4X8HA

Crystal structure of e. coli adenylate kinase p177a mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 73
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8hA00
4IW3B 4DLSA 1K6MA 1IXZA 4ZCLA 1CJUC 4PQRA 3UANA 4K46A 2XNDD 1Q1BA 3GJ3A 4OQXA 3SC3A 5C46F 3CRRA 2ZRBA 1COWD 2ZJ8A 4CVNA 4LI0A 1W48A 2GXAA 1D2MA 2QAGB 3TE6A 5K8LA 4OK6A 5DI9A 2GF9A 1OH6A 1FNNA 4PAOA 3CM0A 4P33A 1R5NA 2RB4A 3CB4A 3EZ6A 4HAUA 3VR2A 1E96A 1U0JA 5A0FA 4FD2A 3ONWA 4LYFA 3QPVA 4M1WA 2J0QA 3IILA 4JVLA 4LOAA 2O8BB 2ZS8A 1UBFA 1VPLA 4Q48A 2ONJA 4TYQA 1O3YA 3W6PA 4GPTA 5EXSA 1Q12A 2CDNA 3RRZA 2IWRA 1E1RD 2WWYA 2J5XA 1BYIA 1RRGA 4AYWA 2RCNA 3IEUA 3SFVA 3D8BA 1F2TB 1VIYA 5GVRA 2YOGA 4V0OA 2ZIAA 5CDFE 1KI8A 1UAAA 1RVDA 1Q1ZA 1P6XA 2GF0A 1TNDA 5CK5A 4P32A 3R7WB 3LFUA 5SZIA 4GBMA 4UXJA 2PH1A 2ZI5A 2Z4RA 2CE2X 2VSXA 3IIMA 3GLIB 2IT1A 3RDPA 1S1MA 2ODNA 4Q9IA 2DWPA 5LB4A 5KNDA 4X8OA 1E79A 4JZKA 5DYGA 1S9DA 4FMDF 1ZIPA 3F8TA 4B3BA 2R6AA 2QBYA 3WMEA 2GHIA 4AURA 4G1UC 1WRBA 2RGNA 2BKEA 1W49A 3PR1A 3Q7QA 2DB3A 3AGPA 3PFIA 5C2JB 2B7CA 2C96A 5JJIA 1Z0JA 4J0QA 3QBVA 1NVVQ 2BJVA 3PEVA 3VU9B 4OK3A 1KO7A 4P4SB 2BMFA 3QKUA 3LXXA 4ZI3A 5TVKA 1ESMA 5DHFA 3WBJA 1U94A 4DCSA 3VNVA 1XXHA 1JBKA 1ZUNB 1NLFA 2OFXA 2WVJA 3FMFA 3T1OA 1PUIA 3GCGA 3ZD6A 3K0FA 2QG6A 1Q0UA 5AWFC 3WP0A 5GVSA 1NIJA 1NP6A 1ZINA 4DRZA 3TSZA 4Q9JA 1GAJA 2QSZA 5KSZA 1PUJA 5G53C 4PR0A 1GOTA 4DUGA 4DKXA 1G16A 2N1BA 4C7OB 4ON9A 3GJ8A 3MMPA 2QRZA 1U8YA 4FW9A 1FQJA 4Q4HA 3LBIA 1E0SA 2ODBA 1E98A 4LGMA 3RC8A 1P7CA 4LCBA 3QPUA 2EFCB 3F3YA 4MKGA 2BM1A 4L4UA 5FL7D 2N42A 5JZVA 5CJ2A 3ICEA 1TTTA 1W36B 1Z6YA 2IS2A 1IY1A 4LYJA 2QPTA 3FVQA 4EPVA 3TW4A 3BB1A 4FN5A 1W4AA 3QKSB 5DN6D 1UADA 2AWOA 2NTYC 4DDVA 1RRFA 2ZI3A 3BFVA 1EFHA 2R6FA 2DCUA 1CJMA 3SJZA 1JECA 2GAOA 3U6KA 4EDHA 1DE0A 4MDFA 1VCOA 2PX3A 3UWKA 4B73A 4RFSA 1WXQA 1J7KA 3FWYA 3SBDA 2OCYC 4Q21A 2B92A 2JJ1D 1W2HA 2XJ4A 1Y63A 4D0NA 2IYQA 1JR3E 3LBHA 1Q44A 2IXFA 1IXRC 2FGJA 2CJWA 4TMWA 2J9RA 2LWIA 4B3FX 1SZPA 1Z63A 3TSWA 1HTWA 1N5IA 2QAJA 2O8CA 3I4LA 4V02A 4D0LB 4IDQA 3IPXA 2ZR0A 3L0IB 3WNCA 4DSOA 2EW1A 2GESA 2VF8A 1CS4C 3NTUA 1T3SA 1YVDA 4CYMA 1G5PA 3AH8A 4FIDA 4HUTA 2PZFA 2J7PA 2P65A 4W7SA 3A36A 3IBGA 2HJVA 4TTQA 3RRNA 2BC9A 4OHWA 1JXMA 2X19A 2QGZA 3CX8A 1FW6A 1N25A 4ACAA 3AVPA 3OHMA 1IN6A 2DFLA 3FMOB 4JS0A 2XTZA 4P4TA 5DYIA 5EUMA 4PQFA 3UG7A 3ZVRA 1XCMA 4Z1MA 1G7CA 1ZU5A 2WJIA 2P5SA 5H70A 4DZZA 2NO0A 1SQ5A 2YC4C 4MRSA 4WXRA 1IHUA 4CT5A 4HZIA 4M1TA 1FX0A 2V1XA 3JVUA 4PC3A 3RANA 2BJWA 4LBYA 3IBYA 4HB2A 1TEXA 5HE9A 4U00A 2KJQA 4CEHA 2C9CA 1Q20A 2BWJA 2NO9A 1DAMA 3I5YA 4JIMA 4DLWA 3RWMB 2NIPA 2VA8A 3QKRB 2ZUCA 2Z43A 1G3IA 4QHSA 1QHHB 3WYAA 3WYFA 2WJJA 3BD9A 2ZTSA 2RAPA 3CF0A 2QUZA 1FPMA 4Y0AA 4OI1A 421PA 1IOZA 4HB3A 5HCNA 1GWNA 4BFYA 4R9UC 1ZBDA 4DLUA 1CR1A 1YZTA 2PLFA 1VDZA 1AM4D 1R0ZA 3AVXA 5FBVB 4B48A 1XD2B 3QXJA 3ZVNA 2R65A 4KLNA 5E7IA 1IN5A 4JL5A 3C5CA 3FHTA 3BERA 1IN7A 2ODWA 4ILEA 2UVQA 3MJRA 3U3RA 3BGWA 4IDHA 5J4YA 4ZKEA 2XZPA 4Q7KA 4Q02A 4X8HA 4B71A 3HYRA 3H84A 4M53A 4CRWB 2ZEJA 1PVOA 5CK4A 4YXWD 2FOLA 3E2IA 1ZUIA 2RGEA 4OKSA 4DXAA 1D2NA 1CRQA 1U99A 3L82B 2QL6A 1W36C 2W6JD 5JWOA 1MRNA 3I72A 3MRSA 2D3WA 5AJWA 5FOTA 4DIEA 4FINA 2AKAB 3ZZTA 4YMSA 2GCNA 4PZLA 2ZRNA 2VP2A 4BLOA 3VKWA 1DG3A 4IVQA 4ARZA 1S96A 5F3WB 2FNAA 1F60A 3B78A 5K8IA 4TL6A 6Q21A 1E9DA 3QQ5A 4KFTA 1HH4A 1QDEA 1NBMD 4MGYR 1UPTA 1S2MA 3D31A 2BDTA 3BRWD 2PZEA 1NVVR 1XTSA 3FFAA 2Q3MA 3KJHA 4B44A 2HLDD 2OCAA 3TJZA 5KSYA 1E69A 3NBXX 1US8A 2WWFA 1PV4A 4KBFA 2O8FB 2JIZD 1AQUA 1IONA 2WWWA 4XD7D 4JJKA 1XMVA 4HB4A 3Q85A 5ELXA 2BCJQ 3OEED 4BZQA 1YU9A 3DO6A 2WMOB 1D5CA 4HAWA 3CIOA 4Q9KA 2QM8A 2H5EA 3BJIC 4UNPA 1M6NA 1VYTA 4W5HA 1L8QA 2OSBA 4CEIB 2GJ9A 4NKRA 4WZAE 4UKDA 2IUUA 4LJ7A 1XZPA 3BXZA 4JVSB 4Q9LA 4MQBA 3RS5A 2F1IA 1E9EA 2W2VA 3NEJA 4C0AC 2FN4A 3R7WA 1W5SA 3ZIAD 3KB1A 2PL3A 1U9IC 1YZKA 3CH5A 1KAGA 2X1VA 2OILA 1E2EA 1R2QA 2IUTA 3R20A 3ZGXA 1AN0A 5JBQA 1E32A 2GJ8A 1WF3A 1KGDA 3QOFA 4PAQA 4F93B 4B6EA 2NO6A 4AK9A 1L4UA 1QHHA 1E2LA 1UKEA 1CR2A 5J4HA 3U7FB 1KK2A 1KK3A 3HR7A 5JS8A 1OH7A 3CWQA 4ZIRB 4WOPA 4DVGA 5KPJA 4M9XA 4YDHB 2OE2A 2R9VA 2RGDA 4LBZA 2RH5A 4MRPA 3W8RA 5K8UA 4GNKA 1NMYA 1ZCAA 5M04A 2HF8A 1NBME 4ESHA 1I2DA 3OF5A 4EPWA 2ZJ2A 2EWWA 5IF9A 4NCIA 3ASYA 1JXOA 5BQ5A 4M1YA 1OW3B 1R5BA 4Z51A 4TT3D 1R8SA 1E3MA 1CR0A 4TMXA 5K8TA 1KI7A 1N5JA 3MJHA 4KO8A 4LJ8A 1R0YA 3R9XA 3LWNA 3PEYA 4A0FA 4XWOA 4K81B 5CIQA 1E2QA 2Q6TA 3AQ4A 4CW7A 4HDCA 4OQNA 1ZU4A 3ZIAA 1QVAA 4A92A 5TB5A 5JSZB 2E1RA 3B7GA 4E5UA 4LRWA 3W5IA 1S0UA 2PEYA 4BFZA 1E4YA 1C9KA 4Z8XA 2XB4A 2WHXA 1FL9A 3N2IA 4MKIA 1TUEA 4G5QA 4BFUA 1OHHD 2O8EA 1R8QA 2I1VB 4MKHA 4MKFA 1CXZA 5IDVA 1MH1A 2Z83A 3L8ZA 1R4AA 4TQ9A 1BYUA 4UXHA 4A8JC 1N5KA 4ZKDA 3PJRA 2EFEB 2ZSAA 1HEIA 3A4NA 4ARZB 1MT0A 2PX0A 3GJ5A 5JCPA 1IAQA 3T12A 1OIXA 4F4IA 2QSYA 3AUYA 5J4LA 1SVIA 3EWAA 1GP2A 2CCGA 4JKIA 1HQYE 2HXSA 3VFDA 1XPUA 1Z2CA 5FI0B 4CZ2A 1NN0A 4B3CA 4D4KA 4JLJA 1FP6A 4IEEA 1VECA 2YV5A 4W9MC 1VCMA 3SU8A 5A4JA 3M0EA 1Z08A 1RFLA 4DUGD 4QM7A 4TMZA 1W0JD 3AKYA 3RVBA 3U7HB 4NCHA 3PQCA 3W6OA 1OLOA 3V4RA 1KSFX 4LY6A 4TWZA 3I8XA 4TYWA 1MO3A 3FFBA 2UKDA 3GD7A 2ANCA 3ZS9A 5JRZA 5EP3A 1ZNXA 1NG1A 2EYUA 4QJ3A 4XSHA 4IXMA 4GP7A 3TVTA 1IY0A 1QHIA 1UBCA 2WV9A 5FPYA 5HR5A 1J99A 1AS0A 1Q57A 1SGWA 3KKNA 4JSTA 4Q4AA 2DWQA 5FH9A 3VR3A 2VRWA 3DZ8A 3TNFA 4DDWA 4QM6A 5FR1A 1HE8B 3HYTA 2ZRCA 4A4DA 1KMHB 1X8KA 1NNEA 3AVWA 3O8RA 1G4AE 2ZS9A 1JPJA 2H7VA 2HDNB 4HZUA 5KHOC 1OHHA 1HYQA 2BCGY 3KZ1E 4XIGS 3SNHA 4QL3A 3LLUA 3RABA 1XCPA 2GA8A 3T5DA 4M2LA 2JA1A 1CU1A 2VSFA 3A8TA 1FQKA 3AKDA 4FI3C 1XXHE 1G4UR 1XXHB 1RIFA 2OT3B 1UF9A 1E9RA 1M7HA 1XU4A 1Z06A 3EAQA 4TSFD 3D6TB 3U5ZB 2PJRA 3A1TA 1AGPA 1GRRA 3NEYA 1RW4A 4PX9A 1KI3A 5EJEA 2VHJA 2D7CA 5FOUA 2GXSA 3MWLA 2OFOA 4EQ6B 2BBWA 2F7SA 2JLRA 2JAQA 3B85A 3PUZA 4Q01A 1NY6A 3MD0A 2ZR7A 3EASA 3NVAA 2H8KA 1MABA 2FWRA 3W3ZB 5FFMA 2J7KA 3WBKA 2W2XA 1ONBA 2YVUA 1U9IA 1Z0FA 1HT1E 1QVRA 1ZNYA 2FFHA 3KQLA 2UZIR 4KVGA 4PC2A 4A82A 2IYLD 4LK2A 4YC7A 4MGIR 1NRJB 3CX7A 5CM8B 1OJLA 3VTKA 3U7GA 3TSOA 1SXJA 2FJUA 1J8MF 4YDSA 5D3MB 1XEXA 2QPOA 3TLXA 4ZDIA 4XWKA 4C2TA 1ZJ6A 2VP4A 4DJTA 3FHCB 5CDFA 2MSCB 4M1KA 4NBSA 3Q5DA 4GSYA 2OLKA 3ZZ0A 1OPXA 2QTVB 2NZJA 1N5LA 2DHRA 3H2YA 4LV5B 3DVLA 2E9SA 2RGAA 3TBKA 1AJEA 2WJVA 4Q00A 1S9HA 3ND8A 5KSPA 4Q7MB 3FE2A 5FPSA 1M8PA 3EZ2A 4AKIA 1EFTA 3NDBB 2DWOA 5B57C 2H1LA 4MITA 4XJXA 2VBCA 1G3QA 4KFRA 4CEHB 4O25A 3KXIA 3OEHD 4S2EA 1XEFA 2CK3A 3RS7A 1F6BA 4RD2A 2AKYA 5D3MA 3EPLA 3ZLJA 2GZAA 3V4FA 1GILA 2Z6VA 2ZRGA 1R7RA 1F2UA 4OQMA 1OXXK 5JLJA 4C7OA 1P2TA 2NMVA 1IQPA 5F9FA 3GFTA 2QP9X 3JZAA 4HLUC 1KIMA 5HZHA 3TW8B 2ZQ5A 2A5GA 5BXQC 2FFBA 2G0TA 3OIYA 4HUQB 1Z3IX 2FF7A 2J41A 4GOJA 1XD2A 2WMNB 3BH6A 4B76A 4RCZA 1G64A 5IT5A 4JBWA 4MYCA 1M74A 4US2R 3ZVMA 1G8HA 1VHTA 3PXGA 4LHZA 1COWA 2PCJA 2CHQA 1W0KD 3LQRA 4GMDA 1KZGB 5JEEA 1KMQA 2GJAA 2GXQA 1KO8A 4FCTA 2JLVA 4NYJR 3THOA 2OV2A 3SHFA 2B21A 5TARA 4JYBA 2W2TA 2IYUA 2QMHA 3NHBA 4KFSA 4NH0A 3LNCA 5TMPA 4NZYA 1DO0A 2CLDX 3NBFA 2YNMA 4JLNA 2A5DA 1TEVA 3WMGA 4A15A 4M0LA 1OFTA 4MGZR 2ZI7A 3TAHA 2SHKA 3KUCA 2ZSFA 4TZ0A 3OIVA 3LDAA 1JEEA 1AK2A 4HDQB 2GVZC 2XB2A 2D7DA 2O8CB 1M2OB 2VO1A 2K5UA 3RNLA 5BN3A 1VMAA 3CZPA 5JJLA 3GLHA 4MUBA 1SXJE 3OE7A 3EZFA 5IRCD 4RZ2A 4V0NA 2IYRA 1JJVA 3IHLA 1AKYA 4PHHA 3REFA 2AX4A 3QBTA 4WZBE 1UBEA 2I4IA 1LVGA 5A5GA 1NVUQ 2RMKA 3K0AB 5FUWA 4EJSC 1RRCA 2IL1A 1TPZA 2HT6A 5J40A 3U4QB 3PUYA 3B9QA 2YWFA 5AJYA 2VP5A 3EC2A 3WNBA 4RKFA 3B6EA 4RD0A 5FOSA 2PT7A 1YZNA 1ZMXA 2CL6X 4C0BA 1KJZA 4D0GA 1IJEA 2YKGA 2NPIA 4KJZA 4TYYA 1RKBA 4C4PA 2XXAA 2VF7A 1E0JA 3LV8A 1A5TA 1HE1C 2AFHE 1LF5A 2BVNA 4QHTA 2JLUA 1G3RA 1SHZA 1SVOA 4QBGB 4TMKA 4DT1B 2VHCA 2DBYA 2IS4A 3AF2A 1ZC3A 4Q19A 2QU8A 4NE2A 3MFYA 4UNSA 2Q9CA 2Z4SA 2MMCA 1E9BA 4PQYA 5E4FA 3AVUA 1PLKA 2QGNA 4QG7A 1MO6A 4G3XA 3S1AA 1W7AA 3EA5A 1QHNA 3E70C 3K53A 1TAGA 1ZUHA 4RSGA 1JAHA 4PHTA 3TQFA 2J87A 5FTJA 1NN5A 2ZS7A 2H18A 3K0CC 621PA 2OFWA 4RD6A 4JKYA 4BLTA 3U2QA 1F2TA 4KYIB 4Q1FA 1JPNA 1GNQA 1HA3A 4LJ4A 4R2HA 3K9NA 1E2HA 2HYIC 4EPYA 3M6AA 1AZSC 2J45A 3LRPA 3O8CA 3H4MA 1G19A 2PMDA 3I32A 3X1WA 2WICA 4HLCA 2IYVA 3BBPA 3J81k 2BMJA 4A0RA 5DNYB 4D4JA 4ASUD 5B30A 2AR7A 2DFTA 2KBFA 2MSEB 4B2PA 5L3QB 3P20A 2ZJBA 4LJYA 3K0EA 1W4RA 2OG2A 1DADA 3R8FA 2G1JA 3GLIA 2GTPA 4DSUA 1NI3A 2TMKA 1C4OA 1T6NA 2R6GA 2NOAA 1TUIA 2OAP1 2WOJA 4C0HA 4Q4AB 1E0KA 1V5WA 5EP4A 5LD2B 4FWIB 1NSTA 2RGXA 4LJAA 1P2VA 1RYHA 5FBQB 5FTLA 3LQQA 4D26A 1EX6A 1G41A 1OB5A 3MUFA 4PSAA 5EZ6B 2RKOA 2QE7A 1S4QA 1XEWX 4XD7A 3W9YA 4PPGA 2REXB 1OFIA 5AUNB 5F98A 5CITA 1UEJA 2OXCA 3DMDA 4LZZA 4DEYA 3IPYA 3KDSE 1SVKA 1YQTA 4E22A 4Y0VA 4NU0A 3RS4A 4K8OA 1ZNZA 4LV6A 3K9GA 2GETA 4MUAA 3I61A 4LC1A 4OL0A 4ZO4A 1ZM4A 4Q4LA 4PSKA 3W8NA 4NMMA 2WKQA 3THXB 5HCIA 3REGA 4A8JB 2RGNC 1MABB 4DDUA 2OUKA 2ZYUX 1G8GA 4P0TA 3U3JA 4MA4A 3NBZC 2AHOA 1KSHA 3THXA 4C9BA 3HU3A 4F38A 2NGRA 5C18A 1S1CA 4ASUA 4URYR 3UXMA 5EZ5A 2H17A 4DBLC 1E4VA 4ZV4A 3K0FB 3SFZA 4CEIA 4MRRA 4BZPA 3AGQA 4BPBA 4RD4A 3WMFA 1G1MA 3GLIE 1T9HA 1MO4A 3L8YA 3LAWA 2BOVA 5DLQC 4LHVA 2O8BA 4PSVA 4ZI2A 5GJBA 4QNRA 4H9GA 1U90A 2C99A 3EWSA 2GEVA 1AQYA 2EFDB 1KSJA 2ZJYA 4LHXA 1XB2A 3CPJB 3FOZA 2X2FA 2BIFA 3TK1A 2IYWA 5CLQA 3K70D 4MYHA 2AXNA 3AF1A 4Q7JB 2CBZA 4TYPA 2B8WA 5FBLB 2G1KA 3BWDD 1VYVA 3V00A 2WAXA 1FZQA 1P5ZB 4N3NA 4KI0A 1OF1A 1ZD9A 4KU4A 1E0AA 5J4VA 3TH5A 4OQLA 4IFBA 4PTLA 3GLFE 2VHTA 5DH9A 3SOPA 4GFDA 5KTYA 1BOFA 2ORWA 3OAAA 3CX6A 3K70C 2P6UA 3NDPA 2CLSA 3QSYA 3ADKA 4FMDB 4BWYA 1P75A 3UPUA 3IEVA 5HKKA 2KE5A 1LY1A 4B74A 4C30A 1KI2A 4RD1A 2BKUA 4CIDA 1N2CE 1PLLA 5LDDC 1E9SA 4L15A 5FTNA 1R0WA 1WQ1R 3VX4A 4D80A 2ZJAA 4Q4HB 1RC8A 3EXAA 2MSDB 2JJ2D 1OB2A 4B43A 2IWHA 3BFKA 2QAGA 5EXTA 4LJ5A 3VX3A 3P32A 1KJWA 3QF4A 1KDRA 4IEIA 2ZXUA 1H8EA 3ICQB 4IOKA 3AVOA 3GLGA 1EXMA 4PO8A 2VP0A 2ZVQX 1WDTA 2JDID 3GJ0A 4HDOB 3WYGA 1KI6A 1HT2E 4R71A 2ZYWX 2IEZA 3UATA 2EWVA 3O8BA 1YZLA 2D4HA 2ZPTX 1DTSA 4TYNA 1FTSA 4I99A 121PA 1SKQA 3N70A 2G77B 2YYZA 3HWSA 3OIUA 4OJKA 2FZ4A 3B1VA 1F3OA 4P3YA 1IN8A 3B1ZA 5JI2E 3KUDA 2D62A 2ZSEA 4BLQA 2A7QA 5SZJA 1W46A 2F9LA 1E9CA 2C2HA 2OBNA 2FG5A 2GRJA 3RWOA 3G5UA 3RLFA 4CT4B 1XZQA 1L4YA 2F1HA 3NH6A 1LTQA 2FPKA 3LLMA 2A3RA 3BH7A 3QNUA 4MGKR 4BZXA 1FMJA 5KNCA 3K0AA 1W4CA 2QBYB 3AM1A 1FMLA 4JLOA 2OZEA 4BUJA 2OCPA 1G8FA 1P9WA 4BE7B 3LVQE 3KQUA 1Z2AA 1IN4A 5FI1B 2DY1A 3LXRA 2P0EA 3Q7PA 3GQBA 1LNZA 4L16A 2IEYA 4OI2A 5BYKA 2D2EA 1LV7A 3K0SA 2REBA 3DL0A 3KXKA 4M4SA 5KUTA 1X3SA 3M1IA 4MH0R 3ZD7A 4Q03A 2QN6A 2V4ZA 2QE7D 3ECCA 5GJVC 2VQSA 3P26A 2J0VA 5H68A 5IK2D 1YE8A 2ZAOA 1KAOA 1E9AA 4KSCA 4M8NE 3TIFA 4JVNA 3CH4B 4B47A 2WPDA 3A1WA 3BC1A 4I81A 2P6NA 1SVMA 1VG9B 2O0JA 2IUSA 3UK6A 2LCFA 1F5NA 4DLTA 1HURA 3I1FA 3NC1C 2ZU0C 1N6RA 4KHZA 2CCJA 2V7QA 2BBTA 3B1XA 2C8VA 2BEJA 2OBLA 4TQAA 1LS6A 2Q21A 4QNMA 2FSIA 4QKQA 2XZLA 1KOFA 1ZM9A 1TQDA 2G88A 4RFVA 3DHWC 1B0UA 1DS6A 2UZ3A 2V1UA 3PIRA 3U3OA 1N0WA 2W0SA 1S3SA 4G0NA 4NYIR 4XH9B 2A5JA 2X8AA 4YMUA 4RZ3A 4B33A 2WBLC 3SDZA 3SN6A 5EXXA 721PA 4UQOA 3KTAA 3G0HA 4DT1A 2GILA 4OI4A 5C1BA 2NO7A 3CRW1 1BMFA 2QT0A 1GTVA 2GBLA 3GFOA 1NIPA 4TL8A 1G3UA 4BFXA 5GADl 1CIPA 4AY2A 4CEJA 3LX5A 2NZ8A 3ADDA 1P72A 2IYXA 1DAEA 4IHQA 1X1SA 4PO9A 1E79D 4PFSA 1YRBA 4BLSA 4M9ZA 3THWB 3AB3A 3C15C 3KXLA 2F3TA 4YMWA 4GOKA 3LH5A 3KQNA 4C0QC 4QC2A 1JALA 5JRJA 3NH9A 3UKDA 1M34E 3PVSA 4O2RA 4O2LA 4BFSA 1OYWA 4V0KA 2QTHA 1KK1A 3AV0B 2W0MA 4URUR 1ESNA 4W5WA 2HT1A 4URXR 3MWYW 1ZYUA 1ZM7A 2HXYA 1OXTA 1JJ7A 2GXUA 2ZI6A 1E2PA 2GCPA 3IGFA 2WKPA 1KO5A 1EFCA 4ZCIA 1W0KA 2ERYA 1T8TA 2F55A 1UKZA 2J59A 4UNNA 3VR1A 2XTMA 3B82A 5E3HA 3T61A 1G5RA 4D4LA 5L3QA 2CNWD 4YONB 1JNYA 3U6BA 4PZZA 3ADBA 1Z28A 4NCKA 1S3GA 2ZU6A 4G01B 1OH5A 2Q3HA 1P60A 4KV9A 1XRJA 3CR8A 4HAVA 3FYHA 3A1VA 3IDQA 4LUCA 1YR6A 2CXXA 3FMPB 4U02A 1WBDA 4NCNA 1NJFA 1DO2A 3PEWA 3NBYC 2X2EA 3A1UA 4TQUS 1G5TA 3RAPR 5HPYB 4B75A 2BMEA 3T1VA 3UMRA 3CW2A 3RS2A 3HU2A 2FZLA 4TT3A 3R8CA 4DIDA 1NLYA 1V43A 3X1YA 2FA9A 1UJ2A 1Z8FA 1DVRA 1P62B 2OEPA 3WXMA 2JATA 4TMVA 2YWHA 4GZLA 5AJXA 4B34A 1YZGA 4JBYA 1EX7A 4FXPA 4BFVA 2J46A 3B1YA 4GL2A 4AKHA 4DCNA 4TLEA 1FNMA 1NKSA 3CO5A 3FDIA 1E2KA 3DMNA 3CRVA 3KB2A 4B32A 5L8VA 3WY9A 1G7RA 5FPKA 3PUWA 4XTCS 1TU4A 1D9ZA 5B58C 1RYFA 1KDOA 2RGBA 3VHLB 2GCOA 3B60A 1G3MA 2XNDA 5FBWB 3SQWA 2VPPA 4PHFA 1ZP6A 3QXHA 3TAUA 3BK7A 4JYCA 3AVVA 1WMSA 3IIKA 1KY2A 1XDBA 1CLUA 1KI9A 1XJQA 2ZR9A 4F91B 4YXWA 2QM7A 4KBGA 2GDJA 1N6LA 1LFDB 3QVUA 4JL8A 4OJQA 3FKQA 3AP2A 3AVQA 4KYUA 5CJPA 3F0TA 4UNRA 1IM2A 4RKEA 3GLGE 2XEXA 2IBMA 4HSEA 4JJZA 1DAKA 3ZS8A 3NXSA 5KNBA 4AWXA 3GLFB 2VHUA 2A78A 2ZRLA 2YJTD 4QBIA 5TXGA 1GRQA 1VTKA 1NN3A 2AD5A 2BBOA 3N2EA 2FU5C 1Z47A 4Q5IA 5EP2A 4RY2A 3CKLA 5DHAA 3KKPA 1LW7A 3K1JA 1II8A 5JWHA 3SJCA 1XMSA 1D6JA 1ETUA 1GL6A 4M9QA 2JLXA 4QOSA 3P4XA 4NYMR 2GJKA 4IDNA 3T1TA 3GFPA 1DPFA 4N0EA 2ZI4A 1P61B 2JLQA 2B7BA 3VR6A 2AFIE 2AK2A 2KWIA 2WSSD 4EFNA 4I1SA 5KDDA 2KB0A 3IO5A 4GRAA 2PEZA 1GFIA 1Q21A 2ZJZA 5E7MA 4DCUA 5G3ZA 1G21E 5CB6A 1ZC4A 3Q3JB 1QG2A 3K09C 2XAUA 4JLAA 1VG8A 1W1WA 4DCVA 4LHWA 1N6PA 1I2MA 4OBEA 5C4MA 4JMPA 4KVAA 1A1VA 5DE3A 4C0SA 4LYAA 1Z07A 1YR8A 2ATXA 5KSOA 3TUZC 1QF9A 4L9WA 1KDPA 2QMEA 3CPEA 2V55B 3MSXA 4KLZA 4EIWA 5F9HA 1N6OA 3TR0A 1SULA 4C3ZA 1I4LD 4B35A 3RS3A 5JSZA 3OFNA 3LVRE 4YQFA 1T3HA 1T91A 5HKKD 3R9WA 4LBWA 3SR0A 4URWR 1WBBA 1RJ9B 1X86B 4DB2A 1W2GA 1GKUB 3U61B 1KNQA 4HI0E 1AA9A 3CBQA 4LPSA 4FWTA 1DOAA 1R5OA 2R2AA 3I8SA 2R6CA 3NWJA 3SE0A 5JHHB 4AI6A 1Z6XA 2IF2A 1X1RA 2PCLA 5KU1A 2WSSA 3FKSD 1MR3F 2D74A 3X1ZA 4E03A 1ZCBA 2BEKA 4AYXA 1LS1A 3RYTC 2PMKA 2ASEA 4EQ6A 2YC2C 4HB0A 1SHKA 1AKEA 4E09A 1Q3HA 4H1UA 3T1QA 1Z6AA 2O52A 3Q9LA 4B2IA 2IA5A 2CVFA 2YHSA 3QPWA 2Q9BA 4LWZA 4RCYA 1XJ0A 1XTRA 1OT3A 4Z54A 1W4BA 3NC0C 1H8HD 1U0HC 2C95A 2O0HA 5FPHA 4AKGA 2O5VA 1D8TA 2OLJA 2A9KA 3D3QA 3C8UA 3KKQA 5L3RA 2B6HA 1U8AA 4NDZA 3WHKA 2W6IA 1E1QA 4N0DA 1U8ZA 4PXAA 3W6NA 2XZOA 2QENA 1OFUX 4BEJA 2IYTA 1GKYA 1SKYB 1YZQA 4QJ4A 4M1SA 4QGAA 5JWRA 1GITA 1DAIA 4GZMA 3FPAA 4F4CA 2VSOA 1U81A 3CRQA 2R44A 4KODA 3SBEA 4JL6A 1FOEB 1OIVA 4JSYA 3DKPA 1KZ7B 1AGRA 1ZM3A 2CE7A 2V6JA 4HATA 1Z5ZA 1W0JA 3SJBA 1ANKA 2JIZA 2ZRIA 3UMSA 3FB4A 4MDEA 1VG0B 1EK0A 1Z0IA 3O8DA 1T5LA 1XBTA 3QXCA 3KJIA 1Q1QA 5LBIA 3EA0A 1WP9A 2ORIA 2C78A 3CLVA 1H8HA 1L2TA 1XJCA 1II9A 1HV8A 5JJKA 2RHMA 2A2ZA 2YOFA 3OAAD 2VP6A 3MGCA 3W34A 5GJCA 1T3LA 1QHGA 3H1TA 5LD2C 1E2IA 1EFUA 3QJYA 3K8YA 5H1YA 3JZMA 3VHXA 4JLDA 5J5CA 1JR6A 2GK6A 2WKRA 2E87A 2JCSA 2ZRPA 2V8OA 3B1WA 1VHLA 4B2LA 2IYZA 4WBSA 1G7TA 4RD3A 2L0XA 2VL7A 2W00A 1JI0A 2ZSDA 4OK5A 4YLGA 1I4TD 1G291 4Q18A 1UDXA 1CJVC 3DM5A 3Q8XB 1RJ9A 1G7SA 1YR9A 2W6ID 4GT1A 2WIAA 2FPMA 3IO3A 2WTUA 3U4QA 3AP1A 3CUEF 4H1VA 2FV8A 3AKEA 1KDTA 3QVVA 4FCWA 1G6HA 1E94E 3BOSA 3WNDA 4AG6A 4Q1CA 2VTKA 1J90A 1BIFA 2Q0HA 4HYYA 1RPZA 2A5FA 2BMDA 4L8GA 4UJ5A 1P9RA 4CF7A 2D06A 2BM0A 2JJ2A 5C4GB 1QZXA 5FTMA 1UBGA 2ZREA 4DDTA 2ZROA 4BASA 1NKTA 2RHDA 1SXJB 2GEDA 3SYKA 2ODEA 2IX3A 1XD8A 2EFHB 3K9LA 2ZRAA 1H8ED 2YZ2A 4HLDA 2OBMA 2R6DA 5AJZA 5EE1A 4XVRA 4B3DA 5KO2A 3FTQA 3T06B 4AKEA 2HF9A 5EUQB 2Q3FA 4L5BA 4U5XA 1P2SA 821PA 2HYDA 3DM9B 4IKEA 5JMTA 3I5XA 1XEWY 1DAGA 1TQ4A 2QEQA 1TF2A 2EQBA 1Z83A 3L0OA 1A2KC 2DFKB 4LHYA 2WOOA 2GWHA 4PO1A 1W44A 1P4SA 1S8FA 3CZQA 4Q1DA 1A2BA 5AK0A 3SQXA 3B5JA 3GLHE 4NTZA 3KJEA 2ZANA 4RJLA 4II7A 2FSHA 2FH5B 1PJRA 4NYJQ 2I3BA 3QY0A 1MO5A 4LYHA 1T0JB 1ZM2A 4FMCF 4Q1EA 2O8DA 1EFRA 2Z5FA 1Q3TA 2Q9AA 1KO4A 4XSGA 5AUOB 2JEOA 3QKSA 4BFTA 5CM9C 1TF5A 3GEHA 1KKMA 4ACBA 2X77A 3X1DA 4X8LA 1PLJA 5GJWC 2ZE8A 4MRVA 5FOXA 1HY3A 4TTPA 1DAFA 2XJ9A 4D25A 3L2OB 2JLWA 4U7DA 2XSZD 2XGJA 1NF3A 5J4KA 1NY5A 1DBSA 3AEZA 3BB3A 3X1XA 5KPDA 3UG6A 4MRNA 1G18A 5CLLA 3RRYA 2IXGA 1VKJA 4JLBA 4TTRA 4RZXA 2WSMA 4BFWA 3TR5A 4C0LA 1XF9A 4PHGA 1JR3D 3O47A 2XITA 3N5CA 2DPXA 5BW8A 1OXUA 1TX4B 3PUVA 1ODFA 3QEJA 3EIQA 5CYPA 3SI7A 2HJGA 2ORVA 1A82A 4QBHA 2J0UB 1Z6TA 1J2JA 3GLHB 4LSGA 5JI3E 1ZD1A 3B2EA 4JLMA 2CMKA 3IHWA 3TRFA 3VNUA 4WW0A 1JQJC 1Y3AA 2AXPA 3CNOA 3GMTA 5AJVB 1AS2A 1KJYA 5H8WA 4YMVA 4DSNA 3PUXA 5JS7A 2QRNA 1FUUA 3S1AB 4A8JA 3UWOA 4TSFA 1CTQA 3GEIA 4BEBA 2AWNA 1EWQA 1Z0DA 2WIBA 4W5JA 4JLPA 3QXSA 4F92B 3HU1A 4PC6A 4NONA 3THYB 1EFRD 2ZRFA 3U60B 1U98A 4A1FA 2OESA 2ZYTX 1CF4A 1ZRHA 1GM5A 2WAYA 1RE0A 4ZCMA 2LKDA 4AIIA 2QQ0A 4YMTA 2J3EA 2QQEA 3WRXC 3TGPA 4Q1BA 2PLRA 2AL7A 2N46A 3QIAA 3ASZA 4S35A 3TVDA 2H92A 4DEXA 4DLVA 4M9SA 1CKEA 3PG5A 1XFAA 221PA 3T15A 3CNNA 1XMIA 4ZDWA 2VHQA 1XX6A 4GOXA 4D81A 4GDFA 1QHXA 1U2RA 2P67A 3GJ6A 3PITA 3P27A 4HAXA 2FGKA 2AK3A 3BE4A 4ITRC 2XTNA 3C5HA 5HTKA 3DEFA 2CNWA 2F3RA 5JEDA 1E99A 1JQLB 1G17A 2WJHA 3THWA 3MWKA 3SYNA 2IS6A 1NSFA 3KFVA 1F2UB 3QXXA 3Q5EA 3SYLA 1UEIA 1TQ6A 4BQSA 4LX0A 4P31A 5KDOA 3Q72A 2F1JA 1T4GA 1TU3A 4LJ6A 2FE4A 2O8FA 1G20E 2F43B 2CVHA 4A9AA 1WE2A 4DB4A 3C7KA 1L7VC 3GPLA 3SJAA 1GSIA 1N6IA 2YINC 4ZPXA 1R10A 4WVFA 3G82C 2P2LA 2W6JA 1CP2A 1OIWA 4EPTA 2J0UA 1JAIA 2PJZA 3A1SA 2JJ1A 3NKVA 1EG7A 2HLDA 4HLQB 3U3KA 1UDWA 3MG9A 4OQFA 3RS0A 2ZJ5A 5JHGB 2O8EB 3OESA 4KFUA 4LV8B 3QI2A 3KJGA 5L3VA 3LD9A 4P4UA 1VCIA 3X2SA 4EFMA 3U3MA 5FTKA 5SZKB 4C0KA 1NN1A 2V3CC 3MWJA 1NJGA 4UJ3A 4JVMA 1CJTC 2JJ8A 4E07A 5DSZA 3LW8A 4OYHA 3ZJYA 4LC0A 1J70A 1SKYE 1XTJA 3C4JA 4JBXA 1K5GA 1W47A 3RHFA 4Q47A 2WJYA 4PC7A 3T34A 2G83A 4XVQA 2CJWB 5CB8A 4EKDA 1KI6B 8OHMA 3MLEA 4WIAA 2A5YB 2V7QD 4BLPA 2QI9C 3VKGA 2GNOA 1US8B 3HJNA 1NL3A 4OHZA 1XPOA 3C14C 1MV5A 3W5JA 2GK7A 4M1OA 4QGGA 4F4JA 2WM9B 4DLRA 2J0SA 4XVUA 1E2MA 2ZRKA 4G5SA 3ZQ6A 3HPQA 3NHAA 4B3XA 4HUQA 3W90A 2D2FA 1OKKD 3I92A 3EZ9A 1FP7A 2GVDC 5G41A 4I1UA 4QGHA 1X8JA 1AZTA 1ZD8A 1FFHA 1T5IA 4P4SA 1NMXA 1QBKC 4TZ6A 5TDHA 1KTVA 1W5TA 3U44B 4G5OA 2ZRHA 5BN5A 1N0UA 3HDTA 4QHYA 1VG1A 2GAAA 1XEXB 4IVRA 3EIEA 1CR4A 2JDIA 1BKDR 2FFAA 3DZDA 4PZYA 2AD1A 5J47A 2QZ4A 3AUXA 4UXIA 4Q66C 2KI5A 4QRHA 3T35A 4B3GA 4ZIRA 4JT2A 4IOLA 3B13B 3OE7D 1UM8A 1YKSA 1D2EA 2RGGA 4Q7LA 1IY2A 2OCBA 1CJKC 2ATVA 1AS3A 3CPHA 2H16A 3K09A 3QE0A 3K0CA 1KO1A 4PAMA 1ZW6A 2EVWX 2OM2A 1OXSC 1A7JA 2ONKA 4QGFA 2I1QA 4G5RA 1D9XA 5TY0A 1XTIA 2MMGA 1OKKA 1WA5A 1TADA 4A6PA 3AVYA 1GDDA 1XWIA 3BAFA 2DYKA 1NBMA 4R2IA 4NPHA 3FGNA 2ZVPX 3CF2A 3EPKA 4TLAA 3D7MA 1KI4A 2DR3A 3CONA 4MYTA 4A2QA 4NYMQ 2J7PD 1M7BA 3THYA 3BS4A 4CDGA 2ECKA 5FUXA 1GKIA 1G8YA 3MAAC 1NVWQ 3CNLA 5FL3A 3LA6A 2XXAB 3E5HA 2GCOB 3CWZA 3JVVA 5D3QA 2EFGA 2V9PA 1X6VA 3OEEA 5P21A 3AVTA 3CRMA 3ZZUA 2QROA 2BHRA 3QF4B 4IDPA 4M21A 3TUJC 3V9PA 1XTKA 2FDCA 4EFLA 1GNPA 4IVPA 2QA5A 4EJSB 2FEMA 1UKVY 2QP3A 3EW9A 1GVNB 4I1VA 5G40A 1IBRA 5BN4A 3ETLA 1W36D 4MYUA 1ZVQA 3ZYCA 1I4DD 4X8MA 2ZE7A 4Z1MD 1DAHA 2J1LA 3TUIC 4F7WA 3M4YA 2V54A 2C03A 1SVLA 3ZQJA 2JLZA 2Z0MA 4URVR 2F43A 1ZAKA 2VP9A 4L9SA 5EQTA 2IHBA 1X8LA 1XNJA 3BIFA 2V6IA 2W58A 5B64A 2VH5R 2FFQA 1K8RA 1E1QD 1CRPA 1CULC 1Z0KA 3HR8A 5EE9A 3EX7C 3K9HA 1BH2A 1LF0A 5FBRB 5AUPB 5HE8A 1N3BA 4O3MA 2NPFA 2G9NA 4IOMA 3BFXA 3VR4A 1Q1EA 4QBFA 2OAQ1 1E2GA 1ZNWA 1KY3A 3AP3A 4AYTA 2O8DB 2HCJB 1MRSA 3UIEA 1OH8A 5JFGA 1UFQA 3QG5A 4LDJA 1Z0AA 5FUYA 4US1R 5DN6A 5LPNA 1NMZA 2XOKA 4POAA 4NL4H 1CEEA 4G5GA 4WAUA 2A30A 4RFSB 4PPQA 4Q9HA 2QORA 5LB2A 3QG1A 3GJ4A 4LJ9A 4TLBA 1H65A 2XNSA 1M1YE 3SZRA 2EU8A 3GEEA 4BGDA 4OI0A 2C04A 2QPAA 3EC1A 3LY5A 1ZIOA 2CEAA 1KYIA 3VAAA 2YOHA 2F9MA 2KBEA 2CHGA 1Q22A 1GRNA 2GJSA 4HZUB 1II8B 3CF6R 4I1OA 1XMJA 3KTAB 4IOJA 4DLYA 3A6PC 3AF4A 1P2UA 4V03A 3A4LA 3RC3A 4BLRA 4BRWA 3DOEA 4JLKA 1XD9A 2NQ2C 1E1RA 2ZUBA 4ABYA 1HUQA 2C98A 2O0KA 1E2DA 1GUAA 3BORA 3B9PA 1VIAA 1Z22A 3P1JA 3TMKA 3F5FA 4OHXA 4EPXA 3ZDQA 1GIAA 1OSNA 2NO1A 3OIWA 4LPKA 4EPRA 4PPNA 3ZVLA 2ZE5A 2G3YA 2HEIA 2VEDA 3T5GA 3QKRA 4V0MA 5FPTA 1XCGB 4V0LA 1R0XA 2AN9A 2IK8A 4UNQA 4OHYA 3ZH9B 4Z8YA 2FPLA 1YHNA 5BWMA 4CEJB 5FR2A 5HZKA 4EAQA 1P3JA 4C2UA 4JT4A 3EIHA 4EJSA 1WB9A 1EGAA 1E2JA 3R9IA 3EPHA 3LW7A 3ND9A 3KKMA 4WZ6A 3WP1B 5FOVA 4NYIQ 4A6XA 3QEOA 4I4LA 3VQTA 4WXPA 521PA 4RVCA 4A0GA 4AG5A 3ADCA 2F6RA 1OV4A 1VYUA 4XWAA 3GP8A 2JGNA 1FTNA 5DI3A 1Z6GA 1OXVA 1N6HA 1O87A 2G6BA 2JLSA 3IIJA 4V0ME 5EE5B 4DC9A 2IC5A 1PZNA 1GL7A 4URZR 5DI3B 5E7JA 4Q4JA 3RSOA 1MOZA 1T8UA 1UKYA 3WRYC 4AD8A 5G3YA 5DO9A 2ZRDA 5SZHB 2VLIA 2FX3A 1E9FA 4A2PA 4BECA 2ANBA 1RZ3A 3QKTA 4TMTA 4A0HA 2ZUDA 4NHOA 3PCRB 2WWXA 1ELOA 2P3SA 2OO7A 3AF3A 1SVWA 4OHVA 1GG2A 4HAZA 3DOFA 2HUPA 4IXNA 4IJMA 3EARA 1F48A 1YJ5A 3IUYA 1J8YF 1LB1B 2QMOA 4RZUA 2QMUA 1N6NA 3NG1A 3SHWA 1II0A 3DKVA 1DEKA 2IXEA 1G9XA 1G6OA 1TQ2A 2C77A 4HAYA 5ANRB 4LBVA 4N1AA 4DLZA 5F2EA 2OXRA 2XSZA 1EESA 2P6RA 1KNXA 3B8HA 1P73A 1HQCA 1MKYA 2W83A 1FX0B 2CCKA 4HLUA 5FL7A 1E2FA 2ZI9A 4BRUA 3GLGB 2REOA 3I3SR 4R98A 3GJ7A 1P9NA 4NP6A 1YR7A 2ZRMA 2LKCA 2C9YA 3U7EB 3EPJA 1OYYA 3W3AA 2NG1A 3VR5A 2GEUA 5KOYA 3C41J 3H86A 5B2ZA 4C0JA 3KQHA 2ZJOA 5FOWA 4EUNA 3VKHA 1IJFA 1E2NA 1R6BX 5E95A 3A58B 3KKOA 3FHOA 2RGCA 3KQKA 2C9OA 2FMXA 3K70B 1EWRA 4R7ZA 1JEDA 2IHYA 1SXJD 1AIPA 3MCAA 3IKJA 2YWGA 4KXFB 1K5DA 1IXSB 2C5LA 1XPRA 1TMKA 2CLCX 3QF7A 4IDOA 5CIWA 5EE0A 2JLYA 3E1SA 1XTQA 3RRMA 4HEJA 3OEHA 2QNRA 3L43A 4DWJA 2CK3D 2FEOA 4Q4JB 1QHYA 1OE0A 3L0PA 1OFHA 3LX8A 4ERNA 4A2WA 2GBLC 4DHEA 2ZSBA 3UMFA 4QFMA 2CHVA 1SXJC 2QAGC 4NCJA 1BO6A 1KHTA 2PBRA 3GLFA 4QXAA 4ESVA 2BBSA 2WWIA 4Q1AA 5EP1A 5UKDA 2R62A 1RRPA 3EG5A 3FKSA 2P5TB 5TV2A 2QY9A 5DIFA 1KK0A 4TL9A 4JLVA 1WCV1 1NVXQ 4GP6A 4GI7A 5IK2A 2ZETA 4US0R 2PZGA 1SVSA 2HV8A 3IQXA 4FCVA 3U44A 3BH0A 3A37A 4O0MA 3KFXA 4WA7A 1TL7C 3NIBA 3VU9A 2KSQA 4M22A 2GZDA 3PENA 2R8RA 3A4MA 3TQCA 2EYQA 4D82A 4DSTA 1QG4A 3FMIA 1BMFD 2IYSA 1E6CA 4GMXA 5EE3A 3LBNA 3OZXA 4A36A 4TLCA 3H0KA 5L3SA 4QJ5A 1N6KA 2ZM5A 2GZHA 2FSFA 2DFNA 1A4RA 4FMBB 4ZDJA 2HCBA 2WWHA 1FUKA 4IRUB 5L3SB 2IS1A 2F1RA 1GNRA 3KX2A 1TF7A 1NLZA 4AC9A 4TN1A 1CBUA 1T0HB 1QHSA 4DCTA 1KMHA 5DISB 1GL9B 1JR3A 2QT1A 5JCZA 4B6FA 2VYFA 4ZDKA 1N0VC 3HPRA 2ERXA 4FMCB 5DGXA 2JASA 4PC1A 3WHLA 1DARA 4TL7A 4D4MA 2WWGA 3P4YA 3BB4A 5FUVA 4PANA 1KSGA 5KDLA 2ZAMA 5JECA 2IF0A 2FSGA 5IHPA 2QTFA 2IYYA 4IFEA 1G8PA 2CL7X 3KL4A 2GKSA 3DPUA 3I73A 5KYKA 4D2IA 4M1MA 5EXPA 4KAXA 4PPFA 3OFND 1B23P 1YRAA 1GZSA 1XP8A 5AR1A 1JB1A 3EZ7A 4CGZA 2H57A 1NG9A 1M7GA 2OHFA 2PT5A 3TKLA 3C16C 2Y8EA 3VMFA 2ZRJA 4KITB 1DELA 4XOIA 1DG1G 3L0SA 3PEUA 2ZE6A 5BYJA 3QUSA 3RSLA 2IW3A 3AKCA 2VIIA 1VCNA 3DDCA 3GJXC 3PV0A 1QRAA 2B8TA 2BV3A 3I62A 3LO5A 2ZYVX 2WZQA 2QP4A 2CL0X 5CYOA 4XTRA 2XOKD 3HP1A 4KCGA 1U0LA 4D6PA 1C1YA 3SEAA 4DLXA 3IQWA 2G0NA 1BS1A 2WPDD 5AUQA 4TLDA 1YZUA 2WJGA 3SS8A 1KI1A 1Z29A 2XX3A 1KKLA 2YWEA 2ZITA 3CR7A 3QENA 3AF0A 4KSBA
chains in the Genus database with same CATH superfamily
3MW8A 1S5PA 3HB0A 4IW3B 4MVWA 1A9TA 2QTLA 3BMNB 1RU3A 1Y8AA 3EZNA 5EGNA 4KWEA 1YS6A 1SCKA 1A7UA 3H9UA 3HYCA 3S3TA 3DOCA 4OHUA 3DLCA 2C5AA 3CRRA 2C3PA 1U8UA 3O82A 3V4LA 2ZJ8A 2G4VA 3V1UA 5KINB 3SLKA 4AMGA 2PZMA 1LTKA 5EMHA 4CF4A 5JPIA 2OUIA 3KOMA 3K6SB 1JKJA 4OK6A 4YJFA 5DI9A 2VNIA 4KPYA 3IXQA 1FNNA 2NUTA 2Q9UA 1VKZA 3CM0A 1SURA 4G1CA 3VISA 4JC0A 4P33A 1R5NA 3CB4A 3EZ6A 4XE5A 3ROTA 1U0JA 2PGJA 3ADOA 2J6BA 3WYBA 4EUFA 4P81A 2UDPA 1N7JA 5ALUA 5FP0A 1V1MB 1S7GA 1EG2A 2E55A 2O8BB 1XQYA 2RAFA 1PVDA 3D6UA 2C5GA 1QX3A 3KJNA 1I94B 5MHTA 3W6UA 5BSMA 1H5QA 2XGGA 4RA9B 4H35A 2VDOB 2IWRA 3WIEA 4N76A 4QODA 1E1RD 3GLVA 2WWYA 2LIPA 4ARUA 1RRGA 1ZXBA 4HV4A 2RCNA 5M5BA 3D8BA 1JHPA 1IG0A 4R2LA 4PLCA 3SXUB 4DN6A 2Q2QA 1F4PA 4V0OA 3UB4A 3TDKA 4YAGA 3N58A 1RVDA 3GUYA 1Q1ZA 2O1WA 2GF0A 1SUSA 2P78A 1GLNA 3C8MA 4UATA 5T67A 1GZ7A 3AEXA 3R7WB 1Z4MA 3CLSD 3RUHA 2SBTA 5AOAA 2JI6A 4D56A 4U8HA 2D1YA 2MTBA 4WNAB 5LSAA 2HU2A 2P62A 3BGDA 1KC3A 1ZQ9A 2VSXA 3IIMA 3JRWA 3T7SA 5IUNC 1E1LA 4DV1B 3RDPA 2ODNA 4ZAXA 1E6LA 5KNDA 1SBNE 2BUAA 5CXUA 4L73A 3BN3A 2YXLA 4FMDF 4MW9A 4HNAA 3W9BA 3V3TA 5EHZA 4B3BA 1DJMA 3AG5A 1Y4UA 3OE4A 4JZYA 3IV9A 2GLXA 3E9ZA 3LRTA 1HQKA 2MYTA 4AURA 3W0LB 4NCBA 4KQXA 1VGVA 3EVFA 1D1PA 2RGNA 4HBZA 5GIPE 2BKEA 1WLSA 1E4EB 2DM6A 2GF2A 3WLFA 1UFRA 1VL2A 1Z0JA 5ICEA 1YS4A 1NVVQ 1PIWA 2DHCA 3CB2A 3MNFA 1E66A 4O63O 1B2LA 4P4SB 2BMFA 1M8KA 3LXXA 5TVKA 1ZGBA 1U0FA 5DHFA 1P6UA 2HBYA 4Y9SA 3FBTA 4JJIA 1LDBA 1ZUNB 2OFXA 3NYQA 2G4CA 2XB9A 3C3JA 3ITKA 2WVJA 4FYHA 4CMBA 1OBFO 5I5GA 1J06A 2QZZA 2K87A 2PL5A 3WP0A 3HM9A 1NIJA 5HKBA 3FH0A 3KYIB 5M29A 4YJFB 4NF2A 1CNFA 1GAJA 3GEMA 4NOMA 5KSZA 2RHRA 1GPYA 4U3JA 2ZB3A 1PWZA 3NRJA 4FDAA 5AYVA 4R01A 2RSLA 1BGXT 1RYMA 2JZOA 4MQMA 3ILHA 4ON9A 3GJ8A 1SG9A 3BZUA 3MMPA 4FW9A 1NVFA 1RWWA 1E0SA 3R6GA 5HF5A 2ZXEA 1QHEA 3W5HA 1ZEMA 4LCBA 1XAHA 2EFCB 3F3YA 3DA8A 4L4UA 3KKKA 1GTG1 2O5RA 1Z88A 4B83A 2BFWA 5DOVA 5J63A 3T3OA 5B3KA 3ZOZA 1TTTA 1I6MA 1W36B 1Q0SA 1Z6YA 3PFHA 2QKYA 1B8OA 1WB6A 2I6QA 3FBGA 2FW6A 3TW4A 3W05A 5A4MS 1EDEA 3QKSB 5A9SB 3LUKA 3TDNA 1JBEA 1UADA 1NGSA 4INAA 1DBPA 4DDVA 1RRFA 4ZOQI 4YNBA 3V8MA 3PYLA 4EJ2A 4WN3A 1EFHA 2R6FA 1PL8A 3RKRA 2R7MA 5E8RA 3CJRA 5IMBA 3O9VA 3I4CA 2PX3A 4LWPA 3KDAA 2W9XA 4BAUA 3GFGA 5CT5A 3GXOA 4F84A 1J7KA 4LVCA 1V26A 2VS1A 2O2ZA 3NTVA 5BW6B 1UP6A 3RUFA 3GDOA 4DAEA 2EKBA 3OT4A 4NEHB 1V0JA 4UTZA 5HEKA 2JJ1D 3CE9A 3RR2A 4DMKA 1U2QA 1E3TA 1FYFA 2OLEA 4H0FA 2I1WA 1SA0A 2NYVA 5CRIA 1JR3E 3BREA 1Q44A 2EAUA 3HK2A 2DLDA 5AW3A 1QGDA 1AZLA 2FGJA 3MTIA 4Q1VA 1U7WA 2LWIA 1Z63A 2EGUA 2HDHA 2QM0A 4K6MA 3TSWA 4B8ZA 1H1TA 2HA6A 3E0XA 3ZKAA 3UWSA 1KBQA 2XHEA 1KQGA 3KOUA 3TGLA 1ZG3A 2ZR0A 3G8DA 3U4MA 3ZUGA 3JZFA 1Q5PA 2GESA 3HP4A 3EVDA 1XKLA 1CS4C 4JYAB 1EQUA 4NMWA 1BJRE 2G8LA 2Q8QA 3R9KA 1BCRA 4YJ3F 4ZQEA 5LQJA 4UHHA 3CISA 2HN9A 3AH8A 4FIDA 5ERYA 2J32A 4HUTA 2X6QA 4BKUA 5EJ9A 5AVTA 3O74A 1JZQA 2BC9A 4LECA 3ZU6A 4P86A 2QGZA 3CX8A 4ACAA 4M0CA 5CURA 4BO3A 1RLOA 3AVPA 3F6EX 3JPWA 4LN1A 3S44A 1MO2A 4QA9A 3FMOB 5GOTA 3QU5A 2XTZA 3FPEA 4IEFB 4JS0A 2DT8A 2G7ZA 4PQFA 1XCMA 3IKVA 1ORRA 5AKIA 5HIMA 4LGCA 3RJZA 3A32A 2HMVA 4M6WB 3ZTYA 2H07A 2P5SA 5CA0A 2WIJA 5DKFA 4ZHQA 1KARA 3QXGA 2EZ4A 2YC4C 3GAZA 3M4XA 1BMTA 4MRSA 4W7HA 1PR2A 4IQ4A 2GX6A 2QUHA 1X13A 4M1TA 2V1XA 3L7OA 1FXWA 1H0HA 1DHRA 2B5WA 3LYUA 2EL9A 2EX1A 4KWIA 4PBTA 2O2XA 3GG9A 1NTOA 3PX2A 1GGNA 2GRUA 2NUPA 2W90A 3L07A 4MW4A 4U00A 3NYRA 2BZGA 3S8EA 4V38A 5M7EA 1OFUA 3PDWA 2WF5A 1DAMA 4OHMA 4YT5A 4BNHA 4CFYA 1F51E 1YFJA 1CF9A 4DLWA 4M37A 1WTAA 1Y9AA 2Z43A 3OO0A 4UBJA 4ZVNA 2I03A 3D4OA 3O4JA 3WYFA 1YZFA 5JQGB 3GAAA 4DC1A 2RAPA 3CF0A 2QUZA 1ETHA 2AEJA 3UICA 4Y0AA 2GEFA 4F2DA 2ID8A 4FNMA 5LFAA 4FOTA 4R9UC 1OYOA 2Z5LA 5CNIA 2PLFA 2NZYA 3EQ6A 1NT4A 5ALSA 3T7RA 1QOQB 3MUNA 1VDZA 1U3CA 3RJMA 5FBVB 3OQBA 2E21A 1L4KA 1Y4DE 3EQ9A 1GTZA 1NBEA 3O1JC 1EHCA 2RC6A 3GLTA 3FHTA 1JWLA 2DTDA 1S2LA 1IN7A 3CEMA 3NNNA 3W3AD 2C2YA 1YAJA 2BMWA 4EJ0A 3WQBA 4GPZA 1EWKA 2WRZA 4M53A 4CRWB 1MJFA 1ID1A 1QYVA 3PDHA 4Y2UA 1PVOA 3BT7A 4RX1A 1M75A 3LHIA 4XQ9A 1O5IA 2GNPA 1U99A 3LKBA 4PBSA 3HVJA 3UJAA 1RLMA 1NQWA 1F4LA 4D9BA 1H6DA 3WGHA 1RXCA 2IPAB 3A3KA 4BN5A 1QANA 2D3WA 1XK7A 3BKXA 1TPYA 2PUHA 3L6EA 4HGNA 3GGCA 4WMLA 2BE9A 3NBAA 2WM2A 1VZ3A 4KV7A 4YJ2F 3FYUA 1ZH8A 5NULA 1O97D 2JFYA 3PGMA 2GN2A 1U4NA 1XRMA 4KXLA 1RWOA 5CW2A 3RK4A 2OWEA 3CXUA 1J21A 3VKWA 1TTQB 4EJFA 3OY7A 1DC8A 3FYUB 2R96A 4GG1A 2EHDA 1TM3E 3BZWA 4MLCA 4ZQHA 3KZXA 4Y1RB 5LQDA 2YMQA 3HHPA 1JG6A 2VBGA 3AT1A 4KTTE 4YWHA 1IEWA 1F0KA 2QOEA 5K8IA 1OU4A 2GM9A 2X5KO 3OVMA 4Q3OA 4MQLA 1ODIA 2WLSA 5K3FA 1XTSA 2Q3MA 3H5WA 4CKWB 2X1MA 5C8YF 1E69A 3R6WA 3NBXX 4FLEA 4TV8F 5FYDA 2YCBA 5AW0A 4KBFA 3GEPA 4K2HA 2JIZD 1HRKA 2XKAA 5IJXA 2PQ0A 4G4JA 3C1AA 4JQYA 2XODA 1Z2NX 4GS5A 5LWHA 1BX1A 1WSAA 4RPIA 3BXGA 3IUSA 4HZGA 2OPHA 1AZWA 2HR1A 2A84A 4FOLA 4BNDB 2XMDA 4WK4B 4KOAA 2WMOB 5IHXA 5K99A 1RYBA 1XA0A 3PICA 3BJIC 4ZODA 5EWJA 1VYTA 1L8QA 3TLBA 4F2GA 3ULKA 3K5WA 5WRFA 3SDSA 2OO5C 4LJ7A 3RS5A 3AXSA 1LSSA 3CLHA 3MS4A 4YGYA 3V4OA 2GT1A 1B14A 1C4WA 3VC7A 1T3ZA 1HG1A 3KPJA 1YIAA 3KWFA 4G9EA 3KZOA 3EEYA 1U9IC 1FFYA 1U28C 1YZKA 3Q2IA 1R2QA 3ZGXA 4G5XA 5D86A 4CT0A 4FHCA 1FVXA 1ZQ1A 4PX3A 4W8OA 4C5CA 1WF3A 5JD4A 2WE8A 5K2MA 1P1RA 2W37A 3HCDA 3H19A 4AK9A 4B6EA 1QIFA 1VL1A 6REQA 4D45A 4X0EA 5T6BA 3U7FB 1SEVA 2V97A 5I47A 4XM0A 1W5AA 1X19A 1UDCA 2EEZA 2DLNA 2OM6A 1KK2A 1KK3A 2C2MA 2VJAA 3QU4A 5EXEA 5BV2P 5EKUA 2VJPA 1IK6A 4ISCA 4DVGA 1Z7GA 3WSWA 4YDHB 4DXDA 4JXXA 4E88A 1EXNA 1NVTA 3WLNA 1ZCAA 5M04A 1E0DA 1I2DA 4J7AA 4ZOLB 1PZHA 1L5RA 2BFBA 1ZW1A 2EWWA 4BV2A 5KTOA 3K5IA 5HX7A 2MWMA 2IPXA 3ASYA 4NCIA 4PE5B 1R3DA 5KIAA 1ENYA 3QYJA 2ZFUA 4XW2A 4E2FA 1R5BA 1U7OA 1P33A 2VJMA 4TMXA 4GYWA 4H7IA 3E35A 1N5JA 2Q4TA 3QWFA 1S3FA 4LJ8A 4A0FA 4XWOA 2ZTMA 1E2QA 2Q6TA 2O2YA 3N86A 3G7NA 1TJ4A 4C88A 4ME6A 1QVAA 4A92A 3WLKX 3WRXA 1E89A 4MSUA 4CQLA 1TT5A 4PYQA 3A6DA 2C1EA 2HIHA 3LWZA 3JS5A 2XB4A 2JAXA 4LHSA 2HD4A 2Q4BA 4BBZA 1W5EA 4MW6A 5HZMA 2EJCA 1D2CA 1EUZA 2XE4A 4G5QA 5LCXA 1F0NA 5JJBA 2PY6A 2XF8A 4GGOA 3BJZA 4MKHA 3VYVA 4UE2A 5C8VA 2PUFA 4ZKDA 3K20A 4CMHA 3QX7A 2FUCA 5JCPA 1CY0A 1IAQA 1NFRA 3AEQA 4BEVA 1XZ8A 2OBYA 2OZLB 5SY4A 2ODPA 2GPBA 4X64B 1RKQA 3L8GA 4GEGA 2B5VA 1Y0BA 3H16A 2JHAA 2HXSA 4LE2A 3FPKA 2ZYAA 5E4TA 1XPUA 1LRKA 2O7QA 1XA4A 5HSGA 4L8WB 1NN0A 2G82A 3RNOA 3MJEA 4DV7B 4JLJA 3EY9A 3KT8A 1SXIA 2YV5A 1ISGA 3ESCA 3OFJA 4GOOD 3LBYA 1MA3A 2PIAA 1K3UB 3KJXA 5DM4A 4YRLA 3UMBA 1E6WA 1NC1A 1H9AA 3PRJA 4A8PA 4QM7A 1R1DA 3RVBA 3FCOA 3NRCA 2Q5EA 2GGSA 4NCHA 1C80A 3SXUA 2FHPA 1DRKA 2P9YA 5KQMA 3V4RA 1O5OA 2OG1A 2PLNA 4NPCA 2ATIA 4S1VA 1MO3A 3WJ2A 1N0HA 1S8AA 2G7MC 3GD7A 2VYQA 5TT1A 1Q6ZA 5JRZA 1Q7BA 1MVLA 5CFPA 3ODPA 1NG1A 1ECJA 1NPYA 4XSHA 1ZI6A 4FOOA 4D8TA 4GP7A 4A8HA 1YVRA 2K2QB 2PRJA 2LR0A 3M4NA 5DIZA 4F3CA 5HR5A 5LOVF 1CUHA 5DHRA 1KERA 3WKDA 3B7WA 2Z3ZA 1MX3A 4Q4AA 4ZYWA 3VR3A 3IYLW 5A4AA 1WKCA 1ZD3A 3MWDA 1WVMA 3MUEA 2X7JA 3TNFA 4QM6A 5FR1A 4HH0A 3HYTA 2ZRCA 3NBQA 1H23A 4K9MA 2FPPA 3H9CA 4A4DA 2WHRA 1FU7A 2I3GA 5PNTA 3ZHVA 3O8RA 1RLUA 2PTGA 3AR5A 4KIGA 3TJMA 5EIAA 1ZK1A 2EZ9A 1Q1NA 4KH0A 1OHHA 2GBCA 1SCDA 3JASB 3RSZA 3WRWA 4CE6A 3B8EA 3HFJA 4XIGS 5CG2A 4AQ7A 3RABA 4IFTA 3PK0A 4WEQA 1XNRB 4P7KA 3UWMA 4M2LA 1CU1A 1EUCA 1E5DA 1FQKA 5AI8A 3VC2A 4FI3C 4PLPA 1G8JA 5IASA 2BR3A 1ZK2A 2O8VA 2YHBA 3I28A 3U5ZB 1NYTA 1A98A 1T9KA 1Z06A 3EAQA 4TSFD 2RI1A 1EQAA 3BMCB 3I8OA 3WTCA 3O91A 4X20A 4PLHA 1RW4A 2OK7A 1KI3A 4W1RA 5GONA 1P74A 2GBPA 3AZOA 4C4SA 2VHJA 4F11A 2XKKA 4CM1A 5HRCA 1QF6A 2BBWA 1ITZA 2GN4A 2XKBA 1BHQ1 3GGDA 1IHYA 2EQ5A 1WOMA 3ENKA 1YL5A 2H8KA 3KZVA 1MABA 4K6GA 3I9LA 4UMVA 1Y7TA 2BM9A 1SXGA 5FFMA 2W2XA 4I50F 5J2TF 3A7EA 2CBGA 4ZXFA 3TYXA 5DN9A 5CD1A 1L7AA 2FFHA 2H2DA 4I9HA 1NQUA 2UZIR 4CLOA 4KVGA 4PC2A 3O3CA 4A73A 2IYLD 1UWVA 3IAFA 4JXKA 4LK2A 5AKJA 3IHTA 3PTZA 1MGPA 1CIVA 5ERGB 1FNBA 1ML4A 1NRJB 2HZ7A 2PWBA 4DR6B 2GFQA 3NTLA 2YVQA 5G0SA 1OJLA 2XGOA 2DOKA 1SXJA 4YDSA 2FWPA 1XEXA 4RXTA 1K89A 1SU4A 2X1LA 2H3EA 2VQ3A 3TLXA 1ZJ6A 4LKOA 3HRKA 1NW3A 1CG6A 4V0QA 5CDFA 3ZDYB 1RDFA 2QLNA 2CJPA 2BY4A 3ZZ0A 1M2NA 1WHSB 4TWAA 4UAGA 1UT5A 3R3XA 1T1RA 2E6KA 1UWLA 4DIKA 3H2YA 3UY4A 5FXMA 1AJEA 2M6LA 2WJVA 2QQGA 4YI3A 1U5AA 4R0VA 4QQNA 3ZDZB 1MXFA 1WZCA 4L22A 3N76A 4E4RA 4KAJA 4LQ4A 4L2IA 1S7CA 1FS5A 2A9FA 1I80A 1PWYE 3CPSA 1BXGB 4AKIA 1QBGA 1XCJA 4TN5A 3SAJA 5ESXA 1QQ5A 1XZDA 1JHMA 3HE3A 1LLUA 1XN1A 2EBWA 5B57C 4UE3S 1IJKA 4RKYA 4KFRA 1CQZA 3PVZA 4NS4A 3FTDA 3GDWA 1S3IA 4X1YB 3HKBB 4NDNE 1CNEA 3LLVA 3H5AA 3NJ4A 2F4VB 3EPLA 2AKYA 4OSEA 4P5PA 3NAMA 1CVIA 4BO6A 1F2UA 1D2HA 5IDWA 5JLJA 3D2BA 1P2TA 1ZSVA 5FHQA 3AM5A 2OHHA 1DLIA 1MJNA 1V1RA 2PT6A 4HLUC 4P36A 1Z16A 2ZQ5A 3R3SA 2HA5A 2A5GA 1UDBA 2FFBA 3OIYA 1Z3IX 1NM5C 1OXMA 2J41A 4WK2B 2QUKA 4CN9A 4DR1B 1PT5A 4RCZA 1G64A 4MYCA 4TVBA 1LLCA 1QE5A 2IITA 1VHTA 5LQMA 3PXGA 2C4WA 4M8IA 2TMGA 3FM9A 4W8HA 2CHQA 5LZ4A 1E5XA 5TJ9A 2D0PB 1KMQA 2GJAA 1KO8A 4NENB 3L9WA 5ALVA 1LLFA 1ORVA 1XGKA 4G24A 5L7YA 4UDYX 3HA5A 1ZN7A 2JCYA 3RKUA 2RHJA 5CUQA 4GQIA 2B21A 1XQ1A 1K7CA 5EERA 3VO2A 3J7TA 3DZKA 4KFSA 5ER6A 3QJGA 3MLBA 1USUA 16PKA 1DO0A 2CLDX 2NLOA 2YNMA 3FYTA 4JLNA 3ZXIA 1YA6A 5DHQA 1WO8A 4HDNA 1PJ8A 2JH9A 4M0LA 2HSEA 3TBHA 3OFSA 4L78A 2SHKA 3G9TA 3OI7A 2H1SA 3KUCA 2II6A 4X1IA 1OX4B 1CRLA 1MG5A 1XFDA 4JMLA 1P1IA 1SA0B 2O6LA 2AE1A 3B6MA 2YIVX 3DGFC 4P38A 5C8XA 4DQVA 5FO1A 1K8QA 2H51A 3N59A 3T5TA 4P98A 3UUWA 5IG2A 4HDQB 1MCZA 4LNAA 2ISQA 2YV2A 2XB2A 2D7DA 5JJLA 3TL2A 3RIEA 3UZUA 5AW8A 1K2VN 2E4WA 5JYCA 3OZEA 4DW8A 3EDCA 4LYEA 4V0NA 3A1NA 1BOOA 3COVA 1EINA 1JJVA 1RADA 4PAGA 4PHHA 1Q17A 5JADA 5ALHA 3PTLA 5A5GA 5DNUA 1NVUQ 2Q3DA 1BQ3A 3LS2A 1QRRA 2YX1A 5EKDA 2IIPA 5K8CA 2IL1A 1TPZA 2P9JA 2HT6A 3VTAA 5BW5A 4IJUA 3PUYA 3B9QA 3D64A 4Y6PA 3QKWA 3EC2A 3WNBA 5J1SB 2O5CA 3AR3A 2R00A 1PR5A 4JB0A 3WFZA 4RD0A 4ZT7A 1E6MA 2PT7A 3NOXA 5FOSA 2X5XA 4PNEA 5KQLA 4M89A 3WLIA 2DVMA 3TTYA 4N54A 2YKGA 2NPIA 4WBNF 4TYYA 2TMDA 1EDZA 1BXKA 4KZKA 1I9CA 2XXAA 1PBNA 2BR4A 3I04M 2XDAA 2Z98A 1LF5A 4QHTA 4QBGB 2HA4A 4UOEA 2NZUG 1CW2B 2WT4A 4OOFA 3ANSA 1ZC3A 2JGMA 2ZUTA 2RONA 2Z2IA 2ZDGA 3I2IA 3ROEA 3QU7A 2I3ZA 4LX8A 3KKEA 4OATA 2VXCA 3EMDA 3AVUA 2L82A 3F5QA 3R7SA 4EHFA 3KCNA 3TXXA 3VU0A 1M9NA 3WLSA 4MIEA 1B1AA 2ZIFA 2UU9B 3E70C 2R5WA 3OPVA 2FZVA 1LBEA 5H59A 5C4IA 1ZSNA 1NN5A 1B3BA 3DFKA 3KJFA 4LQDA 1FZTA 2OFWA 4RD6A 2J08A 4EBFA 4NBNA 4G25A 3U2QA 2V65A 3STYA 2WAAA 4Q1FA 4B84A 1ZCZA 4R2HA 1E2HA 3QLVA 4HH3C 4WNYA 4EPYA 4Q34A 1THGA 4D1YA 3PGA1 1UAYA 1AZSC 1JEYA 3HO8A 2J4CA 4RAOA 4LIPD 3BA6A 4E70A 1KFKB 1ZGCA 4QDOA 3BBPA 1U2PA 1NBOA 1JDZA 1NR7A 3WRVA 3R7AA 4J03A 4M0PA 4HRVA 4DMGA 4KR2A 3C3AA 2A9VA 4O2BB 1WVGA 3HA7A 4ASUD 2HH9A 2DFTA 2MSEB 4RJKA 1LX7A 5BQOA 1P17A 3NCTA 1YGPA 2ZJBA 1OBCA 1W4RA 2OG2A 7ABPA 5BSHA 4KI7A 1XKQA 4MYRA 3R8FA 2QXTA 1MPXA 4D8VA 1JG7A 5FX2A 2GTPA 3DONA 4DSUA 1C4OA 1T6NA 2I3AA 2R6GA 2YCLA 4C78A 4ER6A 1P8AA 2FZKA 1AC5A 1CUXA 1LX6A 2YJGA 4Z86A 4Q4AB 1E0KA 3WQRA 1CUIA 1V5WA 2FDXA 4D9HA 1Y34E 3AM1A 5EZSA 2CUTA 2ZBPA 5B58T 1RYHA 2WDZA 1G6KA 2QTAA 3PRHA 4XR9A 2Q7DA 3LQQA 2IV2X 4E46A 3RYCB 5DX0A 5EJ7A 1K7SN 1O6ZA 1T2CA 2ZWAA 2YS6A 3MUFA 3PJEA 4YO8A 5EZ6B 1JFLA 2QE7A 3IJEB 5EUBA 1S4QA 5A4IS 2HWXA 4IGAA 3OT1B 3ICCA 5AKYA 5TMBA 3W9YA 2A0XA 3P52A 3STVA 4OLBA 4NECA 1P1JA 1C9EA 3EXEB 3F5DA 3KPUA 3PNSA 1WV0A 1RBMA 2JA2A 5KYUB 3HR4A 3DNPA 4WK0B 1NRXA 1R8JA 3DMDA 4G4SP 3H5TA 5T3YA 3P45A 4FK8A 4ITVA 1YQ9A 1CVLA 1SVKA 3PXCX 2OGSA 4KVZA 4PG6A 3TIGA 4E22A 3QE4A 4NU0A 4E1AA 4IIJF 3L6DA 1NLMA 2GETA 1MH9A 4L72A 1J9EA 4HNUA 4OL0A 1LPBB 3E4DA 4GX1A 3NHKA 5BY2A 5KYWB 2B34A 3T7DA 4GUDA 1GLGA 5ILGA 4RADA 2ADOA 3THXB 3E05A 4A8JB 3UMMA 2YXEA 1VKNA 1MABB 1HO3A 3IPLA 3FCSB 1OYVA 4OMFG 4U1RA 3W4IA 4DDUA 1X9HA 3WQSB 2P4QA 4MA4A 1T1EA 3KQOA 2FLWA 4Z4FA 3C5EA 1A9PA 4HMPA 2XYRA 4QUJA 2WJWA 1MC1A 1UR5A 3JQBC 2BI4A 3MEQA 3OZVA 3QFCA 4LVUA 2ONYA 4S1PA 2IXDA 4AM8A 4YAFA 2FPOA 4Q3KA 5I4CA 2EFYA 2Q8PA 4Q3NA 5DMXA 5DNWA 4EA7A 1E4VA 3WYCA 1YF3A 1HR0B 3CHYA 1U80A 4MRRA 2RK4A 4YLEA 3AGQA 4JJ6A 2X42A 4RD4A 5IVKA 1JLRA 1Z74A 2VOEA 3KYJB 4KN9S 1T9HA 1MO4A 5ALGA 1SIBE 1NUQA 2BOVA 1K6JA 1PJ2A 3UM9A 4DLBA 3Q8KA 4QNRA 4Z2YA 1YMUA 2K7ZA 2P0AA 3WB0A 4BNYA 3G0GA 1XRRA 4LSMA 1AQYA 5EZYB 3R7LA 4P5DA 1QYCA 1YVEI 3SYRA 3GUHA 4YMIA 1HMYA 1U4SA 3SVTA 2QT9A 3A6FA 3U4IA 4YALA 3R5XA 2YY7A 4MJ3A 2VWGA 4Y0NA 6GPBA 2VDVE 2HA0A 4R1NA 2CBZA 3KBOA 3CFYA 1EJ6A 3LPLA 2R0QC 3O95A 4BYGA 3NEPX 4IIJA 3U37A 5C81A 2WAXA 1FZQA 1P5ZB 4N3NA 3NMUF 3WDSA 4H7HA 1ZD9A 4ND5A 2BPOA 1V8DA 2JFVA 2H4WA 4L7VA 1H9BA 3DZHA 4TRRA 4KREA 1D7AA 4IFBA 3RIYA 4HNGA 1M2KA 4N5MA 5LMUB 6PFKA 1AD2A 1YJXA 4O59O 3OAAA 2Q3CA 3QVJA 3LCMA 2P6UA 3FWPA 3NDPA 3K70C 1FP4B 3OCJA 4EG0A 3QSYA 3ADKA 4L4RA 3THSA 1QK3A 5FADA 3GA0A 5EZYA 5HRUA 3D6HA 2W42A 1LY1A 3VPGA 4C30A 1KI2A 1C30B 1BD4A 2BKUA 4RD1A 5F7JA 4CIDA 2IOFK 4F7DA 1RQ7A 5FTNA 4ZMSA 2UVPA 4D80A 5HWSA 2PU7A 2HO4A 3I37X 4D9FA 5KREA 1GN8A 1M8GA 3F3MA 3NAGA 4Q4HB 4FYWA 1OB2A 1B3RA 2ZK7A 2IWHA 1CZKA 3BFKA 6ADHA 1T9CA 3RTEA 4A3SA 3ZGOA 2X5JO 2JCXA 4CDNA 4FGWA 3TQQA 4A5SA 1C2TA 1E60A 2YBEA 4MUKA 5ICMA 5IJZA 4IEIA 2ZXUA 3ICQB 4QUEA 4OJYA 1QO9A 4PO8A 1V3VA 1T5HX 1XZHA 2VP0A 1IQ0A 1ONSA 3P5SA 3BF7A 2CNKA 4WXEA 4RXMA 5ICFA 1HT2E 2Q5OA 4PRKA 3H2GA 4CM5A 3LP6A 1XYYA 2WF9A 2X1HA 5TF0A 2IEZA 3T95A 2EWVA 2JARA 3CUSA 3ZH2A 5B12A 1I6LA 4WINA 1DEXA 2QY6A 4U3JB 1M1ZA 3V6LA 2ZPTX 1XRLA 3I4FA 4X9XA 3IVXA 1T5DX 3D8RA 4LOJA 2DT5A 1YGYA 2POQX 2ZUUA 4GZ3A 3RVMA 3WL7A 1CUSA 3EF3A 3OIUA 1F8YA 4M99A 4AQDA 5B2FA 1TZ2A 1RWMA 1O9GA 3B1VA 3D9QX 4KUGA 4P3YA 1O0CA 4MP6A 5LVAA 2K7FA 2XCRB 3L6CA 1NONA 2O3UA 3KUDA 3ZWMA 2D62A 2ZSEA 3T5CA 2JFHA 4BLQA 2CXRA 5ICGA 5ALZA 2IHUA 5SZJA 1VPWA 1KE1A 2QN8A 3UJ9A 1M33A 4AIRA 2GRJA 4TUYF 5ALLA 4AN1A 5CVVA 1X7ZB 2XVAA 1SBCA 2HWWA 4YPFA 3I2HA 1U2GC 3DFUA 4MVYA 5I8WA 2PA3A 1TLTA 2LPMA 4KGZA 3OJCA 1IB0A 1NPDA 2Q5HA 2FN8A 4BZXA 3AF5A 4MPTA 5HJ5A 5K0ZA 4O1IA 5KNCA 4LE1A 5A05A 2E5FA 3ED5A 3WYEA 4IAOA 1G8FA 1CUJA 5EINA 3QVWA 5F35A 4XGNA 5HQTA 2LZ0A 3EBOA 5IAEA 1OV6A 5BQPA 1ODTC 1D8AA 1MV8A 3O8LA 3NM5A 2ID9A 3LXRA 2H00A 1FP2A 3GQBA 2QVCA 3RFFA 2HUNA 2IEYA 3M3HA 2D2EA 1LV7A 3H6HA 4OIFA 1U3FA 4N6OA 1U0SY 3T6KA 2C8JA 1W8DA 4UU8A 3LOQA 1OX4A 4M4SA 3F1KA 3ZD7A 5DK6A 2V4ZA 5F77A 2VQSA 3LUBA 1XMPA 3EXFA 5EL0A 5IK2D 1U9CA 3A2LA 4JVNA 4NX2A 4B47A 4D8WA 4S1OA 1BVHA 5D5PA 1NF8A 3UVEA 5FUQA 2ODAA 2IUSA 3UK6A 2LCFA 4I1PA 2Y93A 3KUKA 3OP4A 4IGKA 1HURA 3I1FA 5KB3A 3OKCA 4PCUA 3GVHA 3WG9A 2X15A 1YJAA 2ZU0C 2DR0A 2V7QA 3QPAA 1RYZA 3EZXA 4Z4QA 2OBLA 1A96A 4P92A 3ZWDA 3EVEA 1C5KA 5FF9A 2XZLA 4IYJA 1BDMA 1KOFA 3DUFB 5B7QA 4PVCA 4O4IF 4RFVA 3RV3A 1PYGA 3C3PA 3DHWC 3DO8A 1B0UA 4G84A 2PIDA 1D03A 3I9NA 2NX2A 3DLHA 2FN9A 2XYPA 4IDAA 2W0SA 4UVHA 2X8AA 5TR9A 4AMUA 4B33A 4YMUA 3WYNA 4IVNA 3SDZA 5EXXA 3KXDA 3HUFA 1ZI8A 2QK4A 3KTAA 2Z04A 4LNUA 3N8KA 1H1LA 3MTAA 2NO7A 3EAFA 2CXUA 2QT0A 3DMYA 3V1LA 1E3WB 1O2DA 1PF7E 2GBLA 4TL8A 5GADl 4AY2A 3GG2A 3O0DA 3WLQA 4UQPA 4J9VA 2ZWOA 2IYXA 2O0LA 1UT8A 5DTRA 4OREX 3KAKA 1HORA 1BU5A 3NVMB 4PO9A 1YRBA 1SUCA 3B36A 4M9ZA 5KVQA 3E9DA 3UCEA 2OV6A 3AB3A 3C15C 2F3TA 4IIHA 4YMWA 4E2YA 3TE7A 2ZP1A 3KEQA 3LH5A 2J0EA 3DPIA 1C29B 1VM6A 4ZCPA 4C0QC 2XUDA 1JALA 3K4HA 4X91A 5CX1A 4BFSA 1QTIA 3PVSA 4O2LA 5ERXA 5LLDA 4FKMA 4DZRA 5ES4B 1PS9A 2QTHA 1IXYA 4P08A 5LWQA 2UYOA 2CLIB 2VCEA 5ETJA 4UFPA 2W0MA 4UQLA 1DJLA 4URUR 5AVQA 4W5WA 2GKGA 1VE3A 1ZYUA 2D1TA 1F6WA 2HM7A 3E3OA 1J0BA 4MWOA 1ZM7A 4NBKA 5AHXA 3SSAA 1YDWA 3JTEA 3D4IA 4KLRA 3IGFA 2WKPA 1KO5A 1TYEB 3I2YX 4ZCIA 2HV9A 4XXHA 3JYOA 3W7VA 5KU7A 2J3QA 3IQFA 4LXQA 1H69A 2BISA 3VYUB 3PJDA 4Y67A 3ONEA 3G2JA 1PFVA 1IBCA 3VR1A 1ZHHA 4FFBB 5L3QA 3C6KA 4HQLA 4QPNA 4DMFA 4INOA 3UKOA 4CM4A 3FETA 2V5VA 3L6BA 2ZU6A 1Y98A 1QGUA 3PPVA 2Q3HA 4G01B 1M2WA 4KV9A 1IG3A 1N2SA 4MGEA 3ZV5A 1H2HA 1NAIA 1TGYA 3CR8A 2QR3A 3LO8A 3QV2A 2PS1A 3FYHA 1EB9A 3IDQA 1RAIA 3TIFA 1YR6A 3JQ9A 3ZDDA 3C3YA 3FMPB 4S0XA 2UYHA 4U02A 3G8YA 1NJFA 1DO2A 3N0XA 2X4LA 2PMBA 3NBYC 4LJKA 4XA8A 2GM5A 1NYLA 2PGLA 3DEYX 4L0QA 5A3QA 3WKAA 2MSLA 3F97A 3EULA 3T1VA 3FTPA 4BDSA 3CW2A 3HO6A 3RS2A 1MJGM 1VMKA 4TT3A 3WGQA 4CCYA 1DCKA 5K7SA 4TV9F 5I9MA 4ZO9A 1VPDA 2JATA 5EHIA 4IQGA 5F3RA 4XFKA 4J7CA 2HHCA 1I1NA 5AJXA 4KPEC 2QTCA 3AY0A 4JQOA 4PSDA 3R0JA 3B1YA 1TK9A 2W2QA 2C2WA 4IDFA 4C1NA 3U26A 4AKHA 3U7QB 2R11A 3FUUA 1Q7EA 3I1JA 2FPGA 1FNMA 1NKSA 2DTXA 2H2IA 2W8BA 1E2KA 3DBLB 3FDIA 3CRVA 3IUBA 3P0RA 4IX1A 4MCHA 4RTQA 5L8VA 2B9VA 1TKAA 2FJ0A 1FX1A 2JAUA 4Z9BA 3WY9A 5C7IO 4J94A 4MWBA 4TS9A 3D0QA 2W6MA 3G1TA 4XTCS 4I3HA 3TNJA 5B58C 3SKVA 4NH4A 3WGNA 3MT0A 1G3MA 5FBWB 3SQWA 2H0AA 4NJMB 4PHFA 3TAUA 3N2YA 1KPIA 2G04A 3ZHBA 2OYRA 4EHLA 2NTVA 1GHTA 1JXAA 2Z8YM 3KU4A 5ARDA 3ZWAA 2O57A 4U7WA 1YB7A 1ZSYA 4YXWA 1F38A 2QM7A 1CJCA 3O84A 3TEFA 2PO5A 4WERA 1N6LA 2I6GA 2V4MA 3PHIA 3WWYA 4RTLA 3AP2A 3C4QA 5HIIA 2ST1A 4UPVA 5DDIP 3W1WA 4RDHA 5ALIA 4UNRA 3JSXA 5KO2A 3EFEA 1SJ9A 4DNXA 1GA6A 2XEXA 4IS2A 1JQAA 4R3WA 5FWYB 3GLGE 4JJZA 5KNBA 3NXSA 4Y2JA 3VR5H 4IUYA 3D3NA 3ZLBA 4AWXA 2GPAA 3QA9A 2VHUA 2ZZNA 2ZRLA 2RFLA 2YJTD 4G63A 4URHA 5TEWA 1VTKA 1YL6A 3Q10A 4I4TA 4H59A 4OQDA 4W6QA 4F21A 2FU5C 2DMRA 4JP1A 5JTUA 3BX1A 1T9ZA 5AKHA 2PS0A 3CKLA 3KKPA 2I2FA 2VUSA 1II8A 1KFCB 3F67A 3LMKA 2VKTA 1YB6A 2YZMA 5LZ2A 4IDNA 1QAMA 2A9QA 2YWRA 4D0SA 1JW9B 1HBJA 2AK2A 2KWIA 2WSSD 5KDDA 4J3NA 3LF2A 4GRAA 1C3OB 1EBFA 1N2IA 1Q21A 5EQJB 2G1UA 5E7MA 5ECWA 1I2ZA 1QG2A 3K09C 5CH8A 3I30X 1ZMBA 4HDRA 2XAUA 2HNKA 2VF5X 4R69A 4RS4A 3H1BA 1W1WA 3V7YA 1NI5A 4CCWA 4QLBA 5IYZF 3JQ7B 3OZSA 4AUNA 1DKMA 3GHYA 2NYUA 5JJ5A 4ZU3A 5DE3A 4LYAA 4D9GA 1SWVA 1YMQA 2FCRA 4DLKA 3O1HB 5F7OA 3G02A 3TUZC 1QF9A 1ZESA 3S7ZA 2P9CA 3TJRA 3ZY5A 4LHEA 1R18A 4C2TA 1R4NB 2XRZA 1N6OA 1ODKA 1SULA 3TR0A 3VO9A 1TT5B 1V96A 3BXPA 3QTTA