4X8HA

Crystal structure of e. coli adenylate kinase p177a mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 73
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8hA00
4LYJA 2FX3A 1SKYB 3QXCA 3O47A 1KK2A 3LRPA 2ZJZA 4QNMA 2YNMA 4IEIA 3AVOA 3MG9A 3IO5A 3UWOA 2AK2A 1J2JA 4Q4JB 2X2FA 4XWAA 3R7WB 1N6NA 2V3CC 2QQ0A 3OEHA 2PH1A 4FINA 3LX5A 3HU1A 4OQXA 1PJRA 2FSFA 1ZNYA 1FL9A 1G9XA 2PMDA 2RMKA 4A8JB 4P3YA 4FMDB 4DXAA 5JHGB 4S2EA 2OUKA 4POAA 4PO9A 3ZVMA 1XD9A 2V7QD 2B92A 1C9KA 1ZD9A 3NHAA 4OHXA 3NBYC 3CPEA 3NTUA 2PBRA 3QF7A 2J45A 1S96A 1LV7A 2ZREA 5KTYA 1AZSC 3E70C 3P32A 4N0DA 2C5LA 2GESA 3BB1A 2Q0HA 3CWQA 2WWHA 1ZM3A 2OFXA 3BWDD 1VG0B 5FBLB 1HURA 1T3SA 3LO5A 3OZXA 4ABYA 5FBQB 4KLNA 3TJZA 1MABB 3AKCA 3IPXA 3K0FA 4RD0A 4TT3D 4OI1A 3RNLA 4MYHA 5ANRB 5AUOB 4LHWA 3C5CA 2Z83A 1N5KA 2V4ZA 1G8HA 4B2PA 3Q3JB 2XXAB 5K8LA 1T8TA 1IJFA 1Z0KA 3GFOA 4JLOA 1KKLA 3QPWA 2KBEA 2CK3A 2R2AA 3LW8A 3SYNA 4BFTA 3GJ0A 3T61A 2IYTA 4WW0A 2GTPA 2RGAA 2MSCB 3EA5A 3RS5A 1OH6A 4RD6A 4BFSA 1E0JA 4LHZA 3A1UA 3BH7A 3RLFA 1D5CA 4A1FA 821PA 5FL3A 1KSGA 8OHMA 5G41A 2WWGA 4C0HA 4RD4A 3EPKA 1CLUA 3D6TB 3I73A 1G7TA 1T0JB 3GLGA 3GJ3A 4EJSA 2VF8A 1KJWA 4XWKA 1CRPA 3O8BA 4LWZA 4AD8A 1XRJA 3NEYA 2J87A 1NG9A 3TH5A 5JJKA 3FKSA 3CWZA 1TUEA 2JIZD 1KMQA 2P6RA 1G5PA 3IEUA 3TRFA 2O8DB 1KKMA 3LH5A 3EIEA 3BFXA 1UKEA 1Q3TA 1G6OA 4LYAA 2JLZA 5J47A 2W6ID 2F6RA 5D3QA 3M4YA 1E3MA 1Z29A 3ZD6A 1X8KA 5AK0A 1OKKD 2Z0MA 4A9AA 2QORA 1KI2A 3P20A 1X6VA 2FU5C 2CDNA 2BVNA 4JS0A 1F3OA 1RIFA 2R6CA 2UVQA 1GRRA 1CS4C 3TK1A 3GFPA 4ZIRB 1W36B 4QHYA 5JSZB 4Q00A 4FW9A 2NO7A 2W6JA 4U5XA 2EWWA 4F93B 1XZPA 2JLQA 3ECCA 1TEXA 1U81A 1E4VA 2ZR9A 2C9YA 1KMHB 3I8XA 3FMPB 4RVCA 3ZQJA 2BC9A 2C77A 5CK4A 4ZDIA 2GEDA 1DEKA 2OBLA 2WPDD 1Z63A 4JBXA 3IGFA 4OQMA 1GZSA 3DVLA 4LK2A 4N3NA 4LJ6A 3WHKA 3QY0A 1C4OA 4HLQB 1XXHB 4UXHA 1F48A 1U94A 2D7CA 3R9IA 3TR0A 3C5HA 5C2JB 3SE0A 1G8YA 4LV8B 3G5UA 1YJ5A 2Q9CA 4OHZA 2GF0A 2IK8A 1JQJC 1RPZA 3LNCA 4HYYA 2WBLC 1WP9A 1Z0DA 1KK0A 3MWJA 2X1VA 4Y0VA 1KNQA 4DCSA 3IO3A 3VHXA 1KOFA 1E2DA 3IHLA 3V4RA 4F92B 1FW6A 4AKGA 1NF3A 1HQCA 2VHUA 4PPFA 4DB4A 2ZJAA 4URVR 3W8NA 1ZAKA 2NO1A 3T34A 1DAGA 1NVXQ 3EXAA 3RWOA 1KY3A 3W5IA 4K46A 5KPJA 4TYYA 2IYRA 2WVJA 1KK1A 3UANA 4EQ6B 3GLFA 2FDCA 3U7FB 4F4JA 2A78A 3K0CA 2C78A 4IW3B 3B85A 1NNEA 1G291 1IAQA 2YV5A 3CRMA 3W9YA 3OFND 3M6AA 4IEEA 4BUJA 2CLDX 2ZRGA 3VNVA 3SU8A 1W4BA 2ERXA 2IBMA 4Q7JB 3AGQA 1Z6YA 2XTNA 3SOPA 5FTLA 4DT1A 3U6KA 3KJHA 2BDTA 5G40A 3GP8A 3KKQA 2JCSA 2XAUA 1ZW6A 2W58A 2IA5A 4NONA 1Q20A 4BFYA 2W0SA 3RS4A 2WIAA 3C8UA 1E1RD 4HEJA 2HLDA 1IN4A 5JRJA 1UJ2A 3A6PC 1E9RA 2E87A 3U3MA 721PA 5FUVA 1FP6A 4W5HA 3DMDA 4GOXA 3E5HA 2DPXA 3J81k 1KJYA 3SFVA 2XTMA 4C0AC 1OXTA 4DSUA 3KKOA 2CJWA 3KJGA 3C4JA 1SXJA 2ZVPX 3NBZC 1OYYA 2KJQA 1AM4D 4NH0A 4BWYA 1N6KA 1U2RA 1VG1A 5DH9A 4V03A 1GIAA 2DFTA 5FFMA 1E99A 2J0UA 2WAYA 3SN6A 3U7EB 4A0GA 1A4RA 4D4KA 2W00A 3KQHA 3LVRE 1BO6A 4IDOA 2WJJA 2G0TA 3V4FA 4PC6A 1IQPA 1Z0AA 1GL9B 3H0KA 4QC2A 1II9A 4KSCA 1N0UA 2D2EA 4Q1AA 1NVWQ 3MWKA 1GKUB 5AJZA 3K9NA 4LY6A 5HZKA 4B6FA 4B71A 1VDZA 5J4HA 2R6DA 5A5GA 4KCGA 1U8AA 4QFMA 1WBDA 5F3WB 3B1ZA 1E0AA 1CJTC 4C0BA 2BEKA 2IF2A 3A4LA 1BYUA 4PHTA 4DRZA 1VCMA 1M1YE 1NMXA 3LLUA 5L3SA 2VA8A 2QN6A 4H1VA 1YVDA 2Z4RA 4YMSA 4AG5A 2ORWA 2AK3A 2H57A 4EPTA 4LPKA 1WRBA 4GSYA 4CEIB 1FTSA 1OE0A 1R8QA 1FX0A 5FL7D 1JAIA 4C0SA 1P3JA 2B7BA 2QTVB 5HKKA 4V02A 4B75A 4ZV4A 4QKQA 2GCOA 1PUIA 4BFXA 1T91A 5A0FA 1XMIA 1GKIA 3PEVA 2B21A 3OIVA 3IUYA 3K0FB 3AVVA 1Q57A 1LTQA 3X1DA 3BK7A 5HR5A 1NBMD 4TZ6A 5J4LA 3RSLA 3SYKA 1GILA 1UFQA 4US2R 1W4AA 1L4YA 2LCFA 2WSSD 1QHSA 3GJ4A 1FTNA 1PLKA 4TL8A 3HU2A 2Q3FA 1SZPA 3F3YA 4EJSC 2QUZA 1U0JA 2SHKA 5L8VA 2ZJOA 4WVFA 4MQBA 2ZRFA 4NE2A 3WMEA 5P21A 3SFZA 2OLJA 3GLIE 4TQ9A 1A2KC 4B33A 1ZNWA 2JLXA 3CX8A 5HTKA 2WKRA 1FQJA 1JI0A 1G3RA 2ORVA 3LFUA 4L15A 2GVDC 2JLSA 4TLEA 5A4JA 1C1YA 3KKMA 1FOEB 2WHXA 3DEFA 1D9ZA 3SHFA 3GLGB 4EJSB 1VCOA 2Z4SA 2DFNA 4ZDJA 1GNRA 1VCIA 3O8DA 4HAYA 5J40A 4EPWA 1R5OA 2BBOA 3L8YA 3CX7A 3AUXA 4MRSA 1TEVA 4HLUA 4TL7A 4S35A 2QTFA 4LBWA 4MA4A 4BE7B 3FTQA 3ICEA 1IXZA 1E2GA 4MITA 3LQQA 4M9ZA 1KYIA 3RSOA 1QG2A 1KAGA 1OXVA 2PZGA 4NBSA 5E4FA 2IXGA 3X1WA 1XMSA 4G5SA 4M22A 4Q66C 4AYWA 4OHYA 2ZUDA 1GL7A 1J70A 2OILA 3GQBA 4TSFD 1K6MA 5JZVA 1IN5A 1FUUA 2DWPA 1XJQA 2L0XA 4XD7D 3UKDA 2GVZC 3NBXX 3VX4A 2O0JA 4JYBA 4Z1MA 2FFHA 2CHGA 2V54A 2J1LA 1EESA 1Y3AA 1NLYA 2WKQA 3BH6A 2WSMA 1YR6A 4IOLA 4XOIA 5JEDA 2C2HA 3HYTA 3U3OA 4DEXA 4KBFA 4V0NA 2IS6A 4M0LA 2B6HA 1OFIA 4QRHA 2G1KA 4X8LA 4DLVA 3G0HA 5HE9A 3B1XA 4Z8XA 2F43B 1RYFA 2RCNA 3I8SA 2J41A 2OXCA 1DELA 3ONWA 3SQWA 5FTKA 3ASZA 1F5NA 3LA6A 1W0JA 3IEVA 3VQTA 1DVRA 2A30A 1NVVR 1P2SA 1KHTA 1KI1A 3K0CC 5CIWA 3PUXA 4KVGA 3WY9A 4ZI3A 4I99A 4LOAA 1X1SA 1XDBA 4XSGA 1JECA 2O5VA 3KFVA 1DAEA 3VFDA 5C46F 2HJVA 5CJ2A 1IY0A 1LNZA 3NIBA 3LVQE 4MRVA 2O8FA 1Q12A 2O8EA 3SBEA 3OESA 1HEIA 3UK6A 1G5RA 3A58B 4QBGB 1LS1A 3UMFA 3U7HB 3OF5A 1N6LA 1E0KA 4PC1A 2PLRA 4B2IA 5JECA 2OESA 1WA5A 3AVXA 3LBHA 1ZU4A 4O0MA 3VR5A 5JWRA 2GAOA 5TV2A 1FFHA 4JMPA 1NRJB 4BPBA 1E69A 2V7QA 4TL9A 2BEJA 4DT1B 2YKGA 4NTZA 1J90A 2IXEA 4BLPA 4JLBA 4YONB 1KGDA 1Z0JA 1SXJC 2KSQA 5BYJA 1E2JA 3B60A 1U99A 1XTJA 3Q72A 4LJ4A 2ZR0A 1S9DA 4II7A 1HH4A 4NHOA 2ZI9A 4A15A 1IJEA 2KBFA 2PJRA 2QL6A 2XITA 4JT4A 4FWIB 1G6HA 1MKYA 1VHLA 3T06B 4WIAA 1V5WA 5EE0A 1S1MA 4V0OA 3E2IA 5CM8B 3ICQB 1IY2A 4MH0R 4KAXA 2H17A 2CL7X 4LHVA 2BCJQ 2WIBA 4YXWD 1W2HA 4KITB 2CJWB 4LPSA 1MRSA 1SXJB 5FOSA 3AQ4A 2W0MA 4EPYA 2XZLA 2VP5A 4PXAA 4TT3A 2KI5A 3KUCA 5J4VA 4KV9A 2OLKA 4HSEA 2ZITA 4LDJA 2JJ2D 4O2LA 2J0UB 4UXIA 1EFUA 3K0EA 4JLAA 2R6GA 1JJVA 4EAQA 2CE7A 4GMXA 4AC9A 3AGPA 1N3BA 1N6IA 3EIQA 3HDTA 3P1JA 5JJLA 2KB0A 4U7DA 1NJFA 6Q21A 4B74A 1P72A 2YOHA 3AP1A 3BERA 2HYIC 1UKZA 4KYIB 2ZIAA 2FPKA 4D26A 1GNQA 3GCGA 2XNDD 1U98A 4BFZA 1CR1A 3DM9B 1OPXA 4DIDA 1CBUA 1E94E 3ZIAD 1G16A 2R8RA 5K8TA 2NG1A 2C9CA 5C4GB 3SS8A 3KL4A 4EUNA 1KO5A 1VG9B 4OBEA 2V9PA 4IVPA 2BMDA 2HCJB 2HT1A 2QP4A 1OH7A 1JALA 3RRYA 2JIZA 4TMXA 1VYUA 3C15C 3GLFE 1N0WA 4JLDA 2NO6A 3EW9A 1FX0B 1P6XA 2CCGA 2OT3B 5EUQB 2YZ2A 1GITA 3Q7PA 4D6PA 4QGHA 5CYPA 2GCOB 2QENA 1H8ED 1A2BA 1TQ4A 3B8HA 2JASA 4HLCA 4H9GA 4QNRA 3NC1C 4M1KA 3OAAD 1JPNA 5AR1A 2WV9A 3SI7A 2ONJA 2ERYA 4TYPA 4DB2A 1H8HD 4FN5A 4AURA 2ZETA 1XX6A 2H8KA 4O2RA 4AKHA 5E7JA 1WXQA 1II8A 5AJXA 4EIWA 1P9WA 1PZNA 3TAHA 2IHYA 1IN6A 2VO1A 3QXHA 4PQRA 4Q9IA 2GWHA 4URXR 2IXFA 1H65A 3TSZA 2W2XA 2MMGA 3U44A 4I1VA 2D06A 5L3QA 4HLUC 4KLZA 1DTSA 2FOLA 1P4SA 2CCJA 1HT2E 3EZ7A 1DE0A 1SXJE 3I3SR 1AS3A 4G3XA 1TL7C 621PA 1QG4A 3TQCA 1EFRD 5JEEA 2VSFA 521PA 1XJ0A 4M9SA 3LAWA 4L16A 1YZGA 1ZIOA 1G17A 1LF5A 3CR8A 3DM5A 1COWD 4IOJA 1NKTA 2WJGA 5DLQC 2ZRNA 2DFLA 4B3XA 3RABA 3P26A 1P75A 2Z5FA 2DY1A 5FBVB 4Q7KA 4K81B 4D81A 2IS1A 2E9SA 4R2IA 2B8WA 3RRZA 2NZ8A 2JJ1D 5L3RA 4Q9JA 3SNHA 1T3LA 1CKEA 1CJUC 5L3VA 2VHTA 3CF6R 3VAAA 1VIAA 4K8OA 3EWSA 5TB5A 2G1JA 2QRZA 1UKVY 1NY6A 2AXPA 3HYRA 4TMKA 2WJVA 4HB2A 4ON9A 3C16C 3P4YA 4PAQA 3CW2A 4PSKA 4XTRA 2JLVA 4IRUB 1QBKC 3BB3A 2ZS8A 3IQXA 1KZ7B 2YC2C 5F9HA 2QE7D 2XTZA 2QGZA 3KXKA 3PCRB 4Q4AA 2ZSBA 3VKWA 4F7WA 5IHPA 2ZSDA 3KX2A 1QHHA 2HUPA 1Q0UA 4ERNA 4MDFA 3RAPR 5JWOA 3N70A 3KQLA 2EWVA 2P5SA 4LJ7A 1DAHA 2A9KA 1Z6XA 2H16A 2D3WA 3U60B 4CEJA 3CX6A 1GSIA 2FWRA 2OHFA 5IK2A 1DO2A 2QMUA 3L0SA 2FN4A 3GJ5A 2ANBA 2YINC 4GMDA 2BBWA 4MKIA 4RFSA 3KQKA 5TDHA 3CPJB 3LBNA 5KSOA 2VTKA 2B8TA 4DSNA 2QI9C 4A0HA 4BFWA 4TMTA 4JLNA 3D7MA 1DBSA 4FWTA 3NXSA 5LDDC 1BMFA 2BHRA 2ZAMA 3TAUA 4LC0A 3TMKA 2ODEA 2WMNB 4Q48A 2B7CA 2GJSA 4PZZA 5FOVA 4E07A 1LFDB 1ZCAA 4OL0A 2IEYA 3RHFA 4TYNA 3U2QA 1CU1A 3UMRA 4I1SA 2ZROA 2CL6X 1KY2A 3T5DA 1N5LA 2O8EB 3GEEA 3K9GA 5DSZA 2NOAA 4GT1A 1Z08A 3PEUA 3SC3A 2IHBA 3CR7A 4CF7A 1DADA 2PMKA 4GRAA 1UBEA 2VHQA 2XZPA 5K8UA 3QG1A 2C96A 2WMOB 1RRPA 2CCKA 2QGNA 1P9NA 1N6RA 1QHNA 2AFIE 4PQYA 4AYTA 3N2EA 1KNXA 3KQUA 1MO3A 2BBTA 5EP1A 2GZDA 4HDQB 2QROA 4BFUA 1QVAA 1KJZA 2PX0A 1R0XA 1G18A 3MFYA 1OYWA 1P9RA 1XFAA 4F38A 3FKQA 5FL7A 3AP3A 1L2TA 1PV4A 1OFUX 4TTRA 4PFSA 2CVFA 5BWMA 1ZRHA 5FPKA 1DOAA 4NYIQ 2ZUCA 1BYIA 2QA5A 1W4CA 4HZUA 1VIYA 2KE5A 1U90A 2AD5A 4GP7A 1K8RA 4R98A 2IS4A 2F1JA 1QHYA 2JLYA 4HUQB 2R62A 4RCYA 4RJLA 3CNNA 4JYCA 1GFIA 4OK5A 2VPPA 1OB2A 3TVTA 5BN3A 2YVUA 3THXA 1YZUA 4D4JA 2BJVA 2ZI5A 3V00A 3L0PA 1Z6TA 3FMIA 2X8AA 2ZAOA 4M9XA 2FEOA 2K5UA 2DFKB 1MRNA 3A1SA 5FR2A 3AVQA 2O0KA 4R2HA 2BOVA 1G64A 4BFVA 3PXGA 1OXUA 2G0NA 3AVPA 1XPOA 4M1SA 4LX0A 4X8HA 5SZKB 1VCNA 3SJCA 2J46A 5JS7A 3I92A 1Z3IX 1IONA 3T1VA 2GXAA 1DAMA 4NYJR 1W4RA 2P5TB 4B3BA 4CT4B 2PT7A 4IDHA 4G5RA 4B76A 1I2MA 3SR0A 2UKDA 5EZ6B 4RD3A 1G8FA 4DUGA 1G1MA 1E79D 2IT1A 5EE9A 3PUYA 2OCAA 2XB4A 4DLZA 1RRFA 5H68A 3CRVA 3EA0A 2IYXA 3TUZC 2BM1A 1JEDA 3BFKA 4D0GA 1D2NA 1G3IA 3QVUA 4MKGA 1UBFA 5KNCA 5IRCD 1EX7A 5KPDA 3RANA 2J7PD 3AB3A 4M1TA 4HB0A 1GUAA 1AQUA 1UBCA 1FZQA 1CXZA 5LBIA 4DC9A 3UIEA 4Q4LA 4XD7A 4JT2A 4LRWA 5CYOA 1ZINA 2QMEA 3MJHA 4TYWA 3IBGA 1NL3A 3FHCB 1JR3D 4X8OA 5KHOC 1D2MA 2GNOA 1ZJ6A 5KNDA 5L3QB 1KZGB 2RAPA 2F1RA 1OF1A 4OJQA 2YWEA 3PEWA 1TF7A 1T0HB 3FFAA 4NYMQ 1W36D 1U8ZA 3QEOA 2GJ9A 3ZVLA 2PCJA 2G83A 1TX4B 1VYVA 2VF7A 4EFMA 3CO5A 3ND9A 2X19A 3U4QA 5DI3A 2D2FA 1M74A 3K53A 2FPLA 3QI2A 3THWA 1SQ5A 5CK5A 1P2UA 2FSHA 1NN3A 3AF2A 2JLRA 2Q3MA 4P4UA 3ZGXA 2YOFA 4DCUA 3A36A 5AWFC 3DL0A 4KXFB 1TUIA 4LCBA 3TR5A 3UG7A 1A82A 3W3AA 4NYIR 4PX9A 4OI4A 4Q1CA 4IXNA 5GADl 3UPUA 2ATXA 5BN4A 5JI3E 1L8QA 2IEZA 1N6HA 1VKJA 4OHWA 3WRYC 4G5OA 5G3ZA 4DWJA 1AN0A 4M1WA 1IN7A 3O8CA 4TTPA 2F55A 5KDOA 1R5NA 2GBLC 4EDHA 1E2PA 5KSPA 2ZJYA 4US1R 5EJEA 2I1QA 3CKLA 1KI6B 1E9FA 3NG1A 5HPYB 5AJWA 2A5GA 5FOXA 3X1YA 3Q5EA 4AIIA 1QRAA 2YWHA 2ZE6A 3NVAA 3WRXC 3AKEA 3W3ZB 3PUZA 4LJ8A 2EW1A 4TLCA 4QG7A 2GEVA 2J7KA 1TF5A 3I61A 4Q4AB 2V55B 2ZYTX 3CLVA 1FP7A 3MJRA 4URZR 2DWQA 3EIHA 4UKDA 4PPNA 3FE2A 4WZ6A 5TY0A 3GPLA 4GZMA 1QHHB 1TAGA 2NMVA 4C7OA 1BOFA 1G41A 1I2DA 4H1UA 2J0VA 2CHVA 1R6BX 2AFHE 4MYCA 4URUR 2IYLD 3KKPA 5GJWC 4CEJB 2C03A 1YR7A 4UNPA 1ZNZA 3GLIB 3GJ8A 5F9FA 3JVVA 3QKRB 3SZRA 1Z0FA 2WWXA 4NCHA 4FCWA 2E1RA 1W0KA 4YXWA 4M8NE 2HT6A 2NO9A 4Q1FA 2H18A 3AKYA 2CLSA 5DO9A 3OIUA 4WXPA 2KWIA 3W6NA 4BQSA 4ESVA 4OQNA 5KSYA 3TE6A 1KK3A 4BRWA 4TMVA 5CLQA 4PC3A 4DEYA 4JKYA 1E4YA 5CB8A 1R4AA 3EZ2A 5D3MA 5CDFA 3BRWD 2N1BA 1YZTA 1M8PA 3I72A 4GOKA 3I1FA 2VP4A 5FPYA 3I5XA 1AA9A 1N5IA 2FZ4A 2ZSEA 3GLHE 3MSXA 3R8CA 4L9WA 4A92A 1JQLB 5LPNA 1XTKA 3BB4A 2ZYVX 1N6PA 1D8TA 4IFBA 3B6EA 2ZU6A 4NYMR 1KI9A 1NLZA 2QPTA 4C0QC 4EPRA 5KNBA 2ZTSA 5LD2C 3H4MA 3DKVA 1E2HA 2H1LA 4URYR 2IL1A 1V43A 3CH4B 4MRRA 4CGZA 5H70A 2OG2A 3KJEA 1S4QA 1GWNA 3OHMA 2ZU0C 4LBVA 2VIIA 4R9UC 1US8A 4DLXA 2GILA 1NVUQ 1EG7A 5JJIA 1NVVQ 1G4AE 1UKYA 3RYTC 2LKDA 3WBKA 2BMEA 4ZKDA 1JAHA 1AZTA 3PENA 3VR6A 1H8EA 4LYFA 1KSHA 5JI2E 4CEHA 2DWOA 4FMCF 3IPYA 1HV8A 5DYGA 3PVSA 1UM8A 1UDWA 5TVKA 5HCIA 4HZUB 1WBBA 5FOUA 1E9SA 4L9SA 1H8HA 1UEIA 3K0SA 3MLEA 2CNWD 3ADKA 2H92A 5SZHB 2EU8A 2GETA 3NH9A 1CR4A 3AF0A 4KFUA 1XF9A 2IF0A 4MGZR 2ZYUX 4TTQA 4Q7MB 2QNRA 3HJNA 3MD0A 3QPVA 1ZP6A 2ZSFA 1GM5A 4QHSA 2RH5A 1Q3HA 4M2LA 1NI3A 5B58C 1ZMXA 2GXQA 4M21A 3TNFA 1SHZA 3R8FA 1YKSA 2F3RA 1KDTA 3LDAA 3QXXA 2EFDB 4PSVA 3BXZA 4HI0E 4RFVA 5E7IA 2A5YB 3NH6A 3RC3A 1EFRA 1I4TD 3S1AA 2REOA 2VH5R 4BRUA 2AD1A 2EVWX 5C4MA 4DBLC 3LY5A 2IUTA 3KQNA 1COWA 3QBVA 4TWZA 2WAXA 2WICA 2WKPA 1W5TA 1U8YA 1Z6AA 3AV0B 2GK7A 3UWKA 2W83A 4E22A 3ZLJA 3MCAA 4I1OA 1OIWA 3U3JA 3BOSA 2I4IA 2ZI3A 2PCLA 4I81A 2W2TA 1TPZA 3Q85A 2QP3A 2NIPA 2ZE5A 1BIFA 3D3QA 4KVAA 3N5CA 4NU0A 4B73A 4CRWB 4C4PA 4OHVA 4LV5B 3TUJC 1P62B 4V0LA 3SDZA 4E09A 3PITA 2NZJA 4UNSA 3AH8A 3GFTA 2ORIA 1NY5A 1FNMA 2MSEB 3ZH9B 1EGAA 3LD9A 1OHHD 2X2EA 1DAFA 3KXLA 2YHSA 2IS2A 4BLOA 2I1VB 3PFIA 4NCJA 3F0TA 1CJKC 1E2NA 1HE1C 1F2UA 2GZAA 1G7CA 1RC8A 1AS2A 2NO0A 1JXOA 2C98A 2C99A 1KI3A 4FMDF 3I32A 3W6OA 5JLJA 3CF0A 1ZNXA 2FFBA 2QAJA 4ZO4A 2W6JD 1NBME 4JL6A 2ZS9A 2XJ9A 3QENA 4YC7A 4Q9HA 3Q9LA 5AUNB 3GD7A 3K0AA 2P67A 2P65A 3THWB 2ZJ2A 3CM0A 3QKSA 4Q9KA 5GVSA 4PO1A 4WZAE 2AL7A 2FF7A 5DGXA 4CDGA 2J5XA 2BJWA 2IYZA 4D25A 4A4DA 2GEUA 1ZM2A 5FUYA 4PC2A 1GP2A 2LWIA 1E2IA 3EPLA 1GRQA 2F9LA 5E95A 3QSYA 5HCNA 2J3EA 1CP2A 5KUTA 2MMCA 3NKVA 2HXSA 1Z5ZA 3GLFB 3VKGA 1E98A 1AGPA 2VSOA 1AS0A 2V8OA 4YMWA 5DYIA 1T4GA 4CZ2A 2N46A 4JSYA 1HYQA 4WZBE 2OXRA 4Q5IA 1ZC3A 3ZS9A 1UPTA 1ZBDA 3CB4A 2D62A 3A8TA 3NWJA 2BKEA 2JGNA 1WQ1R 2QZ4A 3CRW1 4QBFA 5CLLA 1VYTA 3EC1A 2TMKA 3DOFA 5EE3A 5BYKA 1TQDA 4JLJA 4U02A 3LXRA 4DLUA 2HDNB 3IIJA 1SKQA 4C7OB 3FGNA 3ADCA 2WOJA 4Q02A 2P3SA 1KO1A 4ESHA 4KSBA 4C2UA 5FR1A 4B47A 1CTQA 4LUCA 5CB6A 2ZXUA 3PG5A 2QM8A 4GFDA 2OFOA 3SEAA 3CZQA 4YMUA 2DCUA 3W5JA 2ZRIA 1E0SA 1LY1A 2P6NA 3OEED 3ADDA 2OCYC 1IHUA 3VR2A 5G53C 1OFHA 3DMNA 2DB3A 3VU9A 4EFNA 3I62A 3EC2A 4TQAA 4FCVA 2EYQA 5KOYA 1E2MA 5FTMA 1X1RA 2WWWA 2Z43A 1GTVA 4Y0AA 1S9HA 2HCBA 4LHYA 3B9PA 3V9PA 4AG6A 3LW7A 1QHIA 4HLDA 1TNDA 1W7AA 4JLVA 1T6NA 4DVGA 1KTVA 3DPUA 2CHQA 5DNYB 1SHKA 4M4SA 5FBRB 4LJYA 3BH0A 3B1YA 1JEEA 5C18A 1SVOA 1WE2A 4DDWA 4F91B 4MGIR 4A82A 1XEFA 4GDFA 3B1WA 2YOGA 2ZRAA 4C0LA 4P31A 2ASEA 3MUFA 3UMSA 1YHNA 5L3SB 4W5JA 2OO7A 3GMTA 4LJAA 4TLAA 4DLRA 4ZDKA 3PJRA 4LBZA 3MWLA 2F1IA 2ZRJA 4NCNA 4NP6A 5SZJA 1US8B 4RZUA 1DAKA 1F6BA 3ASYA 5FUWA 3FYHA 4UNQA 1VTKA 5DHAA 4V0KA 3T35A 3FMOB 4MRNA 2W6IA 2O52A 1EK0A 1G8GA 3AVWA 4CEHB 2EFCB 2ZE8A 1OKKA 2ZS7A 3OIYA 4PSAA 2J0SA 1JJ7A 1M7HA 2FSGA 1FMLA 2A7QA 3QNUA 4YMTA 1YU9A 3IDQA 2IYVA 3U3KA 1NSFA 1WB9A 3GJ6A 5IDVA 4HATA 4ZDWA 2AN9A 1W47A 1Z83A 2FPMA 3VR1A 1TU4A 4NDZA 2VLIA 1W5SA 3L0IB 5HKKD 2FGKA 1M7BA 3WNCA 1CEEA 4XSHA 1NIJA 4CVNA 1CJVC 4F4CA 1JR3A 5LB4A 1U9IA 2QEQA 2O8BA 2XB2A 2WPDA 5F2EA 3QBTA 2RGDA 3T1OA 4B34A 1G3UA 2OFWA 4A6XA 5JSZA 1Q1QA 4DDTA 2JDID 5HZHA 5B64A 3WMGA 1GG2A 3PUVA 2J0QA 3LX8A 3S1AB 3GLHA 3FHTA 1QZXA 1R0WA 1G3QA 5GJBA 4X8MA 4Q18A 5CDFE 1HA3A 4QHTA 1E2EA 1CJMA 5FI1B 3GEIA 1NN0A 2VYFA 3VNUA 3OE7D 4JJZA 1NLFA 1PUJA 4XIGS 5JCZA 3KZ1E 4TN1A 1OXSC 1P61B 1ZM7A 2FSIA 3HP1A 1M2OB 2FMXA 4US0R 3EAQA 2VL7A 3MWYW 2VRWA 3UXMA 2ZM5A 4C0KA 4OK6A 3X2SA 4PQFA 4B35A 4DJTA 4FXPA 2QRNA 4FMCB 2QU8A 4E5UA 3K1JA 1KI8A 2HYDA 2PL3A 3PV0A 1LB1B 3OFNA 1OXXK 1TADA 1S1CA 5EXSA 3QF4A 5JFGA 5B57C 4KYUA 4GP6A 1X86B 1AJEA 2XOKD 4NZYA 1YRBA 1X3SA 1F2UB 3KFXA 2RGNC 3C14C 1XEWX 3PEYA 3K70C 3B1VA 1KSFX 2ZJ5A 1Y63A 1Z8FA 5SZIA 2GBLA 2GZHA 4Q1BA 5DIFA 1IOZA 2OBMA 1E1RA 3E1SA 5IT5A 1CR2A 4NYJQ 4BLTA 4D82A 3B82A 4HAVA 2NPFA 1J8YF 1IBRA 1P60A 2I3BA 1OV4A 2QT1A 3A4MA 4JLKA 4OKSA 4DCNA 2N42A 1VHTA 3SJBA 3A4NA 2YC4C 2IYYA 2BCGY 3K0AB 5KDLA 4KU4A 1DPFA 5UKDA 3TGPA 5J5CA 2AXNA 2CBZA 1XU4A 3B2EA 3K70D 1K5GA 1E6CA 1I4DD 2CVHA 4HAZA 3PQCA 5EUMA 2YWFA 2XGJA 4GPTA 1PLJA 4JZKA 3SYLA 1N0VC 5JBQA 2WTUA 4ILEA 2MSDB 4NCIA 4RSGA 2ZRKA 1UAAA 2EFHB 1MV5A 1E9BA 4B32A 1SGWA 3RWMB 2NGRA 1XNJA 2R6AA 4Q01A 3ZVNA 2O8FB 4TL6A 3MGCA 3B13B 3DDCA 3N2IA 5EE1A 3ZVRA 4M1MA 4A6PA 5FTJA 2WJHA 2ZUBA 3WXMA 3SJAA 2FA9A 2F1HA 1GAJA 1KIMA 1NMZA 1WCV1 2PZFA 3W6PA 4A8JC 2REBA 2OE2A 3KDSE 2FG5A 3BBPA 3CRQA 1XP8A 3M0EA 1D2EA 2QAGA 4JVSB 4PAOA 1E1QD 1CULC 3BE4A 2QSZA 5JS8A 2NQ2C 1F60A 1ETUA 1OIXA 1NMYA 2WZQA 3EZ9A 4LYHA 4B48A 1CF4A 5AUPB 1AK2A 4ZPXA 2IUSA 4OK3A 4ZKEA 4MYTA 5FPSA 5GVRA 5EXTA 1KDRA 3BFVA 1ZM9A 1Q1BA 5J4KA 1ZD1A 2GJKA 4JL8A 5B2ZA 2DR3A 5JWHA 2EYUA 2WWIA 2R9VA 1R5BA 5BW8A 2QMHA 3AP2A 3NDBB 1ANKA 1M7GA 4W7SA 1N2CE 3RDPA 4JBWA 3EZFA 1E2KA 1B0UA 3H2YA 3DOEA 1DAIA 1A5TA 1XPUA 1JR6A 3CPHA 4ASUD 3GJXC 3T5GA 1NBMA 3MMPA 1OH8A 5KDDA 3VU9B 2WSSA 3SQXA 2RGGA 2CNWA 2REXB 1OH5A 2AWOA 2XZOA 5ELXA 4A36A 4CEIA 3FPAA 4P4SA 3K8YA 4CW7A 1D9XA 2GCNA 4ARZA 2C9OA 3U5ZB 3NEJA 2GXSA 4RCZA 5DE3A 4Q1DA 3MAAC 3WYFA 2CL0X 3AEZA 4HDOB 3CNLA 1G4UR 2AKYA 2FFQA 2ZRCA 1AQYA 3K9LA 3B7GA 1AIPA 1P2TA 4L4UA 4QJ5A 4RKEA 1G19A 1EFHA 2DHRA 2Q9AA 4LI0A 4ZCMA 3RC8A 3VKHA 4D2IA 1G8PA 2OCBA 2OAP1 3IILA 2VP0A 2G9NA 1N6OA 3GEHA 1SULA 1L7VC 2IC5A 3EG5A 3KJIA 3WMFA 3JZMA 3KB2A 4DLSA 1DG1G 3QEJA 5CITA 2QQEA 4Q47A 3EX7C 2QBYA 4ITRC 1QDEA 4D4MA 3QKTA 1HQYE 3FB4A 2LKCA 3ADBA 4UJ5A 4O3MA 1W1WA 5F98A 3EPHA 5DHFA 1RRCA 4IOMA 2IWHA 4HZIA 2H5EA 2G77B 1FNNA 2BWJA 3BIFA 2Q21A 4HB4A 3RVBA 2DYKA 4C0JA 4M1OA 2UZ3A 2ZSAA 3B5JA 2ODBA 1KDOA 1SKYE 1U9IC 2OCPA 4YDHB 3D8BA 2OV2A 4WBSA 1HE8B 2BMFA 1EFTA 1ZC4A 421PA 1YRAA 2VP6A 4Z54A 4MGKR 4TSFA 1E2FA 2QMOA 1II8B 1W36C 2NPIA 2QM7A 1DG3A 1OHHA 3JVUA 1UBGA 1Z0IA 4GBMA 3ZJYA 2ZI7A 4XH9B 2AX4A 1DO0A 4XTCS 4EPVA 2OEPA 3U44B 2EFEB 4A2QA 1R7RA 2ZI6A 4V0MA 2O8BB 4LC1A 3BGWA 4NL4H 4G01B 1Z6GA 2GCPA 4UJ3A 1QF9A 3LV8A 1PVOA 4R7ZA 3FMFA 5TXGA 4RZ2A 2VQSA 2WWYA 2QT0A 2ZJ8A 2A5JA 2QPOA 4IOKA 3RRMA 3EWAA 4KJZA 4OJKA 1XJCA 3GLHB 1ODFA 1X8LA 1QVRA 2YJTD 2P0EA 5DI9A 3IKJA 4LSGA 3REFA 221PA 1J8MF 5TARA 4BLSA 4Q7LA 1RYHA 2CMKA 1UADA 5FUXA 4BEBA 1ZYUA 4O25A 3ZD7A 3K09A 3AVYA 5CJPA 4JL5A 2Y8EA 1XMVA 1R0YA 5DN6D 3D31A 4JKIA 3W90A 2VHCA 4RY2A 1N5JA 2D74A 4AYXA 1ESMA 1T8UA 2F43A 4IDQA 3CRRA 3HWSA 3TLXA 4KO8A 4HAXA 4OQFA 4J0QA 5BN5A 4YMVA 3QVVA 4WAUA 5EP2A 1XWIA 3I4LA 1WF3A 3W34A 5H8WA 1MO6A 1ZUNB 4B3FX 4G5GA 1P5ZB 3QF4B 1R2QA 1W46A 4QM7A 4QJ3A 4NCKA 2A3RA 2VP2A 1S8FA 3Q8XB 2XSZD 2IUUA 2D7DA 3BAFA 1PLLA 1XCPA 2C8VA 2ODNA 5JHHB 4QBHA 1SVWA 4GZLA 2BBSA 5CIQA 1P73A 1KI7A 3THYA 4DSOA 3BD9A 2HEIA 4UNNA 4N0EA 3ZDQA 4BGDA 1OT3A 3C41J 1RFLA 3TBKA 4A0FA 4KHZA 2IW3A 4D4LA 1IXRC 2IYWA 3H86A 2V1UA 4D80A 2CLCX 3CIOA 4RFSB 5KSZA 2FNAA 1FQKA 5M04A 3O8RA 1XPRA 1VG8A 3QQ5A 1TU3A 3OEEA 3QPUA 4XVUA 4WXRA 1JR3E 1MOZA 1UEJA 2PLFA 2OM2A 3CNOA 4P32A 1P7CA 1WMSA 2WJIA 2JJ2A 2V6JA 5B30A 2W2VA 3CH5A 5FBWB 1T3HA 2QAGC 4BLRA 1JB1A 5BXQC 4DDUA 5CM9C 5IK2D 1E9DA 3LXXA 3PUWA 2O8CA 4CIDA 4ZCIA 2IYSA 1E9EA 2CE2X 2ZQ5A 3F8TA 3A37A 5FPHA 2XNDA 1UDXA 1XB2A 3KB1A 3P27A 4IJMA 1BMFD 5EXPA 1W44A 3ZIAA 1G21E 1ELOA 3CBQA 3U7GA 4OI0A 3ZZ0A 1OFTA 2QAGB 1SVMA 4A2WA 1XXHE 3R9XA 3L2OB 4PR0A 2PEZA 4AKIA 2HF9A 1MT0A 2GKSA 2ZRLA 3EZ6A 2V1XA 4C3ZA 4CYMA 3EPJA 3OEHD 4QGAA 2R65A 2RHDA 4JLMA 1G20E 2CEAA 1EX6A 3KTAA 4AY2A 2JEOA 2FGJA 1ZD8A 1I4LD 2G88A 2JATA 3DO6A 2H7VA 2O0HA 4FMBB 4EPXA 5LD2B 4GOJA 4PZLA 4MDEA 4QGFA 5GJVC 2VEDA 4TZ0A 4G5QA 3OAAA 4NPHA 2ZYWX 1S0UA 4AK9A 3KUDA 4OYHA 5JCPA 1XMJA 3DZ8A 2HV8A 1M6NA 3HR7A 1BKDR 1E9CA 1Q22A 3M1IA 4QGGA 3SHWA 3ETLA 2C95A 2UZIR 4BZQA 2ZVQX 4OQLA 4P4SB 2ZANA 1W48A 1P2VA 2OZEA 3FHOA 3QXJA 4ARZB 5EP3A 4URWR 1KO4A 3ZYCA 2ZRMA 3THXB 1G7SA 2BMJA 1BS1A 2J59A 2ODWA 2YWGA 3JZAA 1EFCA 3IIKA 2AWNA 3CONA 1E96A 3QG5A 3UG6A 4RZXA 1Q1EA 4P0TA 2GA8A 2CK3D 2HJGA 1Z06A 2R6FA 4Q1EA 2JDIA 4W5WA 1RJ9A 2Q9BA 5EQTA 4Q4HA 1OIVA 3T1QA 2F7SA 4TYQA 2Q6TA 4GI7A 1NKSA 4AWXA 3AF1A 2QBYB 1XEWY 1MO5A 2IYQA 1L4UA 2RGCA 1K5DA 2GJAA 2P6UA 1EXMA 2R44A 3OE7A 3TW8B 4AI6A 3VTKA 3HPQA 4QM6A 2IX3A 4TMZA 3AVUA 3T1TA 4B3GA 3TIFA 4HB3A 2JLUA 5FI0B 2JJ1A 2ECKA 4KBGA 2BKUA 4Q9LA 1Q1ZA 3FKSD 4WA7A 4QJ4A 3G82C 3VR3A 1TF2A 1XD8A 1N25A 4CT5A 1D6JA 1JXMA 4DUGD 3A1WA 4TQUS 4DZZA 1XEXA 1S3SA 4JJKA 3DHWC 4BZPA 2A5DA 3OIWA 4U00A 4ACAA 1XZQA 3A1VA 4Q21A 3TVDA 2WOOA 5BQ5A 3ZS8A 2XOKA 4Z8YA 1B23P 4DLTA 3KKNA 3VHLB 2QE7A 4PANA 4Q19A 4FI3C 4P33A 2YYZA 1R0ZA 5FPTA 5E3HA 3K09C 3VX3A 1E2QA 4B2LA 3QIAA 1OSNA 1IM2A 4HUTA 3TSWA 2GXUA 4QOSA 3DZDA 4DLYA 1IY1A 3T15A 4DLWA 4B6EA 5DISB 2PJZA 3IIMA 3FOZA 4BEJA 4I4LA 3R9WA 2CXXA 2VHJA 5FH9A 3U4QB 4A0RA 5DI3B 3NDPA 1A1VA 3QUSA 2RGNA 1T5LA 2ZE7A 1YZKA 2BM0A 3RS0A 2FH5B 4PTLA 3CUEF 1ZCBA 3QKUA 3W8RA 1KO7A 1VMAA 3IBYA 1RKBA 4DCTA 1KI4A 1XTIA 1ZUIA 2C04A 1CRQA 4LHXA 1XTRA 4MKFA 4LBYA 5EZ5A 1ESNA 1OJLA 1LS6A 2EQBA 3BS4A 2FEMA 4IDPA 1YZLA 3NC0C 2FE4A 4IVQA 4F4IA 4DDVA 1S3GA 1X8JA 1LF0A 5GJCA 4C30A 5LB2A 2GJ8A 3BJIC 4PHHA 3RS7A 4RD2A 2HXYA 1A7JA 1GVNB 1NG1A 1XD2A 1E32A 2PT5A 3HU3A 4MUAA 1F2TA 1EWRA 3H84A 4PO8A 3WNBA 4W9MC 2Z6VA 4JVNA 4LZZA 4R71A 4IVRA 2QPAA 2IWRA 1ZUHA 1YZNA 5AUQA 4MGYR 2WM9B 2XNSA 1U0HC 1OLOA 2JLWA 2ZR7A 1Z2AA 2DBYA 4DHEA 1E1QA 1ZU5A 2QSYA 3TKLA 4HDCA 1RVDA 1YR9A 3GLGE 4XVRA 4M53A 4Q4JA 1SVKA 3R7WA 2A5FA 3LBIA 1R8SA 1YQTA 3THYB 1SVSA 1T5IA 1GDDA 4A8JA 2F3TA 4JSTA 2FJUA 3TW4A 3L43A 2ZRHA 5HE8A 3P4XA 4JBYA 1S2MA 4IKEA 2QP9X 1Z2CA 2ZPTX 4PPQA 1O3YA 2VBCA 3WNDA 4ASUA 4QL3A 5JRZA 5KU1A 2HLDD 5EP4A 4V0ME 5IF9A 1E9AA 1UF9A 1HTWA 4NKRA 4D0LB 3QJYA 2JJ8A 5FTNA 4L8GA 1ZIPA 1OW3B 4TLBA 3ND8A 5D3MB 2ZI4A 5KO2A 1KO8A 3C7KA 4LJ9A 2O8CB 1W0KD 4ACBA 1KDPA 1YR8A 1MABA 1SXJD 4P4TA 4RZ3A 4KFSA 3TSOA 4RKFA 3CZPA 1Q21A 4JVLA 1AKYA 3FFBA 1FUKA 3ZQ6A 2GAAA 3LWNA 1XCGB 3AF4A 1WDTA 1SVLA 2XXAA 3PIRA 1OB5A 1NP6A 3IHWA 4HUQA 4PHFA 2EFGA 1HT1E 4L5BA 1E2LA 1YE8A 2XX3A 1GOTA 4D0NA 3AF3A 3GJ7A 4DIEA 3T12A 3U3RA 3L0OA 3SJZA 4XWOA 2RGEA 4TLDA 3HPRA 3L8ZA 4N1AA 4UQOA 3TQFA 1G3MA 4WOPA 1FMJA 4B3DA 2G6BA 3AM1A 2HF8A 5G3YA 4MKHA 1E79A 1HUQA 3KTAB 4NMMA 3I5YA 3FVQA 1HY3A 1QHGA 4B43A 1RRGA 3MRSA 4JIMA 4G0NA 2WWFA 1SVIA 3REGA 1EWQA 1VECA 4KODA 3TUIC 2GHIA 2ZRBA 1Z28A 1J99A 1ZM4A 2J7PA 3FDIA 5AJVB 4I1UA 2A2ZA 3X1XA 2OBNA 4JVMA 2JA1A 1JNYA 2RGBA 2O8DA 1W2GA 4GL2A 1DARA 1LW7A 3IQWA 1RZ3A 2G3YA 1ONBA 2D4HA 4KI0A 5FOTA 4A2PA 3WBJA 1O87A 4FD2A 1W49A 3A1TA 2GDJA 2XEXA 5J4YA 4M1YA 4QXAA 1AKEA 2ZRPA 4RD1A 1JBKA 1NJGA 1G7RA 2Q3HA 1ZVQA 4LV6A 3EASA 4BZXA 5JMTA 2J9RA 4PHGA 1XBTA 2PX3A 2P2LA 3QE0A 4MUBA 1GNPA 1XCMA 4YLGA 4ZIRA 4E03A 4PAMA 4KFTA 5FOWA 1Q44A 4JLPA 1MR3F 4C2TA 4DSTA 1CR0A 1NIPA 1RJ9B 2QTHA 2ZRDA 3HR8A 4HAUA 1U0LA 3NHBA 3THOA 2WJYA 5AJYA 3CF2A 4IXMA 4PPGA 1KMHA 3F5FA 4MYUA 4Q4HB 4M9QA 3NBFA 2FFAA 2OSBA 2V6IA 4FIDA 3QOFA 2VP9A 5C1BA 2RHMA 5DN6A 5E7MA 1XXHA 2RGXA 3BC1A 3B9QA 4DKXA 3BORA 4IHQA 3AVTA 1CIPA 2JAQA 4GNKA 2ATVA 5KYKA 4TMWA 4HAWA 4BLQA 4EKDA 4LGMA 1RW4A 4IFEA 4B3CA 1MO4A 1XEXB 2OAQ1 4G1UC 4BECA 3VR4A 4YDSA 4ZI2A 1G5TA 2PEYA 3LLMA 3AUYA 1RE0A 1NN5A 3EARA 3U6BA 3UATA 1IN8A 4PC7A 3SBDA 1YZQA 2ANCA 2IYUA 3WHLA 3K9HA 1TMKA 1XTSA 2XSZA 4UNRA 4Z51A 2AHOA 3R20A 5H1YA 1FPMA 5K8IA 3RS2A 1DS6A 4PZYA 3WP1B 4EQ6A 1Z07A 3B78A 4LJ5A 1GKYA 4Q03A 4UXJA 1Z22A 2AR7A 5EXXA 1KI6A 3FWYA 1M34E 4Z1MD 3RS3A 2AKAB 1MH1A 4KFRA 3WP0A 4IDNA 1Z47A 3DKPA 4C9BA 2ZEJA 3LQRA 1BH2A 2XJ4A 3RRNA 4BASA 1J7KA 1JPJA 1XTQA 1R10A 3L82B 3ZZUA 5EE5B 4B44A 3Q7QA 3QKSB 3K70B 3AKDA 1QHXA 1T9HA 1VPLA 2BV3A 4AKEA 2VSXA 1NSTA 2GF9A 2QG6A 2F9MA 3QXSA 3WYAA 2GK6A 2RKOA 1TTTA 2FZLA 2QY9A 3KXIA 1II0A 2FV8A 3X1ZA 1KAOA 2GRJA 4ZCLA 1NN1A 2ZJBA 3GLIA 2X77A 4OI2A 1W0JD 3QKRA 1TQ2A 4EFLA 2PZEA 2ONKA 1LVGA 1XD2B 1IXSB 1AGRA 1GL6A 2RB4A 4MRPA 4QBIA 4YQFA 4DCVA 1F2TB 4XJXA 2BIFA 3PR1A 1GRNA 2NTYC 3Q5DA 3ZZTA 3U61B 4FCTA 4XVQA 3H1TA 3WYGA 121PA 3VMFA 1KSJA 5TMPA 1TQ6A
chains in the Genus database with same CATH superfamily
3TO5A 1VLZA 4LYJA 3PC3A 2CXRA 2IXTA 2PZMA 3SZGA 3LRTA 2AOWA 4Z5XA 3O47A 4X20A 2OOKA 1CZOA 1LK7A 1X9HA 2V45A 3CNQS 3ORFA 4IJ6A 5EEHA 2XA9A 4TM7A 4G37A 4LXGA 5GQSA 1J2JA 4H60A 4XWAA 3SLGA 2OENG 3PFNA 4FCCA 1C0LA 3BTSA 1FFGA 3JZDA 3OEHA 2PH1A 4FINA 4P80A 2GPNA 3TR6A 3HU1A 1PJRA 1N2HA 1GVHA 2FSFA 1FYDA 1FL9A 1G9XA 1ZNYA 1Q2UA 2PMDA 3Q1KA 1ZH0A 5FUQA 3WNZA 3PI6A 3CLRD 1B0AA 1BHJA 2OUKA 2QN2A 4MB6A 4ECAA 5IT4A 3IP5A 4ETWA 3NPMA 4HNAB 4UEOA 3O2NA 4P22A 4G25A 4N7MA 5LU8A 4ZWNA 4IIFA 2DU8A 2NZ2A 2OZLA 1QGOA 2PBRA 2PO7A 3BXEA 2WF8A 1SQ0A 2HA7A 3IERA 1I4OA 3TM5A 3I8OA 1S96A 1MOSA 1CJCA 4LOIA 4QFBA 5F76A 3VV3A 4RKRA 3OQNA 1AZSC 3ZBPA 2IDMA 5JC8A 3GG2A 4R2XA 3BF7A 1GQQA 1C2YA 5ETJA 3A28A 4EUSA 3AM5A 2XMPA 3AZPA 2ACWA 2Q8PA 4P6VF 2X0DA 4CDRA 4Z4QA 2YWXA 3GVHA 1CS0B 3C2QA 3SS7X 4IKPA 1N75A 2Z2IA 2Q4RA 3DC2A 3C8ZA 4WLEA 5BQPA 3TJZA 2LV8A 1E7YA 3IPXA 4ER7A 4CTMA 4HOYA 4RD0A 4L3OA 1GTSA 5AUOB 4M8KA 3FFXA 5I7SA 4LSMA 4OXKA 3TSYA 3V7YA 1H66A 1QORA 4XB6B 4B4UA 3AR3A 2P4UA 4CMIA 5K8LA 1D7AA 3VNQA 3QX3A 4GQBA 3T7AA 5D7NA 1DU4A 2HNAA 4L28A 2O07A 5H5JA 2XRFA 1QUFA 1Z0KA 3PFKA 4JLOA 3MQ2A 3QPWA 2WWTA 5GY7A 1EYZA 3R3VA 4N12A 5C8YB 2FZKA 1RHMA 3RU3A 2HHLA 2ZM6B 1D8AA 4FFMA 3VBCA 1E0JA 1PNQA 2E2WA 1F8FA 5C7IO 1U0RA 2ARKA 3RLFA 3CVVA 1CRWG 2IXAA 821PA 4FLMA 4QU5A 1UMCB 3WGHA 5JXJA 4BZZA 1R37A 4JN6B 2WWGA 5G41A 5AP9A 8MHTA 1ATZA 1UPCA 3AL0C 2Q1YA 4Y9TA 4DYVA 1KY4A 2B8NA 2VJPA 1K7SN 4FIZA 2D0OB 4J7CA 1TO2E 2FPPB 1C1DB 2CXPA 4XWKA 2LBPA 3ADPA 3I6IA 5LMUB 4YJ2A 3NEYA 3NGMA 5JJKA 3FKSA 2JIZD 3WLJA 2P6RA 1Q7BA 1PK8A 3EMVA 3IEUA 3OSZA 2I7VA 4M9RA 4Y1RB 5TMDA 4ZGWA 2O8DB 1LDMA 3IH5A 1ZOOA 3BRSA 3HCPA 5C35A 1DL5A 1TECE 1Q3TA 1G6OA 2BR3A 3NTXA 4OHUA 4E4RA 3FOWA 5J47A 2JLZA 2W6ID 2F6RA 3DB1A 4NCXA 5DBHX 2EZ4A 4KN6A 3WICA 4AF7A 5AKXA 2HJRA 1Z29A 2ZKLA 3B6JA 5H80A 1STOA 2Q3EA 3RAGA 1IPEA 2ZIWB 2Q5OA 2RGUA 2Z0MA 3HKEB 4P4LA 4E14A 2QORA 3Q1LA 5AW1A 4Z9AA 2FQ1A 3LC2O 1TZJA 2FEWB 3F2IA 3EGWA 3R77A 4K9QA 2BVNA 4O4LA 1KZHA 5JISA 1RIFA 4ALNA 1QWOA 1N1MA 2UVQA 3GUCA 1CS4C 4RVUA 3RG8A 3WIVA 1T1GA 3GFPA 4B2YA 2J31A 4OL9A 4FW9A 2NO7A 2QRVA 2XUQA 2ON6A 4U5XA 1GRCA 4FKBA 2M6SA 1WPXA 1H2YA 4F93B 1M2FA 1TC2A 3DAHA 3PUHA 4OFZA 1FIUA 1TEXA 1H6CA 1E4VA 2ZR9A 1KMHB 4UUQA 4BVAA 3ZQJA 4RVCA 4PN7A 4YCCA 3QE3A 1U28C 1I80A 1DEKA 1PCXA 4KJXA 8ADHA 4JBXA 1ONNA 4OQMA 5AHRA 1GZSA 1NXVA 3TJMA 1KF0A 4N3NA 3O8CA 4Y2UA 3WHKA 1DFGA 3WLTA 3L05A 1SBNE 1F48A 2D7CA 4UXHA 2BR4A 1KERA 4ZO9A 5C2JB 4PV7A 1C14A 3V4PB 3I83A 3G5UA 2WP0A 2AQKA 1E8DA 3RQSA 1YJ5A 2BGTA 4UM8B 3L40A 3GF4A 4E7OA 5K3EA 3S2ZA 2VDMB 4HYYA 4H0NA 4AECA 4J1TC 2DLCX 1T8WA 4HG2A 1DJLA 3C5VA 3W8DA 2R7LA 1U1FA 3MWJA 3X2EA 4Y0VA 5ITSA 1X9IA 1KNQA 4MW5A 3HJHA 4M88A 3UXEA 3VHXA 1PR2A 4L6AA 3IR7A 3AW8A 3UV7A 5FLKA 3UK1A 3AEKB 4F92B 3F6SA 1DI0A 1XZAA 2VHUA 3ORSA 1MORA 1Z8NA 1T2EA 4PPFA 3M3DA 1DIAA 2GN4A 4JXZA 2IDZA 2JPDA 4J0EA 5GM1A 4URVR 2NO1A 3ZU6A 3DXFA 2NVUA 5CFNA 3OJCA 3W5IA 4BRSA 2IZ0A 4K46A 1UM9A 3UJ6A 2IYRA 1WZEA 1ZMOA 3IE0A 4JCOA 4YT5A 1H0SA 1CEXA 4CPDA 4EQ6B 2X1LA 4F3TA 3VYUB 2X0KA 4U7TB 2A78A 1OLUA 3BZBA 2FLVA 4IW3B 3G02A 3WNQA 2YV5A 3A2KA 9GPBA 3OFND 3M6AA 3N8IA 1GPWB 4Z0NA 3GRCA 2V7BA 5CT4A 2ZB7A 2IBMA 5CCDA 4HCJA 3TZCA 1PGQA 3AGQA 1Y4SA 5C8VA 3H13A 4OSEA 3SOPA 2XD9A 3KJHA 3TOCA 1FVFA 3MA0A 5ALSA 3HEBA 3M5DA 1IQ0A 1QIFA 1UJ4A 2AV6A 2IA5A 2ZTMA 2I6UA 3EW7A 1UC9A 4GPD1 3S5JA 2IZZA 2C5AA 1AG9A 1JU9A 2Z5GA 4LX8A 1NVGA 1X7WB 4HEJA 4IBOA 4IIJB 3U37A 1KMIY 4YJGB 5JRJA 1E9RA 2XCQA 3FCYA 5FUVA 1HDEA 2EKZA 2XMRA 3CZRA 2PUEA 5HVNA 4G56A 2DPXA 2FZEA 3VJRA 3MSCA 1TM4E 3H11B 3LY7A 2YNMC 1KJYA 4TV8A 2IV3A 3SFVA 5A04A 2C8JA 3LM8A 2FUNB 4C0AC 4DSUA 3N53A 1PS9A 2VZEA 3NIFB 1SXJA 3NBZC 1OYYA 3FPKA 3U3XA 3B5EA 1YBVA 4YDRA 5D5PA 4JXXA 1ZJWA 2BH9A 1U2RA 3EWIA 1R0CA 3OZIA 1E99A 5DTMA 1JYEA 2EJUA 4E32A 4CQJA 3FVVA 3ASUA 2FZ5A 3LVRE 3OP4A 5DBOA 3MCZA 4AJHA 2IZ5A 1CUUA 3H4TA 4PC6A 3K92A 4JI6B 1LU9A 1Y6QA 4QC2A 2HMTA 3JD1A 1V8OA 3KAQA 1NVWQ 1XAJA 2I5PO 3WLNA 1ADYA 2IH5A 4ZVRA 2PUDA 4UBJA 5AJZA 5MDHA 2W4QA 4B6FA 2UUBB 1VDZA 2H1HA 4WD3A 5EXDA 4DDHA 3D4PA 1ZJYA 5IG2A 4QFMA 4ER5A 1L3IA 3TNYA 4FYYA 4P0QB 4AJ4A 5F3WB 1E0AA 2J6HA 4A10A 1GPBA 2FDXA 3IJRA 2IITA 3T3MB 3W5UA 4DRZA 2J32A 3MGGA 4K9RA 1SWWA 1M1YE 3BGSA 4MI9A 2VA8A 2QN6A 3PPWA 1U65A 1YVDA 2O19A 1NWHA 4YMSA 1QHFA 1IE3A 4J0KA 1K8QA 2PIDA 3DB2A 1ZR4A 1BOOA 1C7RA 2QRPA 1WU8A 4OFXA 3E9QA 4CEIB 3ANXA 4RZHA 1OE0A 2F4VB 1UJNA 1DWOA 4Y6PA 5FL7D 5TQVA 1U1IA 1L1EA 1GZVA 1P3JA 4YRGA 2QTVB 5F5NA 5HKKA 1EGQA 4B75A 2GCOA 3EJWA 1W94A 1QIMA 4O4JB 4QFCA 1PYDA 3EB9A 3GNSA 3R3HA 2GVNA 3OIVA 3PEVA 1K6IA 2JC3A 5L7WA 3K0FB 4R8KA 3AVVA 4E1VA 2FJ0A 2WFLB 1NBMD 3F9IA 2ZG6A 3GRFA 5FFFA 1GILA 1AXEA 5JJCA 1L4YA 1LA2A 2LCFA 4UQPA 5BY2A 4BLUA 3HB9A 1T13A 2VN8A 1FTNA 1Z56C 1C9JA 1QR6A 1YTUA 2VUUA 2WFAA 4UZSA 4EJSC 4ROSA 5JXWA 1HMYA 4CKBA 5IPFA 2ID7A 2WU1A 3HC7A 4KO3S 3I53A 2ZRFA 4MQBA 3WMEA 4CG1A 2QW8A 3L8CA 4MPTA 1I4WA 1KP2A 3MINA 1PJAA 4J7UA 1GGJA 4RVHA 5GTDA 1R8XA 1L5ZA 3CX8A 2JLXA 2WKRA 4C5AA 1JI0A 1GN8A 1KIFA 1CB0A 3FNBA 3HB4X 2BEUA 3IB3A 1PS0A 1Y89A 1HFJA 5KCZA 1K6EA 3GRVA 3TFOA 2JGDB 3GLGB 1D9ZA 5AVOA 1VCOA 2Z4SA 4JYMA 1OILA 4MXDA 1VCIA 2A94A 2R68A 2WHRA 4Q1VA 5J40A 3VTZA 1L3CA 1R5OA 5AKKA 5IU6A 4Y8VA 4KDFA 1P9OA 1QDLB 4QQNA 1I01A 1G5FA 4DZRA 2Z8ZA 3H1EA 4TL7A 4KZKA 2YMLA 2ZRQA 4MA4A 3N2KB 4DRXA 2JFZA 1LBSA 2Z1MA 1PJ2A 1IXZA 2EC5A 4RXUA 4JEUA 3K8ZA 5JQGF 1LW6E 1HRKA 1QPGA 1TO6A 3LQQA 2WIJA 3JCZA 4M9ZA 4XIIA 1BRTA 4EI7A 2J3LA 1QQTA 3ITNA 1A0OA 1FDWA 2FQWA 2OBBA 4KDRA 4N5HX 5EMKA 5FBZA 5KNCD 1DOHA 1P81A 4AJEA 2POCA 1HT3A 3AY6A 4QUIA 2JHAA 3LP8A 1KEZA 4WDRA 5E4FA 1XMSA 3X1WA 3Q41A 2ZGVA 3QEMB 1OGJA 5EJIA 5T64A 3H5AA 1J70A 1K6MA 2HWYA 1FUUA 2DWPA 1X14A 4DV4B 3SM9A 4AG3A 1CVLA 1FDVA 4MROA 2G25A 4ANFA 3O38A 4YUWA 1SPXA 2V54A 5BUQA 4P0PB 3A1DA 3G9UA 5CEFA 1HG0A 2J1LA 2ZYGA 1B26A 3QYPA 1YBAA 1DQPA 3U81A 2WKQA 3BH6A 5JC1A 5JXGA 5KJ1A 2PZBA 1X2EA 4IX9A 4E22A 2C2HA 3HYTA 4KBFA 9ABPA 2E55A 4V0NA 5LMNB 2IS6A 4M0LA 1CY1A 1LSJA 1Q5PA 2G1KA 4LMRA 2MCFA 4OUKX 2IPLA 4G5YA 1P0CA 3ZE7A 1YOVA 3I8SA 3SHQA 3RHSA 2OXCA 10MHA 4K6HA 1NTOA 3H2JA 4ENPA 3ASZA 1F5NA 3DTNA 2QLTA 1A9OA 1W0JA 4ZT2A 3JYQA 4TUYB 2YJ3A 3EBLA 3FROA 1KI1A 4TGLA 5CIWA 4IXWA 3PUXA 4ZI3A 1E3JA 2LZ0A 4I99A 1SVUA 4QDUA 3SXUA 1X1SA 4DBVO 2V7WA 2QD3A 5K9ZA 2YIMA 4UCXA 3LGSA 3ZOKA 2JKZA 4M89A 5EWJA 5CJ2A 2D2IA 3KQMA 4BQFA 5U1PA 3TXAA 1LNZA 4BO9A 3S2EA 4PLWA 4BKQA 5IXYA 3V4SA 5A0TA 3DCNA 3OZCA 3OESA 3SBEA 1AHNA 1UJ5A 5CDGA 3F46A 3UK6A 1G5RA 1HYBA 2EFJA 2XQKA 4QBGB 1FJXA 2RBKA 4AZWA 3IUMA 3R9KA 5HOEA 2ZULA 1XDZA 2QOEA 3OF5A 4ARBA 3R3XA 4YO8A 1DWQA 4PC1A 3WL7A 3SZ3A 4D97A 5FWAA 3RRXA 3WC4A 4EG5A 3AVXA 1MUUA 4QQRA 3VR5A 2GAOA 5JWRA 5LZ2A 1J0AA 3PWZA 1NRJB 4FOSA 1E69A 2V7QA 5D8DA 2OCLA 4DT1B 3P5SA 4NTZA 5AM3A 4BPBA 3ERCA 3N59A 5A7HA 5T57A 3OG9A 1XCBA 4JLBA 5BYJA 4L4SA 2VSNA 2JD2A 2BFBB 3TBFA 3MB5A 2JAUA 4N49A 4YDQA 2YWJA 1U6JA 3U56A 1BN6A 4NHOA 1IJEA 3FH0A 2H3EA 3DA8A 1FPQA 3QYJA 4LMBA 4DBLE 1QOQB 4IYJA 1G6HA 2G5GX 1Q16A 2ACVA 2JS7A 4AZTA 1GU1A 4F9FA 2OFPA 4IR7A 2KPOA 1IY2A 1JJFA 3W5AA 4KGXA 3UCXA 1UKBA 2RAUA 2PQ6A 2XWSA 1ZGAA 4KAXA 4AWAA 2H6EA 2BCJQ 3U7QA 2BKVA 3BFJA 4YXWD 2PVSA 1R64A 2A35A 2LVBA 2RHBA 3DVAA 1MRSA 2V59A 4LPSA 5DYWA 3JAKB 4MK4A 4RDIA 2DR0A 4YQYA 3WL6A 3ZHUA 3KUCA 5IT0A 4KV9A 4EW6A 1JKIA 2O2GA 2FZVA 4MUIA 3GB9A 1QGDA 1RAAA 2ZITA 1JQDA 2QUHA 4DSZA 2JJ2D 1YC5A 2JARA 2J0UB 1IXKA 1EFUA 3K0EA 4RJ2A 3GAAA 2CE7A 3JYHA 4GMXA 4AC9A 1B8UA 4H6XA 2XUJA 6YASA 4EG3A 1NJFA 1JVSA 1TLFA 1P72A 5FA6A 2B82A 4MS4B 4BQNA 6Q21A 5AVQA 5LP6F 1UKZA 2ZIAA 2FPKA 2YVQA 1GNQA 4UUMA 2XNDD 3BQ9A 1U98A 5DTQA 5HJ7A 3JRXA 3MC1A 1QH9A 4DIDA 4AUKA 1Z7EA 1E94E 3IT2A 1G16A 3QLVA 2R8RA 2NG1A 5CLIA 4HGOA 1KQPA 2WYOA 4UTZA 5KNBD 3ZK8A 4EITA 4OP2A 5C32A 4R1TA 4FR0A 5M5BA 4DQ0A 3EFOA 3KM0A 1KO5A 3WSVA 4F11A 5LXTB 1YXMA 2V9PA 3U0BA 5A2QA 3PHBE 3RKSA 4LQ4A 3WIUA 3O9ZA 2VZ0A 3T5PA 1IATA 3NBMA 4OU4A 2HIAA 2HT1A 4DA0A 2R0QC 3BK2A 2VQEB 1I6MA 1VYUA 4TMXA 1WVGA 3GLFE 1TC1A 3INNA 4ZC1A 4DV1B 2V0CA 1WMFA 3EW9A 1MAAA 4PS0A 4UMEA 1L7DA 1F1BA 3O73A 2OT3B 4ZRDA 4CLDA 1M1XB 3Q7PA 3ZGZA 2QF7A 2W9XA 2BGJA 3RTDA 2OHJA 3DT9A 3AYZB 3GRZA 2J5QA 3MERA 1TQ4A 3K0HA 3Q7EA 5CYPA 5JY6A 1P8AA 1P8JA 4BC1A 1ZHFA 5DBIA 4B82A 4M1KA 1YA8A 5ARDA 3FMGA 5LC1A 1Y8AA 2ERYA 4F45A 2K2QB 4FHFA 2QMYA 3LHSA 4KKVA 3GFVA 3FN4A 4AURA 4AKHA 4NDNE 5ALKA 1KBOA 3GI1A 3G2HA 1H9AA 2HA2A 1PZNA 2P2NA 2GEKA 3SY8A 4XASA 2RGRA 2C31A 3HADA 3VH4A 1P18A 4RZSA 5EJ7A 2MMGA 1HXHA 1WW8A 2P9HA 3EEIA 2D06A 4DJEC 1DFIA 1BXRB 1ZSVA 1HBJA 3KDPA 3ZXYA 5C81A 1QU3A 5AMXA 2FOLA 3U09A 4I1PA 1YZFA 1BCSA 3VV2A 3S7TA 4EG7A 1TL7C 4CCAA 4DL9A 5E1BA 1VJ1A 3PPYA 3HBLA 5BR7A 1K0FA 3C87A 5I7VA 3ZU5A 3IAXA 4QXPA 4MUXA 3INGA 2PH3A 3RRBA 3SD7A 4IFTA 2G5TA 3K2QA 4L16A 4KQXA 1PR1A 2C57A 4YUZA 3OCCA 2Y76A 5A4DA 3RYFA 2LTAA 1VQ1A 2HZBA 1RIIA 3DM5A 3O82A 3PXXA 2XLBA 4IOJA 4EY8A 4CF4A 2PXAA 1NKTA 2SECE 2AJBA 1T2AA 1YZHA 2ZRNA 4IXDA 5DLQC 5I7FA 1GLGA 4JT9A 2DFLA 2NZVG 4B3XA 3N8DA 3OSUA 3UYLA 4M7OA 2Z5FA 2N75A 3BMNB 5B3LA 4G36A 5J2TF 2DY1A 1AT1A 4W82A 4Z9YA 5F2KA 2C3MA 3N2LA 3HJUA 4EF6A 4DEVA 3SSAA 4TRJA 2B8WA 1OBOA 1PW7A 2I6SA 4OQEA 3I2JA 3UICA 4CCSA 1CKEA 4J1TA 4O8ZA 1CJUC 3V4OA 1V11A 3DCYA 2NT3A 2XW6A 2VHTA 7ABPA 4UM5A 3D3WB 1VIAA 1JA1A 4AX8A 5F2NA 4RTOA 3TQQA 2P75A 2JB9A 3K1AA 5I9TA 4LRSB 2ZTHA 2WJVA 1Y3CE 3VH3A 3C16C 3HVIA 1NUQA 4PAQA 3VR5H 2WDPA 3O31A 5JNTA 1KU0A 3BB3A 3RT7A 1RLUA 4KACA 1JEQB 5B7PA 2OZKA 2QE7D 1FA9A 4L27A 4PG8A 1BE8A 5BMVB 1D1PA 1XT6A 3SLKA 3U1VA 3VKWA 5HM6A 5IHPA 3GGCA 3KX2A 1T1RA 1YI0A 4WJKB 5BWBA 1QHHA 3ZZNA 3LHFA 1E3SA 4LRQA 3OX3A 4ARIA 4D8YA 1ADCA 3L6DA 4W1PA 3KHTA 3AIKA 2FLWA 5JBNA 1DAHA 1EVKA 3BIOA 1Z6XA 2D3WA 4TKVA 4CEJA 1MIHA 4DR2B 1IBSA 1T4CB 4QUKA 5TS2A 5L6MB 1WDMA 4WK6A 1EBFA 1F1JA 2YINC 3GJ5A 2BBWA 4MWGA 4C6TA 3MUOA 3LBNA 3A3OA 2AI2A 2C29D 3AHCA 1KQOA 1BD3A 1GSAA 3IAUA 2ZSKA 3VDXA 3PB3A 4BFWA 3OIFA 1LLUA 1V5FA 4KVFA 2VLBA 1CW2B 1XPJA 4LMAA 5JIBA 1BMFA 2DP4E 1UINA 3CPSA 3G89A 4H6WA 4MICA 3BZWA 3N2YA 2E4AA 1DBQA 2F64A 3CLRC 1E5XA 4G63A 1ZCAA 3U2QA 2C1ZA 1CU1A 3UMRA 4I1SA 1N7GA 1OZ0A 2PA3A 4LQCA 2DRIA 1N5LA 3DAOA 5BSFA 3DDOA 5BW4A 1JILA 4RSHA 3U4CA 3M8KA 1EH5A 4MW0A 3K9GA 4V3CA 4BVHA 3HV0A 1T9DA 3JASB 1JX6A 4MJLA 5I6DA 1NMEA 5K09A 5E6UA 1Z08A 2Q2QA 4E2FA 4X00A 1GARA 5JYEA 3W2HA 2GO7A 2H4WA 4R68A 4X92A 1Y5IA 2PMKA 2XZPA 4AQDA 3IEPA 3RC9A 4X94A 2XVMA 2RJ3A 2VHXA 4U3JA 2CCKA 3SFTA 1P9NA 3C8DA 3KPVA 1QHNA 4PQYA 5ECWA 5JH7B 1CX9B 2I4NA 5HOQA 4QXMA 2ISQA 5ITVA 2HBQA 2PSJA 3IOCA 4X1KA 3WGNA 4N3AA 4ICIA 5EP1A 2I2CA 3QX9A 1U0FA 2OCGA 2W2QA 3HZOA 2QROA 1L7OA 4WADA 2L18A 2PX0A 2PZKA 3A32A 3M83A 3MFYA 3WWPA 5CMLA 2ACKA 2JAOA 2GPJA 4D5EA 3AP3A 4E13A 1UMBA 1PFWA 1RXUA 2DQYA 4CU2A 3ZVKA 1B3RA 2JHGA 3Q88A 4KXYA 3N7TA 4G89A 5BWMA 4BP9A 1SB8A 3KELA 5KWEA 1GGKA 2O20A 1RQRA 4V24A 4LRXA 2IYFA 1J25A 4HNGA 2Y1CA 4GP7A 3TVYA 3LOPA 4NJMA 2TMYA 4IIHA 4PLCA 4RCYA 3WVNA 3UWSA 1J1UA 5B7QA 3HYNA 1E89A 1FP1D 2H0RA 4X1OA 1YACA 4JYCA 4YRQA 5I8ZA 5ECDA 2NVBA 2HMWA 3B7PA 4R51A 1QP8A 3WB0A 3OFKA 2YVUA 5IANA 4WZAA 1SUEA 1YQUA 5BNWA 1EK1A 2ZI5A 3V00A 1PSDA 1Y1RA 1Z6TA 2FN7A 3HA2A 5YASA 1PDOA 5D84A 3H3FA 4MCJA 2FEOA 3LKBA 5ALUA 1M2JA 3AVQA 2O0KA 1NV9A 4YAWA 2BZGA 3BSWA 3A6GA 2G0NA 4JOQA 3AVPA 3PQ5A 4MKXA 3PXGA 4X8HA 1JDJA 4YUVA 3RK0A 4IF4A 4XIYA 6ADHA 1IXYA 3V1UA 1H5QA 1Z3IX 1SCJA 3OQ1A 4IMRA 5DK6A 1NWCA 1DAMA 3GLSA 2A0XA 5DW0A 1PFGA 1SD5A 3L7AA 1MW9X 3F74A 4KPGA 3ACDA 1PZXA 3EH1A 3TLMA 3NT4A 4RD3A 3T7EA 2K2WA 4D6YA 5EE9A 3PUYA 4L6CA 1P4GA 2F1KA 3SVTA 4BBAA 2FK8A 5JJBA 3KJFA 1NJ5A 1RRFA 1JDUA 1G8AA 1WOMA 3I5MA 4KYVA 4TRNA 4MVWA 4D3SA 3EA0A 5CPFA 1ZOSA 4WXEA 5K4HA 4D0GA 4RYLA 1D2NA 1T6XA 1AGYA 2I6XA 1ZCZA 3MTEA 5AXDA 4DR4B 1T9GR 2WF9A 4TYMA 3QK7A 4PFQA 1ISFA 2XUGA 2D00A 2Z3WA 3CLHA 3VU8A 3Q8MA 4H1HA 4DC9A 3N8GA 1X19A 5LP6C 4EUEA 4Q4LA 3PU6A 1DBWA 3QTTA 4F9EA 4WNAB 3CLTD 3UCEA 4CF6A 4BNLA 1GZDA 3TWOA 4B7CA 2QMEA 1NULA 5EQFA 5IH3A 3A0RB 2A3NA 3IBGA 1Q83A 1JR3D 4EO7A 3S2SA 3CKMA 3P9SA 4QGSA 3D6AA 2I6GA 1Z5OA 2GNOA 5KNDA 1ZQ9A 1DIOB 5L3QB 2GH1A 1MT3A 3ND6A 2F1RA 1OF1A 4HWGA 1Z73A 2WZCA 4AWBA 5BRJA 5BUCA 4OJQA 5IAJA 2YWEA 3RVRA 3FFAA 2J9GA 3CRNA 5B6JA 3CVOA 1I2CA 3PQ3A 5TGTA 3TZKA 4BXOA 3O2QB 1XDDA 5B1SA 1QRRA 1W581 4KH1A 2PWZA 1VYVA 2O5EA 1QG6A 4RE6A 1SC6A 3IA7A 4LS3A 3U31A 1BXGB 3DZJA 3FY4A 3THWA 3LO8A 1JR4A 2MSKA 3R0XA 4G41A 2BTEA 4BUZA 3ZGXA 1H6AA 3GEGA 4OAOA 3HCOA 2XT0A 4A26A 5AWFC 4A5SA 5I7RA 2CV0A 4RMIA 4JJFA 4OMCA 4NYIR 4KL8S 3ETNA 3PC8C 5T4HA 5KOJB 4IXNA 3DBOB 3IXQA 1VKHA 4FSDA 2H7YA 2QDKA 4NMHA 1GCIA 5THXA 3TLGA 5GADl 2HHHB 5L95A 1ZWKA 1M6YA 3I52A 2IEZA 4INAA 4N7RA 4DWJA 1F4VA 5G3ZA 4L22A 1WF6A 4S1VA 4RZQA 4RM3A 3UMGA 3QUTA 1X70A 1XTTA 4DNPA 3KOZA 2ALJA 2PUAA 1E2PA 2Q4BA 2C7BA 4L0MA 1IK6A 2XUIA 3FNFA 4US1R 4Q6BA 3ELWA 2I1QA 1QRTA 3WO1A 3BTOA 1U2SA 2IRWA 3ABIA 4IGAA 4KMSA 4NESA 2WRZA 3X1YA 5FOXA 3AOGA 1UBKS 4XPIB 5HF5A 5IWCA 4ZOEA 2M9MA 4AIIA 2YWHA 2F59A 2PAAA 3VO2A 3AKEA 3VSDA 5BNIA 3OJLA 4BTEA 4R1UA 3KSBC 2HIHA 2OO3A 3MCUA 3I61A 2BL4A 3ZR4B 1FP7A 1IHPA 1TJ3A 2DWQA 1SC4A 4H7IA 2FWPA 4WZ6A 3ZDFA 1SCUA 5TY0A 3SKXA 4AWXA 5LQKA 3KVNA 3D81A 3OCUA 1DBVO 1RAIA 1G41A 2XWBF 5HS4A 1MZVA 4PCVA 4MYCA 2WZDA 1M73E 2R1TB 3EVGA 4L5CA 5D5HA 5EYPB 3CKKA 3E82A 4EB8A 1YAJA 1YR7A 3EYAA 1ZNZA 7REQA 3GLIB 2PL9A 1SA0B 3ZUPA 1LPBB 2WWXA 3LTNC 3WTCA 3BWMA 4HTAA 1OTHA 4NOMA 5AM0A 2H18A 1O6GA 3ZCPA 1RQ7A 1NRXA 1ZGJA 1Z5WA 3MJSA 1JV2B 2ZTVA 1CY0A 3EZNA 3IURA 1M1ZA 1OXKB 3TE6A 4UUOA 3UV3A 4BQSA 1ODTC 2FW9A 2V5UA 4YMLA 3HJRA 1IYZA 3WL8A 1B43A 4JKYA 2IV2X 1NE2A 5KOIA 5EJ9A 5CDFA 1ODIA 3BCSA 2H07A 2QN8A 2HK6A 3EZLA 1M8PA 4ZOLB 1MQAA 4I8XA 2VP4A 3V3TA 1P5FA 4TZKA 4BNYA 5CFOA 2B61A 2FZ4A 2ZIFA 2ZSEA 3PUIA 4OBWA 1CE8A 1ESZA 1ZD2P 3R8CA 3WB9A 2IUEA 3ZD8A 2W6CX 3HLTA 2V0NA 2P79A 2DKNA 2ORYA 2VSQA 1XTKA 4WECA 3WXBA 2I99A 2DECA 3ANNA 1JQEA 3IKLA 4P3XA 4JODA 4ZREA 2EHJA 2ZU6A 4NYMR 1KI9A 2DLDA 3G9XA 3RREA 1SHJA 2R4QA 3IFSA 3H4MA 4F5DA 1CQZA 2NUPB 3DKVA 1E2HA 4Q3DA 4DCCA 7MDHA 5IUNC 1JPVA 2H1LA 4HFMA 4MV7A 4YP5A 3UHAA 2IL1A 5BW5A 1IIBA 3CH4B 2Y71A 3OF3A 3RASA 1NR7A 4EW3A 1MH9A 1TAUA 3HB0A 2VIIA 1PGJA 3ELBA 4L6IA 4R9UC 4N4AA 5IVPA 3AR4A 4ZTBA 1TM5E 1NVUQ 3COVA 1XTUA 1TUGA 1VB5A 1MNQA 3VXKA 4EY6A 1G4AE 2LKDA 3QU4A 2J67A 2CJFA 4GOOD 4L8VA 3JQAA 1AZTA 1EZZA 1WUIS 3PENA 1H8EA 1A9SA 4LYFA 2HHAA 1KSHA 4OX9Y 4CEHA 3EA4A 2DWOA 2HSJA 3NIDB 1XV5A 4OJTA 1PF7E 4ITUA 2GK3A 1JG6A 1N2BA 3NEAA 1UDWA 4MPPA 4HZUB 5FOUA 3RVOA 3N58A 3TQTA 1TYDE 1H8HA 1UEIA 2QN7A 3DFIA 2CNWD 3AG5A 2BTQB 2V7GA 3GC6A 3FNRA 3O6VA 2IZOA 4JSRA 4GC5A 3MBIA 5SZHB 5CDTA 2GETA 2P7HA 2V6GA 3AF0A 1IZ7A 1BD4A 4ZYUA 2R5NA 3E61A 3R24A 4UUNA 5B1EA 3IAAA 1HEYA 1BDJA 4TTQA 4W8OA 2OGZA 3EHEA 4KPYA 4U39A 3RYIA 1GM5A 3L7CA 4M2LA 4BC0A 4F72A 1NI3A 5KNDH 4GI3A 3G2PA 4LXTA 2I54A 5CNJA 2OSVA 1TKRA 5G0TA 1Y8RA 4M21A 4MTLA 1LPOA 4LGVA 3TNFA 1SHZA 3R8FA 3OTWA 3L6RA 3LDAA 2PS0A 4PSVA 1XQYA 4EYSA 3BXZA 2NSJA 4HI0E 1J33A 4IHJF 1TE2A 1YJBA 2A0KA 3SEFA 5E7IA 1SXPA 3IJPA 1NVTA 4KVZA 3OJOA 1B00A 4EF5A 2PUHA 4BNTA 3DEJA 4PAWA 4HAOA 5DHTA 2I8AA 2XNJA 1GGMA 4TM8A 4X0EA 3N2GA 5DNEA 4CT0A 5C4MA 4O8CA 5K1ZA 4QU9A 1COWA 4GWKA 2Q7XA 2WAXA 2WICA 2XR1A 2O6HA 4D3ZA 1W5TA 3AV0B 3LE8A 3UWKA 4JP1A 4I3FA 4FW8A 5A4MS 3ZLJA 1AZWA 5CFRA 3MS2A 1UH5A 3JALA 2VXBA 4I1OA 3QLUC 5REQA 1H94A 2CNNA 4EL5A 1N5RA 1KYWA 4FT4A 3OBBA 3ESQA 2BUAA 1N34B 5A05A 1KFKB 1R6UA 3L8HA 3SR3A 2C1XA 2WHPA 2AI3A 1BIFA 2ZE5A 3KD3A 3N5CA 4KVAA 1JE0A 1XLUA 4NU0A 4U8HA 3W78A 3WGYA 3UK2A 2Y66A 3OPXA 3NHZA 4RH0A 4C4PA 4RLQA 5CURA 4QDZA 3EEBA 5DSXA 3SDZA 3QVKA 2O2DA 1VM6A 4Y7DA 3W1WA 1M3SA 3R4CA 4ZVMA 5ADHA 5LYJA 1KP3A 2J9ZB 5JCJD 1TEHA 3LD9A 4OUDA 1DAFA 4PGMA 3KXLA 2YHSA 4RA9A 4U7HA 5AVUA 2GOYA 5DULA 1CF9A 4FYWA 4IIUA 4S0ZA 4BX2A 2Z2KA 3F0TA 3CW9A 5JOQA 1WNFA 4CIBA 5EJ6A 3N2NA 4LTDA 1Z74A 1JXOA 2C98A 1FS4A 2R00C 2YCLA 3EAGA 1NQ5A 1Y1TA 3PFCA 2A58A 4UCQA 3FOFC 3KPJA 1IB6A 2G7MC 1Y3BE 2GN6A 5EJMA 3W79A 1ZNXA 2FFBA 3GJZA 3LHKA 4BB0A 4OYRA 3RH0A 3L6EA 1GGVA 1SQSA 5DBFA 4UE6A 5E8RA 5HMLA 1YOBA 9LDBA 3PDIA 3CVXA 3H5WA 3G49A 3Q0EA 1D2RA 3KVVA 3Q6NA 3H6GA 5AUNB 1XMXA 2D13A 2PRSA 3EDMA 4BNIA 3K3PA 1AXGA 1WR8A 2P6OA 3PRKE 1SJ9A 2DPLA 2H7CA 2HRDA 1K63A 5KYVA 4FWBA 4BGIA 3PJEA 4CG3A 1YMQA 1Y4ZA 3WBBA 2J5XA 3IJEB 2IYZA 1JU3A 4D25A 2P3QA 2UVPB 1TKBA 4MVJD 1PJLA 2EZ9A 2PD3A 3WR5A 4HNUA 3AUKA 4DV5B 1GP2A 1E2IA 4EUFA 3HUUA 1GRQA 1ZL0A 2W5UA 5JQGA 1D0IA 4OREX 3RLIA 1CP2A 2MMCA 3GYBA 4PGGA 1O58A 1TMOA 3P2YA 1OYOA 2D5BA 2WJ6A 1E98A 2XBUA 4CKZA 2QW1A 5DCUA 2HQBA 2HTEA 3OBIA 4PS1A 5CDUA 4DCMA 2GYVA 3VZPA 1F0PA 3ZY2A 3D3NA 2GM3A 2JIRA 1RYYA 1ZC3A 3UAXA 1UPTA 5C8YF 3FDZB 4E2ZA 1TQ8A 3CB4A 3NWJA 4PR3A 3ANTA 1P7WA 4DY4A 1EAYA 1WQ1R 1W2WB 5LLDA 1QZZA 2FOXA 2X4DA 1CWUA 2NVOA 2QPLA 3Q15C 3NHLA 4G0PA 2SKEA 2VYCA 1JL3A 3BIJA 1V35A 1OI7A 3FWHA 1QIKA 3FMVA 3WQBA 3ZHQA 1T0UA 3HVKA 2V03A 5CA0B 4F3RA 4JR0A 4ESHA 5EIXA 5FNZA 1EDDA 4HF7A 1O03A 1CTQA 5FR1A 3R7BA 5K0BA 1AMUA 4LUCA 4I3HA 2Z04A 1X8XA 3QHPA 1U5BA 2ODTX 3DOHA 4BJ5A 2RHWA 4GFDA 4EYQA 2XE8A 1QQ6A 1S3IA 1ECGA 2AR0A 3NKLA 4LHEA 4EZEA 5IVHA 1E0SA 1E1YA 1ZAYA 4LGYA 3ADDA 1EK5A 2OCYC 1IHUA 2Q0QA 1HR0B 5PGMA 3HXQA 1C7JA 2OXTA 3CJQA 1QKIA 1TTHA 4NMWA 1ISSA 3N07A 1LRKA 3MRXA 3ZK9A 2JFYA 3G13A 3MM4A 3VC1A 4FB5A 2I6FA 4EB6B 2WWWA 3MLBA 1S9HA 2HCBA 4HDSA 3V9PA 1J2EA 1QHIA 2HY7A 5CYFA 4HLDA 4YT2A 1H69A 4Y6OA 5M29A 4I50B 1LQTA 4UHJA 1NXPA 1O54A 1TD1A 3WHPA 5IM4A 1HTTA 3OZDA 4J1SA 1V96A 2KW5A 5IJ9B 1U7PA 4CIVA 5BYAA 2ZCUA 3JQDA 4GMGA 3RSFA 3UH0A 3V8BA 2VWQA 2VQFB 2G63A 3BH0A 3A2LA 1JEEA 1HDGO 4M60A 2A86A 3IEKA 5ICCA 1HETA 5BOVA 2QXUA 5A3VA 2QJWA 3IJ5A 4GDFA 3B7WA 3D8RA 3VVLA 1K9VF 3RVNA 4PZCA 4QYMA 4CM8B 1ND6A 1Q92A 3ROKA 3UMSA 1IMOA 5FWXB 2WFZA 4YJKA 4M0CA 3DEYX