4X8HA

Crystal structure of e. coli adenylate kinase p177a mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 73
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8hA00
4N0EA 3ICQB 4C7OA 1DAKA 1IN8A 3QXSA 5IRCD 5FTMA 2JLRA 3IBGA 1ZUNB 3I5XA 1EWRA 4IOJA 2JJ2A 3LDAA 3TGPA 2BBOA 1XJCA 3ZLJA 3WBKA 3RC8A 1E9DA 5BYKA 4IOKA 2QNRA 1XRJA 2QROA 3OZXA 4D81A 1KJYA 2VF8A 2OEPA 1S3GA 4QC2A 1VCMA 4S2EA 1MT0A 2D3WA 3D8BA 1XTIA 3N70A 1FNNA 1GAJA 3EZ9A 1LFDB 1DARA 4E09A 1SVMA 3QOFA 3ONWA 3CPHA 2J0UB 2YHSA 2NO9A 2ZE5A 1XMJA 3QF7A 3CF6R 4MGZR 1TEVA 4Q1AA 5CJ2A 4V0OA 2VP4A 4CF7A 2Z4RA 1YVDA 1CU1A 1FP6A 1YRBA 4DB4A 3GLHE 5CM8B 4DLSA 2RGBA 3U44A 2GXQA 2IXEA 1US8A 3B1VA 3D7MA 1F6BA 4LJ9A 3W5IA 4HATA 2AKAB 1R6BX 4LBWA 1ZAKA 2PMKA 4TQUS 5F3WB 1CLUA 3HJNA 3U4QB 1CJTC 2JASA 4PSVA 1YRAA 3A1SA 4TN1A 4HAYA 2GHIA 3U3KA 2PL3A 4QJ5A 3B6EA 4RSGA 4RZXA 4LJ5A 1FUUA 5JBQA 3CLVA 4L16A 5CB6A 4MRVA 1PV4A 4J0QA 4O2RA 1HY3A 2WIBA 3EW9A 1OFUX 4IFEA 1E9RA 2NPIA 4ARZA 4JBWA 4BZXA 4OHYA 2FA9A 4HLDA 3CRRA 4JLBA 2EFHB 1E69A 4HAVA 2V55B 1U0JA 3LD9A 5SZHB 2BEJA 5GVSA 2ZQ5A 4LI0A 3SR0A 4QJ4A 2XZPA 4FCTA 2WTUA 1JXOA 2OV2A 4LJ8A 3AF1A 4R98A 1HURA 1G8FA 2QQEA 1OLOA 1S3SA 4G5QA 1P9RA 4KCGA 1CEEA 2IUTA 4D4KA 3H4MA 2WBLC 4AG6A 4EIWA 1S2MA 3AVVA 1SGWA 1RZ3A 4Q66C 1ONBA 4Q03A 4HSEA 1ZNWA 5C4GB 4II7A 1OXVA 1HQCA 3G0HA 2REBA 1XPUA 1GKIA 1Z6YA 3U61B 2Q3FA 1VHTA 2OXCA 3CH5A 1T3SA 2HCBA 3PEVA 2GEVA 4DDVA 3M0EA 4NCJA 2F1HA 2IYYA 3DOFA 2EVWX 1OXUA 1NY6A 1NRJB 3CX7A 3KJIA 1ZVQA 3ZQ6A 4LJ6A 3EZ2A 2R6GA 4RD1A 4BUJA 3DEFA 1UBFA 1C1YA 1LY1A 1SQ5A 4OI4A 5DSZA 2G9NA 3ZZTA 3EARA 3NC1C 4DRZA 2DCUA 2ZE6A 3UMSA 4DEYA 2CCGA 1SKYB 4DCUA 1OT3A 4D0GA 2RCNA 2V7QA 1M2OB 4YXWA 3NTUA 3U3OA 4RCYA 3A4LA 2ATXA 2EWWA 3LX8A 1UFQA 4BFVA 1VYVA 2ZE7A 1YJ5A 2J41A 3P20A 3K0AA 3BB1A 4WVFA 4PX9A 3KXLA 2ONJA 3AF0A 3FGNA 2ZRGA 2Q9CA 3SHWA 4C9BA 5EP2A 2GWHA 1X8JA 1VG0B 1OFTA 2C8VA 3ZIAD 3LO5A 1AA9A 1LNZA 4NDZA 1E2EA 1FTSA 2Q6TA 2R6CA 2JLQA 4O0MA 4X8MA 3WP1B 1Z06A 4DDWA 1XCGB 3GLGB 4B3DA 1G8HA 1Q44A 3ZJYA 5CK4A 5D3MA 3CRW1 1XD8A 1XXHB 2HT6A 4WIAA 1XTKA 2JAQA 4LBYA 4M2LA 5FPHA 1ETUA 1LS6A 1PLJA 3AF3A 3LLMA 2NG1A 5JRZA 1EXMA 2EW1A 3ICEA 3AVYA 1GDDA 2R62A 1G1MA 4DWJA 4X8OA 5JEDA 4EFLA 1IY0A 4FD2A 1E98A 4Y0AA 3ZD6A 1E2JA 3RDPA 2J9RA 3X1YA 4XVQA 1G17A 1NN5A 4RZ3A 5EE0A 4IEEA 4Q1CA 3QBVA 3TVDA 4GZLA 4ASUA 4KV9A 1G5RA 3B9PA 1G18A 4PO9A 1XF9A 2VP6A 4I1OA 2FFHA 2W6ID 1R0XA 3PUZA 2OBMA 4DDTA 1Z47A 3W8NA 3CWQA 4X8LA 4B2LA 2QP3A 2XNDD 2HJVA 5FOWA 1RIFA 3EC1A 2FGKA 3KB1A 4CDGA 3GJ8A 5AUOB 2SHKA 4PXAA 5EP4A 3FFAA 2IYLD 1NMZA 2OM2A 4PHFA 1QHGA 2J0UA 5EXXA 3C16C 2A3RA 2QE7A 2ZEJA 3FTQA 1G9XA 1SKYE 1XTSA 2YYZA 3BD9A 4QFMA 4B33A 2WWIA 1EFRA 4TL8A 1YR6A 1MO5A 1CJVC 1NN3A 1N0UA 4M21A 4LYAA 4XTCS 4E03A 2QPTA 4CT5A 1W47A 3VHLB 2QRNA 1D2MA 3MLEA 2V1XA 521PA 5L8VA 2BMDA 1KO1A 3ADBA 3RWMB 4W7SA 1Z5ZA 1J8YF 3AKCA 4KYIB 3AF4A 2OO7A 2B7CA 3ZVMA 2WPDA 3X1ZA 1JEEA 3B1XA 4JLVA 3GLGE 1E2PA 4FCVA 2G83A 3T1VA 4OBEA 1E96A 3KKPA 1XXHE 2IXFA 1JAHA 2ZUCA 3B60A 5H70A 1JEDA 2AD1A 3DO6A 5FOXA 3HU2A 1UF9A 4PZZA 5GADl 1P5ZB 3SYLA 3KKQA 3P4YA 4FN5A 4ILEA 2CCKA 2C9YA 4CRWB 3PUWA 2W6JD 3BK7A 1EK0A 3QKRA 4JYCA 3WBJA 4OK3A 2ZAMA 1EFHA 2OHFA 4V0MA 3RYTC 2EWVA 4NYJR 5CJPA 2AXPA 4B48A 2AFIE 2WJHA 5HE9A 4B75A 1PVOA 1ZM3A 1FMJA 2D2EA 1NLZA 3WHLA 4CEHA 2ASEA 4BQSA 2IT1A 1BKDR 1T8TA 3TNFA 4A0FA 3RAPR 3SBEA 1D8TA 2ECKA 3IUYA 2D2FA 4I1UA 3GEHA 3TMKA 2RH5A 1G4AE 2PZGA 3HR8A 4C3ZA 1RC8A 4RD4A 3BE4A 3B82A 4DUGA 3FE2A 2BM0A 1SXJB 4KLZA 1P2SA 3B85A 4LJ7A 1UKZA 1KI6B 1W4AA 1QZXA 4QM7A 2B7BA 4NKRA 2ZUDA 5FOVA 3R8CA 2CK3D 2AWOA 2AD5A 3ZVNA 1YZKA 2RHDA 4HB4A 2XSZA 3UPUA 4R9UC 1VKJA 4G5RA 5TARA 3Q9LA 2ANCA 2W00A 3BH0A 1G8YA 3AUXA 2ODEA 1NN0A 4IJMA 421PA 4OKSA 4RKFA 2QP4A 2VHTA 1E0AA 3AEZA 4H1VA 3A36A 4AY2A 5LPNA 5E4FA 5KOYA 3NG1A 3OFNA 1JR3D 4Q9JA 1CIPA 3X1WA 2H16A 4I81A 4LV5B 4Q9HA 1L7VC 2I4IA 3KTAA 3KDSE 2MMGA 3RS3A 2ZJBA 5P21A 4X8HA 3AKDA 2EFCB 1XCPA 2ZRAA 4F4CA 1VCIA 4NTZA 1RFLA 1RE0A 3QF4B 3A8TA 1GFIA 3LFUA 3TQCA 4HDQB 1TEXA 4XWKA 4QGGA 4MRPA 2ZSEA 5HKKD 2AXNA 4TL7A 1UBCA 4HB2A 4TLAA 2WWFA 2ZRMA 2RGNC 1MKYA 4JL8A 4LHYA 4D4LA 1TADA 1ZM7A 1VHLA 3GP8A 1GRQA 2VLIA 4BLTA 4OQLA 5FR2A 4QGFA 2ZRFA 1VDZA 3C14C 1X6VA 2H17A 4US1R 3SN6A 4NMMA 5JSZA 1CF4A 3QIAA 3TBKA 4C0KA 2P3SA 4A6PA 3H2YA 1IHUA 1W36B 2BHRA 4JKYA 3SZRA 3NC0C 3K8YA 5FTJA 3AVXA 2QSZA 2XTNA 1JB1A 1YHNA 4YDSA 1W4CA 1NVWQ 2QMUA 2ZSFA 4JLAA 4JT2A 1MABB 1DAGA 4LPSA 1U8AA 4G5OA 2N46A 4C0LA 2YKGA 5JJIA 1N5KA 1O87A 2GKSA 4IHQA 3EIEA 4ZO4A 2F3TA 4B3CA 2VL7A 1SXJE 5DI9A 2X8AA 4A6XA 2GJ8A 2F7SA 3AVPA 3OEEA 2D7DA 4W5HA 1FZQA 3N2IA 4A0GA 1KJWA 1CR4A 2IC5A 2NQ2C 2XOKA 3KJGA 4G5GA 2WJYA 1JECA 1OPXA 1T5LA 1G8GA 2GZHA 4C2TA 2GJKA 4UXJA 1UM8A 2NOAA 3SEAA 2HYIC 2Q9AA 3R9WA 4H9GA 1OH8A 4A0RA 3W6NA 3ADCA 4JLDA 1Z6AA 4L5BA 2C98A 2D4HA 4UXIA 3ZVLA 2W0SA 2ATVA 2ZJ5A 1MO3A 4QNMA 1CJKC 2ZRIA 1MO4A 4OQFA 4M9SA 3RS4A 2H57A 5AJZA 4U02A 5FOSA 1KI3A 2YOFA 4TYYA 5EE9A 5DNYB 4L9WA 5ELXA 1KNXA 2F43B 1P9NA 3IBYA 3DZ8A 1X1RA 2B8WA 2ZYVX 2ZYWX 3O8BA 2BMJA 4DVGA 1G41A 3TUJC 5LD2C 1ZINA 1AGRA 2NPFA 3CONA 5DIFA 3FB4A 1TQ6A 4Q4AB 2FSHA 2MSEB 2FNAA 1KSHA 3G82C 2C9OA 3PQCA 2ZJ8A 1N6HA 1RYFA 2FOLA 3IO3A 4KJZA 4Q4LA 2QL6A 4RD0A 2A5YB 5CK5A 2BOVA 1ZC4A 4P33A 1W4BA 1N6RA 1FMLA 3I3SR 1G3IA 1CP2A 4I99A 5AK0A 4Q7JB 1XTJA 2FG5A 1Z08A 2E87A 4Q9LA 3UK6A 1FP7A 1NBME 4LRWA 2NIPA 3LXRA 1ZD9A 5CDFA 1WCV1 4AKGA 4HDCA 3FKSA 1OV4A 1QHYA 2AK3A 3I1FA 3IKJA 1DEKA 4V0LA 1NN1A 4TSFD 4AWXA 1H65A 2QPAA 1W49A 2IWRA 2GILA 4MRRA 3K9LA 3QENA 1DAEA 2ZRBA 5KDLA 4O3MA 3KKMA 3TK1A 1FX0A 1OW3B 2WAYA 1GITA 4HI0E 2QI9C 4EKDA 3B7GA 2JLXA 2V1UA 1E9AA 1HA3A 5JI3E 2G3YA 2WJIA 2JIZA 4PZYA 1LW7A 2IHBA 4MYTA 1RJ9A 1XJ0A 3QXHA 1SXJA 3I61A 2GK7A 4AYTA 1OXTA 3CBQA 4LBVA 621PA 1AKEA 1N5IA 5LBIA 3X1XA 2VTKA 4ESVA 3OE7D 5L3QA 3SFVA 3BJIC 2JCSA 1QF9A 1EFUA 2HF8A 5DYIA 4C0HA 5HZHA 1NF3A 4DCSA 5HZKA 4UXHA 3THYA 1AS3A 5DE3A 3ZZ0A 4TZ6A 3QG5A 2QM8A 4HAZA 4KBGA 5JLJA 4TL6A 2GEDA 4ZDJA 3BIFA 2VBCA 2D74A 4HAXA 1CRQA 4G01B 1E1RD 4OHXA 5AJYA 1V43A 3CRVA 5EUMA 4D80A 3U44B 1F5NA 4US0R 1US8B 2YOGA 2VSXA 1QHHA 4CIDA 1ZYUA 3OHMA 3PR1A 4URWR 1XZPA 5FTNA 2FMXA 2CHGA 3QPUA 3QJYA 4QL3A 1A2BA 3QF4A 1Z8FA 2W2XA 4Q18A 1U94A 1W0JD 3W3ZB 1Q3TA 3L8ZA 5HPYB 3R7WA 3BORA 3NXSA 1Z0AA 2F1JA 3BH6A 4B3GA 1R5OA 2ZM5A 4URXR 1EX7A 2CL7X 2MMCA 4ARZB 4GMXA 4A2PA 1UKEA 2OCAA 4LV6A 5K8LA 4QHYA 4UNPA 3EZFA 3VX3A 5GJWC 2B8TA 1G5PA 2IS4A 3KL4A 1IXRC 2IX3A 3FFBA 2FU5C 1TUEA 4B6EA 2ZSBA 5AUNB 4OYHA 2C03A 4TT3D 1N0WA 4UQOA 4P0TA 1XBTA 3MWJA 1YR7A 1GL7A 1DE0A 3X1DA 1E2HA 4AD8A 3GMTA 3C8UA 1G4UR 4MKHA 4WXRA 3RRNA 2QBYA 3AVTA 2AX4A 1HUQA 5HCIA 2FSIA 4R71A 2RKOA 2Z5FA 1ZNYA 4KI0A 3Q8XB 4P31A 2BM1A 4IXMA 4JYBA 3HPRA 3IIMA 4TMXA 2G6BA 1W2GA 5JECA 4XIGS 4XWAA 4OQNA 2XTZA 2GAAA 2GETA 3AKEA 1IN6A 4MQBA 1J7KA 5JMTA 2WWXA 3CH4B 1F2TA 1N6LA 1W4RA 3C4JA 1N25A 1TF5A 1E79D 4L9SA 5FFMA 4URUR 2NO6A 1X1SA 2BDTA 2JJ1D 4WXPA 3T5DA 4IDPA 4DLTA 5E7MA 5SZIA 2F1RA 2IEZA 1KZGB 3KXIA 2IA5A 1AJEA 4XH9B 3WYGA 3F8TA 4DT1A 4JL6A 2JDID 1U8YA 2GJ9A 1D2NA 2ZTSA 1E1QA 3GJXC 4Q7MB 3T34A 2ORWA 3K0AB 4ZKEA 1GKYA 3KKNA 1G291 1F2UA 1Z6XA 1GRNA 1QHSA 2ZRDA 1HE1C 4KAXA 4E5UA 3DHWC 4DIDA 1T91A 3TRFA 1FQKA 4R2HA 5J4HA 1U81A 1I4TD 1G6HA 1OXSC 2FF7A 4PZLA 2CCJA 2OCYC 2ZREA 4PAMA 4V0KA 3T1QA 2VHCA 4F4IA 1LS1A 5IT5A 1E32A 5G53C 4C0SA 3NVAA 2HT1A 1NI3A 1SVSA 1Z2AA 4FW9A 3WHKA 2O0JA 1PZNA 1KI9A 3NKVA 4NP6A 2QAGC 3KB2A 4LSGA 3WNDA 5BN3A 1VIAA 1P72A 3GFTA 2BIFA 1M1YE 1CXZA 1T3LA 4GL2A 1S1CA 1COWD 3CR7A 1TTTA 1OKKA 2IYQA 3IO5A 3EPLA 4M1TA 2O8DA 4B74A 4QNRA 1Q3HA 2CLCX 4HZIA 2IEYA 4HLUC 3R9XA 2CLSA 2OCPA 1I2MA 2ORIA 2O8CA 1Z0DA 1WBBA 1ZU4A 1AQUA 5JCZA 4Z1MD 3K0SA 4GOJA 2W83A 5TDHA 1K8RA 3LV8A 1FQJA 3AVUA 5F98A 1UKYA 3RHFA 4B32A 5CIQA 1KMQA 4W9MC 3QNUA 3PUVA 4OQMA 1UPTA 4I1SA 4NYMQ 1Q0UA 1GRRA 2QN6A 3BOSA 2J7PD 1AZTA 2ORVA 3UMRA 3PG5A 5EE3A 2PCJA 3ZVRA 2J46A 2LKDA 2QY9A 2GAOA 3ZD7A 4RJLA 4BFUA 3ASZA 3BC1A 4HLUA 721PA 1XX6A 2P6RA 5JS8A 1TF2A 3EAQA 1BMFD 2Z43A 3MD0A 4P4TA 1E2GA 4KBFA 1HTWA 4B73A 4A82A 3U3MA 2ODNA 3GD7A 4QRHA 2HLDD 2VPPA 4KFSA 5FBQB 1CJUC 3IHWA 5B30A 3GFPA 4OK5A 2DWPA 3DM9B 3MCAA 4M53A 4F7WA 2JLUA 2Z4SA 3CB4A 1ZU5A 4DEXA 2QSYA 4QHTA 1QVRA 2O0HA 1XDBA 4A0HA 1LF0A 3NBYC 2Z0MA 2FPMA 2IW3A 2QA5A 3IIJA 1D6JA 2FZLA 4GDFA 2C9CA 3VNVA 3K70D 1E3MA 1PLLA 1H8HD 2F9MA 2ZRPA 5J40A 1P61B 1AK2A 2VA8A 4BPBA 4KSBA 2KB0A 4HZUA 4DIEA 4XWOA 1TNDA 2B92A 2GEUA 3TLXA 2BV3A 1MR3F 3FMOB 5JEEA 4NH0A 2WWYA 2YV5A 2PZFA 3MAAC 1QVAA 4B35A 2YVUA 1T0JB 1IOZA 2A5DA 3QKRB 4O2LA 4OI2A 3RRZA 1U2RA 3RSOA 1Q21A 4C0BA 3VR4A 4GT1A 1R8QA 2ZVPX 5K8UA 1TAGA 4BRUA 2FFQA 2WSSD 1OFHA 1KDPA 1O3YA 1Z6GA 4LWZA 4RFSB 4CEHB 2CNWD 1XEFA 3KUCA 1ZIPA 5JZVA 1MH1A 4LPKA 2A30A 1KK2A 2A5FA 2CL6X 4EJSC 3VTKA 4DCNA 3SOPA 4Q1DA 4A8JC 1RRGA 2Q9BA 5CLQA 1VPLA 3V00A 3QXCA 1S9DA 4BRWA 5KO2A 4WA7A 5K8IA 1QDEA 1CKEA 1KNQA 4B2IA 1GZSA 3EWAA 1G20E 2WWHA 3ECCA 4D2IA 3DZDA 1CR2A 1ZM2A 3SE0A 3PUYA 1M74A 1EGAA 5J4VA 2OZEA 4DLYA 3LBNA 4B6FA 4MDEA 4JLKA 1IQPA 1OIWA 3EASA 1GVNB 4D0NA 4LYHA 3T12A 2I1VB 2JLSA 1KI8A 4JS0A 1DO2A 4NL4H 3BWDD 2XITA 5J4YA 3OIYA 4A8JA 3GEIA 2BBWA 2Z83A 2REXB 4JJZA 1E0SA 2YOHA 3RNLA 3MWLA 1M8PA 2OSBA 4LUCA 2BJWA 1XMIA 4GZMA 4Q4HA 5EZ6B 4AIIA 1QRAA 3KTAB 2GDJA 3AH8A 3FMIA 3VFDA 1K6MA 3CZQA 5JI2E 1P75A 5JWRA 4RKEA 4QKQA 121PA 2G88A 3EPJA 3SYKA 1B23P 4Q1BA 1ZBDA 2ZI7A 4CZ2A 4GP7A 2P5TB 4LHVA 5FUWA 2W2TA 3ZIAA 2P0EA 3PITA 2OESA 4UJ3A 3T61A 4D0LB 5IF9A 3W6PA 1RYHA 4XD7D 3OESA 4MUAA 3VMFA 2DWOA 2Z6VA 4Q7KA 2NGRA 1R0ZA 2BMFA 1G19A 2YWEA 2GCNA 4KU4A 5EZ5A 2EQBA 1EFTA 1KKMA 2NZJA 3CF0A 3H1TA 2CJWA 2XGJA 4N3NA 2OXRA 1TPZA 1UDWA 1NSFA 1Y63A 2VF7A 3GEEA 4V0ME 2VEDA 5JSZB 4XSGA 4EPRA 4M8NE 3VR2A 3O47A 4KXFB 2ZRKA 2WOOA 2ZU6A 1KDRA 1WXQA 3AP1A 3LY5A 2VP5A 3EZ6A 3WNBA 4U5XA 5C4MA 3JVUA 1FTNA 3I4LA 4HUQA 2QMOA 3TJZA 3I92A 3BS4A 1VIYA 4QG7A 1VG1A 1WDTA 4FMBB 1W0KD 3SS8A 1ZC3A 4V02A 1NSTA 2ZANA 1DELA 2W6IA 4K46A 2IS6A 1IN5A 3AP2A 1HH4A 2ZJ2A 4HAUA 4A9AA 2XNDA 4V0NA 4FI3C 1E0JA 3NEJA 3LVRE 4TWZA 4BLRA 3UG6A 2YWHA 3K0EA 1H8ED 2GRJA 4LHWA 1FPMA 5TXGA 4QXAA 1WA5A 3A1UA 5TMPA 1VMAA 1G3QA 1NJGA 4B3FX 3U7FB 4UNRA 2ZI5A 3EIQA 3OIUA 4QOSA 2BJVA 1ZCBA 4TYNA 3PEUA 1UADA 3QUSA 4NCKA 3RS2A 1VG9B 4RVCA 1CTQA 2EYUA 5EUQB 3OEHD 1GL6A 4Q9KA 3L0OA 2IBMA 1W2HA 3BRWD 3I72A 5CYOA 2O5VA 1QHXA 1DAIA 2P67A 5IK2D 4WAUA 5CIWA 1G3UA 3JZMA 4NU0A 3F5FA 4CGZA 2ZXUA 1J90A 5EQTA 1I4DD 2V8OA 2IYVA 3PENA 3QKSA 1L4YA 2NTYC 1KY2A 4BEBA 4HYYA 3KQHA 4TQ9A 2WSMA 1XP8A 4CYMA 1U99A 3ADDA 3KX2A 4TTQA 5HE8A 3ZS9A 4UNQA 4WBSA 2PJZA 3TIFA 2KBFA 5G3YA 2IUSA 3KQLA 4AKIA 3A4MA 821PA 3RABA 3MFYA 3E2IA 4KSCA 1Z07A 5FUVA 1W46A 2G1KA 2VH5R 3QVUA 4FIDA 5UKDA 1CRPA 4C30A 2A5GA 4GBMA 3TAHA 4YMSA 3WMFA 2QGZA 2AN9A 4TLDA 2WAXA 2DFTA 5LD2B 2BMEA 5C1BA 2OE2A 4OJKA 2W6JA 2O8FB 1E9CA 1WF3A 1T9HA 5BQ5A 1HYQA 3WNCA 2C5LA 4RFSA 1E2KA 1FX0B 4CEJA 1D2EA 1VTKA 2QT1A 4PQYA 2RGEA 3C5CA 4Y0VA 1R8SA 3HDTA 1ANKA 3SDZA 1RJ9B 3OAAD 2JATA 2W0MA 4PAOA 1JNYA 1GNQA 1E4YA 1I2DA 2V6JA 3PIRA 4TLEA 2R2AA 4TYWA 1S4QA 2A5JA 4AYWA 1E2IA 3RS5A 3R8FA 2GCOA 5L3QB 5AUPB 4POAA 3U7HB 2GZAA 2AL7A 1FNMA 1A4RA 2WM9B 4C0QC 5KPDA 3THYB 1G16A 1EWQA 3CPEA 3QVVA 4HAWA 3P26A 4RZUA 3C5HA 2CK3A 2ANBA 3KJEA 4D25A 3C15C 1VCNA 2QTHA 1OHHD 4LHXA 2HCJB 3LWNA 2ZE8A 5F2EA 3AVWA 4M22A 5KSYA 2H7VA 4QM6A 1QHHB 1HV8A 4Q5IA 1Q22A 4BFTA 1Z28A 1GNRA 2QAJA 3LH5A 2ZROA 2IYZA 5FI1B 2ZRNA 3HU3A 1TU3A 5FBVB 2IYSA 1YE8A 3NBFA 4B44A 1WB9A 2J59A 1F60A 1FFHA 1JR3A 2J0QA 2MSDB 3A58B 3QEJA 3W9YA 3R7WB 2ZS9A 2DWQA 4BLQA 3B5JA 4IEIA 3UANA 4BFSA 2RAPA 4KLNA 1G3MA 5H1YA 1ESMA 1P2VA 4KFUA 1RVDA 4JLPA 1RRCA 3SHFA 1KJZA 4Q48A 4ON9A 5FTLA 1N2CE 1BYIA 1U90A 221PA 1X8LA 5DO9A 3UKDA 3ZQJA 5CDFE 5HKKA 5AWFC 4NPHA 2OLJA 4I1VA 2OAP1 4BLSA 2XJ4A 2A78A 1KKLA 4HDOB 4RD3A 4DLWA 4G5SA 5EE1A 1XNJA 1VECA 3MRSA 3RWOA 4EAQA 3T1TA 1NIPA 2AKYA 3CZPA 4B3XA 4MGKR 4GSYA 4QJ3A 2QBYB 1KDOA 5HTKA 5DHAA 4LZZA 1LV7A 1RRFA 2QTVB 2A7QA 2GVZC 2RGNA 5D3QA 2X19A 5B64A 5C2JB 3KQNA 3TUIC 1BIFA 2YJTD 2FPKA 3FVQA 3I62A 1IN4A 4NYMR 1KK3A 1UBEA 2JGNA 4OHWA 5KNCA 3DL0A 5JCPA 2YZ2A 2XXAB 2KE5A 4M1SA 1E94E 2VP2A 3HPQA 4JLJA 3ZGXA 3QPVA 2C04A 4HUTA 1F2TB 5BXQC 3CPJB 2GXSA 4JVSB 4QBIA 1N3BA 2OFOA 3JZAA 2BEKA 3K09C 4OI0A 5G40A 2ZR0A 4D26A 4URZR 2F3RA 1UBGA 1EX6A 1JPNA 3WYFA 4EFMA 3C7KA 3GFOA 4EQ6B 1Z0JA 4OI1A 2R6DA 2XAUA 1YKSA 4PSAA 4DT1B 1GL9B 1D9XA 3SJZA 1A1VA 3PXGA 3EC2A 3BGWA 2VIIA 1E9EA 3CNOA 3QBTA 4TLCA 1F2UB 1F3OA 2G1JA 4LYFA 5HCNA 2HEIA 4BFYA 4S35A 3GPLA 5TV2A 2R44A 1BS1A 1IY1A 3GQBA 3HP1A 2D7CA 4IFBA 5J4KA 1KMHA 3P1JA 4BECA 3RS0A 3A4NA 4N1AA 2RMKA 2AFHE 5FBWB 4GMDA 4OK6A 4BWYA 4NZYA 1E9SA 1LVGA 1YZUA 3LLUA 1E4VA 3VR6A 4FMDB 2DBYA 1K5GA 1L2TA 1M6NA 1AN0A 1SKQA 2IL1A 1ZD8A 1WQ1R 4DJTA 5AUQA 4IVQA 4A1FA 4BFXA 4P4SB 1SZPA 1Q57A 2PEZA 3V9PA 2O8DB 1KO7A 3HU1A 3SQWA 2B6HA 4WW0A 2EFGA 4NCNA 2O8FA 2O8CB 1ZW6A 1KGDA 4Q1FA 2C96A 4KHZA 4YMUA 3NDPA 4TSFA 4HLCA 2C99A 2VSFA 2PJRA 4QBGB 4B34A 5FR1A 4BLOA 2KSQA 5JHGB 1M7HA 3E1SA 3PFIA 3THXA 2F55A 4XOIA 3SJAA 1CBUA 3FHOA 1XWIA 3U7EB 4MDFA 2ZR9A 2QAGB 4FWTA 2RB4A 3UIEA 4A15A 4HB3A 8OHMA 4NCHA 1VG8A 3ND8A 4KITB 3W90A 2FE4A 3PCRB 4DSNA 2WOJA 3K9NA 1KI4A 3CF2A 3IGFA 1ZM4A 2IF2A 2G0TA 3LA6A 2R9VA 1DADA 5JS7A 1TL7C 3BBPA 3NBXX 3H86A 2WJJA 4G3XA 1GIAA 3A1WA 3OE7A 4DLRA 5FL7D 3AQ4A 2RHMA 3FYHA 1KSFX 3F3YA 2P5SA 1XEXA 1RKBA 1NKTA 4DCTA 2IYWA 2GJAA 4PO1A 2C78A 4UJ5A 3IEUA 5EP1A 1WE2A 3IQXA 1MO6A 3Q5DA 1G7CA 4M1KA 4B47A 5FPKA 3CKLA 4QHSA 1IN7A 5KDOA 1YQTA 3O8CA 3MSXA 3LBHA 4Q01A 2UKDA 5KTYA 4NCIA 2JLWA 3I8XA 4IXNA 1XD2A 3LAWA 5GJBA 1Z0FA 2QG6A 5H68A 1OYWA 2WV9A 3CUEF 4F93B 1AS2A 2QORA 4EDHA 1X86B 2OCBA 4MA4A 2OG2A 3DKVA 2VHQA 1UAAA 1W0JA 4HZUB 2YC2C 3LW7A 5B2ZA 2CLDX 4Q47A 2FWRA 4BE7B 1L4UA 3KXKA 3L82B 4DLZA 3DDCA 3WY9A 1W7AA 2R6FA 5K8TA 2BWJA 3S1AA 1P62B 1P3JA 2CBZA 2R6AA 2XJ9A 4PSKA 3WRXC 5IHPA 3VNUA 1W48A 1DPFA 4GPTA 4OL0A 5J47A 4Q02A 1F48A 3H0KA 3RANA 5FOUA 1G64A 2ZUBA 4RD6A 4PHTA 3WXMA 3NH9A 2AWNA 1NBMD 1DBSA 3REGA 2QT0A 1N6KA 3NDBB 4H1UA 2VRWA 2V3CC 3ADKA 4TT3A 4MRSA 1SHKA 5EXPA 2P2LA 2D62A 2X1VA 3B13B 1CR1A 4ZCMA 1W36D 4RFVA 1UEJA 3ASYA 5M04A 2E1RA 2HUPA 4WZAE 2O0KA 4Q4JB 3J81k 1A5TA 1ZM9A 2XXAA 3VU9A 2PX0A 2ZRHA 2CMKA 1JALA 4M1OA 3K0CC 3NBZC 2ZPTX 4U7DA 5DN6D 1XFAA 4LJAA 4DC9A 4JLOA 2IS1A 4ACBA 2I3BA 1PLKA 4NONA 2HXSA 2IK8A 2F6RA 3BERA 1IXSB 1P73A 3MJRA 4D82A 4EFNA 3HWSA 3HYRA 3IPXA 1OSNA 2OFWA 2G0NA 4US2R 1E79A 3VR1A 4EQ6A 4F38A 1II0A 1Q20A 1AQYA 1OXXK 3EPHA 5BWMA 1KO4A 5IDVA 2JJ1A 2RGGA 2J1LA 3FPAA 2PEYA 4EJSB 2FDCA 1KIMA 2HF9A 1OFIA 4A8JB 4MKGA 5L3SA 5GJVC 2GJSA 1OH6A 1OB5A 1P9WA 2EU8A 4MGIR 2JDIA 4LC0A 4Q4HB 3NEYA 1KOFA 3CX6A 1Z2CA 2XNSA 3HYTA 3AGPA 2V9PA 1WP9A 2PLFA 4L8GA 3X2SA 1DAFA 1LB1B 3VR3A 1JQLB 3WMGA 3TSWA 1R10A 2UZIR 2CL0X 3T35A 2ODBA 1GUAA 3L0SA 3RRMA 1OIXA 1NMXA 5FBLB 2FSFA 2Q21A 2PLRA 5J5CA 3T15A 3FOZA 1ZNZA 3SFZA 2N1BA 2DR3A 3TVTA 4YLGA 2CJWB 4P4SA 5E3HA 3SC3A 4PQRA 1OF1A 1II9A 3Q7PA 1G8PA 1W1WA 3E5HA 3I8SA 4BEJA 2WKQA 2RGDA 3AM1A 4RY2A 1COWA 5BW8A 3CW2A 3DM5A 4CVNA 2VQSA 1KI7A 2NO0A 3MJHA 4JBXA 4OJQA 1GOTA 3IIKA 1W5TA 4HUQB 1E0KA 4EPTA 3I5YA 2ZI9A 5JWOA 4FMCF 4B71A 3VAAA 2J5XA 3MWYW 1XMVA 2QAGA 3D3QA 1JAIA 3BAFA 4Z1MA 1WRBA 2ZS8A 4FWIB 2J45A 4M0LA 3B8HA 2JJ2D 3EIHA 3G5UA 1GWNA 2ZRLA 3EX7C 1WBDA 1MV5A 4PR0A 3CNNA 4YMTA 3LQQA 1KAGA 3K53A 2VP9A 3B1YA 3IPYA 1QBKC 2J7PA 3K1JA 1OH7A 2A9KA 4QBFA 2C95A 3IDQA 4DZZA 3IILA 3QXJA 2ZRJA 3FMPB 3KJHA 2H92A 4Q00A 2ZIAA 2FZ4A 4AKEA 1EFCA 4PQFA 4MGYR 4DLUA 1NY5A 2C2HA 3B1ZA 1BMFA 3VKWA 2PZEA 3K70C 4AYXA 1Z29A 1GSIA 1TMKA 2GXAA 3WMEA 1PUIA 2QEQA 2YC4C 3LXXA 3AP3A 4PPNA 3UG7A 2NO1A 3DPUA 2HLDA 2IYTA 4IW3B 1NNEA 2E9SA 5FPTA 1CJMA 2CVHA 4FINA 4ZCLA 3KKOA 4LYJA 1IM2A 1DG1G 2ZAOA 4NHOA 3L2OB 3QKSB 1XB2A 2Q3MA 2CHVA 3NHBA 5JFGA 2VSOA 1ZIOA 1BO6A 1OE0A 3ZS8A 1T6NA 1FW6A 5JJLA 2Q3HA 5EXSA 3BB3A 1NVVR 2FPLA 4XTRA 1XU4A 3W3AA 1TUIA 3QE0A 1H8HA 4IVPA 3K9GA 3VKGA 4JIMA 5DH9A 4JKIA 4DDUA 3BH7A 1TQDA 2VYFA 1UDXA 1G6OA 4NYIQ 3REFA 1SVWA 3RLFA 4M9ZA 2GZDA 2XZOA 1IJEA 3GLFB 3QKTA 4PFSA 4V03A 1BOFA 2FSGA 1A7JA 1U0LA 2EFEB 3BFKA 3PVSA 2P65A 1C9KA 3PUXA 1KSGA 3UMFA 3GJ7A 4HB0A 5EJEA 1VYUA 4GOXA 4GI7A 4EPYA 4CEJB 4CEIA 1Q1BA 3QPWA 4MUBA 2F9LA 1TF7A 3LQRA 4XVUA 4RZ2A 3RSLA 2WKRA 4Q4JA 2WSSA 4I4LA 1ODFA 3U3RA 3N5CA 2QZ4A 2Y8EA 4NE2A 2ZRCA 2CNWA 4URYR 1II8B 1W5SA 4DLVA 1XPRA 3KQKA 2GCOB 2V6IA 3QKUA 4QGHA 4Z51A 6Q21A 2HYDA 1P7CA 4Z54A 2JLYA 1JPJA 2FFAA 3A6PC 1Z22A 4FCWA 1XTRA 1E9FA 1U9IC 1CULC 2ERYA 2DYKA 2WKPA 2ZYUX 3I73A 4YC7A 3WRYC 4EJSA 3CRMA 1YZQA 3ETLA 3H84A 2X2EA 1WMSA 2A2ZA 3M1IA 2AHOA 2V7QD 4YXWD 1NG9A 4Q7LA 1S0UA 2ZETA 3OIWA 4ZIRA 1T4GA 4K81B 4TMVA 3K0FA 3QXXA 3ZZUA 2GCPA 4URVR 1P4SA 3ZDQA 3QG1A 1UEIA 4IDHA 3SJBA 5DYGA 2QPOA 1JBKA 4AC9A 5F9FA 5DI3B 1KHTA 3ZH9B 3C41J 3GLHA 1U9IA 4FMDF 4OHVA 4DXAA 4F4JA 1YR8A 4L15A 5TVKA 2FJUA 2WICA 5BN4A 2PT7A 5E95A 3PEYA 4LJYA 4YMVA 2K5UA 2C77A 1GG2A 4M1YA 4ABYA 2WZQA 1KK1A 1X3SA 2ZJOA 4KVAA 3ND9A 4XD7A 2GF0A 3GLFE 4MKIA 1Q1ZA 1E2QA 2XB2A 2IF0A 4IDQA 4OQXA 1G3RA 2IUUA 1E9BA 5KNBA 4TZ0A 1QG4A 4Z8YA 1AIPA 2PMDA 3QEOA 5KDDA 4UNNA 5G41A 4TL9A 4D4JA 1E2FA 2D06A 2QUZA 5JWHA 4C0AC 1EESA 4ASUD 4M1WA 1ZJ6A 3R9IA 2VP0A 5FOTA 3VHXA 3AB3A 2HJGA 2FFBA 2UVQA 2O8BA 5EE5B 2QRZA 3PJRA 1W0KA 4F91B 1JXMA 1KZ7B 4IDNA 1NVXQ 4KO8A 2FV8A 4A4DA 3U6BA 3GJ6A 2WWGA 2EFDB 3SQXA 1CS4C 2J3EA 1Z6TA 3R20A 3M4YA 4PANA 4GOKA 1XJQA 1N6OA 2KBEA 2LCFA 2QMHA 3M6AA 2IYUA 3KFXA 4WZBE 5L3RA 2YWFA 2H1LA 1Z0KA 3TSOA 5CITA 3FDIA 1H8EA 2TMKA 2PCLA 5J4LA 2FH5B 2QE7D 4DBLC 3Q72A 5KSZA 1LF5A 3NHAA 1FUKA 4IOMA 4E07A 1E99A 1G7SA 4M4SA 4M9QA 2BKEA 3L8YA 4C0JA 1DTSA 1EFRD 3TQFA 4Q19A 2JJ8A 3U5ZB 3A1TA 1CR0A 3B1WA 4ZI2A 3P4XA 4EPVA 4JSYA 4P3YA 4P4UA 4EPXA 3OEHA 1JR3E 4DSUA 2FEMA 4A36A 1YU9A 2OT3B 2GBLC 3FMFA 2Q0HA 1KMHB 5IK2A 1T5IA 2GF9A 2LWIA 2XZLA 3CM0A 2CVFA 5C46F 3OIVA 2O8EB 1HE8B 3U4QA 2CXXA 3QI2A 4JJKA 5FTKA 2ODWA 2WPDD 2X77A 4JT4A 2GVDC 5E7IA 4NBSA 2QTFA 4TMKA 4A92A 3CWZA 4HEJA 5F9HA 5FUXA 3GLFA 1TU4A 2VHUA 4W5JA 2CE2X 5LB2A 4XJXA 2GBLA 2WMNB 3E70C 3RVBA 3IEVA 1GP2A 4KFRA 3L0PA 1D5CA 1R0WA 3MMPA 1UJ2A 3SNHA 3IQWA 2L0XA 1IONA 2GTPA 4LV8B 4BFWA 2QU8A 3AVOA 1N0VC 3EA5A 3L43A 2CDNA 2XX3A 2CE7A 1N5JA 3CR8A 3MG9A 5CYPA 1KO5A 3THXB 2JA1A 1G5TA 4TQAA 1T0HB 2QP9X 2ZITA 1P60A 3EZ7A 3GJ3A 5HR5A 1IJFA 4QGAA 3SU8A 1E2NA 2BCJQ 2I1QA 5BYJA 4FMCB 1II8A 4PPQA 2GXUA 1R5NA 5AJXA 1MOZA 3LW8A 2DFKB 2G77B 2H5EA 5JJKA 4ZPXA 1XEWX 2AR7A 1A2KC 3VR5A 3PEWA 1I4LD 1NP6A 3OAAA 4MKFA 2OILA 3AGQA 3MUFA 1J2JA 4DUGD 4CT4B 3GJ5A 4Q1EA 1P2UA 2MSCB 1NLFA 5AJVB 1GILA 4ERNA 5KYKA 2EYQA 1N6IA 3EG5A 4TTRA 1XEXB 2DB3A 2J87A 4P32A 3WP0A 3W8RA 2R8RA 4BASA 1OH5A 1NIJA 2R65A 5A0FA 2YWGA 1Y3AA 2XSZD 2CHQA 4DHEA 2OLKA 4XVRA 2XTMA 1YZLA 2QQ0A 4YDHB 2OBNA 5L3VA 1ZCAA 1OHHA 2W58A 2WVJA 4TMTA 5H8WA 3SBDA 2O52A 4AG5A 1EG7A 2QM7A 2IYRA 1XD2B 3RC3A 1JI0A 5DI3A 3OFND 2BKUA 4B3BA 2GA8A 5KU1A 4ZDIA 4N0DA 1Z63A 3TW4A 4JMPA 1YZGA 1MRSA 1AZSC 3CIOA 3K9HA 2XB4A 3BFXA 2BC9A 1NVVQ 1KTVA 3LRPA 4DSOA 1HEIA 1RPZA 1NVUQ 3VX4A 3LX5A 4WOPA 3U7GA 1G7TA 1XZQA 4U00A 1T3HA 1XPOA 2V54A 3DMDA 4MH0R 1S1MA 2ZI4A 5SZJA 1HT1E 2NZ8A 1R2QA 3S1AB 5GVRA 1AM4D 2V4ZA 1QHNA 3EWSA 3GLGA 2J0VA 1C4OA 1OB2A 4IDOA 4Q21A 2B21A 4AI6A 1XXHA 2BVNA 1Q1QA 3GJ0A 3U60B 4TMWA 4XSHA 3THWB 5C18A 2QGNA 4IVRA 2BCGY 3JVVA 2DHRA 2NMVA 1FL9A 2KWIA 4LCBA 3FHCB 3EXAA 5A5GA 3O8RA 3U6KA 4DKXA 1E2MA 4Q9IA 3FHTA 1IY2A 2ZJZA 2ZSDA 2FX3A 3V4FA 4AURA 3UXMA 1JQJC 3NH6A 2N42A 2OFXA 2ZR7A 1L8QA 3VU9B 4PTLA 5KPJA 1JJVA 3D6TB 4TTPA 1Q1EA 5ANRB 4B76A 4JLNA 2BBSA 2XEXA 1U98A 2FN4A 2PH1A 2BBTA 3QQ5A 4IOLA 1DG3A 3Q5EA 3OEED 3TR5A 4FXPA 4PC2A 5LB4A 4GP6A 1U8ZA 4JVLA 3HR7A 2XOKD 3BFVA 4DCVA 4PC1A 4TYQA 3I32A 3W5JA 1J99A 3MGCA 5EP3A 2NO7A 2IWHA 1OIVA 4ZV4A 2ZJYA 1S96A 4BLPA 2JEOA 1VYTA 1YZNA 2DFLA 4PPGA 2QENA 4ZDWA 4HLQB 3QSYA 4PC6A 5L3SB 2LKCA 4ACAA 2DPXA 5CB8A 4ZDKA 3K09A 3T5GA 4MITA 4WZ6A 3AKYA 2RGAA 2GESA 4L4UA 1J70A 5KHOC 1N5LA 5BN5A 1NMYA 4BZQA 1T8UA 5DLQC 4D4MA 1XTQA 4YMWA 1NG1A 2O8EA 3SYNA 3Q7QA 5FPYA 1K5DA 1XMSA 1KI2A 1ELOA 3BB4A 4UNSA 2GK6A 1TQ2A 4BGDA 4F92B 3B78A 2JLVA 1W44A 1SVLA 4NYIR 5GJCA 1HQYE 2PBRA 3GJ4A 4JL5A 1G21E 1ZNXA 3T06B 2IYXA 3MWKA 3VQTA 1XD9A 5FPSA 1SVOA 1OJLA 5B57C 3TAUA 3CNLA 3SJCA 1ZD1A 1HT2E 3EPKA 3TH5A 4LK2A 3FKSD 1TX4B 3OF5A 1M7BA 3RRYA 4TMZA 2OBLA 3FWYA 4BZPA 4PHGA 4DSTA 4R2IA 1SULA 3UWKA 2ZJAA 4BFZA 1SXJC 3CX8A 1KYIA 1Z0IA 5E7JA 1IAQA 5KUTA 4UKDA 5G3ZA 4GNKA 3IHLA 2J0SA 3GLIB 4DB2A 3W6OA 4A2QA 1BH2A 5JRJA 4C7OB 2JIZD 5KSPA 4JVNA 1R0YA 3FKQA 1Q12A 3DOEA 5FL3A 2PX3A 1X8KA 3AV0B 4IRUB 5FH9A 5DISB 5TY0A 1R4AA 1SXJD 2PT5A 3AUYA 4G1UC 1RRPA 1ZP6A 1G7RA 2ZI6A 1JJ7A 1MRNA 2YINC 4C4PA 1NKSA 1DVRA 1OYYA 2HXYA 4IKEA 4PC7A 3SI7A 3TR0A 3U2QA 4ESHA 1ESNA 1IBRA 1KO8A 5FL7A 1KI6A 2WMOB 4OHZA 5B58C 3KUDA 4DLXA 4D6PA 1B0UA 2GNOA 3U3JA 3TE6A 2X2FA 1E1RA 1TQ4A 3Q3JB 1U0HC 4LGMA 2AK2A 1N6NA 1DS6A 5DGXA 2WHXA 2ZYTX 3NWJA 1DOAA 5JHHB 4GRAA 5CM9C 1ZUHA 1KAOA 3TSZA 3A1VA 2P6NA 2DY1A 3O8DA 2IS2A 4EPWA 2KJQA 4LY6A 3KQUA 1ZRHA 3TW8B 5CLLA 4KVGA 3D31A 1FOEB 1KK0A 2JLZA 2CEAA 5AR1A 5EXTA 3K70B 5FUYA 2WIAA 1E2DA 1NL3A 2FGJA 4M1MA 4C2UA 4AKHA 3B2EA 4MRNA 4EUNA 1NLYA 1W36C 3VKHA 1N6PA 3AVQA 3NIBA 4MYUA 1GNPA 2REOA 2ZI3A 4JZKA 4PHHA 3KZ1E 3EA0A 1V5WA 3LVQE 4QBHA 4PO8A 3ZYCA 1J8MF 5FI0B 3THWA 2HDNB 1E2LA 4JLMA 1R5BA 4JVMA 1AS0A 1JR6A 2ZVQX 2IHYA 1S8FA 4CEIB 1R7RA 2VO1A 2VHJA 1NBMA 1Z3IX 2F1IA 1E6CA 1D9ZA 1P6XA 1SVIA 3GLIE 3B9QA 2QMEA 1XEWY 3T1OA 1RW4A 4NYJQ 3TKLA 5A4JA 4GFDA 3CO5A 1GTVA 3F0TA 2WJVA 1MABA 4Z8XA 4TLBA 1BYUA 1DAHA 1QHIA 4TYPA 2RGXA 3LNCA 5DN6A 3WYAA 1YR9A 3V4RA 2ERXA 5TB5A 3KFVA 2ZS7A 4ZKDA 5KSOA 3A37A 4PC3A 4YONB 1AKYA 1DAMA 1Z83A 1NJFA 3P27A 4O25A 1M34E 2HV8A 4AK9A 4LOAA 1AGPA 4B43A 1SHZA 3K0CA 4M9XA 4R7ZA 4ZIRB 2IXGA 2W2VA 1PUJA 3K0FB 5AJWA 4LHZA 4PPFA 1E1QD 1GKUB 3UATA 3Q85A 3QY0A 2KI5A 4ZCIA 4LJ4A 1LTQA 1ZMXA 3DKPA 4ITRC 4PAQA 1KI1A 5KNDA 4KODA 5LDDC 4G0NA 3DMNA 3GLHB 3THOA 3W34A 2ONKA 5FBRB 4LC1A 2P6UA 1IXZA 1DO0A 2ZSAA 2F43A 1KY3A 4JBYA 3P32A 3DVLA 2ZU0C 1A82A 2YNMA 3CRQA 1PJRA 4LBZA 4JSTA 3UWOA 2H18A 4KFTA 2J7KA 1XCMA 1KDTA 4LX0A 4Q4AA 3L0IB 4E22A 3TUZC 3PV0A 1S9HA 1SVKA 2OAQ1 4A2WA 2WWWA 4ZI3A 1YZTA 1P2TA 1UKVY 2OUKA 3BXZA 1M7GA 3LBIA 2WJGA 5D3MB 2DFNA 3AF2A 4LDJA 3GCGA 1OKKD 2FEOA 3N2EA 1VCOA 4K8OA 1KSJA 4MYHA 4RCZA 4W5WA 4B2PA 1ZUIA 4CW7A 1QG2A 4RD2A 4KYUA 4YQFA 4MYCA 1GM5A 2UZ3A 5SZKB 2H8KA 5DHFA 3GLIA 2RGCA 3RS7A 2O8BB
chains in the Genus database with same CATH superfamily
1NNSA 3TZLA 1IN8A 3KLOA 5IRCD 5H3LA 4AS2A 1P9LA 2PL9A 3PHHA 4AJHA 1EWRA 3HL0A 5AXBA 1E8DA 2JJ2A 4QTXA 3W9BA 3G8YA 2BBOA 1R9GA 3FCXA 5LSAA 1XJCA 3PCTA 3WIDA 4Z3OA 1NZFA 1GYQA 1HG0A 3WBKA 2JAOA 3HZHA 3QLVA 2QROA 3A3PA 2XKAA 4RF2A 3G9XA 4KQFA 3HL4A 4QC2A 4S2EA 1MT0A 2I3GA 1UJCA 2C9ZA 3N70A 1FNNA 4XJTA 1QFZA 1TD9A 4ZD6A 3SFTA 1R15A 1WWKA 1H5QA 3FPBA 4KV7A 1M34A 3CIFA 1XK6A 3EZ9A 1LFDB 3JD4A 1DARA 3GARA 4YRLA 4U6NA 2Y93A 2FK8A 3QOFA 2G5TA 3CPHA 1H93A 4MQ6A 5D87A 4W1RA 2JFBA 3EPPA 2YHSA 3IE0A 2OHIA 3P2IA 1ZY2A 4FLFA 1XMJA 3OT5A 4JBLA 4YRIA 3K8ZA 4V0OA 5BVHB 2PTHA 2FLKA 5C4IA 1YVDA 1UZLA 4UTZA 3D2AA 4AUEA 1CU1A 1FP6A 2CD9A 2XCSB 1QGUB 2R1TB 3MOSA 3H05A 2PUDA 1YRBA 3SLGA 4C06A 4WK0B 2HA0A 4PG8A 1HXHA 1MGPA 2GXQA 2IXEA 3HFSA 4L9AA 5JZMA 4MV8A 3MUEA 3NRBA 4LBWA 1W85B 4TTAA 3DEIA 1A8IA 1CLUA 4I55F 2DETA 5E9QA 4PZDA 3AHIA 3GMDA 4BZZA 2JASA 3T1TA 4L08A 2BM9A 1Q74A 1OX4A 3ZIUA 1NQOA 2GHIA 5IANA 1KTIA 3QU9A 2HU5A 4RZXA 1NFFA 1WP4A 4LJ5A 3IQGX 3SHQA 5TSDA 4MA5A 3WB2A 2AC4A 3KPUA 3WADA 4P8RA 5FQNA 4KTTE 3DMTC 3EW9A 4D97A 1OFUX 1WAMA 2FF5A 3HFGA 4OGGA 4Y30A 2NPIA 3P9KA 4MTLA 4BZXA 2IIVA 3ETEA 3L6DA 5SV2A 2G5GX 1PQPA 3ITDA 4O08A 5KWIA 2DUJA 2EFHB 1E69A 1BVRA 1DC5A 2HTEA 1U0JA 2V55B 3KQTA 1Z7GA 2BEJA 3LD9A 4KJXA 1HDGO 3JD2A 5AK6A 3ZE6A 5A06A 2XZPA 1EX1A 3VR4D 1BWPA 4FCTA 1V47A 2LIVA 3D8SA 1Y82A 2C8JA 1YA8A 1X9HA 3G0DA 4LJ8A 3VO9A 3FSGD 5BWCA 1NASA 1JHVA 4CMEC 4G5QA 3WWZA 3LT4A 1EGQA 1CEEA 4L5YA 3DMTA 1KH1A 2WBLC 4IJUA 4W82A 4EIWA 3KPJA 3B5EA 4N8SA 2W48A 3DOOA 3AVVA 2FDXA 2CZCA 3L8MA 3IMKA 4Q66C 1ONBA 4BU1A 3SF8B 1HTTA 2BMAA 1VOTA 3HUFA 1ZNWA 4OM7A 5C0OE 3ZD9A 3JAWB 4BJ3A 4M36A 2FWIA 2HU7A 1VLQA 4R7GA 2FSSA 1ADBA 2H0RA 2Q3FA 3DS8A 3W78A 1L5QA 2GEVA 2P9ZA 1OA1A 4NCJA 3DOFA 2AJ8A 2V7VA 4PLTA 1L4FA 1PFVA 2YXDA 1P8JA 3KJIA 4LJ6A 3WE7A 4CMEA 4EX7A 5AIBA 1U2QA 4YALA 1ONPA 1T1JA 1C1YA 1UBFA 3N9IA 4J3JA 2NU8B 2QUHA 1SQ5A 2MSKA 4MW5A 4ALLA 1P77A 3OTWA 3EARA 3JASA 1U8TA 2ZE6A 2AEFA 3AEKB 4QO8A 1BH6A 1SKYB 1Q95A 4JP2A 4F6CA 3USES 2Q7XA 3PWZA 1M2OB 1Z5UA 1FC0A 5CB4F 4UMVA 3VNSA 4NAHA 1T0IA 2Y1CA 3U3OA 2ZSUA 3IERA 4B2YA 1W5AA 2EWWA 4O1HA 1H5UA 2J41A 3K0AA 3BB1A 2BFEB 1CYEA 1U8FO 3FOBA 3WRYA 2PXCA 5ALWA 5AM4A 3E7FA 1OLSB 3L1UA 3ZK7A 4M7PA 2JAUA 3NHPA 5CVVA 2CJPA 3EDQA 3H17A 2GZ1A 1Y8QB 1SG9A 1X8JA 3I2FA 4HHEA 3E7PA 3ZIAD 3ELBA 5J2TF 1B14A 1NVKA 2VOJA 1T2CA 2FQ1A 1AA9A 3BSWA 4KXVA 4B9EA 4BX0A 2IXTA 1E77A 1VKOA 1FTSA 3SBXA 2VSQA 3MS2A 4IMPA 4O3FA 3RROA 3V48A 4MQEB 1CRWG 1A04A 1J9EA 1G8HA 1VE5A 2FMKA 3QLJA 3AEUA 2YQ5A 4Q34A 3KQSA 3SICE 2EJTA 4QUDA 3ZJYA 4L3VA 1OCEA 3NJ8A 2EHDA 1PBTA 5FPHA 5K4AA 1PR1A 1PJBA 1PLJA 3AF3A 3PR3A 4ER7A 3TOZA 3CX4A 4ETNA 5JRZA 2OC4A 3VR2D 2AMYA 1FF9A 5DHRA 5BNIA 4BNDA 1SVUA 4DWJA 2Y4OA 2HH9A 4WNYA 4FD2A 1DGQA 1PJZA 3VC2A 1B8NA 1E98A 5C7YA 1JDBB 2A88A 3RDPA 4L9RA 3X1YA 4XVQA 2OECA 4RZ3A 5LYYA 3IVXA 1RXWA 1J0CA 3ETHA 3TVDA 2R8OA 2IU6A 4FEEA 4GZLA 3ESYA 4C05A 4KV9A 4J8PA 3G8BA 5HOEA 4YLYA 2PM8A 4ZC1A 1S01A 4ZGGA 2AFIB 3C1OA 4YWJA 1WNTA 2W6ID 3JS5A 2QX8A 4HF7A 1N34B 3DPSA 1TIPA 4FOOA 5H4HA 3M9WA 4TTIA 2XKBA 3W8NA 1EB9A 3CWQA 6NULA 4B2LA 3TQOA 3NBQA 2FPOA 3ZN2A 3ZQ4A 3O84A 4QYIB 1N1DA 4MUGA 2FWPA 2VBIA 1BE1A 1PDWA 1UK7A 3KB1A 4LDZA 3PJFA 1DI0A 5AUOB 2BR5A 2SHKA 4L4XA 5EP4A 2PFGA 4MS3A 4UREA 3FCYA 2Y05A 1NMZA 2OM2A 4Q1VA 3WLKX 4D8VA 2ZM6B 1UZMA 1D2CA 3O9ZA 2WNIA 3R5FA 4L07A 2BHTA 2QK4A 1G9XA 3COWA 3GT4A 5HUHA 2YYYA 5FOQA 1NULA 1NDUA 7REQA 4B33A 3H5OA 4FKMA 3X2FA 1UK6A 3LY8A 5K0BA 1U2ZA 4CLEA 1JFTA 2FW6A 2JCXA 4TL8A 4BNZA 1RHRA 3GVXA 1CJVC 3WSVA 2O1SA 3RTDA 1SOWA 4E03A 3RYCA 2VQDA 3N3BC 4J0JA 1USVA 1D4AA 2I2XB 3VHLB 2NSLA 1Z2OX 2BGJA 2V1XA 4J94A 2H48A 2H54A 2BMDA 4K05A 5HS6A 3FD8A 2BI4A 4ZI7A 2W98A 1K27A 2C0CA 1MEJA 1J0XO 3L6OO 5IVIA 13PKA 3RRXA 4E4TA 2W2LD 4FZJA 3MTAA 2L82A 5IUNC 3ZVMA 1JHAA 2WPDA 2I7CA 1UAGA 1VKNA 2AKEA 1E2PA 5I7SA 1V6AA 3T1VA 3GRPA 3IV9A 1YFKA 3G2QA 3CH7A 3D1LA 2Y1DA 4N49A 1CWUA 4CG1A 2QTAA 4G0VA 1P0IA 2IY7A 3B60A 2AG0A 5H70A 1EGVB 2IHNA 1QYWA 2NXNA 4C88A 3FTEA 1UF9A 2ZT6A 4HWTA 4Q93A 2JFVA 2GR9A 3PQEA 3KKQA 3GYGA 3RKSA 2H85A 4FN5A 4DIFA 4HFRA 4H1WA 4A03A 3R5XA 3PUWA 2W6JD 2ZB2A 4KRYA 2CDCA 3KJQA 3L8HA 2Q28A 2ZAMA 3INTA 1LJ8A 3AYXB 1GAXA 5JQGF 4WCFC 4NYJR 4N8EA 4XSVA 2NXCA 3C3AA 3PE6A 5IVHA 1NE7A 3AL2A 2BEUA 1K7SN 3EQZA 1NVEA 1PVOA 1HRDA 3Q10A 1ZM3A 1EFDN 1FMJA 1RC1A 1E1YA 2QTRA 2ET6A 5IG2A 2ASEA 4BQSA 1BKDR 2ZIWB 4DQLA 3PBKA 3SBEA 1I2AA 4GI3A 4IO0A 4B3MB 2PUBA 3IUYA 1W8DA 4WJKB 2HF2A 3GEHA 5T4EA 3HR8A 1U5BB 4D8UA 1RC8A 2C2GA 3NMUF 3BE4A 2FUNB 1P45A 3LYAA 2FEAA 2BM0A 4N18A 1PK9A 4RORA 1W4AA 2NTNA 5K3AA 1G6Q1 3QW2A 2X40A 3BCHA 4RKQA 1XZNA 3PUKA 2PO7A 4KWHA 1BVUA 3I2HA 2CK3D 2AWOA 4GVXA 4JEIA 1KP9A 3CZMA 3T94A 3IKMB 4GPAA 4I6EA 2ZAYA 1VKJA 4GE3A 5TARA 1WBDA 4MUNA 3E0XA 4OXRA 1JWAB 1G8YA 3P9SA 3P97A 1NLUA 1NN0A 2NXJA 3PUHA 4OAOA 1DTWA 5ECGC 1QGAA 2PZJA 2HEGA 2QP4A 1JDJA 4RKFA 3HJFA 3TGLA 3OZEA 1XRQA 1E0AA 2QHXA 2HB6A 1FFEA 3SHVA 5DP1A 5LWQA 1KR2A 2PKWA 5FYQA 1IJBA 2D5CA 1JR3D 3OFNA 1D03A 2NUPB 1CIPA 1FDRA 1P4JA 3RQIA 3RS3A 4MI1A 3KDSE 2MMGA 2JL1A 3S99A 1CHDA 2OGSA 2ZJBA 3TDMA 5P21A 5HZGA 5K3OA 3UJPA 3DAHA 1EFPA 5E9JA 3PPVA 1VCIA 1Z74A 3K9BA 4JNCA 2OAGA 1BNCA 1MEEA 2PKRA 3QF4B 5ALEA 4ZRMA 4HN9A 4MKXA 1P31A 2DY0A 2OV1A 5K1ZA 4JI8B 2ILTA 1GPUA 1NW4A 3AFMA 3K05A 1OJ7A 2M1ZA 2GUWA 2B36A 2Q2OA 2BD0A 2AXNA 2H8GA 5HKKD 4EVRA 1P1KA 2YY5A 4TLAA 3V7FA 1VRVA 4ZFNA 4P7JA 5JROA 4LHYA 1CY8A 1RADA 1M8FA 5B7NA 4BYMA 2IUFA 2QXYA 3KUKA 2OXIA 3G02A 4P5EA 2MU1A 3GP8A 2XUAA 3NCHA 3ROMA 4EY4A 3FYUA 3QOYA 4ZO8A 4ZCQA 2J4FA 4QEKA 4I8IA 4PEVA 4YPVA 3CZRA 4QQNA 5JSZA 3QIAA 3TBKA 1GCIA 1ORHA 1GPH1 4C0KA 2JARA 1G8AA 1A50B 1S02A 2JHFA 3AM5A 3IKTA 1LPNA 3A1EA 3IJ5A 5EMJA 2XVXA 5I51A 1FS6A 1JB1A 1VDMA 1YHNA 1W4CA 1NVWQ 2ZR8A 4R0NA 4JT2A 1U8AA 3DQZA 2YKGA 2IP1A 1O87A 4QXMA 4O4JB 1I3KA 4GKJB 3D4IA 5BSGA 4N8DA 5I9NA 1ZGGA 1E4EA 1QDLB 1P29A 4URHA 4G5YA 5JTUA 4RV5A 4EEZA 2VL7A 2D7DA 4A6XA 5ESWA 2ZJ7A 3AVPA 4QOHA 3PKIA 3N2IA 1QE3A 4OQ4A 4KQ6A 2J09A 1NV9A 2XOKA 1AMUA 1QP4A 1JECA 1G8GA 3JRNA 1ZJJA 3NM4A 4Q3CA 4UXJA 1RXUA 1S7GA 1UM8A 2G4CA 2NOAA 3D6NB 3MYYA 4R40A 2MCFA 3ID6C 4QT0A 3SEAA 4CN9A 2Q9AA 3RVSA 1ZD5A 1OH8A 4A0RA 3W6NA 1V4BA 4UXIA 3BGSA 4YA6A 1QJCA 3ICPA 4QAJA 2ZJ5A 4TXJA 1RI2A 2JGRA 3WDMA 3COVA 1F5SA 4GLBA 3B6IA 3QEMA 2YJ4A 5BNFA 2GRUA 5EZSA 4KPGA 5C7IO 5AJZA 3THSA 4IXDA 1H6BA 1EEHA 3DLAA 3OTIA 4BO9A 1SXQA 3U9LA 1V71A 2QV7A 3WL7A 1K6JA 2X41A 5DNYB 2OHXA 4CCYA 5I7VA 4NV0A 3PGA1 4GM0A 1U0RA 1X1RA 1I4EB 1P1IA 1XLTA 2BMJA 3Q7IA 4RGBA 2OCKA 3NHKA 3L5OA 2RK4A 5EMKA 4DVGA 1N57A 1UMCA 2HDOA 2ZAIA 5DIFA 3PNSA 5A2GA 3AR8A 1TQ6A 1ZHFA 4Q4AB 5ER6A 2MSEB 2RH4A 4G56A 3FMGA 1LTKA 1RHJA 3H9QA 3RGGA 4KJZA 2FOLA 1UANA 2QL6A 4MWZA 4E5MA 2Q4BA 4QATA 3AUJB 2QX4A 3CFYA 3B38A 1N6RA 3UF0A 4EDFA 1DBVO 2PD6A 3FPGA 4I99A 1NLMA 2YRFA 4RDXA 2YHUA 5ILQA 4Q7JB 3BYZA 2PRKA 1J6UA 3IHKA 2P4EA 5A5VA 2E21A 1N2CA 3O1LA 2BSXA 4LRWA 1ZD9A 1RBZA 3ABIA 1WCV1 4DCPA 1UPXA 4E2XA 5IF3A 1V39A 5ICMA 1ZK2A 1I5OA 1OV4A 4MMYB 4U2BA 4REMA 3M4XA 3SCZA 4AWXA 4DILA 1CQIB 1H65A 5KQRA 3TTWA 5BQOA 4CCSA 3U13A 1W49A 1TVCA 3W77A 3ZY2A 1QQ7A 2WFAA 3H4IA 3D6FA 5DIZA 3A7EA 1FVXA 5DT9A 3TINA 3UGQA 3TK1A 3QKIA 2D7JA 4KN8A 4PYQA 3IVMA 4EKDA 2JLXA 1XTTA 2AJLI 2QI9C 4XPIB 2ID9A 2D2IA 2JJYA 3ZW9A 1HA3A 2WFZA 3STXA 1N8SA 4FC7A 4I4NA 1T9DA 4PZYA 1FQWA 1HK7A 1LW7A 4OLJA 2BEVB 3URMA 1QZUA 1MIOB 2PVCA 1A9TA 3I61A 3JTEA 4AYTA 5KYWA 1QR6A 2QKYA 3CBQA 1KYQA 1N5MA 3JQBC 1N5IA 3Q3HA 4LBVA 2VTKA 4ND1A 3OE7D 3X1XA 4BPRA 1KGSA 2X76A 1QF9A 3K6RA 4OXNA 1EFUA 4ZOEA 4Z4HA 1FA9A 4UU1A 1HG1A 1NF3A 3FZNA 1CE8B 1MHPA 3A3KA 1MAAA 1H4VB 3THYA 4I7EA 3EYWA 4TUYB 1PKEA 4I1RA 1SBTA 4CG2A 5ESDA 3EF3A 1UBLS 5GV7A 2GEDA 4PLHA 4ZDJA 1NAIA 1UQTA 2BF7A 2RC6A 4HAXA 1MENA 4S1NA 4LCEA 5EUMA 3H7IA 3TS1A 1M72A 3RADC 4FYXA 2OO3A 5GAJA 1HL7A 4PAWA 4HS4A 4E70A 3J7AC 2VSXA 2RB5A 3GT0A 1QHHA 1Y3FE 3ORYA 4PX5A 4JUBA 1ZYUA 3QVWA 3NNDA 3PR1A 4URWR 3LFHA 2GD1O 3CO0S 3PX7A 2RHBA 5ADVA 5ALRA 2Y1FA 2FMXA 5DMHA 2CHGA 2DKOA 4GL4A 3PJDA 3QPUA 3WFJA 5JTTA 3QJYA 1JEJA 1X38A 4EO7A 2B8EA 1DRKA 2QRVB 3BORA 3LWDA 2GPWA 1X1DA 3NXSA 4AJ9A 1T9GR 2A1UA 3OQIB 2BE9A 2Q46A 1RU3A 3O8OB 3LT2A 2ZXEA 3O9VA 1EX7A 4NSNA 4ARZB 4URXR 4GMXA 3LC7O 2OO5A 2XRFA 2JJMA 3H42B 4D9FA 2ZBUA 2OCAA 1D6SA 1RP7A 3AFOA 5TS2A 5K8LA 3EZFA 3VX3A 2YHAA 2Z6UA 1AXGA 4G0QA 5TQ2A 3S81A 1PS9A 2B8TA 2BM8A 5LIRA 3KL4A 1IXRC 3FFBA 4H0NA 4UARA 1YI1A 1M1YB 3ZWAA 4FSHA 2FU5C 4CLOA 3NTLA 5LN1A 1SM4A 2CLIB 4HDKB 2C03A 4OYHA 4TT3D 4UQOA 4P0TA 1XBTA 1Y81A 3MWJA 1MQ8B 4WBNA 1AZLA 1GL7A 4RABA 1DE0A 3X1DA 3HN7A 2EKQA 3VA7A 5KOHA 2CNBA 2QBYA 3RM3A 3AVTA 1HKUA 4ZT4A 2PMWB 2QTVA 3F7TA 2E4ZA 3W1EA 1TEHA 3BE8A 2D1YA 2XUIA 3L5KA 3LKZA 4XCQA 2WJ6A 1ID8A 4R71A 5KZMB 4AICA 1SMKA 5CH8A 4KI0A 5B1YA 4P3OA 2FUG6 1PTJC 2OTCA 2JFZA 4JYBA 3IIMA 4TMXA 4BNIA 2G6BA 4OQNA 3PI7A 2XTZA 1BS9A 3FUXA 3FPKA 1K1EA 1T0PA 4MQBA 4U3JB 5JMTA 3T7CA 5IVKA 4H4EA 4IJVA 3LOPA 5L40A 3EY4A 1N25A 2DHEA 3KG2A 1A95A 4B3HA 1JEAA 3HK2A 2NO6A 2XYVA 5M3BA 1IULA 2JJ1D 1O96B 5LBTA 3PQFA 2QF7A 4NOJA 2WTMA 2F1RA 1AKRA 2IEZA 2VG8A 4MYDA 4PSDA 4UM7A 2EJUA 2IA5A 5KWJA 2P2CA 1AJEA 3NBUA 1PT9A 3OD5A 3K5WA 5IABA 3JWPA 1JJIA 1VSQA 2OKCA 2PSSA 4LOLA 4DT1A 4URFA 1M2FA 2ZTSA 1E1QA 3K15A 3NDRA 3OQ6A 4HWRA 2ORWA 2PX4A 4Q7MB 2DPMA 1GKYA 1MV8A 4IP0A 3KKNA 4L8FA 1LUAA 4K3UA 3PNYA 1QHSA 1Y3HA 1XMXA 5SYNA 4K1LA 1R66A 3GVPA 5G0WA 1Z8HA 1UPFA 3TRFA 1FQKA 3BZWA 4R2HA 3W5CA 4EYOA 1ZL0A 2A94A 4G89A 4FFBB 5E6UA 3Q2KA 3T3DA 1YGPA 2OCYC 4BL5A 4CG3A 2JGKA 3HB0A 4MDYA 4S0ZA 2ZJ4A 3KTDA 1NXSA 1E32A 2J9ZB 3C3YA 8LDHA 1YL6A 3ETDA 4IHKA 5G53C 2OV8A 1SFRA 4OGWA 1SVSA 3MSCA 2D1SA 5AVJA 4FW9A 4PTZA 4YJ3A 3TECE 3C7DB 1K75A 1L7NA 2XUOA 3RBXA 1KI9A 3NKVA 2ZJFA 1QRDA 3C3EA 2D0DA 3H6HA 3KB2A 4NP6A 4IIJB 5ITVA 4KXUA 3GFTA 2BIFA 1CXZA 3E8MA 4RV9A 4ER6A 2D1FA 1S1CA 3CR7A 4GYKA 5I8ZA 3GLTA 3SKVA 3UHFA 1BMTA 4B74A 4IIHA 2C2XA 2I80A 5D1HA 2VF4X 3OO0A 2ODQA 4HZIA 4ZVRA 2IEYA 2CY0A 1N92A 1MUUA 2Q5IA 5FJIA 1TYEB 2OCPA 3R9XA 1Z0DA 2HK6A 1WBBA 3I76A 1Y7IA 3MRVA 2GN4A 3NWOA 5JCZA 1MJNA 4BC0A 2W83A 5TDHA 3D4NA 4BKPA 1Q2UA 1K8RA 1RKVA 4EKEA 1L7OA 1RAHA 3DE6X 3HV0A 3MT0A 4FEYA 3AEQB 3AI1A 3WJ2A 4OQMA 1JIJA 1UPTA 3P9CA 4NYMQ 1Q0UA 4BVBA 3PFWO 2QN6A 3BOSA 3DONA 2P77A 3I9V6 2ZIZA 1FEZA 2PCJA 4CM7A 4JB8A 5K3FA 1MW9X 3ZD7A 3JQ8B 4RJLA 1VC2A 3ASZA 5TIIA 2AGVA 5HIJA 2P6RA 1T1EA 2HO5A 1NXPA 5JS8A 4M87A 1W1UA 1XL1A 4QUJA 1TF2A 1ZAYA 4NWIA 1J09A 1JSRA 4L4ZA 2XY4A 3GZ4A 4K9LA 4UVDA 4FGUA 3Q41A 3MD0A 3BCUA 1DMSA 1U0TA 3U3MA 1QFMA 2P9QA 3GEMA 4QRHA 3CLTC 2HLDD 2C5GA 1DAOA 2RGYA 3D7RA 4DCCA 1M67A 3DE3X 4L8WB 5B30A 2DWPA 5D85A 4C01A 3GG2A 4YMIA 4PGGA 1JVBA 3EK2A 3U7QB 1T5SA 3CB4A 2CV0A 4DEXA 1BE8A 2QYTA 4EY5A 1GQYA 1Y1PA 1XDBA 4A0HA 4IIDA 1X9GA 3P2JA 2FPMA 4NATA 2NUAA 5E6SB 2D5LA 3TCNA 4DY6A 2FZLA 4PR3A 1K5HA 4RNDB 4WHMA 5HSGA 1T9AA 4AKSA 1PLLA 5A9RA 2ZRPA 2E4XA 1UPUA 1AK2A 1P2GA 3IAFA 3FPSA 3JQAB 3M6WA 3OJFA 4BPBA 2KB0A 1SBZA 2QR3A 4DIEA 4FYPA 3EZLA 3HE3A 2ZSKA 2AN5A 1YK1A 4DCMA 6CHYA 1N2JA 4O4IB 2AE1A 1Y1SA 3FMOB 5JEEA 1IBKB 4MKRA 2JZNA 3FNQA 4V3CA 4B35A 1X1CA 2RI0A 5BWOA 2X1HA 5JNVA 1MO2A 4HWPA 1JHZA 2YVUA 1ST3A 3AW9A 2IPAB 1PWEA 2ZKIA 3UJ8A 2CSUA 4B81A 4DG5A 4G0XA 2QT9A 1P1BA 2YXLA 4H7DA 1LTHR 4GT1A 4O4JF 5L95A 5J23A 1R8QA 3CT6A 3HB7A 5K8UA 5E4JA 1TAGA 4HYQA 1XJWA 5AQ1A 3E4DA 3NHZA 2E4UA 5JMPA 3WHIA 1OFHA 1O3YA 4QICA 4CEHB 1XZGA 4GGOA 3C4VA 1NI4A 2CNWD 2QJFA 3U5TA 1REQA 1XEFA 3KUCA 1FDSA 3SM9A 3T54A 5IJ9A 2A30A 1ECFA 2QRMA 4ZARA 4Q1DA 3G23A 2H2WA 1VM6A 3HDYA 1Y9DA 2V4MA 1RVV1 2XXJA 1SUBA 3KSZO 4RY8A 1U2SA 1FXSA 4XEUA 4Z4CA 5AVWA 4WA7A 2G40A 2P3QA 3FLBA 5CA0B 2BH9A 2PGOA 3FTFA 1Q0PA 1G20E 1QPGA 3TLEA 3UC9A 3H8JA 3DZDA 4CMCA 1I5EA 3K1AA 4E6EA 3GLKA 1ODLA 1I36A 3HEAA 3G5TA 1L5MA 5HYVA 1LCIA 1OROA 4JLKA 4YQEA 1OIWA 4JC5A 1EAMA 5CX4A 1NYLA 5EQDA 4G4SP 4D0NA 4UDOA 5LUAA 2I1VB 5KYNA 4YB8A 1KI8A 2IJGX 3LZ6A 1TLTA 1IZZA 4WUTA 4IZOA 2HF7A 1O95A 1VB3A 3BWDD 1U3CA 3OIYA 3OY7A 3GEIA 2ETXA 4MW2A 1JBEA 2C4KA 4NOKA 2BBWA 2X1LA 1J06A 5GM1A 3RAGA 1UMBB 3NHFA 4A8HA 3RNLA 1AKNA 4NEHB 4DA8A 2G8LA 3O2QB 5G0SA 1UBTS 2BJWA 2NNWB 5EJ8A 1PKXA 2GDJA 2JJQA 3AH8A 3B3QA 3IJRA 5DSXA 4ZU1X 1P7VA 1JKIA 2HBZA 3O74A 2X0RA 5DW0A 1EMDA 2EL9A 121PA 5ECDA 5EWLB 1Z0ZA 4QKQA 4OPMA 4Q1BA 3OQMA 5FADA 2AC2A 3IUBA 5B2FA 3PTZA 3AIMA 2H08A 2GK4A 1BA3A 2W2TA 3KYBA 5FUWA 5BSMA 3RJMA 4DAOA 4KQ9A 1EZZA 1VBFA 1HDYA 2WG0A 3I8OA 3RYIA 4D0LB 2DE0X 5IF9A 1TIKA 1VP3A 2CVPA 1T5BA 4CM3A 5CD9A 1VHQA 2GCNA 2XQIA 3D2CA 4X85A 2NZJA 3KR2A 4MR8A 5BRNA 3WWEA 3ZNQA 5TPZD 5KNBD 2N0SA 3L1HA 3U48A 5ES3A 3FPEA 3ZXYA 2HRRA 1OV6A 2VEDA 2JLCA 4R01A 4R0MA 3EN0A 4FU0A 2Y3IA 5DX0A 1O97D 1ZLXA 2ZRKA 4LGYA 3JAMA 4GUDA 1T10A 2O7QA 2Q7DA 2A33A 3OM0A 3EZ6A 4U5XA 3V2GA 2LXNA 4HUQA 4DA0A 1LDMA 3T3GA 4D7AA 4IDAA 4E5NA 1B3RA 1RM3A 5KWSA 5AM2A 4UUQA 3SQMA 5MFPA 4QTTB 4IQ0A 1WOYA 1ZC3A 3EIWA 4LE0A 4MRMA 1NSTA 1GR1A 2B61A 2ZANA 4FHEA 3I6QA 1Z35A 3M6MD 3JTMA 4OMCA 1IN5A 3GYBA 4F3CA 1KVRA 3BE5A 3FVRA 4FDTA 2XMPA 2ZJ2A 4HAUA 3C6QA 4TUYF 4YJHA 2XNDA 4MWDA 3RJTA 4V0NA 2RHCA 4TWZA 2REQB 2PVPA 3QBDA 1ILWA 4E5YA 3K5PA 1JDZA 2YWHA 4LHWA 3PDJA 5TXGA 4CUZA 3HO8A 1RI3A 2GYVA 1K89A 4P86A 1U8EA 1NXQA 1G2PA 2OQ2A 2I4TA 4WACA 4JFRA 4WNAB 5ER9A 2J48A 1HYHA 1I30A 2ZI5A 3MQ4A 3OOJA 3SNKA 1R16A 2D8AA 1FRFS 5EXEA 3U7IA 3Q9SA 4IRMA 3VSAA 2ZULA 3BTOA 2P1DA 1C3OB 3JV7A 3DCNA 4J4BA 5DM2A 1VG9B 1W9HA 4ARBA 4JXZA 2XUPA 3IESA 2JD0A 2PQ2A 4IGEA 4WV3A 1ZBQA 5EUQB 1GL6A 5KSWB 1MQSA 4KTVE 4R8VA 3BRWD 4XIIA 3NNSA 2O5VA 3NI2A 5BR1A 1HDCA 1O9GA 1TB4A 3P7MA 4WAUA 4YRDA 1EBBA 1W6UA 3A2NA 5EQTA 1I4DD 2V8OA 3VDQA 4D6YA 1KEKA 1D0VA 1EWYA 1L4YA 1MB2A 2IXBA 1LPOA 4I1YA 4NBKA 3K9FC 5AFSA 4TQ9A 2PBZA 4H6WA 4Z7NB 3URKA 4FEGA 3H5NA 5HE8A 4ARUA 2JKVA 4Q9NA 5CFPA 3WMXA 1WABA 2VJDA 1H9BA 3LVFO 3TIFA 1YJ8A 4R8LA 4BQIA 1WW2A 1H42A 2DQSA 2G6TA 5AHRA 1X7XB 2BKLA 2WJWA 3IODA 4XASA 3RABA 2G1KA 3EIFA 5CT6A 5UKDA 4AKTA 4PFQA 3TAHA 3TYXA 2O3RA 5EUCA 4YMSA 1CZHA 3CLHA 5LD2B 3C87A 4OKIA 1XTVA 3L7BA 1GLGA 3M5PA 2QDKA 4W7IA 5KYGA 2HW8A 4R05A 5L7TA 4IEFB 2VKTA 1XZEA 1ACLA 1QC5A 2CVQA 3JQQA 4KLRA 4QQKA 1OC4A 2RONA 1HYQA 5EN4A 1EP9A 2O3JA 1FX0B 2VUSA 4B7XA 4BP9A 1CUXA 1VTKA 2QT1A 3C24A 1WTAA 4PQYA 2RGEA 5EG5A 5CFQA 3M4JA 1N2ZA 5IZCC 3H11B 4RACA 4TV9B 4YH1A 5F5XA 3HYSA 3HDTA 2TYSB 1PR6A 2PV7A 4HRVA 3BQ9A 1DT3A 1RJ9B 2FSVC 4JQOA 4Q3DA 4ZAZA 3SDZA 2P4QA 2V6JA 4GOLD 3SZUA 3TQSA 5B5SA 4RPLA 3GA5A 1QCCA 2IPLA 2YHIA 3AYZB 3R8FA 3CHYA 4J4TA 2YFHA 4EA9A 3SGLA 1Q0SA 7ABPA 4ETWA 2ZIXA 1YQUA 1UKAA 3WWDA 1PSZA 2NXEA 1KE2A 1F12A 4C0QC 3P8ZA 3PEEA 3ROPA 1LDGA 3WGYA 5LP6A 4BY9E 2Y0BA 3DFIA 3EIOA 2HK7A 2ZYHA 4QLOA 3CPEA 5JDCC 1EWQA 5C1DA 1UK8A 1JB9A 2WT8A 4QTUB 5EYPA 5IZCA 4Y6SA 5IM4F 5ALNA 4D25A 1MPXA 3LDUA 3L84A 4YCBA 4P34A 4M22A 1CUVA 2C8KA 3EHDA 4WN3A 5HJ2A 4ZZ2A 3P52A 2X8JB 2EG9A 1Z28A 1ZXBA 3NPAA 4BBAA 2QAJA 4EVSA 3MS4A 1RMQA 3QH4A 5ALZA 3E4CA 5FI1B 4ZVKA 5A3JA 2ZRNA 3UNXA 2A9VA 1TU3A 3WLJA 1AF7A 5JADA 1DBWA 2EQ5A 1EIZA 1PJ8A 1YE8A 3PD7A 4AWAA 1FYVA 1U02A 1XMPA 2FTKE 3C48A 2IGBA 4YAEA 3UANA 1ZVMA 2GTIA 2WDZA 4IIJF 1U2TA 1G3MA 1NBAA 1P2VA 2WSBA 1V35A 2XV1A 4TWBA 3ONDA 4FJ2A 4IIVA 4JLPA 3ESAA 1KJZA 3G2NA 1RRCA 1KL7A 1EHYA 3CEMA 4QQ8A 3C3JA 1U90A 3UKJA 2DUMA 3I1YA 3MWDB 1MQAA 4TLMB 3PX2A 5CDFE 1J22A 4HH4A 5AWFC 4NPHA 1TA9A 2Z98A 1PG5A 2ZIGA 2OAP1 1FE8A 1Z4QA 1L4NA 1M2WA 4BLSA 2A78A 1XKLA 1OWMA 3G7NA 3IKVA 3JQDA 4TOIA 4M0DA 4W6QA 3QY9A 3TTVA 4G5SA 3H8WA 3RBAA 3EMBA 2G63A 3WKCA 3ZNPA 2CKDA 1CR6A 3LECA 3ONVA 2LBPA 1RZRD 1NIPA 2AKYA 4IHJB 1PR4A 1Y9ZA 2VWQA 4PVDA 4YP0A 1KDOA 5DHAA 1IHOA 5LFAA 3OZIA 2B2XA 4M76B 4UE2A 5DPMA 3AK4A 2ZWVA 3UPDA 5C2JB 2YJTD 3G6KA 2RGWA 1NJ5A 2TRSB 1Z5WA 1TXGA 4E7PA 1JZQA 1MJGM 1P5RA 5KNCA 3DL0A 3MXTA 3P9NA 1C7JA 1XEAA 2BFPA 4IWXA 5B58T 4F0JA 4W5QA 2YZ2A 2XXAB 4C6SA 2KE5A 1CD5A 1C9MA 1ZSVA 3IUSA 4M1SA 5K20A 2WG2A 1LPMA 3UGKA 3ZGXA 3PSHA 5K6AA 2C7BA 4IQGA 1BDHA 1F0YA 3GW8A 1PK7A 3E15A 4TVBA 5DHPA 5H83A 1KQGA 3V7WA 1N3BA 3JZAA 4OI0A 2B1JA 1K4YA 2A35A 3KPYA 4Y1FA 1Y42X 2ZR0A 1N4AA 1FCJA 2FEKA 4M49A 4PGMA 3F2IA 4UFPA 5CPBA 2FXIA 2ERCA 3WYFA 4WPGA 4GPEA 1L4BA 1UK9A 3FCUB 1Z0JA 3GFOA 2R6DA 2XAUA 3JVEA 3W2EA 1OLXB 4EZBA 5KX5B 1GA1A 4NG4A 3GR6A 4PNPA 3P2MA 4WFJA 3SJZA 1PS0A 2J5QA 5B7PA 4UNIA 2VIIA 4UQPA 1E9EA 4CFZA 1LSJA 1F3OA 1V11A 5A02A 1ZH2A 3BWCA 2G1JA 3MTEA 1AKUA 2QQGA 4U0JA 4QPCA 4LDQA 3TJMA 3GPLA 2BZ1A 4HNAA 4MWOA 2D7CA 3NT4A 4IFBA 4MLCA 5AESA 1FFCA 1XRRA 3WYCA 2I6GA 4HC4A 3ANNA 1L6RA 1A7AA 3ZBPA 2QVYX 4HADA 4UVEA 1EXWA 4I14A 4K8RB 5FBWB 1BGWA 4J75A 3CX3A 3HLYA 1VP9A 1OR8A 1QKIA 2GASA 2YTZA 2V9CA 3E3LA 3HKDA 3LCRA 1E7RA 4MS1A 3R6WA 2BMWA 3LLUA 1E4VA 4H16A 1I2BA 1PGJA 3ND5A 3OCYA 4FKZA 3N0VA 5B37A 3R7BA 5IJZA 4KQEA 4Q6WA 1WQ1R 3I12A 3GNQA 3BD6A 3KSMA 4NI5A 4QOIA 4J7AA 4P4SB 1USKA 4YAWA 4LE2A 4CKYA 1QIKA 4CKCA 3V9PA 1SU8A 1KO7A 1EXDA 1DKRA 4WW0A 1QKJA 1EDZA 4EI7A 1HLGA 2Q5OA 3A11A 3PC6A 2O8CB 4Q1FA 3VU1A 4TLLB 3CV3A 4U6SA 3BCRA 2MSNA 2PGAA 3JD3A 4HLCA 4QBGB 2E55A 4AT1A 3EXHB 1GG9A 2ONZA 3O5AA 3ZDZB 1CBUA 3THXA 2VDKB 3FHOA 5A4IS 5HA5A 1SRQA 3KQPA 3IOBA 3UIEA 1DSSG 4RENA 3WWOA 2X1MA 1E60A 5J43A 1OYOA 1G8SA 1MZVA 3PF9A 1IAVA 4M37A 4Y6OA 2C2KA 3MAGA 4OHCA 3V8EA 4EKIA 1MFZA 3CMMA 1N77A 2P9YA 2PIDA 4X6UA 2FVYA 3CF2A 2X14A 4WFKA 2DM6A 3L41A 1P81A 2IF2A 2HO4A 3GZTB 2BFCA 1DADA 1NVGA 3BZBA 4HFNA 4QOFA 5LMUB 5BW4A 4KR2A 3H86A 4FDAA 4MHSA 5TPWB 4DLRA 1EFVA 1PZXA 1M1NA 4RA6B 5FL7D 4CETA 3AQ4A 2RHMA 4JOQA 3DCJA 1PIWA 1IE3A 3NOQA 1D4ZA 1IEVA 4HX9A 2P5SA 3SAJA 3OD1A 5GZ1A 3ZI0A 1NKTA 3VPDA 3OP1A 2BFBA 2C78A 3I1JA 3LUAA 5TQ0A 3IEUA 4I2NA 1EDDA 4EB0A 3KUXA 1PZFA 1WE2A 3VSEA 4B47A 4HWGA 2QJWA 2QYSA 4INOA 1IN7A 1GXSB 4DLLA 5KDOA 4ML3A 3O8CA 3OJ0A 2HWKA 3R7NA 1FFSA 4NZ9A 3DFMA 1VSBA 3GGDA 3MMNA