4X8HA

Crystal structure of e. coli adenylate kinase p177a mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8hA00
1G17A 1Z2AA 4W5JA 2AXNA 2KSQA 2D7CA 4A2WA 2XX3A 5TY0A 1P62B 4DT1A 4QHSA 2G0NA 4HEJA 2V6JA 1EFCA 3QXXA 5FBWB 2WKRA 5DHFA 3WMEA 4WXPA 2UVQA 2VIIA 4Q9KA 2CL6X 1EX7A 4HZUA 4BZQA 4NPHA 1VDZA 4O0MA 5FUVA 5TDHA 3QVUA 2C9OA 4BECA 2WAYA 4DLYA 1HYQA 1X3SA 4GFDA 1GFIA 5M04A 3ND8A 1R6BX 4PO9A 3RC3A 5K8IA 1TF5A 3DZ8A 4PC6A 4UJ5A 2XB2A 2BWJA 2C77A 3OF5A 4Z1MD 3EA5A 3AP3A 4OI0A 1G5RA 2VYFA 1MRSA 1M1YE 1W2GA 3UG7A 1G3UA 2YOFA 4LHZA 3P4YA 4LBZA 4PQFA 4TYWA 3FVQA 1XXHB 3LNCA 4Q48A 4TLEA 4TMVA 1IY0A 2FE4A 3B2EA 4F4JA 1Q3TA 5B64A 3I4LA 4LYHA 2WJVA 4C3ZA 2VL7A 4R9UC 3LDAA 5FR1A 3RNLA 3V4RA 4ERNA 3SEAA 4RFSA 2D3WA 1COWD 4M53A 4Q4JB 3T15A 4MRSA 2VO1A 1BIFA 2FZ4A 4QNMA 2ZYTX 3SDZA 2NQ2C 5LDDC 2ERYA 4DLWA 1GRRA 5FTLA 5JCZA 4XSGA 1Z0AA 5JRZA 4Z1MA 4HLCA 2CCKA 4DSNA 2G6BA 4M1MA 5GADl 5HTKA 4Z8XA 1T91A 3AP2A 1PLJA 2OG2A 2QORA 2R2AA 2ZJ8A 4OK6A 2F9LA 4PO8A 1SHKA 2ZRMA 2D62A 3ZZ0A 1OYWA 4HDOB 1JAHA 3PUWA 1NIPA 4IHQA 5KNCA 3P4XA 5D3MB 5L3SA 3TIFA 2A78A 2BKEA 1CEEA 3T5GA 3O8DA 4QNRA 4PC2A 4YXWD 3H84A 4NTZA 2HF9A 5CDFA 3B82A 1COWA 3K0AA 2FPMA 1L2TA 1ZU5A 5ANRB 1N6NA 4MDFA 2A5GA 4W5WA 2ZI3A 1U81A 3ZYCA 721PA 1BOFA 5BW8A 2FOLA 3CUEF 1OW3B 2ZI6A 1E2IA 4BUJA 121PA 4DUGD 5LD2B 2R6FA 3PVSA 4UNPA 2WJHA 1Z3IX 4C30A 4C4PA 5KO2A 4LBVA 3THYB 2KI5A 5E7IA 1OKKD 2VH5R 4DIDA 3FMOB 3BH6A 3MSXA 4ASUD 3CO5A 4ABYA 4C2TA 1FPMA 2EVWX 2IT1A 2QQ0A 2Z4RA 4IRUB 4GZMA 5EE0A 4YXWA 4G01B 4CYMA 1MRNA 1O3YA 3UMFA 3IIMA 1HY3A 4TLDA 1EXMA 3HR7A 1CKEA 1NLFA 1WA5A 4AG5A 3CR8A 4MQBA 4G1UC 2WJJA 4TQ9A 4BFSA 1P2TA 2CHQA 4FIDA 1NLYA 4RZXA 5AJYA 2ZVQX 3U7EB 4A9AA 2AD5A 2W0SA 1N5IA 1Q12A 2KE5A 3K0FA 4JT4A 4LUCA 4OK5A 4LC0A 2WOOA 4QJ5A 3SJBA 4DUGA 1W0KD 2ODBA 1HURA 4X8MA 2O8FA 3DZDA 4N0EA 5ELXA 1QHIA 3GLFA 2F7SA 2P67A 4Q1AA 4FWIB 1UKEA 2OXRA 3AVQA 4A0HA 3GLFB 1UKVY 2B7CA 3LY5A 3K70B 1GKUB 2FSGA 1P9NA 5EUMA 4DCNA 1F5NA 2GBLA 2GCOA 2N42A 1E2DA 4L9SA 2GCOB 3RRNA 3W5IA 3U3OA 1R5NA 2CE2X 1JQJC 4UJ3A 5DYIA 2WJYA 1BYIA 3G5UA 1F3OA 1S0UA 5F2EA 3W6PA 3WMFA 5J47A 3UXMA 4DLRA 1NN5A 5CM9C 4TMKA 1BMFD 1OFUX 1E94E 3NVAA 1W0KA 4HAYA 2EYUA 3DOEA 4EKDA 2H92A 4MRPA 4W9MC 2CE7A 3K0CA 3CPEA 3PJRA 5AUNB 3KXLA 1X8JA 4OKSA 5DN6A 3B8HA 4NZYA 4B35A 2PT7A 4O3MA 1G7TA 1OF1A 4D0GA 4PO1A 3ZD7A 3UMSA 4BGDA 3A1WA 4JBYA 3D6TB 3NEJA 5H1YA 1Z2CA 1G16A 3BFKA 1KI6A 1E9CA 4LWZA 2C04A 5JLJA 1N3BA 4A6XA 3B1XA 3IBYA 3N5CA 2NPIA 2H16A 4IW3B 1N5JA 3AF0A 2J7PA 3F8TA 4DDUA 2BBWA 1ZIPA 1XCMA 3KUDA 1F6BA 3WHKA 2A5FA 4LY6A 1KZ7B 1LB1B 3NBYC 4EPVA 1NY5A 3FGNA 1EFHA 1OFIA 2EFHB 4HLUA 3VMFA 4IEIA 2F9MA 2JLSA 3CNNA 1WQ1R 1ZVQA 3KUCA 4YMSA 4DLUA 4LDJA 4RY2A 1GM5A 2GKSA 2YINC 1F48A 2Q3FA 3BGWA 1WXQA 4OHZA 4HB4A 4P33A 3SI7A 5JI3E 3D7MA 4NU0A 2ZS9A 1NVVR 4C0KA 5F9HA 1VIAA 4FI3C 2W83A 2BM1A 2ONJA 1NKTA 3KZ1E 1G8YA 1M7HA 4RSGA 2IYRA 2J5XA 1MO4A 2O5VA 5KYKA 1OH5A 1VG9B 2H5EA 5DI3A 1G6OA 3E2IA 3IUYA 4GOJA 4HB3A 4QG7A 3WP1B 3KFVA 4BQSA 1VYTA 2DHRA 2DYKA 2GILA 2QAJA 3H2YA 3VKWA 1JB1A 2JLZA 2B7BA 3BORA 1YR8A 2OLKA 2VHCA 2OCPA 3LH5A 4C0QC 3U6KA 2ZS7A 4Q21A 5KOYA 4Q1EA 3A4NA 1JBKA 1Z22A 2W58A 1XEXA 4ZCMA 3GLHE 1PJRA 1E98A 1KK2A 1QBKC 1XEXB 2NZ8A 2X2EA 3F0TA 5E4FA 5HPYB 4U7DA 4TTRA 3GLIA 2JLUA 4LYJA 2D74A 1G1MA 4Q9IA 2RCNA 1CTQA 5B2ZA 4O25A 2XB4A 3ZIAD 3TGPA 1G8GA 3FPAA 1VMAA 5KNBA 2QAGB 1JXOA 2X1VA 3ADCA 2ORIA 4XTCS 1TNDA 3NTUA 4A8JC 2ZSBA 2CNWD 3FMFA 2F55A 1JXMA 3W3ZB 2VLIA 3Q85A 1FMJA 3GJ3A 4WAUA 1JALA 1NN0A 4A6PA 1QDEA 3QPWA 2C99A 4TSFD 1UJ2A 3DPUA 4IVRA 1N0UA 3THXB 5JWHA 3K9LA 2V1XA 1DO2A 5A4JA 4J0QA 2J45A 4M0LA 1E1QD 3EXAA 3ADDA 3LRPA 3DM5A 4P3YA 3B7GA 2QGZA 5G40A 5UKDA 1S9HA 5JSZA 3KX2A 4OI1A 4HAVA 3ZIAA 4Q01A 3TQFA 2IYYA 8OHMA 2IYVA 4TL8A 2EWWA 3G82C 1MO3A 3IHWA 2QROA 2PLFA 4AWXA 3DO6A 4ILEA 4DCSA 4PTLA 4QM6A 2FGKA 3OFNA 5K8UA 1KI4A 1PV4A 2ZJAA 1KI2A 2DB3A 3OIYA 5FTKA 4DSUA 4ESVA 3L43A 4JYCA 1SXJE 2JDID 5KSYA 4TSFA 1U9IA 3VR5A 5JECA 3AUXA 1RZ3A 2FEOA 4RD4A 2ANBA 4E03A 1LY1A 1KYIA 1E1QA 4TL6A 1GILA 1E2FA 1Q22A 3TH5A 3TSOA 4XH9B 4IOJA 1CR1A 2BBOA 1W46A 1AK2A 521PA 5BN3A 1XWIA 4BLTA 1S3GA 3JVUA 1Q1BA 3AF3A 2I3BA 1GZSA 2ZYVX 5CIQA 3T34A 1E2JA 1GL9B 3DL0A 2RKOA 4C0HA 2ZRJA 2A7QA 4LJ7A 1RRFA 1MH1A 4YONB 3GJXC 3LA6A 2JDIA 4JL6A 2DCUA 1GRQA 3WXMA 4PQRA 4DLTA 3GLGE 5AR1A 5AJXA 1IXSB 1XNJA 2A3RA 2SHKA 5TV2A 3CWQA 2WHXA 4TWZA 1ZBDA 2IUUA 1G3QA 4DDTA 1MOZA 4PPFA 4JJZA 2YZ2A 3VR1A 1PUJA 3X2SA 1ZUNB 2FZLA 1W4RA 2GESA 1WE2A 4FMDB 5J4LA 2MMCA 4Q4LA 3QKRA 1A5TA 3RS4A 3THWB 4UXJA 3PIRA 1VECA 1FTNA 4JVNA 4HAUA 4P4SB 2O8CA 1P9RA 2FGJA 5FUXA 2W2XA 3CONA 2CCJA 3BRWD 2V8OA 4NYMR 5HKKD 1JR6A 2IYLD 3W34A 5EE9A 4DCUA 4D4JA 3L8ZA 4EJSA 1EGAA 5FPTA 4DWJA 4UNQA 4TT3D 5E7JA 3WP0A 1XD8A 3SHFA 1GG2A 4M21A 2ZITA 3UMRA 1KSHA 1KJWA 1II8B 2YKGA 4OL0A 4JSYA 3EPHA 2HT6A 5J4HA 3TBKA 4MRRA 1N0WA 4B2LA 1QHHA 3TR5A 4L5BA 2O8BB 3W5JA 2JIZA 2X19A 4URYR 1N6OA 2RGAA 2GF9A 4FCVA 4I81A 1T9HA 2A5DA 221PA 1GSIA 4GP7A 1ZAKA 4R98A 1HE8B 3KKPA 2GJKA 4ZPXA 5EP3A 3GPLA 5JS7A 4LPSA 3AQ4A 2F3RA 2J1LA 5HKKA 3BB1A 2C9YA 1LF0A 3IPYA 2B8WA 1DEKA 2XZLA 3Q3JB 1VHLA 4LHVA 1KMQA 4V0MA 1QVRA 1IXZA 1R5BA 5JI2E 2NZJA 1TF7A 2OE2A 4FMDF 1DOAA 3HJNA 3CR7A 5G3YA 2JLQA 4P4TA 2ZJ5A 3OIUA 4A0RA 3EASA 3UG6A 3U7GA 3SFVA 1NG9A 4I4LA 1T3LA 1T8TA 1TQ2A 3OZXA 4F38A 3CX6A 1P7CA 3UPUA 1ZIOA 2IHBA 4GZLA 2WMNB 3C7KA 1NIJA 2O8EB 1WMSA 2GZDA 1E9BA 2R65A 3RSOA 5LD2C 3R7WB 4CT5A 1AS3A 1HUQA 3NC1C 1ZD9A 4DLSA 1HQYE 5CJ2A 4C7OB 1Q0UA 4A2QA 4HZIA 2FFHA 3BJIC 2RGNC 1NBMA 2ONKA 3CNLA 5DIFA 3CWZA 4JLDA 1ANKA 2ANCA 4BWYA 4LV5B 3HWSA 3RLFA 2ECKA 3AM1A 2J9RA 1N5LA 1XPRA 5H8WA 1SXJB 3CB4A 4HUTA 3C16C 4XSHA 2PL3A 3KQUA 3MJHA 1IN8A 4D0NA 1OHHA 2XTMA 5AUOB 2JASA 2GEVA 2WM9B 4M1SA 2PCLA 3IHLA 1QHXA 4ZDKA 3QEJA 1M6NA 4LHWA 3JZAA 2VTKA 4HYYA 2J59A 2N1BA 4BFTA 2FN4A 1OLOA 5FOVA 2CLCX 4FXPA 4CW7A 3LVQE 3LXXA 1U8AA 1KMHA 1DBSA 1L4UA 2OXCA 4NBSA 5JEDA 2FMXA 3K70C 1YRBA 3SE0A 4QM7A 4WXRA 2RGCA 3LBHA 2CDNA 1ZMXA 1AN0A 3QBTA 1ZC4A 1W4AA 4FD2A 4TLAA 4Z51A 3PUVA 2OUKA 4MGYR 2CHVA 2BVNA 2REBA 3U4QB 3X1WA 5KPDA 3I5YA 2IS4A 3ECCA 2RH5A 2YC4C 5G3ZA 2OESA 4UNRA 3A1TA 1XP8A 3ETLA 2QL6A 1B0UA 4MH0R 3UIEA 2AHOA 4V0OA 1FZQA 1T0HB 3EIEA 4JBWA 3SYLA 1W36B 5EP1A 4URXR 1YE8A 4BLRA 1R0ZA 2G3YA 1IM2A 3TUIC 2BMEA 4C9BA 3ICQB 4NCIA 2XGJA 2YWHA 1BYUA 1Z28A 1NJFA 4B3CA 5K8TA 1ESMA 4CVNA 3KQKA 3X1XA 3AEZA 4LGMA 1JEEA 2KWIA 1U99A 2OCAA 1JR3D 3T1TA 2ZI5A 3KKOA 2PLRA 1XTSA 2CVHA 4LBWA 4DLZA 4YQFA 2PT5A 1G3MA 4TN1A 1Z0JA 3THOA 4BFYA 5DISB 1A2KC 3BS4A 5CYPA 1T6NA 4GRAA 1AA9A 5EZ5A 3NBZC 1G4UR 2YOHA 4EPXA 1D5CA 2FPKA 1KDOA 2WAXA 1U90A 3KTAA 3VU9B 1J8YF 2H8KA 2QMEA 2CK3D 3AVXA 4PC1A 4WZ6A 3KTAB 2GK7A 4MKHA 1OB2A 3CPJB 1UKZA 3MFYA 4JLPA 2H18A 4X8LA 4AYTA 4MYTA 3REFA 4QGHA 2QT1A 3ZH9B 2H17A 1IY1A 3LBNA 2ZETA 1S96A 1Z0KA 3QXHA 3EPLA 3RSLA 4CIDA 4B44A 1KI1A 1VYUA 4LPKA 5CDFE 3M1IA 3BFXA 1LTQA 1AGRA 3JVVA 4NCNA 2HJVA 2IF2A 4KBGA 4TLCA 2IX3A 5L3QB 3P27A 1Y63A 4V0NA 3ZVMA 4AK9A 3IILA 4D2IA 2KJQA 1KJYA 2QRZA 2ZM5A 5JWOA 1UBCA 3GMTA 5TMPA 2PX3A 2L0XA 2AWNA 4B2PA 3X1YA 6Q21A 1FX0A 2CK3A 2ZQ5A 1QHSA 2C8VA 3HU2A 3RRZA 1L8QA 1FTSA 3JZMA 1IN6A 4XD7A 4RD6A 2ORVA 4Q4AB 2NMVA 1QHGA 4NHOA 3AVUA 4KHZA 3CZPA 4ZKDA 4KO8A 1DE0A 4JLJA 1G8FA 4XWOA 2F1HA 1JAIA 2GAAA 2AWOA 4R2IA 2R8RA 3VFDA 2P6NA 2B8TA 5L8VA 3ZZTA 4HLQB 1E2HA 1S2MA 2ZRFA 3K09A 5IF9A 2R44A 4ARZA 5KPJA 4OHXA 4JLNA 2QAGC 2MSDB 2Z4SA 4PZLA 4W7SA 3MLEA 5AJVB 4DCVA 2VP9A 5FFMA 3U44A 2V55B 3IO3A 2PX0A 4URZR 1NN3A 2QNRA 1H8ED 4LJ8A 1N6PA 2NG1A 3HDTA 4RD1A 3B85A 1E2NA 2BBSA 1YR7A 4N3NA 2ZR7A 5J4KA 3GLFE 3NKVA 4I1OA 3BK7A 4ACAA 2VRWA 4B47A 3B1YA 4G0NA 1OH8A 3G0HA 2GXUA 2WSMA 1D8TA 2IXEA 2QMUA 3ZQ6A 1KI7A 1KTVA 3T35A 3EARA 1GNQA 5C4MA 1IOZA 3MG9A 3MRSA 2ZSAA 4Q1CA 3SBEA 4B3FX 4DT1B 3KXKA 2X8AA 4EFLA 1TU4A 4LJYA 4JBXA 2WSSD 3CNOA 3EIHA 2N46A 1AZSC 2OCBA 4ZI2A 2CHGA 2QQEA 4HZUB 5CLLA 3LBIA 2AX4A 1OIVA 2VPPA 3FWYA 4O2LA 4TMXA 2JLRA 1H8EA 5EE3A 1AIPA 5FTJA 2ZJZA 1IN4A 3CZQA 1CR0A 1OYYA 1XMVA 4LX0A 1YZKA 3H0KA 1SQ5A 3KKQA 2KBFA 3EIQA 4RD3A 5TXGA 3O8BA 1OFTA 4H1UA 1X6VA 5BQ5A 1RPZA 3R9WA 3A4LA 4HUQA 2JAQA 2QPAA 4YMVA 2G77B 3RC8A 3QY0A 1Z07A 2ZIAA 1QVAA 1XD2A 2CMKA 1BO6A 3DEFA 1UFQA 2QZ4A 3NIBA 3IQWA 1US8A 4Q66C 2PJRA 1MO5A 5BYJA 1TADA 1T3SA 3L8YA 1D2EA 2WSSA 3W6NA 2FFAA 1YZNA 1G291 1KDTA 2DFNA 3AF2A 4KSCA 4RFSB 1W47A 4B34A 3DKVA 5IDVA 1J90A 4IVPA 1GTVA 1KNQA 2Z43A 2OILA 4M1WA 1E0KA 4LJ4A 3EW9A 1IHUA 3R20A 1ZUHA 3WHLA 5AUQA 1G6HA 4GMXA 1IBRA 1OJLA 1XU4A 2RGEA 3QSYA 2WIAA 1ZM7A 4KJZA 4PHTA 3NXSA 2IYSA 5FPSA 5L3SB 3I72A 1GKYA 3AKEA 2JLWA 2I1VB 1KY2A 3BOSA 3OAAD 1GRNA 1YZTA 3PCRB 4GBMA 2QBYA 5FOTA 4Q7KA 2FFQA 3W8RA 4HDQB 5CIWA 3K0AB 3WRXC 1GNRA 1JQLB 3SS8A 1LVGA 4HATA 4ZDIA 5EQTA 4A2PA 2YJTD 4LRWA 3LX5A 1WB9A 3H4MA 3BH7A 1AJEA 4LHXA 2G9NA 1VHTA 1Z6AA 1G5PA 4KVAA 4Q1FA 3GLIE 5AK0A 1AS0A 2OHFA 4BE7B 2QI9C 3B1WA 2ZRAA 3PEWA 3I62A 4DXAA 1XCGB 5HE9A 2E87A 1JECA 1ESNA 3OAAA 2O52A 4PHHA 1YR9A 1AZTA 3EA0A 1SVSA 2IYUA 3U7HB 1HE1C 4P4UA 4I1VA 1X1SA 1ZCAA 4YMWA 3LW8A 4Q00A 2XJ4A 4JJKA 1NVVQ 1T5IA 3WY9A 3K0FB 2VBCA 4PX9A 2CXXA 2E9SA 2QTVB 3LQRA 5EP2A 4DRZA 3C14C 4XIGS 3VX4A 2O8FB 3DKPA 3QVVA 1G19A 2GNOA 3EZ6A 4MRNA 2YHSA 1TF2A 2MSCB 2ZRCA 1Z29A 5DN6D 5B30A 2YNMA 4B33A 2NO0A 2WWXA 1ZYUA 2EU8A 2VF7A 4WZAE 1ZM4A 1D6JA 2HJGA 1XJCA 4EUNA 1J7KA 5C2JB 3FDIA 4B76A 1R7RA 4JS0A 4D82A 2Q3MA 2Z6VA 3WBJA 1E0SA 1L4YA 1OXTA 4AC9A 2CLSA 1NJGA 4PANA 3GJ5A 4MGKR 3PFIA 1FNNA 2J7PD 4MUAA 3T1VA 1E9FA 2ZE6A 3RRMA 3BBPA 5KDLA 3I92A 4Q7LA 3QUSA 1E9EA 2WPDA 3KJHA 5EP4A 2C5LA 1YHNA 1XTIA 3NG1A 5FPYA 1KNXA 1FP6A 5CYOA 3IQXA 3QKUA 3A1UA 1GWNA 2VP6A 2ODEA 1SXJC 4HAWA 1G20E 4B73A 4OJQA 2J0UA 1HA3A 1A1VA 1EX6A 1CJUC 1ELOA 1PZNA 2ZJBA 3BD9A 4LJ6A 2V1UA 3ZJYA 1KAOA 1LW7A 1GL6A 4DBLC 3FKSD 1CU1A 1KKMA 3U3JA 3Q5DA 5TB5A 1KI6B 3QNUA 3WBKA 1W1WA 2ZPTX 1NSTA 2ZRPA 1W44A 1X8LA 1P3JA 2BBTA 4OI4A 1RVDA 1AQUA 2DR3A 3EZFA 2OAP1 4XVUA 1M74A 5CITA 4A36A 1FP7A 1XX6A 2QUZA 3V4FA 3E1SA 2IYXA 1S3SA 1JPNA 1R10A 2EFEB 2ZYUX 5P21A 1QRAA 3IBGA 4D4KA 2GVZC 2WKQA 3ZD6A 5HZKA 2FH5B 3TRFA 1BH2A 3PG5A 3GP8A 5CB6A 3CW2A 4M22A 1IN7A 2IXFA 4DEXA 4DLVA 1UF9A 4E09A 2O0KA 1Z0FA 1UAAA 1TQ4A 2TMKA 3VQTA 2XTNA 1EK0A 1XMIA 2HF8A 4JZKA 3K9HA 3EZ7A 4NH0A 2JGNA 3SYNA 1RC8A 2BMJA 3GJ6A 3FKSA 1W5TA 3TAHA 1W2HA 5A0FA 3CRMA 2G1JA 4KFSA 4Q1BA 1W36C 1LS6A 2FA9A 3RS7A 1II0A 3BERA 4Q18A 3C5HA 4AI6A 1XEWX 1D2MA 2FSIA 1S1MA 5DI3B 2OZEA 5IRCD 2JCSA 2P3SA 1CR2A 3QPVA 4KYUA 4GNKA 1G4AE 2H1LA 2OT3B 2A30A 2NO1A 3IGFA 3U3MA 3DHWC 5LBIA 1I2DA 2QTHA 3ZVNA 3NHBA 3AF1A 2HT1A 3HU3A 1W48A 4URUR 2VF8A 1A82A 4D26A 1RYFA 2DFKB 4CEIA 3I73A 2RAPA 4AKIA 2GETA 4EPWA 1MV5A 1SGWA 2JJ8A 4CZ2A 5JZVA 3GLIB 1YZQA 4RVCA 1G18A 1HT1E 4JYBA 4MGZR 3SOPA 4AKHA 5FTMA 3MJRA 1QG4A 4YC7A 3E5HA 3UANA 2JJ2D 1SKYB 1H8HD 3DMNA 2J3EA 3MAAC 4IOKA 4V0ME 4W5HA 1E4YA 1VG8A 1OXXK 3FFAA 3OE7D 5FOWA 3OFND 5LPNA 2NIPA 3SHWA 4AYXA 1R8SA 2JATA 2NO9A 4GOKA 1OT3A 4D25A 5H68A 4EPTA 5BXQC 2GXQA 2ZR0A 3TAUA 3TW4A 3WNBA 5DHAA 1SULA 2IEYA 3T5DA 2ZRGA 4MUBA 3A37A 2QY9A 2ZU6A 2VSOA 4NYMQ 2J0QA 2CL7X 2ZRDA 3PITA 5JHGB 4ITRC 4B3BA 4TYNA 4I99A 3SN6A 4CEHA 4KFTA 4DLXA 2H57A 1ZM2A 4OQNA 1KDRA 2OV2A 1P4SA 3EWSA 4CEHB 4F91B 4OI2A 5JSZB 1V5WA 3BAFA 1VG0B 2X2FA 4IJMA 1KO1A 4EDHA 1OXSC 1D9ZA 4Q4HA 3TMKA 4A0FA 2Z83A 3Q8XB 2JJ2A 1WDTA 1H8HA 4QRHA 2RB4A 5FBVB 3U60B 3OE7A 5F9FA 5KDOA 3HR8A 2F3TA 4MA4A 5F3WB 4FW9A 2YWFA 1R0YA 3MUFA 4G5QA 3U3KA 4R71A 4KV9A 1YVDA 5JHHB 4GI7A 1E2MA 1E2KA 3AGPA 2PEYA 3HYTA 2LKDA 1WCV1 4NYIQ 3VKHA 5HCIA 1IXRC 3GJ0A 4AKEA 3BE4A 1I4TD 2FEMA 2ZROA 5FOXA 3QKSA 1W5SA 5JMTA 3Q7PA 4CF7A 3LW7A 1S9DA 2GJAA 3CRW1 1Q57A 2C78A 3DVLA 2KBEA 1O87A 2B21A 1JJVA 1MR3F 4ZO4A 3A6PC 2BM0A 4JVMA 2V54A 4BLQA 2F1RA 1IY2A 3VTKA 3SYKA 2CJWA 1WRBA 4IKEA 2CJWB 1G7CA 4JLMA 4UNNA 1ZNZA 3R8FA 2QPOA 2RGGA 2D4HA 3RRYA 3H1TA 2F43A 2ZEJA 1HEIA 2RMKA 2ORWA 3LLMA 1ZRHA 3P1JA 3WNDA 4ZIRA 3B1ZA 3CRQA 2Z5FA 3PUZA 1ETUA 1L7VC 3CKLA 3VHLB 1WF3A 3GEEA 3OESA 1W4BA 3M4YA 3T1OA 2JIZD 1TPZA 3RS5A 3QXJA 3UK6A 4GDFA 1FFHA 4TYPA 3QKRB 4UXHA 4Q02A 3SJZA 4BASA 3KQNA 2WZQA 4FWTA 1NL3A 1XB2A 1RRPA 2FSHA 3DDCA 4GP6A 2O8CB 2QGNA 1G64A 1OE0A 3NH6A 3OIVA 4QGGA 1NI3A 5FPKA 1XPOA 1TQDA 2X77A 4LC1A 1UADA 3EC1A 4HB0A 4PSKA 2ZJYA 4TMTA 3W8NA 3WNCA 1M2OB 3A1VA 2JEOA 3ADBA 4MDEA 4EJSB 2YYZA 4HB2A 3AP1A 4HAXA 1YR6A 4YLGA 2D2FA 1U8YA 4N1AA 4QOSA 4G5GA 4C0SA 1KO5A 1KIMA 4A1FA 3F3YA 3J81k 2DFLA 4WVFA 3U6BA 1QHHB 5FH9A 1YJ5A 1GP2A 1Q1EA 4FMBB 1Q3HA 4QBHA 3B9QA 2IF0A 2OBMA 1K8RA 3T1QA 5IHPA 4GSYA 5J4VA 1R4AA 4NYIR 3ADKA 1JR3E 1NG1A 4BEJA 1DO0A 2HUPA 3PQCA 1RYHA 4MKGA 5GVSA 2ZE8A 1NBMD 2JA1A 2ZRKA 4ESHA 1LFDB 4BZXA 2C98A 4LYFA 3UATA 4BRUA 5KHOC 2C95A 3QF4A 3GLHA 3HPRA 1JEDA 3BFVA 2VEDA 3O8CA 4P31A 2GDJA 2EFCB 1OHHD 3FKQA 4OBEA 5G53C 1P9WA 3EAQA 4FINA 2FFBA 4Q9HA 1UDXA 3FE2A 4NYJR 4OQLA 1YU9A 1IQPA 3L82B 5JWRA 4OHVA 1J8MF 1I2MA 3K9GA 1EFUA 5EXSA 5GVRA 2WWYA 1GITA 2C03A 2R6GA 4M1OA 4WOPA 4GL2A 2OCYC 4BFUA 1U94A 1JNYA 1E1RD 3CF6R 1EWRA 3SC3A 1OXVA 5FBRB 1SVLA 4RZ2A 5A5GA 1P2UA 3WYFA 4Q9JA 1VCMA 3U2QA 1IONA 1QF9A 2Q9AA 1DAHA 2WV9A 3LD9A 2D2EA 1UPTA 3QIAA 2DPXA 2IUTA 5C1BA 821PA 4S35A 2UZIR 4KU4A 3VNVA 2ZI7A 4JL5A 3VR3A 4CDGA 2G83A 2GJ8A 1N2CE 4EPRA 1KHTA 4YDSA 2VHQA 3AH8A 2HXSA 4TMZA 3WMGA 4A4DA 1P72A 3FTQA 1WBDA 3LO5A 4ZDWA 3MWLA 3TSWA 1QHYA 3QBVA 4KVGA 5FI0B 2QTFA 4LHYA 2QSYA 1E1RA 1Z0DA 3P26A 2DWQA 4N0DA 1E6CA 1KMHB 2IYZA 2W6ID 5LB4A 4LOAA 1AM4D 2REOA 1U8ZA 5TARA 4CEJA 2ATXA 1NF3A 2O0HA 4EQ6A 2GBLC 3A36A 4RCYA 3ZVLA 2ZI9A 1TEVA 3OIWA 5JRJA 5J5CA 2GTPA 4TL7A 1OH7A 2I4IA 5K8LA 4TQAA 4B48A 2ASEA 1TAGA 3I8SA 5FBQB 1N25A 1VCIA 1DG1G 2W00A 1RFLA 1SVMA 1NLZA 5AWFC 2OM2A 3NBXX 1AKEA 1ZP6A 3BB3A 1CS4C 3K0CC 3VR2A 4JLOA 4Q7MB 2GVDC 2FJUA 3CRVA 4H1VA 4IOLA 4QBGB 4UKDA 4ZCIA 2W6IA 3Q7QA 1W49A 2A5JA 1LV7A 1KK0A 4LJ9A 4TL9A 2RHMA 4CRWB 4ZKEA 3LV8A 1TUEA 3DM9B 4M2LA 4BFXA 1BS1A 2JJ1D 2FPLA 4EFMA 4D0LB 2Q6TA 2PBRA 1VTKA 3ND9A 4B75A 4ON9A 3IIKA 4WBSA 1Z6TA 1RRCA 2P6RA 1G5TA 1ODFA 2G88A 3NHAA 1P60A 2P2LA 4XD7D 3AVVA 4JIMA 4U00A 3HYRA 4HLUC 4QKQA 3RYTC 1NMXA 1VYVA 4B3XA 3IIJA 4XWAA 3AVYA 5HE8A 1CR4A 3OEHD 3A58B 3PENA 5F98A 3FYHA 5EXTA 3PUYA 4KI0A 4UNSA 4BZPA 1P2VA 1XBTA 2JJ1A 1W0JA 3S1AA 4U5XA 1OPXA 5JCPA 1DAFA 3S1AB 4A8JA 1I4LD 3AGQA 1ZNWA 5EE1A 1P61B 3H86A 1UBFA 3IPXA 1XPUA 3HU1A 1E69A 4UQOA 3Q9LA 3TLXA 2QN6A 4B2IA 5DH9A 1XTRA 3R9XA 1FX0B 1XCPA 2VHJA 3P20A 2YWEA 1NP6A 1UBGA 3GFPA 3NEYA 5KSOA 1ZCBA 1E2PA 3EX7C 2XZPA 2BCGY 2AKYA 3WYAA 3PEVA 3BXZA 2O8DA 2XNDD 1EESA 1MABA 2QSZA 5SZKB 2ZRIA 3NC0C 1MABB 3GJ7A 4JLKA 4QHTA 3VX3A 3RAPR 1Q20A 2B92A 3OEHA 1TQ6A 2XZOA 2AXPA 1DARA 3AKDA 2Q0HA 1Z63A 1TUIA 5J4YA 1AGPA 1KJZA 4ARZB 5DSZA 3TNFA 1E2QA 5DNYB 3U44B 2LWIA 3TR0A 3UKDA 3W9YA 4MYUA 3I1FA 4QJ4A 2NPFA 2IYQA 1FL9A 3I8XA 3EZ9A 2PZEA 1BKDR 2XNDA 4AY2A 1KY3A 2WMOB 1F2TA 2ZVPX 1SVIA 4MITA 1KGDA 2XJ9A 4X8HA 4D81A 2AFIE 1FQJA 1F2UA 2XEXA 2YWGA 3CF0A 2XITA 4NL4H 4QBFA 3E70C 1XMJA 2ZUBA 1DAIA 3AF4A 1AKYA 2DY1A 1E3MA 1DELA 1OSNA 1KO7A 3MGCA 3O8RA 2IK8A 2RGBA 2HV8A 3ZDQA 1YZUA 1XDBA 4PHFA 4ZCLA 4II7A 4TLBA 2PZGA 3D31A 4DIEA 2QRNA 3AVOA 3L2OB 3A8TA 4MRVA 2VP0A 4ZV4A 1XEFA 1ZINA 1U98A 4PSVA 2QG6A 4F92B 4M1YA 4C0AC 4DSTA 3SU8A 2WIBA 4JVSB 4RD2A 5JBQA 3LLUA 1U9IC 2BCJQ 4GPTA 1OB5A 4RD0A 4DB4A 4HUQB 1HV8A 1DAEA 1RKBA 3I3SR 3C5CA 1GIAA 3KJIA 5DYGA 1XD2B 2ODNA 2MSEB 5L3RA 1US8B 3AUYA 3MWYW 4GMDA 4BLSA 1UBEA 4KXFB 5D3QA 2E1RA 2FU5C 4JLVA 4NCJA 1W7AA 1Z6GA 2XOKD 3ZLJA 4GT1A 4WZBE 1MKYA 1P6XA 4H9GA 2P6UA 3W90A 2VQSA 3Q72A 2NO6A 1FNMA 1WBBA 4JSTA 1Z83A 1XXHA 1SVKA 1GVNB 3OHMA 2ZJOA 4IXNA 4E5UA 2OFXA 1KSFX 4IOMA 1CJMA 1XRJA 4TYQA 2FX3A 4I1UA 4KLZA 5EXXA 4Q4JA 3ZS8A 3TE6A 2QT0A 4BFVA 1E0AA 1NVWQ 1OFHA 1LF5A 2CEAA 1D9XA 2IUSA 3GFTA 3KB1A 3DMDA 1FW6A 2A9KA 4M4SA 1NRJB 2NO7A 3L0PA 2P0EA 4DDVA 4JMPA 2XOKA 2ERXA 2QBYB 4PPNA 1EFRD 1T5LA 3GCGA 4HLDA 3M0EA 5IK2D 4E22A 3AVPA 1II9A 3CM0A 4G5RA 4NDZA 4R2HA 5HR5A 5D3MA 3GQBA 5HZHA 4DJTA 4B74A 3QG5A 2KB0A 1FMLA 2GJSA 4EJSC 1ZJ6A 3LXRA 3NBFA 3REGA 2DWOA 3L0OA 1E99A 1U0LA 1T0JB 4PC3A 4Q5IA 5H70A 2QMOA 5SZJA 4IDQA 3RS3A 4C2UA 3B13B 3KXIA 2XTZA 1KSGA 4TQUS 1XEWY 1YKSA 1XTKA 3SQWA 5FUYA 1VKJA 2C96A 4A82A 3MWKA 1SKYE 2IWRA 3AVWA 2W2TA 1EFRA 1KSJA 1N6IA 1UEJA 1ZW6A 1GNPA 3F5FA 1FQKA 5IK2A 1XMSA 3TQCA 3EC2A 4QC2A 3I5XA 3CLVA 3THYA 4LI0A 1E2EA 5BN4A 4A92A 5FR2A 4RJLA 5BYKA 4DHEA 1Z0IA 2IWHA 2RGNA 1JPJA 3QG1A 3K70D 4L9WA 5AUPB 3N2EA 3TUZC 3X1ZA 2WPDD 2QM8A 3X1DA 2GA8A 2BV3A 4HAZA 2EWVA 2FSFA 1CULC 1GAJA 1DAKA 1H65A 4M9ZA 4GOXA 2GEUA 3ONWA 2IXGA 2JLXA 2ZSDA 4IDHA 4KLNA 2AR7A 1C4OA 3AKYA 3P32A 5FBLB 3RHFA 2WWGA 4X8OA 4D6PA 1OKKA 4IEEA 4Q19A 3DOFA 2R62A 2F1JA 1Z5ZA 3NDBB 4ASUA 4NCKA 3QXCA 5CK5A 2PMKA 1OIWA 2A5YB 5DE3A 5CM8B 3LWNA 4LJ5A 4XVRA 4PPGA 2VA8A 1CIPA 4JLAA 3W3AA 1CRQA 4F93B 2BJVA 1Q21A 2PZFA 2GXSA 4MGIR 4NKRA 4LK2A 5DGXA 2BMDA 1P5ZB 4PXAA 3BC1A 3HPQA 2DWPA 4G3XA 3WRYC 2ZI4A 3V9PA 2GZHA 1G9XA 1TL7C 1DG3A 2IHYA 3FFBA 2PCJA 2J0UB 1GUAA 2HCBA 4TZ0A 5AJZA 4V02A 4C0JA 4ACBA 1N6KA 2BKUA 4K81B 3GJ8A 1XJ0A 2EFGA 1ZC3A 2VHTA 4QXAA 4BEBA 2WBLC 2J46A 3GFOA 3TVTA 4EFNA 2YV5A 2WOJA 2BDTA 4B32A 2R9VA 5HCNA 1KK3A 3UWOA 1R8QA 4LYAA 5B57C 4IDPA 1G3IA 4DDWA 1J2JA 3MMPA 2VHUA 3BIFA 4WA7A 2WTUA 4NP6A 1CF4A 2AKAB 2ZUDA 1R0WA 3K53A 4IFEA 4JVLA 4URVR 1S1CA 4U02A 1C9KA 4PAMA 1DS6A 2XSZD 2OEPA 1ONBA 2G1KA 2LCFA 2FNAA 5EJEA 4B3DA 2RHDA 1BMFA 5KSZA 3RDPA 2QMHA 4KITB 2ZR9A 4R7ZA 2W2VA 1V43A 1Z6YA 1OIXA 2OO7A 1ZD8A 3TSZA 4OQXA 1KDPA 2UKDA 2ZANA 3ZQJA 2R6DA 1Q44A 1G8HA 2IYTA 4G5SA 2LKCA 1EWQA 2QEQA 3PR1A 1LNZA 5GJBA 1KO8A 4M1KA 4RKEA 2CBZA 4V0KA 2ZXUA 2FG5A 1RJ9A 1EG7A 2F6RA 2V6IA 4OYHA 5SZHB 2RGDA 4PZYA 1RJ9B 2ATVA 3VHXA 2DBYA 4B6EA 1HT2E 3A4MA 2IS6A 2R6CA 1QHNA 4LCBA 2V7QD 1FUUA 2F1IA 2QP3A 2ZE5A 2XSZA 3AKCA 3NH9A 2BMFA 5AJWA 5JEEA 1TEXA 3N2IA 1J70A 2IBMA 1SKQA 4US1R 4KBFA 5E3HA 4CEIB 4YMTA 4IDOA 2GK6A 4QBIA 2EYQA 1M7GA 3QI2A 2IS2A 1K5GA 1NVXQ 2WVJA 1Z6XA 4EIWA 4NE2A 3I32A 1G3RA 3SNHA 4DB2A 4JLBA 1NVUQ 3LX8A 3VNUA 3AV0B 1E9DA 1CXZA 1NMZA 1SZPA 3O47A 4M9QA 3VR4A 3U5ZB 2OBLA 1HTWA 4ZDJA 2BHRA 4C0BA 1E9SA 2V7QA 2IL1A 4C0LA 2NGRA 5BN5A 2ZYWX 2GF0A 2HCJB 5JJKA 4Q47A 4KFUA 1JJ7A 2AD1A 2QAGA 2W6JD 3QEOA 4BRWA 3TJZA 4M9XA 5E7MA 3T61A 2Y8EA 1QG2A 4NONA 2FF7A 4WW0A 421PA 2UZ3A 3GJ4A 3NWJA 5KTYA 3B6EA 4HSEA 4PC7A 5FOSA 3CH5A 4D80A 2DFTA 3ZVRA 1XZQA 2CL0X 2QPTA 4URWR 5KSPA 3THXA 3KKMA 3CX8A 1NBME 3PV0A 1AQYA 1NN1A 1ZNYA 4Q4HB 3KJEA 1LS1A 1CJVC 4CT4B 4AURA 2V3CC 5JS8A 1G7SA 1OV4A 2OLJA 2ZAMA 1OXUA 3CX7A 3PEYA 4XTRA 1NNEA 1TMKA 2W6JA 2QM7A 1F60A 1QZXA 2PEZA 3K09C 2CLDX 1CLUA 3QJYA 4V03A 4PHGA 4EPYA 3FHOA 2CNWA 2GAOA 4OJKA 2AN9A 2HXYA 2ZS8A 4ZI3A 1KAGA 2GEDA 3MWJA 3K0EA 3QKSB 4XJXA 2ZSFA 4S2EA 4AIIA 2Q21A 3MD0A 5GJVC 4OHWA 3R8CA 1Y3AA 2EFDB 3LFUA 3B60A 2QE7D 3QXSA 1E79D 1HQCA 4PR0A 4NCHA 2A2ZA 4UXIA 3VKGA 2FV8A 2AL7A 4QL3A 1SVOA 3BWDD 4DSOA 1YRAA 2QA5A 3K0SA 4IFBA 3RS2A 3TVDA 3MCAA 2WJIA 5TVKA 5C18A 2GXAA 4KYIB 1W4CA 2JLVA 1CJKC 3B78A 2ZREA 4AG6A 1PUIA 4NYJQ 4BLOA 4AYWA 5EE5B 1AS2A 2ZRBA 2Q9CA 4IXMA 5EUQB 2ZUCA 2P5SA 3EZ2A 3IKJA 2VP5A 2F43B 1Z8FA 4PQYA 4QGFA 3SZRA 2WKPA 3C41J 4OQMA 4ZIRB 3D3QA 1RW4A 1XFAA 4Y0VA 2Z0MA 1M7BA 1E96A 3AVTA 1D2NA 4M9SA 1G21E 2QU8A 2REXB 1MT0A 2RGXA 1DAMA 4MYCA 3RWOA 3SJAA 1K6MA 2D06A 1Z06A 4POAA 2QE7A 5DI9A 1RE0A 3WYGA 1IAQA 4D4LA 1IJEA 1E79A 4DZZA 3VAAA 1N6HA 3LQQA 2HYDA 4Y0AA 2PJZA 3OEED 2IW3A 3FMPB 3U3RA 5FL3A 5IT5A 1TTTA 4TYYA 3RABA 3R9IA 4KODA 2ZRLA 2FWRA 3SFZA 4XVQA 2ZSEA 3RS0A 3D8BA 2D7DA 2J87A 3THWA 3LAWA 2ZU0C 2WWWA 2ZTSA 4L8GA 4P4SA 4OHYA 5FL7D 2C2HA 1K5DA 2QP4A 3IEVA 2BEJA 2ZJ2A 1SVWA 1EFTA 1E0JA 3U7FB 3L0SA 3ZGXA 1X8KA 2WWHA 5J40A 1R2QA 5KDDA 3ZS9A 4MKFA 3SQXA 1KZGB 4D4MA 3AB3A 1T3HA 4LSGA 1SHZA 3FMIA 1II8A 2BJWA 3OEEA 2HDNB 3B1VA 3A1SA 3L0IB 4BFZA 2OAQ1 2ZRHA 1YQTA 5BWMA 1YZGA 3CBQA 1NMYA 3C8UA 2O8BA 4B43A 5JJIA 4G5OA 1C1YA 1XJQA 4V0LA 5FL7A 2O0JA 3QF4B 4FCTA 3GLHB 5GJCA 2IS1A 5EZ6B 4DC9A 2QP9X 2XAUA 3KL4A 1GL7A 2J41A 4IDNA 2VSXA 5C4GB 1E4VA 1P2SA 1KI3A 1XTQA 1ZM3A 4LJAA 2EW1A 1DTSA 4FCWA 1GDDA 4I1SA 2JLYA 1E2LA 4E07A 1PLLA 3IEUA 2XXAA 1Q1QA 2NOAA 2VP4A 3K1JA 3EWAA 4TT3A 4US0R 2XXAB 2IEZA 4PSAA 2OFWA 4JL8A 1X86B 4PFSA 5JJLA 4F4CA 3KKNA 1HH4A 1T4GA 1SXJD 5C46F 1KOFA 3I61A 4LV8B 3FHTA 4XOIA 4KSBA 1A2BA 3U61B 1ZU4A 2O8EA 2YC2C 3ASYA 3TK1A 3K9NA 1CJTC 3R7WA 2AK3A 4BFWA 4FN5A 5SZIA 3FOZA 3GEIA 4PAQA 1IN5A 3NDPA 1VCNA 4C7OA 4O2RA 1TU3A 3KFXA 4TMWA 1Z08A 1CRPA 1VG1A 4PPQA 2HLDD 2YOGA 2ZE7A 4Q1DA 1MO6A 4FMCB 4RKFA 3T12A 2B6HA 1FUKA 4F4IA 2CVFA 2NTYC 2YVUA 1N5KA 3IO5A 1DPFA 1SXJA 2HEIA 2OBNA 1UEIA 4OQFA 5DLQC 4RZ3A 1TX4B 1N6LA 2ZRNA 2MMGA 3ICEA 1CP2A 4Z8YA 4CEJB 5FUWA 4EQ6B 3TW8B 1XD9A 2P5TB 2ZAOA 1KI9A 2V9PA 1W36D 5B58C 2OFOA 3FB4A 4HDCA 4B71A 1XTJA 1U2RA 3GD7A 1KI8A 2WJGA 3CIOA 1GKIA 4A0GA 4KCGA 2HLDA 3SJCA 5E95A 1I4DD 1Z47A 5FTNA 1ZUIA 3K8YA 3RVBA 1S4QA 3BH0A 2BC9A 4JT2A 3B9PA 3C15C 4Q9LA 5FPHA 4Q03A 1R0XA 2GCPA 3QE0A 3M6AA 3B5JA 1A4RA 2IC5A 1G41A 3GLGA 2GZAA 5CK4A 3U4QA 5L3VA 4CGZA 2VP2A 3GLGB 4M1TA 4EAQA 2GRJA 2GCNA 2Q3HA 2ODWA 4FMCF 3SBDA 1P73A 3KQHA 1W0JD 4DEYA 5KU1A 1RRGA 1XXHE 1KK1A 1RIFA 4L16A 1X1RA 1KO4A 2GWHA 2J0VA 4DCTA 3UWKA 3N70A 4F7WA 5CJPA 5GJWC 3PUXA 1WP9A 4QHYA 3VR6A 5KNDA 3Q5EA 621PA 2Q9BA 1NY6A 4NMMA 1N6RA 4YDHB 3W6OA 2WWFA 4MYHA 4A15A 1G7RA 3V00A 4JKIA 1JI0A 4RFVA 3TUJC 2GJ9A 5CLQA 4BLPA 4LZZA 4L15A 2PMDA 4Q7JB 2C9CA 5G41A 2BEKA 2BIFA 3VU9A 1XF9A 1ZM9A 4KAXA 1CBUA 3SR0A 2IA5A 2H7VA 3EPKA 1U0HC 2R6AA 3KJGA 1ZD1A 4L4UA 4LBYA 3KB2A 4AD8A 2IYWA 1R5OA 1GOTA 3T06B 1G8PA 2J7KA 4TTQA 3QQ5A 4OK3A 4A8JB 3QKTA 3CF2A 1E2GA 1J99A 2I1QA 2FDCA 4M8NE 2QENA 4B6FA 4QJ3A 4HI0E 1M34E 1NKSA 1JR3A 2BOVA 2V4ZA 1DADA 5FI1B 1DAGA 5KUTA 3KQLA 3RWMB 2GHIA 5L3QA 2O8DB 2WICA 5LB2A 4DKXA 2P65A 3GEHA 4K8OA 4P0TA 4PAOA 1ZNXA 3EG5A 1UDWA 3FHCB 4TTPA 3QENA 3KDSE 1VIYA 2WWIA 2J0SA 5EXPA 4WIAA 2XNSA 4K46A 3CPHA 1T8UA 3QPUA 2PH1A 1S8FA 1E9RA 2AK2A 4Q4AA 1U0JA 2OSBA 2EQBA 3PXGA 4YMUA 4TZ6A 5FOUA 1PLKA 1UKYA 3IDQA 3C4JA 4RZUA 4KFRA 1A7JA 1Q1ZA 4B3GA 4QGAA 4AKGA 1P75A 1E32A 2AFHE 3ASZA 3QOFA 5CB8A 2CCGA 4PZZA 4BPBA 1M8PA 2K5UA 1E9AA 1NSFA 2G0TA 4LV6A 1F2TB 2VSFA 1DVRA 3CH4B 3CRRA 4JKYA 4P32A 4RCZA 4DVGA 3EPJA 1PVOA 1F2UB 1OH6A 3LVRE 1VPLA 1YZLA 1XZPA 3TKLA 5DO9A 5JFGA 1FOEB 1UM8A 4Z54A 2HYIC 3PEUA 1N0VC 4MKIA 1IJFA 1B23P 4QFMA 2W0MA 3BB4A 1KKLA 3QF7A 1VCOA 3HP1A 3ZZUA 4US2R 4XWKA 3RANA 4IVQA
chains in the Genus database with same CATH superfamily
3VKFA 4IIUA 5KNBH 5FIUA 2DU8A 2NV2B 4A2WA 4H4CA 5TY0A 4EY6A 1A7UA 4EY4A 3DLCA 2G0NA 4HEJA 1EFCA 1X92A 2XUKA 5FBWB 2XW6A 2WKRA 3WMEA 2HUNA 4TTSA 1PL0A 4ZGBA 1TU0A 3M9LA 4RVFA 3OLVA 4OA8A 3JRXA 1Z5NA 1O95C 3ETNA 4HZUA 4HPJB 1Z4JA 1O97C 4O0MA 3GFBA 1RPJA 1E3EA 4YN3A 1RYDA 2IXTA 5TEWA 4IY1A 4DLYA 4DG9A 3W6UA 5M04A 2Q3EA 2FWAA 3M83A 3TPCA 2VXYA 2AQKA 4Z9FA 2CLOB 1YMQA 3A06A 4PC6A 4UJ5A 2FUG6 3S28A 2YS6A 3W78A 4CDMA 4YRZA 2XB2A 3WOVA 1UJNA 3EA5A 3OPYB 4OJTA 3QMPA 4MUMA 1JQDA 1WO8A 5DT9A 4MS4B 1W2GA 5KJ6A 3K0HA 1G3UA 1F8UA 1OMOA 1S01A 4BN5A 4L8VA 2XDQB 4LBZA 5CPBA 3ORYA 3PQ6A 4PQFA 4RAQA 3KV1A 3ZWBA 3KUUA 2BR3A 1A77A 2YZMA 3EUEA 1JAXA 2CXSA 4EG3A 4NZOA 5KNCD 3OMXA 1F1JA 2GRAA 3CSUA 2BGNA 1IY0A 2PVPA 3CS3A 2A35A 1LDGA 4H7KA 4O4LB 3I4LA 4M99A 2DUWA 2WJVA 2VL7A 3P96A 2WQZA 4JC8A 4RQTA 3V3KA 3ZI4A 4ERNA 4D3FA 5EGNA 2D3WA 2OD9A 2VRCA 1UOPA 4Q4JB 2VO1A 4DL9A 3VU3A 3SDZA 3IOBA 3QVSA 5IUNC 3U37A 4J9VA 2NQ2C 2G09A 3JD1A 1GV0A 2JGAA 3JYLA 2I7DA 1ST2A 2C31A 3EGDA 3OO1A 1MQAA 2CCKA 3GFQA 5DULA 2CDCA 1CW2B 1KVTA 2CF5A 5GADl 2CXTA 3NDIA 4OBWA 4XIJA 5C5CA 3AP2A 5CVVA 2QORA 1ULSA 2XB9A 4QUGA 3HR4A 1NLMA 3P4XA 3TBHA 5L3SA 1L7NA 1Z74A 3QEBZ 1NJ6A 4WY8A 3H6HA 2A1UA 2OQ2A 1BMQA 2BFAA 4IIBA 4CCAA 5C8VA 1CZNA 1CEEA 2OV4A 4H35A 4S3MA 2A9JA 3ZGVA 5K1ZA 3M6IA 1TEHA 3SVTA 1XTUA 2ODQA 3B82A 4DM3A 4ZQBA 1IBCA 4ER0A 3ZR4B 4CUJA 2L42A 3K0AA 4YT5A 1ZU5A 2BFCA 4NU5A 1DIAA 4W5WA 4F9GA 3T5BA 5JSHA 4J76A 1WETA 1NULA 3HDVA 3NAGA 4DANA 3RIEA 3EY9A 4L0QA 4HQ6A 121PA 1AO3A 3DL7A 2R6FA 4DUGD 3QWFA 2RSLA 5LD2B 2WJHA 1Z3IX 4LBVA 3THYB 3EGXA 3G2OA 3L4BA 5E7IA 2VH5R 1PKEA 3LC0A 5JNSA 1UJCA 3BH6A 4Y9DA 1AK1A 3CX4A 3DBRB 2UYHA 1L3IA 2EVWX 2QQ0A 3KLPX 4IRUB 5TC4A 5FUMA 2BFWA 1BHO1 4J7UA 4G01B 4CYMA 3PGLA 3CURA 4G0XA 1DZ3A 1NLFA 5F12A 4Z9BA 5IFLA 1CNMA 2W6OA 2WJJA 2ESRA 4JLWA 3VNRA 2EFYA 5IS2A 3O1IC 1NE7A 4FIDA 5AOCA 5EHQA 4ENQA 3MS2A 1XQVA 2AS0A 5AJYA 4GMGA 4ZC8A 2UYQA 4M8LA 3WQHA 2KE5A 3U09A 4JT4A 1RWXA 2BEVB 3IBFA 4JBLA 4QJ5A 3O7WA 4EKEA 1N2JA 2ODBA 1HURA 4IGFA 4X8MA 2WA2A 3UUFA 1RLJA 3HS3A 3QWHA 1CY4A 1DX6A 5CNJA 5KYUA 1PFQA 2NO4A 3MRXA 4RHCA 3WNVA 4QULA 1P1HA 2NADA 1PJQA 2V7EA 3ODPA 4AO8A 5ELXA 3U80A 3GLFA 1KYTA 2OWEA 2OXRA 3M6LA 4MLCA 3R76A 1TLTA 3K70B 4R1MA 5AKYA 4BNIA 5CFZA 1JHVA 3DV2A 3PEEA 3PYMA 4C0XA 1XJ5A 4EG4A 3ZY5A 2GCOB 1CJSA 1PJZA 4NOMA 3VPHA 1V8DA 5AHWA 3ESQA 5AFSA 4M3NA 1KKUA 1Z6QA 2XMDA 3DMHA 5B3JC 5ICGA 2WJYA 3W6PA 3G5UA 5J47A 1W35A 5F2EA 1FMCA 3WMFA 2QT9A 4KWTA 4TMKA 4QZVA 4YT2A 3S81A 1JRLA 3JAKB 1E94E 2YHIA 1UZMA 3F6RA 3K5PA 3WIVA 1MJGM 4V3BA 1FQWA 1W0KA 2BZGA 2EJCA 2NQTA 4LTDA 5CGQB 1K97A 2ISSD 1KWKA 5KX5B 4BBZA 3ZH2A 1IH8A 1UP4A 4MRPA 3S99A 4WN9B 1MLDA 3NUGA 3CPEA 4OMDA 3N0WA 3K16A 3MM4A 1PWZA 2GK4A 2OHOA 3DE0X 4ZPJA 3B8HA 4L51A 5IEJA 3D2CA 4LRTB 4CMEA 2GBFA 4AMBA 3D6TB 1YZYA 1ZQ9A 4HUJA 1NVAA 2YVKA 4O4JF 3T8YA 3THSA 4F3RA 2X1LA 4F9FA 3EF1A 4M8IA 2G82A 2I67A 1Y7PA 3BFKA 4LWZA 1KEEB 5JE8A 5A4KA 2X15A 3AIMA 4UEJA 3TB6A 2ZBUA 3C5EA 3KE9A 2FP4A 4NBRA 3F8TA 4HP8A 2BFFA 3L8GA 1XCMA 4PGGA 1XZGA 2PSHA 4PNHA 5I9TA 3KUDA 5FKJA 4D41A 3IQDB 3WHKA 3EIWA 2B8JA 3JZDA 1KZ7B 5CA0A 3NBYC 1NY5A 2R97A 3GIWA 4MJLA 2OECA 1Y1KE 2EFHB 1D6SA 1U0OC 4F2HA 2VSQA 3RRXA 4EW2A 3EGOA 1HETA 3KB6A 4GW3A 5A4AA 3I5YA 4I2NA 3OLZA 3SHVA 1DAOA 1SU4A 3OU2A 4DLUA 1T4DA 3L79A 1GTJ1 2J4DA 4YAGA 1F48A 2OCXA 4X44A 1WXQA 3H0EA 3VHXB 2Q2NA 4NU0A 5FXMA 1TPYA 4FIZA 1RQPA 1VIAA 1JLHA 1SUWA 3AR2A 4L5AA 4NQZA 5CX4A 5F7ZA 1E9VA 3KZ1E 3M6WA 1U80A 4RIFA 1G8YA 3QLJA 3IQFA 2J5XA 2X9QA 3OY2A 5DU2A 1OWNA 1DBQA 2GAFA 3JD4A 1T1GA 2SCUB 4ML3A 1DIBA 3WGUA 1OH5A 2LDXA 1QRSA 3EEIA 3EJWA 1K89A 3UB3A 4UHDA 3V7YA 2IHNA 5DLYA 1E0DA 1X1BA 2E6UX 1YGYA 3KFVA 4BQSA 1RDFA 1VYTA 1ORWA 1A9PA 4HLNA 2DT5A 2O9JA 3I4CA 4N8SA 4MW6A 3S55A 3VKWA 1L5HB 3DWIA 1MA3A 1N1MA 2VBIA 2OLKA 4HFRA 2GSWA 2OCPA 3GV0A 3ET5A 1NHWA 2QIOA 3WGTA 4FFMA 4B5KA 1YUMA 2V03A 4AS2A 1Z5VA 2Q8QA 3DHVA 2JPDA 3DCIA 3KUXA 1KOLA 3A4NA 2PNJA 4RTKA 2BH2A 3ILHA 1Z22A 4MUIA 5DXJA 3VVCA 3X43A 4ZCMA 5F3RA 2O7QA 3OCWA 3W9BA 3S8MA 4J0KA 2CHUA 2YDXA 3O26A 1E98A 1UC8A 1QBKC 4NZZA 5HPYB 2JLUA 1JBEA 1PFYA 2WFMA 1DKNA 1YV9A 2D74A 3C8ZA 2JB9A 3F47A 2XVYA 5FLYA 2G67A 2XB4A 5LP6C 2LPMA 4E14A 1L5VA 1VMAA 1FP4A 1OY1A 1QX3A 2QG9A 3FPAA 4HX5A 1GCIA 1JXOA 3G0OA 3QVXA 5AKJA 3PLRA 1TNDA 2O2EA 2EOAA 4RYDA 3NB0A 1OI3A 3NTRA 5JNRA 4LNHA 1UBJS 3MWFA 4UHBA 3OM1A 2O20A 3VI4B 3W3ZB 1JT2A 3HGQA 1JALA 1NN0A 1J8QA 2ZT6A 3M3DA 1QDEA 3BIXA 2AEEA 2OD7A 4TV8A 1JEYB 4IVRA 5EQDA 5JWHA 4KQMA 3RV3A 4MWDA 1MXHA 2PGNA 3VPBA 1VL0A 2HPHA 3DE2X 2GPAA 2YYYA 1RM3A 4J0QA 1TLLA 3FOFC 4B84A 3Q2KA 4U5QA 2KYRA 1E1QD 3EXAA 2UZ0A 4KLCA 3GC6A 3LRPA 3DM5A 3ADDA 4M87A 1NVDA 3HG7A 3UCXA 2F1KA 2ZWOA 5HG0A 1TRKA 4EG6A 5I9MA 4YK7A 5EJ9A 3ESZA 1UOQA 3TTXA 4JP8A 5GWXA 1SD2A 3O91A 5IAOA 2P4SA 2PDAA 2YJGA 1MO3A 3UGQA 1X3LA 3DQQA 3IHWA 3L8MA 3NMUF 1Y9AA 2QROA 2XT6A 3CINA 3AI1A 4OB8A 1C1DA 2CBXA 4A10A 1SUIA 2ZJAA 1ZN2A 2LCIA 5JS6A 4B4VA 3ENVA 3OIYA 4OJYA 5FTKA 4EWLA 3VZCA 3L43A 4FQ7A 1UXKA 2JDID 3DUWA 4GR9A 4LG1A 4TSFA 5E9JA 5JANA 3UMMA 3AUXA 3TM5A 1RZ3A 1WS6A 4YMHA 2QYHA 2ANBA 5BSUA 4YJ2F 1U9JA 4ITVA 1EB9A 4E03A 1LY1A 1KYIA 3EGCA 1E7MA 2EZTA 1IB0A 4ME6A 4YRRA 1JH8A 2DJ5A 5LSAA 1EWKA 2QZJA 1QIIA 1R6VA 2Y1WA 1E5XA 2W48A 4NQRA 1CR1A 2BBOA 4QGSA 2XUIA 3BMNB 2A58A 4BMXA 3LL7A 4BLTA 1Q1BA 3Q2OA 3AF3A 2ZT8A 3QWAA 1SU6A 4P84A 4U7GA 3WFIA 1V8PA 4DA8A 5B36A 5CBPA 1UIRA 3SLRA 3T34A 4EA6A 4YUZA 4FDLA 1EA7A 5F78A 3EFEA 3KQTA 2PAFA 2ZULA 3OFKA 4C0HA 4MR7B 1RRFA 4YONB 4X65B 4YYZA 3LA6A 1KFBB 5BNIA 2JFNA 1L7RA 3Q15C 4LZPA 2Y99A 2B2CA 2Z6QA 1UKAA 5AJXA 4QATA 1IXSB 1RYEA 4D8YA 1FLDA 1ZBDA 5IH3A 3UOAB 3OIGA 1RSZA 4HYEA 3IEIA 2YZ2A 2CSXA 3HBMA 5H59A 1Y82A 1QB7A 3AZQA 3ORFA 1KFEB 3R44A 4G5XA 1DIGA 4G0VA 1EVQA 5J4LA 3L02A 4X1OA 2B36A 1NQWA 4Q0MA 2Z2ZA 2XE4A 1A5TA 1E1CA 4MP8A 3RS4A 1LJLA 4P08A 3W5HA 4A8TA 5JCJD 1P9RA 5EYPA 2UAGA 1Z56C 3RVNA 5I7EA 1F4LA 4LGYA 2GTIA 2Z2XA 3GRKA 1QNLA 1D04A 5HKKD 2R4UA 1EK6A 1M2OA 1N4DA 5KNBA 4KGZA 4EHLA 3JQ8B 3W34A 3N75A 2GN4A 3L8ZA 3UWSA 2PWAA 2E49A 3E03A 4J91A 4PYNA 3U17A 4DWJA 4UNQA 2NT4A 3EOBI 3HY6A 1XHFA 5E7JA 3GGCA 1YS7A 2ZGVA 2WJ6A 3WP0A 3URMA 1D4OA 3PNOA 1KSHA 1H22A 3QPBA 5ER6A 1OX5A 2ZIXA 1II8B 1BEEA 1LXCA 4UMVA 2BTQB 4HDRA 4KQJA 5KWVA 2HT6A 2FPIB 3COZA 1JEQA 3PLNA 4FYPA 4MRRA 3TBKA 6ADHA 1N0WA 2YVAA 3PE3A 2DQYA 2PU5A 2VUTA 2V5AA 3FZYA 2ZBDA 3OQ6A 4TXMA 4XJSA 5ESXA 3TR5A 2JGDB 3OTWA 2I2BA 5DM4A 4AZ0A 3N2YA 3EBOA 2EEZA 3OZUA 4L72A 1T9HA 1X39A 221PA 2A5DA 4HGZA 3ABSB 1GSIA 4GP7A 1ZAKA 4R98A 4ZPXA 4A23A 1ZK4A 3BRWA 1EK5A 3AQ4A 5CLGA 3II6X 3H97A 2FXVA 2HY7A 1ZNQO 1N2HA 4JC4A 1NZFA 1HC7A 4HDMA 2PIDA 3QRWA 1NQXA 1IXZA 2X9VA 3W5SA 3PQDA 1ZH8A 1TF7A 2OE2A 7ADHA 3HJNA 1VPTA 4FFVA 3KDAA 3CR7A 3ICCA 3PJFA 3UPDA 4UBMA 1XN4A 4A0RA 4AWAA 3VVMA 1AKWA 3F90A 5KQPA 3PFNA 4YJDA 1ONPA 4KIJA 2P68A 3FUTA 4UUQA 4C6RA 2IHBA 1I2CA 3USZA 1ENZA 3C7KA 1PDWA 5DDIP 3HXOA 2XYPA 2HSEA 3OE5A 2R65A 3TO5A 4X63A 1KH3A 3Q2IA 1U7OA 1BX0A 2GYWA 4AZSA 1A1SA 2R3SA 1HUQA 4Y2SA 1FY2A 4HVLA 1NF2A 3NC1C 2WMDA 3OCZA 4WESA 4C7OB 2AGVA 3KJXA 5KQRA 3BJIC 1CCWA 1NBMA 3BIJA 3CNLA 4IX9A 3PDJA 4WUVA 5DIFA 4JYPA 4GZ3A 2ANCA 4PIVA 1Q6ZA 1TO1E 1YL7A 4FYHA 2ZXFA 4WCFC 1J20A 1PR4A 2LZ0A 2VF2A 3WRYA 4E2YA 5ALNA 5DNEA 1HO3A 1SXJB 2ICAA 2GK3A 3CB4A 1YFJA 4X3PA 3C16C 1BVYF 1FSGA 3OJ0A 4BO2A 3GN2A 2MR6A 1E6EA 3R40A 2GEVA 3ZDFA 4ENRA 2GI4A 3IHLA 4KREA 1CY2A 1J5PA 1VE6A 1ZIXA 2M2IA 1MX3A 2XV1A 4MUKA 2C2XA 3ZCTA 3WWCA 3R0QA 1QGUB 4HYYA 3INYA 3GLQA 2EXXA 2I7XA 2QRGA 1OLOA 4QPDA 2EJVA 1GYRA 1XDWA 2PSSA 4FXPA 5E9WA 3KSBC 3D6JA 1H0RA 2KM1A 1NASA 1JJBA 4X62B 3PHCA 4U2FA 1L4UA 2OXCA 5JEDA 1XQXA 3PQ2A 4QSMA 4Y6GB 3SE0A 3IQZA 1ESEA 4WXRA 3LBHA 3P9ZA 3PRYA 4Y67A 4NULA 5JUWA 3PHGA 4C4ZA 3P0JA 5ITVA 4NARA 1DBPA 3MNFA 2IBSA 4OSEA 4HFNA 2FQWA 4TS3A 1M1XB 4Z51A 2PO5A 3G6WA 5A1JA 2OUKA 2WUVA 4MGYR 2CHVA 2IS4A 4LHSA 5KPDA 2CNNA 5A4DA 2QR5A 3EB9A 3ZW9A 4IQGA 3NFYA 4UNRA 4PGFA 2HOQA 4G9GA 3AT1A 5CVDA 1KRWA 3G9UA 3VAZA 4B85A 1T0HB 5DYNA 5JW6A 2QMQA 1W36B 3DZKA 2BI8A 2AYYA 3GAMA 5EP1A 3FLAA 1ZH4A 4EFDA 1A2OA 1IM2A 4C9BA 2BMEA 2QUKA 5A4MS 2Q4BA 4NCIA 1G21A 2Q4TA 1TFUA 5HF5A 4ZI7F 1QAMA 1K4MA 4UAVA 4UVGA 5CT5A 1G8KA 5LZ8A 4DC0A 5A2QA 1HQKA 1QKJA 3AKZA 1FSPA 2LP4Y 3G68A 2MCFA 5B6IA 1O5OA 3DCNA 2PLRA 1XTSA 3KKOA 4NR0A 2Y77A 2PT5A 1I7NA 1ZR2A 4TN1A 3C43A 3SVZA 2VHXA 3FOCA 2JFYA 1MNQA 3RBZA 4L6IA 1OX4A 4MV5A 3QE3A 4P54A 5EZYA 1XK7A 4P4LA 5EZ5A 1P29A 2ECQA 3HB7A 3OT5A 5KTSA 2A1IA 3AOEA 3COSA 2AZ4A 3VU9B 4EZBA 1J8YF 1PT9A 2H8KA 1JYFA 5F2OA 4I2VA 2X0EA 4ZYVA 3Q8LA 3KTAB 3AVXA 4MKHA 4NOLA 3GF4A 4RVGA 1EGMB 1LDBA 4JLPA 5FT9A 2NX2A 2HZBA 3C7CB 4NNPA 3ZH9B 1IY1A 2ZETA 3UAYA 5I3CA 3FVWA 4D56A 2E4UA 2G63A 3HO6A 3RSLA 3V1YA 4D44A 1KI1A 1ULAA 3UNXA 3D81A 3V4SA 2O3SA 4AS3A 2W2QA 4LNUA 3OJWA 2HJVA 2IF2A 3A6EA 4N3CA 3DULA 2AKEA 1ZD2P 2QX7A 4E5KA 4ZRMA 3W6ZA 1I6MA 3P27A 2WF7A 4RXUA 2YN2A 3E7WA 5HXAA 3IILA 4D2IA 3OI7A 1Z25A 2FUKA 2KJQA 1DJNA 4JP2A 4WASA 4ZN6A 2ZM5A 1MA0A 3GMTA 1LW6E 1TZCA 2EKQA 5IDQA 4ZU1X 3X1YA 3V6LA 1FX0A 1L5RA 3LGAA 4DHWA 3WBFA 3R1IA 1DQSA 4BJ6A 3PX2A 3V34A 4Z4CA 2X5NA 3CSDA 1NRIA 4M7PA 1T9AA 4XD7A 1YBHA 4RD6A 2N75A 3PXEA 1QHGA 5ISMA 3C1OA 4G09A 2HKIA 3M5WA 1PR1A 4DFDA 4G25A 4AECA 3N76A 3VDMA 5JJ5A 3C5VA 4YACA 3FSRA 4R2IA 4X7PA 5GV7A 4TVSA 5F76A 3VFDA 2B8TA 3KJNA 4PG8A 5MFZA 1E2HA 4P4NA 3FF4A 1S2MA 4YX9A 4L50A 4FM9A 3JPWA 2G4CA 4LAFA 4QJBA 2PPLA 3TX2A 1WKCA 5LUBA 4DCVA 5BSKA 5JXIA 5KINB 2NYAA 3KVRA 3L46A 3TZEA 5IDXA 3W04A 4DAOA 3DOIA 3G0IA 1GARA 2WF8A 3IPAA 4HEHA 3M2TA 1V11A 1KVSA 3IKVA 4NENB 1V25A 1E5QA 4MVWA 1WXXA 1YR7A 3AUTA 4I1OA 3CYFA 3L06A 2DQKA 3QW2A 3P2YA 4N7MA 3ZWWA 1N2CA 1QIJA 3G0HA 1CYDA 3FPJA 2E3JA 1E5DA 4MI3A 1D8TA 3IP5A 4PGAA 2D1YA 2IXEA 1GAXA 4JI6B 3ZQ6A 1U4NA 1KTVA 1PX2A 2RIPA 3L5KA 1GNQA 3V7UA 1CF9A 5C4MA 1NX9A 2OC4A 4IH1A 4FJ0A 4DT1B 3R8XA 1GU0A 2DKOA 4DDKA 3QV2A 2A4MA 3EVFA 3A3KA 5C1DA 3PDIB 4I7EA 2EBWA 4N5DA 4KRXA 5HIAA 3PFKA 4ZQCB 1AZSC 2Y0EA 3KEGA 3TRHA 3V42A 4PX2A 4BN4A 2VRCD 3DFFA 2RHRA 5CLLA 3U4GA 1OIVA 3PR3A 3TEFA 3FWYA 1FTWA 4O2LA 4OLHA 2EQAA 3E84A 5EE3A 3G6KA 5KOJB 1AIPA 3T7EA 4CM4A 3IOYA 1MMFB 1Y6ZA 3CZQA 1IN4A 5D00A 1OYYA 2AW5A 2PPVA 3M34A 4H0CA 1YZKA 3W4JA 1JG4A 3KKQA 3JRNA 1JL3A 1VPWA 5DYYA 1YHYA 1PWHA 1X6VA 2O3UA 2PRYA 4H1UA 4DJJA 3R9WA 1RQRA 2JAQA 4YMVA 3UJ7A 1L8OA 3C48A 3PNSA 3Q9NA 2ZIAA 3QY0A 1RJGA 2CMKA 2XNKA 3NIBA 1H2WA 4KWIA 4Q66C 5LA6B 3GW8A 4HQ0A 1MO5A 2JFZA 2YJZA 1Y8CA 4MHSA 3O8QB 5BYJA 1S2NA 2IJGX 1T3SA 1E59A 1EFKA 2VHEA 1D2EA 3H1EA 4KDCA 4QYXA 5FFFA 2QQGA 2GDZA 2FFAA 3W6NA 2ZWAA 4K9KA 1KDTA 3AF2A 3CLRC 4MB0A 4RFSB 3DMTC 4YJ3F 5D5HA 3ILXA 2F1OA 3LYLA 3DKVA 1AHHA 4R81A 4GOMD 4DR6B 1GTVA 1O6ZA 2Z43A 3MPOA 2OILA 5FBKA 1MVLA 1PZGA 1D0SA 1GQOA 3JALA 1IHUA 3WHLA 4Z2AA 1KEVA 3UJCA 1I6WA 5AUQA 5LOVB 4L2IA 3OKAA 3F2IA 2YVQA 5KVQA 3K9BA 2B4RO 5C9ZA 3RUPA 1XU4A 1A5AB 2ID8A 2AT1A 3F3MA 4I4CA 4LY0A 1SBHA 4R8SA 2BISA 1V7CA 2Z2YA 1QGDA 3DZCA 1Z26A 2AUNA 3N8NA 5FPSA 3REQA 4CR6A 3I6BA 7GPBA 4EY5A 1ZSVA 4L28A 4CKEA 2AOUA 1UC4B 2I78A 4IXDA 1R88A 2I1VB 3EPRA 4QDUA 4AMZA 1X7XA 3L6RA 5ELLA 2Y76A 3PCRB 2WIFA 2WM8A 3L1VA 5FOTA 3RGWS 1C9DB 3K05A 4HDQB 4PYQA 1F6DA 3S8EA 4E46A 2C5GA 1O08A 2J3LA 2PRZA 3EZNA 3Q7IA 4AX8A 5FOQA 2M32A 2XUZA 2WFLB 2XF2A 1MJGA 2VJCA 4HATA 3WLMA 3AJAA 4A2PA 4OK5A 4PXSA 1NPTO 4BXOA 2NSDA 2RC5A 5JXHA 4MQEB 2YJTD 3MOIA 3CUUA 3L8HA 1JMYA 2NXJA 1VJ0A 3BH7A 3Q11A 4K6FA 4MGHA 1WB9A 1AJEA 4K9DA 1GFWA 3AXSA 5FNVA 3STUA 1YUBA 4O3FA 4L3OA 2G9NA 2XUQA 1G5PA 4AJ4A 3GLIE 1IZ7A 4KUEA 1RXSA 4OXQA 3VZBA 4BE7B 5CLJA 2YNMD 3LP8A 4KRYA 4M98A 3PEWA 1KZHA 4CIYA 1ENOA 2FXIA 1ZHOA 3HCAA 5DBFA 2F9FA 3OLQA 4KIWA 2P7HA 4NFSA 1Z0ZA 3ED1A 3EA0A 2FZCA 2D1RA 1HE1C 2FQ1A 3UJPA 5LWQA 4BVFA 5E1OA 1ZCAA 4Q7QA 2REQB 5DXFA 2EV9A 4PSDA 4G6ZA 2PXXA 3ND7A 1TCVA 4PBSA 2XCUA 4JVOA 2Y1KA 4C08A 4IG4A 2CXXA 3MTEA 3DMFA 3LQRA 4UU8A 4D8TA 5DIZA 2OFPA 4DRZA 4D6XA 5H81A 2ZSJA 1RZVA 3R3WA 2YHBA 4HADA 3DKPA 4TQGA 4ND2A 3D2AA 3WA7A 2EC5A 2F2TA 2NLOA 1TF2A 1CD5A 2MSCB 1H6AA 4BPRA 4ARVA 4JQSA 4NRDA 2E37A 1J2EA 2BSAA 3H99A 3OX3A 5GGYA 4ZEVA 1K63A 1TXGA 3PXAA 2BFEB 5BV2P 4NCBA 4R4JA 1X70A 1R4NA 1ZM4A 2F3PA 3CE9A 2W2MA 3D3EA 1XJCA 5SICE 4BBPA 5LVAA 3FDIA 1R7RA 5BUQA 4XM2A 2BFBA 3O8NA 1NXTA 2Z6VA 4D82A 1L4YA 1X87A 2GRUA 4C7BA 5B12A 2Q0SA 2GLUA 2CLSA 1NW5A 1O8BA 2XR1A 3FPGA 4PANA 1C1XA 4OVKA 2WP0A 1I14A 2W11A 2X0RA 3PFIA 1FNNA 5CEEA 1Y4ZA 1E9FA 3H8SA 5HIIA 1LKZA 3RLIA 1OZAA 5DVZA 2VTBA 3A9UA 3BBPA 4KKVA 5EP4A 3GDOA 1TAHA 5AH0A 1PO7A 2C5LA 4PYKA 2ZBPA 1CUWA 1CVLA 5E4JA 1G59A 5BP7A 3O1JC 5F73A 3IQXA 1Y3HA 3Q0IA 3A1UA 4NLLA 3NOQA 5AVTA 4IJ5A 1X1DA 2VDQB 2F8LA 2HQRA 4HAWA 3W1WA 3WMXA 1WUKS 3EH1A 5DWDA 2AZMA 1HA3A 4BYGA 4F11A 1XZDA 1OWMA 3H9QA 2DECA 1AN9A 3RTBA 1PZNA 4G56A 4Z4EA 1E7YA 3ZJYA 1KAOA 1LW7A 1GL6A 1J33A 2I6TA 3A9CA 2B9EA 1L5OA 1DUIA 3Q5DA 3QNMA 1BJKA 4YJFA 1QO7A 3T7DA 3A2KA 3Q12A 4WOJA 5ADVA 2EJUA 1NSTA 5KCZA 1DDIA 3JWHA 1RXYA 2BBTA 1AQUA 2BT4A 3EZFA 3LUDA 2NTEA 3CY6A 3PL5A 3BULA 3PNMA 1PV2A 2FLVA 2QUZA 3V4FA 4CMIA 4QQNA 4EQZA 2AUTA 1HKHA 2EFEB 1D4FA 5IKOA 1QRAA 5P21A 4AF8A 4D4KA 5BSFA 3L9XA 2FH5B 5HZKA 3OA0A 4UCFA 1BAPA 4GI2A 4UPVA 5CB6A 1U7PA 4NBLA 3UWPA 1MB9A 1HZZA 1NNLA 4AL4A 3RYCA 1PGPA 2IXFA 1VJRA 3MELA 2Y68A 3PC7A 3P0FA 4DLVA 2ZBFA 4E09A 1FDTA 1TQ4A 4UM9D 3SHOA 1VJ5A 3VBCA 1TMOA 3EXFA 3DKKA 4G4SO 4NH0A 4CUKA 4ALIA 3ZJTA 3LBFA 3FKSA 2HJSA 1W5TA 4UTNA 1GGNA 2WTBA 4OUDB 4Q1BA 4KFSA 2QTTA 1RJEA 1RP7A 3L7CA 5KVVA 4UBKA 4P53A 4AI6A 1U1GA 3PK0A 1QIFA 1N7GA 5DI3B 3TGLA 1CR6A 3HCPA 4CQMD 2P3SA 2RI6A 8GPBA 1IBLB 1K68A 2A8YA 2O23A 1RI2A 3ZYZA 4GNKA 4CG2A 3GMSA 2H1LA 2FX2A 1LUAA 2WC1A 3U3MA 1NXPA 2G9UA 1P74A 2QYOA 3A05A 5CEFA 3AF1A 3PHLA 3JTEA 4FDUA 4R41A 3HU3A 3ZCPA 2VHYA 1W48A 1QWSA 4URUR 3T0FA 1OBHA 2VDLB 1A82A 1OCEA 2YXDA 4I5DA 1THMA 3KZVA 3CLTC 4CEIA 3QOWA 5T4HA 2RAPA 1UODA 2OSVA 1LI5A 2GETA 2Q8NA 4NEQA 4EPWA 5HK9A 3TZQA 3OHSX 3HWWA 5KTOA 1ZRNA 5JZVA 2Q5QA 1YBMA 1G18A 2ATEA 1T29A 4MGZR 1Y1QA 4UHHA 3WO1A 5FTMA 1EVKA 4JI0B 3WK7A 2CFOA 1LPAB 5EWJA 3PNVA 2FW0A 2JJ2D 5A5EA 4W5HA 3MAAC 3W5AA 1E4YA 2XYRA 2JAHA 2NVOA 1V95A 3PT9A 2VH1A 1TQHA 2PFSA 3NFRA 2NIPA 3BKWA 3OFSA 2D2VA 3HN6A 1WVMA 4GOKA 4GXNA 5H68A 1YBAA 5CIYA 4LE1A 1ZJJA 2ZR0A 3RK1A 1DWUA 3TW4A 1U6JA 3UHPA 5HKBA 5BNWA 3HTXA 2I80A 3PTZA 4LZJA 2YZGA 5A9TA 3VBEA 4BTVA 2Z6AA 1A0OA 2P8SA 1MENA 2VXBA 3A37A 2B78A 3AIKA 2VSOA 3G5AA 1B7GO 4H17A 4NYMQ 4ZQGA 2CL7X 2ZRDA 1KVQA 5CDYA 1EP1B 4I99A 5FNZA 1C3JA 1P80A 1DC4A 1HSOA 2X42A 2YY7A 2Z1NA 1V5EA 4KFTA 4MS3B 3CFYA 1SHJA 1L4MA 1QV7A 4OQNA 4W1SA 1WOYA 4OI2A 5EHNA 1LRKA 2X2FA 3DEHA 4IMIB 1PVDA 1K7EB 1O6CA 2LXNA 2A0WA 2Z83A 4Q93A 4AMGA 1H8HA 1BRMA 1O89A 5FBVB 1XLWA 3D8UA 5F9FA 1QIKA 1RXCA 2OMEA 1ZSYA 3LHFA 5D6OA 4FW9A 1X7WA 3DVAB 1R0YA 2WAMA 3T54A 1YDHA 4XCVA 1YVDA 5KQMA 3BA6A 1SFRA 2JIOA 1U0FA 4JR0A 2GEJA 3I2KA 4YCMA 5JYCA 1IPFA 2XYGA 1O95A 2VS1A 4FFLA 5A03A 2ADMA 2IEBA 4H3VA 1WCV1 3E9YA 3IUMA 4X1IB 4ALMA 1G8SA 2EGUA 1ISJA 3PXBA 3I09A 4AKEA 2VPYA 3WNQA 1KY5A 2DUNA 2FEMA 1S6YA 4LI3X 4EGSA 4R68A 3QKSA 1FRFS 1BSVA 1GU1A 1H66A 2ODTX 1PZHA 1O03A 1PQWA 3LW7A 1FSFA 1S9DA 1VKOA 1U65A 1TA4A 2WNHA 3CRW1 1U11A 4MV0A 4EHNA 1MDBA 3HVUA 2V45A 3DNPA 1O87A 2C57A 1JJVA 2QM3A 2XYHA 4Y30A 4ZO4A 5DKFA 5JBNA 4UUMA 4KBYA 3MQ2A 2F1RA 2Q2OA 3HSSA 1NATA 4ZMRA 3VTKA 1P7VA 2HU8A 3VSBA 4W7IA 3IAXA 3OLCX 4P7BA 4EYEA 2CJWB 5CEJA 3OICA 1K27A 4JLMA 3WLAA 3WK6A 4UNNA 2BKAA 5DRTA 1PJCA 4PRYA 5HS4A 3SIWA 1ZOOA 1V8ZA 3RRYA 2ZEJA 2PVCA 1Q2XA 3AEKA 3WNDA 1R4ZA 3DMYA 3P1JA 2C0QA 3STXA 3VKUA 1CZKA 1LVHA 1U2ZA 4Y2YA 5EIFA 3ASUA 3CRQA 3O3OB 2H1RA 4CQLB 3PUZA 4J7CA 3PD0A 3P8ZA 5IVPA 3GCXA 3GEEA 1W4BA 2HM7A 3T1OA 1ULBA 2C0CA 1TPZA 4IO0A 1CF2O 3KYIB 3Q0TA 4TYPA 3KQNA 4BASA 4QEKA 2WZQA 3K3PA 4FR0A 1NL3A 3SZMA 1XB2A 3WDMA 2O8CB 3BCUA 2QGNA 1VBNA 2YX1A 3LDGA 4PO3X 4QGGA 5FPKA 5IPFA 4LOJA 1VGQA 2X77A 1B42A 1UADA 3DBLB 1VSVA 4LC1A 3W8NA 1UXHA 3NDJA 1KETA 3VO8A 1CY8A 2C3UA 1SUAA 2JEOA 1O58A 1SUSA 5IT4A 1MTZA 3PGXA 4HAXA 4HB2A 1A50B 5I9IA 1Q0RA 2YVLA 3FDZB 3VYRB 3W5CA 1VQ1A 2D2FA 1QPGA 4N18A 3HE3A 4QOSA 3IV6A 4LYDA 4YLGA 4YFVA 4EENA 4HNUA 1J21A 1A9SA 2DWUA 1KO5A 3LZCA 4MV4A 5TMDA 1KIMA 3BWEA 3B2QA 4OMUA 4A1FA 1VSUA 2COKA 4LIPD 3EZLA 4HVTA 4Y8VA 4HN4B 4CF6A 3JSAA 5FH9A 1YJ5A 1QOPB 3K9QO 2FQYA 1DG9A 3KKLA 1N78A 2FK7A 4FMBB 3EISA 4QBHA 3B9QA 1V1MA 2EAUA 1K8RA 2IF0A 2YY5A 3CT6A 5B1DA 3R4VA 4YJGA 5IHPA 1R4AA 4NYIR 3ZWVA 3ADKA 4BEJA 2I1WA 1J2YA 3PQCA 3U49A 1JTVA 1JIUA 3KT3A 1EM8B 3DE6X 3RT1A 3TTVA 4GM1A 2IP1A 4MI6A 4EVSA 1NBMD 4QUBA 1D0IA 3K4PA 1LFDB 5COQA 5K3AA 1F8XA 1WVIA 7REQB 5KZMB 2XDYA 1VSQA 4V0SA 1P18A 1FNSA 3TG2A 4BRUA 2HO4A 2CY0A 2AG6A 2NXEA 3HPRA 2H59A 3R3VA 1EFLA 4A2CA 1IPHA 1QP8A 4NV3A 3COJA 3KSZO 1JKXA 1Q2UA 2IVFA 1U02A 4YNBA 5F52A 1EQUA 5KVCA 3WQQA 4NV0A 1OC4A 3O9MA 3R74A 1P9WA 4CTJA 3ZDAA 3IAFA 4FINA 4KTVE 3M6MD 1ZVVA 4Z4GA 1U5BB 5E4YA 2HPVA 4TKUB 5LYJF 3MIZA 1HDZA 4A16A 3C4QA 2VJAA 1IQPA 3DSRA 5I3ZA 4Z6KA 5EFOA 1ORTA 3K9GA 3PDUA 1T9ZA 1WV0A 3HXMA 2C03A 4WOPA 2N0SA 2P5YA 3L7YA 3UK7A 4D43A 3MB5A 5FWNA 1GPLA 4DDMA 2WYWA 3DV9A 2WEKA 5LMZA 1EWRA 3GDWA 2PQMA 3SEFA 5A5GA 1R9MA 3O9ZA 1FDUA 1P2UA 4GEGA 5B3JA 1NLUA 5B6PA 1QGAA 1XKTA 4BB0A 1QF9A 4KSYA 3SSAA 2WV9A 3LD9A 3ZHYA 4JUDX 3QIAA 5CP8A 3HV0A 3ELBA 3ZX5A 2G72A 3E7XA 821PA 1PQ4A 2ZCJA 1QQ7A 2UZIR 3VNVA 3FLBA 3L7LA 2ZI7A 3TYXA 1I9CA 4JL5A 3DTNA 1H2ZA 1C7JA 1J25A 3EY4A 2JCVA 1NQTA 3AH8A 1UBOS 3WMGA 3BG5A 2HNBA 2A94A 2V6BA 2O54A 3EOAI 3L1IA 2XQFA 2GUWA 2RK6A 4XIFA 4YP0A 3DBVO 3UJDA 3MWLA 1L4NA 1WBDA 1ENYA 3TSWA 4GX1A 4R05A 1DQNA 3QBVA 5FI0B 4BQFA 5DSXA 1XQYA 5EWLA 1Z0DA 1KMHB 2IYZA 2IZ0A 2W6ID 5FX2A 1Z7BA 1AM4D 2HJHA 3CUVA 4R8KA 2O0HA 1VI6A 2XBUA 3QYPA 3TSAA 2ZI9A 1TEVA 3T1NA 2LNDA 3B48A 5JRJA 5J5CA 4BNNA 2GTPA