA 4G5YA 1Z2DA 2WG2A 5IJAA 3ZWAA 5DN6D 3BD6A 4O5AA 1WPQA 5FI3A 1K66A 4HH3C 2C7PA 2VLIA 4JI1B 1RP1A 1Z2CA 1Z0IA 3SS8A 2FUNB 1C1XA 2PPLA 1M1NA 1QGED 1FP6A 3C1UA 5C31A 3VC2A 5JJ5A 1ZW1A 3DBOB 4IKPA 1S1CA 5KTNA 3RHSA 2CL7X 5CURA 2H54A 3LKBA 1PDWA 4Q9IA 1Q7BA 5DTEA 1FYWA 4TKLA 1GVNB 4XJSA 3UAWA 4YYEA 3TQTA 2J8ZA 3LWDA 1ICEA 3A6LA 3WL6A 3RKRA 1PJZA 2VK4A 2VZ8A 3FPKA 2WE7A 3QPUA 2XNDD 4CTJA 1SUSA 1WD5A 3TEMA 1UQUA 4DC0A 2Q5FA 3RRMA 2XCSB 1EVLA 5CA0A 3TB4A 3KOXA 4WEOA 1VRVA 3WMWA 3H1TA 2HIGA 3G5TA 2HU7A 3FWYA 4UFOA 4J9UE 1P6QA 3JYOA 4UHEA 4AWAA 5EPUA 1Z6GA 2NO7A 4W5NA 4EOGA 1G55A 1MEOA 1ZK4A 2A14A 4K6MA 2A67A 3T9CA 2QBYA 3QMWA 4Z9FA 4IQGA 2G09A 3M4ZA 2OFWA 1K8RA 1GRQA 4RVUA 3RNLA 3VR2D 5KOYA 2MU1A 3BMOB 5AI8A 3B2QA 1IY0A 3CNEA 1V11A 3WRVA 2VQFB 2EP8A 4YV2A 4Z3OA 2HMVA 3HK2A 5BOVA 2YWGA 1DT5A 4ZAVA 5EESA 3V4SA 2IKSA 4YMLA 2HDNB 3BWBA 4MCIA 4UJ5A 1W49A 4F6CA 4TS4A 3RVMA 3AMVA 1DQNA 3G2LA 3PFHA 4P53A 4KUEA 3VHQA 2X7JA 1JR3A 1FLNA 4YDQA 2JAXA 3ISTA 2BGKA 1CQIB 1MRZA 2IU3A 2VI5A 4OXKA 1Z63A 1HNXB 3GEIA 2CB0A 2HB6A 1PJAA 4N0DA 3BULA 4MUYA 4G65A 2BEUB 1W85B 2W22A 4NH0A 3EW9A 3LUDA 3WL5A 2FPGA 4BV3A 2J32A 4DCSA 1ZNZA 4GX5A 2GM5A 1GA6A 3LL7A 4M55A 4OP2A 4CQJA 3Q8MA 2Z43A 1YVPA 2W0SA 2E3JA 3EULA 5B6JA 1A2QA 3IV7A 3EASA 2EG5A 1JR6A 1C2YA 3LX8A 4MEBA 1U7XA 4QVIA 2WTUA 1IM5A 3KDAA 4XH9B 1LJLA 1C0KA 2J31A 3OAAD 2WU3A 1WXDA 2RGCA 1L7EA 1XLVA 4I2NA 2FEAA 1LSOA 2P11A 3NTOA 1E61A 4QGSA 4J94A 1NJSA 1GRRA 2PX8A 2I6XA 2PQ2A 3LVBA 4YNBA 1KMMA 3B1JA 4R98A 4U39A 1OYYA 5DM60 1D4OA 1Z7GA 3IAFA 4CBVA 3GDOA 5A3QA 3KWMA 1H2WA 1RD4A 3PCXA 4ECEA 3OPYA 3ONFA 3TAUA 4C7KA 1V5EA 4LF7B 1FYDA 2W6JD 3HDQA 4JR2A 2OYCA 3TCXB 3LOPA 2X0NA 5IRCD 4BGEA 1C14A 4R69A 4WLEA 3A2KA 2ZYAA 2ZRBA 3K6KA 4JUIA 2N3ZA 1X7YB 2HQSA 4GKKB 3WLSA 1H5QA 2HZ7A 3FHTA 2J09A 2A58A 4O4HB 2QPAA 2RBEA 1T5HX 4QREA 3MMNA 3ZDYB 5AW1A 3HTXA 3ON5A 2J5XA 1A8SA 3BFXA 3H18A 1LLDA 4U0JA 4HQRA 3KUCA 4MV4A 5JEDA 4Y6QA 2P9CA 2WLSA 1O95D 3F7NA 3FUWA 1JILA 3QKSA 3QXHA 3L92A 1JQAA 3FNEA 3TR5A 2JGJA 1P5RA 4UBIA 1TTPB 4FGJA 3RS9A 1NUSA 4DNXA 3B7GA 3IUPA 2YS7A 2C4TA 3C6ZA 4IHJB 2ZUTA 2O3QA 4GS5A 1OC4A 1UJMA 5JXWA 1GRVA 4H15A 2OR3A 2QLFA 1MOZA 1OGYA 5JMPA 4QFDA 4M7RA 4YS6A 3ZJUA 5K9ZA 5HILA 3FKQA 3QQPA 1SUCA 1F4PA 1GUFA 3RQSA 2CXQA 2RHOA 3DMHA 4BATA 4JKIA 3KPUA 1WXFA 3P1JA 2DKFA 4J4BA 4KHPB 1G21B 2XDWA 1SKUA 4HEHA 2OQ2A 4IS3A 1ICIA 2YMMA 5AKKA 1E1CA 5FULA 2HGZA 5T5QA 4YAIA 3BTSA 1RXYA 1ZH0A 5DVZA 5HRUA 4XEUA 3AEYA 3N39C 4KXNA 5IVIA 4PNHA 3P9QA 4X8OA 1GCGA 3PPXA 1U3WA 1RJGA 1VI5A 1PE0A 2D2IA 2FW9A 4LJLA 1D2RA 4M53A 4R5MA 1AB6A 1P6XA 3GEMA 2CNLA 2REBA 1U0LA 2FN8A 3HUFA 1R12A 2BMAA 4FJ0A 4RVHA 3O9VA 3UOAB 4I9NA 1S96A 5A4FS 1VYUA 2VXCA 4BN0A 1HORA 1WXEA 2FWRA 1JEAA 4IDBA 1NBME 4UDXX 3H84A 3VTZA 2FWAA 3MNFA 3ZHXA 4WY2A 2OV4A 3WMXA 2IOFK 5LN1A 4BVFA 3K0AA 4EHBA 3UF0A 4W1QA 4ZT3A 1KMHA 2RBGA 2ZUCA 1QGOA 2DKOA 4GPIB 5HKOA 2WY2D 4DR5B 1A77A 3DYIA 3H11B 4M2LA 4TKVB 4UMEA 3RW9A 4KGVA 5HX7A 3A6PC 3SBDA 2A5DA 3UAZA 1XHEA 3IUSA 3TRDA 2ZDQA 5I01A 2PSFA 1A1SA 4RAQA 4TMWA 5TQ0B 3SR3A 5T8KA 1BHSA 1XKLA 3IQEA 5G53C 3A14A 4UE3S 3T5AA 2CF5A 1A5SB 1US8B 3B1KA 4DIOA 2Q5HA 3NAMA 2YCLA 2ESRA 3OZGA 5AP9A 3U5TA 3I1IA 1UC9A 2QNIA 2IITA 1QHNA 1ANKA 1GGJA 1V35A 2GA8A 4EX6A 5ICSA 3RF7A 5LPNA 2WKRA 1NYTA 4ZJZA 2CV1A 5D3ZA 4UTNA 1IZ7A 3NRCA 3DV2A 1L5NA 3N53A 1UMCA 3NM6B 1EA7A 3T7SA 3SXPA 4AD8A 2QB5A 1E7YA 2XMZA 4I5DA 1WSWA 1SU6A 1PWYE 4PGMA 3ENVA 3WGYA 1ODSA 1YRBA 7GPBA 1T0IA 1F2UB 1DELA 3OX4A 2PX5A 1AGXA 3WLPA 2X5NA 3COZA 4I9GA 1RC1A 1X19A 1IY1A 5CVUA 5K2MA 1OROA 1U5AA 4KVZA 2OO5C 1T6ZA 2QVGA 2ZXEA 5JC1A 1V16B 3PPIA 1DWOA 4KDFA 1IAQA 1XIVA 4KTTE 2ZE8A 3FNQA 5AK6A 1DC3A 1GPMA 1VLJA 1X1RA 3FCYA 3UENA 3ZG6A 2VPWA 4GNRA 2PTHA 2XDAA 1U5BB 4CFYA 2CJFA 3D0RA 2OZLA 3MT8A 4X7PA 1IVSA 3BK1A 1ESMA 2FN9A 2KPOA 1AO0A 2VYNA 4MVJI 2YUIA 2ZR9A 3GLHE 3NDRA 1N6PA 2R7AA 4D7AA 1XA4A 2CBZA 4P22A 1W36C 4MVJD 4OKIA 2DEUA 2GASA 2BTQB 2ZJ2A 5CB8A 1Y48E 4YBZA 3SOPA 3VJLA 4ZODA 3FCXA 2J5KA 3IBCA 4L4SA 1L5ZA 4XLZA 3D0KA 1ADYA 2ALJA 4DSNA 1ONNA 5ES4B 5DT2A 1VCMA 2BM0A 1JN0A 2OQRA 2W0MA 3A0RB 3O4GA 5AXBA 4PCVA 3WJ1A 4NFSA 5J4VA 3BSFA 5D2CA 4PYIA 6GPBA 1XQ9A 1RJEA 4TRMA 2QM3A 5FV4A 3TBHA 1BN6A 1U7UA 2NO9A 1ECCA 3M34A 1NA5A 3O92A 3L1VA 1L2TA 1GUYA 1Q16A 1Z56C 5H3LA 4EHJA 1E4YA 2YRFA 2XXBA 2V7QD 1DEOA 2QEQA 2J4FA 3LIIA 5F4BA 1NOJA 2D0IA 2PSDA 5I7WA 1TU4A 3W8RA 3BEDA 1X1AA 2YOHA 4LGYA 3UPDA 1EFTA 4EKGA 9MHTA 3DYVA 2DETA 5F1KA 4F0JA 2FUCA 3SVLA 1AXGA 3FDJA 2RHRA 2NAFA 3D7MA 4F84A 3BHIA 2XTNA 5IAAA 5CM2Z 1A2BA 4PZ0A 4JQSA 4P86A 4WGFA 3P2JA 4J1TA 5A9TA 3VV3A 3U4HA 2G4LA 3TB6A 2EFYA 4LHWA 2D59A 2UKDA 3CUKA 3MTIA 2J85A 1RKUA 1Y3CE 1BH2A 2QNRA 1E3WA 2YZ2A 3PUWA 3VI4B 1HE1C 1O8CA 2QDKA 3C8MA 3HUDA 1RLIA 3PIIA 3AJDA 1XTUA 2P4UA 4KQJA 5SYAA 2WU0A 4I1YA 3OTWA 2AYYA 4YPOA 4BO7A 5J4KA 1FU7A 2F3SA 5KVAA 5G02A 1AJEA 2O14A 2FPPA 3U7GA 2J0UB 3D6AA 1YKFA 1IOVA 3SJCA 4R1LA 1LC0A 1CBUA 1E9SA 1XZCA 2PLRA 3EC7A 4JVOA 5BW5A 1HDGO 3OCJA 4HH4A 1RYDA 2W2VA 5D6NA 2O8FA 2EL7A 4EGJA 4BAGA 3NAZA 1N6RA 4Q7KA 3HFGA 5T3YA 3HGQA 1DAEA 3H2KA 5LC1A 5KSWB 1WMEA 2PNJA 2H1FA 4OLFA 4S1VA 1KDZA 4HMQA 3DHYA 4PG5A 3GLTA 3CZPA 2AWNA 2W2PA 3DW3X 3I05A 4J7AA 1EX7A 1TRKA 4UXIA 1HM5A 4M87A 1Y4AE 5AWFC 3RC1A 1RM0A 2PKXA 3W5UA 4M76B 4W5RA 2A9JA 3EZ7A 3FLEA 3KEOA 4H7FA 2TRSB 5K3OA 2PMKA 4G3XA 4OI4A 2E6UX 3LIPA 1Y4ZA 1G9TA 1F9EA 5GONF 1F0KA 3GJ8A 4HDRB 4EBFA 1I1OA 3O3CA 3RG2A 1CUIA 3TXYA 5ALDA 3ISJA 3CJTA 1N7JA 3GY0A 1I2MA 1WO8A 3CO5A 4L4UA 3EIOA 1S89A 5EWMA 3X1XA 1YB4A 2ZAGA 2QRNA 2P3OA 2ZU0C 3EGVA 3JYLA 3LO5A 2JGDB 4L8YA 4OHFA 4CG1A 4GLBA 1HE4A 2MSDB 1ZD5A 4NMHA 1PIWA 2JFWA 3RKUA 1XF9A 3TRJA 2I55A 2PKQP 3B13B 3CU5A 3DZIA 3JD1A 1A9YA 5D7NA 4BKPA 2DR0A 3NWJA 4DR7B 4FMPA 4A8TA 1V7CA 2Q1TA 2OBFA 4PX9A 5DYWA 1U2ZA 1NMZA 2QVBA 2V74B 4ETWA 1UEXC 3DKIA 2UZ1B 2QM0A 1XD8A 2FR1A 4KLAA 1EH5A 2NSLA 1UBNA 5DTRA 1H4TA 3PUIA 4CR7A 2O50A 1GTVA 4RGYA 4QUHA 1RFGE 1QJCA 2AV6A 1P5HA 3LRTA 4MWOA 1PNOA 2DGDA 3EQ6A 4UU1A 5BV8A 1F3OA 2BGGA 2G9UA 4Q3OA 2PA3A 4CYMA 4D6XA 5KMGA 2PXXA 2PLFA 3VKUA 4CKBA 3T5MA 3WSWA 4YAJA 4LZWA 3G2KA 4MYDA 2O6LA 3L0SA 1RSZA 2QN6A 4OMCA 1CERA 2BFDA 2BMEA 1PZFA 1Y37A 2ZIXA 3LLMA 3LNTA 1ZN9A 4M9XA 1SK9A 1C0LA 1XI2A 1Y4SA 3GAAA 4QAJA 1MC5A 5AUPB 4DQKA 1WHSA 5CDHA 3AERB 4P1ZA 4BKRA 1YZKA 5CFZA 5JAMA 3ROTA 3ADBA 3BQ9A 4ZCTA 1CK4A 1D1QA 2QQFA 2ZSHA 2C03A 4FHGA 1ZEJA 2J0QA 1CY1A 2AE1A 1PG2A 4A6XA 1R5NA 4FYHA 5IH7A 2OP1A 4D9JA 3CH7A 1YZLA 1EFPB 3NGLA 4JKYA 3RAEC 1MQ9A 1ZC3A 3I9MA 4HJRA 5H5JA 1T0PA 3L84A 1O97D 2BI8A 3Q10A 4ARIA 2EZ8A 1X74A 1TVKB 4L6CA 4M7OA 3EUWA 1RAFA 3ZY6A 1WBDA 3BH6A 4JITA 3ZE0B 2NT4A 2FVYA 4IIVA 4TQGA 3T34A 4Q3LA 1EAYA 5CK5A 3ANTA 1EE2A 2Z4RA 1RCTE 3JQRA 1W6UA 3LBNA 4K81B 1ORTA 2X3UA 4PW0A 4LY9A 3K0SA 4JV5B 1JHRA 1TYDE 1ZS9A 3F5FA 4ZOAA 2FMHA 4YDRA 4DJJA 3GNTA 4A91A 2R47A 1O5OA 3MEQA 1L3IA 1GARA 2PAAA 3EFBA 3FLAA 3VXKA 1LKZA 5IMSA 3JTMA 1RC0A 1Q3KA 4ND7A 5BV7A 3SJZA 1V8DA 3EG9A 2OZLB 2QLBA 4OATA 4JCOA 2BJHA 3T1OA 3K1AB 3THRA 4MKGA 4R8SA 4AY5A 2CCKA 5ICFA 2HNAA 2PQ0A 3DMTC 1PT6A 2E7ZA 3TRKA 4RQTA 2XE4A 3C1TA 5JTTA 2P6PA 2I62A 3DEYX 1WUTA 1N0HA 1VSUA 2FSHA 2PUHA 1WLSA 2WHPB 2E4AA 3Q7RA 1L8LA 1T4CB 1X9HA 4TTAA 3JQAB 4UZFA 2VAVA 2JC3A 4O4HA 3I2FA 4FOOA 1LFDB 4Y0AA 4IIJA 4B3CA 1YQUA 3WMEA 2P4HX 1DHTA 3I8OA 5JMOA 4ZA2A 1M66A 3HH8A 4DMLA 1OWOA 1OYVA 2A9RA 4ASUA 4EFLA 3B1WA 5M34A 3GBVA 4EI7A 3BDVA 3UQZA 4TKZA 2FSIA 3M6AA 1POXA 5LFAA 4NNPA 3WOHA 4WZBB 3K9CA 2V6IA 3HP7A 4RV5A 5TQJA 2WVGA 2JGMA 1DKNA 4RKQA 4FB4A 2GZHA 1QK3A 2E18A 3KXDA 5E6RB 4DQDA 5HKBA 2IYVA 1NR7A 4ZI5A 1NP7A 3L0BA 4WJLA 3OA0A 3QG5A 4CMAA 3AQIA 3PJEA 1JIKA 3QFFA 4M1EA 1KNQA 1SQSA 2YFHA 3OQJA 5G1OA 4KOEC 4D3YA 1NAIA 2D4HA 2HLHA 1G4AE 4FYMA 2XA2A 1H22A 4EELA 1RRPA 1GL9B 3SYKA 2FETA 2X9NA 4WTOA 4X92A 3TZQA 3CVWA 3FWNA 2ACEA 1K8YB 1LLUA 2RH4A 4RA6A 3DTTA 2B83A 1USKA 4LV6A 3N5KA 3WB9A 2ZWAA 1QAMA 4AF7A 2PGXA 4YK7A 3R8XA 3ZWNA 5I9IA 1QQTA 5ICEA 2CYBA 3DUWA 1JNYA 1Q2UA 1HQCA 4CF4A 1L7NA 3AM3A 1NQWA 4Z2YA 4O25A 5AK5A 2B21A 3KQWA 4YRMA 1G3UA 1NV9A 4CT5A 4PC7A 1RWVA 1KZYC 4PSVA 4TKMA 2A0FA 4R2JA 3R41A 3V1KA 2HRQA 3N86A 3P4UA 2O7SA 3AFOA 4G0ZA 1SXQA 4AY6A 3H9CA 1QIDA 2UXDB 1LDBA 1NHGA 4NQZA 4WLUA 4YECA 1RM3A 4FNAA 3QI2A 2C61A 2N9UA 4XOUA 3GRZA 2VWQA 3UK2A 4PNEA 4M0CA 3B89A 1GNPA 4XB2A 4B8WA 1QPGA 1I01A 2COKA 2R1ZA 1DHRA 1NJFA 1TIKA 2GK4A 3GMSA 3JTEA 3KKKA 4HVAA 3ZUPA 3I4FA 4JVSB 1C29B 4CMCA 1E96A 3TIFA 3UGKA 1JH8A 2ISQA 1QVAA 1GWNA 4YFYA 1XCOA 3ER8A 2B4AA 2ZVQX 4JUBA 1VCNA 2RGDA 1GCAA 3DFFA 3SF8A 4DQXA 4E31A 4CI0B 4NFHA 5I48A 4RH3A 3ZCPA 2HBYA 3OD1A 4JK3A 3TZKA 4M88A 2XCOA 3ZXXA 1XAIA 2ERCA 4ERNA 3NBMA 3EEIA 4D3DA 1RMYA 4LA4A 5AM0A 2DPHA 2ZG6A 1UXJA 2DG2A 2VKTA 5CNIA 1PJBA 4NBTA 5B36A 1AQNA 3QUAA 4N7BA 3EDRA 3G2OA 1U2DA 1VYHA 1HE3A 3IBFA 2VSFA 2AFVA 3EGDB 5IXSA 3WLRA 2Q6OA 1M7GA 1CEXA 3ZCVA 3N2KB 2YWFA 4HNAA 5K4HA 2ZT6A 1UH5A 3M7IA 4WL0A 2G9ZA 3HJGA 1OUMA 5DHAA 5TNXA 1Q1GA 3PNKA 4ZEVA 3FWPA 2LD4A 1WNTA 2Z0MA 1XMVA 2MTBA 4M0UA 3PR1A 3V1MA 3IULA 2CDNA 3B9BA 3NYWA 4B5KA 4C04A 5F98A 4UCXA 1JAIA 1TE2A 3HO6A 1VXRA 1D8AA 1KHTA 2AI3A 2C4VA 3L7IA 2I67A 4NBKA 2Z2ZA 5FH9A 1MW8X 2HD4A 3RQIA 4UD2A 2BH9A 2GETA 4PC2A 2JLBA 2HNKA 3OPXA 1RCUA 1ML4A 2V9ZA 3Q7IA 16PKA 1NVDA 5CPBA 5JS7A 4XR4A 3Q12A 1ONSA 2TS1A 4L4YA 1Q17A 5BQOA 1QO7A 5CXXA 3DLTA 2OB2A 3GLFB 1Z16A 1BD3A 2BTQA 2HA4A 4DCMA 3D6HA 2QUIA 4NENB 2WR8A 4F1WA 2WFAA 1JMYA 2IV7A 1JL3A 1AKMA 1J22A 2CHUA 3NH6A 3LU1A 2X15A 2GCNA 2ZJ8A 4MRSA 2E4UA 4NZ9A 3H5LA 4XGKA 5BN4B 2GXAA 2DLDA 1OXUA 1ZJJA 1OHHA 4QNRA 1GKIA 3O9MA 3HL0A 2GAAA 1ID1A 1Q22A 2CFTA 1MA0A 8ADHA 1S4QA 4IM7A 1EVYA 4EMSA 3NWEA 3DTVA 1C3LA 1BCSB 1TVMA 2I3GA 1K4KA 3JQBC 1PJ3A 1XZPA 4UUNA 4X6LA 3TMYA 3FOWA 3BS4A 3L6EA 3S5UA 1P1RA 1HZZA 1U3DA 2A88A 3IBYA 3NC1C 1SBQA 4FCCA 1QMGA 1U81A 5JDIA 2R6DA 2PUFA 5T6MA 2WJ6A 5IEJA 2GLUA 4MCJA 1JU4A 2D4AA 2HA0A 4FZJA 4Q1EA 3D8UA 4OM8A 1U0GA 3BD7A 4M99A 4MA0A 4HB0A 5IT9A 1WVGA 1BCRA 1BVRA 1DG3A 4MQEB 5J63A 4OEHA 3JALB 3FHCB 1NRXA 2F90A 3V8NA 1JSRA 5GVRA 3VSEA 3G6WA 2DBZA 1XFDA 1E1RA 2G9NA 4IVRA 4ZYWA 4KMRA 2VXOA 5G0WA 3ZGZA 1IHDA 2Z2JA 2LCIA 2CXHA 1WDTA 3ED1A 3PQ8A 4E12A 3GLIE 4K6KA 2C9CA 4LMPA 3LK6A 1DOHA 2HLDD 1W1IA 3GRUA 1E6UA 4KSYA 5J5VA 2NPOA 3BXHA 4DLZA 4HKTA 2MYTA 3TZLA 1U28C 2RHDA 3GWZA 3IQGX 3IXMA 1U04A 3O31A 3O2NA 1Q3TA 1YUMA 4FUTA 4NH4A 2FZ4A 3FNHA 4J0IA 4ZQIA 5CFQA 2DTXA 3DKRA 2FN7A 4MZDA 5IBQA 2OECA 1KVTA 3V2UA 1SAYA 1QUEA 1EJ6A 1W88B 4BNJA 4PIPA 1N2SA 4ER6A 3SLGA 4F60A 1KK1A 4II2A 5GGXA 1IJBA 2BZSA 3P9IA 3TIVA 4OFWA 3GU3A 4IUBS 2BCEA 3IUEA 1CY8A 3ZIUA 1RKBA 4DWWA 2XPCA 4AS3A 1A97A 2XD9A 4HLQB 4E3WA 5AVUA 4IF4A 1BXRA 1CY4A 2BUCA 1X0VA 1IQ0A 2VJMA 3GEHA 3OOSA 5BMVA 1SIUA 3E15A 4X93A 3QVUA 2ID9A 1EG7A 1BMTA 3O1JC 4MRVA 2EL9A 2DZDA 2XQVA 2ZIEA 3BN3A 3JD0A 3H2GA 5FUBA 3FRIA 5IBCA 2Q9CA 2D62A 4O2AB 1K68A 3E1SA 1WPXA 2XIQA 4I81A 2GNOA 4UM5A 2I8LA 3T5CA 2C78A 4LSZA 1QH8B 1K5GA 2X3FA 4CKWB 4RA6B 1KEEA 4MYTA 4INAA 5EWMB 4BDSA 2ZUSA 4P81A 3E84A 4CV0A 2ZJ3A 1R9GA 3AVTA 3O1LA 5DCWA 3VKFA 3IDOA 4LDNA 4OYHA 3PX2A 4YP9A 4KXXA 2KBFA 1S9HA 1FVFA 2I3ZA 3Q5GA 2WUDA 2CD9A 3VNVA 4CNQA 4DL9A 3ZZMA 2ZQ5A 5JRJA 2G80A 3VMFA 1GUDA 2IXGA 3IOEA 4X94A 3IMGA 3LCRA 1J25A 3NT5A 5C8YB 2ZBEA 3GFRA 2PS9A 4L3WA 1RNLA 5IXYA 4OA5A 1QZTA 3K92A 1TJPB 1IPEA 2VJLA 1W34A 4EP1A 2X9QA 4DMFA 1HDEA 4ZVQA 2B9EA 2C2HA 3GPIA 4UAVA 5FTJA 2VR1A 1YK1A 2Y9MB 3M5CA 4PYRA 1FMJA 1OOEA 4JLNA 1CZKA 1PZGA 3P0FA 4TM8A 1OT5A 3UMBA 5M5BA 2WJAA 3CEMA 4G5QA 5MGNA 5FYQA 1IHYA 1K2VN 3FUVA 2OFXA 2ZKIA 1NBWB 5KYGA 1QDUA 4A36A 3E9NA 2P68A 3A3PA 3RFXA 2FG7C 2ECOA 3KR0A 1EGHA 4CKBB 3RWBA 1GDTA 4JOSA 2C96A 4F5ZA 3WLNA 2DQKA 2GLTA 5COBA 4DB4A 4NK5A 4B35A 2XADA 3PGXA 4HRXA 4WFKA 5IDQA 5CR9A 4GXRA 4IUDS 5EGSA 4JEIA 3ZV3A 2FSVA 4KODA 1NFQA 2H5EA 1TTTA 2XRMA 3FDZB 5KI6A 1O6BA 1VE9A 1EXVA 3PLAE 4OQFA 4K8OA 3TF5A 1EHYA 1DJQA 3TD9A 4LGMA 2EJUA 4GI5A 1G6KA 1T2NA 3GK3A 3T7IA 4GOMD 3OF5A 3ESQA 4CV3A 2X40A 1UJ6A 1EBBA 3INRA 3PI6A 1P9NA 4QBGB 1L1EA 5K6AC 1GTG1 2DLNA 2WJHA 3AM4A 2GHIA 3MIZA 1T5SA 3DWEX 3SPXA 4A8JC 4XM1A 5BMOA 4IDOA 2ZRCA 4XEHA 2FFJA 4N5IX 4B75A 2E5FA 4Q0MA 1O9GA 3TE6A 3B53X 4A0HA 5JBNA 3IHLA 1KSGA 3T12A 3IV6A 2QS9A 1YFKA 2A0KA 3N8KA 4RNDB 1N6OA 4PQRA 1EXNA 2PH7A 3BMQB 3S7TA 4FD2A 3K2IA 3TD6A 1YOVA 2XTJA 2CZQA 5BURA 2CWWA 5B1HA 3QTBA 4IXWA 3VX3A 3LCMA 1A4IA 3IAS6 1JDUA 2YV4A 1EWYA 3F4BA 1OZFA 3VDNB 4RK4A 3KNZA 4KE6A 5I7UA 1N75A 5J47A 4W5TA 3PFBA 5K8VA 3PLNA 4W6ZA 2UYCA 1JAZA 1QNLA 1VPWA 3I42A 1C1XB 2NACA 4R3WA 4IILA 5J1SB 3FYUA 4IDDA 4RXTA 4X24A 1G8PA 3KKLA 1OLXB 4EA8A 3KO8A 3D3WB 4D26A 1YCFA 3K9QO 3OZBA 3QX7A 3SE7A 2QJWA 4E03A 3GP5A 2AC7A 1UFOA 1EWTA 1P5FA 2WHPA 4BS9A 4BB0A 3R5KA 1U94A 2GN6A 4S24A 3VPCA 2B1GA 3G5AA 5E7QA 2FF7A 2H52A 1KVRA 4EUSA 3I37X 1OAAA 5GJVC 5BWOA 1QHGA 3KPYA 4ZGBA 3F78A 1GEEA 3IOYA 1ZK3A 4FNGA 1SCQA 2Y92A 3CVXA 4YAGA 1JHYA 4BQSA 3HVRA 2XYRA 2ZBPA 1YF3A 2FU5C 2CBGA 4NBUA 5EJ8A 2GPBA 3MLEA 3GPDG 1UDXA 3OLQA 3AL0C 3UB2A 2VNJA 3KT0A 4IYJA 3HJHA 3AONB 4YIHA 5KNDH 3C8UA 4DMRA 2XGSA 4JFAA 5LCXA 2AXPA 3D0QA 1FTYA 4O4JA 3WG9A 4U2CA 2YHUA 5IT0A 1EGVB 3DJYA 1J24A 1JR2A 1X1QA 3QKUA 1UBKS 5PNTA 2YHSA 3RIHA 3GVHA 4PY2A 2RKBA 3CLHA 3MRSA 4Q4AA 2DFLA 4QDUA 1BCRB 1G291 1PL8A 1GYQA 1QLHA 3MUNA 4IOKA 4MQEA 5CJPA 3UOGA 1G4UR 3ZWXA 4ZOQI 1JAHA 3QY9A 5IKPA 2JH3A 3CUEF 4JLUA 2Q9AA 4LBZA 2AKAB 2ZIZA 1XZ8A 3QH4A 1YGYA 3V7FA 2F64A 1BHJA 2EJTA 2FW6A 2DWPA 2PKWA 1RI1A 2XOEA 2YFYA 4KPUB 2D5IA 4B7XA 3THWB 2ZJYA 5E38A 3M70A 2DOKA 2HK7A 4JC8A 3C3WA 4CMIA 4DPMA 1M2WA 1NSTA 3R0ZA 3UT0A 3C74A 1HZZC 4NULA 1C7EA 4JLAA 4MLPA 2FN4A 1YC5A 3AEQA 3VH1A 3R2JA 5IWAB 1XZFA 4QQKA 2ERXA 2RGAA 1P29A 1JI0A 3HB4X 4BEBA 1M6HA 2VCYA 1SZJG 4WY8A 1YVUA 3JASA 5DTIA 1ISSA 1ABBA 1JXAA 2VL7A 2AH5A 2ENUA 3AETB 3E8XA 4AZ3B 4HD8A 5CG2A 4W1RA 2O1SA 4QXOA 1KY5A 1MLDA 4QE3A 5TQ2B 3PQFA 5K20A 4GP7A 3O4IA 3PGKA 3OZTA 2YXDA 3ZLTA 1NP3A 2JVIA 1EX6A 4BJ1A 5KPJA 5FLXA 1J06A 2G1AA 4NE9A 1E77A 4G81A 3WDSA 4NBVA 4F06A 2O8DB 5IAKA 4Z9AA 2IEZA 5FNVF 1SFRA 2H1IA 3GG9A 5I7EA 1J9GA 1N36B 2BDTA 5JPIA 2EZ9A 2B1QA 1OX5A 3VO1A 2WI8A 1B8UA 1KPHA 2GZAA 4GL4A 4ILKA 2H57A 3OBIA 3N8DA 4GQAA 1Z35A 4YDSA 4YAKA 5BR1A 4F3YA 3UW1A 5MGBA 3K9BA 3L0CA 3SLRA 3R7NA 3MJSA 1YQTA 3B3GA 4F6LA 2ABWA 3B36A 5F5LA 1ZI8A 4MW7A 3VBCA 3DUFA 4ITRC 4DNPA 1E6MA 5J9FA 1NJ2A 4E4TA 2JKZA 4D0GA 2O2IA 4EG1A 1XTRA 3GJ4A 2R2GA 4JXKA 4OQPA 1PT7A 1XQVA 5CYFA 2F3TA 2H92A 1JJVA 5IWCA 5KWIA 1RYZA 3JALA 2XODA 3PQ6A 4WBSA 1I3MA 2ZKLA 4G9BA 1E0JA 1DADA 1UDRA 1W85A 2NM0A 3BAFA 3L8HA 3NKVA 2B4YA 1T9HA 2PL5A 4O4IB 2C4KA 3L8YA 4TTSA 5EXDA 4FCVA 4JT2A 4TPKA 5KQLA 4M1WA 1PZXA 1V6SA 3I1YA 5CB0A 1P7YA 2F1RA 2B98A 1FS5A 1GTL1 5JWHA 3GLGA 2HT1A 1E1RD 1K08A 1XF1A 4Q18A 4CLDA 1Q15A 3HM9A 4WQMA 1VRWA 1JHDA 1KMIY 2P9TA 4UM8B 3JARA 3PKZA 5AJUA 3MXTA 4B6SA 5JXHA 2WJVA 3CBQA 3QUQA 1Z8DA 4HFJA 3P9ZA 4JBYA 2FV8A 1CU1A 4C0WA 3Q6IA 3W3ZB 4FQ8A 4C6SA 4KBGA 4I8IA 4RFSA 4XTRA 3PTLA 2ZROA 2GCPA 4F8JA 3VKGA 4MKFA 5GINE 1AKQA 4QRIA 4LEIA 1FNSA 4Y9TA 1DOAA 2J6CA 4Q9JA 3WA7A 4HEQA 1QAOA 2WEKA 3KR9A 3ZIAA 2SNIE 1P1CA 2QZSA 4QTZA 3SE0A 1SKYE 3TX6A 4W5JA 4N5MA 2XWJI 2HADA 5DMHA 3YASA 2O2SA 1ZLYA 4X3OA 1CVIA 3TL2A 3JYQA 1N2HA 2P9QA 3HADA 5CLIA 5KQGA 1I7DA 4IG4A 5TVKA 4OB6A 2QJTA 5F2NA 4PBSA 4L51A 5CRIA 1RBYA 4N1AA 1PS0A 4F9EA 2AC4A 4RHFA 2GZRA 3AVXA 3RAGA 2BWJA 2HCRA 4QOIA 1OW3B 3I04A 3OLYA 5ALPA 4N47A 5HSGA 1OU0A 4GVXA 1TQ6A 2Q6VA 3DEJA 2YWEA 1EFUA 1VC2A 1GG5A 4OK5A 3ZHQA 4PNPA 1US8A 3A27A 5LIRA 3WTBA 3UM9A 1UPXA 4KIFA 3IEXA 2X86A 3W7VA 4I55B 1J97A 2QZPA 4IPTA 4BLVA 4BO1A 3O7MA 1JFSA 1E9AA 1ZJYA 5EZYB 5AHOA 4KRYA 4XARA 3W2FA 1WE2A 3P26A 2QV0A 3EBPA 5BUSA 3WNCA 5JASA 1QIEA 3Q85A 2IZZA 4QBFA 1Z7YA 4PRYA 3H2YA 2A78A 3DOHA 4I08A 2QD1A 2OVBA 1JPVA 1XWWA 1MNQA 1L6IA 1RAEA 2KMLA 2OEPA 2FUKA 2PDAA 2XQFA 3PL5A 4GKVA 1WETA 2NP7A 4B6OA 2CXNA 1MEJA 1T10A 3EIWA 4EEKA 2PBLA 3LQYA 4TTPA 1ZOSA 4UBMA 1XALA 3ZU4A 2QN9A 3NS7A 3VR1A 2CDBA 1IY9A 2C3UA 4IH1A 5KTYA 3L7DA 3WDLA 5KWVA 4CIXA 2G5GX 1DTEA 2XVMA 5EP1A 5A4IS 2ODWA 1ZOIA 2OCDA 4KQIA 3CVOA 3ES9A 2ZULA 3VAZA 3T3OA 5G2OA 4G2TA 5F9MA 5AFSA 4AJOA 1JHUA 1KJQA 4Z1MA 3BWDD 4GX1A 4JJ8A 1KEZA 4LZZA 3BREA 3I6BA 3DE4X 3A06A 3MQ4A 3NBZC 2OGTA 3JYPA 4KB5A 3FVQA 3K9FC 2O0JA 3MCAA 4EGSA 5FFMA 3ELDA 5CA0B 1U1CA 4JVNA 3AVQA 1ZWLA 1XXLA 2X0RA 1TM2A 3H5IA 1MJFA 2AUTA 4WVLA 1CZOA 3KQVA 5CAEB 1U7DA 4AURA 2YJ5A 1PVOA 3RSFA 2J3LA 3DWFA 1UF9A 2GKOA 3FGZA 3OT4A 3EWSA 4FLFA 2RHGB 4D8YA 3LLUA 4EG8A 4PANA 1D7OA 1GT91 1G2PA 1XTVA 1PRYA 1W9MA 3SJBA 2JGRA 4G26A 1KF0A 1QIKA 2QX6A 3BE8A 3GNQA 2EFGA 3VNSA 4BU1A 3BJRA 3ZV6A 1CR0A 4HFMA 4IOLA 3X2EA 2XMSA 2R60A 1NF9A 3A4NA 1IJKA 4BNDB 1QV6A 4RD6A 2QSJA 3WB2A 1SIWA 5FOWA 5DWDA 5CB4F 1UINA 1Z25A 1LK7A 3IVAA 3CR8A 3EHDA 4FR0A 2BF7A 3ZK8A 3QYAA 5TIIA 2VAMA 2POQX 2Q1SA 5IS2A 4UUPA 4C21A 2BKEA 3IQIX 4OJQA 2ZIVB 1IYZA 3BKXA 1F2UA 3Q11A 3ICOA 4J0GA 3BWEA 5ILQA 3KQSA 3ZX4A 1CY0A 4DG8A 3AETA 2PZJA 3NEPX 5JDIC 2ZTVA 4WUTA 3ZCTA 3RRZA 7MHTA 5B4UA 4BQOA 5F51A 4XWOA 3BRCA 2CD7A 2EBWA 4Z5XA 3BCUA 3QHAA 1K98A 4FSHA 4ZJUA 1E1KA 5DJ5A 4ZANA 3RHFA 2CHGA 3O84A 3R7WB 3UWDA 2R8PA 2QD3A 2XBLA 4D6YA 2H7YA 2HNBA 2CZGA 2Z3ZA 2CVZA 1T9GS 4MI1A 4NDNE 1PQWA 3FMFA 3DMNA 2HSDA 5K0LA 3LHSA 5I7HA 1EE1A 2VF7A 1ML3A 2JK1A 1XNRB 1WXQA 3L9XA 1ZVQA 1G4HA 4N18A 3TW6A 1ZH8A 3KJFA 3N2EA 4UEQA 5BWCA 4G1EB 1HSOA 2ZPUA 5HF5A 3V8PA 4ZYTA 1APBA 1JQ5A 1U0TA 4GOLD 1LJ8A 4JS0A 1CUVA 2EYUA 2PBFA 3IPLA 2COUA 4EA6A 4YJFB 1DINA 1GKLA 3KXIA 3OURA 4U7TB 3I5MA 5KOIA 1U2TA 5FPQA 1KKUA 1ZN7A 3ZOZA 1PGNA 1E59A 1C8LA 1V8PA 1W44A 1Y5RA 2OSBA 4JGGA 5LA6F 2PUDA 4UATA 1NU6A 1OWNA 1EHIA 4NU0A 1JYFA 1CFZA 1XYVA 4JI7B 1WTAA 4GGPA 4MA5A 4CHTA 4E14A 1GTZA 3I9V6 1XA0A 1E6WA 2DLCX 4FZVA 4P32A 2OCPA 1LPBB 1II9A 2HPVA 2PG3A 4CN8A 3FJOA 3DVQX 1JDSA 3MAAC 2C5HA 4C7XA 4EGFA 2GN4A 2HMYB 3OKFA 1YTLA 1Z4NA 3CUWA 4ZYUA 3OIWA 721PA 3NBKA 2HT6A 1NGSA 2VUUA 1GITA 1MPXA 2X5KO 1DIRA 4HNRA 1J07A 3FCOA 3VYTB 4US2R 5HYVA 3EIXA 4ENQA 1QH9A 4FFVA 5ITZA 3RAJA 1MZVA 3TDKA 4AVYA 3U16A 1DKUA 4LJAA 3ROQA 3WFZA 2PRYA 9ABPA 1X1EA 3S68A 3EF3A 4O2BB 4YO7A 3KHUA 4FWIB 2MSNA 3F2VA 3R76A 1S01A 1VOTA 3H0CA 1K5HA 3WRYA 1CVLA 5BRNA 2KLBA 3WJAA 3LA6A 1DUVG 4UE6A 2PT9A 4HWRA 2GZDA 3BAZA 4NNOA 1QP7A 1EK6A 2ZRIA 2FRVA 3NYRA 4HQ0A 1W36B 4EVIA 1FW8A 3B6EA 5IKEA 3DB1A 4NZZA 1VJ1A 1MFZA 2H4XA 3IUYA 3M3DA 3QBDA 4DE5A 2R6R1 3BE6A 2QR3A 1KR2A 2HM7A 4PCLA 2OBYA 3HO1A 1LF5A 2HSGA 2PFGA 4KN8A 2XMGA 4AT1A 3PUKA 3R6WA 2ACVA 2O3JA 2GZ1A 4GLJA 3AERA 4UU7A 5KSZA 3CLRD 3JQQA 5ENZA 1AF7A 1M0TA 3RADC 1SG6A 1CUUA 3PUYA 1QTNA 4E33A 3ZXUB 4P2GA 1R6VA 4IGIA 1S2GA 4KFTA 5CEJA 1DTWA 3LQKA 1U3VA 3HXMA 2HLPA 2B94A 1PF7E 1D0VA 2WABA 4EJ6A 2PPVA 1K88A 1XTPA 4OCZA 4R83A 1Y3AA 4L5JA 4YJDA 1KH2A 1T4MA 1UJ2A 3H5AA 5K3CA 1ZIPA 1BIFA 1PT9A 5EZSA 2XY4A 5A4JA 3K9HA 1NMSA 3KB6A 4LF5B 4PPYA 4NVRA 1H6CA 2P9ZA 1NULA 1B26A 4IJQA 1KAEA 4ZI7F 1FEZA 5DNEA 1BO6A 1BE8A 4WN3A 4HZIA 3SOZA 1GXSB 4UPEA 3HB1A 2IWRA 3WNZA 2K7FA 4Y1RA 5HZGA 3JASB 4MRPA 4M9RA 3RC3A 4F4DA 4BVJA 3DXFA 1P4JA 4WY5A 5AVJA 1IOWA 3AEZA 2OORA 1SBIA 4KFRA 3RC9A 1BMFA 3T6KA 5LL6P 4ND8A 1RHMA 2PANA 4U7WA 5HCNA 1CUFA 3OQIA 4FHFA 3GRVA 2VP3A 3ESAA 2F1IA 2VHZA 3KJIA 4K3UA 2E9SA 3UAYA 1ZH2A 4YLGA 4ZRNA 3K09C 3L4BA 3OX1A 1NVMB 2JHFA 5CGZA 3WBBA 3PHLA 4HVCA 1IM2A 5HRAA 4B43A 4EL0A 1ODCA 5U4QA 3LXUX 1G5TA 3L82B 3NANA 4GF5A 4OQYA 2VHUA 4UJ3A 2Y67A 4I5IA 4R2MA 1OJ7A 3K5HA 3I52A 4JLWA 1U6JA 2RAPA 2WKWA 3ZVKA 2DFNA 4GBGA 4Y2HA 3ZQUA 2NUAB 5ARBA 221PA 3CA8A 2HU2A 1EM8A 3L1UA 1SZCA 5AMXA 3E27A 1Q1ZA 3DMPA 5A3VA 1V7PC 2HO4A 4QUAA 4UU8A 3U1BA 1U0SY 2IIBA 4NATA 3OLCX 3UXHA 3HVHA 5KIAA 4LDPA 2DPXA 1UKYA 2JCSA 1GPUA 2V6BA 5KC8A 4UCQA 2LKCA 4JJZA 4C76A 2DQSA 3I28A 1CZNA 1GR1A 3BL8A 1A4RA 1SVOA 3GLGB 3U44A 3ZWDA 3BD9A 2GEVA 1NM5C 3WKBA 4JB3A 1PTJA 5U1PA 5JJKA 4FYYA 4L6AA 1KYVA 2JEZA 3HCPA 5H81A 1RXEA 1KY3A 2WDZA 4W8HA 5EKSA 1PYGA 2PWZA 2IV2X 3NHJA 1KDOA 1JHPA 4IMRA 3IMCA 1ADBA 4M1SA 1JHXA 1X1SA 5CFPA 2Q1UA 1JQ3A 3MWJA 3IVXA 4I6GA 4B4KA 2IRWA 4RFSB 2UYYA 1LU9A 1E3WB 3ECSA 3LFUA 5DULA 4M9ZA 5HCUA 2QMQA 1GUZA 1L5GB 3IE1A 2Q8PA 3EG9B 1EJ0A 1XP8A 2P4SA 1TMYA 4XDHA 3NHRA 4CM4B 1EFKA 4I3GA 1XCPA 4WOBA 3I76A 1VLLA 4EW2A 3LC7O 3GZNA 3PC8A 3IS3A 3BSWA 2C92A 3IMKA 4OGWA 2CXTA 4K9OA 4CL2A 1DBPA 3BGVA 3CN9A 4GOXA 2R4QA 4KWIA 1G8JA 5E3HA 5JSQA 3EMVA 2Q45A 4NHEA 1TGVA 2JIOA 3K0BA 2EDCA 2O07A 5LKAA 1NN5A 1OWLA 2C9ZA 1HXHA 1COWD 5JYEA 8GPBA 3NHZA 1NUPA 1HDRA 2B3TA 4GBJA 1ZIDA 2Z08A 2I1QA 3CIOA 1H1LA 5CA1A 2P2YA 4WE3A 4WZBA 5AUOB 5HUHA 5D1NA 4E5PA 5IASA 2YTZA 1LRKA 5FFFA 1RJDA 6LDHA 1ZOOA 3BJZA 1CUAA 2QY6A 3OOYA 1M5RA 4EKYA 3M6WA 2RCNA 1JB9A 3KBBA 4GMGA 2VHYA 4QUDA 4IIJF 2R6ZA 4CVNA 2REQB 3AOGA 3IP1A 3V6MA 4CLOB 1AMUA 4MB0A 5F9FA 2QAGA 1SC6A 2EW1A 4KBYA 5IARA 7AT1A 3KQLA 5BSGA 2QIOA 4MS3B 1QHEA 4L2IA 2ZZKA 3V7UA 3WWOA 4CKZA 3U9LA 1DNPA 2C29D 2FNAA 3AUAA 3OTHA 2GOYA 1RM4A 3OWHA 3IFSA 2RGEA 3OIGA 4BFSA 1TL7C 4M8LA 2G1KA 4QWMA 5ALLA 5FUWA 1RLJA 1L3BA 3LQRA 2O8EB 3IH5A 8AT1A 4JP2A 5KYVA 1RWWA 5E3IA 4R3UC 2C8JA 1JKJB 1SXJA 1UL1X 2OV1A 3WQQA 3QU2A 2JCBA 1CIVA 2O2YA 5EWLB 1BC5A 4TLLB 2A9VA 2AOUB 3FVVA 1DI0A 3OLVA 2B92A 2O1EA 3KAJA 1U3FA 4RFVA 5DRYA 1XEAA 5K0BA 1ZHOA 2H1RA 5SZHB 3FF1A 4QYXA 2QTRA 5COQA 1NBOA 3ND6A 2FE1A 1ND5A 1MJGA 3OZAA 4MQ6A 1IUPA 4NZOA 4Z8XA 3CW8X 4ENUA 4X7BA 1E0AA 2FOLA 4KQ6A 2WICA 2R8OA 4U5QA 4F12A 1DXYA 1JJIA 1R0LA 2HQ1A 5E1DA 4PFQA 4B7ZA 1COWA 3HYLA 4NENA 4QLBA 2BFEB 1O6ZA 2OCXA 1E3DA 1EKXA 1FXWA 4P5EA 5DNVA 4HB4A 2QORA 3K6SB 4BY9E 3KUDA 2AQHA 3O91A 2F3PA 2PJZA 2PL3A 1RIFA 2WA1A 4HX2A 4R6XA 3S3TA 3W5AA 2FRDC 3SICE 4IGKA 2AS0A 2PY6A 2YJ6A 4DB2A 4MQLA 2I22A 4HRYA 1ISIA 3UFBA 2EKDA 1DSSG 1R1DA 2CLLB 1KP3A 4NICA 4CEJB 1MXHA 2P6MA 4OXYA 3BZWA 1GL7A 3VBEA 1R8JA 3EZ9A 4URZR 4ALJA 5A04A 1U9JA 4BOYA 3CIFA 3DOIA 3ULKA 1WXHA 2YV3A 5CPFA 1VPLA 2P41A 2J9RA 2G72A 3S2SA 1GU1A 2ZRJA 2ET6A 1P80A 2WWIA 3ONWA 2WWTA 3O75A 4LZPA 3FYTA 1XGKA 3JSXA 1XXHB 4N65A 4L78A 5L9AA 3QXSA 1CC1S 2AZDA 4IZ6A 2QUHA 5JNSA 3I62A 1G60A 1MUUA 3DNPA 2BEWA 3JAKA 3IP7A 3N59A 4RSHA 4RTNA 2ZANA 2HRBA 4E3ZA 3W04A 3RC8A 1Z2OX 1M34E 1ILWA 2C4NA 4L8FA 4P5PA 4HNUA 2C84A 1B8NA 1K6EA 1Z82A 4AYWA 5JROA 1H5UA 1WMSA 4JEMA 2AMJA 1T29A 3BQNB 4Q3KA 2OQIA 2OENG 2LP4Y 2QYSA 3AVOA 3QXGA 4RJIA 1N3BA 1B74A 3G8BA 3DBVO 2GCOA 3GIWA 5LLSA 1E60A 1W4LA 2BFBB 2J0VA 3KYDB 3QVTA 4ZK2A 3A1NA 1UPTA 3L4BC 5E8JA 4LF4B 2OGZA 5JSHA 4P3PA 5KNBH 2PWBA 2X4LA 3HO8A 5I9LA 4ZKDA 5JNLA 1RE0A 4Z0HO 4ZU6X 1DCMA 1N5JA 2CUKA 3QLUA 1XG5A 4WGGA 1XL1A 2ZTHA 5AIAA 4DN6A 3UOWA 4U3JB 5C1DA 2NO0A 1XAJA 3EF0A 5B3LA 2OHGA 1FFAA 3MCWA 1C4WA 2VNKA 1Q0PA 2GFQA 4LC0A 1YQQA 4Q19A 5ICMA 5IN5A 2G25A 2N47A 4DLSA 5CDSA 3DQQA 3WGMA 1H05A 1Z4OA 2J3IA 2WWFA 3PJRA 1EFHA 3CNHA 2SKCA 1EVJA 1UKVY 4MGHA 3I9V1 1VKNA 3HP4A 2PSHA 3CPEA 3K9GA 2C4UA 2C7GA 3O73A 1EFVB 2J3EA 3NOVA 4ZO8A 5F77A 1KQNA 3VR0A 4ZCPA 2I4MA 6CHYA 1KRXA 3DHVA 4A82A 2XGOA 4A0GA 5C5DA 1KMCA 3TM5A 2G07A 2Y0DA 4NYMR 3WYFA 3PCRB 2QPOA 2I7VA 3D5TA 4G0NA 2JLZA 1L5LA 3K15A 5F3RA 3JZMA 4BLPA 1CD5A 5ITSA 1DMRA 2GBLA 2CLEB 3EGDA 3NHKA 3VO2A 1ZLXA 3ORRA 4FC6A 4KK4A 2WKQA 1PK7A 3TGLA 3QEKA 1IDN1 1DJMA 2QYHA 1Y7TA 4RY0A 4H17A 2NSHA 4ACAA 3QOFA 3MT7A 3A4IA 4X1KA 1P1KA 1ZM7A 1OU4A 3LCUA 3H1AA 1XLUA 4I46A 4YJGA 4KU4A 2O52A 3KPVA 4LHXA 4JR0A 1N5KA 2PBRA 4JEHA 4X1OA 2PO7A 5TS2A 4C08A 2J7PD 2XQJA 3EA5A 2FCAA 4GYWA 4IQ0A 4IXDA 2YNMD 5EXXA 3CZ9A 3C5VA 1R0CA 3B2NA 2JBHA 2C2MA 5B4TA 4GUAA 4MZXA 2Q07A 4HPJB 1UT5A 4MVCA 3W0LB 2O7NA 3AHEA 3GD7A 5J43A 1U8AA 5CD9A 1FFEA 1WCXA 3KQOA 5K3AA 4E2WA 2RHMA 1RPNA 3EXIA 4HLCA 4Y1GA 1Q7GA 4AYXA 8LDHA 3DFZA 4PS0A 3VR2A 5JSZA 2W6JA 2H1WA 1HQDA 4GSYA 4HF7A 1CRZA 4P54A 3VPXA 1C7IA 2HCTA 3PR2B 2X0IA 3I72A 4G5GA 3SFZA 1VA4A 1X1CA 3HJBA 3CLUC 3I2HA 4NAUA 4WK6A 3ZVRA 3S81A 3DF7A 3COPA 2YVLA 4GW3A 3ZJVA 3VZBA 4O0MA 4YRLA 1K5DA 3S1LA 2CMGA 2AL7A 3ZK9A 4N7JA 4A6DA 1Z2AA 4ARZB 3REGA 3PEWA 4NCJA 1XMQB 3DTVB 3R7AA 3EBOA 2I6UA 3KSDO 1K27A 1ZJ4A 2W48A 4JJAA 1CJKC 3X0DA 1R0BA 4G5FA 2F43A 3PNQA 3E7FA 3R5SA 5D51S 3T7TA 3PQ4A 5JSZB 3DVSX 3CKLA 121PA 4RK6A 1KYZA 3IJEB 3K0KA 4OBXA 5C1BA 3IALA 2YC4C 1Q7EA 1SXGA 1DS6A 2V5VA 3TW8B 2UXBB 3KOOA 3BMQA 2ZRFA 1N1DA 4N9QA 1IVNA 5CX1A 2GRUA 1H9BA 3HPQA 5JS2A 4D4KA 5MN6A 4LBYA 1P4RA 3UXYA 3UKJA 1TJYA 2AOXA 3JATA 3UY4A 1I51A 4TX1A 2AOUA 3WDKA 5D8DA 2XNHA 4AECA 4B71A 5LDDC 2QRMA 3WGKA 1V5IA 2RGYA 1OR8A 2NSYA 2YY5A 3EZ6A 4XYGA 2H1VA 3L18A 4LX0A 2JJMA 3EX7C 2B61A 1WMBA 1OXBB 2VNHA 1SHJA 4JJIA 2DY1A 4H4CA 4H6PA 2G3YA 2H4JA 4O29A 4Y2QA 3GGCA 3VAAA 1TK2A 1Q7CA 2ANBA 4RHTA 2NZUG 5HKKA 2P90A 3NRBA 4BFLA 3W05A 3ZVLA 5CITA 1TU3A 1IXZA 2FLVA 3Q7PA 4MB2A 4OH1A 5EFZA 6ADHA 2DKNA 1X7YA 3EZFA 2QLNA 3TZHA 5KDOA 3PEYA 3NEYA 4CF6A 4X3PA 1ZI9A 2XEDA 3QWHA 4OUDB 4LRQA 1W8IA 1N2OA 4ZEMA 4RTOA 3ABZA 3S44A 1P3JA 2OCYC 4RY2A 2ODQA 4DLVA 4OAPA 4JELA 1A7KA 1SIBE 4NABA 4JH0A 4D3FA 7YASA 1GV1A 1BJRE 5DCYA 4CT4B 2UVPB 1NFRA 2W90A 1MABB 1R66A 3CVJA 1KO8A 4DR6B 3BCRA 2BPOA 4ID3A 4FU0A 2QX9A 2XZPA 4NOLA 4C0SA 1JLHA 4DQ0A 1FFWA 2GJSA 2W4QA 5EJFA 4F21A 5JHGB 1XK6A 3EUAA 2CLDX 3M49A 4DDKA 621PA 5IABA 1IU9A 1WOYA 3DKKA 3CXRA 4II3A 1A1VA 1IWPB 1Z26A 4IMIB 1T35A 1VLQA 3WB1A 1AS0A 1QBKC 3BK2A 3P94A 4Z7JA 2IXAA 4X60A 1GA4A 3DD1A 3U62A 1LGYA 2IEBA 1VZ2A 1SA0A 4EGAA 4H7IA 1T8WA 2H16A 4DF3A 5A3RA 3DV0A 4J0JA 1C2TA 5IZ4A 2H8KA 1KEEB 2C07A 2PUGA 1NPDA 1YOVB 2G04A 2WAAA 1XXHA 4IWYA 4G86A 4E15A 4XM2A 1UFRA 2B78A 4KR0A 1QP0A 2GD0A 3AOEC 3E7PA 3GLKA 4KLNA 1H6DA 1NW4A 2QI9F 3ZGNA 1M75A 3Q4GA 4UEJA 4J6FA 4WCFA 3BTVA 2WUGA 2ID8A 3AUTA 1TQDA 3DONA 2FMTA 2QTFA 1U8YA 3R75A 4EUEA 4Z9XA 5AW3A 1W46A 2VSOA 4MK4A 4YASA 2OGWA 3LSYA 4HAYA 4YJ3F 1QDEA 3G13A 5ITVA 4QEKA 1L8XA 2J6IA 5TQ2A 2E1RA 4O4IF 2ZBDA 1UXHA 3DKPA 3EJ6A 1YHYA 4O33A 4OP1A 1Y0BA 1ZK1A 2Q1YA 2X0KA 1R3UA 5AM3A 2TMKA 2YYAA 1NLMA