5B7NA

Crystal structure of periplasmic 5-methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
SAPILIQGAMDVEVETLVAALKDKQELTVGSWTYWQGTLSGYPVVVSRTEVGLANAAAATTLAMERFQPRLVINQGTAGGHDPALHRGDIVIGTKSFNMGAYRSDLTPAEQGVDPSKWHNFEVTMRLRDNGKLVEHSSFAGDPELVGRALGMADRYRHGRVVPGIIGTADEWNRQVARINWLHQTYQTAAEEMETSSAALVAEAYKVPFVGIRVLSNTDLHGEEFDPQTAIHCQQFVIDYAKALINGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH nucleosidase
publication title Structural and Functional Analyses of Periplasmic 5'-Methylthioadenosine/S-Adenosylhomocysteine Nucleosidase from Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Hydrolase
total genus 87
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b7nA00
4BMYA 4G8JA 4X24A 1VHWA 2Q7OE 4OGLA 1K3FA 1U1DA 1Y6RA 1M73E 2BSXA 3E0QA 1PR4A 1Z36A 3K8QA 3PHCA 1YQQA 1Y1RA 3OZDA 5F73A 4P54A 3E9RA 4LNAA 4QATA 4OF4A 1Z39A 2XRFA 1Z38A 4LKRA 3TL6A 4PNPA 4OJTA 4TS9A 4TYMA 4F1WA 5F7XA 4MARA 1RSZA 3ENZA 1A9PA 4DANA 5CCEA 3UAXA 4BN0A 4TTJA 3DPSA 4D8YA 1Y6QA 1SD2A 1TGVA 2RJ3A 2OXFA 3K8OE 3GB9A 2HN9A 1VMKA 3FWPA 1A9RA 3P0EA 4OY3A 1SQ6A 4TTIA 1YBFA 1RXSA 5CCDA 4QAQA 4F3KA 1U1CA 4TXHA 4PR3A 4TXLA 5I3CA 1K9SA 3OCCA 1Z33A 4YJKA 2I4TA 1T8YA 1ZOSA 2A0WA 1CB0A 3KVYA 4DA7A 5EUBA 5F77A 3NM5A 4DA8A 1YR3A 4TXJA 4G89A 4OEHA 5B7PA 1SD1A 1Y1TA 1V3QE 1Z35A 1JYSA 1U1GA 4WKPA 4DABA 1ULAA 4FFSA 1PR0A 1XE3A 4KN5A 4YO8A 5F78A 1ODIA 2QTTA 2QDKA 1JE1A 4I2VA 4R2XA 5CYFA 1V48A 1I80A 3GGSA 1OTXA 1A9OA 4BMZA 3LA8A 4MCHA 2OC9A 4L5YA 2ISCA 1U1EA 2ON6A 1RXCA 1ZL2A 1ODJA 4DAEA 3U40A 4U2KA 4RJ2A 3NBQA 1V45E 4DA6A 3T94A 1YRYE 1Z5OA 3KU4A 4D8XA 5C80A 1C3XA 1PK7A 4DARA 3F8WA 3C74A 1OVGA 4F2WA 1V2HE 2HWUA 5DK6A 1A9TA 4GLJA 1JDTA 3FAZA 1PR2A 5B7NA 3DDOA 3KVRA 2AI1A 1RCTE 4EARA 1VHJA 1CG6A 1B8NA 3OZBA 1RFGE 3SCZA 1V41E 1PBNA 2P4SA 3ODGA 3D1VA 1FXUA 3MMSA 3OZEA 4F3CA 4GMHA 1OV6A 3NM4A 5EPUA 4YMLA 3OPVA 4R2WA 4WKBA 4WKOA 3OOEA 2HRDA 2QPLA 4QFBA 4L5CA 5FAKA 3FOWA 1RXYA 1RXUA 4TXMA 5IFKA 3OOHA 1JPVA 1RYZA 3P0FA 1VFNA 1OTYA 3EUFA 1A9SA 3PHBE 1PR5A 3DF9A 4H1TA 3FNQA 1N3IA 1V4NA 5KB3A 4ECEA 3EEIA 3LGSA 3INYA 3BJEA 2B94A 3PNSA 4WKNA 1LV8A 1Z5PA 3LBAA 4R31A 3ONVA 1PK9A 3O4VA 1PW7A 2OC4A 3O6VA 5F7JA 3FB1A 5CXQA 3BL6A 2I8AA 1LVUA 3IOMA 5JPCA 4JWTA 1A69A 4QEZA 4QASA 5B7QA 5B7GA 5EFOA 1NC1A 4L5AA 4K6OA 4YNBA 1JDVA 1RR6A 5ETJA 4F2PA 4GKAA 2HSWA 3UT6A 3NM6B 1JDSA 4BMXA 1OU4A 1LX7A 5IU6A 1TD1A 4M3NA 2OECA 2AI2A 4MCIA 4UC0A 3E9ZA 1RT9A 3DJFA 2A0YA 4E1VA 2GUWA 1T0UA 1YQUA 3EMVA 1A9QA 1TCUA 4DA0A 3OZCA 3BSFA 1Y1QA 3UAWA 3UAZA 1ECPA 3EUEA 1NW4A 4D98A 1T8WA 3QPBA 1JE0A 1PKEA 1PR1A 1ODLA 1Y1SA 4QARA 1Z34A 1JP7A 4NS1A 1NC3A 1Z5NA 5F7ZA 2AI3A 4D9HA 5CXSA 4D8VA 2QTGA 1PF7E 4TTAA 4EB8A 1K27A 3MB8A 4JP5A 1T8SA 2IQ5A 2A0XA 3FUCA 3OF3A 2H8GA 1B8OA 3KUKA 5K1ZA 2AC7A 1Q1GA 3UAYA 2QSUA 1ODKA 1TGYA 1U1FA 3IEXA 4LNHA 1Z37A 1SJ9A 4IP0A 3PNPA 3UAVA 1T8RA 3KVVA 1PR6A 4LZWA 4DAOA 4TS3A 4M7WA 5F7OA 4M1EA 4GLFA 3DP9A 1WTAA 2PGAA 1TCVA 4L0MA 5CYGA 4LDNA 3BGSA 1QE5A 5F76A 4TXNA 4NY1A 1PWYE 4NSNA 4WKCA 1G2OA 4OGKA 1ULBA 1JDZA 4JOSA 2A8YA 4L6IA 4G41A 1OUMA 3KHSA 1JDUA
chains in the Genus database with same CATH superfamily
3DCYA 2GRAA 2FMTA 3P9XA 1LJLA 2JZNA 2NZVG 1PEYA 1F2UA 1Z0JA 5FL7A 4HI0E 4KHZA 4MYTA 3JATB 1F6WA 4EF6A 4TKVB 5KTNA 2HJ9A 1G8KA 1Z4MA 2O3UA 2OUIA 2WJVA 2H29A 1M73E 5KQLA 4TZ0A 4R2KA 4EMBA 1WHSA 5ALWA 3E0QA 2YWHA 2O0JA 1NN0A 4J0KA 1SUPA 3GF4A 2QM3A 1RYHA 4RMJA 1PDOA 3F5DA 5FV4A 2DJIA 2WTNA 3RK1A 3WYGA 2GNPA 4RO0A 3I2JA 5DMHA 5IDQA 1QKIA 3HCDA 5T8KC 4CMCA 3H2HA 2PEZA 2Z6UA 1T9ZA 4MH0R 3VGJA 1JQ3A 3KEFA 1R74A 2OCYC 1H9BA 4RVFA 5JWOA 2W2QA 1QIKA 1EZ4A 1BHQ1 3NRCA 4YQZA 1H0HA 4AL4A 2YVAA 3LCJA 5K6RA 4N48A 1U94A 1A9XB 1G9XA 2WT8A 2L19A 5SZJA 4R83A 2WF8A 3DBIA 1WHTB 4AZTA 2P2SA 1MW8X 3ENZA 2WDZA 3M49A 4JLSA 1E1CA 3TLEA 1UC9A 2IS6A 2ZCUA 5CDGA 3D59A 2CD7A 5LBUA 1VDMA 1IY9A 1NX6A 1ENYA 3HXTA 3C4VA 3JAKA 4IBOA 2ZAGA 4F6CA 3H83A 4IAOA 2NYRA 4P3XA 4XUDA 5REQA 2XTJA 5KC8A 3HJGA 1FVFA 4X8LA 4DQ0A 1M5UA 3HYRA 1YMVA 4K9OA 4X1YA 2W58A 4X92A 4FB5A 5I7WA 5KVSA 3OCXA 4QPCA 2GHRA 3QXHA 5DTEA 5LCXA 4G5RA 4LDJA 3U37A 2BR3A 2H9AA 4DMGA 1VKOA 2DBQA 2P8JA 1R0KA 2W00A 3AILA 4G37A 3V00A 5B4VA 2XCRB 9LDBA 4C0LA 1LUAA 2FEAA 3I1IA 1PNQA 2DFKB 5BQPA 3S8MA 4V02A 3V55A 5JROA 3QX3A 1U99A 2FW7A 2O2YA 3Q87B 3V4OA 2JKYA 4C9BA 1PV1A 1HDCA 1R7RA 3MJCA 4G85A 1V43A 3RAGA 4KQKA 1YAJA 3FLEA 4ZD6A 4IDGA 1R6AA 2B1JA 3CO0S 1U8YA 3FY4A 5L3ZA 1F6DA 3AHDA 2L42A 1E3IA 1NIJA 1VL6A 3Q1KA 5EZSA 4KYIB 1CY1A 1T25A 3U6KA 5AM4A 2R5NA 2E87A 5HZKA 3UK0A 1XHFA 2WIKA 4LV6A 2VSXA 4YC7A 3P2YA 3KUDA 1SA0A 5EMMA 4TSFD 5FF9A 4JEHA 1DRWA 2Q4DA 3TVDA 2DTEA 2I6XA 1RU3A 4HAYA 4IJKA 4OKIA 2Q2WA 5EZYF 1B42A 1W4CA 3C6MA 2HM7A 1GA6A 4WLFA 3ZCSA 4JLOA 4KV7A 2IP2A 2WU1A 2BF4A 2IBMA 3DOJA 4JJFA 2H1OA 1OXSC 2PYZA 5J40A 4AZ0B 1MW9X 2D0IA 2H85A 2YZNA 3B6EA 2UYOA 3A26A 3BWCA 5DYNA 3NT2A 3RYFA 3GJ5A 1E99A 4PSCA 2H9IA 1U1GA 4L16A 5LMUB 2FUCA 3LSTA 1JJIA 4S1VA 2I7TA 2P2GA 2B1RA 2Q5JA 3GR6A 4NDZA 3FI9A 3B6MA 4URVR 1D7OA 5DEIA 5KOJB 1W30A 2TYSB 1NVXQ 4EYSA 3KDAA 2I3GA 1FP4A 1VCIA 4RIHA 4UHKA 3UTCA 4V0QA 3WMXA 1Y6JA 2ZJFA 4HDMA 3RHFA 5J4KA 4N9WA 5FOQA 4LGYA 2EL9A 3OJOA 3MPOA 1F2DA 4GM1A 1GPNA 2QTCA 1BX1A 4C6HA 1QHNA 3PEVA 1DEKA 4YCSA 3UMFA 3ZBPA 4CL8A 1GZHB 1Z6XA 2VYVA 4F0JA 2OV4A 4H4EA 4MUKA 5ANRB 4ZK6A 3EZ2A 3QV1A 1YGPA 4HWRA 1JSZA 4OHPA 4QDKA 3RF6A 3S3TA 1KFBB 1K08A 2W2PA 4RVCA 1T8UA 3O83A 1LQTA 4WK4B 1CQIB 4F72A 3L84A 2JGJA 2ON6A 2WFAA 1X1EA 5IXYA 1KVSA 3OA0A 4XUCA 3GVPA 3F9RA 4H7KA 3A7DA 4AICA 5LP6A 1IZ0A 4RJ2A 3VR3D 2IYXA 2O2DA 4DR3B 1V45E 5FOTA 3F67A 3VPHA 3KU4A 4I7EA 1G6KA 1PJ4A 1Y1KE 3GP3A 2PVPA 4NDAA 4WSOA 2NACA 2EG5A 4DSUA 3DQQA 1X80A 2RHGB 1M5RA 1T9HA 2HDWA 1WV0A 2Z08A 4WLOA 4UTXA 5JH7A 3D3NA 1O0CA 2XUKA 4UBMA 2VDWB 1EB8A 4Z4GA 2XQGA 4KSCA 1D4OA 3WDMA 3QIVA 2NT4A 3TDMA 5T4BA 4CRWB 1BQ4A 2GAFA 1GCIA 1OGIA 2EKPA 2Q41A 2X2OA 2PRSA 3HP7A 3KHUA 2VS1A 1YMUA 4TMKA 2AOXA 4RBNA 3WADA 4PCVA 5HR5A 3UGQA 4BVGA 3IXQA 3TJRA 4F2WA 4GDFA 1BJRE 4TL6A 3ND7A 3MJVA 1AGXA 1EWKA 4C1BA 2XKKA 2CVZA 4YXWD 3L8EA 1JDTA 5LA6A 1KE2A 3RQIA 3G6KA 2XR1A 3I9V1 3T3EA 1ONOA 1PR2A 2J0EA 3G1UA 4G9BA 3QU9A 4K9KA 4XRRA 3UATA 4IXNA 1YASA 4C1NA 1XR3A 5KOIA 3C4QA 3DDOA 4K7JA 4MKRA 2AJTA 1CPYA 3M0EA 4KMOA 2GDJA 4DSTA 3B9RA 4LBYA 3TM4A 1GSHA 4H16A 3W1EA 4CMBA 1QB7A 3NYIA 3ICWA 2CB9A 3CH6A 4PIMA 1UJ5A 3RE1A 3RYHA 5IKMA 2C3OA 3NAGA 3R7LA 1TKCA 4DUPA 1X0VA 3T3IA 2R6R1 2ZRPA 3P9YA 2BCJQ 4OAOA 3AZPA 4FUQA 1YDGA 1NTOA 3IUMA 4WN9B 3QW4B 1JHPA 1L9XA 4MVWA 3AETA 5PNTA 1X7YB 2IHTA 2A84A 3UMVA 4LGMA 1G8SA 5JI2E 2FMFA 2ZE6A 3MMSA 2ZWIA 4D4IA 2Y1DA 3UYLA 2HCJB 1NVKA 3HHEA 1J49A 4E12A 1W2HA 3PNLA 1WCYA 3CZ5A 4Q1DA 2PJRA 3K2IA 2HZBA 3E7PA 3VI4B 3LY8A 3WRXC 4ZYWA 2PHZA 2PUJA 5A6VA 3E48A 1H9CA 2ZT7A 3ZDFA 1TKRA 1H2HA 1UZMA 1NAIA 4D8UA 5BSEA 3V1YA 2ZRLA 3FE2A 4X65B 4HLUC 1U11A 3E1SA 4R2WA 1KI7A 4WKBA 4P84A 1CEXA 3WGVA 1DJQA 4FNGA 2GHTA 1DX6A 2J4DA 2HRDA 4TTPA 4U8HA 3SYKA 5MHTA 1VA4A 4XX0A 2X8LA 4Y9SA 1GUYA 1LK7A 4DJEC 3EPLA 4P83A 3HCOA 1UEIA 3TSYA 1XWFA 2PBRA 1B14A 1CF2O 1OFUA 2D1SA 2HFKA 2CCKA 2FMUA 2VPYA 4F7WA 4YRSA 3R3SA 2XUHA 1IJKA 2VF5X 2YHIB 4XASA 4ML3A 4A2PA 4BAZA 1YFLA 2NXWA 4ZZ3A 3GQVA 2YWCA 1B1CA 4N01A 1L4YA 2XMQA 1K7XB 2NSJA 2RGUA 4A3SA 1F4LA 1FS5A 2O3TA 3W06A 3QF4B 1FJXA 1QG0A 1Z7WA 5KSPA 1ZIOA 3H1GA 3IL2A 2KLBA 2ACEA 1JQBA 1AGRA 3P0FA 2FRXA 4MEJA 4PHFA 4B32A 3JQCA 1VFNA 3GW8A 4KW7A 1A9SA 1M8JA 3UBMA 4CLHA 3ZD8A 1E3TA 1G5FA 4ZEOA 4ZZ0A 2P6RA 4YYEA 4FDAA 4PHHA 1UBKS 5FIUA 3VJMA 3UC9A 1R50A 1NRJB 5E8JA 5ESXA 3S2UA 2YNMC 3O5AA 4HBZA 4TZTA 4EMSA 4ZI7A 4OH7A 4ARVA 1MJNA 5JSYA 3HYSA 1FIUA 5KZMB 2W6JD 2O1WA 7YASA 1HURA 1QHHB 3INYA 2FPPB 3LQ2A 1E2HA 3OI7A 5E4TA 3FYUA 4B3GA 1G8FA 2YV3A 3H11A 4Q18A 1T43A 3A3KA 3R3UA 1QTQA 4YT5A 5TDHA 1IEVA 3NWEA 5P8WA 1NHWA 3AEUA 3B2EA 4MIEA 3AKDA 1REQA 3EFOB 3L1JA 1IUKA 1U7DA 2EWMA 4HYYA 1KFKB 3U7RA 1JPJA 4YP7A 1NQXA 1G1AA 1FS4A 3PHIA 3PDWA 4NBWA 3TD6A 2YCLA 2ZDHA 1J25A 4XDHA 3UYKA 1NF9A 1E9VA 1V6AA 2OO5C 3DZFA 4ND3A 2FSSA 4E7PA 4UNSA 3C6BA 4CM3A 4QJ3A 3OE7D 1SUAA 1M2OA 1SIBE 2CMKA 4JVLA 3TW8B 2XA2A 3AOEC 3BL6A 2I6QA 4BNVA 4YUZA 1SY7A 3OHPA 4D0GA 5HWSA 5ALTA 1VM6A 1E89A 1M6VB 2HIGA 3KYBA 1UIMA 4O1HA 4A8HA 5CH8A 4HB2A 2FTKE 1YK0A 2RHJA 4TROA 1Q1BA 1HMYA 3FHLA 3H2YA 5H3HA 3TX6A 4NPCA 4CM7A 3NYWA 4Q3BA 1N36B 3GIWA 4EECA 1A69A 2HK9A 1BROA 4OK6A 4AJOA 2DBVO 2H4JA 3K9CA 1C4OA 3P0JA 3Q11A 2HWXA 1AA6A 1NC1A 1HT1E 4GOJA 2BFMA 1G20B 1DKRA 1GV0A 1V39A 4IDEA 2XITA 2YHAA 3EW9A 4S1TA 1AN9A 5JAUA 2J3LA 2JGNA 4F2PA 2OUKA 5EP3A 1QVWA 4HQ0A 4BX9A 1E7YA 2J3MA 1UMDA 3MQ2A 5C0OE 5TR9A 3BIOA 2J7KA 1VJDA 4M60A 2NGRA 2O3QA 1PYOA 4ETMA 2O48X 4DMRA 4LPKA 2Y4NA 3CRRA 3H7IA 3NPMA 4URXR 3UN1A 3WYDA 3JQBA 2E6KA 1DEAA 3TAUA 4C7JA 4Q16A 2OSVA 5J3JA 2NVWA 3HVUA 4JI8B 4KUGA 2B61A 4OLAA 5AXBA 1KVRA 1GRNA 1UPFA 1VJCA 1EFDN 3VAZA 1DQPA 1JW9B 4HATA 1G18A 4LVCA 5ES3A 1Q0LA 2NNLD 3KJIA 1LQ2A 1T9CA 1AKYA 1UH5A 2MSDB 2ZJBA 3KAJA 5CP8A 1Z75A 3NVAA 4ND4A 4PGAA 5C35A 1J5EB 3LRTA 1VB3A 1XQ9A 1YV9A 3S2ZA 2GZ3A 1TTQB 3WL8A 3B1JA 2XHEA 4YJHB 3BVPA 3A2KA 4IRXA 2I4MA 2XLBA 3DXXA 4Z5XA 3DMTA 2CYCA 2KE5A 2GS9A 3HADA 3UK6A 2B78A 5MFPA 4KRXA 1NW4A 5AW9A 4CG0A 2YR0A 2E4UA 1KQ3A 1NA5A 2EQ5A 3WXMA 1T8WA 1LBIA 5EUMA 4PXSA 3K1JA 2ZRBA 3U6BA 1E69A 1ZIYA 5I8PA 5CX1A 4IY1A 5I7EA 4EW6A 1EP2B 3RV4A 4EPVA 4B7AA 4DR4B 4CWAA 3KOZA 1U2PA 4PLZA 1SO8A 4NJEA 3A9SA 3Q9UA 4NABA 2WF7A 1MO4A 2IU0A 4CG1A 1P1BA 3ECAA 4CL0A 4K9QA 2FLWA 4RDCA 4WNYA 4RKFA 3TNJA 2AI3A 1IQRA 1TUBB 2CBGA 3DKIA 3LQFA 2F4VB 1EFPB 5JCXA 3MGCA 4L8LA 4HDQB 1JTFA 3WIOA 1CZOA 3P9RA 3LP5A 5CMLA 5I8ZA 2XGJA 8GPBA 1UBHS 4YMIA 1ZJWA 3U0BA 4QG3A 2IQ5A 3CZPA 4M98A 1POXA 1EVIA 3HVIA 4KZPA 1UWLA 4LMBA 3AP3A 3BCRA 3OJWA 2A0XA 4UCQA 3BF7A 3WISA 2BFBB 1E4YA 4DA9A 4DWVA 1EAYA 3E1GA 4NIMA 4AXXA 5TIIA 2W2XA 1Q16A 3NHLA 2WPDA 1CS4C 1PZGA 4D3YA 1BXGA 3GDWA 1VI2A 3T9FA 3QFHA 5BYKA 2JCYA 2XT6A 3DZKA 1M8FA 3VKUA 4F60A 1EJ0A 2CFCA 1F2TB 5I4KA 4R0MA 1TJNA 1ZM4A 3WAJA 3JVIA 1RM3A 4DILA 2BR5A 2CB0A 4FOTA 1ADCA 3K2QA 3KEMA 3MOSA 3ROKA 2AT1A 4KE8A 5H3CA 2C83A 1H6AA 1OKKD 4X41A 1Z0UA 1WTAA 5BSRA 2Z6AA 4XUEA 3G2MA 1BS2A 4IEIA 1RQXA 4M8IA 4TRJA 3LXXA 1J5XA 1N3YA 3VNUA 3LJKA 2BFDA 1PWZA 2I0FA 1QZ3A 2Z8XA 4R9SA 4H1UA 2F90A 1JFTA 3L6EA 4WBXC 1UKEA 2EJVA 3PI6A 3ZNNA 4A6EA 4FM9A 3QVVA 3RHTA 2JW5A 4LXXA 3VDXA 2UZ1B 2IUUA 3QLEA 1KH2A 1QTNA 3LL4A 4KYVA 3SXUA 2Z8ZA 4IJQA 3DHYA 2Y2VA 5IHPA 1SCQA 1ANKA 4JY7A 4BFYA 1O8BA 1WVGA 2Z58A 2RGWA 2VKTA 3A1SA 3DAPA 3A14A 1G2IA 3KZKA 1A8IA 1W36D 2A8YA 2HBYA 1EZ1A 1WNTA 4UXIA 3MJFA 1PLJA 2QB5A 4OHUA 1II8A 1KI6A 2GEJA 4IMPA 2X9LA 2HKIA 3HA7A 1XZHA 5INTA 4F4HA 1TDJA 5I9NA 2W2MA 1O77A 1U1DA 2QN9A 3HWSA 5ALHA 1SQGA 4MLPA 4MWZA 4D96A 1HEUA 5BW6B 2Q3DA 2E4AA 4HBGA 1L7DA 1U2DA 4CLOA 3DXZA 1K6MA 3MT9A 3NDIA 4YP5A 3VU8A 4TWRA 1M33A 2NU8B 5GJCA 4MQ6A 2CT8A 1ZHHA 2FFJA 2IU4A 3P4YA 5JD4A 2FX5A 5KMGA 3QVUA 1J00A 3BXXA 1A8QA 1THGA 3T0IA 2QTHA 1PWHA 1G3UA 3QELB 2IHJA 3N2GB 5CNJA 2F1OA 5HCIA 3WBJA 4N5IX 3GI1A 1TQ8A 2R00A 3EZ9A 1NL3A 4ER5A 3DEJA 5BWLA 4O02B 1P4GA 3A2MA 3K0CC 1M8KA 1OJLA 2GLUA 3IPAA 3K0AA 2R66A 3LZDA 4AJ4A 1GKLA 2GPWA 4IH9A 1C7JA 4TN5A 5CM8B 2BBWA 3QVWA 4OLJA 2ZIXB 1CP2A 2QR2A 3HXLA 3FXAA 4WI1A 3RIXA 3RS9A 4QLAA 4D9GA 3TQQA 2O0KA 4XCQA 5KVAA 2BYTA 1OBVA 2WQ7A 3H7AA 2CMFA 2Q0SA 1ENZA 3U48A 5KEIA 2HGSA 2R1VB 4EFKA 4UQLA 1XSEA 3ABIA 1HYQA 1RSZA 3KZMA 4RCYA 4R3NA 3FKSA 4RQUA 4UHHA 3PUXA 5EZYB 5UKDA 2G1JA 5DJ5A 3ZU3A 1GU7A 4LYYA 1L5HA 2C7RA 1H0KA 4LF4B 1G21E 4I99A 2DSTA 3M5DA 5K4AA 4CDRA 2GNAA 3A4NA 1JRLA 5E0KB 1PL8A 3RB8A 9GPBA 2PUWA 1IY8A 3NV9A 4NH4A 1Z0DA 4OAPA 1NQWA 4FYKA 4M1SA 1F8UA 3QITA 3ZE0B 4F5EA 1TMOA 1UKYA 5C51B 4KB5A 3KFVA 3U1VA 5CTAA 3W77A 3A11A 3CKLA 1NMXA 5EEHA 3UIEA 4CKCA 1P29A 3GRRA 2C9DA 2Q5HA 4QBFA 5EHQA 2FZ4A 1E32A 3MXOA 2VAVA 4P36A 3SX4A 2X2PA 3BX1A 2F3PA 1ZJ5A 4HHEA 3PWKA 3LECA 4YEDA 1CY2A 3D8NA 1IN4A 4CKBA 1Y8AA 4DSOA 4MW4A 4OLHA 5E9WA 1E63A 2AHOA 5KYVA 3G68A 1ZESA 4WNAA 4J1QA 4QGAA 1VPWA 1KO8A 3MVEA 4EA8A 2KQUA 1XZBA 5HMLA 2C9ZA 3MUEA 2XUPA 2X42A 1ZK4A 4V0RA 4Y6GB 3CN7A 1E8MA 2BE9A 4WK2B 5I3CA 4G5YA 1K9SA 3IEIA 3D0RA 5DM4A 2GAJA 4CUJA 1KRXA 1UC4B 3U3OA 1PUJA 2AEEA 1Z6ZA 1L4KA 4RK5A 2RH5A 4NRDA 2I76A 3I9MA 1W36B 5CGZA 3REGA 3RSFA 4UKDA 3MLBA 3RUIA 2VXYA 1VPVA 1YUNA 2AMVA 4I81A 4NOJA 3VR6H 4F46A 5BSGA 4K46A 3L7JA 2Y9MB 5AKZA 4CCWA 2W6CX 3DAYA 3NM5A 3P9NA 1YR3A 3LKDA 4ND8B 4AC9A 5IVPA 3X0DA 4WZ6A 2ATCA 1UP4A 2GFQA 3GVXA 1DKOA 3QPCA 4L8FA 1LPOA 1ZCBA 4HQFA 4OEHA 3NAMA 1EESA 1N2JA 3HJHA 3HYTA 1U4OA 3KQTA 1P18A 5T3UA 4CI9A 4PC1A 3SF8A 2CVHA 1ZCJA 2W71A 2IGBA 3FDJA 2J3QA 3VDNB 4A26A 4WJKB 1H69A 3I6MA 2IYFA 3ZHSA 4NZOA 4IIGA 1CB7A 1T2CA 2BMWA 1A0OA 2FW9A 1GPAA 2ID8A 3H0CA 3KEOA 3MHPA 4X90A 3U3XA 4CIDA 3WFZA 5JC8A 2W7TA 3S5UA 3D1JA 3G2HA 4I2VA 3IAHA 5I7VA 1HORA 1QVRA 3UV7A 3QF7A 3UPUA 3RRFA 1DIAA 3EG5A 4N65A 2GX6A 3UCFA 4B85A 1RTTA 2PTGA 2OBNA 1IZ7A 5K3OA 4BMZA 2ZB2A 1E9SA 2AUMA 5KS2A 2OC9A 3I6QA 5GM2A 4EJ0A 3BFKA 3TJMA 4K6FA 3WGMA 3L46A 3C0KA 3MJ4A 1BQ3A 4CU2A 4E7OA 1F4PA 2NO0A 3SKYA 1ZL2A 4AY2A 1E1DA 4IGAA 5IMSA 4QUBA 5EE3A 1K7SN 3ECCA 4BIMA 3KHTA 2F1IA 3UUFA 3BORA 4YAIA 2FAXA 3E5MA 3WDKA 1KDZA 3T94A 1CR4A 2BKUA 1AHNA 1YACA 2TMGA 4WOJA 3S2GA 4MPJA 3WL4A 1EYZA 4G23A 5DX0A 3BTSA 4GZLA 1Z8HA 2J1LA 3GRUA 4GKVA 3TBHA 4DARA 3E15A 4BO6A 3FCUB 1FYXA 3VI3B 1JG1A 1Y8RA 2VQEB 4LJKA 2C9OA 4FKMA 2HJWA 5IRCD 4DGSA 4JGIA 2Y0PA 2O20A 2O7QA 3P71T 3BUSA 3FZGA 3V8RA 3V7NA 4JCCA 4O1MA 3WWDA 3I05A 1GN9A 4XWAA 5GP1A 4W6ZA 1RS0A 2EW1A 2P6PA 3N58A 1M0EA 3JZIA 2V03A 2AWOA 3KYDB 2Q7XA 4YX9A 1ODCA 1T3HA 2JBWA 3E35A 1R37A 1U80A 2Y0CA 4IUBS 2C04A 4QTZA 4U7JA 1MG5A 5BO5A 3WYAA 4M0MA 2OCXA 3K5HA 4GH5A 3T5CA 1Y89A 3CMCO 3JRNA 4RABA 4DKJA 4C0JA 2OWDA 3FNFA 5JEEA 2D6FA 3EZYA 2Z0MA 2WYWA 2IEYA 4KWHA 1YVUA 3ISTA 1UWKA 2JASA 5BSWA 1YUMA 2QBYB 1P0PA 2ZQYA 2ET6A 4DMFA 5KDOA 4MVJI 4HPJB 3JYPA 3WLEA 1OIWA 3AGQA 3WRVA 4HFMA 1MO5A 1U2QA 1VHJA 3JQPA 1X42A 2ZT8A 1O95C 1X7DA 1LZLA 2Z4RA 4RL6A 5KPDA 3U7GA 4M1KA 2N0SA 4P7FA 1FU4A 4RD4A 3SLKA 1KFJB 4YRAA 3ZKAA 4Z1OA 4E11A 5KYYA 1XX6A 1VLMA 4RLHA 3SCZA 5JAZA 4HZGA 4RVNA 1U7TA 2ODTX 2VAXA 4MAAA 1U7HA 3THXA 1OBFO 4K6CA 1K06A 1U0JA 3U4AA 2NM0A 1NJFA 5H9WA 4QHTA 4YDSA 1NQAO 3PL1A 4KXXA 5CUQA 4Z7NB 2WLSA 3OIWA 4FTWA 4K6GA 3WHLA 3RIGA 5C1OA 3BSYA 3HDVA 1ZH8A 4BVFA 1FDSA 3AU9A 4HB0A 3U9LA 4AUEA 1OV6A 1WKBA 2WHQA 1ZNZA 2H00A 1TM7E 2ZR0A 3A06A 5A4MS 2QN6A 4WDRA 4P4GA 4AW9A 3KT6A 1NQVA 1D2CA 5JBNA 1I6WA 4LA4A 4QUGA 4RTQA 5AVTA 3NHPA 4WCFC 1XRJA 4FI3F 4R9UC 5D86A 4BWFB 2JCSA 1SQSA 4HNTA 3IO5A 1C2YA 1VE3A 2GASA 4G67A 5DHAA 4C4ZA 1R16A 1I32A 1OB2A 5ARDA 3VC1A 4IDHA 3KTOA 3GJ8A 3L6RA 1NPYA 4IHQA 4EI9A 1JU3A 2R6ZA 2VF2A 4TLAA 3LKVA 3TR5A 5MN6A 4L02A 1IEXA 2XUGA 4G0MA 4M7RA 2NSYA 2IU3A 2AX3A 4CQJA 1DIRA 1PQPA 1EINA 1QM5A 4NBSA 3VZBA 3OZWA 3P9PA 4XIFA 5D3KA 5WRFA 4B3MB 3E0XA 2K4MA 3A2LA 4R2MA 4YLYA 3G0HA 2QVYX 3BMXA 1G8GA 4QEDA 3R7AA 4DF3A 3FWNA 3PGJA 1FFGA 4NAVA 5TY0A 3LPDA 5HDBB 1SELA 1U3DA 1A8SA 3Q0IA 3CR3C 5D00A 4B87A 2X0NA 1JVBA 1A5ZA 1YQEA 4LRYA 1FU8A 1Q95A 4P0TA 5JAOA 5BMVA 3N0XA 1MJ5A 4RYDA 3UA4A 4URYR 4EHNA 3R74A 2FUNB 3EAFA 2FEOA 2ZCVA 2F9FA 3FSRA 1QYCA 1D8TA 3IHTA 4L51A 5KYTA 5DLDA 1R2QA 1XLUA 1ZJ6A 3ASZA 2IL1A 2JAQA 2QR5A 1CDZA 1M72A 2A3NA 1C3VA 4DYVA 2G9QA 4MVJG 1ZVMA 2VTEA 4RV4A 3O03A 1V4NA 3LH5A 2QRVA 3T9BA 4QEKA 5JQGF 3BDVA 2CEKA 5H5JA 4E4TA 1JF8A 3LGSA 4I3GA 3R77A 3RUPA 4ENVA 1WPQA 3OESA 3LPCA 2X86A 1MAVA 3DLCA 3HN6A 3V4VB 4CF6A 5KIAA 4U6QA 2BHRA 1Z0IA 2ID7A 4CKYA 3NC1C 4G1EB 1LJUA 5A7GA 5DNVA 4RE6A 1PIWA 3KJZA 5ISMA 3KP1A 3FVRA 4FCWA 1T10A 3O4VA 3L49A 2OP0A 3T8YA 3IEPA 3Q8XB 2QMHA 1OWLA 3MJSA 5T6BA 2MCFA 2QNBA 1YQGA 3GVCA 4LJ6A 1GPBA 4R8SA 4MIKA 4Y1FA 4HGZA 5EIFA 5K8UA 2MSLA 2MMGA 3USES 5ICEA 2EKLA 1DC6A 4C4OA 2CNBA 1UBJS 4G25A 1NJ6A 5DNUA 4EY8A 1JDBC 3ROPA 1JFLA 2NO6A 5EJ4A 2DSNA 3V48A 2BUBA 3Q7TA 5L9AA 1JTVA 2D1TA 4YUAA 5HS6A 4ENUA 1TAUA 2XBUA 1GPH1 2O5RA 2PZLA 2VLBA 3JD0A 3D6UA 3ND9A 4LVNA 4GM0A 1IJFA 4FCVA 4FP9A 1JLHA 2HK8A 3FOBA 1UFQA 1W48A 4UHJA 4H7JA 4HVTA 2OZLA 2YYYA 2GFHA 3LBFA 3IKTA 1H5NA 2CNOA 4QOHA 3UQZA 5DNCA 2DHRA 1XZ8A 3B12A 3DXFA 3JD1A 1GAXA 1PQ4A 2FVXA 1NKTA 3LX8A 4L5IA 4MPRA 5GONF 3ICQB 2EWVA 2AR0A 2JLSA 4FGKA 5AQ1A 4MDEA 2NPOA 4ZK2A 1M6NA 5J4LA 4NOKA 2IV3A 1OYOA 1QHXA 1TCBA 2WA2A 3KJHA 4M53A 3X1ZA 1JDSA 3EXG1 3ZWVA 3FN4A 5FLKA 4F9GA 1CUHA 4L8WB 1QWOA 4W8GA 4B09A 4E5SA 4OJMX 1PSDA 2QJTA 1FDVA 1SVUA 4QECA 3R8XA 2H4XA 2VT2A 2BEWA 2Z09A 4O1IA 4Q7MB 5BV1A 4ENRA 2HOQA 1E3QA 2XDQB 4GPZA 3SGLA 1KMMA 3H1BA 3DUFB 2J9GA 3H86A 3REFA 3SM9A 3ZNOA 4K6HA 4U7PB 2IA5A 3ML1A 3ZXYA 4OVKA 2JLQA 1I8TA 3TLKA 1DP4A 1QE0A 3BSSA 3EVTA 3BGOS 2NVUA 2GN6A 3DVSX 4WZAA 4C0KA 5HIKA 3IJ5A 4MSUA 4B2LA 1QTRA 5A6SA 2FR8A 4RW0A 1ACJA 3S2EA 3ZTTA 1U0SY 4BFWA 1NATA 3DL0A 2BF7A 3P2MA 5BSFA 2NYUA 3PRYA 2NVBA 1TCAA 4FXOA 2HRZA 3Q7QA 5L45A 1UJ4A 1UT5A 4K5QA 1WDLA 2YXEA 1Y8ZA 1QHYA 3BIWA 3C5CA 5HF6A 2WW8A 2C3MA 4LPSA 1KY5A 3ZOZA 1XLWA 3ZCVA 1SULA 1A97A 3BRCA 4FGSA 1RZRD 1HTBA 3N7AA 4KPGA 3VJLA 5H59A 4ABTA 3ES9A 4G0PA 1NBEA 3DB1A 3CNBA 3U7QB 1H2ZA 1I1OA 3E3LA 4ND6A 2AZ4A 4OQYA 2AGVA 2OXCA 4YPOA 2E5FA 4RD1A 4S1NA 2G1AA 1Q50A 3JQDA 3OTWA 4Q9IA 4AMZA 4KLZA 3W4JA 3WB0A 1OE0A 4CM9A 1L5FA 3R5XA 3GVIA 4EKDA 5JNVA 2QN2A 5FEUA 1Q1NA 3OTGA 3I01A 4LK3A 1PNRA 1NC3A 3QVLA 5FBLB 1SXJD 3SQOA 4RJJA 1L7AA 3BMNB 1TQ4A 5F7ZA 5HVNA 2IE8A 5EMLA 1OBCA 2FFQA 1J0AA 3FWYA 3TD9A 1UPXA 3TR6A 4GKKB 4YP1A 3VO8A 3H8SA 2OVFA 1K27A 2G6BA 4ID9A 2CVPA 5L40A 2QQGA 1IN7A 1BRMA 3PIRA 3A9CA 4IVRA 2CUKA 1E4OA 3Q3HA 4IW3B 5ED0A 3R8FA 1UDAA 2D1QA 2G07A 1BDBA 3X2SA 1EP3B 3FCCA 1OI4A 1T3LA 1GTVA 1KSFX 1ODTC 3E05A 4RTMA 5CFMA 2IH4A 5K1ZA 1TK9A 3ZHZA 3D1LA 2NUPB 3FFWA 1TMYA 1XMJA 1LPBB 3BFVA 2H57A 3CMMA 4RM3A 3TL2A 4X1IA 3BIFA 4LF6B 3WAKA 4CEHB 2FRDC 4KPUB 4MRAA 3B8EA 4C88A 1MX5A 4JLKA 4MRMB 3AVXA 3PVCA 1KGSA 2XX3A 1AVTA 3KQVA 1DFHA 2ECQA 2Z2KA 1QRRA 1EUYA 1Y7TA 1N0IA 2WU8A 1BX3A 2VUIB 1IY0A 2XCOA 3DWEX 4RCVA 4ZZ2A 4R6WA 3QWHA 1QKKA 2GEKA 2P6NA 4GLFA 3RK0A 4ARZB 3B1ZA 2J87A 4L74A 1EFVA 1LCIA 1RZUA 1O89A 3I5MA 1M7GA 4JHXA 4N54A 2F8SA 2NU9B 2ONJA 1DC3A 4RHUA 3ICCA 1CJCA 3SR0A 1NZJA 3AVQA 2RH8A 3NHKA 4TXNA 1AMNA 2AEFA 4MKGA 4RORA 3ZY5A 1LI7A 4WKCA 3IE0A 3IMEA 2O57A 4C0QC 3EZ6A 3H13A 4J9VA 4KAAA 5C81A 3EF1A 4P82A 2DKNA 4Q05A 4ATNA 3LXUX 3SBOA 4KQ1A 1G2OA 5IKPA 2BBTA 3TIIA 1ULBA 3UMYA 4BLPA 4QU9A 3LLSA 5DTRA 3FR7A 4DQKA 3UWSA 2YN4A 1BEEA 2GZAA 4JCOA 1TIPA 5HRAA 2O5EA 1SUIA 4G41A 3R3XA 3LP6A 2D00A 2IEDA 1JDUA 2RARA 3AERB 3VBCA 5IX8A 1PNTA 2Q7OE 2DUWA 2OWEA 4P4NA 3I09A 3N7TA 4MW7A 2VYCA 3QIAA 2EZUA 2BM0A 3OJFA 4IWYA 2O3JA 2IODA 4ZU3A 4C87A 3TW0A 2WSMA 2D2VA 1XYGA 1W9HA 3OFKA 4I9HA 3W4IA 1V1RA 3EDMA 5G0UA 5KQGA 2O7SA 1OWMA 2PXXA 3P2OA 4OI1A 1PT5A 1V7PC 3KQOA 4U2DA 2VJLA 4Y2YA 1Y1RA 2Y1WA 1FYWA 4MB2A 1PG0A 2QD1A 4JV5B 2VJQA 2AXQA 4FNAA 4JUAA 3R0IA 1XB2A 4QUDA 1BTOA 4TLDA 5CYOA 3DW1X 2QGZA 1RHKA 4G1MB 3GRYA 3BD8A 3MA0A 3OX3A 3A1TA 3IHWA 3QNWA 4PXAA 1SXJB 3L1UA 1EE2A 4Q4JA 5IN5A 4PG7A 4CCYA 5KYWB 3OJXA 3HB5X 1R4MB 3T7RA 1B8PA 3N8DA 1TMKA 2HRQA 2WSBA 3PGVA 4NU8X 4PLCA 4CT5A 3RUCA 5K4HA 1Z62A 3QW2A 3SBEA 4KDFA 2IEZA 4TQ9A 1KORA 3VJRA 5E8RA 4OGGA 3UAXA 5DGCA 3PR2B 1UPAA 5CCEA 5CCBA 4RKWA 4YAKA 2QLLA 3AF1A 4PLTA 4NXMB 2VCYA 4DC9A 4Q34A 3RT1A 4MR8B 5BQFA 1IZZA 1UC8A 2VP5A 3LMKA 5E6UB 2JFXA 2VDMB 3HKCA 1YGYA 2XUZA 3NANA 3PC4A 1AK9A 1U2TA 2JH9A 4Q3OA 4UTPA 3FDIA 2O5CA 1CY7A 2X5NA 1Q0ZA 3IPXA 3CNOA 3ZCPA 2QU7A 3RVOA 5JFGA 3E9NA 3BDIA 2JK0A 2V65A 4V3CA 1PZEA 1Z73A 2ZVQX 2PMEA 4C06A 2EL7A 5LWHA 1FMTA 2O7RA 3DKRA 4RY0A 4D8TA 3CZ4A 2IIPA 4HUJA 2HQRA 2R2GA 2X7XA 1C30B 1WDKA 5LD2C 4U7TB 1SBHA 2PM8A 4EJSB 3PRHA 5L7TA 5EP2A 5FA6A 5A5FA 1V4BA 5IUJC 2W6ZA 3TBKA 3FWPA 4AX4A 2I80A 3OH8A 2XGGA 1PG5A 3F5FA 4LRQA 1X7HA 1VOTA 2R7NA 3GJRA 3RIEA 1JHMA 1FTNA 2PMBA 2UVPB 1B6RA 2WEKA 4M1OA 1ZAKA 2R6CA 2H7CA 1UQTA 1Y9JA 5LSAA 1QSGA 1G8MA 1XP8A 4DY4A 2C61A 3V33A 5JOQA 4I55A 1KVUA 4LF5B 3OE5A 3V4SA 1AB5A 4ZAGA 4YRBA 4JZKA 1GEGA 1FFSA 3TN7A 1UT8A 3OPYI 2ZUWA 2VK4A 4QA9A 4AY3A 2YRFA 4EMUA 2JRLA 2HF7A 3LQKA 4R1OA 5L3QB 1JQLB 1RBQA 1S4QA 2P6OA 3P96A 1B3RA 3KB6A 4F8EA 4GNRA 4DBLC 4OX9Y 1TUEA 2XOEA 4RK6A 3UCEA 1R5NA 1YS7A 3KKEA 4JLMA 4JX9A 2ZPAA 5EWJA 1GCAA 2ZAOA 2HQ1A 1OW3B 5I4CA 1BDHA 4W5HA 4DR6B 1AOXA 3EFHA 3P4UA 3GFPA 3SIRA 4H3VA 1KKMA 1UDXA 1S2OA 3OOYA 5HGJA 2FSHA 1Z08A 2VDOB 3IIEA 3QVGA 4C0WA 3N86A 4BZZA 1Q84A 2NQTA 1KS2A 3SN6A 3WWZA 1C9YA 2R7KA 4CV2A 2YMPA 3ZU2A 2PCJA 3P94A 1NT2A 3CUVA 3K73O 4JLJA 1L8QA 4R9VA 5EJ9A 2QKYA 5ALKA 5AM3A 3JWJA 2K2QB 4I1YA 1X38A 3D6TB 3LNCA 4YDRA 4ZVPA 3O2NA 3KD2A 3WQQA 2E1PA 5COQA 5AQEA 5K6AA 5DIZA 1R1DA 1KMQA 4F5YA 1Y8CA 1XVLA 4WGGA 3KPWA 3UMCA 3OJLA 3T5DA 1S2NA 3L92A 1M34A 2WM8A 5DCUA 2PR2A 1GDTA 4L9SA 4O4LA 3VYVA 4D7AA 3S4YA 4E5DA 4EBBA 2A9JA 1ORHA 1UZUA 2G88A 4D5EA 1NKVA 2C42A 3QUTA 5G3ZA 5C7IO 4ARIA 4J03A 3FHTA 5KNBA 1VJGA 2M1XA 5L3RA 3ESQA 3AR8A 2Z9DA 5IJ0A 4DCCA 4FOSA 4Q7QA 1R6UA 3LW7A 2PQ2A 2DWOA 3U80A 2CD9A 2G9VA 2HMYB 2RG7A 4DG8A 3TO5A 4XI9A 5DGTA 4AM8A 1J90A 1MORA 3GEGA 4DCMA 1C3XA 2CHGA 1LRJA 2OQRA 1D07A 3RU3A 3WL3A 3HO1A 4Z51A 1TYEB 3A6FA 3GEIA 3A1DA 1UK9A 4IHJB 2H2HA 3SX0A 1IM8A 1Q2UA 2EDAA 2EFDB 3V7YA 1YT5A 4TRMA 1BCSA 2Y67A 3UHJA 2RGBA 2X4GA 1G5HA 2WWWA 3FPEA 5AUPB 1U3WA 2IZ0A 3JALB 4UU7A 4NBLA 2RI0A 3W9YA 2OCIA 4ZCPA 3T5AA 4LYEA 1LBSA 3AUAA 5CBPB 5BT9A 2VUUA 4TKLA 1RCUA 2WJPA 3GNQA 2XTMA 3HFSA 4GMGA 5JSHA 4J0GA 9ABPA 1MB3A 5KTOA 2FPUA 2IS1A 2IZ6A 4XTCS 2BKLA 3NOXA 3UG7A 4F3YA 1KIMA 2ZAIA 3VR6D 5C7YA 2AA3A 3BC1A 1Z68A 3OFJA 3OM1A 1AV7A 1JZTA 3DBLB 4KNVA 1KK3A 3EGEA 3QEJA 4FX2A 3AGPA 1RCTE 3CSDA 4MRPA 2PRJA 3U4HA 4OXYA 4U7GA 1LKZA 1MV5A 5HW0A 3UB2A 3ZDXB 4URUR 1PZHA 1V71A 1KEUA 3FCEA 2OFWA 1W87A 4GHWA 1KMCA 1J8FA 4RKQA 1T5DX 1L1EA 1QQ5A 3HRKA 3Q3GE 3WG9A 1K4KA 1P4AA 2I4LA 1UK7A 3H1FA 4OYLA 5T4HA 2OHIA 3UKOA 4CPDA 5IZ4A 4AKEA 2HLDD 3R40A 3GBPA 4MJLA 1UIRA 2C82A 1DCKA 3KAQA 4R3UC 4E1BA 3UK2A 4QG7A 1KRWA 1Z25A 5FI5A 3EC2A 2CLSA 3NEYA 1BDIA 2HT6A 1WABA 3OBBA 5DB4A 4ASUA 5IBRA 3MYYA 4WN3A 2O50A 3TQCA 3JVVA 4DQDA 1QP4A 3KT8A 1Q0QA 3RS2A 3VH2A 4MVJP 4ZO4A 5FPSA 5KNLA 4RTRA 2HMSA 2YWBA 5JQGB 2FF7A 1XTUA 4Y9DA 4XAQA 3HB0A 2ECOA 3BMCB 1YS9A 4N82A 2CFOA 1ZL0A 2ZR7A 2JLCA 3C3XA 3IAS6 3IPRA 3EGIA 3O2SB 1ECLA 4Z0PA 3ZZ1A 1RI1A 3WMGA 2Y6VA 3NIWA 4F96A 5CXUA 3UGJA 3IYLW 3WGNA 3DD1A 3G2KA 3OSUA 4Z0NA 3TW6A 1TJPB 3WBKA 1CXZA 2FJPA 3PD1A 1P9NA 4RLQA 4XR9A 5AICA 3U09A 2WV9A 2M6LA 3R4VA 3VNAA 5IMBA 1R5OA 3U13A 1W5SA 5B4TA 1Z8DA 5EPOA 1JIKA 5HCNA 1B2LA 3BTUA 1F06A 3ASUA 4AKHA 1TA4A 3HABA 5IJZA 3AEKB 4JB3A 1QUEA 1EI9A 3ET5A 4PXYA 4CU5A 1XFDA 5B1SA 1HETA 4KTVE 3PPXA 2BEUB 2JHCA 1LFDB 2DP4E 4X85A 4YR9A 2LKDA 1X14A 2BJHA 3IVGA 3PUIA 5FUBA 1AGPA 2IYEA 3D54D 3UMSA 1OGJA 4HNAA 5K03A 4N6GA 5FLXA 2G1PA 3WAGA 2O2HA 3D8TA 4IO0A 1YTLA 3ICEA 2KS6A 1GFWA 1UM9A 1NR1A 3CRZA 2ZI3A 3SSMA 4F45A 4DV2B 3HTXA 1EE1A 2PSSA 3VPDA 1U3UA 4JL6A 3KALA 4E2ZA 3UHOA 3E7WA 2GAAA 4FLMA 4C5CA 4NYJR 4MR9B 4ITRC 1ID8A 3B1YA 3IAM1 1KVQA 1XL0A 5GONB 5HA5A 3I6IA 1C3LA 4IQ8A 4DVGA 1KF0A 1W4RA 1XDDA 4IV0A 1ZUD1 1M1NB 2YZMA 2PANA 3KLNA 1IPHA 3QA9A 1JEOA 3CISA 2P6UA 3AYXB 1X8KA 3PYMA 4ECEA 1F14A 3FOEC 3BJEA 2YMLA 1USGA 3RSZA 4Z54A 3W5SA 3L7LA 4HDKB 3LV8A 5A5EA 1WTCA 4DOMA 3IO3A 2VUSA 4LJLA 4M0DA 4Q4LA 3TI9A 4IYJA 3CEAA 1YDMA 2JH8A 3UWOA 5BSMA 3VPGA 2EX1A 5JAIA 3B2QA 1DAGA 1YFKA 2LDXA 5L6LB 3TSOA 4NICA 1M8PA 1XTZA 4H2DA 4A4DA 3W2HA 4BDSA 2HX1A 4LZLA 1OREA 4EQ6B 3ZGZA 4WINA 3QLVA 4TPKA 5JLJA 4PG8A 2F1HA 1JUDA 1JKJA 2VA8A 5ALDA 4TRNA 1YR7A 4IIEA 5AR1A 1E0AA 3GH1A 3EOBI 3MWDB 4RKRA 4OIFA 2WSIA 1RQGA 2A9KA 4QPJC 2DQ4A 2YZ7A 5AJUA 1XELA 2HDNB 2I8AA 4EF5A 4ZYTA 5KTRA 2TS1A 5M5BA 4A8TA 2VF8A 3O2QB 1G8JA 3KQPA 2I1QA 3FGOA 5JPCA 3JWGA 3SHFA 2P1RA 4TWZA 4ZOLB 1T5TA 1NM5A 1XO1A 1UBFA 3GGPA 3T5MA 3P0RA 1HT0A 2IYZA 4B8YA 2BM1A 4QODA 1JLKA 1RP1A 2GJ8A 4ZZ1A 4MS3B 3C41J 3K3PA 2VOJA 2R60A 1A71A 2VJMA 3A4TA 4H7IA 2R8ZA 3THYA 4Q1CA 1HNZB 1G3RA 4KIJA 4K6OA 4P31A 3JQ6A 2EIXA 4BFCA 3JZFA 3A6DA 1N6IA 4YLGA 1T9GR 3X43A 1N7JA 2OV2A 3AFIA 5AKGA 1SHZA 1XI2A 2UVDA 2I55A 2EP5A 3M2TA 4HK4A 4D1YA 4S04A 1IB0A 4QVGA 2FP4A 4ZMRA 4NBKA 1U8AA 3LOUA 4YGXB 4BQPA 1WG8A 2BGGA 2ZK7A 1A4UA 1LTKA 8MHTA 4RJIA 3MBIA 3PUWA 4OHKA 5JHGB 2C29D 1DIHA 3GZTB 3KL2A 4M54A 4UC0A 5H80A 3DEFA 4WPGA 5CIWA 4CUKA 5FUXA 1XXHA 4Z7OB 5K2MA 2PLRA 4H4CA 1SUWA 3JR7A 4WXRA 2R47A 3Q3VA 5DMXA 1II0A 4IV8A 4ZVSA 5J43A 3TIFA 1FBNA 2ZYTX 3ZHTA 2F3TA 1QPGA 3NIDB 3NALA 2YJZA 4Y1GA 4D9CA 1G9SA 2XMSA 1IHUA 3LYAA 5JNWA 2HY7A 2XCLA 4PAQA 4LXTA 4UMVA 1Z45A 1K63A 5B3KA 3SVLA 2CV1A 4UASA 2PKQO 3CONA 1TZ2A 2WB2A 1E2GA 3VNQA 4R1MA 4AMVA 5LP6F 4OOEA 2J3HA 1A7UA 2R1TA 3AWDA 2EAUA 2IUSA 4HH3C 1ZCFA 1ATIA 2FN3A 2I71A 3FOAA 4QBHA 1PS0A 3CF4G 1L5MA 3EAQA 1L7QA 4R5HA 2DTXA 3BA1A 4V39A 1EK2A 1CJKC 1H2YA 4MW1A 4Z1MA 4J7XA 3I32A 3IRVA 1N2SA 4OK3A 4BB6A 1J0XO 2FRVA 4WZBE 3OM9A 2P2LA 2XIQA 4AXBA 3T7DA 1VL0A 2YW9A 3KOOA 4JP8A 3RS0A 4BO4A 4F86A 5HFJA 2NPIA 2COKA 2GPSA 4IUCS 3LQ4A 1RKBA 2WVGA 2IIQA 3IAXA 2WG0A 5EJFA 2JLVA 2VUTA 3T7IA 5LKRA 4J6EA 2NXEA 2J3JA 3T95A 2ESRA 2VI5A 3GT4A 1W93A 1Q19A 1Q0SA 4GAEA 4ZO8A 5DGIA 1O5IA 4B45A 3A6GA 1GRCA 1PF7E 2P5SA 1JS1X 2V7TA 3IAAA 4ZVLA 4AN0A 1J6UA 3ODPA 1AKUA 3PHJA 2FWMX 4NAHA 3SZUA 4HLCA 1JTEA 4EX6A 3GUYA 4JP5A 2E4YA 3D0QA 1FFCA 5AUOB 4RF3A 3DWIA 2R87A 4XOIA 1U7UA 2WKQA 1EFUA 2EGHA 1FVOA 2B35A 3D8BA 4GWKA 3R7SA 3TFWA 3QQPA 4Q48A 4IIDA 4D44A 1WUHS 1E9BA 3PUJA 4F4CA 2VNJA 1U4SA 2DLDA 1N2IA 1I1HA 1U0EA 1IWOA 3UZUA 3TK1A 1JEEA 2AE2A 4FYMA 4NMXB 2QSUA 4J75A 5FO0A 4W9RA 1BGVA 2CYAA 1IBMB 3DLHA 2JI4A 2WB4A 6GPBA 2WR8A 2BEKA 4BNGA 2FSUA 1P1RA 1WQ1R 5AM2A 2FB9A 2PZMA 1O6ZA 2ICAA 4S0XA 5HS4A 1EUCB 4M7WA 4QXAA 3LIIA 3KR1A 3G8BA 4HWSA 3OU2A 3LC0A 1JX6A 3PXBA 2G25A 5KJCA 5EIHA 4CMJA 1UMBA 2IIBA 4EB3A 3LTNC 1FFBA 1TCVA 3EPPA 5ENDA 1YE5A 3JPWA 4KPEC 2PU7A 3EVAA 5DGHA 2MDTA 3LKBA 4ERNA 3IKLA 1EHCA 3AFMA 3UMBA 1CFJA 5F2KA 2G70A 3PE6A 5ENVA 4O0MA 1KI4A 3RSSA 2D7CA 3FSEA 3OY7A 1TAQA 4IFTA 2PA3A 5G4KA 5AHOA 5CFZA 1BWQA 2YMQA 2F43B 2HSJA 2QAIA 4L76A 5AXCA 3DFFA 3GLFA 5C46F 4O2LA 4AG3A 3KOYA 2Q9UA 3COSA 4Z9YA 3H9BA 3JQ7B 1UPBA 3REQA 4MV1A 1N75A 1QOQB 5AYVA 3EY4A 3PNYA 2V8BA 1V8ZA 2G0TA 3H3FA 4BMYA 4YO7A 3VR1A 1EWQA 4RZUA 1ZKDA 2N1MA 1BGWA 2PAFA 2FSIA 3L0CA 1OFGA 2ZWMA 1CF4A 1EXDA 1T2EA 2I22A 3O0TA 1MHPA 2K6GA 1K8XB 1ZS9A 2OBMA 5CA0A 3SFVA 2CDRA 1RI2A 3D6VA 4JXJA 4TYNA 3C5WP 4ZXFA 3PDUA 5ERYA 1BMFA 1HNNA 1X2BA 2UU9B 3F9IA 2QG4A 3QRWA 3WJ7A 5JO0A 3OZDA 2JJMA 4XLTA 5J2UA 2XCUA 3CUSA 3FHOA 4B33A 2VTVA 1OFIA 1Y9DA 4P54A 4ED9A 1RBYA 3ILVA 5JXIA 3FTQA 4XIGS 3WO0A 5KTPA 4GM4A 2L69A 3DC2A 3FJOA 3PEYA 4M6WA 4OF4A 3O1HB 4OIMA 3BRWA 5KSZA 1TUIA 1RE0A 1WXQA 4JU9A 5TGTA 2X3FA 5FR2A 5GJBA 4M37A 2Q5EA 4OGFA 3WGOA 4D9FA 2WSSA 1YCDA 3ZIDA 3UJ6A 1O6CA 1SUBA 2AOWA 5CVCA 2XB4A 3Q41A 1A4XA 4FR5A 4GS5A 4I6EA 3K9WA 4KG7A 1TM4E 2VEOA 3JYNA 3GVHA 3SJZA 3MAJA 3R9XA 2CJWA 1PBTA 2PY6A 4O0LA 3ZLJA 1TAHA 4EY6A 1NVMB 1VHDA 2D5CA 4H31A 4HTFB 4TMZA 5M34A 2IBSA 3E7DA 2ZSKA 2IKSA 4KQHA 5EXDA 3NNNA 5AI0A 2Q4BA 3IQGX 3DMHA 3SI7A 4P4LA 3HU2A 3ZU5A 4HZUB 5IWAB 5D5QA 4KN9S 1TXGA 3GB9A 1RJFA 4W82A 3U39A 4PZPA 1JA0A 4BQFA 3TIVA 1E3DA 5FL7D 4RAQA 1DDIA 3OU7A 1YFZA 1EVYA 1P73A 3P0EA 5LLTA 4UHFA 2CXRA 2QRNA 1H1LB 3DDZX 3ESDA 4OBBA 4D74A 4UUBA 5CCDA 3O4GA 2JAHA 4M9XA 1XVIA 4QAQA 1HTWA 2X0FA 2CWDA 1KNXA 3VNBA 4BL5A 1U1CA 3O9VA 1KPHA 4TXLA 3DR5A 2C96A 1TF5A 1OLUA 2VDLB 3L9XA 4D02A 4JSYA 1HDXA 4CM1A 2WOJA 4DBVO 5AW4A 2XRYA 3ZDZB 3HKEB 4IXWA 4OHBA 1WRBA 3RWMB 3K1ZA 3M34A 2PFSA 1HE4A 2VJNA 2X0RA 5ALGA 4D4JA 1XCLA 4BX0A 2EBUA 3JQFC 4LZPA 1NX9A 4R7ZA 5ECDA 1F5NA 2B36A 5IASA 4PYNA 2ZLBA 3MCVA 4X6XA 5IAAA 4ZI2A 5AOBA 4QRHA 3U4CA 5A05A 1MB2A 4JYMA 1XMXA 3H3XA 3PSAA 1HOTA 2XOKA 1NJ8A 4WCFA 4MA4A 4YK7A 2W6MA 1WXDA 4WD3A 1E4EA 2V97A 4FN4A 4HWPA 4N0EA 1U3CA 4N40A 4ZRNA 1M1ZA 4IDPA 3R44A 4JNCA 4C5BA 3RI3A 4EA7A 4MOWA 3M2PA 2V4UA 4UNRA 1QHGA 3BD7A 4DV4B 2Y0BA 3RAEC 2QV0A 2YJTD 5FV7A 2ODPA 2XUOA 3LXRA 4FOOA 1EG7A 4JL5A 3PTAA 5BURA 1X39A 2D06A 3MFQA 3Q40A 2O7VA 4MVXA 5KTTA 1ZITA 1QP7A 1EVLA 1OX6A 3ZWOA 4A8JB 2DPGA 2M98A 4QUKA 1N8SA 2AC4A 3RT9A 3LBYA 1UXOA 2FE4A 4XUGB 4KGDA 4QTXA 4UZFA 2C4KA 3H16A 2XA1A 2BL4A 5FNVA 2IHYA 2Z1DA 1QUFA 4JJ6A 3KFXA 1NI5A 4NZZA 2DHCA 3VZCA 3PQ3A 2NVOA 3HJTA 1N2ZA 2OAGA 3LPLA 2ZJ5A 4Q12A 3PKIA 1BH2A 1UOEA 2XY4A 3QEMB 2YJ6A 4B9AA 4D9KA 3FZQA 4DV5B 5H1YA 1V1MB 1OILA 5J2UF 3OHSX 1MC5A 2B25A 1EBBA 1V47A 5CFLA 2OLJA 3F90A 3PGLA 3VPXA 4RPCA 3PQCA 3L43A 1YL5A 1R9NA 2GN0A 2IY8A 2VRBA 3ETEA 3F3YA 4L7VA 1LFAA 3RVDA 5JJBA 4P3KA 3AVOA 1XL1A 3EAGA 4EELA 3OY2A 4GVXA 3GLIE 1I2MA 2PZGA 2RSLA 2V96A 3B1XA 3G2NA 3ER6A 3NP9A 3J7AC 1YL7A 4GSLA 2NUAA 2J32A 3GEHA 2H07A 2A5LA 5JO9A 3ZS9A 1MA0A 1SZPA 1KMNA 5AJVB 1OF1A 2DG2A 1EFLA 1EWRA 4D3ZA 3T9CA 3I6YA 1M83A 2C9CA 3KDPA 4RL4A 5DNDA 1QCCA 1S2MA 3GXBA 1ODSA 2N47A 4JB8A 5B1EA 3VNVA 1OVGA 2O2XA 3M6IA 2WMDA 2D2XA 4KGXA 4KWIA 5I9MA 3T4XA 4BOYA 2WTUA 4I9NA 3EVFA 4PLPA 1GPKA 3IJEB 1VJRA 3PQ7A 1I3MA 4I1IA 5ALYA 4GUDA 2C95A 3SDBA 3CXRA 4O3FA 5DFAA 4NG4A 3VH4A 4TTSA 2XUAA 4AD8A 4RK1A 3U7FB 1DDGA 4HDCA 1OFUX 4Y2RA 4LY3A 3T52A 1WHSB 4FFMA 1B6GA 1WKCA 2XMGA 4PO8A 1FZTA 1KS9A 5HBRA 2OG1A 1KJ9A 4EPXA 3TOXA 3TUIC 1GZ4A 2LXNA 3GFBA 4QAJA 4AB1A 3LGXA 4EARA 5HKOA 2YRXA 2HCTA 3QY9A 4GEKA 4NYJQ 3NT5A 3RGWS 2E4VA 1M5TA 2OGUA 3AR4A 4MUHA 2H1FA 3I8OA 3EW7A 3MELA 4LHZA 4BVBA 2GZSA 1ZWLA 1G5IA 1YZKA 3HO6A 4G26A 4RENA 3SP1A 3VPFA 2NSLA 5CFPA 2QAGA 3I39X 3PLNA 4PAWA 3OLVA 2VTBB 2VF7A 1Q0RA 1RRFA 2O9JA 4ZCQA 4DIUA 4UM5A 5JNTA 4PZDA 2V7EA 3DT6A 3CZMA 3H1PA 3IHLA 1F8FA 2HYDA 1E1CB 2AK3A 2J09A 3Q9SA 5EPEA 4BKPA 2HEIA 2QJOA 1SXGA 1A82A 4BUZA 4KXUA 1V6CA 4WEQA 5JLAA 3RSOA 2J6CA 4DLKA 4M22A 4BZQA 2I6SA 4DCNA 5JSZA 3AL2A 3JAKB 5CITA 5A3SA 3D6MA 4YMLA 4ZCSA 2C5BA 1T36A 1NP7A 4O6VA 3LVRE 2O07A 4B43A 3DVAA 3HI6A 1OB5A 3NFYA 1NNSA 1QDLB 4RK7A 3KIPA 2D4HA 1XG5A 1Y5RA 4X1YB 2VG8A 3SFZA 4PFSA 4BVEA 3O1JC 2HREA 3HY6A 4OYHA 4ZC8A 5K8TA 1IZ9A 2CF6A 4UHBA 4S1OA 5HQJA 2PKYX 3M33A 4QFCA 4CM8A 3E9EA 1BOFA 1JILA 4EG0A 2IIVA 1RDFA 4OX9B 2PS9A 2WA1A 3EWSA 1N9KA 4JLBA 1QBKC 3DO6A 1TYBE 1GLVA 1SPBS 5LU9A 5AW6A 5ICMA 3HB7A 3N0VA 1U2ZA 1UFVA 5K5EA 3QVXA 5C8ZA 4TTQA 1YAHA 1CZLA 4ER6A 3RRNA 3A9VA 1FQWA 5BSKA 2AEMA 2R4QA 2YINC 3H18A 2GWRA 3BZWA 2OO7A 2WKRA 3S81A 4F6LA 2A94A 2PIDA 5AW7A 2B2XA 4ABYA 1SA0B 1MDBA 4Z0TA 2ZTUA 1FMCA 3NV7A 3PFKA 4YRMA 1C8KA 1BRTA 2C2ZA 4LG1A 3EPRA 2JIMA 1BVUA 5ALMA 3EIWA 4ARBA 2PSEA 2YWDA 4CMIB 5G40A 1HE1C 3DF9A 3FPGA 1M34E 4Q4DA 3QEAZ 3PBKA 5EWLB 1OLSB 4CKCB 4Q3CA 2XQVA 3RYFB 3R09A 3H17A 4WACA 5AJYA 4BHTA 2JLUA 3I5UA 1ZVJA 4MWBA 1Y82A 4AUNA 3SSNA 2B94A 3ME5A 4BMNA 1P2DA 3LLMA 1SWWA 2BUAA 2Q1XA 4HYQA 4K87A 4ZQGA 1W0CA 2H7VA 2QT9A 4P7GA 4PPQA 4BNYA 3AI3A 2POQX 2XCQA 2Q45A 4MV9A 4RF4A 4F4FA 5FUWA 3AUSA 4HDMB 4KO3S 4OXNA 5DM60 1QFZA 1PDVA 3O4JA 1XCPA 4D57A 1PZXA 1E7MA 2NX2A 2YWXA 1CIVA 1EVJA 1NUTA 3SYRA 5EAIA 1HO3A 1SXJC 1WIWA 2IF2A 1N3LA 4NATA 1UBSB 3I6ZA 3C8MA 5BV2P 1QO0A 1QRUA 2EF1A 1MPTA 4P8RA 4RK4A 3ULKA 4RIIA 3IIMA 4YRNA 3UWPA 2ONKA 2B3TA 2ISQA 1W47A 3OX4A 4BJHB 1ZMXA 5LP6B 5FEMA 1Z74A 3UCXA 1E2LA 1Z5ZA 5TC4A 2Q6OA 3CH4B 3DYVA 5HK9A 2BGUA 3H2IA 1FTGA 5DGDA 4YBZA 5J23A 3ZI0A 2BIFA 4JU8A 3AIOA 4E32A 3P8ZA 2LBPA 3PQ2A 2VSYA 2JHPA 2Z3VA 4FFWA 4NKRA 4MTLA 2R11A 1KJIA 4YCNA 3W5CA 2CGEA 1L4FA 4L5AA 5EXEA 2ZRDA 1FS6A 4JBIA 2OFFA 4EZBA 1WWKA 1THTA 4PLGA 5CA1A 5JH7B 2P62A 2QN1A 3CEMA 2ZE8A 3G7UA 4BMOB 2FWBA 1K1EA 2CFIA 3CWCA 1HYEA 2V45A 5C1PA 2PWPA 1BOOA 2R25B 1RMTA 2PK3A 1BXRA 2P3LA 3N9IA 2RHRA 1UODA 3GQBB 1AIPA 2FKNA 2HJVA 3U3MA 3BIJA 3O8OA 3RCBA 3VOBA 3ZJ5A 2K7FA 2DTDA 4JQSA 2ALJA 4Y2XA 3T7JA 3DZIA 1E2EA 1YD7A 4G01B 4HX9A 1G4HA 2TSYB 4IEEA 1RACA 4PZ0A 5BNZA 1WW2A 4J90A 4CKEB 2QLJA 4DCJA 1CTQA 1JB9A 3BN3A 1R4NA 4E1VA 5U9CA 1JKFA 1XCMA 2FLVA 4TZ6A 2OYRA 3TLMA 4JC0A 3UOAB 5KPJA 4KITB 2A1TS 3W3AA 4I1UA 3WDLA 1C80A 2I1LA 2VK8A 3D7MA 1QHFA 3ADOA 3D7RA 3GLHA 1OCEA 3K1AB 5EKTA 5AK6A 5TJHA 1D09A 1KJWA 1JAZA 4ZOQI 5M04A 1SVWA 1EUDB 2GZMA 4MITA 1L5OA 3Q2IA 2R6JA 1T4BA 3K9BA 5FWDA 5IJAA 1QH1A 2IEAA 1TPZA 2ZG6A 4LYDA 2X2EA 2FSVC 3OIUA 4OQZA 3VZDA 1UKBA 1F7UA 3AETB 1WQ3A 1AN0A 1YI8A 3S70A 5EQFA 1IU9A 1A8HA 4FSHA 3T6KA 1WUJS 5HIAA 3CU5A 1OC4A 3GDFA 4II3A 1F38A 3DEAA 3QJYA 3IBTA 1UDWA 1ZUHA 3C39A 3PT5A 4GICA 4CCYB 5AKJA 1PKEA 1WNFA 1K66A 2P4HX 4MW9A 5ILOA 1RCFA 2IT1A 2INGX 3HU1A 4QQ8A 3SS7X 4DV1B 1SG0A 1HOXA 5DE3A 1QHIA 5LQRA 3JARB 3SWWA 4MIYA 5F9HA 2BMFA 3LUJA 3QYPA 4JC8A 1KQOA 1SBZA 3AFNA 4W8HA 3WNDA 1Z0ZA 2PKWA 4PSKA 5CVJA 2VNSA 3MOIA 4Q24A 4WCVA 3C1OA 1TOAA 4XGRA 1K3UB 1PQYA 1O97D 3QBVA 3ZZNA 4C6RA 3WLTA 4F5DA 4TTAA 7ADHA 1QNFA 4EB8A 3JQ9A 3GZNA 2V7UA 3SX2A 3MB8A 4NBRA 3BCSA 5GIOE 3PG5A 1FNNA 4MDYA 3TG2A 4JYAB 4L0QA 2DKOA 2VSFA 4G5FA 3GU3A 2D7DA 3VKFA 1RRCA 1SK8A 2IP4A 5TGZA 4CYMA 4DCOA 2QTVA 1K8QA 1E2DA 2DHEA 1XEFA 2ODAA 3DL7A 3HR7A 1Y81A 5JUWA 1LSOA 2XVYA 2PX4A 1H1DA 1E7RA 3PICA 1CUWA 4BYMA 2FUKA 5DDIP 1QCDA 1RABA 4JKYA 1N2BA 1VG9B 4LNHA 3TMKA 4QJ5A 5AVQA 1HKHA 4K0KB 3QPDA 4CTMA 2QZSA 1GZSA 2XZTA 4EY4A 4F04A 4TS1A 3HN7A 3KSUA 5PGMA 3KJFA 1XEXA 3NJ4A 3QKRB 4QTUB 4R01A 3DAHA 4W4TA 3HE3A 3SVTA 2DE0X 3DYIA 4DPKA 1LWNA 1KYXA 4EG5A 5M2QA 4A6XA 1U4NA 1J8QA 2EW8A 2ODQA 5EC8A 5F3WB 2QN8A 3CSUA 3HBMA 2QUAA 1ZMBA 4MUXA 2BFFA 4FLFA 3SEQA 4AS3A 2ZGVA 3DEKA 2GEDA 4OREX 4UATA 4FDMA 1JJVA 2CE2X 2RB4A 4P5PA 1N5RA 3PVZA 4MTCA 5J4YA 2JC3A 3C3WA 3FF4A 4CTKA 3FYUB 4HUTA 5JISA 3H11B 4B31A 3TKLA 1IBRA 1EH5A 4N5HX 4I1PA 3AF6A 3DSRA 4BNJA 4OGKA 1T8PA 2APJA 5AHWA 4EYEA 5K0TA 1REQB 3SE0A 4QU5A 3OTIA 4QGBA 4HNUA 5CJJA 5ECWA 3U1BA 5IKEA 4M7OA 1K4MA 1Y4SA 2G4LA 4YROA 4Q3NA 4N0PA 5EZ6B 5GAJA 2XQIA 4B82A 5BW8A 2IQIA 5EHXA 1UKVY 2PWBA 1EVKA 3NBUA 4JUDX 5HGXA 5IDWA 1EDEA 3WKDA 1K3FA 4QE3A 3PC3A 5EP4A 1I24A 2XB9A 2DJ5A 2FG7C 1GQ2A 1E79A 1SU7A 3PQ8A 1DQNA 1RVV1 2HPHA 3JQRA 4O5OA 1O58A 3CF6R 1Z7BA 4HWGA 2FR1A 3GXOA 3HBJA 4DNOA 3K70C 5AJWA 4RPLA 1ABBA 1D1QA 2C78A 3BB3A 2O3RA 1PR4A 4FHCA 1TYZA 1M2FA 2WPDD 1PZFA 4W7SA 2WP0A 5C5DA 1SQFA 5I5EA 1Z36A 3H99A 3FTDA 3K8QA 1XXLA 4QQKA 1XXHE 4PYMA 3FJ1A 1VXOA 3DDUA 5LZ4A 4FK8A 4JEMA 5AUNB 4GI1A 3DKKA 5K3FB 4IMRA 5CVEA 1DMSA 2FWRA 3A8TA 3Q8LA 3FVTA 2RHMA 3IAS1 1YJAA 1ZZEA 2FEKA 3EC7A 4U2GA 3TDNA 5LNK6 2J07A 1FFXA 1YONA 4DLVA 1UMDB 1IN5A 3BREA 1C0KA 4UBLA 3JSXA 1YZLA 3AP1A 4RLFA 1KNQA 1V4VA 1P61B 2JFOA 5F7XA 2J0SA 5JS1A 5IYZF 2W8ZA 1W75A 1FNSA 2CNLA 2JIOA 4JT9A 3V8VA 3OQPA 1NF8A 1ZD9A 2I34A 2QI9C 5KVQA 2YDXA 4L7QA 1ARZA 3ZK9A 1AG9A 3O3CA 5C18A 1UOQA 2PKCA 1FC0A 4IDQA 2ZBVA 4YR7A 2QK4A 2C4NA 3KL4A 2PUAA 2DH5A 2H63A 2OBBA 1GGEA 3OOSA 4K28A 2GWHA 2HIHA 3VPSA 1LVGA 4B3JA 3GLSA 3SAJA 1SUEA 4HNQA 1T34A 1T0BA 3IDAA 3D3KA 4QRIA 1QAMA 3TH5A 3VTZA 5B2ZA 4HH1A 4AWXA 1LLQA 5HIJA 4Z3OA 1NNEA 4HSGA 1NXSA 3A9TA 4Q4AB 3UJHA 3WA6A 4JGGA 3ZG6A 1KXZA 1N3BA 1U5BB 1SHLA 1VMKA 2VBGA 4Q9AA 5F51A 5EXTA 4R98A 5B6JA 1ELOA 1G63A 5JNRA 2BGRA 1XZPA 2CK3A 4M7PA 1JSLA 4EDFA 3PE4A 5ALOA 2Z5GA 3UGTA 4RH0A 1ZSVA 4WLNA 6LDHA 1X2EA 1PJRA 3L3BA 3AQIA 4OUDA 2XB2A 3VSCA 4J4TA 2WZQA 2VK1A 4X61A 1OMOA 2MYNA 1L1FA 5AKHA 2OESA 2M1ZA 1E3WA 5J2UB 5TQ2A 1Z8NA 2ZT5A 4MQFA 5EMHA 3RKSA 3WNBA 4BU1A 4A03A 3X1MA 2RK4A 3ZNPA 5LFAA 3NKVA 3FB4A 1ESNA 1YZYA 2CZQA 3OP1A 4NONA 4Z99A 5JBIA 1TLFA 3HWWA 4AMYA 1CUSA 4E1AA 3FPKA 2Z30A 1NN3A 1W35A 2AQKA 1MJGA 1Q7BA 3AOGA 4G0VA 2WUFA 3KS9A 1T2UA 1TLTA 1YUBA 2WIAA 5FDFA 1ZRNA 1I6KA 2A5FA 2YRWA 2RBGA 1VLJA 3FKSD 4ZOEA 1DAEA 2ZATA 4UDOA 1SHTX 4BWVA 2HMAA 4D25A 3V2UA 2VSQA 1CQXA 3EIEA 3UWMA 2I9KA 2F64A 2J9FB 2ZWVA 4E0BA 4UE6A 5CLQA 4Q39A 3SKXA 4Z4QA 1BXGB 1BE0A 4DLZA 2H2FA 2IDKA 1NULA 3GAMA 5LMNB 1JI0A 1Z26A 1FDWA 3KCQA 4URHA 2Q3EA 1BX0A 4JL8A 1FDTA 2OO3A 4DHEA 5I4BA 5KQMA 3UTDA 5CXQA 3M3PA 4R8VA 3U81A 4B7XA 1K5GA 5AW8A 5HF8A 4D46A 3NBZC 4YBRA 1HA3A 4Q3KA 4PRZA 3Q8WA 4JA0A 2IEGA 2AG6A 1A9OA 2PRKA 2EERA 2C59A 3E2PA 5HSGA 3WK7A 4M8SA 4YCDA 3T12A 2A33A 2BW0A 2FWAA 2I2AA 2LD4A 4ND1A 3DGFC 1NQTA 5K0FA 3F7OA 4J07A 1XTBA 3GJYA 4UTOA 2XYGA 2I3DA 5F9FA 2CN1A 4OH1A 4LMPA 4DAEA 1VE5A 4NLLA 5HKBA 2O05A 1U6KA 3CR7A 2ZJ2A 5C52B 4DJFC 4M9QA 4Q3EA 4JXKA 5E6RA 4UUPA 3GEBA 4AK9A 3GOHA 5JBQA 2ZUDA 3IQZA 2R6AA 1L7MA 3QI2A 4XH9B 3GWZA 3W8DA 1CR2A 2F62A 4UMEA 1GYPA 1MX3A 1IBCA 1QS0A 2R97A 3F8WA 1NY5A 1XKXA 3RRJA 3KLOA 3C4JA 5FPPA 2BFAA 2FWJA 2G7MC 3EASA 3GL9A 1W8IA 3ORFA 4KAJA 5FPQA 4DQVA 4RY9A 4YV0A 4W5QA 4V38A 1NXPA 1IC6A 1II8B 1KI6B 4CFZA 4JQZA 2PV0A 1R66A 2YJNA 3PFWO 2X77A 3L7AA 2H08A 2CLCX 2QQ5A 4G2TA 3HN2A 4YRQA 2B3DA 1CY8A 2JI7A 1NNI1 4XEHA 4EHDA 4CLOB 1NU6A 2GD0A 1NSYA 2QROA 4XFDA 3MJHA 4WUVA 1W2WB 1CEQA 3SMVA 4C5AA 5KMGB 3TQHA 3A27A 5TQ0A 3EH2A 4IR7A 4LBVA 4A0GA 1Y42X 4E4YA 2IYWA 2YVUA 2GBLA 3TVYA 1DE0A 5I9TA 5F33A 3UVEA 4D0LB 5HM8A 4LMRA 2PH1A 5A4FS 1NVEA 1VLQA 2VSNA 3JW8A 4ZP1A 3EF3A 3ESCA 1R5JA 1VTKA 1PGOA 4WEOA 1E6UA 3FNHA 5E7QA 3TEJA 1V41E 3HFGA 3IA7A 1CYEA 4RZ3A 4CM4A 4AJPA 3ZV4A 1XLTA 3RUEA 3A0RB 4YJ3F 3AHCA 4YPVA 4PCAA 2YZGA 4JSTA 2AL7A 3GRKA 1ESDA 3T5TA 1C7IA 3V46A 1J23A 5IC6A 2GERA 4A0FA 4RSMA 4HUQA 4PQEA 5HIIA 4GRAA 2ZRIA 4F3CA 3DDNA 2H17A 4FEGA 1D0VA 1KXJA 4I1VA 1E0KA 4RPHA 2WM3A 3ZVKA 5JADA 1T5OA 3A4VA 4Q03A 3HJBA 4YJ2A 4NMMA 1RVDA 4EOGA 3S27A 4PZ9A 1MOPA 2BTQB 2DT5A 4ONEA 4Y8VA 3OQ1A 1H94A 4Y2HA 5E9QA 3RTEA 4LJRA 1E3MA 1VJTA 2PJZA 3GO4A 1JHAA 3BT7A 4BEVA 3IQFA 4Q4HA 1BHSA 3GJTA 4A16A 4IDNA 5DN9A 3I61A 3DONA 4MS4A 4B2IA 4DV6B 3ZGVA 1U9IA 4TUYF 1RJDA 5IUKC 2GDZA 2ZITA 4CKBB 1EK5A 1FP6A 3LGAA 3BAZA 2OCAA 4BFLA 2WDPA 3LDAA 3THSA 4A8PA 3G8AA 4MWOA 1Z82A 4LRUA 4LQCA 4WNAB 2ZT6A 4L75A 3SC2A 3OQBA 3SQDA 3PTLA 4K40A 1Y3BE 3TPCA 3AKEA 2WNHA 3C48A 3HXQA 1ZU4A 5SY9A 2D3TA 2GBGA 3AJRA 1O5OA 4QBTA 1YCFA 2ARKA 3GWGA 2ZDGA 4Y30A 3EGWA 1XNGA 3PLAE 1C9MA 2IZ7A 3PYXA 1VSUA 1D0IA 1N6HA 2QS9A 3M5CA 4OP1A 2GRJA 3NHMA 3L6BA 1VYTA 2VCHA 3LCUA 2YVKA 4WMLA 3GT7A 4X6YA 5SZHB 4HGYA 1L5LA 4RTOA 3P20A 2AIRA 4L78A 5KYUB 3T1NA 3L7NA 3VKVA 5T41A 3JR3A 1LDGA 4ZIRA 4D0NA 4A0RA 2Q9AA 3K0EA 3BWBA 4QU0A 3ZLUA 4O2AA 2OQVA 1Z17A 5BOVA 5A7HA 4ZVQA 3DOHA 3WKEA 4LY9A 4RH1A 1VP3A 1IWBB 1YULA 4YECA 1PJ2A 2QM0A 3CC8A 3K32A 2BGTA 2VSOA 5ALZA 1HBJA 3ZWYA 3JTEA 3RNOA 3TLZA 3TZEA 2OFXA 4O4HF 1HDGO 3JQAA 4QTYA 1JA1A 1XOIA 2B37A 3ZCRA 4R2JA 1QH8A 3C6YA 5AW2A 1GJRA 4RCZA 3TMYA 3ZWMA 4OQPA 1AQUA 2C4MA 3UT5A 4WGFA 1PJCA 3QV2A 4QZVA 1E1NA 2A2ZA 5JMTA 3AV0B 2I1WA 1EFCA 1QFYA 1VMDA 2A92A 2R84A 5TPWA 4B0OA 2ZU6A 1XKTA 2KBFA 4RGBA 5IABA 2AUNA 3VQTA 2EFJA 3ZUPA 4I55F 4RD6A 4GMKA 4LXQA 4IQFA 1N92A 3PHLA 2C3UA 2GF2A 1M1YA 2QWXA 1RE1A 2PBZA 1N5KA 3DE5X 1QCYA 3EVBA 3O90A 4YT4A 2WINI 4E5MA 3RSHA 1DTWA 4FD3A 4FYXA 4QASA 5EFOA 1YZTA 2R5WA 1HG0A 3D43A 2QLBA 2W2VA 2ZYWX 1Q0HA 2XKJE 1AS3A 2DWQA 1T2VA 2HDOA 3DS8A 4EHAA 1WF3A 5ETJA 5EIWA 2HSWA 2QYOA 3JTMA 1BA2A 3UANA 3OZRA 2OHVA 2WU4A 1YB2A 2HMUA 4H77A 1UMCA 4YRGA 5DSZA 1J2YA 2ZBEA 3UAGA 3VVBA 4TL8A 2P4UA 1DXYA 2FPGB 4LDPA 3W79A 3I4CA 1V8BA 4F8YA 4KH1A 3CB2A 3O74A 3MTEA 4NNOA 3VOSA 4BKUA 4MCIA 4RA6A 2JLBA 3I0MA 5T6MA 1ICIA 4XSGA 1JJ7A 4EFMA 1XZNA 1RQ2A 2IWRA 3TJZA 1QGAA 3EDRA 1QYRA 3X1WA 1KEKA 1SHJA 2HMWA 3RARA 4PIPA 4FKBA 1NYRA 3GV0A 3NASA 4TQUS 4X97A 4XARA 1B43A 3IP9A 4Q0MA 1PSZA 3HNPA 3HZZA 5AM5A 4JDUA 2BZGA 4ZAFA 3ZZTA 5KYYB 2V7GA 3UXMA 3HV2A 4V2IA 1EXMA 2QZ9A 3BERA 4CL3A 2EF0A 2ZPTX 2B34A 3THXB 5C8XA 3WGUA 3LHSA 4ZHQA 3ACBA 1WW3A 4XGKA 1RFLA 4Z8XA 1JXQA 3EIUA 2HU7A 2V7QA 3TM5A 4C22A 3BFPA 2XRMA 1QIIA 5K01A 1VPEA 1TQHA 1XDUA 2I4RA 3WWOA 3ZJYA 1W4AA 3RUDA 4YV7A 3CM0A 3VZQA 1OZ0A 1LGYA 4M88A 1VE6A 3PE3A 4ARAA 1HLFA 3T0GA 4P0QB 2WYIA 1RHMA 4V03A 2JIQA 1HFKA 2WHPA 4OFXA 1L5NA 4A8JC 1GSOA 4AKTA 1O54A 4EYGA 2IYAA 2P2CA 4B6FA 1M8GA 1LNZA 1RQLA 3AM3A 3E5NA 4DNFA 4H6XA 1LPSA 2PRIA 3IALA 1IB6A 3FYDA 4B5LA 1GZUA 4KDRA 4GSKA 1L7BA 1YRWA 1N32B 1CRPA 3TXXA 1ZNQO 3N1UA 3RC9A 3PS9A 4KQXA 3MWJA 4R81A 4Q1AA 4JLWA 2LP4Y 3TPFA 1I9CA 3GCGA 2AD1A 3II6X 2NSHA 5CLGA 3ST7A 4BGDA 3CX4A 1XTSA 2Y1KA 4QNRA 1GPYA 3MJEA 3KUKA 4WZBB 3HI4A 3L01A 3GGGA 4F5WA 1AKNA 3QPWA 3I04M 3TLXA 1CUCA 1DAFA 1G8HA 1GXSA 4GXRA 1BYUA 1OAOC 3JCZA 5ALJA 1TC1A 4DZZA 1I4EB 1Q14A 2NQ8A 2E1RA 5BMVB 2I6TA 2WJ6A 1UUFA 2AFRA 3MTDA 5FBKA 4ALKA 1YTUA 1DV2A 2ZDQA 4LZWA 2R0QC 1DWUA 1WZNA 3VUEA 2PUGA 3KNZA 3TLCA 4MQMA 2P7IA 1G3QA 1GU1A 5A4AA 3KQLA 3W04A 1PGPA 4DDTA 3ENNA 1W46A 2BFEA 2R6FA 3FIUA 1O9HA 1EVQA 3B89A 4H3SA 4RE5A 3F5MA 4TLCA 1CHNA 4L4UA 2QZPA 1TX4B 2PNJA 2AUTA 4JJ8A 1YZFA 3JQFA 3WB1A 1BVRA 2NWQA 1Q15A 1WBJB 4HRXA 4KODA 3DD5A 2HJGA 1U8XX 5IYZB 5GV7A 5EVJA 1D2AA 2Q6IA 2QX8A 3STTA 4COKA 3OM8A 4KJXA 3W9UA 3PUVA 3RS5A 5COAA 1S3GA 4C2BA 4E15A 4FT4A 1QF6A 5TVKA 2FMHA 3H87A 4AO7A 2QTAA 3Q3IA 1CY0A 4BPRA 5KVCA 4B6QA 5JW6A 5EJIA 2AE1A 1QGZA 1MC8A 3R4CA 1Q17A 2ECKA 4GOXA 3ZU6A 2Q6LA 2ZTSA 1EUQA 4A92A 3E58A 1PFVA 1EEHA 4WL0A 3Q5DA 5BOSA 1TIKA 4JKOA 2GFIA 3NKFA 1EB9A 4HF7A 1RYBA 1VLVA 4O4JF 4GYKA 4ROSA 1GGNA 5E3HA 2XZOA 2FPLA 5DRTA 3IDSA