5B7NA

Crystal structure of periplasmic 5-methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
SAPILIQGAMDVEVETLVAALKDKQELTVGSWTYWQGTLSGYPVVVSRTEVGLANAAAATTLAMERFQPRLVINQGTAGGHDPALHRGDIVIGTKSFNMGAYRSDLTPAEQGVDPSKWHNFEVTMRLRDNGKLVEHSSFAGDPELVGRALGMADRYRHGRVVPGIIGTADEWNRQVARINWLHQTYQTAAEEMETSSAALVAEAYKVPFVGIRVLSNTDLHGEEFDPQTAIHCQQFVIDYAKALINGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
publication title Structural and Functional Analyses of Periplasmic 5'-Methylthioadenosine/S-Adenosylhomocysteine Nucleosidase from Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
total genus 87
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b7nA00
4JWTA 2AI2A 1Z5PA 1OU4A 5B7QA 2QTTA 5CCDA 5I3CA 4TTIA 2HSWA 4QASA 1LVUA 1V2HE 4R2XA 4RJ2A 3DPSA 4NY1A 4L5CA 1RXCA 5B7PA 4OF4A 4D9HA 4DARA 5B7GA 2ISCA 4QAQA 4D8XA 4WKNA 4R31A 5KB3A 3OCCA 3ENZA 4QARA 1C3XA 5EUBA 4FFSA 1Z34A 1N3IA 4YJKA 3P0EA 2B94A 1K27A 5CXSA 4MCHA 1JDZA 4F1WA 4OGLA 2QPLA 1ZL2A 4DA6A 2QTGA 4F3KA 5F7ZA 2HN9A 4H1TA 3E9RA 1VHJA 5EPUA 1RXYA 1ECPA 1JDUA 4GKAA 1SQ6A 1ULBA 1PWYE 1G2OA 1PR1A 1ULAA 1TCUA 3SCZA 1LV8A 4L5AA 5F76A 1FXUA 1RFGE 1K3FA 3IEXA 3NM4A 1CG6A 1OTYA 1JP7A 1SD1A 5B7NA 1RR6A 4M7WA 4OJTA 1Y6QA 3FWPA 4OEHA 3ODGA 1OUMA 3DF9A 1Z35A 5CYGA 3DP9A 3LA8A 1ODKA 3E9ZA 1PR6A 1JPVA 2P4SA 1QE5A 4L0MA 5CCEA 4U2KA 1V41E 3ONVA 1V45E 3UAZA 5F7OA 3OZDA 4DABA 1U1GA 3T94A 1T8RA 3DJFA 4TXJA 1OTXA 4L6IA 3OZCA 4TTJA 1JDVA 1T8WA 2AC7A 4G41A 4NSNA 1A9RA 3FUCA 2GUWA 1RXUA 1Z33A 1Y6RA 2OC9A 3LBAA 4G89A 4D8VA 3P0FA 3BJEA 4L5YA 4F2PA 1PW7A 4P54A 1A9QA 3DDOA 3K8OE 1OV6A 1Q1GA 3OF3A 1Z5OA 1Z39A 2AI3A 3FNQA 4GLJA 1PBNA 1NC3A 2I8AA 2A0YA 3KVYA 2A8YA 3C74A 1WTAA 1TD1A 4LZWA 2IQ5A 3OZBA 3LGSA 1JYSA 3O4VA 1ODIA 1T8YA 1CB0A 1VHWA 1RCTE 1NC1A 1JE1A 1TGYA 3NM6B 3OOHA 4BMXA 5F7XA 3NM5A 3UAXA 3KUKA 1Y1SA 4GLFA 4LDNA 4D8YA 4LKRA 1A9TA 1U1CA 4M1EA 2ON6A 1PR4A 2OXFA 4M3NA 1Y1TA 1PR5A 4WKBA 5CXQA 2PGAA 4LNHA 2OECA 1JE0A 4TS3A 3U40A 4EARA 4PR3A 5ETJA 1M73E 4F2WA 2HWUA 3UT6A 1U1FA 4TTAA 1RT9A 4WKOA 3INYA 1Z37A 5C80A 1PK9A 3K8QA 1YRYE 1JDSA 5F77A 4DA8A 4DA0A 3FOWA 1V48A 4R2WA 3E0QA 3KU4A 3FAZA 4QEZA 3TL6A 4KN5A 5K1ZA 3EUEA 4BMYA 3UAVA 4NS1A 1A9SA 1XE3A 1B8NA 5IU6A 3OPVA 4G8JA 3GGSA 3FB1A 3F8WA 3KHSA 4F3CA 1LX7A 1YQUA 1I80A 3O6VA 2HRDA 3PHCA 1YR3A 4TXMA 4UC0A 2RJ3A 4WKPA 3KVRA 3EUFA 3UAYA 4BMZA 1VFNA 4GMHA 2XRFA 1Z38A 1ZOSA 1NW4A 4TXNA 4DA7A 1A9OA 1TCVA 5F7JA 1Y1RA 3UAWA 5EFOA 1ODLA 1Y1QA 5FAKA 2H8GA 4PNPA 3PNSA 2I4TA 3BSFA 1RSZA 4YNBA 1ODJA 3EMVA 1RYZA 1YBFA 3QPBA 1JDTA 4BN0A 5IFKA 4TXLA 4JP5A 4LNAA 3BGSA 4DANA 1U1EA 4YO8A 3PHBE 4I2VA 4TS9A 2QSUA 5F73A 1PF7E 3PNPA 4TYMA 4WKCA 3MMSA 2A0WA 3MB8A 3BL6A 1YQQA 5F78A 4JOSA 1PR2A 4OY3A 3GB9A 1PKEA 4TXHA 4D98A 4EB8A 4E1VA 1PK7A 1TGVA 3IOMA 4QFBA 1SJ9A 4YMLA 5DK6A 1V3QE 1B8OA 1K9SA 1A9PA 2AI1A 3OOEA 2OC4A 1PR0A 2BSXA 1Z5NA 2A0XA 4IP0A 1T0UA 5JPCA 1U1DA 3EEIA 3D1VA 5CYFA 1Z36A 4DAOA 1OVGA 2Q7OE 1SD2A 4DAEA 1T8SA 3KVVA 2QDKA 4OGKA 3OZEA 1VMKA 1RXSA 4K6OA 1V4NA 4X24A 4ECEA 1A69A 4MARA 4QATA 3NBQA 4MCIA
chains in the Genus database with same CATH superfamily
2WUVA 1BDBA 5DASA 1U0EA 2C2HA 4INAA 3V7FA 3NJ4A 1ZUNA 4RK0A 1GSAA 1WRBA 4QTTB 5IJAA 2GFQA 3R7DA 1SZJG 4XIFA 1TQDA 2RKOA 3NT4A 4B3XA 5B7QA 2FTKE 1GZ5A 3JW8A 3MLEA 4LTMA 5DI3A 4AI6A 1F5SA 1VJGA 3CUWA 4WCFA 4BBAA 4A8JC 5BSUA 1AOXA 1MOPA 5EJ8A 1V2HE 2P62A 1QC5B 2QN6A 4R2XA 1UZMA 4I1SA 1J1ZA 4QDOA 2FWMX 2VJPA 2W9XA 1X38A 4HDOB 4NYIR 2ESRA 3A3KA 3QI2A 4P33A 4WOJA 5IBRA 1H4VB 4UOEA 3ODPA 5T7BA 1II0A 2XCOA 3RW9A 3DE0X 1OCEA 2LUOA 2F67A 2H2AA 3NW9A 1N77A 1XZQA 3AV0B 2GJSA 3DWEX 5TC4A 4FYMA 4WK2B 3CLRD 4TWZA 5ILOA 5K0TA 3JR3A 3WGQA 5KC8A 2GHIA 5AM4A 2VT2A 4YCCA 5LIRA 1ZUD1 5CHYA 4BAGA 3FCSB 1XMSA 1YA8A 1MRNA 1N6RA 2DPMA 1E99A 1TAQA 1VGQA 3E9MA 4R7ZA 5E1OA 4C03A 1Z08A 5L4SA 3K09A 5KWSA 3SJUA 1IEQA 1Y8AA 3GQBA 1O94C 2FZVA 3SSOA 1AJEA 3VX3A 5C1BA 3NV7A 4WK4B 1KSJA 1G5TA 1XTSA 2ZR7A 3JQ7B 4MR8A 3DMTA 3LC7O 2R6DA 3EG9B 2R86A 1BVHA 2QIPA 3TZQA 3IJRA 2G6TA 4GT1A 4X00A 5EJAA 2E3JA 3E4DA 4WLVA 1U0BB 1EA7A 2VA8A 1RWOA 3O47A 3DA8A 3C16C 2CN1A 5KWIA 2D8AA 4QHYA 4U7DA 1MZVA 3JVVA 3RT9A 4ZV4A 2DWQA 3GRPA 3LUKA 4M86A 4FB4A 3WSWA 4K6HA 3C3MA 3V4OA 1YOVB 3AI7A 4NZOA 3LGXA 1ZZEA 3LXUX 3TZKA 3Q3IA 4ENWA 2PEZA 4BKRA 2YFYA 4IGFA 5COBA 3G3EA 5CFOA 4HX5A 4F86A 2JA1A 4R1LA 4W1PA 3SD7A 3GG9A 2MYPA 2XHEA 1X87A 2Z9CA 1AA9A 4PTZA 2C5GA 4F1JA 1Z15A 2PZEA 2KI5A 2HHHB 3ULKA 3OJ0A 1ZNXA 1VPTA 2I5PO 4QUIA 3OWXA 1BJRE 2A84A 1DV1A 3RANA 3ZN2A 4PANA 1JDUA 4JDUA 1IM2A 5FEUA 1L1FA 5A3VA 1PL7A 2JFNA 4B5LA 4OLBA 1G8PA 2P7IA 1RWXA 5F5LA 2VYQA 1N7IA 4BUZA 1JECA 1ZUIA 3FGNA 3ORHA 3VOBA 4B40A 4FILA 1O6FA 2HSGA 1XL0A 4O5AA 2I1LA 3S2EA 4DNQA 4YUXA 2CLDX 3TWOA 3GMDA 2NU6B 4JXKA 2OE2A 4KFUA 4WWHA 1QQ6A 1T1SA 2J5QA 2ZTSA 4UBOA 3UAOA 3UJBA 1ZQ1A 1CZKA 4UU7A 1GRRA 4FMPA 2H7VA 1N6NA 5ARDA 4BZZA 1W0JA 3ZVNA 3ZHUA 3OHSX 4WQMA 1BHQ1 2YINC 1SQGA 4B7AA 1Y81A 1NI4A 3PQDA 2B4QA 1YR2A 1KF0A 1MU0A 2QTVB 3NM4A 1OTYA 3O83A 3FTFA 3VMMA 1ADJA 3AETA 3T7DA 1SXQA 1DAFA 1SBIA 3HP1A 1P5JA 3HU1A 3QNWA 1PQPA 4MEBA 4PQEA 4Y9SA 3F78A 3OT1A 2VQSA 3KS9A 4HWOA 4BGVA 4YR9A 3SF8A 5LPNA 3V2IA 2ZBUA 4EY3A 3UBTA 3QSYA 1V96A 3SYRA 1W0JD 1AKQA 2HLPA 1PLLA 4M0UA 4GSKA 5B7NA 4Y6GB 2GTHA 3OJEA 2NUAB 2P2YA 4YMVA 4PYJA 2WE7A 1Y6QA 3X3HA 1NNEA 1AZTA 4ZDKA 4CGYA 3NR2A 3ZGYA 5BWOA 3C3EA 2NXNA 4JLPA 4NFHA 1ZVVA 1MO5A 4D0NA 3ESBA 1T4GA 1I3NA 4LJ6A 5AW0A 1L7PA 2A58A 1KVTA 3RC8A 3QFRA 5ILGA 3FETA 5E1DA 1RWPA 1DC7A 2BGIA 1J7KA 1PK8A 2ZDHA 2JIRA 4MEAA 2CLFB 3BH6A 4CM4B 3LFHA 4X60A 2SECE 4RY0A 2BHLA 4KRFA 1BDHA 4PAGA 9ABPA 1PZGA 1HORA 4NTZA 4WCFC 4YY3B 4Q82A 3CLRC 1DTEA 4Y7DA 1QCYA 4G86A 2FRVA 3W4IA 3R6TA 1TVKA 3G2JA 5ALEA 3BJMA 2VPWA 1WXWA 4C0XA 1R6VA 1MV8A 2NZ2A 2VYVA 4PGFA 4OAOA 1ZCZA 1L4YA 4PAMA 3U4CA 4YR7A 4DY4A 1W94A 1ZH2A 5JRJA 4INOA 2QAJA 2AWNA 2ZWPA 3PT9A 2HHLA 2QPTA 5AOAA 3ZY6A 1HY3A 4AY2A 2ZJFA 4KODA 1ENPA 3K09C 2BP7A 2VYVD 3QNMA 5C5IA 2GWRA 2G9UA 3AONB 4QSHA 4TRMA 1YB6A 1CY0A 3NHFA 4JKOA 1WMAA 2VPZA 4LA4A 5FUBA 3SSMA 4F5DA 1KMMA 4QGHA 4YRSA 3HWRA 3L93A 8OHMA 3DMTC 5T4HA 4CEIA 1YVDA 4L6CA 4AWXA 2BTEA 4N5LA 3HB5X 1BS9A 1MO6A 4AW9A 3ZJ4A 4WJLA 5IVDA 3IEKA 3O82A 3MJTA 4J49A 1LD3A 1AV6A 1CYEA 4TSKA 1HL3A 4ODIA 2V65A 3VNBA 1N2HA 4EL5A 2LCFA 4ESVA 2NP6A 1PBNA 3WWDA 4N3NA 3X1XA 4JA0A 3RYIB 3V2HA 3D81A 1QYCA 3ZD7A 2RG1A 3E58A 1HNZB 1CQZA 1G9XA 2DJ5A 3MTBA 4JI3B 3MMXA 3OTIA 4IDEA 4BLVA 1O87A 5HS4A 1KI6B 5L7TA 5IC6A 4UAJA 3A6FA 1N2EA 4KLZA 5EMKA 3WRVA 3HACA 5CFMA 1RC8A 3GYBA 1K98A 3SHVA 3C3KA 4ZP1A 4C7BA 4EG0A 1ZI9A 5EKTA 1PZHA 3NWOA 3IAXA 3KVNA 4HTAA 2DT8A 4M1QA 1BRTA 4BXOA 3OD1A 1KH2A 2IU4A 4LPKA 4IVNA 1JYSA 3UXHA 4RPHA 2X0DA 1K7CA 1I8TA 2P1DA 3G0DA 4BQOA 2A9RA 3VR5A 5FBLB 3T7TA 1MENA 3HCFA 4PLYA 1JG6A 1U2SA 3WAGA 3G6KA 4FZ3A 1A1SA 1A71A 2XB9A 4X41A 4ER7A 4JI1B 4MR9B 2J6IA 5JVDB 5LA6B 1JE1A 4BJ6A 1KRXA 1VQ1A 4X90A 1DWUA 1Y48E 3FY4A 1FYVA 2ATXA 4RPCA 3RC9A 3WLQA 3ZD8A 4IIJB 2I29A 1D1SA 3ABRB 4N6OA 1GZ4A 1B15A 5AFSA 1SVKA 3VR5D 1SURA 2HY7A 3K0FA 3AQIA 4CR6A 3B3QA 4RESA 2HL6A 1MHTA 3T3OA 1J8QA 2YHIB 1D6MA 4YHHB 2C03A 4AMYA 4CM3A 4H16A 1O6BA 2OEPA 5DRTA 3GCXA 4JIMA 1OC2A 3W6UA 4BZPA 5LD2C 2XXAA 4DPMA 2QN2A 1IL0A 1ZK2A 4KO1S 4IEIA 1T26A 3CT6A 4ND8A 1YQEA 4M3NA 3HEMA 4RZXA 4XFDA 1KZYC 4KZKA 3EBPA 4KXMA 4DBLC 3MLAA 4AN4A 1FFXA 1TT5B 2AK2A 4NS4A 3W2HA 4CKYA 5ECYA 4BX9A 3C8HA 5BVHA 1IXSB 4QUBA 5JSZA 3R24A 1MB3A 2W8BA 1YK1A 5I8ZA 1VHTA 2IF2A 2RHWA 4F2WA 2IYTA 1BCRB 3AFGA 3AR2A 4IJVA 5E9AA 3GGDA 3D8TA 4QZVA 3GDGA 4M9UA 1ONSA 3OLQA 4B6GA 1J9EA 2J5BA 1N5LA 5JADA 5B6JA 5IS2A 4MICA 1E7WA 1KI8A 3HJAA 4DCVA 5F77A 5FUWA 4CLRA 5CT4A 1C0LA 3PPVA 4U6NA 2WVHA 5C5DA 3V46A 2WWHA 3WV4A 2XE8A 2G08A 3WTCA 2PLRA 4KIGA 3G5UA 3CG0A 1BSVA 1VDZA 3COPA 4HWKA 3ROKA 1P0CA 4UATA 4A7PA 5I7FA 3IV7A 3HCDA 3PCXA 2WICA 1ZD3A 1AKEA 1YQXA 3GIDA 3JQFA 3QPCA 3DTNA 3EAGA 4FHFA 3F90A 4RHXA 2VOJA 3L3BA 4NBSA 4Q3BA 3AQ4A 3H6GA 3V1NA 5FBRB 1KTIA 1QR6A 4D9KA 4P08A 2X5KO 4KR9A 2HGZA 1ML3A 3MBKA 1PP4A 3B9RA 3N39C 1KSGA 5DYGA 4UUPA 5BQXA 2CFIA 2QX7A 2JRLA 3K32A 3SY8A 3N59A 4U2BA 3T9EA 4EDHA 4V0SA 1ZAYA 3CH4B 4GI2A 2L0XA 2FZ4A 4DR4B 2VL7A 3H5TA 4ZCSA 3BT7A 4GSYA 4UMFA 1NFFA 3L6UA 3R3YA 2MYNA 2Q6LA 4LFAB 2WSYB 3REGA 4AJHA 4YCLA 5TE9A 1DQYA 4MUHA 3G9ZA 1NV8A 3GDWA 2VHTA 1QDLB 4I50A 2G1PA 1RYHA 2IEBA 1E1DA 1P77A 2XXJA 3WWEA 2Z1NA 3OKFA 4QSMA 1ESNA 1WCV1 4PBTA 3SYTA 4KO2S 1YS4A 1NTRA 4C0JA 2QAGA 1HH4A 2UUPA 3OF3A 3GROA 2NTVA 1MN6A 2W98A 4BMPB 3RABA 4EP1A 1KDOA 4FN5A 5KSYA 5E7MA 2CDBA 4KGVA 3UAWA 5KSZA 5TS2A 3HBJA 4MEJA 1F12A 2I1QA 4Y6RA 1TKBA 5FTNA 5TQ0A 1YJBA 3MXTA 5HQJA 3ISTA 3O5AA 3T1OA 2IHYA 4J9UE 3H2YA 2FSUA 5KWEA 3GY0A 4I50F 3UH0A 3WBFA 2XMDA 1ZBDA 3H2IA 3LDAA 1D5WA 1N1DA 3O74A 4M6WA 2YWFA 3A06A 3B1YA 3Q1KA 2NUPA 1KZGB 1TF5A 5H83A 4JJKA 3T4UA 1AT1A 2CVQA 2AMVA 2QUHA 2NVWA 3KWLA 4HWRA 3E0XA 1GZDA 2JIDA 3A4LA 1NASA 5BUCA 4NENB 1XPOA 4EY4A 1GPWB 2BYTA 4UU1A 3CUVA 1CR2A 4KU4A 4JYAB 2Z4RA 5C8ZA 1WZEA 5JXWA 1A1VA 3H05A 4BO1A 2IPXA 1JVNA 3I9MA 2QGNA 3A28A 5GVRA 4NDZA 2J3LA 3F5FA 4DANA 4WOBA 4A6EA 1BCSB 3QX9A 2P5YA 2QSUA 3L8FA 1XQ6A 3FNGA 3U4QB 1E9AA 5KYXB 5DNEA 1FTYA 3AXTA 4D9NA 4EHAA 2QD5A 3IOCA 5E4YA 5T3YA 4RVDA 4X7PA 5ILQA 4HB4A 2Q2QA 2FN4A 3GFGA 3OX2A 2D6FA 1EX1A 1W5AA 2Y4OA 5GV8A 3BPSA 5AW9A 3BRSA 4P83A 2R62A 4WL0A 3Q0EA 1EK6A 3FPKA 3HMQA 4UM8B 3WXBA 3CG4A 4TKVB 3AB7A 4DLSA 1JLLA 1KVRA 1X7GA 2NO9A 4NCHA 1SPBS 1X42A 1NVWQ 5EOVA 4UQLA 4U9IS 3BD7A 4D98A 4RVCA 2C78A 5JAQA 2ZJAA 1WPXA 2JLQA 2XODA 1QS0A 3PA8A 1IY0A 2C29D 1DCMA 4ER6A 2JEOA 4CT5A 4BO6A 5CB4A 2QRHA 1UKZA 1GO2A 5JQGA 4O6VA 3IXMA 3SQMA 2UZ4A 1OFUX 3EB9A 4QYIB 1TIKA 1MC8A 3MCZA 4H15A 4ZOLA 3CC8A 3SC3A 2XUFA 4Y30A 4YJ2A 3I72A 3M5PA 3Q5EA 7REQB 2O1WA 3IIEA 4D8VA 2ZJ0A 4YXFA 2UVPA 4LE2A 1M2OA 1O96A 1GTJ1 2JNWA 4UNSA 3OT4A 5ADWA 3JU3A 4NAHA 1K89A 4JBYA 4EQZA 2B9EA 3QUCA 3KB1A 4C0BA 1E92A 1EM8A 5L3QB 2JLVA 1ZONA 4A27A 5CB4F 3GMSA 5JQGF 2A9QA 4TSFA 1MDFA 5JY6A 3RYFB 3ZNQA 3T1HB 2P9YA 1QIDA 3KDAA 4JOCA 4ZOLF 5TDHA 1JHAA 3NGLA 3VBCA 3VR2A 3JQFC 4MDEA 2A92A 2QTNA 3UENA 2W2KB 5L53A 2AMFA 1CD5A 2XGGA 3DL0A 4OOFA 2HWXA 3U4AA 2J5KA 4H7JA 1HEUA 2FZCA 2HEGA 4QRHA 4TSFD 2GF0A 3S40A 3UFXB 4ACAA 4RFVA 3R9WA 1IUKA 1E60A 1NUPA 1CK4A 2E4YA 3VR2D 5TQVA 4GMGA 4XVRA 1G21B 4IL5A 1DVRA 2QUIA 4LJ8A 3HC7A 3UW3A 2D1SA 1IATA 1KYYA 3HVHA 4PC7A 3LP5A 4EMUA 2OHGA 2QL6A 4ALIA 1PFKA 2BMVA 3O75A 3W5HA 1CKEA 2GCOA 3N2IA 4R8LA 1K8QA 3KQOA 5F52A 3TZCA 1EUZA 4FFBA 5IBPA 5JO9A 3VI3B 1CS0A 3NYIA 4KLNA 2F55A 1MHPA 2OYSA 1HYQA 4RTJA 4ZMSA 2IDZA 2AH5A 1R6DA 1YH3A 1R8YA 2BJVA 2VJAA 3A4NA 4HFRA 4KQ9A 2I3AA 1WWKA 1JBEA 2MCFA 2VAMA 1RXVA 2QAGC 2DVMA 5AK4A 5JPIA 5BN5A 3UCEA 4QPPA 2PUAA 1RRMA 2A30A 5FKJA 3BMQB 4TTIA 3VHQA 1DQSA 4LRTB 2XB2A 2QZ9A 4ZDJA 2YYYA 4HLUA 4CMJA 3EARA 2H7CA 1U1IA 5BV1A 3L7LA 4RJ2A 1MAUA 4ZVVA 1JG4A 4NY1A 3I09A 1NP3A 2VPIA 2E5FA 2HC9A 3PJEA 4O59O 2MOKA 1QYWA 1R9MA 4TLBA 3X44A 1GXSB 4DARA 3DG9A 2OBXA 3KTDA 3P2EA 3JYPA 1EVKA 1E3QA 3COWA 1I7LA 9LDTA 1Y7TA 3LKDA 1NHGA 2NPFA 2OD2A 1RWMA 1R27A 2WD9A 4DB2A 2BBWA 1JJAA 3IO5A 4YCAA 2AFIA 1WU8A 2LCQA 3U39A 1ZSVA 2FN3A 5AIAA 1OXMA 5E4JA 4EVSA 2PL3A 1CV2A 1I5OA 1U7UA 2BIFA 2PIDA 2XZTA 2IEYA 3ABIA 3B6EA 3KQTA 3PGJA 3PKIA 4JZYA 4UD6A 4QARA 5ALZA 3A9VA 5I01A 2ZI4A 4OQQA 3BS4A 1O5OA 3P0RA 2VDKB 4O2RA 2JLRA 3K1AB 4Q3NA 4Q7QA 1TVCA 1T24A 1GDHA 1Q3HA 2Q2OA 1A76A 1G3RA 2A88A 2ZJ4A 1FRNA 4OKNA 4QVKA 3QVSA 4HFNA 4MLZA 4FFDA 1KO1A 3PPYA 4QDTA 5F1OA 1AHIA 5J40A 1BN6A 3UH1A 3NBXX 3TW4A 1IZZA 2A5GA 3H8SA 5FAXA 1LZLA 4UQOA 5JXGA 4YMGA 3A6PC 1Z2NX 3PEEA 3TDMA 3I4FA 5U9CA 3A4TA 4JLDA 4J0HA 2F1IA 3KWMA 4PEVA 3DZFA 3SX2A 1KZ6A 1P1IA 2JBAA 2QPLA 4H1UA 1XCBA 3E2MA 3HFGA 2VF2A 3OBIA 1QHXA 4O4JA 4R83A 5L3VA 4TL8A 2CJWA 1J07A 4GNKA 1SG6A 1T5BA 1RMYA 2JLSA 2AYYA 1KDRA 3B7PA 3VR4H 2CLOB 2GMWA 4JLKA 1PNTA 4F5EA 5B1SA 3OJOA 2Y2VA 4K46A 1L5VA 5EJFA 1VLMA 1C29B 4BLPA 1Z25A 4BE4A 3D2CA 3IR5A 2OKCA 3ZWXA 1G7CA 2ZRHA 2LIPA 3BMCA 4XOUA 3LL4A 3A2LA 3ET5A 3K0CA 5AQ1A 2ZYWX 1PT9A 3C14C 3ROXA 4DLAA 4C4SA 1EQAA 4O4JF 1NJ5A 2KQUA 1G42A 2DMRA 3EXIA 1KJ9A 1NW3A 1X7DA 3QMWA 4H7EA 1E9SA 2BMWA 4MQEB 3U4HA 3GRYA 1KVSA 1ZUHA 2GETA 2WHXA 5FD8A 3SCZA 1QTIA 1OH7A 1SXIA 3D3NA 5HNKA 2A1UB 5H68A 1QKIA 4BTEA 5F76A 4GW3A 2GLTA 4JEUA 4QDXA 4HDCA 2CMDA 4YAKA 2J67A 1ILEA 3FZEA 4I7EA 1RBMA 2VQDA 4RZQA 3FH0A 4MQFB 2EFCB 3OIFA 4U1RA 1UWVA 2FW8A 2ZT8A 4Z0HO 3W5SA 2IYLD 3U1BA 1ZL0A 3G79A 3PRHA 3I42A 1PS0A 1ZIYA 5EZYB 3ESZA 2ZITA 4UUNA 4KPGA 1N9GA 2XB8A 4LYAA 4URWR 4ETMA 1X7ZA 4TWBA 3CEPB 2RH9B 2WKWA 4ZV7A 3K8YA 3U5ZB 3ROZA 5JPDA 1L3IA 5EIWA 3HU5A 3ETCA 2Q4BA 2VNHA 4KUEA 4KR0A 4MX8A 3V1TC 5CH3A 4F6CA 2PZJA 2E5WA 1RR6A 1E2FA 4JS0A 4K1XA 4CHGA 2VPXA 2FZEA 4TS1A 3AP3A 4BTLA 3EH1A 3R7NA 1UPCA 1QTNA 4OVKA 5EPEA 1RZUA 1MMFB 1TJ5A 2NVUA 4TMYA 3QU7A 4ZYZA 2O20A 1JI0A 3L9XA 3R3XA 2G5CA 3TTUA 1KY2A 2HQRA 3CBGA 4MAMA 2OXIA 3SR3A 1J2UA 2BY4A 1Z7EA 2P4SA 3E9ZA 3AEUA 3ABQB 3HWWA 1SUBA 1SY7A 3ZJVA 4Y9UA 3A32A 3TUJC 2E4ZA 2V0NA 1DHTA 1USWA 1DU4A 2I2FA 4CKXA 5A5EA 1A2KC 4ALKA 3BGWA 1RHUA 4D41A 4CQLB 2PGXA 3ZI7A 1CZRA 2RSLA 1Y4ZA 4P3YA 5F4BA 1JVSA 5KKAA 5KYYB 1V45E 3PLNA 1G19A 3F8SA 2O8FA 1IJBA 4HLUC 4LQLA 5ABPA 3MJEA 3DV0A 2APJA 4GUAA 5IJWA 5K8LA 1PHRA 1LSJA 1S3FA 5D85A 3ENKA 4AIIA 1WKBA 1NBEA 3D3QA 4BVKA 3KO8A 1JDBC 1J1IA 1CDOA 3Q7IA 2RKBA 1TMGE 1YA4A 4G26A 1D1TA 4HH1A 1LEHA 1E2IA 4MGIR 4RVGA 1U0HC 4EG6A 4ENQA 3MPUA 3TO5A 3WBBA 1XNJA 3KQVA 4FE3A 2C7PA 4BC0A 5I7SA 2AC7A 2R6CA 1UXHA 2DFDA 3QHPA 3T3NA 3KYDB 2RH5A 1MB9A 3WBJA 2NU7B 2Y1CA 5AXCA 1RJWA 2I55A 5EZ6B 3RSLA 4DWJA 2VDOB 4N9WA 4DG5A 2YJZA 2WZDA 5CMLA 3FCUB 4P0TA 4FYWA 1II8B 3M34A 1GPMA 2WYHA 4Y6PA 5FNZA 1I1OA 1K66A 1PNVA 1QNFA 1UJMA 4OQYA 4RC9A 1LDNA 3VUFA 4D57A 3WMRA 4QEDA 1O7JA 2GBIA 1KC3A 3BDAA 3NIBA 3MERA 5HOEA 2VN8A 3VKWA 3NORA 3BDVA 4RFSB 3B13B 3GI1A 1P4JA 4JJIA 1IBSA 2AC2A 4HMPA 3RHSA 1T15A 3FYCA 1U3VA 3HXKA 4PX5A 3I53A 1LB1B 3ECSA 4D9IA 1JMYA 3DTVA 1XQ9A 1Y5MA 3HBNA 3ZHBA 4GLJA 3M4NA 4TYQA 4G1UC 5SYNA 3SX4A 5IEBA 1EBBA 1E1RA 4FFMA 4L02A 5BW5A 3BREA 2A8YA 3G2KA 2ID4A 1PLKA 2RC5A 3W6PA 4B81A 4TM7A 3V1YA 2FUG1 4IKEA 1DC4A 2CMFA 4KIUA 3V7WA 3B1KA 1EHCA 3DTVD 2FFJA 1UDCA 1WCIB 4MGEA 5DXAA 1A97A 1E1RD 3K0CC 2WAMA 4M0DA 3QYPA 3EMBA 1JEAA 3D1JA 4KV7A 4PG4A 3UICA 5A4IS 4IUDS 2YJ6A 4R2JA 3OZVA 1GPUA 3DEJA 3GVPA 3V4VB 2AOXA 3EPLA 4OTZA 1D07A 3MUFA 4I5EA 4YIKA 1TGYA 5D87A 3KSBC 3ZDYB 3F4BA 1AGXA 4XDHA 1E5TA 3L0SA 3M4XA 3UOWA 4JJ6A 1TJ4A 2JLBA 2LZ0A 2PZMA 4JLOA 4N54A 4H59A 5H0IA 3TKYA 3DYVA 4RE6A 3BGDA 4ZEWA 1NBIA 3G1WA 3KFVA 5KTYA 3GVXA 2O06A 4ITUA 3PD1A 5CT9A 2LKDA 4YV1A 1BOFA 1U1CA 1ZHFA 4L9SA 5JD3A 1R66A 4DC0A 4AZWA 2XD4A 2EYQA 4WECA 1HMYA 3W3AH 2PGAA 3MMPA 4PPFA 2WTAA 3JZMA 3IVXA 4ZHQB 3U7JA 4PQRA 2WMNB 4FS8A 2K7ZA 3LDUA 4UUBA 4X93A 1K5PA 1JHDA 1JT9A 4FYXA 2GPNA 1B8UA 4RIHA 5ETJA 2BSAA 5DLYA 2PEYA 2WW8A 3N8DA 1W36D 2HWUA 2GR9A 2QD1A 1U1FA 4ECAA 4IIUA 2CMHA 3TXXA 4H3KB 1JEOA 1U2EA 2QXUA 4CTNA 3FCEA 4FQ5A 3QA9A 3NOVA 3B5IA 2Q3JA 4DTIA 5CT5A 3NFYA 3CBQA 5EIAA 2JD0A 2MYTA 4LG1A 3GEBA 2CYAA 4NI5A 1HG0A 3CNNA 1PTKA 1AS0A 4US1R 5EG5A 5ERXA 1RI5A 4Q1VA 1IN8A 721PA 1Q0SA 1I30A 5MFZA 5K1ZA 1MIOB 3EUEA 4BNDB 2H00A 4DC1A 3GLFE 4G9BA 1TRKA 2C5LA 4MUMA 5KYTA 3K15A 4MYSA 1UXJA 3ZLVA 5FUQA 1J21A 3T7SA 2BFNA 2UYYA 4D4KA 5IH7A 3AY7A 1GCIA 3AK4A 2P3LA 1Y7LA 3IUQA 3FX2A 4MTCA 5IU6A 4UASA 5HRUA 1G63A 1SUDA 1XKXA 1NA5A 3D8SA 2RHBA 3V4ZA 3M1IA 2PJRA 3HO6A 2P5UA 5ALKA 1EK0A 3FW1A 3FUTA 2ZI7A 4WBNA 3TS1A 1GQSA 3N05A 1G8HA 3DVSX 3HYCA 2YWHA 4HCJA 2AL7A 3DWIA 3I01A 4QBIA 4MI1A 4J4HA 4ZQGA 3KKNA 5JI3E 4IIEA 2H59A 5JD4A 2VTDA 2ZRGA 1BVUA 3PHLA 3AEZA 5FFNA 1JILA 3AHGA 1HWYA 1YQDA 4YRTA 2P3OA 5TEWA 1GLGA 4DG9A 2C5AA 3MG9A 4YCBA 3IJEB 3DMGA 2IP4A 3IX7A 4AP5A 3EFBA 3KVRA 2BDTA 2IHBA 3WQRA 4OJKA 1KIMA 3WK4A 3WK9A 2BM1A 2VDMB 4WBNF 3CR8A 4B7XA 4AAYA 4F97A 2P2NA 1RLTA 1PFYA 4KP7A 2ZJ2A 4UUMA 3OMWA 3HDJA 2DX7A 3LQ4A 2PZ8A 2Q1TA 3ABOB 4QGFA 2PZLA 4WV3A 1N0VC 2O1EA 4K8OA 4Z4IA 1S2NA 2R6HA 4KH0A 1UM9A 4YP7A 5G41A 4E15A 3DNFA 2H1VA 4M9CA 1OSNA 5FAKA 1P17A 3CO0S 4BAZA 1ACJA 4ED9A 1Z62A 1UJCA 2UAGA 3SZUA 2H8GA 3CVJA 1DHRA 2GYVA 1J2RA 1I4TD 3VO9A 1CDEA 2P3QA 4F96A 4R54A 4PYNA 2AG0A 1NONA 2H9YA 5EQFA 4F46A 4Y67A 2CMKA 3Q15C 1NXOA 4E21A 4DM7A 4OLAA 5GONB 4BKQA 2B1IA 2EX1A 2FA9A 1Z8DA 2Y66A 1HDEA 3EQZA 2VTKA 3ND5A 1I7QB 1OVMA 3HQ4O 4CN8A 2YJ5A 4Z7NB 1VE1A 1KAEA 3DZHA 4BVGA 2HX1A 4E5NA 3PUJA 2JCXA 3RS9A 3E9YA 1IBRA 2IP1A 3DDCA 3E35A 4G24A 4IO1A 3RV4A 3I30X 3VVCA 3ZXSA 4AKSA 3C48A 4GYWA 4IMRA 4OREX 4EFNA 2PNJA 3HUEA 3MOSA 4R6WA 4I2VA 4Q34A 4X8HA 4CKCA 2G0AA 3IKVA 4R7TA 3QX3A 5FOUA 2XVAA 1PDWA 1U7XA 4TYMA 1H1DA 1BYUA 1ZYUA 2G67A 1I13A 4HQKA 3TBFA 4WKCA 1KKMA 1E1KA 2VI5A 1E2EA 4B9EA 3R5TA 2OYCA 2NUAA 2RCNA 5K3CA 1U3UA 5HGJA 5H4GA 3BL6A 3T3DA 4ENUA 4HL6A 3W2IA 4US2R 2JARA 3HP4A 4C43A 1DOAA 1W36C 1SCJA 3CPEA 3PVSA 5DCUA 4LMAA 1ZLXA 4PYQA 2VJNA 3E05A 2F1HA 3SJ7A 2WU1A 1K8XB 1SHTX 2XUGA 3L0DA 3LPCA 4QOJA 5FUYA 3AR7A 1PD0A 2Z57A 1XZJA 5DH9A 3TW8A 5CA0B 2K2WA 3IJPA 1JJIA 1R4AA 4ZAYA 3BSWA 1UBEA 4MRSA 1QOQB 1XCGB 4GP7A 4WNYA 5BSEA 1SR8A 3LRXA 3ZKWA 4CM4A 4D8TA 4GS5A 3UNXA 1U8TA 1EGHA 3KXKA 3KR1A 4NBTA 3LY9A 4LN1A 3GUVA 3DE1X 3Q3VA 4NL4H 3M6MD 4LSGA 1JXOA 4Q16A 1MBZA 3FOBA 2VT7A 4UPDA 4DPKA 2WU4A 2FWPA 2H1HA 3G8BA 3QHAA 3QV2A 1NL3A 3AVQA 4NMXB 4YJHA 5JSUA 2R8EA 2C2WA 2GRUA 1KZHA 1Z0FA 3TM4A 1L8QA 4L51A 3EVEA 3GAFA 3WV5A 3X2SA 3L4KA 3HFRA 1G5IA 4ZI5A 2YCBA 4HB0A 5HFAA 2WUWE 4G5FA 3BJZA 1QRDA 5LP6B 1HFJA 2ZDGA 1WZUA 3GLUA 1R50A 2LTAA 1YVPA 1NW8A 1ZU5A 3EDYA 5TEVA 3T6KA 3A1VA 2YQ4A 4WI1A 1Z83A 4DLNA 4DR1B 5ALMA 2X8JB 1XQ1A 1JIJA 2X19A 4OI2A 2G82A 2NO7A 5H80A 5HF9A 1ZM7A 4WY8A 3RFFA 1W52X 3PD7A 3SC2B 3X1JA 5B1YA 1AHNA 3C8DA 5FYDA 3RYCB 2X1LA 1JEDA 4RVSA 4DRXA 4RY9A 2C00A 3DCJA 3N2GB 4GOMD 2NXCA 4RGQA 2HJVA 2X8AA 4H7HA 4DMHA 2GYUA 4Z9YA 3SE7A 4F0JA 1RCUA 2Z83A 1GOTA 1UJ5A 2G8NA 4L5JA 4LZJA 3HR8A 3L49A 5ELLA 5K3FA 2R96A 4HBGA 1V1MB 4XFJA 1EE9A 3IV6A 4LDZA 2EBUA 2DKOA 1GD1O 2E21A 4RYLA 1GPBA 1DG9A 2GCPA 3NWJA 4PGAA 2PVCA 3W7AA 1DXYA 2Q2WA 3GMTA 4PSUA 3OJLA 4Q7JB 1GZ7A 3WL3A 1XIVA 4WLEA 1PZEA 2QY9A 2IPOA 3CRQA 4K05A 3FJ1A 4PHTA 4Y2VA 3GOHA 5KCMA 1YJ5A 3MYYA 4UMEA 4ZPXA 4EFMA 5FA8A 2ISQA 1SQFA 5FQNA 3DR3A 2W2VA 4NFSA 2RHDA 1O4VA 3EC2A 3EXFB 3ILXA 4KXUA 4QOEA 5DX1A 1B41A 4EO7A 4LMRA 4R6XA 2P8SA 5E6UA 3GEDA 1M7BA 3T3IA 2QRNA 2ZIEA 4O8ZA 4UARA 3KR0A 5ICMA 3QLJA 1VBKA 3IV9A 1UBKS 2AR7A 5CLFA 1ISPA 5K5EA 4BO7A 2V7QA 3N8IA 2H4ZA 5FI0B 2V5AA 3L4BA 3N86A 4U7PB 5DM4A 4D8XA 3EFOA 2PKYX 5LA6A 3L1HA 4TWRA 4CT4B 2J33A 4X6YA 4UCFA 4ZANA 3FUUA 4B4VA 2LDXA 2QN3A 3I0ZA 1PFQA 4RO0A 1N6IA 3MQ2A 1G5HA 4MIOA 3IDSA 1M6HA 2DR3A 1DEOA 3ENZA 1JQ5A 2V7QD 4C2AA 1X15A 1C3XA 2XIQA 2EYUA 3SYMA 2CHVA 4QC2A 1N2CA 2O3RA 3BFPA 3HDYA 3Q9UA 2HYIC 3K1TA 1ZOIA 3PPIA 5BSGA 5JSHA 2YX1A 4X1KB 4DQ0A 3N6RA 2FLWA 2B7BA 2XCQA 5LA6F 1EDZA 1DMSA 3EODA 4QOSA 1FFBA 1TT5A 1OH8A 2J59A 1WULS 1IJEA 2QLMA 1O6GA 2IIVA 2BUBA 3PXEA 4KPFC 3MK31 3HJRA 4URFA 1V7CA 4E7OA 2J4CA 4OGLA 1GPNA 1LDGA 1MJ5A 2HA6A 1DTWB 2PUVA 3D6AA 3H5AA 3KFXA 1RJDA 4JT8A 3D59A 1BCRA 3JD3A 4WINA 2WFLA 2ZWOA 1ZL2A 3JWEA 3PKZA 4FNMA 3FNEA 2VYCA 4KSYA 1U0FA 2C9CA 5FA6A 1QK4A 3CKKA 1QVVA 1XMXA 3BXXA 4F91B 2BONA 5JEDA 5FH9A 4Z0PA 1RXYA 1TZCA 1Q12A 1MFPA 2H48A 4YP6A 4XIGS 3U3OA 2AOWA 3DBHA 3LCRA 5G53C 2NYVA 3RT1A 2IUSA 4I14A 4LOLA 1XROA 4C78A 2CL0X 3A7DA 4JUIA 1ULBA 1UBUS 4KQJA 5JSYA 4CIWA 3E7XA 2HADA 3U56A 4J1QA 3RS8A 4TTVA 3AP1A 1MEJA 2PD6A 3OLVA 4GD3Q 3H2ZA 1Z74A 2INGX 5DM0A 2I2CA 4DSAA 1KJWA 2YZ2A 1YZTA 4QWMA 1M2JA 3C1AA 4FXPA 3LVRE 1PT8A 1ZWLA 3R0VA 3GFPA 3M2TA 5CFLA 2XGJA 4PLZA 3I62A 3AMVA 1CW2B 1CE8A 1NLZA 1B00A 4GOLD 4EKIA 1HKHA 1IZ9A 1RP1A 3L7IA 2EG9A 2LP4Y 4NCJA 5BT9A 1K97A 3UTDA 4EMBA 3PHJA 3RREA 3Q98A 5DM70 4IVRA 3EA0A 3CVYA 1SUIA 2B7CA 2ISSD 3G5TA 3I3SR 4IXNA 1PT7A 5IKXA 3GDHA 4UMVA 4DZZA 3K4QA 2ECQA 1F2UA 2P1ZA 4FDUA 3KEGA 5A02A 3T7EA 4BCDA 5EXTA 5LZ7A 4IIYA 4DTCA 3SAJA 3BE4A 3RUEA 2G1UA 3S5UA 4BJ5A 4MYRA 1V5EA 4KQWA 1YHZA 1H2WA 3NXSA 2ZYUX 4Z3KA 2BF4A 3MPOA 3D3WB 4EAQA 3WXMA 2XQJA 3P0JA 5ERYA 2YMMA 4D25A 1D4OA 2V55B 1UF9A 1P60A 1RKQA 1Q5PA 2E7ZA 2OB1A 3DOUA 1EVYA 2ZLBA 1YR9A 4CMGA 1RI3A 1H4SA 2W00A 1NJ8A 4U8HA 5A7GA 2PSSA 4F3YA 1V11A 5A5VA 3CH7A 1A5AB 3GRCA 5CYOA 4D42A 5CDFE 3GP5A 3W8NA 2E37A 1CFZA 4R05A 3RNOA 4LPSA 2BFCB 4K6GA 2VSQA 3I73A 5TB5A 2ZJ1A 2OLKA 5BN4A 2Q3FA 1PT6A 2Z5FA 5REQA 4ENVA 2X1VA 1PD1A 2HPZA 3IFSA 1ZRHA 2GF2A 3HY4A 4EHKA 2EZTA 3WNZA 5L51A 2IXAA 4REQB 1IPHA 1M2FA 2D5IA 3FB4A 2O8CA 3E27A 1ACMA 1T8RA 4OA8A 1XVIA 2KMLA 1C9DB 4GBGA 4QTXA 4C5BA 3PX7A 4MWEA 1ID1A 2O05A 3OZ7A 3M4YA 4NABA 1YE3A 3PQ8A 4NOJA 4BV9A 4M0KA 3HYTA 1L4KA 1KR5A 4X7RA 3UB4A 2ZB7A 4R1QA 3WHPA 1PNOA 4DADA 3U48A 3L4BC 2R8BA 3PNKA 4AECA 1XTZA 5C52B 2W37A 3L7KA 3MN1A 4ZQBA 5FNVB 1LK7A 2A0KA 2Q29A 3GH1A 3R40A 4B09A 1U80A 2Y6UA 2Z2IA 2AHOA 1BCSA 3G59A 3PQ2A 1OBFO 1QGOA 3WFIA 4IV8A 3I1FA 1SK9A 1GSHA 3TRIA 1DBPA 3HLTA 1X8XA 1I6WA 2HA0A 2XWJI 4B79A 4E4TA 4BGDA 3SM9A 4TYNA 1V0JA 1CEQA 1J7JA 1M76A 2VJBA 3OF2A 1KYVA 4KPYA 4TLCA 1YZNA 1Z0AA 2RHTA 3E3OA 2VZ0A 1DOHA 3LDFA 4HDMA 4JIGA 1SVNA 5B3AA 3FNBA 4G9GA 3TIGA 3ZLUA 2J9RA 4TKVA 2JVJA 2XV1A 3GJ3A 3SDZA 5HJ5A 3QPAA 4X62B 1LU9A 4EG8A 1GHTA 3L4EA 4C4RA 2H4FA 3V8BA 2G06A 3PJGA 2E4XA 3W9SA 1QVWA 3BXOA 5C1DA 1SBYA 4E5DA 1JVBA 4RQAA 1XA3A 5KDOA 2XNDA 4ZDWA 1NVGA 3PJFA 1Y4DE 4AZ3B 1JA0A 3FPEA 3NGMA 1XQXA 1B26A 1P33A 4FZ5A 4GM0A 1FDOA 1TW2A 1R3DA 4TL9A 4BJHB 4RIEA 3CLSD 7REQA 2IY7A 2OB2A 1X14A 5FL7A 5C34B 4YAUA 1ZFNA 3OI7A 3OEHA 3CF2A 3UMJA 2BHNA 2PR2A 2XNDD 3A37A 1E7YA 1M33A 1RYDA 1ZD4A 1GNPA 4DC9A 2AFHA 5AHKA 3WK6A 3GFQA 3H9QA 4UBJA 1U4SA 1FYDA 5JAIA 3AUTA 3UEOA 3GLIA 2FFBA 5FL7D 5HCUA 3MMNA 4CEHB 1XNHA 3ANSA 3OEHD 1LS6A 2X0KA 4EYKA 1ORRA 2FF5A 4DDUA 4PFJA 2I2XB 4XTRA 1Z06A 1T13A 3DEYX 1HE3A 1NMZA 2WHRA 3VR4A 4E2XA 1AF4A 4G5OA 4QT0A 3NETA 3BKXA 4PZUA 3IKLA 3LHFA 2R84A 5E7JA 4CN9A 2JK1A 3MWKA 3KPJA 3RVMA 3MJ4A 1ORIA 4G2NA 1SUEA 1BXRB 1RM4A 2IWHA 3HJBA 4E4RA 5M2QA 1ORTA 4DV3B 5AVXA 3UAXA 3MSXA 1E1MA 2X76A 5AJXA 1LX6A 3CSDA 1OAKA 4K81B 5E6SB 1A96A 3AXSA 3I1JA 4LJSA 3VO8A 3VNAA 1X1DA 1R5BA 3BIFA 4QEKA 4GBJA 2UYQA 4M1EA 4MPTA 4MUIA 3VR4D 1AD2A 1EEHA 4K87A 4HDAA 4P7BA 1PR4A 2H6EA 3IAS1 3IRUA 4QQNA 3GLGA 1K5DA 5H02A 1T2FA 1EK5A 1Z56C 2P0AA 4NE9A 2WOOA 2YL2A 3VYRB 4DLXA 2O50A 3FPBA 2RKWA 4E1BA 2OECA 2PUHA 2XYGA 4I5GA 1ZIDA 1AF7A 3FZNA 3L7YA 3OPYB 3TZEA 2NSJA 4BATA 2YJ3A 3TUZC 3GV0A 3U40A 3MIZA 3P32A 1WD5A 2CBGA 4D3YA 2QM7A 5IJ9B 2PMFA 3EDMA 3OZUA 3VPBA 4L8GA 3UUFA 1VRVA 1ID8A 3W5BA 1FQJA 2F00A 2VK8A 3VTKA 3RSOA 1WXIA 1JUDA 4MWOA 1AQIA 2RGRA 2B4RO 1XHEA 3ZTTA 2YFKA 3CN7A 5TARA 3ZXUB 1MABA 1PK9A 1KGSA 1RD4A 4CKEB 2C7OA 3ITNA 4X0EA 2OR3A 1ZMOA 2IK8A 5JR3A 1T91A 3R5SA 4EDFA 1U5BA 3K5IA 1GRQA 2GN2A 3CEMA 3E0QA 4N5DA 4NR0A 4R2WA 3RUIA 4UM9D 3U7QB 3ZCQA 5ED4A 1QQAA 3G0BA 3VJKA 2IIPA 3GGCA 4GXRA 1I7DA 3DLTA 2FV8A 1RKVA 2FWNA 3LH5A 1A9SA 2F64A 2X0RA 2OZPA 4TTQA 2GBPA 2J3KA 3IP7A 3USCS 2VH5R 1I4EB 4JSRA 3JX9A 4MWTA 2K5UA 3KTFA 4NBRA 4ND6A 2FR8A 5J4VA 3R9KA 1FYXA 1RRKA 3N3BC 3R6LA 2F2TA 2BGLA 3H9JA 3G0OA 4O1MA 2RBGA 2BFMA 5GZ3A 3ER9A 2CLMB 2ODPA 2PRJA 3CW2A 3F71A 2OFWA 3HCAA 3VTFA 3W78A 4KIFA 4QELA 2FX5A 3O3OB 1K7EB 5TMPA 4RHYA 3OIUA 3TJZA 5TJHA 4DJTA 1AZWA 2PX2A 2R85A 5AKIA 3CT4A 4W6QA 1JSZA 3P9KA 1GQYA 3WKEA 5CDUA 4JV5B 3FCOA 1CHNA 1NOJA 2YKGA 1NVFA 2JFQA 3QJ5A 4P3XA 2C83A 3DR5A 3EUFA 3EY9A 3CLSC 1XF9A 3FBTA 4RS3A 2Y71A 5I47A 2SBTA 1TU4A 1VFNA 3QQPA 4I2NA 3EVCA 1S1CA 4P3KA 5BSFA 1G20E 3DQPA 4K40A 1XZNA 4QUGA 3RG8A 4IUBS 2C57A 3CUSA 2QN7A 1G8JA 1VYTA 2I8CA 3E5NA 3E9EA 3GPLA 3GT4A 1KI1A 1NLFA 4QBKA 3ETGA 3RAJA 2H7XA 4FYVA 1A7KA 4DA7A 1SXJE 2XOEA 3V8QA 1REQA 4WNCA 2UYHA 4I1PA 1IBLB 1WE2A 5T64A 2YIDA 1EXNA 5EFOA 2IXFA 2WP0A 2HJHA 1YACA 3C1UA 3FTCA 4HNRA 4IJ6A 4JNCA 1DEKA 4XJTA 4IUYA 3A1CA 1HM5A 3CJTA 4WLNA 1JQ3A 1PFVA 4HPJB 3EFEA 4PBSA 3UMCA 1HTTA 2QMQA 3UJ9A 2ID9A 3PDIB 4Y2GA 1U7WA 3OCZA 2I7XA 1H22A 1RKXA 1AIPA 3DKVA 4YC7A 3VZBA 2RD2A 4KXYA 5AJZA 3OO1A 1ISJA 1I9CA 1ZINA 3VAZA 3G02A 2TSYB 5IBQA 3VPAA 1N92A 1NULA 5JALA 3CF0A 1IOZA 1M1YE 4NH0A 4J91A 5PGMA 1CFJA 5DVZA 4DUPA 5EZYA 2QG6A 4HXYA 3KLNA 1M1XB 4Z9BA 3ZQJA 3T1TA 4E2YA 4KN6A 3KT0A 2BE9A 4LJ7A 3F98A 4YO8A 3BXGA 1EUYA 5D3QA 1UBFA 5DGCA 3EOBI 2GVNA 2QSYA 4NK5A 2JAOA 4X71A 3ZBTA 1KOFA 3M5DA 4AU1A 1WY7A 4HNUA 2WC1A 2XB6A 1UBOS 3TNJA 3KD3A 4L8LA 3ADDA 5JE8A 3FDFA 3UXYA 4XLZA 1MO2A 3AHIA 3DDUA 4X61A 5EZYF 5H7XA 4A2CA 2O0KA 4Y6LA 3G13A 5FPTA 5LDDC 3ZW7A 3DJYA 5FCDA 4B3TB 1YU6A 2CXSA 3AFIA 2BCJQ 5DV9A 3RUPA 2ZRFA 5CUQA 4EB8A 4MW7A 4BFWA 4BNZA 5JNWA 3PSAA 4ZVOA 2MJLA 1GVHA 5SZJA 3QPUA 4ZZ0A 3FOZA 5T67A 1RABA 3KT3A 3IHWA 4UDOA 5LNK1 3E9DA 2FUKA 2M1ZA 2JH3A 4IDFA 5HRAA 2ZXEA 1JIIA 3EIWA 1VI2A 1Z18A 4CKZA 2D4AA 2QWXA 1Q2UA 1FZQA 1MAWA 4DR6B 3FF1A 3D6FA 13PKA 1IN6A 3AR8A 3LO8A 3ENWA 2G4CA 3K0EA 3QXHA 4IDHA 4KX3A 3D0OA 3TOZA 3W3AA 1JG7A 3M9XA 4S24A 2VDWA 4XX0B 2QP3A 4UE2A 1MR3F 3H9EO 1FLDA 4JK3A 2QTCA 4MYHA 5AI5A 3AF6A 4F12A 1PSDA 3VX4A 1WPGA 1USKA 2YIVX 3C5HA 3EGXB 3HCOA 4FEAA 4IHQA 5BWCA 4OUKX 1L8OA 2W58A 4AROA 4DY6A 5JLAA 3S0JA 4CFZA 2WABA 4O02B 4RORA 3RKUA 2B8TA 2PVPA 4X54A 3AVVA 3U81A 4AJNA 5JPCA 1I3KA 3RSQA 1U1DA 3Q87B 3W3AD 4M60A 3EEIA 1KI4A 2OCGA 1QUEA 1BXKA 1SC4A 1CZHA 3RTCA 3E8MA 3QXGA 1MGOA 2FR8C 5KYKA 2CC2A 1SD2A 6AT1A 3V34A 1IHYA 1YVRA 2HBRA 1V7ZA 1Y3DE 2ZAGA 3O3MB 3KUXA 1DT5A 1Y1PA 3M6WA 1B73A 4GVLA 4M0EA 2HK6A 3JQBA 4BP8A 4NHEA 1NLYA 4LQCA 4F2DA 1YONA 3IPAA 4A4DA 4E0BA 2ORYA 3H19A 4NCXA 4P93A 4EZEA 5FJJA 2QVXX 2FZWA 4K8RB 4K2AA 1QHGA 1JLRA 1YDWA 1U0TA 4ZU6X 5IKPA 3GRZA 2X0IA 4Q15A 5JIBA 3NTOA 4DCOA 1FLVA 1WSBA 2GAAA 3MTIA 1B0PA 3N75A 4HVAA 4MCIA 3KOOA 3ACCA 1DLIA 2JAXA 3OIDA 4PZCA 5FYQA 3S68A 1EDEA 1IXYA 2OVFA 3A1WA 1T0JB 3DE6X 3EHEA 2HT6A 1RRGA 2F48A 3L7OA 1USIA 1M6VB 1WXFA 2IFTA 2QRJA 1JIXA 4GQBA 4M46A 4OMDA 5CVEA 1MV5A 2R11A 5AJVB 4JJEA 4NP6A 1VBMA 3TW0A 4FNGA 1LVUA 1T0IA 3HJTA 3KCQA 3B38A 2COEA 4AJOA 1X1AA 4WA8A 2OESA 3X2FA 2GAJA 1OA0A 4DQDA 2R25B 4WDQA 4A8HA 5I9LA 1NLMA 3PICA 4Y2JA 4EYQA 3M5WA 4JL6A 5KOIA 5D7NA 4WOPA 4CG1A 1RXCA 5BPFA 4U5XA 3ZHOA 1YDFA 2EF1A 1UMBB 2QM0A 4L9AA 4H6WA 4MW2A 4OLJA 2BZ0A 2Q5EA 4V0QA 1SHUX 4L57A 4JC5A 4WESA 3EA5A 2BELA 1ZG3A 2DTDA 5KQGA 1HE8B 3S81A 2YJTD 2SCUA 5FT9A 5LCXA 4CM7A 4AX8A 3DZDA 3HHPA 1I5EA 3KELA 4TKLA 3EDOA 2YWJA 3OTWA 3IIMA 4TMWA 4QTUB 1J99A 3PXAA 5LU9A 2ZRCA 2DCUA 3E61A 1P3Y1 3VAAA 3D0RA 3FR8A 3RSHA 3GEEA 4KG7A 5JHHB 3HCPA 1PJZA 1ZK3A 5LLDA 4Y2YA 3L5OA 4MCHA 1YIOA 4ZAWA 1XZCA 2IEGA 3AR6A 4H08A 3MCWA 4H35A 2RGXA 5ALWA 5F35A 3RGWS 5K0NA 5ENVA 3WMFA 1KKLA 1KP2A 1KJQA 3WLOA 1XTPA 4YCMA 5HEKA 3QY9A 5IM4A 1GZSA 2PPLA 2D1TA 2G25A 1E2PA 4KNWA 4PSDA 4IHJA 1JU9A 2V5UA 1B14A 4HWPA 2Z4TA 2A5JA 2ZANA 1AXEA 4H1TA 3DVAA 2HIHA 1FFSA 1ST3A 3PF9A 9GPBA 3CVWA 2ZCJA 4M53A 1WO8A 3LBYA 5EPUA 2CE7A 3EZ9A 2HW8A 2YWGA 1J09A 3IP5A 4RX1A 3BIXA 3PX2A 1BOOA 1P7VA 3HFJA 1CVLA 4CKWB 1TADA 2WV7A 4JLVA 4YJGB 2F3TA 2FE1A 4RDIA 3WI7A 2JKYA 3EF3A 1P5FA 1RDFA 3EIQA 3RWOA 7YASA 2QLLA 3TLZA 3ZQKA 2ZE6A 1MIOA 2B8WA 3C6MA 3PFWO 5DHFA 1CWUA 1JJVA 4B73A 5C31A 4IHJF 5I5EA 1MNQA 1K4YA 3BXZA 3FPLA 3HP7A 2EDCA 3VM6A 4HX2A 1VL8A 4GGMX 4HJXA 2Y05A 5I7AA 3FLMA 2E4WA 1VKJA 4G23A 4BQSA 5ARBA 5KPJA 1T5IA 1ZS9A 3A1TA 1DJOA 1E1QA 3ZC3A 2XT9A 3GWZA 2UDPA 2XI4A 4R8VA 2O59A 4TOIA 4ENTA 1PEYA 2ZU6A 1PI3A 1WF6A 3CJQA 4MUXA 4QDJA 3CS3A 4YP5A 3EIOA 2C07A 4JQOA 4ZCPA 5A0VA 1CHDA 4ZVQA 2LPMA 4QBHA 1U3DA 3M6FA 5HILA 3RM3A 1F9AA 1EXVA 1JI3A 3NPMA 3O93A 4K9PA 2Q8QA 1SD1A 4ARZB 2J0QA 1AURA 1GRNA 2QU7A 2GNPA 3A6KA 1D09A 1E1QD 1U0NA 3KHUA 3R5FA 4OYLA 3D0KA 1IMJA 2WFMA 5KVAA 5KHAA 4OIFA 5EIHA 3L8ZA 4CJXA 1Z16A 2CGEA 3JQBC 5I6DA 1X7WB 2JF0A 4MS4A 2CDCA 5CFZA 4NOMA 4DEXA 5KTTA 5ESDA 3PDCA 4K9OA 4BLRA 2AUTA 3OPNA 1M5RA 1KXJA 3ODGA 1Y4AE 4FINA 1QGED 4QECA 3RG2A 3KTAB 3NIFB 2FPIB 4URVR 3UYKA 1C1XA 4W1RA 1FSGA 2IUYA 3ZIDA 4G36A 3RS3A 3BK2A 4BGEA 2C20A 1K8RA 3D4NA 3CURA 1PKXA 3FPJA 3GPDG 1JQDA 3SZOA 2BTOA 3AJRA 4DJEC 2IS1A 3IUPA 3BFVA 4S1WA 2FUEA 1U8XX 4EHLA 2ZRKA 3WY9A 1IN4A 2QRPA 4NJMA 3UAZA 5IXSA 5H1YA 5HWSA 1OR8A 3UXEA 3VDQA 5BOSB 4DBLE 5GONA 2QTHA 3GVCA 4I0WB 3CX4A 4M8SA 4KSBA 4OLFA 4YQZA 3U31A 4IDCA 2AVDA 3OKCA 5SICE 4EGSA 3DVRX 2ID7A 2C3OA 3IQEA 2N3ZA 4ZAXA 5I7WA 5JISA 2XQFA 4IH4A 1OIVA 3IVMA 3ND7A 4JEHA 4KYUA 1E4YA 3FKJA 4NVRA 2OAGA 4W5HA 3WQQA 2BFEA 4JVOA 2VJDA 2DPHA 2EL9A 3AGQA 1P9LA 3BULA 3EAFA 3M1AA 3PUHA 2EFEB 3UJ7A 4XQEA 3I3OA 3SYLA 2DH5A 2PMKA 1MCZA 3GJ7A 1QHFA 2G9ZA 1F48A 4H4CA 3S7TA 1HC7A 4G41A 4JYZA 4GPEA 1YZKA 2Q3EA 3MTJA 5GONF 3BWCA 4KYTA 3VSCA 1HDRA 8AT1A 2ZZMA 3ND8A 2VT3A 2I6UA 2JFXA 3DAFA 2EW8A 4ZO4A 1JN0A 4RL6A 4AF6A 3WA6A 5FTLA 5FI5A 3QU2A 1PFWA 3X0DA 3C6KA 4X6UA 4BB9A 4UCQA 5FFFA 4O29A 2DKFA 4KLAA 4RA6B 1O2DA 1TEZA 1KI2A 3QUAA 5FEMA 3QLVA 3D64A 2I7VA 3TZLA 3UGQA 3VJMA 1DFGA 2ACKA 1VIYA 3FDJA 1DQZA 3GPIA 3NBYC 3PP8A 3QE3A 4JA2A 4ER0A 1ECCA 3L01A 4YT4A 3LT1A 2XF8A 4TMXA 3NKLA 2RAUA 3QVOA 3ZLTA 1U7TA 1C9MA 2FPRA 1O03A 1OMOA 1U81A 3H17A 3I32A 3KLOA 3QG5A 1ABFA 1GN8A 2HV8A 4MYCA 3WO0A 3VNRA 1C0EA 3O4JA 4QBTA 2AN1A 3MTQA 1QH1A 4PZ0A 1X7YA 1O0CA 1MQAA 2YFHA 3OZGA 1A4IA 2ZSJA 3B1WA 2G70A 3BAZA 5LQRA 1YZFA 1EEXB 1F8GA 4RKRA 4H77A 5CK4A 1YS7A 4X1YB 3ZIAD 4KTVE 4NYMQ 4BVLA 1WVMA 1FX0B 4EPRA 1K3TA 2XZOA 1TM1E 4GPZA 1G6HA 2BW0A 1ZI8A 1XSEA 1AQLA 1Z0DA 5J43A 1U8EA 3B1VA 4JMPA 2J0SA 1TO2E 1BE1A 1T3TA 3BXFA 3N53A 4HZUB 4N03A 3SC2A 3L2OB 4NRDA 1SFRA 5AUOB 3QKRA 1OX6A 3NM5A 4FTWA 4QG7A 2VWGA 4NJEA 2OBFA 3HKEB 5F64A 1C5KA 1CJTC 3E5RA 5GJBA 1OZGA 5IPFA 2H1CA 2YRWA 3BJRA 1IN5A 1U6JA 3MUOA 1ZY2A 3HXPA 4H9GA 1ML4A 4LDNA 4OUDB 1POXA 3RS7A 4IGIA 1WLSA 4EPWA 1F4VA 3S29A 1Q1QA 2X22A 3TIIA 1OLXA 5FPYA 4MV0A 2B6HA 1SBCA 4N4AA 1V1MA 2GZAA 1V16A 5B36A 4DLKA 1NP7A 2D0DA 3LXXA 1O58A 4LCBA 4OYHA 4LF6B 3LZDA 3VNVA 4YT5A 4QUJA 5CBPB 1TCCA 2GXSA 2QX8A 3D5EA 1TQ4A 2B1QA 1ZH8A 3E22A 4IKPA 1XR3A 2B83A 1C7RA 2BR5A 3QFFA 5IDVA 3X1WA 4BHTA 4EARA 1JYFA 2G8LA 5G4LA 3EOZA 2W6ZA 1GA4A 4MAFA 4GG1A 3LWDA 3RUCA 1LSOA 2YBDA 2F9MA 1RJ9B 5JANA 4KFTA 1ZX1A 1LBQA 5DBEX 3WOVA 1EDDA 1FFCA 4DIMA 1S2DA 1Q95A 5IHXA 1YRYE 2CFCA 1XVAA 3PHGA 1EUDA 1LLQA 3AUXA 2VK1A 4LZLA 3KD2A 3K1ZA 4HQLA 3WIEA 2CLSA 1D4FA 1P2GA 2FXIA 5DNDA 4Z86A 1GGFA 3BSYA 3FFAA 3O9VA 1YO6A 2P91A 2CLEB 2ALJA 1TEHA 3PBKA 4GR9A 1MVOA 1SKQA 3ZE9A 1QGYA 4ARBA 5JAZA 2F3QA 3TN7A 3QEMB 3IA2A 4MZDA 1A88A 1E58A 1G3UA 4RBNA 5BW8A 3IBYA 1FU8A 2QMUA 3GHYA 3O8LA 3WSTA 5D86A 2ZETA 3I2IA 4IF4A 4KI7A 4X97A 1I7SB 4KTTE 2W42A 4KGZA 3CLUD 3IP6A 3HRIA 4AKEA 2D5AA 1U9IA 3MHTA 3D2AA 1KBOA 2O2EA 2RAVA 3L1IA 3ZR4B 4G81A 4NECA 2CNOA 3TLKA 1KY3A 1DXQA 2JHCA 3TQOA 1R9GA 4J90A 4R1MA 1HK7A 2QD2A 3FBWA 4HKTA 1T5DX 5FWXB 3PU6A 5MGNA 2AEJA 3GLFB 3KEFA 3L6OO 3BD9A 1NBOA 3RTDA 4OMCA 2VT6A 3RC1A 3HBFA 1LRKA 1DP4A 4JMLA 5AKYA 4G4IA 4CKBA 3ICEA 4ARAA 4PN3A 1YR3A 4HSGA 2ORED 4F84A 1CRPA 2B7LA 3H8WA 1NUUA 2RJ3A 3QXXA 3C7AA 4DHEA 5CVVA 3RGGA 1N36B 5HZMA 2H5JA 2A94A 3KYIB 3QVLA 3R09A 1QR2A 2XMZA 1V5WA 3HR4A 3QLVC 5J5CA 4ZC8A 1J0CA 3WYNA 2WQ6A 4I1VA 4C3UA 4CM8B 2XZLA 4R3WA 2ZRDA 2GXAA 1J90A 1GEEA 4WEOA 1M75A 1P61B 2NYRA 1T3ZA 4ZZ2A 5HXAA 5C7OO 1J56A 1DCKA 1EFCA 5AJYA 1UJNA 2PBLA 1TQ6A 2O7SA 2DFVA 2GJ8A 3WLFA 5DCYA 5LXTB 1W4AA 3SIPA 2COUA 1AG9A 2WT8A 1X1BA 3NIDB 1XDBA 2G1KA 3ORQA 2J07A 5JJCA 3GLHB 5K03A 2VRNA 1RLUA 3SBEA 3KU1A 2IYQA 4WT7A 1SG0A 3C7DB 5I51A 1Q19A 2IHNA 4H1HA 4PYIA 4AVYA 3QYFA 1Z47A 5E6RA 2Y0CA 3CVVA 3AW8A 4CU5A 4BNHA 1PL6A 1F6DA 5AICA 3BWEA 3KNZA 2FYTA 2QSZA 2VNKA 2R1ZA 2VP4A 4JN6B 4NXMB 3Q7PA 1WXEA 5TXGA 1YRAA 2QYSA 1XPRA 1T34A 3E2IA 1VPEA 4P4LA 1WZIA 3A3YA 2JFHA 1LJ8A 1EAMA 4P1ZA 3FDZA 2KHZA 3ROMA 3RRMA 1KK1A 3T3PB 1NZJA 3TCNA 3VI4B 3I5YA 4AJ1A 1TYBE 2R6GA 4KHPB 3R7LA 2UXCB 2X77A 3A1NA 3FG9A 3KT8A 1OILA 3MMSA 4OBXA 1YXMA 1PT5A 5AUNB 1ZN8A 4TVKA 5AUQA 1AO0A 3OBBA 1NI3A 1DJNA 4GO1A 4WXHA 1QYDA 1U7DA 1UKAA 4ALMA 3AUSA 4E6EA 4JJAA 2B3DA 2G4LA 2J9GA 3ETEA 5G1OA 3NUZA 2R5WA 1QZ3A 4PFSA 5CFQA 4GICA 5KWVA 2BHSA 1BS1A 2VZLA 3DMHA 1KAOA 4Z9FA 1CRQA 1BC5A 3NP9A 1N5RA 4HO1X 1U4NA 4PIMA 3KZXA 2HK8A 2UXBB 1U3TA 2VJCA 2ZE8A 3LWZA 4W7IA 1UIMA 3EISA 4ZMRA 2HHCA 4BOYA 1ZJJA 2FN8A 4RELA 2GA8A 3LC0A 4YN3A 2FEWB 4J6EA 1ORHA 3TMYA 1Z4LA 2BR4A 2ZYRA 3QLEA 2I99A 4QFBA 3CHYA 4HGOA 4ZT7A 5GPBA 4BN4A 1PN3A 1JR4A 1XCMA 3NHAA 1UMDB 1TF7A 2NZVG 2OBLA 2ZJ5A 1JEEA 1QHSA 3DM9B 1LPMA 4P98A 1BMTA 2IZ1A 1HMPA 4ZCQA 1S5PA 2Y0DA 4K26A 1K9SA 2IYYA 2O2ZA 4IH9A 4NHOA 3RS0A 5KNCH 3HXOA 1F8UA 3THYA 3IB3A 3QFSA 2AQ8A 4FNAA 2WE8A 2ZM6B 1UBNA 4PHCA 3TRJA 3KJXA 5U4XA 3CLUC 1WOYA 4R2LA 3BMOB 3CR7A 5KU7A 3AC0A 3DUWA 1GPLA 4S04A 4R41A 3I6QA 5HOQA 4Q01A 4B6PA 2CJPA 2OILA 1EVEA 2TRSB 4MWCA 5H70A 1D9ZA 3AJAA 4NE7A 1JB9A 2WY2D 5I7RA 4U00A 1OBCA 4G67A 1X1CA 1ZGHA 2PKQO 3K4PA 4DAOA 2ZAOA 3ELDA 1STOA 1DEHA 3EEBA 1CDZA 1U9IC 2MTBA 3H1TA 1NX6A 1X7XB 2A4KA 4IQGA 4JQZA 4WNAB 4AC9A 3WGUA 2VDPB 4R9RA 5E95A 3FTDA 4PZ9A 2I33A 3B9QA 3MOGA 5FI1B 1AUXA 4OGKA 4EBBA 3ASYA 1EXMA 2C5EA 1S96A 4RKWA 5E7IA 5A7HA 1E1YA 2BAGA 2VQ3A 3OEWA 2DUJA 1QK3A 3WNVA 4ZYUA 1XTVA 4WLUA 1EX9A 3AX6A 1QKKA 2X0EA 2WYOA 4UPEA 4I8XA 2H5IA 3UV6A 3WSVA 1HOXA 3RU3A 5CW1A 3HMKA 3C15C 3P2MA 4PO3X 1EA5A 2W6CX 2FPGA 3QOYA 4JHXA 2F9LA 3DKIA 4I9UA 2EFDB 4A0SA 2Z56A 5FLEX 3IYLW 2RH8A 3OESA 4IFEA 2VWPA 3QE9Y 2C4WA 3LUJA 4BBZA 4B74A 3A9WA 3GZTB 4RXUA 5IDXA 4H3HB 1UFQA 3PIIA 5JZOA 3NS7A 1OXKB 2A2ZA 3VHXA 3HY3A 4QASA 3X1KA 4HLCA 1V4VA 4UTVA 5KNDH 1KYIA 3NI2A 1DXHA 2P3SA 3IRVA 1C8KA 2JLUA 2BI8A 2W6JD 4M0PA 1JHQA 1TW3A 2OFXA 1EJ6A 4J1TA 1VIDA 3BL5A 2OLEA 5HIIA 4R71A 2AZDA 5EE1A 2WWXA 2WJGA 1F14A 4OF4A 1B6GA 4WFIA 1E7RA 1RBQA 3C39A 4WVFA 3DOEA 2OAP1 1IRIA 1RC1A 2W6OA 4Q4LA 4WKNA 3EQ8A 5T57A 5DM60 1GV1A 2ECFA 2XUOA 1UC9A 4JY7A 3VO1A 3W5DA 2YHAA 1NURA 4XJXA 1G8MA 1UBMS 2JGNA 1OXSC 3KM0A 3RRYA 1OH6A 5CPFA 4U6SA 3GEPA 1DZ3A 3JATB 3U44A 4L8WB 2CUNA 1YK0A 1BE0A 1I0IA 3OZTA 3W1VA 1C2TA 3OC0A 4ZAZA 1W48A 3CPJB 3VJLA 3GJQA 3CJRA 2WB4A 3WBKA 3ZDZB 4E5YA 5EUBA 3K9CA 4ZIRA 1NG9A 1XJCA 4FFSA 3C8UA 1UDXA 2DGDA 1NVEA 3ZWAA 2IBSA 1A9YA 1I33A 1VIAA 5HDQA 4AULA 3KETA 3THRA 4C04A 4QTZA 1UXOA 4CLHA 2PV0A 3VGJA 3K9WA 3KOWA 2GBGA 2IBMA 4MQLA 3FDXA 2OBBA 1DAKA 4NPHA 4WXRA 4F85A 2DRIA 2GI4A 1TM2A 2OHXA 1R0CA 3NIGB 1JDZA 2CXPA 3OPYA 4G4SO 3VZPA 4MB2A 1YD7A 3T1VA 2HJ9A 4I4IA 3T52A 1EFRA 5C32A 3T3GA 2IIQA 3TOCA 2VTBB 1TPYA 3MJDA 4KWHA 1M83A 4YFYA 5ICCA 5JTUA 2P6RA 1A2BA 1VJTA 3DKKA 4EJSB 3ABSB 3LNTA 2WMYA 4RTSA 1QOPB 1KDVA 1S2LA 5KS2A 2FUNB 1G18A 1W93A 2OCIA 2QQFA 4IJUA 1W25A 4OKSA 1B3RA 3CZ4A 3Q10A 1KI7A 5HKLA 3MTDA 3IDZA 2MMGA 1QZTA 2O6LA 2EBFX 3N7UA 4QO7A 2Q21A 5G0UA 4YV2A 2P2GA 4JXZA 1LJLA 1T36B 1VLVA 1WMSA 1D2CA 2VSFA 1IPEA 4U3JB 5FI3A 3SJCA 4G5YA 1GAQA 2YV1A 1FC0A 1YC5A 2PU5A 4AP6A 2X9VA 2EERA 1JJ7A 1WXHA 1FDRA 2VK4A 3CR3C 3IHTA 4DLPA 4E5PA 4EH1A 4ZZ1A 1FOEB 3S27A 4IJ5A 5DBGA 1ZN2A 3UWSA 4HDRA 4JKYA 4HYQA 4OGFA 5J5AA 2X23A 1QRUA 5AVJA 3A36A 1A7AA 3GJ0A 1QZZA 3PWTA 2YICA 2EKZA 4I5IA 2Y68A 2XADA 5COQA 1ECGA 2PD3A 5FB3A 2NU8A 3D7MA 2ZIWB 3AUKA 5AOVA 5AP9A 3TLYA 2C3MA 4QQKA 1E6MA 1Z8FA 3EPRA 4LAFA 4M49A 4CT0A 1KTVA 1QCDA 1K2WA 1PU2A 1QXSA 4YPVA 3SIXA 2EWWA 3EWAA 1BGXT 3ZI0A 3WAKA 4YRAA 3F6RA 3KBBA 1DKQA 1KYZA 3DL2A 4PRKA 5C4IA 1QPZA 2QTZA 1GKIA 1AK1A 1B6SA 1ZJZA 1T9CA 5KOJA 1G291 1P44A 1XRLA 4I55A 4RPGA 3CIOA 4E5KA 1NBWB 1E2NA 5EJ5A 4E46A 4JSTA 1X1EA 3GFBA 4FYJA 4N0EA 4QGGA 2C0PA 4ICIA 5ELMA 4BCBA 1HNNA 5DTMA 4AJPA 1IDN1 1JWAB 3N2LA 3RF6A 1FP4A 2ZVJA 2LNDA 4UNIA 2Z58A 1IVSA 3ROQA 1QF6A 3IKTA 5HMMA 3PEUA 5IVPA 2XYRA 3TOSA 1VG8A 4MQBA 2YN2A 3URMA 4YAEA 1FP1D 2X2OA 3R0QA 1KFBB 1OI3A 2NUTB 2PKXA 4EUFA 2GBCA 1BKDR 4RVOA 4XM1A 5CYGA 1N2SA 4K3VA 3OM9A 1NY6A 1P7YA 2BFPA 4FHGA 3VZQA 3UJNA 3I5XA 3A10A 4I55F 4C0QC 4AZTA 3DE4X 2V4UA 2YC4C 2GT1A 2PQ2A 2CFSA 1GKYA 4U2KA 4XXHA 3T35A 3GA0A 3PEVA 5C3UA 3TNLA 2GM3A 2J41A 3LC1O 1QLJA 2IXEA 4ERNA 3NNNA 1CY2A 2VRBA 2XYHA 5GZ1A 1SCUB 3HU3A 5SZIA 3ZNOA 1SEVA 3WYFA 4DABA 1Z6TA 2PAFA 3DZ8A 1VXOA 1KMIY 4KE7A 1E3MA 5GOZA 2JVKA 3JQRA 3IP9A 4J1TC 4TXJA 1XALA 3I9JA 3K1YA 2E1RA 2GBFA 4E11A 1C9EA 3PIRA 3A25A 1ORDA 1EP3B 3OX3A 3HH8A 5BMVA 4EIWA 3KSDO 1T8WA 1RRCA 3CEHA 1L5SA 3RYHB 3WZMA 2IZZA 3EIXA 2FG7C 3I04M 4O4HA 3HXMA 5JFGA 1PIWA 1CS4C 3OIYA 2G80A 1PVDA 1FEZA 3JWGA 1Y8RB 1P9OA 5ALDA 4HEJA 4A2PA 3UATA 3A6LA 2VUIB 1TCBA 5JXHA 1DQRA 3LFUA 3L0OA 4N1AA 1MD9A 4GNRA 4IRUB 4QNRA 3JQEA 4F2PA 1UM8A 5BMVF 4PGGA 2Y2UA 4F38A 1XZPA 3O8QB 4OQEA 4QBGB 2J9ZB 5MF6A 1Y89A 4K28A 3DW3X 1FSFA 4X20B 1H1LB 2DTXA 2MSLA 3QU5A 1KKUA 1LDEA 1QYXA 2FDRA 2IPMA 2ETVA 1W35A 1Z39A 2TS1A 2YZNA 4N7RA 4TL7A 1NI5A 1FUUA 1MB0A 4CIXA 4QNMA 1SKYE 1EZ1A 4WASA 1T4CA 2GRJA 1CUVA 1VYVA 1XZEA 1ZVQA 2GN8A 1G2QA 2FFRA 3ZV5A 4NV3A 3QKTA 3H2BA 5TT1A 2CXRA 2VJQA 2R60A 1ZW6A 3AESA 4HVTA 4FFOA 4KBYA 3EE6A 1OX4B 2BZGA 8GPBA 3CH5A 3ONFA 1H2BA 1NJ2A 3TG2A 1WG8A 1RIFA 2C9BA 2GTPA 1M8KA 3GO4A 2UZAA 4NF2A 4V0MA 4ISBA 4OCZA 3K96A 3E5MA 3OZBA 5EWLB 4I66A 3VTAA 5JXJA 1S3IA 4AKTA 2QRMA 1QHHB 2EC5A 1O95A 1T9HA 2P2CA 1E2QA 3N9IA 1I2DA 2AR9A 4QFMA 1C8LA 1WR8A 1JR3A 3KJIA 4B47A 4WZAB 3L77A 3VU3A 1GQRA 4BE7B 2GPJA 1H0HA 4RE5A 4RY2A 4RJIA 3SC6A 2CNWA 5C2JB 5JO0A 2ZK7A 2O8DB 3O91A 3JAMA 2FNAA 4OIMA 3DAHA 1MJFA 4ZGWA 1ABBA 1ZO8A 1MJGM 1PYDA 3LVBA 4HTFA 4MV5A 3SQLA 1VI6A 2BGUA 1O95D 5CGQB 5KOYA 4LI3X 1UWCA 4HAXA 1ANKA 1JR3D 5ITWA 3OD5A 1FE8A 5JJIA 1C7ZA 2CNWD 4Q0MA 5HIAA 1K88A 5IN4A 1XZLA 3ADOA 5MFPA 1Y1SA 2KLHA 3LZ6A 2QLFA 4J2OA 4QBFA 3TTWA 3ISJA 4GLFA 4HXEB 3RC7A 2A9OA 1XCLA 3QUBA 1T2CA 3PZBA 4L0DA 1QMGA 1TTHA 4AFNA 4QOHA 2BDEA 1J2JA 3OY2A 3H8VA 4DMCA 2IUEA 5KO2A 5C9ZA 1E3IA 4D82A 1BS2A 2Q5QA 1GNSA 3LV8A 1IU9A 1I2CA 2E89A 1BGWA 1Z3CA 2J0VA 4MW4A 1HSOA 1WUHS 3T7AA 1SCBA 3OOYA 1Z75A 2NAFA 3C4VA 3GGOA 2UV8A 1XHFA 2O5VA 4MHOA 2R2GA 3UT6A 2I91A 2DT5A 2C3PA 4NBNA 5KTRA 4N5HX 1T3GA 4FGKA 1I2AA 3TD9A 3GXBA 3FVVA 5C80A 3OU7A 1JFRA 5KWJA 1V1RA 2HMSA 4HDNA 2B21A 2UZ1B 4FN4A 4O2AB 3SM3A 4DA0A 3T9FA 3WNBA 4GMKA 4L74A 3EJ6A 3FZGA 4LOAA 5EL0A 1HBJA 4RADA 4XDGA 4CFSA 2FZLA 2O4UX 5TRTA 3DOHA 2OENG 3OAAA 3NATA 3RSZA 2XVMA 3BMNB 1QJ4A 1GZ3A 3WGGA 1UH5A 5H4HA 4FLFA 1GILA 1V2GA 2NN3C 1E8MA 4WKPA 3ZWYA 5BUSA 4ZRDA 4QU0A 1AN0A 1CJCA 5JMOA 5DHPA 1PEKE 2W2TA 9ATCA 4CLOB 2PWZA 4I3FA 2QN9A 3GGSA 4PIVA 1M6EX 3RRBA 2O7RA 2VWHA 1Z2EA 1ZAKA 1ZW1A 2ZT5A 3OAAD 4HQRA 3RAGA 5B30A 2CYCA 2PE5A 2O5EA 1XN4A 2PS3A 2PRZA 5TT0A 4AS2A 3TRDA 5I48A 2X4IA 1XAIA 4Z4CA 3MT9A 1Z82A 4R1OA 1CUIA 1I80A 4NDNE 5AKLA 5TX7A 4HRXA 2NMVA 5AIBA 3QPVA 4FIDA 3WQBA 2ZATA 2REXB 1IXRC 4YRZA 4D5GA 1O8BA 5AOBA 1YL5A 5ADHA 2G28A 2IVFA 4EG4A 1TMYA 5BNZA 2AB0A 4DCCA 2ODWA 2NYAA 3KB6A 1ACLA 3B9BA 1MJNA 2I2WA 1FSSA 2IYAA 2LRHA 2BM8A 3GT7A 3JD4A 1DX6A 5DTQA 4K9NA 4ZEOA 4R5HA 2UZ0A 3PQ4A 4PAWA 5AK6A 1FQWA 1DJMA 1J4AA 1I0LA 3W8FA 4HG2A 1W8IA 1CUBA 1BQEA 1Z38A 2G0TA 2PGDA 1ZOSA 3QEKA 3QF4A 5BUZA 4UCWA 5KZMB 2UVDA 3T06B 5KTOA 3IURA 2PWYA 4R4JA 1XQVA 4CKWA 1DC8A 2YFQA 2BEWB 2YC2C 4B3MB 4BKOA 1XLTA 4NYMR 5AI8A 4IF6A 4M8NE 4E14A 1NXXA 5CLLA 3V33A 3IELA 3JARB 5DWVA 2R47A 1ORWA 4AL4A 1CUYA 2OZEA 2NXEA 1OT3A 1R12A 1RSZA 4YFVA 3H5LA 3GCGA 2ID8A 1V9CA 4YP0A 3SSAA 3WTBA 3OP1A 2Q6OA 1YRQA 3PYXA 4UHJA 1O95C 3FLBA 1PG5A 2VF4X 3PLRA 1GAJA 4QL3A 4ZGGA 1IIBA 2VJOA 2WIGA 4ANFA 4DSNA 4LF7B 1SXJB 3S44A 4WUVA 1PZXA 2BV3A 3KYCA 3Q0TA 4TLAA 4KNVA 1QZUA 1W76A 2XMPA 4ZWNA 5B4VA 2X3UA 2H4HA 2WK1A 3L0BA 4C14A 1X8KA 3THXA 5FHQA 1JXMA 3PL1A 2OCAA 1PS9A 1RTKA 1HZJA 1UP4A 3GA7A 2G88A 1YR8A 4K9RA 4WFJA 5FOWA 3IEPA 3QU4A 3ZCRA 2Z6AA 3K5WA 2EAUA 1KMHB 3L1UA 1PGNA 4B3HA 1UKYA 3QBVA 2MSNA 3PFBA 1X7WA 3QVJA 3ZU4A 1H5NA 1IN7A 2Z2YA 3A58B 1GARA 1DTSA 1MXFA 3NC0C 1EWVA 1DKMA 2WU3A 4U2CA 5F78A 4DJFC 5TV2A 1VMAA 2Q50A 1RJEA 4E08A 4LS3A 5H3CA 2ZYHA 4N82A 2QW1A 1T8PA 3C5CA 1TIPA 2GHTA 2NXJA 1PKEA 3CRNA 4HMQA 4JDPA 1FDIA 5IZCA 5JLJA 3DH0A 3NBZC 4I46A 2OHIA 4DJDC 4A8JB 4NEHB 2AF4C 2IELA 4PW0A 3KPUA 2C3YA 4H7KA 3H5IA 3WL6A 2GZMA 3FYHA 1GNQA 4D9MA 3FWZA 1T0PA 3RTBA 3TLGB 4BO0A 4LJ5A 4O5OA 3ZH2A 2O3TA 3K16A 5C8XA 3GFVA 4RGBA 5K4GA 2AG6A 1HEIA 2ATEA 5BOSA 2JGAA 5KJFA 1VKOA 1EUCA 4INJA 4A6PA 2XYQA 4BX3A 1FVXA 3AHCA 1L8LA 1UFVA 1X80B 2Z08A 3NEAA 3PGVA 4BVHA 2FPPA 2J7PA 4FJ1A 2ZVQX 2RI0A 1JZTA 4E30A 4YCDA 3TTXA 1VIMA 4C0SA 2AI1A 2QEQA 2Z8XA 1JMVA 1ENYA 2FN7A 2OC4A 1PR0A 5IMSA 1Y6ZA 1HDXA 4BKMA 2VIIA 5AI9A 1YGPA 3H2SA 3NB0A 4EGAA 4L4RA 4RHTA 1UJBA 2V6FA 3FNHA 2J7PD 3KZMA 4KKXB 1VCIA 1I9GA 2IRWA 1R00A 3NXKA 4QVGA 3THWB 3DFZA 3BWBA 3O2JA 2MSDB 2NNLD 2J0UA 5ADUS 3A0RB 2J9XB 2VDRB 2W2OA 3BF7A 4N18A 4BX0A 1I32A 3KPVA 4BQNA 3IBCA 4EL0A 4GR4A 4NARA 3TX2A 2FQYA 1WB5A 4YGXB 4PNEA 4XIYA 1EX6A 4AMGA 4KDRA 1YU9A 3SDSA 5CDSA 4BO3A 1VMKA 1QHYA 1R4MB 2ZIGA 1W0CA 3CX6A 1BKSB 2ZBDA 9LDBA 2GBLA 1TAHA 2FQXA 4ND7A 4C7JA 2D06A 1A27A 1G8AA 3FI9A 2HU7A 3PDHA 3W2EA 1AVTA 1ECBA 3AH8A 4HDSA 3SHWA 3BFKA 4J29A 1QRRA 2OM6A 5D7BA 2JW5A 4QLAA 2PUBA