4X8HA

Crystal structure of e. coli adenylate kinase p177a mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 73
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8hA00
1W46A 3QXXA 1G19A 5KDDA 4JL8A 4QC2A 1N0UA 1HUQA 2A5FA 3FFAA 3IPXA 5H68A 3IEVA 1VG0B 1ZM3A 2F1JA 5B30A 2P67A 1EFRD 4XVRA 4DBLC 1ESMA 3QVVA 4OHXA 4D26A 3A4NA 3ADKA 5C2JB 4WZBE 5CJ2A 1P75A 2J46A 3KQHA 1E6CA 4M9ZA 2GETA 2XTMA 2CNWA 4Q1EA 4UKDA 4M1TA 4BE7B 1G291 4M1WA 1CRQA 3GD7A 1E0SA 2ZRMA 1JR3E 1Z0AA 3A1TA 3TAHA 4EJSC 4KLZA 4IW3B 5EP3A 3O8RA 4Q7KA 5J47A 1XP8A 4EDHA 3A6PC 2ZRNA 1TQDA 3K8YA 1KSGA 1FFHA 2VSFA 2ZI4A 5EE0A 5FL3A 3P20A 4PANA 1OKKD 4HUTA 1GM5A 3B8HA 4LJ7A 4LOAA 5CK5A 3I32A 2ZRPA 4ZDKA 2BEJA 1Z08A 3PR1A 4ZCLA 1V5WA 2C03A 3U2QA 5JHGB 3GLIA 2HCBA 1VG8A 3C41J 3HDTA 4C0QC 1GZSA 3AVQA 2GNOA 4K8OA 1P4SA 3ETLA 3PUZA 2AK2A 4KSBA 4ON9A 2ZJAA 2IS1A 2IS6A 4C0AC 1G3RA 4POAA 2R6AA 4FCVA 2DWQA 4FMCF 3UWKA 2YWHA 3CF0A 1RVDA 2BKUA 1ZNXA 2MSEB 5DHAA 1PVOA 1S9DA 1X3SA 3EARA 3CB4A 3CX8A 2JJ2A 4CDGA 4CT4B 721PA 2ZRKA 3AF4A 3V4FA 1E2EA 2ZSBA 5FTMA 1Z6XA 3EZ9A 4EPYA 1WRBA 1Z2CA 1HH4A 4L4UA 2EWVA 2G1KA 3GJ5A 1ZVQA 2NTYC 1F2TB 2QA5A 2E1RA 4Q47A 1XWIA 1ZUNB 2QQ0A 1OXVA 2RKOA 2PLFA 5EXXA 4EPXA 3LLMA 2IYVA 1R8QA 2ZI9A 1GKIA 1OFUX 2WZQA 4TMXA 1QZXA 1TADA 1SZPA 2XNSA 3BE4A 3AVVA 1XEFA 4TMZA 4ZCIA 3U6BA 1S3GA 1E2QA 2Q9AA 3UKDA 3NWJA 3H0KA 1EFTA 2DCUA 1Z6YA 2PMKA 3MG9A 4Q7MB 1MO5A 2IBMA 3TAUA 3IUYA 1QHYA 3SS8A 3ZDQA 3BFVA 3EC1A 4GOJA 4OQNA 2N46A 3T35A 4BLRA 3A4MA 3CPEA 1G8PA 2VIIA 3FHTA 4D4LA 3QF4A 2Q3FA 1R4AA 2P3SA 3RHFA 4RZXA 2GCOA 4TL8A 3LD9A 5EP4A 4LBWA 2GDJA 4Q4JB 1TEVA 4LHXA 4OL0A 4YDHB 5SZHB 3TLXA 4BFXA 5LPNA 3T1TA 1A2KC 1S4QA 1KO4A 2Z5FA 3WMEA 2VEDA 2RHMA 2ODWA 5JI3E 5JWOA 1ZNYA 1KKLA 3QXCA 2QP9X 3FPAA 4LHYA 3TR0A 4HLCA 1S1MA 2ZJ8A 3EPLA 1XXHA 2C96A 4B3BA 3CRMA 4H1VA 3GLGA 1JI0A 1GRRA 2FE4A 3TVTA 4A4DA 4O0MA 2G0TA 1Q1ZA 1XTRA 5CJPA 2VP2A 3K53A 4Q19A 3K09C 4PQYA 1LW7A 1UFQA 3C5CA 2IC5A 5J5CA 3M4YA 1MO4A 1SHKA 2BJWA 3KKNA 4NTZA 3K0FB 1ZJ6A 3KKMA 5C1BA 1XEXB 4Q66C 3SR0A 4DKXA 2IYLD 2QORA 1WXQA 3SDZA 2QTHA 2WJJA 4R71A 2GRJA 3VX3A 2V9PA 1Z6AA 4BGDA 4LI0A 5FOUA 2ZQ5A 1P6XA 1VPLA 4Z8XA 2GXQA 2G3YA 5L3VA 3RAPR 1ZM7A 1EFCA 1DPFA 3T1QA 1DTSA 3LBNA 2ZE8A 4B32A 4YXWA 3W5JA 3CRW1 2F43A 5L3RA 2P6UA 3R8CA 1U8AA 1EX7A 3B5JA 1B0UA 4J0QA 1T91A 2ZPTX 1SVWA 3AKYA 1QHHA 2PZEA 2R6CA 1RIFA 5IT5A 3TKLA 2C78A 2R44A 4Q4AB 5TY0A 3TSOA 1DAHA 5FFMA 1XMIA 4DB4A 2EFGA 1JNYA 3UPUA 2HXYA 4LSGA 4PHFA 1CJKC 2OT3B 3HU2A 5FOWA 3EC2A 5JMTA 1NL3A 1ZNWA 4HATA 4JLOA 4NP6A 4ERNA 4ZDIA 1EGAA 2EYQA 4Q9HA 1JAHA 1NSFA 3WXMA 3NHAA 3VAAA 3S1AA 1QRAA 3QSYA 5AJVB 3RYTC 1G8HA 2C9OA 3DOEA 2ATXA 4L8GA 1SXJA 2R8RA 4H9GA 2OILA 4I1UA 3LVRE 1I2DA 3EAQA 2Q9BA 2J87A 2NO9A 4NH0A 2C98A 3VR6A 2ZE7A 4HAZA 3K9GA 4DUGD 1G41A 3AH8A 3WP0A 1TF7A 2IYRA 4JT2A 5AUOB 3CH5A 3T06B 1G16A 3RS2A 1E2JA 4DLVA 2RGGA 3N70A 3SYNA 3R8FA 1PUJA 4P32A 4BZQA 4D4KA 1GNQA 1W48A 3CRRA 1IY1A 2IYZA 4XWOA 2FX3A 4ZO4A 3VR4A 1ZD1A 2B7BA 3SBDA 1KTVA 1US8A 4CT5A 3KJHA 1GP2A 3EX7C 3BORA 1PLJA 2H7VA 5KPDA 1Q3TA 2GJSA 1Z2AA 3GPLA 3UANA 4LC0A 3THWA 1XJQA 3GJ0A 3JZMA 3SBEA 4GP6A 1NSTA 1Z0FA 3SQWA 3Q7QA 4QXAA 1ZD8A 2YV5A 3TIFA 3CR7A 3ZYCA 1IQPA 5EXPA 3SU8A 3FGNA 1U9IC 2BBSA 2YWFA 2G77B 1KGDA 3VU9B 1XTKA 2F7SA 2ZTSA 1ANKA 5GADl 4B44A 3KUCA 3KUDA 1D2MA 3NEYA 4C0SA 3RRNA 4F93B 2V1XA 3IO3A 4MA4A 3T1OA 2IX3A 5FUWA 3ZS9A 4JLJA 4Q1BA 4Z1MD 4DVGA 2ZYVX 3VR2A 5FI0B 2ZE5A 1FTSA 2H1LA 2WSSA 3B9PA 3RS5A 2CHQA 4U00A 2V7QA 4BECA 3A1SA 2QAGA 1XD8A 1GILA 4I81A 2IYUA 4G5SA 4B35A 1XB2A 1BOFA 5FL7A 4Q21A 1J99A 2AK3A 1KNXA 1YR6A 2UVQA 4TLEA 1XD2A 2JJ1A 5F3WB 4FW9A 3PJRA 3ZD7A 2RGNC 2ZEJA 4Q4HA 1TMKA 2GTPA 1DELA 2FU5C 5FOSA 2WBLC 2ANBA 4MDEA 4FCWA 1WDTA 3W3ZB 3WHLA 5HE8A 4I1SA 4RVCA 2ZANA 1AZSC 1CXZA 3LBHA 2WIAA 3SNHA 4P0TA 1IJEA 1JQLB 4QM7A 1NVVR 1NBMA 4B76A 3IIJA 1JPNA 4KBGA 2GZAA 1H65A 5FOTA 3SQXA 1XDBA 4ITRC 1AN0A 2JLUA 3RSOA 2D3WA 5G40A 3FOZA 2JEOA 2DHRA 3RVBA 2HF8A 1N6PA 2ZRBA 1KNQA 5H70A 3IO5A 3I8XA 3QIAA 1SVSA 3OAAA 3OIWA 2KI5A 3C7KA 2IF2A 4O25A 3QEJA 2JLRA 4I4LA 3EZ2A 5D3MB 2XGJA 1DO2A 2ZJBA 4OHWA 4DZZA 2JATA 2FN4A 1M1YE 3BK7A 4JLAA 1YRBA 2CCKA 3K0EA 2ZSEA 4EQ6A 1D2EA 3NH9A 4AI6A 1YZNA 2FFAA 1P3JA 3SJAA 1G17A 1ZM4A 2ERYA 2NG1A 2WOOA 3L0PA 3QJYA 2CK3A 2GESA 1Z29A 3EPJA 5BN3A 1JXOA 1C9KA 1ZD9A 5TV2A 3JVVA 2IYQA 1MV5A 1RJ9A 3W6PA 3VHXA 2XB2A 1SVKA 3R9IA 1Q1EA 1WCV1 5ANRB 1TEXA 3DEFA 3VKGA 3U7EB 3W6OA 2P6RA 5CK4A 2IEYA 4OQXA 2R9VA 1S9HA 5DGXA 5GJBA 3LO5A 4HLUC 4XJXA 1E2DA 1Z0DA 1RYFA 1N2CE 1XCPA 2WJGA 3MWJA 4KFSA 2QSYA 4OI2A 3KDSE 4FI3C 4GZLA 4N0DA 2X77A 1FL9A 3B9QA 5H1YA 4QFMA 4RFSA 3ZZUA 3THOA 3QF4B 1YKSA 2GCOB 4LHVA 2GZHA 2A9KA 4HB0A 5HKKD 3BH0A 3HPRA 4DDUA 3LQQA 4ASUA 2F9MA 1U0LA 2HJGA 5FBLB 2FFHA 1ZU5A 2BJVA 4JBXA 1QBKC 4PC6A 3LNCA 2NO6A 2H5EA 1IN4A 1P7CA 2OUKA 2WMNB 3OEHA 3ZZTA 4C3ZA 2CCJA 3L0OA 3DDCA 3PV0A 3QXSA 4GNKA 4QJ5A 3FTQA 1S8FA 4P4SA 4KFTA 4LK2A 2O8FB 3LQRA 1RC8A 3SHFA 1NLZA 1XXHB 1FX0A 3P27A 5B57C 3AVOA 1Y63A 1DAFA 4OK5A 4PSVA 1Z06A 4DCNA 3AVTA 1ZM2A 4DSNA 3P4XA 3TRFA 5HZHA 4C0JA 4ILEA 4A15A 1KZGB 1UDWA 2VHQA 1CJUC 4IDPA 1KSHA 1NIPA 4UNQA 2OAP1 4JT4A 4LWZA 4X8HA 4KXFB 4KU4A 3I5YA 2FSIA 4DSUA 4KCGA 4EUNA 3FMOB 3EWSA 5KDOA 1B23P 3I8SA 2O8BB 1D9XA 1TQ2A 3W34A 3V9PA 3C15C 3M1IA 3OFND 3ICEA 4A8JC 3C14C 3MJHA 4BFUA 4MGKR 2XOKD 3MGCA 1YZGA 3A8TA 3K70B 3TGPA 5CITA 3AGQA 3CPJB 4MGYR 1KJWA 4TQ9A 3THYA 1COWD 3BERA 3BC1A 3IEUA 1OIXA 1H8HA 1E3MA 2HLDA 2WSMA 2PL3A 1DE0A 1VTKA 3LDAA 3OE7D 1Z83A 3LA6A 5DLQC 5HCIA 1F2UA 2QMUA 3SFVA 5FPKA 4PSKA 2F43B 1F6BA 3GLFA 4BLSA 4BLOA 1KDPA 1UF9A 1LF0A 3LVQE 1ZBDA 1S0UA 1QHHB 1T3HA 2J7PD 3FMFA 4OYHA 3DKPA 4V0LA 4XWAA 4JLPA 5JLJA 2W2VA 1SQ5A 1TQ4A 3HR7A 3QOFA 4ZKDA 1E79D 3A1VA 2ATVA 2WWYA 3O8BA 3ONWA 2GXSA 2B92A 3B6EA 2ZS7A 1E94E 2PT5A 4QBGB 1VCNA 3PEWA 2I1VB 1WA5A 1YU9A 2ZU0C 4II7A 3LBIA 2DFKB 5JECA 2VSXA 1SXJB 3W8RA 4IOKA 4TTPA 2YWEA 4LRWA 3Q8XB 1HTWA 1CF4A 4ARZA 2E9SA 4QGAA 3DHWC 4GZMA 3TUJC 3TVDA 1UEIA 1T9HA 4A2PA 2ZREA 4DXAA 2JDIA 1EG7A 2QAJA 4JYCA 5A5GA 3LY5A 5CYOA 5J4KA 3KKPA 3UWOA 5DISB 3C8UA 1K5DA 1Q3HA 2WV9A 2C9CA 2RCNA 5CDFE 4LPSA 2CLSA 1ZM9A 3PUVA 5E4FA 3MMPA 4PTLA 1L4UA 1W1WA 3TMKA 1KK1A 2IUUA 1ZNZA 1N6RA 2PT7A 3AQ4A 5K8UA 4QGHA 2PJZA 1XZPA 2QE7D 1E98A 4WAUA 4YMWA 3DOFA 4EJSA 3AVPA 1NMZA 4O2LA 4AWXA 3SN6A 4XVUA 1U94A 1N25A 3QQ5A 3THWB 4C0BA 1P73A 3PQCA 1ZC4A 2IW3A 1ZINA 3WYAA 1F48A 4Q9JA 1MO3A 5DO9A 4RFVA 1UKVY 2B6HA 2F1HA 2JIZD 4FMBB 5K8IA 4JL5A 4ZIRA 4HB3A 2HYIC 3RRYA 1DOAA 1T8UA 2V1UA 2QBYB 2XSZA 2CVHA 2I1QA 2PZGA 3ZIAD 1Q44A 1KI8A 4NMMA 3CWQA 5ELXA 2H18A 2P5TB 1W5TA 4DSTA 1E9SA 1E9EA 1T6NA 3KXKA 1E0JA 3GJ3A 1SVMA 3GLHA 4TSFA 2ODNA 4WZ6A 5F98A 4ACAA 4PO8A 5EZ5A 3UXMA 2ZJ5A 2O8CA 4M1KA 1E2FA 3Q3JB 4NL4H 1E1RA 2YVUA 4NYIQ 3L0IB 4OJQA 4L15A 1P9NA 4FMDB 3TQFA 1CP2A 3OEEA 1AKEA 2QAGB 2QG6A 5GJCA 2WICA 1KSFX 5HTKA 3BH6A 4ZCMA 5JS8A 1YZTA 4HI0E 2JLWA 1HV8A 4RSGA 4B33A 2WWFA 4D80A 1HA3A 4NHOA 4US1R 1BIFA 5FH9A 1OH8A 2ZRDA 4DWJA 2OHFA 1W5SA 3I5XA 3ZVNA 4HB2A 4B75A 3IBYA 5DN6D 4BLTA 1NG1A 1CJTC 1OH7A 1CULC 1XPUA 3FMIA 1JBKA 1KAOA 3NBXX 4MYTA 2EFCB 2CBZA 1YRAA 4BEBA 2YC2C 1XD9A 1F5NA 3TJZA 1P72A 4NCIA 3LX5A 5TDHA 5JFGA 3SYKA 2ZYWX 2ZYTX 1N5KA 1OSNA 4AKHA 5SZIA 1UM8A 1P60A 4CEJB 2N42A 3OIVA 2HJVA 4D0GA 4C0LA 4C7OB 3I62A 2ZVPX 5J40A 3NIBA 4JJKA 2ZUDA 4B2LA 1Z22A 3EPHA 3NTUA 2H57A 5UKDA 4Q00A 4JVLA 4M1YA 2ZRGA 4A6XA 2XNDA 2WPDD 1OF1A 4NE2A 5FR1A 3LW8A 4KYUA 1GTVA 1CS4C 5C18A 2W6JA 2X8AA 2H16A 3KFXA 4A92A 3PIRA 4GPTA 4EQ6B 2FDCA 1FTNA 3K9LA 4RD4A 1ZRHA 3WY9A 1Z47A 3K9HA 3UATA 4AKIA 4IOLA 4DLTA 3SHWA 5DI3A 4OK3A 3PEVA 2J45A 2YOHA 3IDQA 1GUAA 1S1CA 1KDTA 3MWLA 3FMPB 1YZLA 1I2MA 1DADA 1W4RA 2OO7A 3K09A 2GEVA 4GP7A 3R7WA 1RRCA 4FMDF 1X8LA 4LJAA 1T3LA 1XXHE 2AFHE 1PLLA 1MABA 3GLGE 3G5UA 2LWIA 1MR3F 4LBYA 5B2ZA 4D6PA 3DMDA 2ZU6A 2R6GA 4L9WA 1XCMA 4QKQA 3AKEA 4UQOA 3KTAA 2FWRA 4P3YA 1E9AA 3U4QA 2G9NA 4TT3A 4NYIR 1IY0A 3ZJYA 2XZPA 4PR0A 1E9CA 2WWHA 4B71A 1G6OA 1FUUA 2FEMA 1N6KA 4URUR 4DDVA 5CM8B 5JSZA 1BO6A 2W2XA 1D6JA 5KO2A 2QM8A 1YR9A 4A0FA 2EFEB 2FGKA 421PA 4M22A 2VPPA 3GFOA 4EPRA 1FX0B 2ZI5A 1XMJA 3EXAA 2W6ID 2CVFA 2QMHA 1E2LA 1A7JA 3QI2A 4PX9A 2CL7X 4R7ZA 3X1WA 1OHHA 2AX4A 4OHVA 4PC3A 5BN4A 1JR3D 2Z6VA 3CZQA 4PZYA 1U90A 2OXRA 4BFZA 2FSGA 4RZ2A 4F7WA 5C46F 4UJ5A 5AR1A 4P33A 4XH9B 2OEPA 1JPJA 1PV4A 4M9SA 4OI0A 3B85A 4KV9A 2IYYA 2ZS8A 1R2QA 4HLDA 2GK6A 3X1ZA 2YKGA 1LF5A 2EFDB 3CNNA 4JLKA 3JZAA 3FB4A 2XJ9A 3FYHA 3KX2A 3PXGA 3RDPA 3WRXC 5BW8A 4KFRA 1G7SA 4AKGA 3H2YA 3K70D 2REOA 3B13B 3D31A 3BFXA 2A78A 3E2IA 2CCGA 2IXGA 1A5TA 4DJTA 4LY6A 1Q21A 4OK6A 3GQBA 4OHYA 1A4RA 1CRPA 1F2UB 4BFVA 2ASEA 1F60A 4GSYA 1U99A 1SXJE 4DCUA 4C9BA 5JEEA 3U7GA 5CYPA 3K0AB 5M04A 1K5GA 5E3HA 4YXWD 3E1SA 4F4IA 3DM5A 1ZU4A 3QPUA 4B3CA 4HDOB 1A82A 1C4OA 2O0KA 2ZAOA 4TYYA 4XOIA 3CH4B 4NBSA 1EFRA 1PLKA 1T0HB 2BEKA 2VO1A 5LDDC 4QBHA 1GL6A 2R6DA 3KJIA 3AEZA 3GJXC 4JLBA 4OI1A 2OV2A 2GILA 4KYIB 1KMHA 3M6AA 1DAKA 4KO8A 5IDVA 1RYHA 3REFA 1NMXA 4HZUA 4RJLA 4BLQA 2O8EB 1WB9A 3L2OB 2C04A 1E9DA 2RGBA 1CR4A 3BB1A 2IXEA 1U9IA 1CLUA 3J81k 2LCFA 2WWXA 3IHWA 4AIIA 1SKQA 5LBIA 2ZRLA 5G3YA 2QN6A 2NQ2C 1SXJD 3CRVA 2CMKA 3B2EA 4CF7A 4QM6A 1PZNA 1G18A 5FPTA 6Q21A 2VP5A 3IBGA 4V0OA 4X8LA 4R9UC 3AUXA 5LB2A 4EPVA 1AGPA 2AFIE 3IPYA 1JQJC 1II8B 4K46A 1I4TD 3FKSA 5TB5A 4JS0A 4Q9LA 4AYTA 1E2IA 4F38A 1CKEA 4Q01A 4XIGS 2OBLA 1KI7A 3QY0A 4LC1A 4RD3A 3UMSA 4GMXA 3BOSA 3G0HA 3P32A 1BYIA 2ODBA 2QGNA 1HT2E 1M2OB 4QRHA 5G41A 1TX4B 1RRGA 3WP1B 1ELOA 4A0HA 3THXA 3WNBA 4WVFA 1V43A 2QM7A 2RGNA 4V02A 2RB4A 4UXJA 2O8DA 4QGFA 5L3QB 1XF9A 1GITA 3T1VA 1IONA 3NDBB 1E0AA 5L3SA 1DAMA 4Q7LA 1W4AA 3DO6A 2ORVA 3U3OA 3UK6A 1NLYA 1P62B 1W0KD 2CL6X 4NPHA 3U3RA 3F3YA 5DYGA 5K8LA 4ZIRB 4XTCS 2C9YA 4QG7A 1NIJA 2B21A 4M1OA 4O2RA 5HCNA 2AWNA 4LX0A 2D2EA 4PHTA 4URVR 5BYKA 3RABA 1ZUIA 4M53A 4V03A 1HE1C 3PUWA 3PG5A 4PC1A 2WJIA 3EIEA 4Q03A 3P26A 4B3FX 3AGPA 3REGA 1AKYA 2ZR0A 4BASA 5BN5A 3SZRA 3NBYC 3PITA 3F8TA 1M8PA 2R2AA 4PPGA 1CIPA 4OI4A 2FH5B 4PPNA 2KBEA 2GEUA 2WSSD 1TAGA 2FSFA 3CUEF 1M74A 1W4BA 2MMCA 4JLVA 2ERXA 5FL7D 3V00A 2VP0A 5FBVB 1Z07A 2AXNA 2Z43A 1XCGB 2EVWX 2JJ1D 1IN5A 3O47A 2FEOA 4M9QA 5TMPA 1WQ1R 1GRQA 2VP4A 1IM2A 2F3TA 3IQWA 1TU4A 3DZ8A 3ND8A 4PO1A 4CEHB 3NC0C 2JAQA 2IS2A 1VKJA 1FUKA 3QKSA 4TMVA 4Q7JB 1JAIA 2OZEA 1D8TA 4M4SA 3K0SA 4JLDA 1OFHA 2ZJYA 4TL7A 5KTYA 2FA9A 4EKDA 3F0TA 2IUSA 3TR5A 1Z0KA 2CDNA 1AQUA 2AN9A 2PX3A 4LHZA 2J0UB 5JI2E 4PPQA 2NPFA 4F4CA 3MCAA 3T5DA 1QVRA 2E87A 4MRSA 4E22A 3R20A 2FFBA 3FHCB 3LX8A 1GRNA 1W49A 1AQYA 1VCOA 5KSPA 2IYXA 2QU8A 2REXB 3AP3A 3DL0A 4PSAA 1SVOA 2C5LA 4B2PA 5KOYA 5DSZA 1G9XA 4B3XA 2HT6A 2JLQA 4P4TA 1ODFA 1X8JA 1E1QA 3GFTA 5EE9A 1OJLA 1ZP6A 3WNCA 2ZVQX 3QKUA 1QHXA 4IKEA 3AVUA 2CK3D 2VA8A 1LFDB 4JIMA 3HP1A 3B1XA 4JYBA 2BBOA 3A1UA 4BZXA 1DARA 1II9A 1NY5A 4JVMA 4FXPA 4QBIA 1GSIA 2G88A 2RGXA 2PEZA 2ZI6A 3X1DA 1KI4A 4A0RA 2B8TA 4MYUA 3R7WB 4OQMA 3ZGXA 3A1WA 4Q1DA 3AVYA 4LGMA 3NVAA 4TTQA 1G20E 2EYUA 2ODEA 2VSOA 3VFDA 4DRZA 1QHIA 1VCMA 3DMNA 1KY2A 3KFVA 5EUQB 1I4DD 1DG1G 1TF5A 1N6OA 1ZIOA 2Z4RA 3CKLA 4W5WA 4LV5B 2J5XA 1P2SA 3CX7A 3QNUA 4A1FA 1EXMA 2RH5A 4HUQA 4EAQA 2ZETA 2D2FA 2MSDB 2V55B 3RWMB 3ZZ0A 1KO8A 2NZJA 1JB1A 2GBLC 1J8YF 3ZD6A 1PJRA 2Q9CA 2ZJ2A 5JBQA 4HEJA 4M1SA 3GLIB 3R9WA 2V4ZA 3K70C 4Q48A 2BDTA 1TL7C 1XMSA 3OEHD 4B34A 4W9MC 4DUGA 1J2JA 2HEIA 1G8GA 2BWJA 2JASA 3IQXA 3MWKA 2C2HA 1OH6A 5FTKA 3H4MA 2PEYA 5G3ZA 3W6NA 4N0EA 2YOGA 5F2EA 1OYWA 2G0NA 1HT1E 1SKYE 1KO7A 2FPKA 3GLFE 1U81A 1NLFA 4HDQB 1VDZA 5FOXA 5TVKA 1VIAA 3SJBA 4GOKA 3ADDA 2NIPA 2GEDA 2VF8A 3WNDA 3MD0A 2O0JA 3QKTA 4C2TA 2PBRA 4PC2A 2HV8A 5DNYB 3ZLJA 4Q9KA 1FNNA 2VP6A 3VKHA 4NZYA 1KMQA 4PHHA 4UXIA 4QGGA 4PZLA 5FUVA 2JLZA 1DAEA 1Z0IA 2FPMA 4ESHA 1OIWA 1AIPA 2C8VA 3QEOA 4CZ2A 1TU3A 4XD7D 2NO7A 2W58A 1C1YA 5CIQA 4UJ3A 1H8HD 3NG1A 1X8KA 2HLDD 3TSZA 3H1TA 3PCRB 4Y0AA 1IHUA 2OESA 3VNUA 1IN6A 1SXJC 3BS4A 1TUIA 3TK1A 2RGAA 2D74A 1XPOA 3BB3A 4CYMA 4DLUA 1QG4A 1S2MA 1WMSA 2BMJA 2GJKA 1GIAA 3Q72A 4QHYA 4JVSB 1E2GA 3CWZA 4LZZA 2WAXA 4D4JA 3AF0A 3BXZA 2IS4A 1JALA 1W36B 1AS2A 3N2IA 3MUFA 3WBKA 2GHIA 4RD1A 1EFHA 1WF3A 4NCKA 3Q7PA 4G5RA 2X2FA 2W00A 1GOTA 4HZUB 3RS0A 3EG5A 4PXAA 3DKVA 2XTNA 2OXCA 2WIBA 1Z63A 2QT0A 4D25A 2FGJA 1CEEA 1Q20A 5KNBA 5BWMA 4D4MA 3GLGB 1L8QA 1E69A 4IDHA 5BYJA 3U3JA 3VNVA 4DLZA 1Q57A 2XJ4A 2ZRIA 5E7MA 4DCVA 1XTJA 4MDFA 4TL6A 2XZLA 5J4VA 3KL4A 1R5BA 5K8TA 3CO5A 5AJYA 4IDNA 1TF2A 2YINC 3L43A 2I4IA 2QPAA 5KNDA 5G53C 1Q0UA 2QTFA 2ZITA 3QUSA 2IHBA 3DVLA 3TW4A 3L8YA 3RRMA 3KKQA 4RY2A 4TMWA 1XTIA 4IEEA 2CE7A 4IFEA 3NEJA 4YQFA 2JCSA 1A2BA 4BFYA 3AF1A 3I72A 2EFHB 2J1LA 5AJXA 4V0MA 2KBFA 2QAGC 2Z83A 3EW9A 2QRZA 3AKDA 1AZTA 4JZKA 2OCYC 5L3SB 2GXUA 1AM4D 1NVWQ 4URWR 3A58B 4EPTA 2UZ3A 4DHEA 3GCGA 4V0NA 4TLAA 2QGZA 2WVJA 5BXQC 2SHKA 1CU1A 2EW1A 2GVDC 2VHUA 4IVPA 4B74A 1ONBA 1OB5A 3UMFA 4HB4A 4PQFA 1DVRA 3VTKA 2ZSDA 1E99A 4IXMA 1U0JA 4M21A 4DEYA 2HXSA 3W9YA 5KSOA 5IRCD 5FUYA 3IILA 2WOJA 3TW8B 1N5IA 1UKYA 1OW3B 1J7KA 3HR8A 4B73A 4TLDA 4HSEA 2GAOA 221PA 3N5CA 1E1RD 4R2IA 1T3SA 1KHTA 3O8DA 3S1AB 3AP2A 3OEED 1S96A 4MKFA 1E9FA 1AS0A 1TPZA 2I3BA 3WHKA 4OBEA 1R0ZA 5IK2A 3SJZA 4Y0VA 2ECKA 3ZVRA 4DT1A 1FP6A 2AKAB 3FWYA 2H17A 4D0NA 4Q9IA 2KE5A 5HKKA 4DLSA 2IF0A 4B47A 4U7DA 5H8WA 5F9FA 1GDDA 4MKIA 2IEZA 5KYKA 2HF9A 4RCZA 3N2EA 3ADCA 4FIDA 2QPOA 4TMTA 2ZI7A 2DFTA 2P6NA 2BMDA 3BIFA 4GFDA 3ZQJA 1KI6A 3EIQA 2ORWA 3SC3A 2J0SA 3ZH9B 3EZ7A 1H8EA 2ZS9A 1UPTA 3ZVLA 2A5YB 1RRPA 1W0JD 4RD6A 3WBJA 1RFLA 1US8B 1G3QA 3I92A 4IHQA 5JWRA 2CJWA 3B1WA 5LD2B 1IN8A 1YZKA 2QY9A 4M0LA 4GI7A 5JWHA 4AC9A 1HEIA 5P21A 1UEJA 2GF9A 2H92A 2IL1A 1F3OA 4AYXA 3NBZC 4XWKA 1NKTA 2ZR7A 2XTZA 1EESA 5DI9A 2OLJA 3K0FA 1MRNA 4HAVA 5JJKA 4DIDA 2WJVA 1KK3A 5SZJA 4DLWA 5KUTA 3I1FA 2XNDD 4OQFA 4G3XA 2WHXA 2ZR9A 1COWA 5DH9A 1NKSA 2ZSAA 4HAWA 1AS3A 1XNJA 4KAXA 2A5JA 4JLNA 1KSJA 2G6BA 2DBYA 1OXTA 3PUXA 2QENA 3EZ6A 3VHLB 5JCZA 2EWWA 3OE7A 2WAYA 1BMFA 1NJFA 2BOVA 3U7HB 4S2EA 4IOMA 2RMKA 4EIWA 4B3GA 1NN1A 2A3RA 1UKEA 1VIYA 5AJWA 3GLIE 2EU8A 2D62A 4DLYA 3V4RA 2NPIA 3D7MA 2VBCA 1L7VC 4EFLA 1L2TA 2QP3A 2XXAA 2YYZA 1UDXA 3U6KA 2ZM5A 5DIFA 4DSOA 4WIAA 2CNWD 4HYYA 3C16C 4TL9A 2H8KA 1XD2B 1YHNA 4Q4AA 3T12A 1E79A 1XPRA 2DFLA 1UBGA 2OFWA 1P9RA 3HWSA 4Q4HB 2GCPA 2BBWA 4WOPA 4C30A 4LJ6A 1OXSC 4DLRA 4TT3D 4A0GA 1T5LA 1QG2A 1FMLA 2XAUA 3KZ1E 1RE0A 2D7CA 3UG7A 5JCPA 4AKEA 4ZDJA 4OJKA 3ZQ6A 3QENA 2IWRA 3B1ZA 3RS4A 1JEEA 3B78A 1AGRA 4DCTA 2VP9A 4MYHA 3U3MA 2X2EA 2C99A 4WW0A 5EE5B 2CE2X 3CRQA 4QHSA 2V6IA 2QROA 2REBA 4I1VA 4G5GA 5C4GB 3LXXA 3R9XA 4R98A 2ZRFA 3K9NA 1Z3IX 4ZKEA 2J41A 4MRVA 4MRPA 4FN5A 1IXSB 2IA5A 2VH5R 4BFSA 3CNLA 2Q3HA 1QHNA 2JJ2D 3L8ZA 4YC7A 1WBBA 1N5LA 2Q6TA 1SULA 3K0CC 4GOXA 1M6NA 2DB3A 1CR1A 4AG6A 2VHTA 1A1VA 3CM0A 4TLCA 1VG9B 1R0XA 5FBWB 1VYVA 2WJYA 1KK0A 3RS3A 3U7FB 2CHGA 4IEIA 1NN5A 1P2VA 4GL2A 3DPUA 3IIMA 2VTKA 3VR1A 2N1BA 1EFUA 3GEHA 3MLEA 3AP1A 3BB4A 4KVGA 4G5OA 1E9RA 1RJ9B 5CLQA 1ZYUA 5F9HA 2JIZA 4IFBA 4CIDA 4NCNA 4QBFA 3LAWA 2QZ4A 4NYJQ 1RZ3A 4PHGA 4NDZA 1XU4A 4PAQA 3VU9A 3ZIAA 1QHSA 4ESVA 3BGWA 3QVUA 1HURA 2FZ4A 2PLRA 2JLYA 3ZS8A 5CDFA 1UBCA 1G5TA 2XX3A 4LJ9A 4JLMA 4UXHA 5FI1B 4RFSB 5GVSA 4RZUA 1X1RA 2YOFA 1W36D 3CZPA 1BKDR 3B1VA 4GRAA 2DWOA 1BH2A 3BH7A 4QNRA 4YMVA 4RZ3A 4EFMA 2RHDA 3D3QA 5KNCA 1OB2A 1IJFA 1SVLA 4LDJA 2RAPA 3AKCA 1R10A 3Q85A 1L4YA 2QI9C 4KLNA 2C95A 3E5HA 4P4SB 1CTQA 3GJ7A 3SEAA 2A7QA 1N6IA 2AWOA 2OM2A 1XTSA 5EXTA 4UNPA 5DN6A 1LVGA 5AWFC 4QOSA 1M34E 2V54A 3W5IA 1T8TA 4LUCA 4PPFA 1EK0A 2WJHA 4EFNA 5AK0A 5FR2A 3I4LA 1KAGA 1OFIA 1T4GA 5IF9A 4YMSA 2QMOA 1UKZA 2WWWA 4MITA 2JA1A 1P61B 2A2ZA 2QPTA 2DYKA 5KDLA 1LB1B 4DIEA 1FP7A 3FKSD 1W2HA 5EE3A 4CVNA 1N6HA 4TYQA 2IYTA 1E2HA 4TQUS 5B64A 1D5CA 1Z5ZA 4MH0R 2NMVA 1UBFA 4OKSA 2FSHA 2ZAMA 4Q5IA 3PUYA 1IOZA 4JSTA 4U5XA 3I73A 1J70A 3THYB 1G3IA 1MOZA 2WWGA 4LPKA 2QRNA 5FTNA 4AY2A 2WPDA 2BVNA 4HLQB 1OFTA 1Z8FA 1YE8A 1OLOA 2PZFA 3LW7A 5D3MA 1R6BX 1GL7A 2A5DA 2R65A 1CJVC 4PQRA 3RNLA 4BUJA 1GFIA 5JS7A 4FINA 4UNNA 1SKYB 1RPZA 1N0WA 4JL6A 3QF7A 3QG5A 3GLFB 3O8CA 1G64A 4PAOA 3GP8A 5AUQA 2X1VA 3HYRA 5JZVA 2BKEA 1JJ7A 1K6MA 821PA 2RGDA 3BFKA 1XRJA 4MRRA 4Q18A 1RRFA 4L9SA 4A9AA 2TMKA 1DBSA 2JLSA 2YNMA 4NYJR 4YMTA 1WBDA 4JJZA 5D3QA 1OPXA 1N0VC 3VR3A 1FZQA 3D8BA 4BWYA 4A82A 2AXPA 2BCGY 2Z0MA 2AD5A 2VHCA 5KSZA 4DCSA 1XX6A 1P2UA 2F3RA 1XZQA 5EQTA 4W5HA 3EZFA 4QHTA 2F1RA 4DT1B 2G83A 1OKKA 2D06A 1II0A 1LS6A 2XEXA 4W5JA 4URXR 2QT1A 2VF7A 2QTVB 4G1UC 4ARZB 2FOLA 2IYWA 4I1OA 2OBMA 2PMDA 2QP4A 2QNRA 4HAUA 1Y3AA 5TARA 1NMYA 3I61A 1KI6B 1KOFA 1S3SA 1G6HA 4BFWA 1E2NA 1YVDA 2GK7A 3BRWD 4QJ3A 3KQLA 4RCYA 3SOPA 2VHJA 5DE3A 2FF7A 3ECCA 2O8FA 1DO0A 2QMEA 2NO0A 2UZIR 2W6IA 3SYLA 3KQUA 1P2TA 4PFSA 2Q3MA 2G1JA 4KODA 4E5UA 2KWIA 2CJWB 2W0MA 1JR3A 1YZUA 4LYAA 4WXRA 3TE6A 5E95A 3TUIC 4EJSB 1NVUQ 1NRJB 2IK8A 1W44A 1RW4A 4MKHA 3SJCA 4B48A 1E4VA 1FNMA 4DC9A 4DDTA 4MYCA 1CBUA 1GAJA 1W2GA 4CEIA 3AV0B 3VMFA 5FTJA 5FUXA 4BFTA 2GBLA 1XBTA 4E03A 2O8BA 1PUIA 2WKPA 1HQCA 5TXGA 3F5FA 2JLXA 5J4HA 4CRWB 2ZYUX 4OQLA 2FV8A 4BLPA 4US2R 1IBRA 3B60A 1KDRA 2OCPA 3C4JA 1KO1A 2BM0A 2XITA 4BQSA 3CBQA 1TUEA 4W7SA 1NI3A 1R5NA 2GXAA 3MWYW 3Q5EA 2IHYA 3SE0A 5EJEA 4A2QA 2FG5A 2OBNA 3GLHB 1E1QD 3X1XA 4IVQA 4FCTA 1SVIA 2BM1A 1OE0A 3KXLA 3QBVA 4BRWA 2O8CB 3P1JA 2F6RA 3WMGA 5FBRB 1M7HA 1NBME 2ZUBA 1FPMA 5GJVC 1JR6A 2DPXA 2OFXA 2XXAB 1J90A 2V7QD 4TLBA 5L8VA 1IN7A 1QHGA 3X2SA 1ZAKA 2ZJOA 4N1AA 1FQJA 3TNFA 2F55A 1OXXK 4QNMA 2B8WA 4C0KA 1E32A 4LJ5A 3AUYA 2YJTD 4Q1AA 4RKFA 3UG6A 5BQ5A 3FVQA 1E96A 3FDIA 4UNRA 1DS6A 4Z51A 3A4LA 3AF3A 1IAQA 2JGNA 1G7RA 1NVVQ 2DR3A 4MRNA 4YLGA 4Q02A 1NBMD 2V6JA 4HLUA 3NDPA 3LWNA 1G3MA 4M1MA 2GCNA 1LY1A 3IGFA 5FPYA 2ZJZA 4JBWA 2ORIA 1Z6TA 1UAAA 5LB4A 1Q1BA 2WM9B 2NO1A 4YONB 3OAAD 3WYGA 2IT1A 2JJ8A 1Z0JA 2NOAA 1FQKA 3BAFA 3GEIA 4GMDA 5J4YA 1W36C 3U44A 4C4PA 1X1SA 3MFYA 1HQYE 1G4AE 1UBEA 2VYFA 3QBTA 1G8FA 4KITB 4FWIB 1I4LD 2ZRHA 3CF2A 3GEEA 4KJZA 1R5OA 3RC3A 4LYHA 4KSCA 1OYYA 3VQTA 5JHHB 4YMUA 4US0R 1R0WA 2FZLA 4X8MA 4OHZA 5DI3B 3WMFA 4B6FA 5FTLA 3NHBA 4RD0A 5CLLA 5JRJA 1W0KA 2FNAA 3U61B 5KSYA 3ASYA 4FWTA 3OESA 3EPKA 3KXIA 2ONKA 2VL7A 3ASZA 2V8OA 3DZDA 3H84A 4K81B 1NG9A 2B7CA 3QXJA 4B3DA 2QBYA 1T0JB 3CPHA 4Z54A 3OIYA 2HYDA 1MABB 1OV4A 1OIVA 3M0EA 2BIFA 4A8JA 4AYWA 1TTTA 2BV3A 3BD9A 4R2HA 2KJQA 2QL6A 4IOJA 4DEXA 3KB1A 3KTAB 3EWAA 3U4QB 3CF6R 3K1JA 4D82A 5JJIA 2ZRAA 3QKRA 3VR5A 2A5GA 4ACBA 1G1MA 1HY3A 2WTUA 2RGCA 4CGZA 4NKRA 4HAXA 2F9LA 5FBQB 2HCJB 2GJ9A 4ASUD 4CW7A 3H86A 2LKCA 4M2LA 1N6NA 5JSZB 4Q1CA 4TMKA 4XTRA 3C5HA 4MGZR 1ESNA 1E2KA 1NJGA 3SI7A 1YJ5A 3EIHA 2Q21A 4D81A 1RKBA 2ZXUA 4GT1A 3VX4A 4V0ME 2FFQA 4LBZA 4XSHA 3TUZC 3CX6A 2C77A 1JECA 4IDOA 5AJZA 5B58C 2PJRA 4LBVA 1DEKA 1G5RA 1KI1A 2EQBA 4TYWA 3UMRA 2OCAA 3CR8A 1VHTA 3AF2A 1TNDA 2WMOB 4F92B 5CM9C 1WP9A 4D2IA 3SFZA 4C2UA 5DHFA 4A6PA 1KYIA 1R8SA 4CEJA 4PAMA 3LH5A 3ZVMA 1E4YA 4C7OA 1ETUA 4DLXA 1BYUA 3IHLA 4BRUA 1QF9A 2P2LA 5FPHA 2PCLA 4DDWA 1N6LA 4F91B 3IIKA 4N3NA 3NC1C 4E07A 5JEDA 1G7CA 1U0HC 1NY6A 2HDNB 1NF3A 1CR2A 4TYNA 2MMGA 1KY3A 2CHVA 3LRPA 3VKWA 3NBFA 1G4UR 4PZZA 3RWOA 3Q9LA 5CB8A 4BPBA 1JJVA 1G8YA 4Z1MA 3LFUA 3HYTA 1GKYA 2O52A 4TYPA 4C0HA 3ND9A 2GJAA 5KPJA 1Q22A 3FKQA 2KB0A 4UNSA 4ZDWA 4LV6A 4URYR 2YZ2A 2ZUCA 3FHOA 1KMHB 2AKYA 4JKYA 2W0SA 2V3CC 1XEWX 4LYJA 2Y8EA 3WRYC 2QSZA 3KKOA 3QE0A 5LD2C 3D6TB 4HDCA 4X8OA 4LYFA 4DB2A 3L0SA 4IRUB 1LS1A 4LJ8A 5IK2D 2GKSA 4G01B 3U5ZB 1W4CA 3LV8A 3LLUA 3MAAC 1R0YA 1KIMA 3RC8A 3HJNA 5HPYB 2VQSA 1MH1A 4JKIA 5EXSA 2P65A 3OZXA 2JDID 5CB6A 1DG3A 2ZROA 2HT1A 1KZ7B 2DWPA 1KI2A 2AD1A 2BCJQ 3IKJA 4HAYA 1LV7A 1FOEB 3PVSA 3GJ6A 1HYQA 1UJ2A 2OSBA 2PCJA 1H8ED 3GLHE 4G0NA 1EWQA 3WYFA 3AB3A 2IYSA 3RS7A 2BMEA 1EWRA 1XJ0A 1IXRC 1NNEA 1EX6A 3THXB 4GBMA 2QQEA 2GAAA 2GZDA 5A4JA 1AA9A 3ICQB 5CIWA 4AURA 1G3UA 2O8DB 1W7AA 4P4UA 4Z8YA 3EA5A 4CEIB 1M7GA 4KBFA 1YR8A 8OHMA 2ZE6A 2W2TA 3B7GA 3L82B 1ZMXA 3GFPA 4YDSA 2YHSA 2OAQ1 5EUMA 4EPWA 5AUPB 4O3MA 2OCBA 1F2TA 2CEAA 3EASA 5EP2A 5IHPA 4MUBA 4JMPA 1U8ZA 1FW6A 2VLIA 1KO5A 2XSZD 1P9WA 2R6FA 2W83A 3PEUA 1QVAA 1VHLA 4Q4LA 4XD7A 5E7IA 3TQCA 1GKUB 5HR5A 1YR7A 2L0XA 1ZC3A 4KHZA 3TH5A 2PX0A 4JBYA 1KI3A 3B82A 1T5IA 1G5PA 1XJCA 4TSFD 2YWGA 5J4LA 1BMFD 1U98A 3AVXA 3TBKA 2IXFA 3P4YA 1LTQA 1JXMA 2MSCB 1R7RA 3RLFA 3K0AA 2NZ8A 1U8YA 1VYTA 2CXXA 4KVAA 1CJMA 3K0CA 1ZIPA 1XTQA 1OT3A 3CLVA 3CIOA 5JRZA 1E9BA 4TQAA 1GL9B 2GVZC 4MUAA 1D9ZA 2FMXA 5A0FA 3HU1A 3PFIA 4TN1A 1XFAA 1E0KA 1Q12A 1SHZA 5HZKA 1MKYA 3HU3A 2HUPA 1MT0A 3A37A 4NCJA 4B6EA 4Q4JA 4D0LB 2FPLA 1NVXQ 4ZI3A 2QEQA 3OIUA 3GJ4A 1X6VA 3KB2A 1W47A 2O8EA 5KHOC 4WBSA 3TSWA 2NGRA 3UIEA 3QKSB 2F1IA 2X19A 1XEWY 4ZV4A 5EE1A 2D7DA 3W8NA 1E2PA 1XMVA 4L16A 2ZI3A 3NKVA 1E2MA 1BS1A 1Z6GA 4A36A 3GJ8A 2GF0A 1HE8B 3QXHA 3AVWA 5FPSA 1IXZA 3CW2A 3E70C 621PA 1II8A 4NYMQ 4PC7A 1OH5A 1ZW6A 3W90A 1K8RA 4NONA 3Q5DA 3MRSA 4BZPA 2CLCX 3A36A 3KJEA 4L5BA 4URZR 5HE9A 1OXUA 3OFNA 1UADA 1VG1A 2IWHA 1XEXA 2XOKA 2GWHA 3U44B 1VYUA 2ZSFA 3FFBA 4B43A 2DY1A 3X1YA 3BBPA 3GMTA 2W6JD 3LXRA 4TZ0A 3DM9B 1NN0A 4LHWA 4G5QA 2KSQA 1KI9A 4ABYA 2OFOA 4AG5A 4NU0A 5L3QA 3G82C 2AHOA 5FOVA 2ONJA 4LV8B 2J9RA 1QDEA 2J7KA 2IUTA 1DAGA 4MQBA 1GNPA 3I3SR 3KJGA 3EA0A 1D2NA 2BBTA 2BHRA 2FJUA 3CNOA 3HPQA 4V0KA 2ZIAA 4MGIR 2WWIA 2J7PA 5DYIA 2BMFA 2ANCA 3BJIC 4M9XA 2LKDA 521PA 3RSLA 2O0HA 4MKGA 3T34A 4BEJA 5KU1A 2JLVA 3NH6A 3QPVA 4A8JB 1YZQA 2WKRA 2J59A 1MRSA 2OE2A 4HUQB 2XZOA 1KDOA 1IY2A 4XVQA 1ZCAA 2PH1A 4RKEA 2UKDA 3QG1A 5AUNB 2J0VA 121PA 4A2WA 1CR0A 1ZUHA 2DFNA 4Q1FA 3QKRB 1GVNB 1KJZA 1ZCBA 2Q0HA 1O87A 2VRWA 4KFUA 1KJYA 4HZIA 1KKMA 1M7BA 4P31A 3KQNA 1AJEA 2P0EA 4GDFA 1AK2A 1YQTA 4LJ4A 5EZ6B 4AK9A 4TWZA 3QPWA 1Z28A 4S35A 2BC9A 2K5UA 1TQ6A 2O5VA 1KK2A 3AM1A 1FMJA 2YC4C 5SZKB 2AL7A 4M8NE 4AD8A 2J0QA 1N3BA 3T15A 2AR7A 4WXPA 1P5ZB 1O3YA 1WE2A 2J3EA 5GVRA 1N5JA 2Z4SA 4TZ6A 2R62A 4CEHA 1X86B 1OHHD 2ZRCA 3PENA 4WZAE 4WA7A 4B2IA 2ZRJA 3U3KA 3MJRA 4QL3A 1W0JA 4QJ4A 5C4MA 2QUZA 3FE2A 2GA8A 1MO6A 2OG2A 2OLKA 2A30A 5EP1A 3RANA 1GNRA 3B1YA 2QE7A 4FD2A 5E7JA 3ADBA 4FMCB 1GG2A 2GJ8A 4LJYA 1Q1QA 3T61A 4PO9A 1JEDA 4RD2A 4U02A 2P5SA 3NXSA 1G21E 1VECA 2J0UA 3BWDD 4ZI2A 1GWNA 3OHMA 2RGEA 1VMAA 2D4HA 3CONA 4NYMR 4F4JA 2WKQA 1VCIA 4JVNA 4IDQA 4NCHA 4XSGA 1J8MF 4H1UA 1LNZA 3RRZA 1G7TA 1NN3A 3PEYA 3U60B 4KI0A 2XB4A 4IXNA 4TTRA 3W3AA 3KQKA 5JJLA 5GJWC 4IJMA 4ZPXA 1DAIA 1SGWA 4JSYA 3OF5A 2CLDX 3T5GA 3MSXA 2CL0X 4I99A 4IVRA 3JVUA 1U2RA 4E09A 4LCBA 1NP6A
chains in the Genus database with same CATH superfamily
2OUIA 5LMNB 3H2JA 1M0SA 2AOUA 2HWYA 1N0UA 3IPXA 3VVMA 3WK7A 1X80B 5AESA 1Q50A 4OLJA 2F1JA 3PXUA 3KXPA 1WDWB 4ZO8A 2P67A 3LUAA 1MEOA 5GWXA 2B94A 3TOXA 4W5QA 1PZFA 2I1WA 2OORC 3QVVA 3V8PA 1RVV1 3G23A 1W581 2NVUA 4S3MA 4EG4A 4M9ZA 4ZMBA 1WB4A 5F77A 2GETA 1MA0A 2XTMA 2HGZA 2W6CX 3UNXA 4BO7A 1E9VA 1H42A 2MU1A 4KV7A 4XLLA 4R2MA 4HEA6 2B5WA 5EGNA 4EI2A 5BQXA 1M83A 4D74A 1E60A 1M2VA 2PGOA 3U81A 4KLZA 4IW3B 5EP3A 3O8RA 3C6MA 4EDHA 4ER5A 1EIWA 2NZVG 2ZRNA 2ZIEA 2CXPA 1JT9A 2PA3A 3QX7A 4BTVA 1RABA 2HXGA 4X1YA 1KY4A 4PANA 4HUTA 2ZVJA 1KOLA 1Z7YA 3PZBA 3DLTA 2JH8A 3L05A 2W2PA 3L7BA 4LJ7A 4TKLA 4XDGA 5CK5A 5CT6A 5IZCA 2L2QA 3RVNA 2LZ0A 5K3CA 1T6ZA 4E32A 5AVSA 5JHGB 3U2QA 3GLIA 1IHYA 1C0IA 2X86A 3T7CA 4GZ5A 4XIJA 5EQJB 4D46A 3BGOS 4EBBA 1A9ZA 4KSBA 2IS1A 5FF9A 2J08A 4XFJA 2O4UX 3K5HA 4ARUA 4N7BA 5EHIA 1TEHA 4AAYA 1A71A 3JQAB 4FCVA 3UWDA 3UWKA 5HOQA 1QRTA 3ADPA 1RVDA 4LJRA 3LY8A 2MSEB 4FJ1A 4YAEA 2R3SA 1BJRE 3EARA 1IBKB 5E1DA 1SUIA 2QX7A 4U6QA 2FQXA 4MKXA 3V4FA 1ZH4A 2RK6A 2ZSBA 5KMGB 1EAMA 1A5ZA 4N0QA 1I6KA 1ADJA 2Y6UA 4Y3UA 5FTMA 4EPYA 4L4UA 1LZKA 4L72A 1GDHA 1WY7A 1ZVQA 4X94A 4YP7A 5A4DA 5KKCA 1NUPA 1CZLA 2E1RA 3G0OA 1RQ2A 3NWBA 4IO0A 1X1TA 4LQ4A 1VE5A 5EXXA 2HW8A 3K96A 3L79A 3T5PA 1X1BA 1YIOA 2JK1A 1R8QA 4QPZA 2CLHB 3GXOA 1GKIA 4TMXA 4UHKA 2WK1A 1QZXA 1LTHR 1TADA 3U7QA 3BE4A 3DVAA 5ETJA 1QF6A 3KT8A 1RHRA 5BSVA 1IPEA 3O4JA 4W8OA 3HY4A 1KFBB 3RAGA 4EW6A 5BWBA 3UKDA 2X0RA 3NWJA 3PGLA 3H0KA 5C81A 4QEKA 2YN0A 3L4JA 2DCUA 3MG9A 3KR1A 3ZOKA 4RTQA 1MO5A 2IBMA 4H6VA 1HETA 4HZGA 4XYGA 2BEUA 2O3QA 2OAEA 4BAUA 1NC3A 1VJGA 5DGDA 2UVPA 4DRXB 1JN0A 2Q3DA 1QV7A 1Z4MA 3P2KA 3Q4GA 1JDUA 2VJBA 4NCBA 5LOVB 1EVJA 1PNOA 2YZ7A 2P4HX 4P9NA 3IP6A 3QF4A 3MCUA 2AI3A 4FKZA 4MV1A 4NS1A 1L7OA 4QQFA 4RZXA 4TL8A 5EP4A 4C0WA 2IH4A 4P4GA 4BKOA 1IB0A 4QSMA 3UPDA 5ALPA 4YDHB 1TEVA 3BZUA 5SZHB 4RZIA 3TLXA 3T1TA 4Q9DA 1J00A 4K26A 1N5OX 3ITNA 7ABPA 5FQOA 2G6TA 4M7RA 3DXZA 5KYNA 1LRKA 1HT3A 1L5WA 4FGUA 2QMZA 1U1FA 3QXCA 4XM2A 1OU4A 1V3VA 2ZSUA 5DTIA 5EVJA 3ZU3A 2GN1A 4XOUA 4MULA 1GRCA 2P2YA 3SQLA 4A7PA 4DIUA 1UJMA 4YUWA 3CRMA 2Z30A 1FYXA 4GWGA 5EZSA 3TTTA 3TVTA 3O9MA 1JKMA 4J4HA 3EEIA 2QN3A 2OR3A 2WFAA 1HX7A 5HA5A 1XTRA 3UJDA 1SOVA 2I6QA 2ERCA 1KWGA 1OX5A 4Q19A 1SOAA 4J1QA 3G2NA 4FNOA 3V4ZA 5JYDA 1WLYA 3ZHVA 4BIMA 3C5CA 2GSWA 4CMEA 4R31A 2IC5A 4FPXA 1TKBA 3ESXA 3RRXA 1MO4A 4FHDA 1SHKA 2EZ9A 3VOTA 2IY8A 4XVCA 4ZYTA 3TZHA 1ZJ6A 2AEEA 2YJZA 5C1BA 1U0RA 1XEXB 2GKOA 4IDGA 3V3TA 2UUBB 4DKXA 3AY7A 1V37A 3FSJX 2MR5A 3ZTYA 4N47A 2GA9A 4XX0A 4NNJA 1GKLA 3HKDB 4YIHA 3MWFA 2QTHA 3RHZA 3OQMA 1TCCA 1QIDA 1TLLA 1O0SA 2H7CA 1WZNA 1Z12A 2VWGA 3EFOB 4DBVO 3CPSA 1DAPA 1T0IA 1WCIA 2QTBA 3PRJA 3QVLA 3VX3A 4BGDA 2HIHA 3TECE 2X4GA 2G7ZA 4GLBA 4I0WB 1GU7A 4LI0A 2JFOA 4XD2A 5FOUA 5I9MA 4FEEA 4LI3X 3EIOA 1V16A 4HBGA 4DIOA 3AI3A 1DPFA 2I3ZA 3HN7A 3ET5A 2ZE8A 2HRZA 4FU0A 1GPYA 2JK0A 3CRW1 2YIJA 4I3HA 1A8QA 1ZK3A 1L0BA 2X42A 1U8AA 2XHZA 1EX7A 3BRCA 4AJEA 3W9SA 3PJGA 4J0QA 4H6WA 3G49A 1I1OA 3I04M 1CUFA 3AKYA 5DSTA 2I1LA 3D1VA 2EQ5A 2RHTA 2R6CA 4RANA 1NXWA 4I50F 1Y8RA 2R44A 2PO5A 3OY7A 2A9FA 3TSOA 5FFMA 1IXYA 4A2CA 1K27A 5NLLA 4IDDA 1HYHA 3B1JA 3ROTA 4ENQA 3C1AA 5FOWA 3UPUA 3IKLA 3HU2A 2O2DA 3DLBA 5ESXA 3M5WA 2BEVA 2QX9A 4JXZA 1LWOA 4NP6A 1RWOA 1VE9A 4BYGA 3NNNA 1L5HB 3DMTA 5KJ6A 1ORRA 2QTCA 1PNQA 4CFYA 1JAHA 1FNCA 4BX9A 2DTEA 4GKKB 1TU0A 4PQGA 4OHUA 1VM6A 2QF7A 4DR3B 1DWOA 3DFIA 4CMCA 3RYTC 1G8HA 2PBZA 3AC0A 1RXCA 3OFKA 3S8EA 3GFBA 3H83A 4WGFA 3L7YA 4M1EA 2WE8A 2OILA 2D1TA 4C08A 1CPYA 3EAQA 2PWYA 4MW2A 5HKOA 5EIOA 4NH0A 2GZ2A 1VI2A 3VR6A 1XZAA 2FPXA 2ZE7A 3QHPA 1YQWA 2F3QA 2JNWA 4WINA 2IQIA 5GINE 3AH8A 1CFJA 5TSDA 1XTBA 4KH0A 3T06B 4BMPB 1GJRA 1ESDA 3RS2A 3VC7A 4DLVA 2RGGA 4DQVA 3JQ7A 4FM9A 3R8FA 1KKUA 1YK1A 5FYQA 3LRXA 4P32A 2JGDA 4BZQA 2H4XA 1RRVA 3JAMA 1DIOB 1W48A 1YWGO 3RWBA 3GEDA 1L7RA 3M6WA 3AUKA 3VPXA 1ZD1A 1A69A 3VJKA 5BWOA 4JJ4A 3R7DA 2P4UA 1A3CA 1W8IA 4N82A 4BMYA 1GP2A 4CM8A 3NAMA 2Q1SA 4L4XA 4QELA 3DV0A 1Y9JA 3UTDA 1WQ4A 4GWLA 2ACWA 4FBMA 4PZCA 4GRDA 4D56A 2RBEA 1IBMB 1J20A 1RM0A 3N7UA 2FLKA 1SHUX 3JZMA 3SBEA 8ATCA 1YR1A 1PR6A 1R8XA 5CX1B 6GPBA 4CIYA 3G5TA 3E4DA 4R40A 1ZD8A 3T7DA 3ZBTA 4GLJA 3HA2A 1EDDA 1SHLA 2NTEA 5EXPA 2QSUA 4B0PA 1L5OA 2BBSA 4RELA 5JARA 2TRSB 4ZZ2A 3BX1A 2G77B 3VU9B 1GUDA 2P9HA 3TPZA 4CU5A 4KGDA 5HRAA 4LF4B 1C0EA 3ABZA 4B44A 2NSHA 3KUCA 3KUDA 5GZ6A 5I7UA 1LPNA 1QZZA 4MUNA 1U9CA 3F3MA 1EBBA 3RRNA 1Y3CE 2YR0A 4LXXA 4Q3EA 5IMBA 2QN9A 3C5VA 4F93B 4Y2JA 2JBAB 3IO3A 2WUFA 3LLSA 4GLOA 3AEXA 4UDXX 1TD1A 4P34A 3ZS9A 4Q1BA 2AN5A 4Z1MD 4I6JA 2ZYVX 5I5GA 3WWZA 1KEKA 4U7GA 1JPUA 1ST2A 2WE7A 1FLVA 3WC4A 3JZIA 1BEZA 4UHDA 4BU0A 4BP9A 4HNHA 2ZOSA 1YI1A 1U7TA 2CFIA 3AZPA 4UDYX 4I81A 4EY4A 2IYUA 1D1PA 3DO8A 3WTCA 3ZIUA 2CD9A 3BHNA 4CTJA 5C7LO 1RWQA 2NX2A 3BICA 4AZ0B 4QIHA 4EG8A 5F3WB 2JJ1A 2OGTA 3FBTA 1PG5A 4U8HA 4W1PA 3O3OB 3RROA 2C7RA 2XD4A 3D4OA 1TMKA 4KZPA 4LWOA 4BNGA 1U4OA 3D8TA 2FU5C 3UMGA 6ADHA 4U5QA 4FCWA 1F4PA 2I2FA 3DE5X 4FYWA 3T3OA 1P0PA 3RC7A 1L5MA 1GPJA 3ML1A 4RMJA 4CLOB 1VBMA 3LBHA 1QUFA 1UANA 2WIAA 4M3NA 4P0TA 4UVDA 1JQLB 1AKRA 1V2HE 2B0JA 2VZ0A 5EIAA 4EYEA 4GU5A 1NVVR 1CUBA 1V5IA 2O8VA 5FOTA 3WGTA 4E46A 5JIBA 3OX3A 1AN0A 2BUAA 3FWKA 1CEXA 4LTNA 2WFLB 1XMPA 4P80A 1PJTA 5JNVA 3QEBZ 3S2ZA 5G40A 5IF3A 3M2TA 1JDBB 5IT4A 2ZYAA 1SPBS 1YL7A 1N6PA 3LSYA 1FYVA 3CLKA 1C1HA 1Y4UA 4AJKA 3OIWA 1KBZA 3GLVA 4ER7A 4ZCRA 2IF2A 3FUXA 3QEJA 1QGZA 2JLRA 5D3MB 3FOWA 2H0QA 4EHKA 2XGJA 3N5KA 2CW5A 3WK6A 4OO3A 4JJIA 4XARA 3ESAA 4FDTA 2QR3A 4TTIA 1SXQA 2W93A 3BK7A 4FZ5A 3IKTA 1J22A 4R83A 3L6CA 1A4IA 1L5GB 4KREA 1GG8A 2AOTA 3IODA 1SBNE 4EQ6A 4UDNA 2ZWPA 3NH9A 4EY6A 3ROQA 5DHRA 4BJ6A 1UQTA 2FFAA 3WK4A 3SJAA 5CA0B 2PVCA 3W2HA 2PXCA 3KUKA 4YV2A 3U5TA 1YHYA 4IWNA 4RVOA 4CCYA 1JXOA 1C9KA 3SHQA 4OXKA 3JVVA 3MNFA 5TV2A 3DGEC 3VHXA 3HYNA 4OB7A 4JA2A 4RL6A 2XB2A 3KYCA 2X22A 3RQIA 2YBDA 1WCV1 4YGXB 4HY3A 1RWBA 2JA2A 4U9UA 1NDUA 1TEXA 3H3XA 4QPDA 5ALXA 5C37A 4M0PA 4MLCA 1S7CA 1T2UA 1RJFA 3JYPA 4O4IB 4PCAA 5I9BA 4E33A 4OQXA 3RQSA 2ZUSA 2VJMA 3LUCA 4GD3Q 3HVHA 5DGXA 3RBVA 3G2QA 4RPKA 3LO5A 2PS0A 4HLUC 1CDZA 1RYFA 5LXTF 2WJGA 1V8OA 1N1GA 3RUCA 3WGYA 3QLJA 1LW6E 4GZLA 2FPWA 4F4HA 3GD5A 3FKJA 4ENUA 5LN1A 2NSJA 2FB9A 4QFMA 1Y3IA 2G40A 2AC4A 4MV8A 4QULA 3JV7A 2C2YA 1YKSA 3VYTB 4K05A 2GZHA 2A9KA 3GC6A 3BH0A 1J9EA 3B3FA 1OH6A 3LT4A 2F9MA 2FJ0A 2HJGA 3WYNA 3T7IA 1YS9A 1V6CA 4FYMA 1VI6A 4PZ0A 1IUKA 1ZU5A 3NHWA 4FYXA 5DX1A 5AW4A 2RJNA 3E3OA 2WMNB 4TYMA 2JLYA 3W9UA 3ZZTA 4ER0A 4L5CA 3HO6A 4GNKA 5TT0A 3AFMA 4E14A 3OEWA 5GONF 3O5AA 4B79A 4KXQA 1YE5A 1NMQA 2XHEA 5H4GA 5KTTA 2O8FB 1FJHA 3DA8A 1EFDN 3MRVA 4D0RA 2C2MA 1O5IA 3PE3A 1RC8A 2B2NA 1XXHB 3SHFA 1FX0A 1R9GA 1G20A 3P27A 2BH2A 3AVOA 4C7JA 1DAFA 3CO0S 5K5EA 1Z06A 2QLFA 3GN1A 3PTZA 4G07A 3AVTA 4C7KA 5J5AA 4M87A 1ORHA 2B1IA 5HZHA 4BTLA 3LC1O 2QW1A 4TS3A 5C0OE 3OFJA 2GBCA 1JG3A 1TLTA 4WOBA 2OAP1 4OHOA 2Y71A 4KHPB 2FPOA 4JT4A 4KXFB 1J25A 4PNZA 4RPJA 4KU4A 2VUIB 3I5YA 1SUWA 3GFFA 4YMIA 1B23P 3AR8A 2Q99A 4PZDA 1YMVA 2IUYA 2PQ2A 3EODA 5PNTA 3J7AC 3OZ7A 1RC1A 1A8HA 2H2AA 4EX7A 1A76A 2BGWA 2IDZA 3AHCA 4RVGA 5G1OA 2B9VA 5E1MA 4BQPA 5CB0A 5L45A 5JS1A 1YZGA 1Q2XA 4O4HF 3A6EA 1DBIA 1RIIA 1U3WA 1KJWA 3AGQA 3BQNB 3IOCA 4MGYR 4RH1A 1COWD 4TQ9A 5C7YA 4NV0A 2P69A 1XA3A 3IEUA 1JU4A 1H8HA 2VXOA 3IVXA 4F6CA 4NY1A 1JFSA 1QLWA 3JSAA 4B3HA 4EYKA 4EB8A 1B0PA 1VTKA 3H5RA 4Q3LA 1Z83A 2I4LA 2IBTA 3UMBA 3JQRA 1F2UA 2HQ1A 1F12A 4Z0TA 2QMUA 2O1SA 1VJ1A 1Y6FA 1HGXA 1K6IA 1PL6A 1BE8A 1XR3A 3U3ZA 3SFVA 5L7TA 3GLFA 5ECYA 2NADA 4BLSA 2DXIA 2C4KA 2RCYA 3DAFA 4I66A 3D4LA 1Q7RA 1KFCB 1LF0A 3UK2A 1XC7A 5FHQA 2VNHA 2AW5A 2O6HA 3GHYA 3NC4A 2E1PA 4KN6A 2CNOA 4V0LA 3ZWAA 1R3UA 5B36A 1OTXA 2QJWA 1SAYA 4MVJP 2ARKA 4NABA 1IUPA 1GGFA 2W2VA 3A06A 4K03A 1TQ4A 1YDHA 3QOFA 4AUEA 1E79D 4CM7A 4WK4B 3H7IA 1NJ5A 2ZS7A 3QU4A 5BQPA 1P4RA 4LGYA 4PWZA 3IP7A 1N2IA 2GF2A 4QBGB 3PEWA 4G9BA 3NTOA 3T4XA 3THRA 1T8YA 1YU9A 2XTAA 3C6XA 3KKZA 4NR0A 5I4KA 3G89A 5JECA 5IAAA 3EUEA 3W8RA 1ONNA 2WYWA 4DIFA 1QG0A 1R4MB 3NV9A 2AEJA 4TTPA 2YWEA 4EW2A 5BNWA 1YA6A 3CA8A 3Q8XB 2PZBA 1OLUB 4X60A 2VNJA 3VYSB 1NI5A 2JG3A 2PVSA 4ARZA 3S8MA 3TUJC 5DF1A 1RLUA 3R5HA 4HDKA 4EB0A 1DMSA 3L7CA 3KS9A 4U8GA 3BMOA 4IHJF 4ZYUA 4HYQA 3C6KA 3MHTA 4UFPA 2XW6A 1B14A 4IYJA 5LA6A 1ZESA 2VWQA 4DXDA 2V7VA 1CEQA 3BZBA 2IZ0A 5CDFE 3R7AA 3WKAA 5EKXA 1N2HA 4PTLA 5GZ3A 1W1WA 5EIHA 2H9YA 3DE4X 1N6RA 1AMUA 2PT7A 4BV3A 1XZPA 3KVRA 1DQSA 3FNHA 4EJSA 2PPVA 3SN6A 1UM9A 3THWB 2PKRA 4OLHA 4BNHA 1RXSA 5IXSA 3SM3A 3V42A 4WBXC 1ZINA 4BNDA 3JRXA 4OA5A 1ZN9A 4YUYA 5LWQA 4QT0A 3B51X 3O9ZA 4ZYZA 4J3JA 4C01A 2F1HA 2JIZD 3U4MA 2VZ8A 2JS7A 5ADWA 2HYIC 4EVIA 3EZYA 1U4SA 1T8UA 1OAKA 4J7XA 5LP6B 3W3AD 2RD2A 2IVZA 2VT7A 4C88A 1FJ2A 3FR7A 5BSTA 1IVNA 4TKZA 1OI2A 1EJ0A 1ORTA 4MR7B 3FZEA 1BHO1 4YAGA 5IDWA 3I52A 2FLVA 1QJ4A 1E9SA 2PV7A 4DSTA 1IOVA 5CVTA 1GZ4A 2DERA 4AY5A 2V4UA 3RBAA 5F98A 3TLZA 1V95A 2O8CA 3M4XA 1X1QA 3Q3JB 5LZ8A 3L92A 4OJQA 3TFWA 1AX9A 4L15A 2I66A 1CZKA 3LQ2A 3Q7SA 4FZJA 3TQFA 3HL4A 1K97A 2W6NA 3QRWA 4JI1B 5IUKC 5JS6A 2Q2NA 2QAGB 1ADCA 2WICA 5AM0A 5HTKA 3GEMA 5E4YA 5JS8A 1MP0A 2QYSA 4LMBA 1T6YA 3ABQB 3PPXA 1BHJA 5DV9A 1F51E 1YTLA 2NNWB 1TJNA 3PF9A 4D80A 1GSAA 2XOEA 4BNIA 2VA9A 3G9ZA 1OH8A 1OGYA 1K88A 4DWJA 5KOIA 3HMQA 1CX9B 4HB2A 3LOPA 4LF5B 3GRUA 1DBPA 1NDQA 3A6JA 3ABOB 4FI3F 2VWHA 5KCMA 4BLTA 5LM3A 5AQEA 3N1UA 2IITA 1CJTC 5C8VA 3G2IA 4HDMB 2ZTMA 4WN9B 1I2BA 1O1YA 2OVFA 3NHMA 4FQ8A 3CLSC 3MINB 2C9DA 1Z2DA 3P9YA 1XD9A 5F4ZA 5B3JA 5C5EA 1WSDA 3O3NB 4NCIA 2GZ1A 3IOEA 1C3EA 3VGPA 3T3NA 3LVFO 4ZO6A 3SYKA 4C07A 2C2KA 2HSJA 1N5KA 2ZYTX 4AKHA 1CUEA 4WBNB 1YVPA 1UK8A 2HFKA 1P60A 1W4ZA 4OGFA 4CEJB 4BE4A 5G1PA 1ECGA 5AW3A 1DP4A 2HJVA 1QQ5A 3HUFA 4J6FA 4ZVNA 5I51A 4RCVA 2OMKA 5I9IA 3Q11A 1LSSA 1YR3A 3RODA 3VNRA 1B8PA 1GPAA 1YBHA 2JIOA 3M4JA 1V1JA 4YHBA 4YUVA 2H57A 4FFLA 1W59A 1PZXA 2HU5A 1A5BB 3AR6A 4M1YA 5UKDA 4DM4A 1DXOA 4MR9A 2WPDD 2HWKA 3N53A 4DWVA 4EX6A 4GE3A 3KZVA 5CH5A 1GTVA 1ZK0A 3ROMA 1QM5A 2BUCA 2P9BA 4F3CA 3I0MA 1B3RA 4I4CA 4JOQA 3P9XA 2XMZA 2D0DA 1FTNA 1T1EA 3CEHA 1NQVA 3HV2A 3GB9A 4F45A 3IQHX 2HX1A 4KQMA 4AKIA 2PLNA 4ZQCB 4BUCA 2FCAA 1Q0LA 2AIRA 3O93A 3YASA 3OCUA 5BN3B 3PEVA 5EAIA 2X2PA 3A4IA 4I9HA 1Z63A 1H94A 5H16A 3IL2A 3UJBA 2DC1A 4NZNA 1J2RA 2FVXA 2I7XA 3FMPB 1USWA 4NSNA 1I2MA 1DADA 2OO7A 4NMXB 4OFXA 3RJTA 3BXEA 5KYYA 2YNMD 3QPAA 4FMDF 1RXIA 4LJAA 4C4YA 1B74A 1XXHE 3VR3D 3WB0A 1E3SA 3C43A 1MABA 1PWZA 3ND5A 2WF7A 3MMSA 2QLLA 3TB4A 4R8SA 1GDTA 2VJQA 2IV3A 1MR3F 5B2ZA 2NV2B 3EDRA 1ENPA 4OQPA 5CDHA 2OBYA 4RMHA 4NAUA 4X63A 5ALIA 3TMAA 2FWRA 1UBRS 1NF9A 4OBXA 3AUUA 4TT3A 4B9AA 1IY0A 4BVFA 1Z35A 2B3DA 5HKLA 2H29A 5T57A 4RWEA 4Y9DA 4P3OA 5DYWA 3HQ4O 2FEMA 2JCYA 4JITA 4X54A 5J2UA 1AGXA 3BWBA 3EQ7A 4OATA 5A62A 3OTWA 3GG9A 4B8WA 3NHJA 4G9EA 4POOA 5F7XA 1D6JA 3HE3A 2AKEA 1SXIA 1JA9A 2DHQA 3EBOA 2QM8A 1YR9A 1M2FA 1I01A 2JZCA 1CDOA 3ICWA 3HXTA 4R6WA 1T2AA 3KHSA 1SCKA 2W37A 3OOSA 4I4TF 4A26A 2L19A 421PA 5CCXA 2ZI5A 3I01M 1TJ5A 2FK8A 2VQFB 4CBVA 3IMGA 4MV0A 4DG8A 1JKFA 1E2LA 2FN9A 1WPRA 3X1WA 1OHHA 2QRHA 2ZAYA 5EL0A 5ECWA 1YOBA 4E4TA 7AT1A 5KYXA 3ISTA 1U90A 3PPVA 3SVZA 4LZAA 5F1OA 3AJ8A 4F7WA 5AR1A 1PR4A 3SQNA 1KVTA 1MQ8B 1L7PA 5KEIA 1JPJA 1XDSA 3FWZA 3N86A 2AMFA 3PL5A 2UYCA 4OI0A 1R2QA 3F5QA 2R6HA 5F5NA 4YRIA 3TLJA 3IAM6 4MUJA 1LF5A 3A2NA 4JI6B 3M89A 2EFDB 3Q41A 3TNYA 3VSCA 4BEVA 1YFZA 4PYIA 1C3XA 5JH7A 1T2FA 4F21A 1PV2A 3KHUA 3TN7A 4DF3A 5B4UA 3FB4A 4D3DA 1KH1A 3WRXC 1A8UA 2X6QA 1NRIA 3WLAA 3L6UA 5CNIA 3E53A 4DG5A 3IEIA 3ZV3A 2WU1A 1K92A 1U2TA 4RVSA 2XCUA 2OB1A 3E2IA 4EP1A 1PVDA 3ZE8A 1ISGA 1A5TA 3A70A 1XYVA 1Q21A 3MWEA 4OK6A 2A7XA 3DWEX 3WQSB 2YVLA 5L4NA 3ZUPA 3VDRA 2B6NA 3D3WB 4FE7A 3AXSA 4MQEB 4WTOA 1VIDA 3FH0A 4E08A 5DNWA 3ZYZA 5E3HA 3A4TA 5K6AA 4AL4A 4D9FA 3IE2A 5EIEA 4B3CA 1A82A 1M5TA 4Q15A 2ZAOA 3T52A 4XOIA 1KJNA 4X7BA 1SWWA 3CH4B 3TJRA 4DJDC 4NBSA 2CB9A 4YT4A 3H4VA 4OHKA 5DBOA 1G21A 4BHTA 1DSSG 3SKXA 3GJXC 3HUTA 4OI1A 2IHNA 1NW4A 1AQIA 3STYA 1P9OA 5CFQA 3BFJA 5IEJA 2X5OA 2YVKA 1JL3A 2Y05A 3M6AA 4KO8A 1RYHA 4LSZA 4NMWA 3WLEA 1GYPA 4HZUA 3OIDA 2PWPA 3L2OB 4Z9YA 2V59A 1LDNA 3V7NA 2YHBA 2QGFA 3KQTA 2VHVA 3O4FA 3NBKA 4IILA 4ENSA 1J42A 1TZBA 3WAJA 2WWXA 1BXGA 1ML4A 3IAS1 2MYUA 4AIIA 1LBQA 4CQJA 2ATIA 2ZQZA 4P83A 3C3BA 2D5AA 4MAAA 1EVZA 3QMWA 4UTXA 5JS2A 4ALLA 2B8JA 1PZNA 2R79A 4OXXA 5AKZA 1EP9A 4O2BA 3IBGA 4V0OA 1ABBA 1C3VA 3GEBA 3ITDA 4P2BA 1ZOSA 1JQJC 3VR6D 4K46A 1I4TD 4RPCA 4P5DA 4Q9LA 1EDEA 1LZLA 3UEOA 4B2YA 3VRHA 4ETIA 3F6SA 1B6TA 2P9YA 4KTTE 2HPHA 4J3NA 2JFXA 2K87A 4WZBA 3I01A 1LNQA 4CKWA 1NV8A 3BOSA 3M3PA 5JYBA 2QGNA 1AVTA 3W3AH 2P9CA 2A9OA 1XQ1A 2F2TA 2VJKA 2WUWE 4DA6A 1AOXA 2HK7A 4R41A 2NW6A 4QRHA 4COOA 1NXOA 4OUDB 1ULHA 4WVFA 5TQ2A 2ZM6B 2FQQA 3BFPA 4FVTA 2X3YA 1HC7A 4DMLA 1DRUA 2Z3VA 3REOA 3T1VA 3NDBB 4N48A 2AQ8A 2IZ5A 5L3SA 4KR9A 3TAXA 1ZISA 2AG6A 1CY7A 4Q7LA 1W4AA 3DO6A 1B16A 3NHPA 3U3OA 4LQLA 1JLRA 5HM6A 1SU4A 4BE9A 3F3YA 3PZRA 2QM0A 2XA9A 2HQOA 3VYUB 1GQOA 4GOMD 4KGVA 3JYLA 3EY9A 1F7VA 1NXPA 2RH9B 4DIMA 3F1LA 2EW2A 4ZT2A 4O2RA 5HCNA 2QXUA 4PYLA 4B84A 3Q8KA 2HEGA 4R8KA 2D2EA 4PHTA 1NI4B 4URVR 1REQB 3F7MA 3H5AA 5A7FA 4V03A 4J1TA 1HE1C 1HOXA 2ORYA 3ADOA 3OZDA 3PK0A 1DJOA 5AI0A 1C4WA 2WJIA 3MT9A 4OP2A 3V8EA 5GZ1A 4B3FX 5HK9A 1UIRA 2HHCA 1EVQA 1AKYA 3CH6A 3X3HA 5BN5A 4C7VA 5BV0A 1JEQA 3SZRA 1J0DA 1QYWA 1PW7A 1RWWA 4J7UA 3ZD8A 2R2AA 1AY0A 4PPGA 2XNKA 2UVDA 3DQQA 4OI4A 5IPFA 4KQ1A 4PPNA 4AS3A 2E49A 3IHTA 3T0GA 3UA4A 1O77A 1LK7A 1MN6A 3HZHA 2Y76A 4QJBA 1JDBC 1KC1A 2J6HA 1ACMA 3LCVB 1BEUB 2O3JA 3QSGA 4JLVA 3HG7A 1V8ZA 1KPIA 2VP0A 1D6NA 3F8SA 3KCNA 3NBAA 4INJA 1PVVA 2Z43A 5TC4A 4BNJA 3KAQA 3P0EA 4E22A 1QH8B 1V1RA 2JJ1D 2P79A 1N7JA 4G36A 4K87A 1N9GB 2WJZB 5ERGB 1UR5A 4H3VA 4M9QA 5TMPA 1WQ1R 3NHUA 1GRQA 5J58A 4IKPA 4AWAA 3DZ8A 4HPJB 4ID9A 4OLFA 4II2A 4W8GA 3GFVA 2A67A 2BFPA 3KQPA 4P4NA 4DCMA 1HKUA 1E5TA 2Q46A 3NC0C 1VLHA 1GR0A 1NQTA 3LM8A 1KMIY 2WT4A 4B6SA 2OZEA 4S1TA 1D8TA 2WFMA 4AJJA 4WKBA 1OFHA 2X2OA 2ZJYA 5CYGA 5KTYA 1W9MA 5I47A 2FTKE 2OO5C 3AL2A 4DARA 1T4BA 2F4NA 4JQZA 4DNQA 1LJ8A 4C7MA 3FNIA 2FOXA 4F4CA 4H15A 4FZRA 4OA8A 2YIDA 4R1UA 1QVRA 2LE0A 5IVIA 3STTA 1GARA 4MR8B 3R20A 4UCXA 2JFGA 4ZODA 3ROZA 5YASA 5JD3A 2FFBA 4CETA 3ESYA 1EFKA 3LX8A 2O7QA 1GRNA 4MW0A 2YYAA 3OQIB 2IYXA 2QU8A 4PM4A 2CXSA 3IKMB 3DL0A 3TZCA 3BMCA 4DNOA 2PA0A 1LBIA 2PLWA 5H5JA 4B2PA 2ZIZA 2H2WA 5DCUA 1VHJA 2OHHA 2HT6A 2JLQA 2XUAA 4P4TA 1PSDA 1V9SA 3T3GA 5K1ZA 5JROA 2WA2A 1T4CA 3S2IA 1XXLA 2PGAA 1C30B 3LT0A 4MIOA 4UHHA 4PW0A 2DBZA 5I3ZA 1WBJB 3G9UA 2AOUB 4PLVA 1UPBA 4Y2UA 2EV9A 4MB0A 1FJGB 5PGMA 2BBOA 2YUIA 1DARA 1BGWA 3E0QA 3JQGA 4FXPA 4LZNA 4QBIA 3JYQA 4X24A 2G88A 4IQ8A 2P41A 3R7LA 3UFBA 2GPBA 3MT0A 2NVUB 2B8TA 3HJUA 5HJ7A 3R7WB 4D6XA 5EJ8A 3QQPA 3A1WA 5TT1A 4LGMA 1BAPA 2O2YA 3VFDA 4DRZA 3LGAA 2BFNA 3DMNA 3CN9A 3NM4A 1X14A 3KFVA 2Z4RA 1EWTA 1M2VB 4Q6WA 4N0MA 5CYFA 4MWCA 4FSHA 2FMTA 5IX8A 4FOLA 4EAQA 2I54A 1V45E 3IXLA 4BRZA 1HMYA 4BYMA 4PNHA 4QOHA 2V55B 4AI6A 4JCOA 1E7SA 1I1QB 2NZJA 1E0DA 1YDGA 4JEIA 4LVCA 4FHGA 2C9BA 5SYMA 5C53B 3ZD6A 3UF0A 1Q2UA 5CLJA 2YZGA 4R1QA 5FD8A 3KSZO 3GLIB 3R9WA 2BKLA 3RK0A 2G08A 5BR1A 4RPHA 4C1NA 5AXBA 3HFJA 3EJWA 1QFSA 3IQXA 2H2DA 2C2HA 4JB3A 3LNTA 5FTKA 3U31A 1ZWKA 3EXHA 3G68A 4DTCA 4NLLA 2FCRA 4CR6A 1SD5A 1U0TA 4GQBA 3IQDB 5F2EA 2G0NA 4DGQA 1O8CA 3W2TA 1AO0A 2Z8ZA 4MV7A 1U81A 4HDQB 1WKBA 4UFNA 1VIAA 2Y0EA 3PUJA 4GOKA 4WOCA 2NIPA 4HMPA 4HQ6A 4N3BA 1VP3A 3MD0A 3QKTA 5LSAA 4I2NA 1SZDA 4C2TA 2PBRA 4PC2A 5DNYB 1KFKB 1YIAA 2FRXA 2IPOA 4Q9KA 1FNNA 1Z5OA 1EWVA 1U31A 2VP6A 3IAHA 5A7GA 1I3NA 1QIKA 1KEUA 4MQ5A 3TBHA 4I3GA 3C3KA 3HBJA 4QGGA 4B4KA 4PZLA 2W48A 4F9GA 3ZE1B 4HP8A 1OIWA 3QEOA 3QWBA 3U7QB 5JBNA 3L8EA 3PJEA 3HGTA 1S4MA 4ZOQI 4B5LA 2W58A 1C1YA 1I2AA 1QYDA 3NUGA 3EEYA 4KR6A 3IR6A 1H8HD 3NG1A 4J0CA 4J0FA 3ZE0B 7ADHA 2KMLA 3PCRB 3NALA 5E2AA 5JDIC 1NXQA 2YJ3A 2OESA 1SCBA 13PKA 1LJUA 2P91A 4YCMA 2BONA 1D4AA 3BS4A 3TK1A 5LWHA 2RGAA 1XEAA 4F0JA 4OXIA 2WTEA 3K1AB 1XPOA 2GJKA 4QHYA 3UY4A 4ZJZA 4ARSA 1Z8NA 2WAXA 1SG0A 2HZ7A 2OOKA 4MYSA 1XMXA 2M6LA 5BSHA 4QPCA 4AKTA 4QYIA 1T8SA 5C34B 3KBBA 4FX5A 5C1PA 2X0FA 1ZW1A 2DQSA 2AZMA 3N2IA 4C4AA 5ES4B 1FLDA 4WCDA 3QKIA 3CZRA 1UFOA 3WLHA 3SLGA 1CQJA 2CXHA 4HFMA 4RD1A 4ZU3A 2G9UA 2XYHA 1GCAA 3RGGA 1G8AA 1IRXA 1ZJ5A 4E88A 3SX2A 2VUHB 1ODTC 3B8EA 3VR6H 4A8TA 2J3HA 4G8JA 4QXMA 3GDWA 1YF3A 1WLSA 2AYXA 2PY6A 3RS0A 3EG5A 4AF8A 4DLBA 4UAJA 2PUAA 3WLIA 4XM0A 4QSHA 2WIBA 1P1IA 4JGIA 4LIPD 3BULA 3I45A 4P3NA 4Y6PA 5J63A 3ZPXA 1NVEA 2FGJA 4QXQA 3GG2A 2IZZA 4DR1B 1CEEA 1YI8A 3LDUA 5F7JA 4BWGA 3GNQA 1ZEJA 1BEEA 1TD9A 3AT1A 4L78A 4CM5A 4PN7A 5DBIA 5BSKA 3ELWA 3C3DA 4YQZA 3E22B 1CZUA 5BWMA 1WDMA 5JO9A 4OU4A 1MC5A 1N8TA 4YCLA 2X0IA 5BYJA 1S2LA 4QUEA 4DLZA 1U6IA 4HPWA 3CG4A 5B1SA 2VOJA 3H6GA 1SHJA 2VDNB 5E7MA 5EHZA 4CPDA 1UP6A 4XGKA 3KL4A 3E8XA 2VT6A 1R5BA 5LP6C 1NQWA 3CO5A 1D4FA 4RACA 3EQ2A 2PSFA 3RTCA 3UAVA 2YY7A 1JJAA 5DGTA 4AY3A 2QPAA 4C6RA 5D7NA 1RQGA 1UAYA 2C5HA 2ZITA 5K3AA 3TLGA 4D9BA 3DVLA 3R5FA 1WG8A 4RY2A 4Z3OA 4TMWA 1XTIA 4AMBA 3KSDO 5B3AA 3OTGA 2KM1A 4YQFA 4R2XA 4Q05A 1HDIA 4RHYA 2J1LA 3C5WP 5DNAA 3ZZ1A 1BDBA 1P7PA 1WCIB 1KY5A 2YMPA 1T8RA 2QAGC 1ZOPA 2Z83A 4D6YA 2QRZA 5GGYA 5KCZA 3IR5A 1BX3A 3GRVA 5I7HA 5TGDA 3JX9A 1YGPA 3OLQA 3MYRA 1YO6A 3PF8A 1Z26A 5SY9A 3HEBA 1Q91A 3QVJA 4NU5A 4TLAA 3BL8A 3KKLA 4CLEA 3BHJA 2CDAA 4PGHA 5BXQC 4GI3A 3DAOA 4RMIA 5B3KA 3GMDA 3PNLA 3IBSA 1T2DA 1OJ7A 4B4OA 4Y18A 2HSGA 4W8HA 4BZWA 1Z4KA 1TW3A 1OB5A 1GLVA 2ZJ6A 4W63A 4BLVA 4IJ6A 2HCTA 4RK1A 3TTWA 2I3GA 4IXMA 1YBVA 1XSEA 2XYGA 4M21A 4DEYA 4EZIA 4EL0A 4PLWA 4F3NA 4XPZA 3IILA 1YK0A 1LUAA 4ZYWA 3GDGA 4PRKA 1UKYA 1OW3B 4FB4A 3RT7A 2BEVB 1E1YA 1IIBA 1WD5A 2EZUA 1RHMA 3IP1A 4JZYA 4X92A