4X8HA

Crystal structure of e. coli adenylate kinase p177a mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 73
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8hA00
4Q9JA 4C0BA 4C0SA 4U02A 2YC2C 4LPKA 3K9LA 4ILEA 1E94E 4M22A 3B1ZA 5EZ5A 1AZSC 1XEXB 1CF4A 1XU4A 1DAKA 1P5ZB 2ZRMA 2ZI9A 3THXA 1AS3A 4L9WA 2QAGB 1W7AA 3KKQA 3RHFA 4YQFA 2JEOA 2Q9AA 4KVGA 5HKKA 1IJEA 1JAIA 1W4CA 3FVQA 4FD2A 1Z6GA 3THOA 3N2IA 4GOKA 4HZUA 4V02A 3AKDA 4FMBB 2IUUA 4GOJA 3C7KA 4AD8A 4EJSC 2FPMA 2YWHA 4PC7A 3TQCA 3K0AA 1ZIOA 4RZXA 1N2CE 2QN6A 4CVNA 2BVNA 3I8SA 3QE0A 2CE2X 1ZNZA 1JALA 3HDTA 4JSYA 2WKPA 4M1TA 3TNFA 4QBGB 1ETUA 3DM9B 5HR5A 3P1JA 2GXSA 3EZFA 5FL3A 1XMVA 3WMEA 4BFUA 1ZJ6A 2A5DA 2CK3A 2ZSDA 2QUZA 4BFTA 1D5CA 1DAIA 2JASA 2OG2A 3KX2A 2HEIA 4D0GA 1FX0B 3CUEF 5FBVB 3AF2A 4CF7A 1CLUA 2IXGA 1E0JA 2UZIR 2ORIA 2BOVA 3RC3A 2XX3A 1DAMA 3LX5A 4KBFA 1Q3HA 2FV8A 4IFEA 1Q3TA 3RC8A 2YC4C 1VCOA 5CYOA 4E07A 5DO9A 1II9A 1ZU5A 1XTKA 1O3YA 4F92B 1IHUA 2J7PA 4L4UA 3T1TA 2WWIA 3CR7A 1Z06A 3FMFA 1IY1A 1KAOA 1G7TA 4LC1A 4UNPA 4QHYA 3HJNA 2ZSBA 2HT6A 4D25A 2G77B 4GP7A 3PUZA 1TF2A 3LQRA 1AS2A 5TARA 5JS8A 2ZE5A 5GVRA 3RRZA 1T5LA 3THYB 4TMWA 5FOTA 2ZRFA 1E32A 4PZZA 4ESVA 5LD2B 1J70A 3AF0A 1H8EA 2YOFA 4IDNA 1YZTA 3BH6A 3UIEA 2ZUDA 1M34E 1RE0A 2V7QA 3NG1A 4QJ4A 2VP4A 2QTHA 2WJHA 1Y63A 2DBYA 1OKKA 4BRWA 2QSZA 1N6LA 2NIPA 2OILA 3I73A 1RVDA 3M0EA 2DYKA 2ZQ5A 5TB5A 1KDTA 2HF9A 4PFSA 1I2DA 2F43B 1M7GA 4UXHA 1IJFA 1Z5ZA 2GDJA 4M1YA 2WIAA 1FL9A 3BAFA 1P4SA 4OK6A 2LKDA 3WRXC 1EWRA 1U94A 2AFIE 1OXSC 5KSZA 5F3WB 1IN5A 3OIYA 1WRBA 5JMTA 1M2OB 1U8YA 4UNQA 2WJJA 3KQLA 1NKTA 4KJZA 1L4UA 3SYLA 4CW7A 4O3MA 2IYSA 1J99A 1NVUQ 1TMKA 4WA7A 1XWIA 4M1WA 3AP2A 4LX0A 1D8TA 3X1ZA 4E09A 2B6HA 3TVDA 2XEXA 2OV2A 3IUYA 1SVOA 1XEFA 4TSFD 4D4LA 1PV4A 3U3RA 5JI3E 2ZI7A 4YDHB 2WPDA 2GCNA 1G8YA 1E2PA 1NLZA 2D62A 4B43A 4RFSB 5EXXA 5JI2E 1OIVA 4OHWA 3CB4A 4C0HA 2DWQA 2FGJA 4JYCA 1XXHA 4PHFA 3VFDA 2QPAA 1R0WA 2XOKD 1SVWA 4OI1A 4F4CA 5KPDA 4NZYA 4G5GA 4ASUA 3I8XA 1F2TA 2VP0A 4V0MA 4L15A 1EFHA 3QVUA 4Q00A 2ZAOA 1FUUA 1H65A 3QOFA 2ZTSA 3PFIA 4WZAE 3SZRA 4B73A 1S3GA 4KFTA 5FPTA 3B60A 1EX6A 2QTVB 3OFNA 4IHQA 3L2OB 1Q44A 2C9OA 3IQWA 1W47A 3O8RA 3BRWD 3WHKA 6Q21A 2QY9A 2XSZA 1VCIA 3LV8A 5AJYA 1MRNA 1JPJA 4JLVA 1BYUA 4B2LA 1XCPA 4PANA 5FI0B 1XMIA 1FQKA 4S35A 1VYUA 5DLQC 2BWJA 4WAUA 2OBLA 4IDHA 3CX6A 2OCBA 2V4ZA 5DI3A 2Z4SA 2EWVA 4DWJA 4DSUA 4O2RA 2O8FA 4JVLA 4JL6A 3RS5A 3QY0A 1EGAA 2A9KA 1OF1A 2AKAB 5FBQB 1VKJA 1KDRA 1XMJA 3TSOA 4JKYA 4OI2A 1AGPA 2X19A 2RH5A 3IDQA 3AVXA 2O8DA 4GRAA 2ZSFA 2VYFA 2IX3A 4W9MC 2P5SA 2F3TA 4DLVA 4NMMA 1WBDA 2IK8A 2IYXA 2G9NA 2JJ8A 3QENA 1VDZA 4FIDA 3VU9A 4D80A 1SXJA 1K5DA 4MQBA 4B3GA 2D06A 2CMKA 3OAAD 4JLDA 1UKZA 3LO5A 4Q4JB 2CCJA 5HZKA 2ZRKA 1R7RA 4D82A 4Z1MA 3LWNA 1FMLA 2W6JD 2HJGA 3KB1A 1JAHA 1H8HD 3BD9A 1AJEA 3A36A 3TGPA 2JATA 1Q1ZA 4C7OB 3CW2A 4BFSA 2BJWA 5FTNA 1E9EA 4GNKA 3AVYA 4TYYA 5J40A 3H86A 1XD8A 2G6BA 1NMXA 4KCGA 4Q02A 1TAGA 1DAHA 3T06B 4US2R 4C4PA 2ZU6A 3NH9A 2PX0A 1ZUHA 1HH4A 4B33A 4I4LA 2QM8A 4AKEA 1HT1E 5HE8A 1CJKC 5TVKA 2CJWA 4HLUC 3EG5A 4MRPA 3CF2A 3RYTC 3WRYC 1GZSA 4Q9KA 3C16C 3BB1A 4M4SA 1P72A 2QE7D 1HE1C 3VHLB 5JJKA 3FFBA 1KK0A 3ETLA 1HURA 1W0KD 2FEMA 1HA3A 1GP2A 2OO7A 4OQLA 1Q21A 1F5NA 1W0KA 1NY6A 1SXJC 1WMSA 2AHOA 3JZMA 3Q7PA 1E1QA 5FR1A 1ZNYA 4WIAA 1XTSA 2O52A 3GJ7A 3E5HA 1JJVA 2IF0A 3PV0A 2OESA 1E2QA 5AJWA 1W46A 3UATA 4DLTA 3EX7C 2WICA 1Z6XA 1US8A 4Q18A 3D31A 2Z83A 4BE7B 2ZI6A 4WZ6A 2ZXUA 3V4RA 1OFHA 1E2GA 2FSFA 2Q3MA 3ND8A 4D0NA 1TUEA 1HE8B 4A0RA 3UKDA 1ZYUA 2FN4A 4P4UA 5FBLB 3K0SA 2F55A 3U44B 1GNQA 3FB4A 3DZ8A 3ZZTA 4D81A 5L3SB 3B5JA 3KKMA 3U7GA 4TTRA 4TZ6A 1US8B 3GFOA 1QVRA 1ZD8A 2GCOB 4JVNA 5FOWA 4NBSA 1NP6A 4HAZA 2TMKA 2WSMA 1XTJA 2D3WA 3RS7A 3ZS9A 3OESA 1KI6B 3UMFA 1QHGA 3X1XA 2ZSEA 2WV9A 2VL7A 4Q48A 3G0HA 1UEIA 5SZJA 4ZIRB 2PH1A 4PQYA 2YYZA 4QFMA 3L0IB 1Z0IA 1W1WA 2C8VA 2BBSA 3CRVA 3K0CA 2OCAA 1CJVC 4HAYA 3SYNA 1W4AA 4LJAA 4QRHA 3SR0A 1OH5A 2ZJZA 3WP1B 2B7CA 4QGHA 3TSWA 1MO4A 2ZRIA 1Z0DA 2HUPA 2A2ZA 2QAGC 5EP2A 3U4QB 3K09C 1OYWA 4W5WA 3QXCA 3O8CA 4W7SA 4CT5A 4LUCA 1UFQA 3EPJA 2R6GA 4CT4B 1XD2A 1OJLA 5FBWB 4DVGA 2XNDA 2VHUA 1G3RA 3ZVMA 1E2MA 2R44A 2H17A 3CONA 1L7VC 2AD5A 3AQ4A 4RZUA 4URWR 3P32A 4JVMA 1KZGB 3AKEA 4I1SA 2IYYA 1XPRA 3VR6A 3ADBA 1XB2A 1DOAA 2P3SA 1LVGA 1MH1A 3MWLA 4PSAA 3UMSA 4Y0AA 2G1JA 4LYAA 2C77A 4RD6A 1GUAA 1S2MA 5AUQA 2QBYB 2XZLA 2O8BB 3SNHA 1DADA 1TF7A 4NHOA 1ZC4A 2QMEA 1J8MF 1QHHB 3A1VA 4P0TA 4QBIA 2YOHA 2O8BA 4NE2A 3B85A 5J4HA 2WBLC 1PLJA 2YNMA 2IT1A 2YINC 1WXQA 3GEIA 5JZVA 1FW6A 1KSHA 1X1SA 5G41A 5H1YA 5IDVA 2ZI3A 2REXB 1D2EA 2O0JA 5JBQA 3PQCA 2C98A 2HXSA 3GJ6A 4HLCA 4NP6A 1YZQA 3SEAA 4MYUA 2W2TA 1OIXA 2Z4RA 1CBUA 5AUOB 4LJ7A 3GFPA 3ZZUA 1R5OA 4LHVA 1GWNA 2BIFA 4PPNA 2V54A 1KYIA 2IYWA 5FPKA 4M2LA 5CLLA 4TL9A 4DLUA 1WDTA 5DI3B 4K8OA 1E2EA 1BIFA 3BJIC 4XJXA 4ARZA 2WWYA 1JI0A 1VMAA 3T35A 3P26A 3UPUA 4DZZA 2FH5B 5LD2C 2ODEA 2IA5A 3M4YA 4OHYA 2GF0A 3OHMA 4MGIR 5FOVA 3IBYA 3TKLA 4B74A 4ZIRA 2QQEA 1M1YE 3IHLA 5CIQA 4KLNA 2YWEA 4CIDA 5LPNA 4QNRA 4EUNA 3NEYA 3VMFA 1COWA 1OV4A 2AN9A 2FG5A 2Q3FA 3DPUA 221PA 4KBGA 4DLWA 2IYZA 3I32A 3SJAA 2X2EA 4O2LA 3N5CA 3AGPA 2FDCA 3TLXA 1GDDA 2D4HA 4GPTA 1Z29A 1D9ZA 1KMHA 4F38A 1DE0A 2NTYC 2VIIA 2RB4A 2WJGA 4HEJA 1ZCAA 2ZR7A 5KU1A 4OI0A 1VCMA 4MGKR 1I2MA 4V0NA 1S1CA 4BEJA 2QGNA 5CITA 2ZS9A 1U98A 4TYWA 3MJRA 4RSGA 2HDNB 4DUGD 2JLVA 1ZUIA 1GNPA 1KKMA 4DCTA 5CB8A 4TZ0A 1U0JA 4ZDIA 4LYFA 2JCSA 4OK5A 4M21A 4C0JA 1O87A 5FTKA 3AVOA 4PC1A 1H8ED 1WQ1R 1PUJA 5AJXA 4JT4A 4ZCMA 5E3HA 1ONBA 1PVOA 2H5EA 2JJ2D 3EZ6A 4EKDA 3LVRE 4PAOA 4W5JA 3RAPR 3FHTA 1UPTA 1JR6A 1JECA 3RS4A 1NN0A 3D6TB 3Q72A 2A30A 1VYVA 3PG5A 1WCV1 5KDLA 4BEBA 4DHEA 4A2QA 2IBMA 4DXAA 4KXFB 5G40A 1YU9A 5KDDA 1VG9B 2VSFA 4LYHA 4LJ4A 5JWHA 3JVVA 1OFUX 2IC5A 3CWZA 4RCZA 2QU8A 1G8FA 2YHSA 2CL7X 4PHGA 4B34A 1TX4B 1ZC3A 2HXYA 4Q1BA 1SHKA 4JLKA 4TLBA 1AZTA 2PT7A 1GKYA 4NDZA 1EFCA 3PXGA 4Z1MD 3CZQA 1DPFA 3WYFA 4AYTA 4NKRA 1AIPA 1FTSA 3B9PA 1LB1B 5LDDC 3AVQA 1N6IA 1YR7A 2ZVPX 4PO9A 2AWOA 3F3YA 1FNMA 2L0XA 3RLFA 4JS0A 1ZAKA 1E2FA 3LQQA 3AVTA 3PEVA 3AH8A 1ZINA 3QKTA 4DCNA 1KI3A 1N25A 1Z22A 1R0XA 5B2ZA 1UJ2A 4A2PA 3KB2A 3AF3A 1ZP6A 3OEEA 1SQ5A 4D2IA 1NLYA 4XH9B 4HYYA 2F1IA 3BH7A 4QJ5A 4BLOA 1S3SA 2A5FA 3BH0A 3RABA 3RRYA 2O8DB 2J0VA 3EPLA 4F4IA 2IXFA 5DGXA 1LS6A 2G88A 5EXTA 2O0KA 2R6AA 4FINA 4O0MA 5LB2A 1A2BA 2X8AA 2KBFA 4AWXA 2W83A 4B44A 2EFDB 4A92A 2IEYA 4XSGA 4ZV4A 1II8B 3UANA 3GLIA 1TQ4A 2FFHA 2YWFA 4GFDA 2IHYA 1EFUA 1RFLA 2WVJA 3DDCA 3FE2A 2W58A 5EE1A 3THWB 4U5XA 5CM9C 1GM5A 2VHTA 2GEVA 3B7GA 4GDFA 2FF7A 2QRNA 1DEKA 3BOSA 1XPUA 3FGNA 4MRSA 5G3ZA 3BE4A 1ZM7A 4QKQA 4E22A 3F5FA 1KY3A 1N6NA 2PZGA 3KJGA 3OIUA 4C0KA 1OHHA 1ANKA 3IPXA 1VG0B 1ZUNB 2NO0A 2P0EA 1AKYA 3M6AA 3KXLA 3QF4B 4V03A 1G5PA 3KDSE 3AGQA 3CBQA 3PUYA 3LBHA 5EXSA 1FUKA 5CYPA 1CTQA 5DI9A 4E5UA 1KK2A 1IXSB 3CX7A 1S0UA 4CRWB 3FYHA 2RAPA 1E2JA 4PHTA 5CJPA 2A7QA 3K0FB 2AK2A 2DR3A 2DWPA 2F9MA 5EE9A 4M9ZA 4PAQA 1YR8A 4OYHA 2ZYTX 1E2DA 4N3NA 3B1YA 3BB3A 3H0KA 1XCMA 1YJ5A 1G3IA 1MV5A 1R6BX 1X8KA 1SVIA 3OAAA 5BN5A 2E9SA 1HT2E 1S1MA 2VO1A 1JJ7A 1MO3A 2DWOA 3K9GA 1Z47A 4A0HA 1LTQA 1U2RA 2GNOA 3FMIA 2WJVA 3REGA 1XXHB 2CVHA 1SXJB 5KYKA 3I1FA 4RFSA 2R65A 2VP2A 3D8BA 4XTRA 3X1YA 1U8ZA 2BV3A 2Z6VA 3EWAA 3ND9A 4RVCA 3BXZA 3IILA 5K8LA 4Q4LA 4LBVA 5BXQC 5K8TA 4GMXA 4Q03A 1Z0KA 1UBFA 1AKEA 3BS4A 2V1XA 3DOEA 3QKRA 1KJYA 2ZEJA 3AVVA 1OXTA 3DL0A 3KQUA 3W3ZB 4DUGA 1R0YA 4IEIA 5KOYA 1RC8A 5J47A 4OK3A 1LY1A 4IFBA 3TBKA 4JLJA 4HSEA 1HEIA 3EWSA 2A3RA 1TL7C 2XJ9A 3LY5A 3QI2A 4JZKA 4LJ5A 1N5KA 1MKYA 4EFNA 1T3LA 3T5GA 2JLYA 4ZPXA 2QMOA 2QT0A 2QNRA 5E7MA 1OXXK 2P2LA 3LBIA 4NCHA 3WBJA 3KL4A 4ITRC 2XXAB 4Q1AA 4AURA 2WWFA 1XEWY 4MUAA 1NBME 3OEHD 3PR1A 3U4QA 4FMDB 2VEDA 1G291 3IIMA 4M0LA 4M9QA 3VKWA 2WOOA 1N5LA 2IF2A 3CRRA 2CNWD 2WSSA 4LK2A 4FCWA 3A1SA 2MMCA 5D3QA 4PXAA 3SJCA 4MDEA 4Z51A 2ZJ2A 2OCYC 2QQ0A 4P33A 1II0A 4TT3A 4HDCA 1AGRA 3QXXA 1KO4A 1Q22A 3THYA 4AY2A 4U7DA 2IYTA 1VTKA 1JXMA 2Q6TA 2W00A 2E1RA 5DIFA 4HI0E 4QNMA 3H1TA 1IN6A 2GZHA 4XTCS 2ZVQX 4TLDA 3WNCA 4WOPA 1J2JA 4ZKDA 2QA5A 2GJAA 1ESNA 3P27A 1JQJC 2C78A 3ZIAA 1KI9A 1E69A 4C2UA 1OXUA 4TN1A 4OQNA 3ZIAD 2ZU0C 3NBFA 3KFXA 3SQWA 2QAJA 1BMFD 2UVQA 4HB3A 2R62A 3TK1A 1FPMA 1IN4A 2F1JA 2WKRA 1P9WA 5SZKB 3PEUA 1QHNA 4MA4A 3B9QA 5CM8B 4BZXA 4RY2A 2IEZA 1Z2CA 4QBFA 4GZMA 4GL2A 1T0HB 3EIEA 4BLTA 1TPZA 3C15C 1A7JA 4Z8YA 2C9CA 3C8UA 4YMSA 3EZ9A 3T61A 2ZREA 1Z8FA 1LW7A 5EUMA 2HCBA 4UJ3A 3D3QA 3BERA 2ZRBA 4BFXA 2ZRJA 3A1TA 4B76A 2GTPA 2H8KA 4A0GA 2CJWB 2GJ8A 4JJZA 4DEYA 1AQYA 2HYIC 1AK2A 1G4AE 1U0HC 3CR8A 3GLHB 4TWZA 1QHXA 5A0FA 1DBSA 2FSGA 1A1VA 1J7KA 2IS1A 3IEUA 4I1VA 1TQDA 3ZQ6A 4Q7MB 3VKGA 3MWJA 2VF7A 4P4SA 1C1YA 3AEZA 3EC2A 1EG7A 3BC1A 3LNCA 3CPHA 1F60A 3THXB 3PITA 4QL3A 1IONA 4BFVA 2P6NA 1YZNA 1S9HA 2UZ3A 5G53C 5H70A 4DC9A 4A9AA 2GK6A 4OJKA 2LCFA 3RS3A 1PUIA 2D2EA 4PAMA 5JFGA 2ZRDA 1NMYA 4OKSA 1L8QA 4Q4HA 2VPPA 2WPDD 4YC7A 1FTNA 2BKUA 4DT1A 5K8UA 2P5TB 1G3QA 1OHHD 1W49A 3T1OA 5L3QA 1A2KC 4DLYA 3VU9B 4X8LA 4BUJA 2G0NA 2J0UB 1NIJA 1NN5A 3K70D 1AA9A 4JBYA 4AKGA 4B75A 3GLGB 5K8IA 4F91B 1WA5A 2D74A 2GAAA 5J4LA 5IK2A 1MABB 2KJQA 4ASUD 1E0KA 1ELOA 1SVKA 3GCGA 5FPSA 4YMTA 5FL7D 4HDQB 1E2NA 3PENA 4TLEA 3WY9A 2REBA 1UBCA 4PC6A 2ZM5A 1EXMA 3I61A 1AM4D 1X1RA 3KTAA 4US0R 3MWKA 3EC1A 3NEJA 4RKEA 4JLMA 4C9BA 4NCJA 1KK3A 4TL6A 4UQOA 3RANA 3HYRA 3VR2A 2O8FB 4V0KA 2QGZA 2FPKA 5P21A 4C0AC 3EIQA 1NSFA 1KNQA 1IAQA 4TL8A 4A6PA 2FE4A 2FU5C 4XWKA 3ADDA 5B30A 1KAGA 3GLGA 2EYQA 4M8NE 1TUIA 1FX0A 2VHQA 4KI0A 3AKYA 3KQKA 4B32A 1NI3A 2KE5A 2PMDA 1KI4A 1G64A 4R2IA 3TR0A 4U00A 3WMGA 821PA 2O8CA 3QF7A 3UMRA 2OBNA 1XD9A 2WWXA 1RPZA 2PZEA 1JPNA 2BDTA 3C14C 2EVWX 1M7HA 2R6FA 5LB4A 1RRCA 3U2QA 2IS2A 2IW3A 1YQTA 2PLRA 3WNBA 1QBKC 2R2AA 3M1IA 4DCVA 1G3MA 3RSOA 3WYGA 4XWOA 5F9HA 4KU4A 4IW3B 3AF4A 2GCPA 3K1JA 4DSNA 3LAWA 2HLDD 3L8YA 3T1QA 5BWMA 1MR3F 3L8ZA 1MT0A 4P4SB 1DO0A 4LJYA 4Q1EA 3RSLA 3U7HB 2YZ2A 4HZUB 1KO8A 3A8TA 3DZDA 1ZW6A 2W2VA 1OIWA 3L0OA 5F2EA 1IY2A 3QPUA 4B2PA 1IXZA 3B13B 2H57A 4HAXA 2NO1A 3KFVA 4EFLA 4P4TA 2FX3A 3Q85A 2FPLA 4JL5A 2IWRA 3O8DA 5J5CA 1XEXA 4LHXA 3ZJYA 2CLCX 4B35A 4URVR 2X77A 2OBMA 2Z5FA 2RGNC 4A0FA 4LRWA 4Q4AB 1ZCBA 2NQ2C 3I92A 3MD0A 4JVSB 3ZDQA 1LV7A 3EIHA 3PVSA 2CBZA 3OF5A 4CEIA 1L4YA 4TMVA 3R9XA 2NPIA 3VR4A 4F4JA 2GVZC 4EAQA 3ZD7A 3IQXA 4TQUS 3RWMB 2RMKA 3AM1A 4WBSA 2MSCB 2Z43A 2NPFA 1BMFA 1UADA 1Y3AA 2IUSA 1NVVR 2OFXA 2YOGA 4M1SA 4Q9IA 4TSFA 5FTLA 4CEHB 5AJVB 1NJGA 1RW4A 3FDIA 1KY2A 4B3BA 1GL9B 1QG4A 1TF5A 1DAGA 4TQAA 4NTZA 2AK3A 1IOZA 4IVRA 4DDWA 2VA8A 1D6JA 2IYUA 3CPJB 1SKYB 1W0JD 2W6ID 2MMGA 5GJCA 2FSIA 1KO5A 1F6BA 4DCUA 3CNLA 2IYQA 4ESHA 1CJTC 8OHMA 1X86B 2DB3A 4AKIA 1F2UB 1G9XA 4MYCA 1NF3A 4G3XA 4TLCA 2WM9B 1YVDA 4PC3A 4NCKA 4KLZA 2ORWA 1RJ9A 3LH5A 5KHOC 1T0JB 2BKEA 4JBWA 4UKDA 3CM0A 5JS7A 3K0CC 3QUSA 5E4FA 1XJQA 1RJ9B 3LVQE 4V0LA 3GMTA 1E4VA 1UBEA 2AXNA 1DG1G 4DSTA 1OT3A 1P9RA 4UNRA 4TYNA 2ZJOA 4TTQA 4KAXA 2OLJA 4AK9A 2XXAA 3U3MA 2IS6A 2B8WA 2RGAA 3B6EA 4XSHA 1P3JA 2ZJYA 2E87A 2FFBA 3SS8A 4TYQA 4LGMA 1I4LD 2JLQA 2NO7A 3AUYA 4OHZA 1JEDA 4B48A 4QXAA 4B3FX 1XCGB 1V43A 1N6HA 1RYFA 4YMVA 1GTVA 3QVVA 4DJTA 1FZQA 3IGFA 4AIIA 1QVAA 1W4RA 2VH5R 3KTAB 5C46F 1ZVQA 4II7A 1XXHE 4ON9A 4DIEA 1XX6A 3VX3A 3RRNA 5FBRB 1F3OA 4YMWA 3WNDA 3EARA 1MABA 4N0DA 4DCSA 1E1RD 3W6OA 1W36D 3GJ5A 3ZQJA 3DOFA 1QG2A 2ZR9A 4OQFA 1NG9A 4RD2A 4MRRA 5DN6D 1PLKA 1G20E 1DG3A 4FCVA 3FPAA 4PHHA 3BFXA 5IK2D 4MDFA 1NMZA 4IDQA 5L3QB 3NH6A 1KTVA 4Q4AA 4DLSA 2FMXA 3NBZC 1G18A 1LS1A 5HE9A 2V3CC 3ZVLA 3A58B 3PIRA 1T91A 1MO5A 3SHWA 4IDPA 2ORVA 1F48A 4G5OA 4L9SA 4MYHA 2NZJA 2CL0X 4AG5A 3DO6A 4AYXA 1XDBA 1KKLA 1YZUA 3K0FA 2ATVA 2WWGA 4GT1A 4MKGA 3I62A 4XD7D 1NIPA 1FNNA 3LXXA 4LYJA 1EFTA 2PT5A 3KXIA 4JLPA 4G01B 3CF6R 1XBTA 2ODWA 3FWYA 3DEFA 3IIJA 4PPQA 3QF4A 2WWHA 4DRZA 3OIVA 1CR0A 3TH5A 4C30A 1SHZA 3EASA 5EE3A 1UKEA 2RGCA 5KSPA 1M6NA 5GADl 2ZRHA 3GFTA 3U3JA 3WP0A 2J46A 1Q12A 2PJRA 2C99A 1ZU4A 3ZH9B 3ICEA 2QROA 4M53A 2HV8A 4URZR 2R8RA 3QNUA 4KV9A 1KI7A 4EFMA 4PTLA 5CDFA 3SE0A 2C5LA 4QC2A 1E9SA 1NG1A 5E7IA 4YXWA 4ERNA 2GK7A 3SQXA 3ICQB 4N1AA 3SC3A 3U6KA 2IWHA 1G5RA 4YXWD 1XFAA 5JWOA 1CS4C 4LBZA 3B1VA 1OFTA 2WKQA 3PJRA 1RRGA 3PUXA 3TW4A 621PA 4A36A 1G1MA 5L3VA 1G16A 2H7VA 1UBGA 1GIAA 4MKIA 3W34A 3X1WA 2JIZD 2CK3D 2UKDA 4NYJQ 4D4JA 5FL7A 1KOFA 2YJTD 2QSYA 1T5IA 4LV5B 4PPFA 2GXUA 2MSEB 2QEQA 4CDGA 1NBMD 5BN3A 1G19A 3S1AA 2HT1A 3AB3A 3GJ3A 3PUWA 1NBMA 3BFVA 4OJQA 2XZOA 1KK1A 1E99A 1QF9A 3JVUA 4Y0VA 5AUNB 4KYIB 4BECA 4DIDA 4A8JB 3TR5A 2OHFA 4IEEA 4C2TA 1Z0JA 4ACBA 2FFQA 4XVQA 3U7FB 3NBYC 2QENA 1N0UA 1E9AA 3TUIC 3UWOA 1SULA 4Q1FA 1F2UA 4JIMA 5J4KA 2CDNA 2WMOB 3UG6A 4D6PA 2ODNA 4BPBA 1DO2A 2G83A 1BS1A 2G3YA 5TY0A 5KNCA 1CKEA 3WMFA 2PZFA 3E1SA 3WHLA 1DAEA 1Q20A 2WMNB 1YRAA 1VCNA 1EFRD 3GLHA 1XZQA 1ZMXA 2GZDA 3MMPA 2H1LA 2QI9C 421PA 2BMDA 1ZM3A 2C95A 3ASYA 3VR3A 4H1VA 521PA 3OEED 2WAYA 3QKRB 4P31A 4US1R 2J1LA 3EAQA 2FZLA 3K9HA 1ZM9A 4F93B 2O8EA 1P2TA 4IOJA 4QM6A 5FPYA 5BW8A 1C4OA 1TU4A 4DLRA 1IY0A 2OLKA 2V7QD 1SKQA 3LBNA 3O47A 4B3XA 4QHTA 4B2IA 4HB0A 2OM2A 1E79A 1X8JA 4RD3A 2LWIA 2REOA 2ZSAA 1LFDB 5ANRB 5TDHA 2EWWA 4IVQA 1UF9A 2B8TA 2JGNA 4Q7JB 4XVRA 1ZBDA 4C0LA 4CZ2A 3CH4B 1IBRA 1XNJA 4JKIA 3T5DA 5FTJA 1CJMA 2DHRA 4G5QA 4LV6A 4Z8XA 1E1RA 5JLJA 1OW3B 2GESA 2PX3A 2MSDB 1KDPA 1VYTA 4TMZA 1GOTA 3A4NA 1RKBA 3WBKA 2WWWA 4B6EA 3BORA 1KMHB 3B1WA 1HTWA 1TQ2A 3IO3A 5HKKD 3K8YA 1QDEA 3NHAA 3OIWA 4HAVA 4LWZA 3OE7D 4EPRA 2CHVA 2ZPTX 4HDOB 1YR9A 5KDOA 4IRUB 1NNEA 1BOFA 1G8PA 1IN7A 4FMCF 5TXGA 4B47A 3ASZA 5SZIA 1Z07A 3W6PA 4EIWA 1T9HA 5IT5A 2IL1A 1L2TA 2OXCA 4MGYR 4ZCIA 2GHIA 3DMDA 1GITA 5FPHA 1W44A 4OBEA 1TTTA 3TSZA 2JLZA 1XTRA 2O8CB 5B58C 3KXKA 3LX8A 3T15A 3U3OA 2NOAA 3P20A 4BLPA 2V1UA 4GSYA 4DLZA 4ARZB 1N6KA 3CZPA 3BBPA 3THWA 3KZ1E 3W5JA 3L0SA 5CLQA 4CEJB 4FXPA 2IYVA 2W2XA 3H4MA 1KIMA 5M04A 1XPOA 1N3BA 2JLSA 3QXJA 4V0OA 3U5ZB 2GJSA 3EXAA 3NXSA 5IHPA 4G0NA 4RZ3A 1G3UA 4LPSA 3MRSA 1N5IA 5LBIA 3LA6A 1D2NA 4RD0A 3RWOA 4UXJA 2QPTA 4W5HA 3H84A 1K5GA 1ZNWA 4K46A 3Q3JB 2WHXA 1W5TA 4LBYA 1LF5A 5CJ2A 5CDFE 1XJCA 2QORA 4PQRA 1PZNA 3HP1A 3CWQA 4AG6A 3MUFA 2IHBA 4DEXA 1CRPA 1OPXA 1G7CA 3K70B 2ECKA 4KSBA 4I1UA 3QKSB 4M9SA 2JDID 2PCJA 1E96A 4PZYA 2RHDA 1XJ0A 4LC0A 2JIZA 1KSJA 3T34A 1KO1A 3SN6A 2ZYWX 3QPWA 2ZE7A 3MCAA 2CCGA 1BO6A 2ZRGA 4FWIB 5HCIA 4M1MA 3ZS8A 1TEVA 1XD2B 1P2SA 4OI4A 3ZVNA 2O0HA 3KJIA 4TLAA 3R9WA 4TQ9A 4WXRA 4FMDF 3FOZA 3N2EA 3VR5A 5C4GB 4A1FA 2GETA 5D3MA 4RKFA 3X1DA 5C2JB 1OXVA 2Q3HA 3L82B 3SYKA 1COWD 4ZDJA 2IYLD 5JJIA 2ONKA 2W6JA 3LLMA 4M1OA 2ZUCA 4MITA 4CGZA 3A1UA 4ZDKA 2OT3B 3R20A 4JBXA 4D0LB 2VRWA 1KI6A 3A4MA 5KNBA 5KPJA 3SFZA 2WIBA 3IPYA 5FUYA 4IKEA 5UKDA 4N0EA 4Q47A 2NO6A 2QM7A 4S2EA 2W0MA 2D7DA 3GLIB 2OCPA 1EWQA 5EE0A 1Z63A 4YMUA 1U90A 3W8NA 5EP4A 1S96A 4X8MA 2OFWA 2XZPA 3MAAC 3U44A 1CR2A 2F9LA 1NL3A 5EQTA 2A5GA 2RGBA 4FW9A 4AKHA 1R10A 4BGDA 1YE8A 2I4IA 1U81A 2QMHA 4HB4A 4KFSA 3RRMA 1P62B 2DFTA 2BBTA 2OAP1 2WOJA 5FOUA 1TEXA 3A37A 5SZHB 3CRQA 3HU2A 3SHFA 3C41J 4H9GA 1YR6A 5DH9A 4JJKA 4QGFA 3ZGXA 4TYPA 3SBDA 2BJVA 4UNSA 3I72A 1E9DA 1GNRA 1HY3A 4LHWA 2H16A 3ADCA 1RZ3A 1E79D 2JLXA 4AYWA 3EA5A 2XSZD 2FOLA 4QG7A 1CR1A 2GBLA 4BFZA 5EXPA 4DBLC 1G21E 3A1WA 3GLHE 2PCLA 3R7WA 2OZEA 1ZM4A 2J41A 4A6XA 1OE0A 2GF9A 3AVUA 2ZRCA 5D3MB 3HPQA 4LDJA 2DFNA 2IYRA 3OE7A 1WP9A 2Q0HA 2GA8A 4ABYA 1Q1BA 2BMFA 5L3RA 2J0SA 5E7JA 4X8OA 4EPYA 1LNZA 1D2MA 1E0SA 3GEHA 4MYTA 2C96A 1OYYA 3U3KA 4G5RA 3HPRA 1E6CA 3X2SA 2XOKA 4OHXA 1N6OA 1BH2A 1K6MA 1C9KA 1E0AA 2ZS8A 5JHHB 4Q4JA 2CVFA 3KJEA 4DDVA 2I3BA 1OSNA 1P2UA 2Q21A 3GP8A 3U60B 3QEJA 3DMNA 4Q21A 2N1BA 1NY5A 1G41A 1KNXA 1ZD9A 5A4JA 1SXJD 2BHRA 4IOLA 3VNUA 2KI5A 4NYIR 1W4BA 1FQJA 1P61B 3LFUA 4KITB 4ZCLA 4BLRA 3V9PA 1EX7A 3DKPA 4TMTA 3ZLJA 1P75A 2VSXA 2F3RA 1P9NA 3W5IA 2J9RA 4BZQA 2NZ8A 1DTSA 5CK4A 1E2LA 2I1QA 2RGGA 2V8OA 2PL3A 1HV8A 3L43A 1IM2A 5C4MA 2F1RA 2XTMA 3R8CA 3QXSA 1H8HA 2V6IA 4B3CA 1VECA 2O5VA 2OXRA 4B3DA 1TNDA 5J4VA 1NJFA 5C18A 1X6VA 4URUR 5FR2A 3K09A 3I4LA 4BFWA 1N6RA 1VHTA 2BEJA 4R2HA 2ZYUX 2CL6X 3SBEA 1D9XA 5KNDA 1KHTA 3EPKA 3H2YA 3R7WB 1YKSA 1ZIPA 4A8JC 1NKSA 3VX4A 5G3YA 4R9UC 1W2GA 3SFVA 3CF0A 3TJZA 5AUPB 5DYIA 3MJHA 4GZLA 4LJ8A 3TAHA 2V55B 1N5JA 1G8HA 1U9IA 1TU3A 1NN1A 3DVLA 3PUVA 3DM5A 4YDSA 2NMVA 5BQ5A 1KI1A 4JLAA 1YZKA 2JJ2A 1M7BA 3OEHA 3JZAA 1RRFA 5F98A 1II8A 2FA9A 2VP5A 3I3SR 2XTNA 5IF9A 5DHAA 1JR3A 3KKOA 4PZLA 5DYGA 3VNVA 1CR4A 2WZQA 3GJ4A 3TW8B 2D2FA 3RS2A 2PBRA 2N46A 2FWRA 3CRW1 4LSGA 4NCIA 4IXNA 1ODFA 3UWKA 4KFRA 1GL6A 5B64A 1E9CA 1GKUB 3QSYA 2JAQA 5EUQB 3N70A 1I4TD 1Z6YA 2A78A 3KKPA 1MO6A 2KB0A 5FFMA 4E03A 1CIPA 4GBMA 1JNYA 2QG6A 4Q7KA 3GEEA 3HR8A 2ANBA 3HR7A 2OEPA 1PLLA 5AK0A 1U9IC 2BC9A 1E9FA 2RGXA 3UXMA 4Q1DA 2PEZA 2BCJQ 2ONJA 2RGNA 3EA0A 1ESMA 2GXQA 1NVXQ 5AR1A 5JEEA 2O8EB 3SJBA 2F6RA 4LCBA 4L16A 1EFRA 1T8UA 3C5HA 1GL7A 1BYIA 4XWAA 1HYQA 4QM7A 2CHQA 4JLNA 3B82A 2QE7A 4ZO4A 2EW1A 2XB4A 2W6IA 3ZVRA 4A82A 2FGKA 2GVDC 2ZJ8A 4R98A 1CULC 2ZJAA 3RVBA 4JMPA 3MGCA 3GD7A 1GILA 3B8HA 4UXIA 1CJUC 1P73A 3TIFA 2W0SA 1JR3E 3IIKA 4IVPA 2IS4A 2CLDX 1S9DA 2EYUA 2FNAA 3GQBA 1SXJE 4FMCB 3BWDD 4MKHA 4WZBE 3VAAA 2QMUA 1T3SA 2X2FA 3HYTA 1Z28A 3BIFA 3B1XA 3TMKA 1W2HA 2BBWA 4M1KA 4DB2A 3SOPA 1T4GA 2BMEA 2OFOA 2DCUA 2AKYA 4DB4A 2EU8A 3LW8A 4DSOA 4TT3D 3AV0B 1OH8A 1NLFA 3I5XA 3B2EA 1J90A 1KJWA 4BFYA 1VIAA 3QKUA 5H68A 2BMJA 1WBBA 3PEYA 4OQXA 2GCOA 1XF9A 2QZ4A 1VPLA 2JA1A 5DISB 4A2WA 1VHLA 2WJIA 1Q57A 2WJYA 2AWNA 3TUZC 1YHNA 2VTKA 1Z08A 1SKYE 4Q9HA 4PSVA 3RDPA 1MOZA 4JLBA 4LHYA 4D4KA 2ZS7A 1VG8A 4LY6A 4UNNA 4ZDWA 1OLOA 3FKQA 3IHWA 1ZM2A 3LXRA 2OUKA 1KGDA 4D26A 3ONWA 2Z0MA 2EFCB 2VLIA 5EZ6B 4XVUA 5FOSA 3PCRB 1Q1QA 1JB1A 5FOXA 3R8FA 1NRJB 3UG7A 2NGRA 1KJZA 4MKFA 1R2QA 2CEAA 1MRSA 3IO5A 1B23P 4PQFA 4OQMA 3CIOA 1OH7A 4FN5A 5GJWC 5ELXA 3AUXA 2ZYVX 2GEDA 1KMQA 3K70C 1AN0A 1YZLA 4GOXA 5EP1A 3V4FA 2SHKA 4B6FA 3I5YA 5HPYB 1PJRA 3VTKA 4BLQA 3FKSD 2YVUA 1GFIA 4XOIA 3U6BA 5HTKA 3FKSA 1SZPA 1S4QA 2G1KA 2HCJB 2ZE6A 3CNNA 4QJ3A 2RGDA 4KVAA 4M9XA 1HQCA 3CO5A 4EPXA 2ZI5A 1F2TB 4YONB 4HLDA 1A82A 1SVMA 2AD1A 1CXZA 1OFIA 1W5SA 4POAA 3SI7A 3NKVA 1FP6A 2HLDA 4HAUA 3QKSA 5EP3A 2R9VA 3KUCA 2RGEA 3CRMA 4ZI2A 4FWTA 1Q0UA 1A4RA 1AS0A 1R4AA 2FEOA 5FTMA 3LW7A 4QGGA 4NCNA 1GRQA 3TVTA 5FI1B 4DLXA 1QHHA 2QP3A 2J45A 3NBXX 2WSSD 1RIFA 3TQFA 2GKSA 2G0TA 4QGAA 1GKIA 2ZAMA 2QBYA 1ZRHA 3DHWC 3EZ7A 1E1QD 4NU0A 4HUTA 5B57C 1IQPA 5JEDA 1G4UR 1P7CA 2WAXA 1JR3D 2IUTA 1P6XA 4MGZR 1GVNB 2N42A 2CE7A 1G7RA 4PR0A 3EPHA 3BGWA 2B21A 3GJ8A 2GXAA 4GP6A 4XD7A 1ZD1A 4PPGA 1GSIA 2PMKA 5E95A 2KSQA 2J59A 2J3EA 3AKCA 3W90A 3GLFE 1TADA 4CEJA 3VHXA 2FSHA 2J7PD 1CU1A 4JL8A 1E98A 1Z6TA 5JCZA 2JJ1A 3CKLA 1G6HA 3FHCB 3ZYCA 4NH0A 3C4JA 2ZI4A 3KQHA 3CX8A 2Q9CA 3Q5EA 3LLUA 1DS6A 2ZUBA 2ZITA 1K8RA 2ODBA 2CCKA 4JSTA 1N0WA 1DELA 1IXRC 3GLGE 2QRZA 4R71A 3HU3A 2JLWA 3TE6A 2A5JA 2GWHA 4LZZA 1X8LA 3HWSA 2ASEA 3KUDA 4WVFA 3RNLA 1G8GA 3QBTA 1Z2AA 2ZRAA 3GJ0A 2NG1A 2XNSA 4Q9LA 5C1BA 4RJLA 4URXR 1V5WA 3UK6A 2AL7A 2DPXA 1XZPA 2AX4A 5L3SA 3MSXA 2JDIA 3W9YA 3AP3A 1E2KA 5JRZA 3QPVA 2EFEB 4IOMA 4JYBA 2P65A 3PEWA 1E9RA 3C5CA 4OHVA 3VKHA 2AXPA 4KFUA 1KSFX 2ZRLA 1NN3A 2OAQ1 4I81A 4NL4H 1NSTA 2VQSA 2J5XA 4OL0A 2X1VA 5DHFA 2ZJBA 5HCNA 1DVRA 3MG9A 5CIWA 1W36B 1QHSA 2GJ9A 1NVWQ 3WYAA 4L8GA 1GG2A 4G5SA 3F8TA 3DKVA 3QG1A 2ZRPA 3KQNA 1FOEB 2J87A 3OZXA 2GRJA 4F7WA 4QOSA 3BFKA 2AR7A 4NYIQ 3NDBB 1OB5A 1UKYA 4I1OA 4K81B 1Z0FA 3FMOB 3D7MA 3CH5A 5DN6A 3WXMA 4TL7A 2P6UA 2BCGY 1R5NA 1SVSA 2C2HA 2F1HA 4FI3C 2C04A 1SVLA 3GLFA 3FFAA 4QHSA 4HLUA 3BK7A 4IDOA 1KSGA 3CLVA 4HATA 4LBWA 1E4YA 4YLGA 1UEJA 5EJEA 5FH9A 1UKVY 3GJXC 3NC0C 1XTIA 3CPEA 5AJZA 1EESA 1HQYE 2ZETA 5GVSA 3GPLA 4EJSA 4DDTA 1M74A 4Q01A 3VR1A 4MRNA 4NYJR 3K9NA 3VQTA 4C3ZA 3KKNA 2DFLA 4HZIA 3ZD6A 4C7OA 2RHMA 4IJMA 3G5UA 2BM0A 2ERYA 1DAFA 3O8BA 1N6PA 3AVWA 1YZGA 1M8PA 1NVVQ 4XIGS 4A8JA 3RS0A 5JSZB 721PA 3IBGA 2R6DA 3QQ5A 1P60A 4GI7A 4KODA 1X3SA 4AC9A 4JT2A 4URYR 2JLRA 2CLSA 2P67A 1T8TA 1RYHA 1U99A 2OSBA 5DSZA 2A5YB 2IXEA 3Q5DA 4ACAA 3NTUA 5KTYA 1KO7A 2OE2A 2VSOA 4HUQB 3LD9A 1B0UA 5KSOA 2CHGA 1U8AA 2VHCA 2ZIAA 1E2HA 2VP9A 4I99A 4RCYA 3ADKA 2LKCA 5TV2A 3G82C 4AI6A 5BYJA 1UDWA 4BWYA 2XAUA 4P3YA 2F7SA 4UJ5A 2ZROA 4RD1A 1Z3IX 3REFA 1T3HA 2EQBA 1R0ZA 4TMKA 2NO9A 2V6JA 1JXOA 4HUQA 4KSCA 2DY1A 5BN4A 1G17A 4J0QA 1I4DD 5J4YA 4MUBA 4BRUA 2ERXA 1OKKD 1RRPA 3U7EB 4H1UA 1KDOA 1QRAA 4LHZA 2FFAA 3A6PC 2J0UA 4HAWA 3T12A 5F9FA 5CK5A 2GJKA 3NWJA 2EFHB 4EQ6A 1KI8A 2CNWA 1XEWX 4ZI3A 2HJVA 1G6OA 2AFHE 4DDUA 5JWRA 2QTFA 2BEKA 4Q4HB 1G7SA 1R8QA 3QXHA 5TMPA 5JSZA 2RCNA 2GBLC 5KSYA 1R5BA 3MWYW 1A5TA 4FCTA 4PC2A 2B7BA 1QHYA 3R9IA 2VHJA 3HU1A 2XGJA 2ZANA 4IOKA 1JEEA 4R7ZA 3MLEA 3K0AB 2XJ4A 2R6CA 2QP4A 3Q9LA 3LRPA 3QJYA 3IKJA 5BYKA 3AVPA 3E70C 3W8RA 2J7KA 4EJSB 1FMJA 1CP2A 1HUQA 3K53A 4WW0A 2BBOA 2JJ1D 4BQSA 5HZHA 2QAGA 1FFHA 4KO8A 1CEEA 1N0VC 3U61B 4X8HA 3GLFB 4RZ2A 1VG1A 3GLIE 3NVAA 4CEHA 4TMXA 2ANCA 1J8YF 2FJUA 4HLQB 2J0QA 1Z0AA 2YWGA 2ZJ5A 5AWFC 1UDXA 2WTUA 2YV5A 1KI2A 3BB4A 2XITA 4A4DA 5JRJA 3EZ2A 1E2IA 1Z6AA 4A15A 3NDPA 2XB2A 4G1UC 4D4MA 1S8FA 3TRFA 3QIAA 4TTPA 1FP7A 1GRRA 1SGWA 5EE5B 3V00A 1XRJA 3L0PA 4C0QC 5DNYB 1W36C 3TUJC 3MFYA 2KWIA 3P4XA 3W6NA 4BZPA 2QP9X 2I1VB 1OB2A 2ATXA 2YKGA 1EK0A 3Q7QA 1IN8A 2C9YA 5DE3A 1ZNXA 3ECCA 3F0TA 4RD4A 1WE2A 2B92A 2VBCA 3NC1C 4EPWA 5IRCD 2XNDD 1DARA 1XMSA 5H8WA 5FUXA 1E3MA 2K5UA 3AP1A 2ZRNA 4L5BA 3SDZA 3SU8A 2ZE8A 1P2VA 1E9BA 4Q1CA 2VF8A 5JCPA 2BM1A 3NHBA 3A4LA 5JHGB 2F43A 4BASA 3FHOA 3QG5A 3T1VA 2D7CA 2VP6A 1U0LA 3TAUA 4PSKA 4Q19A 2KBEA 3P4YA 1XTQA 2HF8A 4EPTA 1UAAA 2JLUA 3QBVA 2CXXA 3KJHA 3FMPB 3LDAA 1XP8A 4WXPA 4EPVA 3FTQA 5L8VA 4PO1A 3IEVA 3J81k 5JECA 121PA 2QL6A 1BKDR 3Q8XB 3S1AB 4EQ6B 2GILA 3K0EA 4HB2A 1Z83A 3QEOA 4JLOA 2C03A 4Z54A 5KO2A 2RKOA 4EDHA 5JJLA 4IXMA 4KYUA 1W0JA 1QZXA 2H18A 1QHIA 4KHZA 4O25A 4V0ME 2H92A 1Q1EA 3E2IA 3SJZA 4B71A 4Q7LA 5FUVA 4LV8B 4QBHA 2Y8EA 1R8SA 1YRBA 1WF3A 4Q5IA 4Q66C 1WB9A 2GAOA 4GMDA 4LJ6A 1JBKA 1OH6A 1UM8A 2XTZA 2Q9BA 2PJZA 1VIYA 4MH0R 5A5GA 2V9PA 3AF1A 1CRQA 4NPHA 4LJ9A 3ZZ0A 1GRNA 2PEYA 4RFVA 4NYMQ 4NONA 4NYMR 4BLSA 2GEUA 2PLFA 5CB6A 1LF0A 5FUWA 1JQLB 2FZ4A 4LI0A 4PX9A 4MRVA 2EFGA 4P32A 1AQUA 2P6RA 1W48A 2DFKB 2HYDA 1T6NA 3NIBA 5GJVC 2GZAA 1KZ7B 3CNOA 4CEIB 2QPOA 4DKXA 1TQ6A 4ZKEA 3W3AA 3EW9A 4PO8A 1GAJA 2ZR0A 4DT1B 4CYMA 5GJBA 5KUTA 3OFND 1G5TA 3B78A 4LOAA 2QT1A
chains in the Genus database with same CATH superfamily
4XQGA 4S0XA 1Q95A 1XAJA 2OTCA 3JQCA 1DEOA 1QFXA 2YC2C 3B48A 4U02A 3VNBA 4E2YA 5IHXA 1AZSC 1P0PA 4J3JA 5AVZA 5KYGA 1NR1A 1P5ZB 3DLHA 4G1CA 4U2KA 2PIDA 4X7RA 2ZI9A 4IQFA 5BRJA 5JU6A 1JR4A 3NHSA 4RL6A 2QTWB 3W8EA 4YV2A 1Z6GA 1EVYA 1VPEA 3O2NA 4FOPA 4GOKA 2X0JA 3C7KA 1HNXB 5EHGA 3JVDA 3C3XA 3K4HA 2BFPA 3NORA 1V6AA 1GPAA 3FOWA 5K6AA 4RZXA 3U7HB 1H1TA 4JJ4A 4RA6A 1Y9ZA 4O1IA 2ES4A 2EW8A 2CE2X 1JALA 3I1JA 3WZLA 1QNLA 5IAAA 3KT0A 4D6XA 3TNFA 4K3UA 4J90A 1DPGA 4MQUA 3OCUA 2M1XA 1V45E 3EZFA 3Q3GE 4UFOA 1IB6A 1C3EA 1D6MA 4BNDA 2HC9A 3OOYA 5KYNA 4B3HA 3P5SA 1NQAO 1BW9B 4MVWA 2ZSDA 5EMKA 1H2FA 3N2YA 5DNVA 5CA0A 4TS3A 4ZVPA 2R8YA 2ZUUA 2Y9MB 3KX2A 4QREA 4JI0B 3EC7A 2D1QA 2VJLA 2IVFA 2YR0A 3RUHA 5H7XA 4WFIA 4CF7A 4N0QA 3RC1A 3ZXUB 1E0JA 2BUBA 3A6KA 5A6SA 1RXUA 3DCYA 3E3OA 4J9VA 5H80A 1PQYA 4KBFA 1Q3HA 2FV8A 1YQWA 3UJAA 1GSOA 5I9NA 5IUKC 2RAVA 2PU5A 5KINB 4F92B 2J7PA 1KEEB 4BC0A 5KTRA 3T1TA 3RSZA 3K5WA 2C4HA 2FSSA 3CUYA 4KKXB 3GNTA 4P1ZA 2QRQA 1U9JA 4HS9A 1G7TA 3MB5A 3MRXA 4AW9A 1IEWA 2DJ5A 4W1RA 1F0YA 4UNPA 4CM8B 5KNBD 1FNSA 3HJNA 3KVOA 2QUAA 1P1BA 3PUZA 3YASA 1IAVA 3DMHA 1LI4A 2DAPA 4FFVA 1M0TA 4LY3A 3U3ZA 4JIGA 3RRZA 3Q4GA 4YR7A 3BXEA 2C2WA 3D3NA 3DE4X 4WCFA 5EERA 3VZPA 3RREA 2FN9A 1ORHA 2HU8A 2MINB 3AF0A 2BFDA 1BU8A 1W4LA 3EXHB 1CNFA 2V7QA 5H83A 3AY0A 4G0MA 2WJHA 5ALWA 1Y63A 5H59A 4ZQFA 3SLGA 4ZEXA 2NIPA 1XUOA 3F46A 3I73A 1RVDA 2OD9A 2DYKA 2QZ9A 3M0EA 3M6XA 1KDTA 4BC1A 3NHYA 5ENDA 2J9YB 3H9BA 3OOEA 3ESBA 4RPCA 2OK7A 3RT1A 2CNDA 2VNJA 1QP0A 4TV9B 2GDJA 1E60A 4KQMA 3PICA 4UM5A 4CL8A 1P4SA 1QIEA 4KFCA 1T34A 3WRXC 3L0CA 4YN3A 4ZEMA 3MTDA 1OXSC 5KSZA 4INPA 3QSGA 3BTOA 2XR1A 4M3NA 4N76A 4FMPA 3I09A 2X9VA 1E3WA 2XVYA 2FW7A 2ZYRA 3GLKA 4UNQA 3SYLA 3KQLA 1WDLA 1XEAA 2WRZA 4UHJA 3AONB 1TMKA 1XWIA 3IP3A 3X1ZA 3TVDA 1E7WA 2XEXA 1EU1A 3ZWNA 3IDAA 4WCFC 5JI3E 2ZI7A 4HDMA 3QJ5A 5CURA 3OZEA 4FHCA 3CQ9A 4LF8B 3HDQA 2GDZA 2Q27A 2RG1A 5EXXA 1AK1A 5FJIA 1HDOA 2NZYA 3CB4A 3WGLA 4DDKA 3VFDA 3NT2A 1XXHA 4UPEA 1RBYA 1YBHA 1S3IA 4TKMA 1Y1LA 1Z5PA 1C9YA 2AVDA 3DYBA 5E8JA 1SVWA 2X13A 3GHHA 5C3UA 1NZDA 1P5JA 3DZCA 3EIWA 4KPFC 3RTAA 5B4UA 3OZVA 3HUUA 4YV0A 3OSUA 3ULKA 2G71A 3I9JA 1UOQA 4ASUA 3FYDA 1TKCA 4HFRA 1F2TA 2VP0A 3QNWA 2HLPA 5HBGA 3QZUA 1UZUA 4V0MA 2WM8A 3VNAA 3IXQA 3K94A 4D3DA 3JAMA 1V5EA 4NARA 3QVUA 4I3FA 1SB9A 1UZNA 3QOFA 1ZGCA 3GBSA 1S3GA 4MP3A 2YIJA 1I9CA 4P54A 1T9AA 1UBKS 1XR3A 4E5DA 4D8YA 2J33A 1GPWB 2OD2A 4L78A 5AVJA 1V16A 4OBXA 3ICOA 4QSHA 5FPTA 3W5AA 3B60A 1EX6A 1IVSA 1GTMA 1HZZA 1U2QA 2BE7A 2QD2A 3L2OB 4NDNE 4W5RA 4O33A 1Q44A 2C9OA 4H0NA 3AR3A 5TMEA 1M1ZA 2QY9A 2HBZA 2XSZA 5H0IA 3Q98A 2FQXA 2G4CA 2XMZA 4H7EA 3SQMA 3BTUA 2E4VA 4JLVA 4QUHA 1L3CA 2G08A 1YSCA 2P7HA 5FI0B 4YREA 4Z3DA 4BO5A 4YH1A 3BMXA 4K40A 2CFSA 1EWKA 1CY8A 3O0DA 1M1NA 3ZN2A 1EFDN 1JLHA 2XBUA 4L3WA 3ZCPA 3UY4A 4WAUA 5KJFA 4ARBA 4IDHA 2CDRA 3IBFA 5ED4A 1GSHA 4GZ3A 2OXEA 4PGHA 3T7DA 2X4DA 1QAOA 2FWNA 2Z4SA 4MUHA 2E4WA 2CV0A 5DHUA 4HQ0A 5LWQA 4XGIA 1PCXA 1OFUA 4EJFA 3CW9A 3G17A 3K2IA 4PXYA 4EG8A 4GWGA 2Q3LA 3Q9NA 5I01A 1PU2A 1F9AA 3KPJA 3QY0A 4JL6A 5T57A 3RS5A 1VIMA 3W5SA 4V2UA 1EZ4A 2BKLA 3D8TA 4Y6SA 4ZVTA 3T7CA 1KDRA 3LDUA 4WBNA 3K9CA 3FSRA 1XZMA 2I6TA 3O8QB 3QVXA 1J49A 2X19A 2XI4A 4FDAA 3HZZA 3IDQA 4I19A 1NUTA 2P1DA 2IZ0A 1KVSA 2H0RA 2VYFA 2IX3A 2C4VA 4YLYA 2LXNA 4NENA 4DLVA 4GXNA 1EYZA 4I7EA 1ZK2A 3DSRA 1MC5A 2X8LA 3IAUA 2WP8J 3KYJB 2G9NA 3PGA1 4BBJA 4EL0A 2GSDA 2Q5OA 3L4KA 4GYJA 3F4BA 3VU9A 4CR7A 2ZZMA 5AW6A 1V8FA 1GLGA 2D06A 2CMKA 2JCYA 4WACA 1NQWA 1SUAA 3KQWA 1UKZA 2YS6A 1E1LA 3PX2A 1OLUA 3VR4D 2D3TA 1DBVO 2ZRKA 3RQSA 1DKNA 3N74A 3JQGA 4GH5A 3EXIB 5HUQA 3RHZA 2HJGA 3BD9A 3PF9A 3A36A 1EGMB 5ILGA 3ML1A 1T8SA 2WHYA 4ZOCA 1GZ3A 3H4VA 1KH3A 4BFSA 1V41E 5FTNA 1E9EA 4MW0A 4INZA 3EH2A 3AVYA 1IUPA 5TPZA 3H86A 3WGQA 2C4WA 1XD8A 2BFCA 3EG9B 3OM8A 5LP1A 1Z34A 1KFKB 1A5BB 4CUZA 1JHDA 2GWRA 1G5HA 1BHO1 2WSBA 2WWRA 1ZUHA 2YTZA 4B33A 2IYEA 5A4DA 1HT1E 4CM9D 4PW0A 5HJ5A 3O9MA 1WL8A 4HLUC 3O92A 4HX2A 3EG5A 4O5AA 4MRPA 3L6UA 3WV4A 4WTOA 5CHEA 4IX9A 5KNDD 4HQFA 1KU0A 4Q9KA 2C8JA 2ZJ4A 2DM6A 1M2KA 3FFBA 3KC2A 1KK0A 2AUTA 1NUSA 1SURA 1GPDG 1W0KD 4E14A 5D2CA 2OO7A 3UPTA 3RUFA 4ZZ0A 3AF6A 4BHTA 5M5BA 3LI2A 1WMSA 1CZOA 2WJWA 3JD2A 4C43A 3Q7PA 5BUCA 2G6TA 5CA0F 2G28A 1EKXA 2O7QA 2INGX 2YWCA 3C6KA 4A1OA 1XTSA 1Y5IA 4UEWA 3QVGB 2QLTA 1KY5A 1L7AA 1E2QA 1F9EA 2Y77A 3EVDA 5AJWA 1F14A 2VDQB 3PZRA 3EX7C 1F4LA 2ECFA 1VA5A 1Z6XA 1NUAA 3D31A 3HY6A 5CGQB 2Q5FA 4WNAB 1JF8A 3WQBA 4DE5A 3ZKAA 1G20A 2FZEA 5H5JA 1JS1X 1GGHA 1OFHA 4YNBA 3UA3A 1UT8A 2FSFA 3ND8A 1UK6A 2I4MA 2JLAA 2VZ9A 4DNFA 4NNJA 1GPLA 2AOUA 1HE8B 2RKWA 1FRNA 1CYEA 1F1JA 1DC7A 1ZYUA 2FN4A 1HFEL 1NXOA 1ODIA 3DBRB 4P3XA 4Q37A 4QYMA 5E38A 2Z8XA 3DZ8A 3KWFA 3T9DA 4CV0A 4F4UA 1JDSA 3TMYA 3I37X 5JFOA 4O0LA 1LA2A 1NA5A 2G1AA 1V0JA 2X4GA 4TVKA 5HIAA 4HAZA 2V97A 3EB9A 4ZTBA 5BT9A 3RS7A 3T3MB 5CCEA 4DLKA 4I36A 1GY8A 1KI6B 4HNHA 4M38A 4UMVA 1B1CA 3UMFA 4DNXA 1DIOB 1YZYA 2ZSEA 1O9HA 2WV9A 3OA2A 3O74A 2Q3EA 2ZJ0A 3TI9A 1L3BA 4UE2A 3A05A 3TTTA 1XG5A 3C1AA 3L7MA 3CRVA 2AE1A 4YWJA 1OZ0A 3QELA 2P9FA 4D99A 1R5JA 1UOPA 3SYNA 2GKGA 4EZIA 4O4JB 1QKJA 4JP2A 3RJ9A 1MO4A 3WR5A 3GQBB 4LZWA 4FXOA 3K09C 3V1LA 1ZOPA 3QXCA 4JXXA 4EZEA 1ORWA 4LUCA 4W6QA 4BMZA 5HGXA 4AF6A 2B9EA 4NAHA 1R0LA 3ESYA 2XXJA 2WMDA 1KF0A 3EMDA 1Y4UA 2VHUA 1G3RA 2PQMA 4ARIA 4PRZA 1L7VC 2OCGA 2AD5A 1HORA 1OX4A 4MVJE 4URWR 4JVMA 3V1KA 2JFUA 4AJOA 2I9PA 2O1SA 4J6FA 2H85A 2L82A 3LHIA 3SQDA 3AKEA 5DX8A 2IYYA 1XPRA 1FNCA 1BWQA 1JVBA 4GVLA 3ADBA 1XB2A 1JRLA 3EGXA 1MH1A 3RYHB 3IUQA 2KLHA 4CIWA 2ZAYA 1W5EA 2B3TA 3DEAA 1RQXA 3OM0A 1S2MA 1NX6A 2XZLA 1RQRA 1DL5A 1ISMA 1T5TA 3ECSA 3WNQA 1TF7A 6AT1A 1R0CA 4G4GA 2HCFA 4Q39A 3ZDRA 3WGVA 4NE2A 1PLJA 1X0XA 4JEMA 4LA4A 2Z3VA 1CUDA 3R5SA 5G41A 5H1YA 3W2IA 3PI6A 3G8DA 1TVEA 1QX3A 1E8NA 2QN1A 5FP0A 4BVKA 3I0ZA 4CKCA 2C54A 5F1PA 1T9GR 3ZIUA 4NP6A 3CLRC 3FYUA 3ENWA 3IHTA 1FFXA 4HQ6A 5E0KB 1BD3A 1RI2A 3BQNB 3IAHA 3SSOA 3ZZUA 1TYZA 1OREA 5EWJB 4UVDA 3R5FA 2V54A 1XDDA 2IYWA 2ZTHA 2ZBDA 2QTAA 4WBXC 1F4VA 4DLUA 5ALOA 1ZXBA 4ARZA 4C4OA 1QYVA 4D8TA 4KV7A 2TMDA 5CX1B 5DBGA 3M6WA 3UAOA 1JFLA 3T35A 1Y1QA 5TGZA 1MVNA 4B09A 2FH5B 4JBIA 2LBPA 1H4VB 4WY2A 3M4YA 3QRWA 2Y2VA 1KBZA 4YRCA 1J0XO 2AV6A 3PDUA 4CBVA 5EKSA 2GF0A 4HH4A 4MGIR 3TKLA 4B74A 1E62A 1M1YE 2HCTA 3I2JA 4G0ZA 3S70A 2YVQA 3FRHA 2YWEA 4NXMB 1LBTA 4CIDA 2YZNA 3D6MA 5CYFA 5ELMA 3VMFA 4EUNA 4KQ9A 2C2XA 4IDAA 2QZJA 5L4NA 1F12A 4XJSA 1OV4A 1ZVJA 2AN9A 4IX1A 1H66A 3ANTA 2PAAA 2X2EA 3AMVA 3N5CA 5AKIA 3TLXA 1HDEA 1HLPA 3PI7A 2JFWA 3ETEA 1NC1A 3OMWA 1GU0A 1AHHA 2WJGA 4UM8B 1TLTA 2ZR7A 2QQ5A 3HGMA 3RK4A 1VCMA 4S0ZA 5KU1A 5LUBA 1I2MA 3O4FA 1S1CA 4UBJA 2GO7A 2QGNA 2ZS9A 3PEEA 1U98A 1PWHA 3JSXA 5CITA 5C53B 1IXKA 2VAPA 1MQAA 4IGKA 1RWMA 3GVPA 5F5NA 2XT9A 3CN9A 4CKCB 1I94B 1YBMA 2E5FA 5CD9A 1WXHA 3DDOA 4MW6A 3B6JA 1GNLA 3OOJA 1KKMA 4HVCA 1GT91 1U0JA 3Q1KA 1MB0A 3H19A 4XX0B 2C7BA 2XQKA 4AZSA 4ZDIA 3ZCRA 1RYZA 1O87A 3CPSA 5ICCA 4PC1A 4NU8X 5ALMA 2Y1XA 1Y7HA 1Y8QB 3EPRA 1AG9A 2OO5C 4QU5A 4D8WA 2H5EA 2JJ2D 5T3YA 4CKZA 5JALA 5TIIA 1PVOA 2ECOA 4DWWA 1JR6A 1JECA 4CLRB 2XV1A 4I8XA 4C4RA 4DAOA 1QPZA 3D6TB 1T4BA 3RYHA 1MC1A 3RYFA 2A30A 4E07A 2Y1GA 4YJ2A 5KDLA 1SUEA 4RWZA 4AB1A 3TFOA 1NQOA 4QYIB 3QVJA 2IBMA 1P31A 4HQNA 1YU9A 3PQEA 4IQ8A 2GK3A 1VRVA 4DM4A 1T5SA 3INGA 4RCZA 1Z4MA 4QZVA 4ML3A 3M1YA 1JDBB 2JZNA 2JFVA 4PHGA 4RGYA 5L6MB 5FORA 4M8LA 1AZTA 4XIFA 5CT8A 1INLA 2VPIA 4YFYA 1GRVA 4FFBA 1EFCA 4KRXA 5FI3A 5LC1A 4PY2A 1DPFA 4Z1MD 2OB2A 5A62A 1DXHA 1EEHA 3H99A 1CJBA 4KH1A 1AIPA 3B9PA 2A0XA 3D6NB 4MVXA 4MWBA 4R31A 3WKAA 1V95A 3AI3A 1EI9A 4BVLA 1JFFB 4IHAA 2WJAA 2BEVA 3OE5A 3BD7A 3DF7A 4REOA 1RPJA 2AZXA 3ZY5A 1PK8A 1FNMA 3RFTA 1IG3A 3VDQA 4NFSA 2H9IA 4DCNA 1B00A 1KI3A 1WSWA 2CLOB 3CMMA 4JP5A 1Z22A 4KO1S 1FVOA 4UDXX 4CGYA 1UJ2A 2BYTA 3RODA 2ON6A 2PA0A 1LSUA 4D2IA 4UUQA 1DBIA 3EEYA 5AO9A 4U5QA 3JU3A 4URHA 1S3SA 3KQVA 1UP6A 2A5FA 4ZXPA 1PV1A 4TTVA 2J0VA 3CURA 1EDDA 2VJOA 2OO3A 3AZPA 3WZMA 3LSTA 4A27A 5JCOA 4CLOB 1FJXA 3UJHA 5BNZA 2R6AA 1M5UA 4G4IA 2C1EA 3DPIA 2B4TO 1A2BA 1F0KA 4PLWA 2W9XA 1R6XA 1YKFA 2EGUA 2HPVA 3FD8A 5DP2A 5DNAA 4K6KA 5FJJA 2BJHA 3HY4A 5CYGA 2QTTA 3GDHA 4XSGA 5DHSA 1II8B 3CINA 4HDSA 3ZX4A 1TQ4A 3N75A 4GFDA 5DTQA 1YF3A 2IHYA 3SZ3A 2WVJA 3DMYA 3THWB 3H9CA 1UM9A 3DCIA 5CM9C 3HL4A 3D5EA 4Y18A 5EWLB 5DW3A 2GEVA 3BJMA 4RV4A 3B7GA 3PQ3A 3GOHA 2WZCA 5C81A 1XWFA 5AKLA 3BOSA 5G3ZA 1ISGA 4GKAA 2O5EA 3C3CA 2QB5A 1EPUA 3LK7A 2YBEA 3IXMA 2FX2A 4CMIA 3D7LA 5ED0A 2AEMA 4TV9F 1J9GA 2B6NA 3HUTA 3IPXA 4AQ7A 2J32A 1A97A 4KR7A 3ZWVA 1ZUNB 1GQFA 2HX1A 1N8KA 2JFHA 3TBFA 2FMUA 3T3IA 4C21A 1G5PA 1T13A 4D5EA 3RUEA 2XE8A 3CBQA 2WF8A 4P35A 1PR4A 4AJIA 2PMEA 4EHKA 2GZRA 4YROA 3KB6A 1S0UA 4CRWB 3V7UA 3RTBA 4IGEA 1Y6GA 3IUSA 2AI3A 3D7NA 3PDHA 4OHCA 2TECE 2D1YA 5CT9A 1DX6A 1LSSA 1RWVA 1U8EA 3OZDA 5LQRA 2F9MA 5EE9A 2FETA 4M9ZA 2Q2WA 5KTSA 3QLUC 1LDNA 1E2DA 1OFVA 1K4YA 1WETA 1ORIA 1XAIA 4IIHA 3ZCUA 5JADA 4B4WA 1R6BX 2VC2B 2XDQA 2EP8A 2E9SA 3DAGA 3MGGA 2Z9CA 3JQGB 3PX3A 1MO3A 7MHTA 1Z47A 3CVJA 1LTQA 4G5HA 3VTZA 3JQAA 4HZGA 1ATZA 1GQ2A 3REGA 1G42A 3KSZO 1UXGA 3BEDA 3GMIA 2YNMC 2FVYA 4L1KA 4RFSA 3X1YA 2ZZNA 2IPLA 3A9VA 2BV3A 2CFTA 5B6JA 4Y9RA 3HKEA 1NATA 1B1AA 3T7SA 1LBHA 1RLJA 3HCRA 4GUDA 4DAEA 3OP4A 4MJLA 5J63A 2LUOA 3U1BA 3WZ2A 4H7IA 4M7RA 1NR5A 3CKKA 5BXQC 1MEJA 1NXTA 1AKEA 2V1XA 1M2VB 1XO1A 4HGNA 5IF3A 3C7DB 2IXBA 3OT1B 2ZSJA 2GHTA 3O8QA 4IYRA 5GZ6A 1YUBA 2GAIA 7ADHA 4DUGA 1XTPA 5H3CA 3N76A 1QRDA 2C82A 5J47A 1RWQA 1HOXA 1LY1A 3TBKA 1A7AA 2YJNA 4JLJA 3ZLBA 1N1MA 3EWSA 4I9NA 1LRKA 2VJDA 5TGTA 4JZKA 2EEZA 3C3AA 2OLEA 2Q3JA 1QGUB 1AU9A 1L4HA 1RNLA 3QYJA 3R09A 4CR6A 4DCPA 1KETA 4ROSA 3DMRA 1OXBB 2OFPA 4OQEA 3UHFA 1OXXK 3I64A 4NCHA 5GONA 4BOYA 2IEGA 4P3KA 1PWYE 4BKOA 4YAGA 2B4KA 3BDAA 3VU1A 2IKSA 3PR1A 2EHJA 4GXTA 1G291 3WVNA 1Z36A 4IWYA 4M9QA 3EDMA 5ALPA 2WOOA 1KR5A 1EFPA 5FA6A 1W5BA 2CNWD 2WSSA 1FXWA 1ZUWA 2QRGA 4W7IA 5D3QA 2PUBA 2MMCA 2F9FA 1XLTC 1SHLA 2OCYC 4M83A 2JCXA 3UTDA 4P33A 4TT3A 4FYYA 3OE1A 1U31A 2J3MA 3AR4A 4U2EA 3H7AA 1KO4A 4G37A 3R7SA 2G0AA 2IYTA 3EXFA 1JXMA 3AHIA 1VB5A 1CPYA 1Y3FE 1XK7A 4AP6A 2JAOA 1IN6A 4FHZA 4XTCS 3WNCA 3SXJA 2BZ1A 4BO0A 3KOUA 4ZT7A 3UJ7A 1ESNA 3GPBA 4P5EA 3VO2A 3WICA 4F2PA 1JQJC 3ET4A 4IMRA 4ZQIA 5JQGF 2ZM6B 3L7IA 4L3OA 1QE3A 4R9NA 4P38A 1E69A 2B5OA 3K4PA 1OLXB 1JIXA 3DZKA 4TN1A 3VYVA 4LZJA 1XHFA 3NBFA 2CJFA 1T6YA 2QAJA 4NI5A 3FVWA 3NKLA 4HB3A 4S1VA 2R62A 3GVHA 3H1PA 4Q3OA 3RGWS 4FX5A 1Q77A 4AXXA 4WZAA 2CD7A 4R8VA 1E7RA 3S2UA 1B6RA 1AXRA 2YIVX 3H0EA 1P9WA 5T4EA 2XPCA 3PEUA 4KQIA 4XPIA 5U4QA 3ZWQA 5CM8B 3K8ZA 2WUEA 3E22B 4TGLA 5HJ2A 4BZXA 3W1VA 4LF9B 1JHRA 2Q6KA 2IKQA 2JBHA 2QTLA 4NSNA 2VQFB 3EIEA 1SAYA 1W75A 3B5EA 4WLOA 3ROEA 1TPZA 1UFOA 2C97A 1B26A 4RPKA 1MFZA 4MROA 4TVOA 3FYSA 5KX5A 4HDMB 3W4IA 3E7DA 3L9XA 3GCDA 3T5TA 5BPHA 2W6MA 2IIQA 2ZWOA 3DW3X 4UFNA 5EUMA 2VTEA 2GBPA 2ALJA 1MN6A 3GVXA 4G97A 2AOTA 4BFXA 6NULA 3REOA 2R1TA 4REQB 1P9OA 3ZXXA 1TVCA 2GRUA 3LC1O 1LJLA 2DQKA 2GTPA 4B76A 4A0GA 2CJWB 2D1RA 2JNWA 2GJ8A 4PBSA 2Z6UA 1AQYA 3VDXA 1AK2A 3GLHB 4DV4B 3DD5A 3KTDA 1PKEA 6LDHA 5K6RA 4JI2B 3GUHA 1DBSA 5CEFA 4IG9A 2I33A 4O2AB 4D8UA 2FUG6 2FTKE 4Q7MB 1GKKA 3GG2A 3A6ZA 1Z45A 2I66A 2CMFA 5KVQA 1EG7A 2PNFA 3F4KA 2XECA 3HFRA 1NZJA 5FBHA 2HMAA 4C7MA 5IBCA 1VPDA 4IUYA 4JQZA 2P4HX 4KPUB 1XVAA 4WK6A 1X38A 1S9HA 4LY0A 4N7RA 5E6UA 3R7FA 1DOHA 4ER5A 4PAMA 4ZV7A 2YHBA 3IPLA 4YP0A 4IIEA 1NMYA 2XYRA 3TM4A 4YC7A 1I4WA 3FDJA 5B3JA 1FTNA 4G85A 3T1OA 4LDNA 1H5UA 3P45A 1IM8A 1A2KC 4GOLD 4F85A 1T5DX 2C4UA 1T8RA 3QK7A 4M99A 3VR5H 3D9QX 3L7YA 4AY6A 1K5HA 2HN9A 5AW4A 1XELA 2XOXA 4NQZA 4Y2RA 5A02A 1P6UA 4AWAA 1NASA 1NN5A 4DOMA 1QCYA 3K70D 5ALHA 3FTNA 3OZGA 4AKGA 5FFFA 1E6MA 2GPTA 2GAAA 5J4LA 2UXCB 2ZKLA 2KJQA 4BX2A 2KM1A 3OF2A 4CM8A 3OJ0A 4CFZA 1ELOA 1SVKA 2O0MA 3PWTA 4BWVA 5FL7D 4HDQB 4JLUA 1E2NA 1ZXXA 3R5HA 4MPJA 4PC6A 2ZJ6A 3RG8A 4I8DA 4EYOA 2QJWA 1QBGA 5JPIA 4IJUA 4AJHA 5I7OA 1AKNA 3C3EA 3EC1A 2PUCA 4JLMA 4C9BA 4MV5A 4NCJA 5I47A 1MB4A 1WUYA 4RGQA 5TEWA 4V0KA 3O84A 5TEVA 4XWKA 3ADDA 2X5XA 3Q3EA 3C85A 3M6MD 1KAGA 3I52A 2PYDA 3UJ6A 5LNK6 4JFRA 2PRYA 3P0HA 3KQKA 1R4NB 5JYCA 1OU4A 7REQA 4B32A 4EVIA 3JYQA 2FLWA 3OLXA 3ME5A 1Q7EA 4IDCA 1IOVA 3OTIA 4DRXB 3G0CA 4P6VF 4U00A 4UUNA 3TR0A 4B1FA 4BNMA 4BNDB 3JXEA 3HCNA 1XD9A 3PGMA 1W93A 3DFMA 5TT1A 3ABQB 1JPNA 1QUEA 2BDTA 3OCZA 4LOJA 5TC4A 4DBZA 5I9LA 4Z9YA 1M7HA 5I7FA 3MINA 3EN0A 1DRUA 1ADFA 1UBSB 3FUTA 3WNBA 1QBKC 1UQUA 4IJWA 4Y1RA 1VSUA 5ARCA 5KMGB 2M2IA 2NQTA 1D4FA 2AC2A 2D1FA 2JVIA 4CV1A 4F12A 2HLDD 5FULA 2A4MA 4ZVLA 1PZEA 2XCUA 3LPNA 3IC5A 4LJYA 2WTNA 3MN1A 4ZC1A 2YZ2A 3UAVA 1FXWF 3WLSA 1XI2A 2HA5A 1Y7IA 3DZDA 4UDNA 4O2AA 1JKIA 3K5IA 2XMPA 4Q12A 1V5FA 5F2EA 3R3JA 1FTYA 3KOOA 2H57A 1ZRMA 2ID8A 4FDTA 1GZUA 2XDAA 3A9RA 3MEQA 4MX8A 4BJHB 1ID8A 2FX3A 1U4OA 5BOVA 3R75A 3ZWPA 4EYQA 1QMGA 4Z3KA 1UKCA 2YS7A 3KE8A 5J5CA 3F74A 4D9IA 1C7EA 5JDIC 2GPAA 4REQA 5EMMA 3PJGA 4URVR 3HXQA 2AOTB 1U0GA 1LZKA 3I5MA 2OHJA 2RGNC 4Q4AB 1L6IA 1ZCBA 3MD0A 4EITA 2QSUA 4JVSB 3CH6A 1PQWA 3I83A 1AHIA 2J6HA 2XB8A 3UJCA 3N7TA 1E5VA 3I2IA 1C1DB 4F4JA 1JT9A 2R60A 2GVZC 2C4MA 1FYEA 3FH0A 3ZD7A 4XYBA 4TQUS 1C0LA 2RMKA 3CW8X 3RWMB 3VR5D 3ZJUA 1H1LA 3AM1A 3BYZA 3TWOA 3PA8A 2AQ8A 5ALDA 4D43A 2E4ZA 1PKXA 2R79A 1Y3AA 2NSLA 2YQZA 4N40A 1F7UA 1NVVR 4Q9IA 1NM5C 4TSFA 1UBJS 5FTLA 5AJVB 2WG0A 1JSXA 1D7AA 3AJEA 1YDEA 3FDIA 3HZHA 1TF5A 3N8NA 4IGIA 4TQAA 4UM7A 4HEHA 3E7XA 2GZ3A 1IOZA 4W5OA 1QK3A 2VA8A 5J58A 1D6JA 4B3RB 1CRLA 2WTXA 3NTRA 2VNKA 3EGWA 4NK5A 5GJCA 3BWEA 1KO5A 3TQSA 5G0SA 1WJGA 3VZBA 4ZMBA 5KBYA 4GGPA 1X86B 3FCYA 2FEKA 5I7RA 4QYTA 4ESOA 1T9CA 1G9XA 7GPBA 5KQPA 4G3XA 2ENWA 4W1QA 5JG7A 1YVDA 2A35A 4F8YA 4PC3A 4GXRA 5HKAA 3DD1A 3FJYA 3SDBA 1RJ9A 4GPD1 1OT5A 3N0TA 4DUZB 4UKDA 3PJEA 1L5ZA 1GZVA 3WIUA 4AUEA 3QUSA 1XJQA 1Y98A 1TK2A 4Z4QA 1J5EB 5EY5B 1G5IA 2A1TS 4V0LA 3GMTA 1NXXA 5IM5A 4KUHA 4N3GA 4N5HX 5LBTA 5C7OO 1P9RA 3K6SA 4PZPA 1GCUA 2YUIA 2JBWA 3QVMA 4LVUA 1IG0A 4GXQA 3NIDB 3G13A 3U3MA 3I3OA 3CLKA 1P3JA 1ZRNA 1NLMA 4ZI7F 4GMFA 4QPPA 2FHSA 1QGUA 4LGMA 2G7MC 4TYQA 1X87A 2QW0X 2PMCA 3SS8A 4B48A 5BY2A 2N3ZA 4QXAA 3BD6A 1VJDA 2MIIA 1RYFA 2J5BA 2PXXA 4X84A 2G06A 4DJTA 4UVHA 1YWGO 4AIIA 1QVAA 1Y80A 5JJCA 5C46F 3MIZA 3SZOA 2Z2KA 1TCUA 1ZVQA 3QYFA 3KEOA 1PL7A 4ON9A 4RFLA 3CZCA 5C9ZA 5K3FB 4B6RA 4PN7A 1C5KA 5D00A 2C7VA 2Y27A 5DV9A 1KMNA 4P7FA 1MABA 4N0DA 1M2VA 4PEVA 4MIYA 3P9PA 5I45A 3IIIA 1RCFA 1QG2A 2ZR9A 2P4UA 5JT1A 1NG9A 2PPLA 2ZAGA 2FUNB 4MQFA 3L0ZA 2BZGA 1I33A 1G20E 4K6GA 4EKYA 3D2LA 3TLBA 5JATA 3BHNA 1VHWA 5E3IA 4P0QB 2DOKA 2ZQYA 3NH6A 2DJIA 3G5LA 1U3FA 4HNGA 1LDYA 2R4UA 3WGMA 2O1WA 4RMHA 5DGCA 5JW6A 1QJCA 2VAXA 5DU2A 5F3DA 1ECBA 3HB4X 3NCHA 3IEIA 5HE9A 2V3CC 1ZI6A 1EK5A 2Q3DA 1T91A 5J2UA 2WHQA 3KWLA 1I1OA 4IDPA 4TKZA 3WKBA 4CQJA 3A27A 3AIIA 4EGJA 2GRAA 2JCBA 1EAYA 5CVEA 4A7PA 3CF4A 3G1TA 4FE4A 4UEKA 4ENRA 3KR0A 2OPHA 4KH0A 3LFTA 1AMOA 1P1IA 3DJFA 4G5FA 4J7XA 3KR1A 4MKGA 4XD7D 3U37A 2CEKA 3A4IA 1O6BA 3LXXA 3C5EA 4JLPA 3B7PA 1YQDA 3CF6R 3G49A 1UDCA 3TO5A 1E3SA 4DRZA 1ARZA 2RE8A 5DM2A 1VFPA 3GJZA 3QV2A 1IZ0A 4CFYA 1I0IA 1TLFA 5EE3A 1LWNA 3I9KA 2WU1A 4ZZIA 4JDPA 5K0LA 1YCGA 1EE9A 4FW8A 1OBCA 3HA3A 4LTDA 1M6NA 1FTGA 1ZH4A 4RHCA 5GADl 2W2LA 1I2BA 3U3JA 4XGQA 5JZSA 1PR0A 4EGSA 4QOJA 1U3WA 1ZQ9A 1O6CA 2J46A 3DUFB 1J0AA 4C5CA 2O6LA 1UPAA 2PJRA 2C99A 1ZLXA 2FPGA 1C3OA 3FVTA 4XCQA 4B45A 1MB9A 2JGAA 1KXZA 2JIOA 2HV8A 1EHYA 3JX9A 3L79A 1SH7A 2X6RA 3ZWAA 2VQ6A 4O08A 1JBQA 1KI7A 3R3VA 1B8OA 1PR2A 4YRQA 4EA6A 5CHYA 3U4MA 2VJAA 2OM6A 5CDFA 3RVDA 4QUBA 3ZWWA 1JKJB 2GN0A 4NNOA 4QC2A 5LU9A 3WIEA 5E7IA 1ZH8A 3SVLA 2GK7A 2Z2XA 2H4FA 1F0PA 5F7XA 4AFNA 4MUMA 3RVOA 3U6KA 5DCUA 2ZKIA 1YZFA 4ZYYA 2F3PA 4MDYA 2B5WA 2CXRA 5JWOA 5KWJA 3OX1A 1CS4C 1X1BA 1SRQA 2WKQA 5IG2A 2H29A 3QLUA 5TVGA 3PJRA 2H08A 1L8LA 4NZPA 2Q07A 3UV6A 1T8YA 1IHXA 3ZE0B 3BUSA 4NCAA 3NKFA 2IQ5A 1P7WA 3PFWO 4ZAWA 4B7AA 3TZKA 1U2DC 1KY4A 4RJKA 4YI5A 4EB6B 4UATA 2QEQA 1TO1E 1YZHA 1U0SY 4XW2A 1X8XA 3WK5A 3RJTA 3ZD9A 1F51E 1G19A 4AQDA 4ZZ2A 2G9ZA 2I6SA 3S1AA 3VGPA 3GJ3A 2XTJA 1I7LA 4OJQA 2X3UA 4Y0VA 3G2PA 2E21A 2GN4A 4DIDA 1NV8A 3LYLA 1C0IA 1U9YA 4HH3C 4IEEA 3TR5A 4A8JB 4DKJA 4ACBA 4TWIA 4QLOA 1QQTA 1GN9A 1N0UA 2JGKA 4A8TA 1LPAB 5ALIA 4L50A 4D98A 1WTCA 3UWOA 4NBWA 4PYNA 4Q1FA 5K09A 3CZ5A 2CDNA 3D59A 4FFBB 2JFFA 4MPTA 4O63O 4QAQA 1DMRA 2WEKA 3SVTA 4XM0A 2G3YA 5TY0A 1CKEA 1SC4A 2PZFA 1NC3A 2QAIA 3E1SA 5CXXA 3S44A 3LQYA 3WMFA 3UT5A 5FAXA 2J30A 5T4HA 1G21A 1EFRD 4QDTA 4DR6B 2GZDA 3VYTB 4Z4GA 3DCJA 8LDHA 5LP6B 1X7GA 4D3YA 1VLLA 3TG2A 2VHVA 3CZ9A 3H1BA 3VR3A 4QUAA 4H1VA 2K87A 3UKJA 5HRCA 2DH5A 5K05A 3QKRB 3GRCA 3QLTA 3HFGA 4F93B 4G0QA 4FGJA 4C2BA 3VSDA 1CYDA 3CEPB 4IOJA 3ER8A 4CLRA 1ODLA 3EGCA 5FPYA 5TQ0A 4OHOA 5BW8A 1C4OA 1IY0A 2OLKA 2V7QD 3LBNA 1EQ2A 1X94A 1C1DA 4UOEA 3L7JA 3N8DA 4HB0A 2ZVJA 1E4EB 1Z33A 1E79A 4HFMA 4LCJA 5CNIA 1J2YA 2LWIA 3WOVA 1ZRSA 3TI7A 1LFDB 4ENTA 3O03A 5ANRB 2Q41A 2YFKA 3BAZA 3C7AA 5F35A 3QLJA 4DLBA 4PSUA 1DJQA 4D9HA 4Q9DA 2IH4A 3CT4A 3DT9A 1WY7A 4FIZA 3CH4B 1QS0A 4N0PA 5FTJA 2XNKA 3QU4A 3T5DA 2DHRA 5KIAA 1E1RA 1QIGA 4IMJB 4Q05A 4MEBA 2D4AA 4F04A 5KJ1A 4LOLA 4X1KA 2HWXA 1VYTA 4BPBA 2J48A 4B6EA 2FG6C 1U11A 3BORA 2WSIA 3B1WA 3M5WA 3CTMA 3EGDB 3O2JA 1QDEA 4N8EA 5JVDA 3O8OB 1ZUD1 3CTPA 3EY4A 2D13A 3A6LA 3OE7D 3VOSA 2CXTA 1U8CB 4AJ2A 5A2QA 4YPOA 1EZ1A 2RHHA 5KDOA 1WCXA 1NJ8A 5JTUA 1JFSA 5TXGA 4W8HA 3PYMA 4H3VA 1M1XB 3ELBA 5SZIA 1ZEJA 5F12A 1PR9A 1Z07A 4Y1RB 5G0WA 4CN9A 4RF2A 2O3RA 3VZSA 1T9HA 5IT5A 1WDMA 2WUFA 1A04A 5AKKA 1VB3A 3STXA 1L2TA 3SAJA 3QE4A 3GRRA 4PCLA 3ZDXB 5DNCA 5REQA 4BZWA 4I4TB 3HMQA 1TTTA 2DPHA 3Q7IA 3L5OA 1XTRA 1QYDA 1QGOA 3IRUA 2CY0A 3IOEA 3LX8A 1XAHA 3NHWA 4QATA 1JW9B 1ONPA 1V1JA 1X2EA 2FP3A