4H7JA

Crystal structure of haloalkane dehalogenase linb h247a mutant from sphingobium sp. mi1205
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 111
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7jA00
5EHQA 4Y2QA 1OILA 2O7RA 2XUHA 3F9CA 1JMYA 4LKOA 2VJAA 1GPKA 5HQ3B 2QUAA 1F8UA 2O2GA 4P08A 3CN7A 4QWMA 1EK2A 3PICA 5C8VA 2WG0A 2WM2A 3R41A 1QE3A 3O9MA 5DTIA 3DEAA 1GXSA 3IIIA 4Q3LA 2B9VA 2ES4A 3FYTA 1C4XA 1AX9A 4U2GA 4BB0A 3G9ZA 3G7NA 1A8UA 4GI1A 1P0MA 4YX9A 5AIAA 1TRHA 2QVBA 1UK9A 4H35A 4FKBA 3FSGA 5AKHA 3FSGD 2JBWA 4EY6A 4UHHA 2HA6A 2EDCA 4KR0A 1GKLA 4BBZA 4KACA 1JU3A 3NGMA 4B9AA 1DX6A 4BAZA 5ALYA 3I2IA 1NX9A 5IH7A 3WK5A 5LZ4A 2JGKA 3DYIA 4UFOA 3VJKA 4QEKA 1YAJA 5E4TA 1IVYA 1GPNA 4W63A 3AJAA 2Y2UA 4IQ4A 3R3WA 3GELA 1VKHA 4MYDA 3BJRA 1XLUA 3VVMA 1OXMA 3LLCA 3W05A 1LPBB 5AHXA 3BF7A 3C8HA 5ALLA 2HU5A 2ZJ7A 2ZYSA 5LZ5A 4P9NA 3AZQA 2OPHA 5D7BA 3IULA 3G0CA 4C87A 3HZOA 3A2NA 3I6ZA 5K5EA 3V1KA 1CEXA 4IO0A 2RIPA 4LXGA 4C6HA 1CFJA 2ZYHA 3HEAA 3M82A 3E3AA 2D5LA 4F0JA 4Y2SA 1XQXA 3FVTA 5BOVA 4DGQA 4RE5A 4L9AA 1ZIYA 3ZLUA 1UZAA 3BL8A 4UBIA 1F0PA 2PPLA 5ALGA 4FBLA 3H2KA 3D2BA 4X71A 1IZ7A 1HKHA 3DOIA 1BS9A 4J0DA 3DCNA 2C4HA 1LLFA 3MVEA 2XUQA 3V9AA 3QPCA 2G4LA 4A16A 2VJCA 3KWFA 3WL7A 2XB6A 5J3JA 3M81A 1X2BA 1TKRA 4YPVA 1RYYA 3DL4A 2XLCA 1CUDA 1JJFA 5DYTA 3IBTA 1WHTA 2JGJA 4H7JA 2PSJA 3AIOA 5LIPA 2HL6A 5HF5A 5CT4A 5K3CA 2WHPA 1WCYA 4AO7A 3L1HA 4DSZA 4HVTA 2WHQA 5AK4A 2ONCA 1PJAA 4BE9A 2HDWA 4FNMA 1E5TA 2Z3ZA 4B85A 2OGZA 2EDAA 5LLSA 2XUOA 5CMLA 1CR6A 4DTCA 1UKAA 3V1NA 2AXEA 3I1YA 3GROA 3PFCA 2C7BA 1BE0A 5FOQA 1OCEA 1VJ5A 2H9YA 5JD6A 4UBLA 2DHDA 3E0XA 5EI5A 2OAGA 4DNPA 4B0PA 1CUBA 4B6GA 4MQLA 1TCBA 1PV1A 3WWPA 2JGMA 3WA6A 3MGAA 1YSCA 3EF3A 5AJHA 5CT8A 1ZJ5A 2BKLA 2ORYA 1VXRA 2FUKA 3AILA 4PQEA 1QOZA 1F0NA 2WG1A 2HIHA 2RAUA 4QDUA 4UUQA 4JYPA 5ALRA 2ACEA 5D6OA 2QM0A 3ED1A 2J4CA 1DWQA 3FAKA 1Z68A 1YCDA 4Q34A 3H18A 2PX6A 4CI9A 2XMQA 1HPLA 5ALQA 3I28A 4NMWA 4S0XA 3K2IA 1QIMA 1MX1A 5ALEA 3S2ZA 2IITA 3PF9A 2V9ZA 1MTZA 1R3DA 1HLGA 1HDEA 4FLMA 4AZ0A 5HF9A 3VJMA 2XUFA 5CTAA 2HM7A 1G42A 4CG2A 1EH5A 4OB6A 2HA5A 1UKCA 1QGED 4K5QA 4B9EA 1EINA 2O7VA 4Y2UA 1XRLA 3I2GA 3VJLA 3OC0A 2XLBA 5HQ3A 2ZJ6A 3G02A 5FXMA 3AUKA 2BCEA 7YASA 4LYEA 1C7JA 2E3JA 1R50A 3HJUA 2WLSA 5C81A 3V48A 1K5PA 3L1IA 2FJPA 5FP0A 1XZKA 3ZLVA 3BJMA 2R8BA 1QIFA 1WM1A 3I2KA 4OUKX 5JARA 4L3WA 3GZJA 2Y6UA 3R0VA 2Y6VA 1JMKC 2OQIA 1XZGA 3WZMA 5AI9A 5LZ9A 1R9MA 4BVKA 3DNMA 4J0IA 1UK8A 3W06A 3G0IA 3H17A 1QFSA 2ZSHA 1N1MA 1LPOA 5EIEA 3S8YA 3DOHA 4ZV9A 4DM7A 1ODTC 2PKYX 1H23A 4GBGA 3WK8A 4DNQA 5HF8A 3WJ1A 4J03A 4H18A 1ACJA 1P0IA 1BRTA 2X76A 5AM3A 2HU8A 1UXOA 3LS2A 4UBNA 2QS9A 1MAAA 4I3FA 4QDZA 1HQDA 1TK3A 4X95A 3D2CA 4EHBA 3C8DA 1QLWA 1A88A 1U65A 4FBMA 3HLKA 5IVIA 2OCGA 3E1GA 2XMRA 1UOOA 4G4JA 3ZV7A 4UHDA 5DNVA 3SX4A 1CUFA 2XMZA 3ILSA 4BRZA 4G9GA 3MUOA 5ISMA 1QIEA 1LNSA 3QMMA 5ALNA 4N8DA 5AK3A 1UK6A 4W1QA 2QOEA 3DKRA 5ALPA 4NVRA 1EHYA 3LIPA 2I3ZA 3IUJA 1YB6A 3OM8A 2ROQA 1MNQA 1JKMA 2VATA 2QJRA 3DKKA 3WWDA 4NS4A 3C6YA 3GFFA 5AI6A 4KE8A 4MQMA 4EBBA 2WU4A 4ZGBA 1SCQA 5EHXA 4FLFA 1XZEA 2G5TA 2G63A 1IUNA 1JJIA 1W52X 5CH3A 2BAGA 2PSEA 1CUIA 2C5FA 1W1IA 4X00A 3SK0A 4AMZA 4PSUA 1MO2A 1MNAA 3STUA 1YS1X 4HZGA 5CT6A 1DQYA 3F97A 4X6XA 3VDXA 1DT5A 2D0DA 5HKBA 3OTQA 2ZJFA 2DR0A 3L1JA 2XMBA 5JD4A 1I6WA 4A5SA 2HU7A 1T4MA 5HK8A 4AN1A 3I2JA 1CUEA 4J7AA 2GBGA 1VLQA 1JT2A 5AKZA 5BWCA 4V2IA 4AO6A 4UBMA 4KJXA 1O6FA 4C4XA 1LPNA 4HS9A 1USWA 4IH4A 4W1PA 3V1LA 1ZJ4A 4LHEA 1CUHA 1R1DA 3W2TA 3D59A 1AMNA 1DX4A 1ZI8A 1CQWA 4FNGA 4H7KA 3ESBA 3Q8WA 1MX5A 3WKAA 1IUOA 4Y7DA 3E4DA 5LKAA 4EY5A 4QLOA 5A7HA 1PFQA 1KU6A 4GXNA 2AJBA 2HA0A 1CUSA 4G8CA 4Y9SA 3WK4A 3IURA 4GHWA 5E2IA 4N5IX 3GUUA 3FVRA 1TCAA 5LKRA 2XUIA 3N2ZB 5EHNA 5DYYA 1WB5A 4ETWA 4X91A 5C8ZA 3FLAA 4X92A 2QXTA 1QIIA 3SWWA 2CEKA 1ACLA 2JIDA 4OYYA 3R3VA 1DTEA 5FPPA 3KD2A 4MXDA 4GECA 4H0CA 3BIWA 2GBFA 5AI8A 4I4CA 4INZA 4UHCA 3D3NA 2OLEA 1WOMA 2WSLA 2O2HA 3W9BA 1GQRA 3EQ9A 1YR2A 1BU8A 1LZLA 3AFIA 5SYNA 3D2AA 4PV7A 2QJWA 1BEEA 1GGVA 1XZJA 1UT6A 4WCVA 2HADA 4B84A 2VT6A 4EZIA 2EEPA 2H7CA 3KOOA 4ZXFA 2DQYA 4M0MA 1C7IA 5AKIA 1CUCA 2YASA 2WFZA 2WJ6A 2WIJA 1EB8A 1LPMA 4ZRDA 1D07A 5HZGA 2V96A 1QZ3A 1EI9A 4KE9A 3M83A 5EGNA 1DU4A 3C6BA 3FLBA 2WHRA 1YAHA 4BCBA 4BVJA 2X5XA 3KSRA 4AMYA 1ZD4A 2VAXA 3WJ2A 4QDTA 5I7UA 1T2NA 4ZI5A 3LP5A 5AM4A 4DLNA 4HXFB 4E11A 3UUEA 4JUIA 4XWGA 4H7IA 5H3HA 1QIKA 3STYA 1WPXA 4JH0A 3V1MA 3K9BA 3H04A 1Y37A 1AURA 4F5ZA 3WZLA 4OPMA 4DSAA 1Q0RA 5ALHA 1MT3A 3BDIA 1XQVA 5AKYA 2GBIA 3LIIA 3UUFA 5HKAA 2XT0A 2J3QA 2W6CX 1CV2A 2JGIA 1YA4A 2DQZA 1QIGA 4BP9A 2HRRA 1ETHA 4UHFA 1VE6A 4UBKA 1VA5A 1MN6A 3QVMA 1VZ2A 3GA7A 4KRXA 3JWEA 1H2WA 2WFLA 3BWXA 4BATA 5IVDA 3H0CA 5A62A 5FDFA 1H22A 3WI7A 2BFNA 1CUVA 4Q3OA 1ZICA 5KWIA 4DMFA 4MEBA 1XZBA 1XKTA 4EUSA 4MJ3A 5AM0A 2IX9A 1XZLA 2QT9A 3CN9A 2XQJA 1FFBA 3IA2A 5FPQA 5FKJA 4X3CA 1EDDA 3F8SA 5K3DA 2JGEA 2LIPA 3A2MA 2CUTA 2BJHA 4PNZA 3FYUA 5DYWA 2HHAA 4BCDA 3CCCA 1AGYA 1AZWA 1ORVA 1ZI6A 1EVEA 3RARA 3STVA 1YS2X 2YXPX 1FFEA 1MU0A 4B7ZA 5K3FA 3M3DA 1G4HA 4MWTA 2XUGA 1ZOIA 2GZSA 4UBOA 4AQDA 4X7BA 4C01A 2QRUA 3IVMA 2VTVA 3H2HA 3PFBA 1MAHA 2I03A 3C87A 1AUOA 4KE6A 3H19A 1QTRA 1LPPA 4BVLA 3QYJA 3IUNA 3BE8A 5CBKA 4N8SA 1ZGCA 2HA2A 4PO3X 4G5XA 4H7EA 2Y2VA 3IB3A 5CH8A 1E8NA 4OSEA 5I9IA 1ZI9A 2XQKA 4OU5A 4OU4A 4EA6A 5T4HA 1XZCA 3FWHA 2PUHA 4B82A 1M33A 4M0FA 4X97A 1E3QA 2Z3WA 2OQVA 1CUXA 3H1BA 4X93A 1GQSA 3A2LA 1CLEA 3C70A 1IUPA 2QR5A 3OPMA 3R3ZA 6YASA 4QA9A 2BUAA 4LXHA 4BRSA 1JJBA 3YASA 2VA9A 1K8QA 3G0BA 3HABA 2CBGA 5LZ2A 3ZPXA 5ALJA 2C0PA 4B80A 1XZIA 5ALUA 2VQ6A 2XMCA 1CUYA 4ARAA 1UOPA 3QBJA 1CIJA 2B20A 1JU4A 1UWCA 2WUGA 3FCXA 5A7FA 1FFDA 1XRMA 2GBCA 4W1SA 4JNCA 1LZKA 5JAHA 4KAJA 3R3XA 3QPAA 4UFPA 1MPXA 3C5VA 4Y2RA 2OAEA 3FCYA 1U2EA 4W1RA 3O4JA 4ITVA 3TJMA 1XZAA 3TEJA 1YA8A 2PM8A 4Q05A 2UZ0A 4GLBA 1CUUA 4G8DA 2WHPB 5AOBA 1TIBA 5ALKA 1XROA 4H7FA 5T4FA 1ZGBA 3C5WP 2OXEA 1NU6A 3WMRA 4FLEA 3CCBA 4FOLA 1KU0A 1AKNA 4FMPA 4WFKA 3T52A 1E8MA 3HSSA 3RK4A 1S8OA 2QXUA 2XQGA 1XQYA 4CIBA 1QIJA 4JEIA 5BV7A 1DINA 2AJDA 2R11A 3X3HA 1N5RA 4H7DA 4LXIA 5JZSA 5AKJA 5ALOA 5AI0A 1CUGA 2VAVA 5A6VA 4TPKA 5JAOA 2GYVA 5EHZA 4G1FA 5CXXA 2XUDA 5CT9A 5CXUA 5HK9A 3HC7A 4ROTA 3ZI7A 2XUKA 1W76A 4KE7A 1CUWA 1LBSA 1EDEA 4AO8A 2BUBA 4E46A 4C88A 1AC5A 1CPYA 2PUJA 3H2IA 4FDMA 1U8EA 4BZZA 3QPDA 1IZ8A 1UKBA 2RONA 3I1IA 4K6GA 4DMCA 1FFAA 1QO7A 2Y1KA 1DWOA 1QJ4A 1XLVA 1XQWA 4NZZA 4LIPD 1MX9A 3PF8A 4WDRA 4OB7A 1XKLA 1E66A 1L7QA 3G0DA 1J2EA 4TGLA 4AXBA 3WLAA 3ESCA 5ALFA 4U2CA 3WL8A 5CT5A 4ARBA 4MEAA 5AM2A 1RWQA 2X8BA 5JASA 2NW6A 2ZVDA 3FBWA 5K3EA 2DHCA 2WILA 5LZ8A 5BWBA 4QE3A 4RGYA 3WL6A 4UHEA 3WKDA 1JFRA 4AB1A 3B12A 4XIIA 4C89A 2GYUA 3RLIA 2PL5A 5JAPA 5YASA 1CUZA 4E15A 2I3DA 5AKGA 4BTVA 3STTA 4C4YA 3WA7A 4KEAA 3VVLA 2XUJA 4YK7A 3C6XA 3KXPA 3F96A 3WKCA 2BGRA 1LPAB 4FWBA 2WTMA 4P92A 2XDWA 3EQ7A 1U4NA 3IUMA 1VA4A 4WY8A 2QTBA 4E14A 2ZYIA 1W75A 1Q84A 3BXPA 5AI5A 1ZD3A 3D4LA 2WIDA 1ODCA 3I2HA 3B3QA 1XZDA 1NU8A 3QMVA 2H1IA 5AKKA 3VXKA 2WUDA 1SCIA 5ALDA 2HFKA 4PW0A 3CXUA 1XRPA 1SFRA 3AIKA 4RNCA 2Z8XA 3W04A 4KAFA 4OB8A 4WFJA 1EXWA 2CJPA 4BYMA 3ANTA 1QONA 3QITA 4HAIA 5FUMA 1RP1A 3DL7A 2Z5GA 1JI3A 5JD5A 3O0DA 4J0GA 4HTAA 1FFCA 1VOTA 3AINA 5ESRA 3JYHA 4WFIA 2JEYA 3QZUA 1EB9A 3RKSA 3STWA 3PUIA 3G0GA 4Y2VA 5IKXA 1HL7A 1WB6A 2WUFA 1B6GA 4XX1A 1QFMA 2OCIA 4CCWA 2CMFA 3WKBA 2XI4A 1Q83A 4WJLA 2WQZA 3B5EA 4ZV7A 4IH9A 2YYSA 4CG1A 2XE4A 3WIBA 4PSDA 5DTJA 3P2MA 4BC0A 1TCCA 4J0HA 2XMDA 2PU5A 1Y7IA 5FV4A 4CCYB 5LYYA 1A8SA 1TQHA 3WWOA 3AZPA 3I6YA 1QTIA 3U0VA 3PE6A 5AI4A 4Y2TA 3I2FA 4K2AA 4BZWA 5JYCA 1DT3A 4WY5A 3OURA 1L7RA 5CH5A 4X85A 3JW8A 2DHEA 4IHAA 3DDUA 5CURA 2JGFA 3AIMA 3BF8A 3OOSA 4HXEB 2ZSIA 1DQZA 4KYVA 5D3KA 1LGYA 1W4LA 4U2EA 2XMGA 1SOMA 5EIAA 3H1AA 2JGLA 5ALTA 4A23A 4H7HA 1E8DA 2XUPA 2O2IA 3F67A 4X90A 1A7UA 5ALMA 5JALA 1FSSA 3NUZA 4OYLA 4XJVA 3W9UA 1KEZA 4OCZA 4U2FA 1QIDA 2XQFA 1CVLA 2ECFA 3FOBA 4QDXA 2QZPA 3NWOA 4UFNA 4Q82A 3ICVA 5ALVA 4L0CA 1YASA 1ORWA 5D3ZA 2DFPA 1EX9A 5K3FB 2HA7A 4DNOA 2XQIA 5C8XA 5KREA 1J06A 5A2GA 4EY4A 5I8PA 3C6ZA 5ALIA 3QH4A 3KDAA 3DQZA 5AO9A 4J0KA 2QUBA 5AKXA 3Q0TA 3G8YA 1W6RA 5K3AA 3D0KA 4N5HX 4X6UA 2J4FA 5AOCA 5IVKA 3IUQA 1XZMA 2VF2A 3O4IA 1THTA 1P0QA 2GYWA 2HA4A 4BDSA 4CG3A 4DMKA 3WYNA 1HBJA 5KWJA 1ZIXA 3GBSA 1N5MA 4X94A 5ALXA 2B4KA 2C58A 1XZFA 1H2ZA 5AK6A 4QZVA 4QLAA 5DJ5A 1XLWA 1F6WA 4F60A 3HI4A 4B83A 5FLKA 1BCSA 3WKEA 1A8QA 2HFJA 3A70A 3LCRA 1R88A 5JAUA 1J1IA 3A6ZA 1ZD5A 1H2XA 3HACA 2ACKA 3PDCA 1VXOA 4QWWA 1XRRA 4ZREA 4UHBA 4KRYA 4G9EA 1WB4A 1LBTA 3O9VA 4J3JA 1WHSA 4IH1A 1TAHA 1MJ5A 1H2YA 5AK5A 5LZ7A 1ODSA 2VJBA 1R4ZA 2RHWA 3EQ8A 3WQHA 3C45A 5A7GA 2CZQA 2RHTA 4L72A 4P93A 1X2EA 4Y2PA 5AKLA 3WK7A 1K4YA 1BEZA 3R40A 5ALSA 3D5EA 2GZRA 5AP9A 4KAAA 1XRQA 4OD0A 3R3YA 2V97A 5EIHA 1SCKA 5AOAA 4N8EA 5A71A 3KWJA 4EY7A 4DNFA 2FX5A 4BAGA 3K6KA 5AIBA 3DS8A 3MUNA 1EK1A 5AM5A 1YB7A 4FFVA 2YH2A 5SYMA 1O6GA 2C0QA 5JADA 4FFWA 5FRDA 2BUCA 4UBJA 4TVKA 1XFDA 4U2BA 4EY8A 4MYSA 4BC1A 2WKWA 3WWEA 4AZ3A 2IIVA 3WK6A 1CUAA 1QIHA 5HFAA 4PSCA 2CKMA 1UOQA 2PSDA 3I6MA 3EBLA 4X6YA 2WU3A 2Z8ZA 5DLPA 1VE7A 4HXGA 5ALWA 5K3BA 4QDOA 5JANA 2QKYA 2HRQA 5E4JA 4GW3A 4BAUA 3G9UA 4H77A 3U1TA 2XMSA 4G4IA 3DYVA 4AX4A 4XVCA 3AZOA 3QM1A 4GDMA 3H2JA 1N8SA 3O4GA 4BP8A 1P0PA 1XRNA 4DYHA 1UK7A 4JYMA 4CIAA 2OGSA 2OG1A 1G66A 3FYUC 2OGTA 2B61A 2DCMA 3ANSA 4J0CA 2WTNA 2Q0XA 4HRYA 1GT6A 4K6HA 4MWSA 2DSNA 5T4EA 3ZWQA 1BCRA 1CUJA 2H7YA 4D9JA 5AH0A 5JZBA 5F4ZA 3SC2A 1GZ7A 4AN0A 2WUEA 3PI6A 3EIOA 5T4BA 2CB9A 4Q1VA 2AJLI 1EA5A 2VJDA 3VISA 1L7AA 3O95A 3BIXA 2K2QB 4RPCA 5EFZA 4C4ZA 5E4YA 3ZLTA 2WJ3A 3IDAA 3WWCA 2OCKA 5HFNA 5DWDA 2W22A 5AM1A 3N0TA 4HRXA 5AKEA 4YASA 4WDQA 1GPLA 3TRDA 3T4UA 5JATA 1IMJA 4I19A 1DWPA 2RGUA 5JIBA 4Z49A 5HF6A 3C43A 2PSFA 3ESDA 4Y2JA 3PUHA 1VZ3A 4K6KA 1CQZA 4BTLA 4RE6A 3G9XA 1EVQA 3WK9A 2RI6A 1BN6A 1AQLA 2PBLA 2VEOA 2AJ8A 4GEGA 3FLEA 4DMHA 2ZYRA 4M0EA 3R3UA 1CRLA 4G8BA 2PSHA 2C5GA 1X70A 1K63A 3HYSA 1GKKA 2HA3A 3DLTA 4U2DA 4GWLA 3FYUB 5ALZA 1E89A 3VKFA 2H7XA 4DIUA 2G5PA 3WYDA 3ESAA 5CRIA 2QMQA 4PF1A 3ICWA 1EDBA 2BGNA 3OG9A 3WL5A 4LYDA 5CW2A 5IVHA 2WFLB 5AICA 4B0OA 1FJ2A 1R9NA 5KBYA 3HRHA 4F21A 4Y2YA 4Q3KA 3D7RA 4EB0A 1QO9A 4O08A 3H2GA 2FJ0A 2XUAA 4ZWNA 4CCYA 2WIFA 5HCUA 3BDVA 3G9TA 1B41A 2AJCA 2WIKA 2V98A 3QMWA 4BDTA 1UFOA 3FNBA 1WPRA 1J07A 2PU7A 2VSQA 4G4GA 4FHZA 1THGA 1Y7HA 4FTWA 3STXA 5DNWA 2OCLA 4UPDA 2JF0A 2WFMA 1Q0ZA 1BN7A 1K6EA 1BROA 4BCCA 4QNNA 4W9RA 1SC9A 2WJ4A 2J3DA 1LPSA 3F98A 3WIOA 3RM3A 5C7YA 3O4HA 4J0JA 1ZD2P 3DD5A 2WG2A 3TGLA 5DNUA 3HXKA 1XZHA 2I78A 4Y2XA 5JZ9A 4CFSA 4BE4A 2WIGA 2P8SA 3DJYA 3UMJA 2VT7A 2PVSA 4B81A 3NOXA 1ISPA 5LP1A 2JEZA 1G5FA
chains in the Genus database with same CATH superfamily
4XDGA 3RC7A 1CDOA 3WE7A 4BIIA 3NALA 1TJPB 3PP8A 5GAJA 3ZDYB 1LW6E 2YWRA 1OWNA 4ND3A 4I50F 4F6RA 3Q8LA 2XUHA 3AV3A 1ZLYA 1JMYA 3NRJA 2Q0QA 4U9HS 3QXHA 2C5AA 4GEKA 4WOBA 2IBTA 1ULTA 3IV9A 4KCGA 1GPKA 2LDXA 5AVKA 3GXOA 4GQAA 4MNTA 3S99A 4ECEA 3H65A 3F2IA 3AUJB 3KJGA 3N70A 1Y6GA 4N40A 1OTHA 1Q77A 1TZKA 1A4UA 4XJXA 1LSSA 3I04M 3O7WA 4DY4A 1ZK4A 1IFXA 1NXWA 1O94D 5C8VA 1GYPA 1GAXA 4ND5A 4B3IA 1ZM2A 5CXSA 2AYZA 4CTOA 3V7NA 4X20A 2B3DA 4YAOA 1QCDA 2PO7A 3LC2O 1SY7A 1ZFNA 3WGNA 2V7PA 4OP1A 5AD1A 5HOQA 4B46A 3G5TA 3ZE0B 3IIIA 3SHVA 1IZYA 2C8VA 1C0EA 4Q3LA 1UJ6A 3LCCA 4KLAA 3DF7A 1RADA 3DR5A 1Z4PX 1NFQA 5HTKA 3SLKA 3LQKA 2R97A 4D5GA 1PG5A 5IUKC 1C4XA 2QR3A 3I0NA 5CGZA 4UTOA 3PLAE 3LKBA 4U2GA 1A5BB 1M66A 1JKJA 1O6ZA 4HWKA 4I4NA 1I1HA 4RELA 4RPHA 2XBLA 1A8UA 3PEYA 4KW7A 4PG4A 3GJXC 3GJZA 4RZQA 1PQWA 3ZHRA 3WC4A 3LRTA 3F5SA 2C42A 4JYZA 3COSA 1JNYA 1SCUA 2EP5A 2W9XA 1L4UA 2YCLA 2ZIAA 3UHAA 1W0KA 3DULA 3UJDA 1H8HA 1GGFA 2RH8A 3WGVA 3OU2A 1TRHA 3NAMA 2QVBA 1CEYA 4P35A 3STHA 2ZWPA 2O2YA 4V38A 2GKGA 2ZIGA 5DT9A 2CXOA 2PLWA 2NO0A 4AMGA 5KJCA 4EF4A 1C7RA 2HIGA 2Z43A 1F2DA 3DMGA 4M0LA 4Q7MB 3U4HA 2NO6A 3FSGD 3FRJA 2QGNA 3G23A 4MRVA 4OSPA 3IEUA 3RT7A 1JA9A 1YMQA 2HA6A 3DC2A 4NV0A 3SN6A 3SR0A 1RZUA 3N8IA 3QQPA 1IXZA 1T1JA 3IQFA 1RWXA 1X7XB 3HCPA 2F8MA 1UKYA 4OHVA 3R7LA 5C8DA 2XAUA 3IAUA 2C5SA 4B9AA 2XEXA 9LDTA 5KAPA 1HC7A 2MTBA 3GZNB 3QSGA 3I2IA 3JD1A 1NMZA 1NX9A 3TZHA 3FPFA 4FFRA 4MVJG 5IH7A 5JC8A 3REFA 1RSZA 4ZT5A 2BMWA 2ZRLA 1IBLB 4BLPA 3FYHA 2VDVE 3VJKA 4DJTA 2PBZA 3FF1A 2AYXA 3W5VA 1GARA 1UFQA 2UV8A 3NU1A 2AV6A 5E4TA 1IVYA 1VSVA 1JAIA 4P32A 3IMKA 5BWNA 1J0CA 1XMXA 2OVFA 2QN3A 1OH7A 2Y2UA 3KKNA 1BA3A 1Y82A 5TVKA 5KTSA 4KV7A 2I7XA 3NDPA 5E1OA 2I6TA 1OVGA 3IP3A 3GELA 4BKOA 3EC7A 5EKSA 3REOA 2PUGA 1EP9A 2FAXA 1QH9A 1XLUA 1WSWA 2PYIA 3VVMA 5DM4A 4Z7OB 1CNFA 1NQTA 1U6JA 1X13A 1LPBB 2C4TA 4YJ2B 4CXMA 1R0RE 3HA2A 4H6WA 1JDUA 1TW2A 3ZHQA 2C5LA 4O8ZA 2IYFA 2F3TA 1TMYA 1X7DA 4H1TA 4JX8A 3SGLA 2MSWA 3O91A 1L9KA 1E9BA 1AXEA 1VHTA 2A86A 3H1FA 4KXXA 5FI1B 2Q2VA 1J70A 2HU5A 2V58A 2DFDA 2Z5VA 2ZJ7A 2J9FB 5D7BA 1CJUC 3WQQA 5FL7D 1VC2A 3G0CA 3MJRA 4KB5A 2ZJ3A 3BQMB 4E08A 4ER3A 3UJNA 3HZOA 1N2BA 2A5YB 2PD4A 3D3WA 5ECYA 1SUBA 5IJ0B 3I6ZA 2WQ7A 4MLZA 1RCFA 2FSFA 2WM9B 2Z57A 1OB2A 4C6HA 2PUAA 2FN9A 1P1BA 3H5IA 2V6GA 3CJRA 1UJ5A 4K1LA 1TCUA 4LMRA 4NQZA 5J4YA 3DLBA 1SMKA 2G5CA 2IEDA 3GDHA 3VGPA 3RSHA 5JYBA 1OB5A 4U9IS 3WMEA 4XOUA 2BBSA 2CNLA 4RE5A 2QP9X 3TLXA 5JU6A 4XJTA 1JLRA 1R6VA 3PDHA 4L9AA 1ZIYA 3FSRA 5K05A 1G3QA 1QORA 3PT5A 2OOSA 3DWEX 3BL8A 1KKMA 4NATA 2FSPA 3OCJA 4UBIA 5IJAA 4ESEA 4E2WA 3QTBA 1HZZC 1Q74A 2GCPA 2P9CA 1G4UR 1YR7A 1WLYA 4TZKA 1J8YF 1IZ7A 1HKHA 3O8OB 1RJEA 3DOIA 4X8LA 3GQVA 4K05A 2F1OA 3B36A 3O2SB 1A98A 2BGTA 2HSZA 1M5UA 1W36B 1B8NA 1NMQA 2O7QA 2C4HA 3DCNA 3V32A 1I5RA 5INTA 3BL5A 1C81A 4KP7A 3D7MA 3FCAA 3MVEA 4MVJD 4O2BA 4M86A 3CINA 5AJUA 5EOVA 3VPAA 1N1EA 3QPCA 2WWXA 2G4LA 3L4BC 2H2DA 3KWFA 2XB6A 3R0XA 4JOSA 1NVVQ 1WW2A 3CNEA 1U3GA 4H6VA 4R7GA 1GCIA 4G85A 1II8B 3JQ7A 1H0RA 1J6UA 1RYYA 1KC3A 2PD3A 3DL4A 2ZM5A 3FTPA 2WYHA 4GFDA 4L2IB 1CUDA 4MVCA 5ICFA 2SECE 1I2CA 3MCTA 2Z98A 5DYTA 5KWEA 4S1WA 4ZPJA 3VPSA 3NYIA 2NZUG 4DLWA 4JL8A 3V8QA 3AL2A 4ZXPA 4H7JA 6Q21A 3FVQA 16PKA 2PSJA 4GQBA 3W6PA 5KTNA 5LIPA 2XF2A 2HL6A 1VMEA 4KYIB 4DCPA 1KGDA 4F06A 4BNWA 3AXSA 1L8XA 3MD9A 4OX9B 1WCYA 2YXDA 2R79A 1UAAA 3EH2A 4PLFA 2ZUWA 4KMSA 4WNYA 2NO1A 4X5OA 4RXUA 3QLVA 2H54A 2OO7A 5AK4A 3AHFA 3QV1A 2LCIA 1OAKA 2YJ3A 5FQOA 4MVJH 4R8SA 1KAMA 1LTHR 1VDZA 2HDWA 3M5WA 1E5TA 4UZEA 4YYEA 5CLFA 1DRJA 1EEXB 5LLSA 1Z08A 4PCAA 1CR6A 1AY0A 3RUIA 4UM8B 3QUSA 4KJZA 2CJXA 4LRSB 2I9KA 5ECWA 1XD8A 4DTCA 1B8OA 4C5BA 1Y6FA 4LC9A 4ZYZA 3O73A 4RY0A 5BOSB 2I67A 1XVLA 5E7QA 1XAHA 3G68A 2OLKA 3AERB 4K0RA 2YOGA 4H0NA 5DM2A 1E2JA 5B3JA 3T4PA 4DWOA 2GM4A 3SAJA 4O4JF 4RTRA 3DHVA 4EGQA 1GPDG 1JBKA 4JEMA 5JCJD 1CUBA 2PZAA 2D1FA 1ZG3A 4MQLA 5IAOA 2FEOA 5DBHX 3T4XA 2GA9A 1YZGA 4OUDB 1TCBA 2AQ8A 3HBAA 3SP1A 1PV1A 4LJRA 1D2HA 2PBFA 1UC4B 3DHYA 4JZYA 1P7PA 3ZH9B 4GL4A 3W2GA 3ZOKA 3CVUA 1RYNA 2HSJA 1ZN2A 3OIWA 4FSXA 5CT8A 1ZJ5A 1PUXA 2EGGA 1D4AA 3DW3X 3H4VA 3PXXA 5AJHA 3L49A 4CW7A 4KC0A 1E60A 1WXIA 2O3SA 3KZVA 1XXHE 2WAYA 3HY4A 1F0NA 4Y30A 4C3OB 3WJAA 1EE1A 5GGXA 1WZUA 1JFFB 4TLBA 4ZOAA 4UUQA 1YQUA 3KZ1E 4JYPA 4EITA 1QQ7A 3OLWA 1OZGA 4FT4A 2ISCA 1OYWA 3ED1A 3LZ6A 1YNOA 1HOXA 2J4CA 4IMPA 3K0HA 3WGLA 3GAZA 2QE7D 1B16A 1YCDA 3TYXA 4CKYA 3OTHA 2W6JD 4DFDA 2HCJB 3WXMA 3AHIA 2B0JA 3BJEA 3PTLA 5DISB 4F1KA 3W8EA 4F4UA 5BRJA 4U7DA 2G76A 4X8MA 2OBLA 4G81A 1SXGA 1GKYA 2PQ0A 4UC0A 3RS5A 1JDVA 5ALQA 1CW2B 3ZGNA 4NMWA 4EPWA 4EGAA 4S0XA 2E4XA 1P1RA 1K7SN 1E9VA 1MPTA 3KVNA 4E07A 3NIDB 4E5PA 5KSOA 3H05A 4YMLA 1CS0B 4Z9FA 2Y1XA 3S2ZA 5JNWA 2YJZA 4DUZB 2QSZA 2OK8A 1J8DA 1T5TA 2GK7A 2V9ZA 3L1VA 3O83A 1MTZA 2JLSA 4C06A 1WQ1R 2V8OA 4MICA 4AVYA 5F23A 3ZKWA 1G2PA 5C3MA 2VRWA 1SBYA 2P3OA 1OR8A 5IXYA 1BQ4A 2Q9UA 4PCUA 3H1TA 4L8YA 2XCTB 4KWTA 4AZ0A 1QCYA 4D96A 2GJAA 3N5CA 3TNLA 3HMQA 4XUGB 1KFKB 4N7RA 2HM7A 5IZCC 3EIFA 4QBIA 4HCJA 3G82C 3VUFA 5JQGB 5KNDH 4LHSA 4KU4A 1T9CA 2BTQB 5HBRA 1YRAA 1UKCA 1B23P 2G6TA 3W5HA 2JIQA 2WW8A 3VV3A 1EINA 1XEXA 2BISA 2O2CA 3BWCA 3NXKA 4YREA 5DBFA 5DH9A 5DN6D 5LOVF 1E2NA 3EVZA 4HLCA 3N2GA 1KNXA 1B0AA 1XK7A 2ZJ6A 3CKMA 3G02A 3G5AA 3G9QA 4H31A 4RKWA 1HDZA 4KPFC 1TTPB 1M7GA 2NVBA 3V6LA 2E3JA 1JJVA 2QV0A 1XWIA 4NBSA 1JR3E 3RSQA 3B85A 1R50A 2DKNA 3U31A 5NULA 1TADA 4PYLA 3UJ8A 1Y8ZA 4W5NA 1ZISA 2Q9BA 2ZWOA 4BFSA 3UFXB 3PWSA 2I76A 2P4EA 4D9KA 4I5EA 1E2FA 4FW9A 1GTZA 1JX6A 5FP0A 4UMDA 1DBPA 2FG5A 4IYJA 1DAIA 5CBPB 2WMNB 4KPEC 1W4ZA 4MVJE 2O3RA 5G0WA 1Q7CA 2XA9A 1N2JA 1I0LA 4L3WA 2P0YA 4V02A 3CS3A 1CRQA 3H0KA 5DSTA 4ZVTA 1E77A 1WUKS 1NSYA 1CRPA 2OXRA 4A9AA 2HWYA 2Y6VA 1EWKA 2ZIFA 5LQSA 5EMNA 5LDDC 2DMRA 4JJFA 1R12A 4MRRA 3MINA 4REQB 2ZYUX 4WBNF 1EWQA 3T9FA 3ODGA 4A0GA 1AUVA 3IRUA 2WJZB 1NF2A 1J00A 5DNDA 4BFCA 2EJBA 5BWMA 3RAFC 3A4MA 1FPQA 1UXJA 4O1HA 1OVMA 3GLQA 1GIAA 1UK8A 5KNLA 1YDWA 2FP4B 2IE8A 1G20B 1NULA 3LTEA 2ORED 3VSEA 3D4BA 2LWIA 1AUQA 2YZKA 4LK2A 1IBKB 1N1MA 1LPOA 1JHXA 3VU3A 2FPWA 3DOHA 3FN4A 4ZV9A 3Q3HA 4PLPA 2HLPA 3RHSA 2X7XA 4DV3B 1PV2A 5C52B 1IULA 1F3LA 5EWLA 1G5RA 5TB5A 5IFKA 2UVQA 1RM5A 4GBGA 1VL6A 1XMIA 1U2GA 1OXKB 1XF1A 4RL4A 3SHTA 2HNKA 4MTCA 5FI5A 4NK5A 4H18A 4QJ3A 3EWAA 4BO0A 2R3SA 1PTKA 1OGIA 4DF3A 1ACJA 5KDLA 1P0IA 4WY2A 2A5DA 1WETA 4XE5A 2EFJA 1O9GA 1K7FB 2EG5A 1BGVA 1UXGA 3NT5A 3RFVA 1DLJA 2WHXA 2PKQO 3W7VA 4LWZA 4DGSA 4YJ3A 1H3FA 1GQ2A 3N86A 4UBNA 1OH8A 2H52A 4IGEA 3BZBA 4BPBA 3AY7A 3DZGA 2H4FA 3W5IA 4BTEA 3BE5A 3Q9NA 1C7FA 5TPWB 4MDEA 4QDZA 1N1DA 1DEXA 4R54A 2VF7A 3VPDA 2R4QA 1Z29A 2GVNA 4P7BA 5F64A 1KBQA 5JBQA 3LL7A 4MCJA 1KY5A 1XX6A 4BQSA 1L3IA 3RKUA 3THXA 4CG0A 3LV8A 5D01A 3WO1A 1A9YA 2AW5A 4X63A 1QLWA 1AT1A 1BJRE 1CBUA 2UYQA 4MVYA 3UMBA 3ZZMA 5CFMA 2B8NA 2WKRA 3I34X 2D7CA 3C7TA 4A2WA 1YO6A 3F1KA 3QUCA 4BNHA 5BT9A 6NULA 1L7PA 5IT5A 4O02B 4FBMA 3Q7TA 4OIMA 1UM8A 1DC7A 5T3UA 4F71A 3KL4A 2HF2A 3CUYA 3EEFA 2ZPAA 4TLCA 1WW8A 3F7NA 3KHUA 2J33A 4G4JA 3ZV7A 3MBOA 4Y6PA 1NHWA 4DT1A 4DG5A 3U7QB 5DNVA 3SX4A 1CUFA 4BMNA 1U2PA 4Z6KA 5I9NA 3OIVA 3OEED 4D82A 4TTJA 4LYHA 2J59A 3M4YA 2O48X 4Q4CA 2JJ1A 1GFZA 2YMMA 2WI8A 3MUOA 1RPJA 3N8DA 4YJFB 3PKZA 2DERA 5C80A 4WI1A 4F1WA 3THRA 3VYRB 3AU8A 2HNAA 2AMFA 2NLOA 1Q20A 5ALNA 5JTTA 4FUTA 3SDBA 3DPSA 1KDTA 5AK3A 5ITSA 1S02A 4MP6A 2QOEA 3CLTC 1Z33A 3A3YA 2P6OA 1TLFA 3FA2A 5B7NA 1RXSA 1F38A 2H59A 2JDIA 3ZVRA 3OZCA 5I8ZA 5ALPA 4BNNA 3HB0A 3SFVA 1DAFA 1Q3HA 3LBIA 3MWGA 1T9HA 5LD2C 2CWDA 4BWGA 2CW5A 2PZLA 2C3MA 2H5JA 3E3OA 3IUJA 2IYNA 4R8KA 2CL6X 4NCBA 5BURA 3CPSA 3ANXA 4DZRA 3IVRA 3MELA 3WWDA 2ORVA 4KE8A 1XPJA 3U16A 1OU0A 5LQAA 1UBRS 2MWMA 5CB6A 1HKUA 3FCCA 3UAWA 2AJTA 2W6ZA 3OUUA 2ODAA 1EIZA 5FNVA 3OZEA 4L3VA 1E7QA 5EHXA 4JI5B 4AJNA 1H42A 4R8VA 4YJ3F 5LXTA 1XZEA 4Q21A 3BWMA 1MJNA 1EK5A 5AVVA 3KC2A 4F97A 3RRMA 2E4UA 1EBFA 4QQNA 5CH3A 5HSGA 1ECFA 2CXNA 2BZSA 3H87A 4QUGA 3U1VA 1Y89A 1CUIA 4CIVA 5L3QB 4N65A 1TA9A 4L5IA 4BMDA 3EXIB 4YT2A 1SUIA 2W6MA 2WP8J 2FFHA 2WWTA 4Q39A 4TXLA 2H85A 5EXPA 4BO2A 5I4CA 5IABA 5JAIA 3L82B 4CIYA 1AHHA 5F1OA 3U9LA 2AN5A 1RI5A 4G0MA 3L7LA 2NO5A 2P90A 2QG9A 2CBZA 2NUAB 3K8ZA 2GXAA 4QXQA 3ZCXA 2QTLA 5ELMA 4ME6A 1CHNA 1TD1A 4UVGA 3TH5A 1G291 3GLIE 1FS4A 4HNUA 1T35A 3IOEA 3FHLA 3F97A 5B6PA 3KEMA 4N76A 1XJQA 3K53A 2G25A 5F2KA 2D0DA 3B7GA 4QU5A 3WRVA 4D9HA 4H6XA 5LDGA 1GZUA 2IYTA 4BQNA 1D4OA 3ROFA 5C1OA 5TXGA 3DE6X 1ODIA 2OHIA 5C8YF 3L1JA 2FUCA 3D4PA 3QBDA 3NTVA 5K3SA 2YQ4A 1GRRA 3FE2A 3BEOA 1A8IA 4JLJA 4A5SA 1XAJA 1YVUA 3FYCA 1OFIA 4R84A 1L4LA 1G6Q1 2QAJA 3PE4A 4MSUA 4QYSA 4V0RA 3VI4B 4RKQA 3JAWA 3K4HA 4BX3A 1NLZA 1VRCA 1WXDA 2H29A 5A04A 2HNBA 4LCEA 3TBFA 3KVVA 3WLHA 2EARA 3W5AA 5AKZA 2JLXA 4V2UA 4NEHB 1PG2A 4AO6A 4UBMA 2ZSBA 5DCWA 3TRFA 5JSZA 1V8DA 3I52A 4Y7CA 4RTSA 2I4NA 5CFNA 4N49A 3OF2A 3CZPA 1M74A 5AESA 3QVGB 1MBZA 2F7SA 1E2KA 1J25A 1PS8A 1TM1E 1M34E 4GRIA 1LPNA 3FBGA 4HGYA 5DCYA 3ACBA 2VK8A 2PN1A 1RFLA 3EHDA 3KZXA 3Q72A 1JECA 4INPA 4Y9TA 2PL1A 2VTBB 2QSUA 1DDIA 4B6QA 1JT9A 2M1ZA 3PSAA 4DCCA 2APJA 1II9A 3OUTA 3OD1A 4CLXA 1USWA 3MMPA 4IH4A 2NU9B 2UUAB 4YQEA 3VAAA 3PFFA 1VJ0A 3B9QA 4DPKA 4J1TA 4BGIA 5TIIA 2C88A 1AKWA 2BMVA 2VUUA 5LOVB 4QVIA 2X0IA 1SURA 1TT5B 4TSRA 3SQNA 1R1DA 1YULA 4O4IB 3NTXA 1VL1A 3RWBA 3W2TA 5LP6F 3QENA 2CFRA 1V47A 3CB4A 1NUHA 4MULA 1FUIA 4G84A 3KPWA 1UFKA 2Q49A 4FNGA 2RE8A 2FDXA 5E0OA 4H7KA 1U11A 5KI6A 1JG4A 5B7PA 3ILXA 1WTCA 4HGNA 1Z88A 3KBOA 1LWOA 2PJUA 1IONA 2V4UA 4MLPA 1MO3A 3R8CA 4JVLA 4Q37A 3WKAA 5L40A 3G89A 1IUOA 2D06A 1ZR4A 2BFPA 4EJFA 1D9ZA 2A6PA 1XTRA 4L78A 3N05A 3QLUA 4K87A 6REQA 1YGYA 2AMJA 5FLEX 2FWMX 3AWIA 5CNKA 3GK3A 4QLOA 4EY5A 1Z4JA 2IKQA 4JJEA 3ELBA 2XCSB 1OZAA 2CMGA 4HADA 3M9LA 3SQMA 4EHKA 1G3IA 3CISA 4JQZA 5IC4A 2AEJA 3T61A 4YJDA 3WL4A 4JELA 1TJ4A 2PRKA 4KQ2A 2CLLB 3B1KA 4YAJA 4JJ6A 1CUSA 3ODPA 1SELA 2HT6A 2IPXA 3GNLA 4IM7A 3ZD6A 4JLWA 1OGJA 4J4BA 1UDRA 2Q1XA 2O2DA 1DFIA 1P7CA 4TVOA 2B30A 2IGTA 1XAGA 1I3KA 2J6IA 2VHQA 1GZSA 3MXTA 5F21A 2NN3C 2VPQA 4IV8A 4AQYB 5TJ9A 1LF0A 4TMYA 1IIBA 1TPZA 2XYQA 2VK4A 2W42A 1K4MA 1TCAA 2VQDA 1SM4A 2XUIA 3DMDA 3OCZA 4FYJA 3T6KA 5IDQA 3K70C 4AYWA 2GMWA 3NHFA 3ONFA 1BHSA 1JS1X 1WB5A 3SIXA 3E7WA 3PC6A 4DYDA 8ABPA 4AKEA 3F6SA 1ZGGA 4NBWA 4OFZA 4XH9B 4X91A 2TMYA 4LDQA 4QLBA 5C8ZA 4L95C 4D57A 1C9DB 1UC9A 4P98A 1P2BA 3DDNA 3EGCA 3RT1A 5BN1A 3MCAA 5DBEX 3W5SA 4MYCA 4B32A 5L95A 1QIIA 1L0BA 3FI0A 4FONA 5KNCD 1JHUA 3CLSD 3DTNA 4AZSA 5LQJA 3IAM1 3PNQA 2OV1A 5ERXA 3JQRA 3GLKA 1ACLA 2JIDA 1X8XA 3O5AA 4ALIA 4DQVA 2ZR7A 1IN7A 3IE1A 3VYTB 1BAPA 2FPIB 4K9NA 4MLDA 3HJTA 4RANA 5FNVF 4I1PA 1RYMA 1K8RA 4D2IA 1JDBB 2R5NA 5EC8A 1TECE 4GECA 2QRPA 3U3DA 4H15A 3EIHA 3LX6A 3BIWA 3ONEA 4NXMB 2GN6A 4MHTA 4FFPA 5E3IA 4YR9A 1EFTA 3A25A 2WLTA 2GBFA 3UKDA 1O8BA 2H00A 2X9VA 3THOA 1KFBB 1PL7A 1ORTA 1CQPA 2GB4A 3GLVA 2P9HA 4HWPA 1KAGA 4QUJA 4TRNA 4C4OA 4CF3A 3BERA 3CH5A 1GG8A 2WSLA 3C1TA 4DSUA 4Q12A 4PYRA 4HRVA 5FLXA 1P3DA 3EQ9A 4IJUA 5DMXA 1NXPA 3JQ7B 4BMYA 3UB3A 3RYIA 3OOWA 5HHTA 3R75A 4DCJA 2BRUC 5KZMB 2WTXA 4FR0A 4FR5A 3TZQA 5IN4A 2LP4Y 3PU6A 3QVJA 1CZUA 3L7KA 5JR3A 1ZUWA 2GAOA 2BGLA 2I2XB 4KYUA 5AJWA 2UXCB 4W6QA 4B84A 3K92A 3QRWA 5FAXA 4D4HA 2WPDA 3R1IA 1YTUA 3I72A 1DKNA 3KT3A 1JLLA 4EZIA 2GSWA 1EWVA 2CLMB 1DB3A 3UC5A 3RNOA 3OE5A 5B2FA 4AS1A 4JB3A 1RBZA 1S01A 1XJWA 2N46A 3NEJA 3B6JA 3DAPA 4H7PA 1T8SA 3TUIC 4DMRA 4Z0TA 3OWXA 4EG7A 1H6CA 1I9GA 3ZUGA 1B6SA 3W7BA 2D5AA 1C7IA 3RFXA 4ZMSA 3FTNA 3FUUA 1Z5GA 3EF0A 5AKIA 4CEIB 1EE2A 2WFZA 3W5BA 1MXFA 1T6YA 4TYWA 1NW3A 2CL0X 4RH1A 4ZRDA 4DCTA 3ZU6A 2P6RA 2ZS8A 3HKCB 2Y1DA 1RHKA 6AT1A 3VU9A 2DOKA 2FZ4A 1X1EA 4DG9A 4HAVA 2PMFA 3MAAC 1I4WA 1MB3A 1TM4E 5FUVA 3S2UA 5LMCA 4MGIR 4C2BA 1FZTA 2FZLA 1W49A 2B5WA 3AX6A 3C6BA 4YRZA 4GBJA 4CEHB 3FLBA 2WHRA 4B6RA 3HBJA 2KM1A 2NM0A 5SYAA 3TINA 2H06A 1SXJC 1XO1A 2PGDA 2ZR0A 4AIIA 4TTVA 3A8TA 2FGJA 3RJ9A 2RH4A 4J0EA 2V4MA 4TWRA 4W7IA 4DMMA 4E5YA 3EEQA 1R4MA 1ZD4A 4M88A 2ERCA 2P9JA 3QF4B 4MKXA 4PYNA 5KTPA 3T9CA 3I9LA 4HATA 4QDTA 5CVVA 4RSGA 4D41A 3H3FA 1T2NA 3G3EA 1P74A 4MUYA 1HNNA 2D2VA 3HA3A 3O1LA 4N0QA 5FTLA 4P4UA 1E4VA 2NG1A 3PWZA 1KO7A 4K9MA 3HXLA 4JUIA 4ITUA 4Q1AA 3RQSA 3L8DA 4H7IA 4F72A 5LQKA 1QIKA 3C3EA 2YMQA 4FYWA 4JFAA 5JO9A 4C7MA 5GZ1A 3WLQA 4BLTA 3CLRD 2HMAA 1SUEA 4DLLA 1F7VA 4QDJA 2CJFA 5JXGA 4ZVVA 1WUIS 2XYVA 3WZLA 5AVRA 1DHRA 3A11A 4OPMA 4WIAA 1V8OA 4IINA 1A5AB 3O8DA 1NMXA 1BMQA 1MQAA 1MT3A 1C3XA 1T1SA 3BDIA 2GAJA 4KTTE 3GGPA 1M0SA 3JASA 3KYDA 3JVIA 3VVCA 2FGKA 2IYYA 1APBA 3LIIA 4QVKA 1MAVA 2CCGA 2J0SA 2J3QA 4PRZA 4MW0A 2D7JA 1VMDA 4KAXA 3K4QA 2DFVA 4JITA 1CV2A 5IX8A 1IK4A 1EFCA 4NZMA 2DQZA 1U2GC 3OKAA 4PSVA 4XSHA 3PIRA 4Y6SA 4QGGA 1NX6A 4DZTA 1CE8A 4HAUA 2PS1A 3HYCA 4UHFA 3T0FA 2V54A 3WNVA 1FJHA 1RFGE 5EZYB 3X1JA 1QB7A 1VA5A 3QXSA 1LQUA 1MN6A 1SVMA 2VPWA 3S4YA 1HRDA 1V7ZA 1VZ2A 1YBMA 4HC4A 1FQKA 2EG9A 2YV3A 3EXFB 1E64A 4MQEA 3DFFA 1B3BA 1TZJA 2WFLA 3A9SA 1U90A 3BWXA 3JWEA 1OMOA 2I8AA 3DR3A 3PTZA 2ZYVX 3FKQA 4GOJA 1BVUA 1HEIA 1KDVA 4BATA 1PX2A 3KTAA 1JDZA 1RMYA 3PEVA 3PNBA 3HN7A 5HCIA 1NJGA 1UANA 1DPFA 2B0CA 4NOMA 3B78A 2O23A 3L7YA 3SZOA 2LKCA 4RPGA 3Q3IA 1VG0B 3HZZA 1KP3A 1L5WA 2CDNA 2A78A 2P9QA 4YHBA 2I7VA 4MEBA 5T5QA 3R4VA 3E35A 3ITDA 4IRXA 1XKTA 2BCJQ 1M1ZA 2J7KA 2Z2YA 3SE0A 4EUSA 1ZSYA 3EC1A 1DQRA 1R2QA 4Q6WA 2OESA 1ZXBA 3GGGA 4YALA 2VPTA 2XODA 2CD9A 3BIJA 3H1GA 4OH1A 1SC6A 3PRKE 3AW9A 1XZLA 1U3CA 4WXMA 3VMFA 4CM9A 1R7RA 4JBGA 3N2GB 1QP0A 3SI7A 2G9VA 5GJVC 5BV8A 2POQX 3PXBA 2BP7A 5F73A 2VDWA 1OYYA 4KL8S 3GRKA 1UODA 3AEKA 4K81B 4NNOA 5ECDA 3RRXA 4AUNA 2GQ0A 3K35A 4DBLC 5HIAA 3DLHA 1W5TA 3D43A 5I3ZA 4Q9HA 2LIPA 3UMGA 1BKDR 1DBIA 1SVLA 3L4JA 4MQ5A 4NJOA 3NGXA 5H5JA 4S2UA 2HHAA 2WF7A 3UYLA 4PN7A 3M5CA 4MYRA 4WZAE 5KJEA 1NWHA 2X5NA 1ZI6A 3PQ5A 4P0PB 1YGPA 4LRYA 3EW7A 2I87A 3G8CA 3KBBA 5K3FA 2ZIVB 1MHTA 4TM7A 1IZ0A 4MWTA 1QHHB 1XHFA 4TUYB 3UH0A 2C4NA 2YY7A 5M34A 5BMVA 4PO1A 1GGJA 2CLIB 2GZSA 4MV3A 4QO8A 3AUFA 4RSHA 4UBOA 1X80A 3G59A 2I2DA 3OJCA 2QRUA 2PGJA 5DDIP 3BXOA 5GQSA 1QUFA 5K0EA 2O0KA 2RK4A 4EKDA 3UJ3X 1JB1A 3KYBA 4IQ0A 4LSGA 3C7AA 1W4RA 4ZDWA 4B3SB 3OIFA 3H2HA 4RDCA 2VCEA 5IKOA 2PVPA 5KYXB 5C31A 1JNXX 1Q0UA 4HQ6A 4UJ3A 3TM5A 4PPGA 3VTKA 4IVNA 4AN4A 3IEKA 4BVLA 3QYJA 4BJ5A 1A50B 3IUNA 3D6JA 3VZDA 4B17A 5JJIA 2V4ZA 4Q9IA 2OB2A 5FOTA 3N8GA 3LK7A 3MOGA 1FVOA 4B6SA 2Y2VA 1KXZA 1C9MA 3MWKA 2C29D 1ILWA 4RMJA 1EP1B 1Z75A 5HVNA 1QJCA 3OTOB 4B44A 5B6JA 2DLNA 5T8KA 3SR4A 2XQKA 3QUTA 1ZM4A 3KQTA 4ILKA 1I3NA 4J29A 4ZZIA 5T4HA 4BNDA 3DG9A 3PPVA 1G3UA 5K1ZA 2CXUA 4DEYA 1HX7A 2PUHA 1I0IA 1X7YA 2GBPA 2ZUBA 1Z2DA 2ZZKA 3LPDA 2G77B 2OQVA 3MB8A 1J23A 3DDZX 3H1BA 2PS9A 4FDLA 4F96A 4EO7A 5CYFA 2QRGA 4X93A 3HFGA 1T5OA 3A2LA 1A04A 1CLEA 2XNHA 1PEDA 2ZUTA 4B2LA 2ZS7A 2AFIB 3FOAA 4PNHA 2FWJA 3GRUA 1P7YA 2C61A 4BRSA 1GJRA 2A9RA 3PENA 3JYLA 2EKDA 3KETA 3LY9A 5I3CA 4Z1OA 3YASA 2W6JA 4RJLA 2EGUA 2C5HA 4HQLA 4BNIA 3AKZA 4L5AA 1RLUA 1SOAA 3HABA 3UWPA 4C6RA 4I99A 2FPLA 1M73E 2RD2A 3ROPA 5LZ2A 2EJCA 4P83A 4IJVA 1VYTA 5LBIA 1I3CA 1V5EA 3WHPA 3SMQA 1KEPA 1P9OA 3OY7A 5DYGA 2WIBA 1Q0LA 3H5RA 5LA6F 4IFEA 2W8BA 3QW2A 4PWYA 4ZVSA 3INYA 1RI1A 1RQRA 4Z7NB 2D5CA 4EZEA 2R1VB 3OZWA 5IK2D 2E2WA 1Y6QA 2CHGA 1CUYA 1NYRA 2HUNA 4RKEA 3TLGA 3QBJA 3U7QA 2GCEA 1L8AA 2JKZA 2VJOA 1DIAA 1TVEA 2W0MA 3HEBA 4U7JA 4UEQA 4BB5A 4DDMA 3Q40A 5IT4A 5F9FA 2HK8A 3HSYA 1ZBDA 1OFVA 3EQZA 4M8KA 3HDTA 4UNIA 2IU0A 1I2MA 1ZN7A 1XL1A 3OICA 5CNIA 3SZ3A 2C1ZA 4RD6A 2F8TA 1CQIB 4X1KB 1M2NA 1CK4A 1YL7A 2ZSUA 3F0TA 3FNHA 3JRNA 3P27A 4QJIA 3V8EA 3WO0A 2VYVA 1YT5A 3FVWA 2WTUA 3SQOA 4ZYLA 1FFDA 1AZTA 1PR9A 4ZDIA 1AGPA 1DAHA 4JBWA 1D6SA 5KIAA 2VS1A 3F5DA 3FJYA 4GPBA 4ND2A 1CQXA 1DL5A 4I8DA 2QM3A 4QREA 4C0KA 4HS4A 2V7TA 1IDOA 3MLAA 5M3BA 1UBHS 1USUA 2J0UA 5GJWC 3HN2A 1WOYA 1ZNZA 2QX6A 4WMLA 1NQ5A 4I6JA 4Y2RA 4YRLA 4IWNA 3P9QA 4TKLA 5FFFA 4XYMA 4L4RA 3CUWA 5WRFA 3QLJA 4F4FA 1NKTA 2HGSA 1NVXQ 4U4AA 3TQOA 3TEJA 3BCSA 1E6WA 4RV5A 1TJNA 4XGNA 1GN9A 2H63A 3ITKA 2W5UA 4DSOA 2GLXA 2R5FA 4WLNA 4C0SA 5DT2A 2UZ4A 4I8IA 4MR8B 2QRHA 1N2HA 1CNMA 3RAPR 1D8TA 3BWBA 2X14A 1TAGA 2YNMA 1LQ2A 2UUPA 1D09A 1TA0A 4DJAA 2O9JA 4ZJUA 3ZHXA 5ALKA 2QD3A 5DK6A 2LPMA 3QLUC 2VJPA 3M4XA 2O05A 1ZAYA 1GFSA 1MEOA 2HD4A 4BIMA 2CNWD 1VGVA 4FS3A 5L4LA 1ZGBA 2J5QA 5FJJA 4PS1A 1N4AA 3F3MA 5IAEA 1G60A 3IMFA 2UVDA 4XVQA 2GPYA 3CCBA 2PKEA 3OCCA 2RSLA 3AM4A 2VYND 1IN4A 1JQDA 1AKNA 4OAPA 2I3BA 1LS1A 2UYOA 1XXLA 4RO0A 2WT9A 3V2GA 1HE5A 4TT3A 4DVGA 4BUZA 4ABYA 4CIBA 1FMCA 1QIJA 4PQYA 5JCPA 2B5OA 2W2QA 4PC1A 4JEIA 5JNSA 3DO6A 5BV7A 3ND5A 1C9YA 1DINA 1NWCA 1E7SA 4K9KA 3EXAA 2HYIC 4PGFA 2R11A 2DBRA 2PKRA 4M2LA 2HLHA 5IJ0A 4AY6A 4B3HA 4DA6A 2EW1A 2G40A 1EA7A 1PFVA 5JCJA 1F8XA 2ID7A 5JZSA 3CUEF 5JS7A 2ZP1A 5K20A 3EH1A 3SJ7A 5KPJA 2OD9A 3N1UA 4UDXX 5E6UA 3TQTA 1U28C 3AT1A 3K4PA 3D8TA 4TPKA 1X1BA 4QPJC 2CYBA 5TDHA 4XUCA 3RVOA 4DCUA 5JAOA 3HGMA 1DBRA 4KH1A 3PPXA 4IG9A 2X23A 4IVPA 4ZO4A 5CT9A 3V7YA 2C97A 5FFNA 3PQCA 3LQQA 1PKXA 1LFDB 4ROTA 2PUTA 1GNSA 4W9NA 4OHPA 1LXCA 5F7OA 3C14C 2GZ3A 2ZBQA 1V7CA 4F2PA 3PYMA 4D42A 1G59A 4ZCIA 1CYEA 1KYXA 1U0JA 3N7UA 1IZ9A 3RO7A 3ZHOA 3QKRB 1JHPA 1LBSA 4O2BB 3TZLA 1EXVA 2RAVA 1G7SA 2JKYA 4IDCA 1X86B 3OFVA 3RF7A 2BUBA 4AO8A 1L9XA 3GAFA 2KLBA 3BHIA 1ZNQO 2NVUA 5DYNA 5FAKA 3H2IA 2PMEA 5TQJA 1SN7A 1ZDMA 3VNAA 4BZZA 2G36A 1UBMS 4EHDA 1D2GA 3GWGA 3NEYA 1ZBQA 1II8A 3F78A 2WVAA 4YJ2A 1IZ8A 1K88A 2JCVA 2BRUA 4XA8A 1AF7A 1Q11A 2H4JA 1MRNA 4NDZA 3WZ2A 1CEEA 3B53X 1UCFA 3KV3O 3FNIA 1U7OA 5AJYA 4TKMA 1FIUA 4CIXA 5MHTA 5EUCA 1T0HB 2RONA 3A4NA 3CEAA 4O4IA 4URZR 3RVNA 3GUHA 3WQBA 5JLJA 5JZVA 2IZ5A 1CZOA 1XLVA 4MPTA 4LPSA 5ED4A 1WQ4A 4B7AA 2V1UA 1IXYA 3K2EA 1P3Y1 1WCV1 4BV8A 2WYWA 2HJ9A 1LFAA 2A7QA 2R84A 3RF6A 4WDRA 1IVNA 4YP6A 2Y77A 4GO1A 4WXPA 3TDMA 1DMRA 2DQKA 3S5JA 1PRYA 2XGOA 3PS9A 3IS3A 1IY2A 3BE4A 4MWCA 4TGLA 1SUFA 2HQRA 1HXHA 3CNOA 1GL6A 1W6UA 3X44A 4AXBA 3ESCA 1O5TA 1URPA 2IEGA 1DFGA 4C03A 4R2MA 4D98A 5CT5A 5AXCA 1UEJA 4YCBA 2MOKA 2HCBA 2X58A 3O8QA 4TV9F 1OTXA 5KQGA 4PQRA 3MWEB 1Q14A 1USGA 3TLBA 2ZYAA 1I13A 4LISA 3IV6A 5KSZA 5JASA 4ZYXA 3ET5A 2NW6A 1SEVA 5JYEA 1GPYA 1YQEA 2ZVDA 4LQDA 2A7XA 1BDMA 3GEIA 4EUEA 3P0JA 4NBUA 3FMVA 1VTKA 3UFXA 2WILA 4DR3B 2PUBA 4BNVA 1Y9ZA 1RRKA 3GYGA 1HTBA 4FJ1A 4F3RA 3IJRA 3WKDA 5IJ9B 4L5BA 4CKCA 3E3LA 4MUBA 4XIIA 2B36A 3EGVA 4PR0A 1Q91A 3WLKX 3AR3A 2O5EA 4JLBA 1YOBA 5JAPA 4Q18A 2G7ZA 1M9NA 4H4CA 1P1KA 1I94B 2I3DA 5AKGA 1HGXA 2AI2A 2QLLA 3I62A 2W58A 3SLRA 2WWHA 4UTVA 3UTDA 2IBSA 1MHPA 1NN1A 3TLMA 1X1AA 3HTXA 4C4YA 5GZ3A 5A0VA 1C4WA 5KOIA 4I50A 2GD2A 2XX3A 1PWXA 2Q2QA 2IYEA 2VBIA 1T0PA 2XZDA 3DE0X 1XYYA 3VVLA 4AZTA 4TZ6A 2OO5A 4YK7A 3C6XA 1JIQA 2O1SA 1ZHHA 2EFEB 2ADOA 2FR0A 1WE2A 2KS6A 3KXPA 4HF7A 4M9QA 2GFQA 4JBNA 3WX0A 2ZW9A 2WJAA 4ENVA 4CKWA 3W90A 3RSFA 2IQ5A 1CZRA 4FWBA 2JIRA 4CTJA 1OZHA 5IXSA 1RYDA 4D56A 2NPOA 2NSYA 1MABA 1VA4A 3K94A 1R27A 4GU5A 4XDYA 3AESB 4Y1EA 4WY8A 3V7FA 4KQFA 1X92A 1UXIA 1O3YA 2B34A 3GHHA 2ZYIA 1ENPA 5DRYA 3F5QA 2DBVO 1DRVA 1IK6A 2VTDA 3C8MA 1Q84A 1IQ0A 1Q17A 3BXPA 3JD0A 4R81A 4M83A 5AI5A 1JF8A 5G2OA 3L8ZA 5K6AA 3UPUA 2ZFUA 3D4LA 5AW2A 4DIEA 2C2MA 4FYYA 1QV7A 3Q2IA 3JQBA 3KG2A 1R3UA 4G86A 1M72A 2G1KA 1WXFA 4B4DA 2Z4TA 3RTBA 2BGKA 1AHPA 2H1OA 4HNTA 1NLUA 2MYNA 1S1MA 2AUNA 2OV4A 3B6MA 1C3EA 2BFWA 3QVKA 2IWHA 2ZEJA 1NE2A 2HBYA 4MRMB 1WZIA 3SKYA 1P5FA 3PRHA 4HKTA 1V9SA 4DSTA 2H5EA 1T13A 3U49A 1DBQA 3D8NA 2IQIA 2HFKA 3AEUB 3B6KA 3CRVA 1LVGA 3I2YX 2GARA 2QN8A 5HKLA 7GPBA 2BT4A 5J4LA 3TNJA 5JS1A 3CXUA 3RVKA 1XRPA 1SA0A 2EJTA 3VHLB 1ZC4A 4KDEA 4C2AA 4F4HA 2Q0SA 5AW5A 1BZYA 3S2IA 4RNCA 3RYHA 1E5LA 2YVQA 1N6KA 1VIAA 3SDZA 4KR7A 1Q57A 2CJPA 3RSSA 5HM6A 3DT6A 3E3NA 4K86A 3LXMA 3DKVA 3CJQA 1RP1A 3DL7A 3JRWA 4IDPA 2Z5GA 3AYZB 2VHVA 3CW9A 3TZKA 5BW4A 4UAVA 4PG7A 4HTAA 3VPXA 1H5NA 4UXJA 4Z1MA 1GR0A 2CLEB 4FMCB 1FL9A 1E2LA 5C1DA 4CM3A 3JYHA 4IUDS 4TRMA 1MB9A 1U7UA 4DT1B 4BXOB 3KOXA 1JDJA 2I4MA 3KQVA 1EB9A 1IBSA 3R24A 3RKSA 4NZOA 5IKXA 3HFSA 4QNRA 5J2UF 3M7IA 4I36A 1AKMA 4LXQA 1QE0A 1IOWA 1B6GA 3HVHA 4XX1A 3KKPA 3BDAA 2I4OA 3HBNA 1QFMA 3N2KB 3MJCA 3ZJ5A 1MW8X 4AF8A 1DG3A 3CBQA 4UPVA 2WQZA 1N9KA 5KCZA 1FY2A 1BMTA 4XRRA 2WWWA 3HS3A 4CLOB 4ALNA 3DVLA 3AI1A 4IH9A 2DWPA 2YYSA 3CC8A 2XE4A 4UASA 1PZFA 2FLKA 4HLNA 1WLSA 3ZQKA 4ZHQB 1U0NA 2QJTA 3P20A 4DZZA 4BC0A 4B7UA 3CVWA 4REQA 1J99A 3GCGA 1CZHA 4BUJA 1MAUA 3HM2A 1IIRA 1M2FA 2ATCA 2Y4NA 2ZWVA 3A14A 3NHYA 4P54A 3RVBA 4GAEA 1GP2A 1AB5A 4YV2A 1N9ZA 2GKSA 1HFJA 5IANA 2XMDA 2RMKA 2W2XA 2PQ6A 3W2EA 4I1YA 1Y7IA 4FX5A 3K72B 4ARUA 2IXBA 4CCYB 4YWJA 1FDIA 2VRBA 2YXBA 1JR6A 1A8SA 3ELUA 1TQHA 5AW7A 3NVMB 3VDMA 1Y98A 3DGEC 1VRWA 4YAWA 1NUUA 2H5IA 3E05A 3HRKA 4JFRA 3WGJA 3JR7A 2LKDA 3H11B 3W2FA 1MV8A 1MLDA 1OZFA 1VMAA 4RESA 3LKDA 2OENG 3L1KA 2ZBGA 3CM0A 3JTEA 3Q98A 1MZVA 1OJ7A 3JZFA 2Q2WA 1KRXA 1SZDA 1DT3A 2DT8A 3OURA 5CH5A 2OM6A 5C46F 3HN6A 1W87A 2DHEA 3JW8A 3OCYA 5L3QA 1T3ZA 3B38A 4P82A 1CRWG 5FBRB 3F9IA 3AVUA 1QFJA 1GAEO 2OGWA 3NBKA 4UQPA 3TX6A 4E94A 3BG5A 4ARVA 3BF8A 3ZX5A 2C1XA 4HXEB 2ZSIA 4U8HA 4KYVA 4C29A 4B6PA 4BGEA 2REXB 4AG6A 3OOJA 3LLVA 2JZCA 1NP7A 3B1YA 3LQRA 4LW8A 4LY3A 5ALTA 1Y7TA 1QDEA 2OUKA 2XRFA 3MSCA 4OKNA 3KS9A 3SC2B 3S44A 2O2IA 5TPWA 4V0OA 5ADHA 4MROA 4PLGA 4H3KB 4C0HA 1EJ6A 1L8LA 1E1YA 5HA5A 4BS9A 3L92A 1P7VA 2BEUB 1DAMA 1AMUA 3ITNA 1Q2XA 4HFMA 4HEHA 4OYLA 5FV7A 3WYGA 1ZW1A 3KJEA 3VDQA 1YRYE 1ZIOA 2VOJA 3AI7A 5A9SA 3WHKA 3KJFA 3JQ8A 1J2YA 2WM3A 5G40A 3OSZA 3KPYA 4UVHA 4IJKA 4O2BF 1JEEA 5CFQA 1YIAA 3P2EA 3LUJA 4UHJA 3LHIA 4FWTA 1QQ5A 3HU2A 3TG2A 2IHUA 4BNGA 1WV1A 2GPNA 1U99A 4LJ9A 4Q3BA 1L5OA 4QDXA 3NWOA 5C4IA 1P61B 4GWGA 3G2KA 3OF3A 1SQ5A 4W8HA 4N47A 1SBNE 2DPXA 3EY4A 4UD6A 3EGOA 5EJ7A 1U9IC 2RCYA 2RHGB 2B4RO 2RH9B 1WXWA 5D3ZA 4HGZA 5BYBA 5KJ6A 4YY3B 1G8FA 1RJ9A 1BH2A 3FTEA 3DCYA 1OAOC 2XVZA 5ES3A 1L1EA 1KMIY 2DPGA 2DFPA 2WD7B 3VDNB 4A0HA 1EX9A 2BHSA 5K3FB 2QAIA 2ZT6A 3D0OA 3I83A 3DZDA 2NUBA 2HA7A 3E7XA 1JTEA 4TLAA 3ZHCA 1HTTA 3BEDA 1T36B 3E18A 2JFOA 2HRDA 2O07A 2VTBA 2PUFA 5DWVA 4I1OA 3VZRA 3IAS1 5EQTA 4OHXA 3UOWA 4D43A 1YDGA 3EIQA 3MOSA 4QBTA 2C00A 4POOA 4EG0A 3KZNA 5I45A 1KKUA 3UC9A 1MQ8B 5ADWA 1PD1A 5AQ1A 2GPSA 4KGVA 1QC5B 3IBGA 3A9WA 5JS8A 3DQZA 3L0SA 3AR4A 1HTWA 3CR8A 1GZ3A 5DX1A 3ZZUA 4PAWA 1YK1A 1I6LA 1OI7A 4ZVNA 2B99A 2O7NA 3ZHUA 5AWFC 1WKCA 2R00A 2DX7A 3EEIA 5FA5A 5IBRA 4Q7QA 4B35A 5MFZA 1D5WA 3D0KA 3O3MB 3D7LA 4XEHA 4M4SA 1RWBA 2C9BA 3TE7A 4LXXA 2RBEA 3PC8A 3C1UA 5A6SB 2O54A 1R66A 2C03A 4V0NA 5IVKA 3IUQA 2ZVPX 3DTYA 3C3YA 5FA6A 3V2IA 4BKUA 1IEVA 1UWVA 1THTA 2NXNA 5LXTF 5BVHA 4KDRA 2HA4A 1EUCA 4BDSA 1RXVA 2I0FA 1RHUA 1T29A 3EXIA 4EVSA 3CX4A 4CG3A 2F1KA 2VRCD 4A2PA 5EIFA 2IH5A 4QAQA 4B4UA 3M34A 3G2PA 1I5OA 1T2UA 3AHGA 1Z6AA 2I3AA 1W29A 4HHEA 5AHRA 1YQTA 1RBQA 2O50A 4YRNA 5HRCA 3FOZA 4EB6A 3R9XB 1HDGO 1DC3A 1WV0A 3CO0S 4IY1A 5KWJA 2BEVA 2R62A 3CQ9A 3Q88A 2BFAA 1PGPA 4PZ0A 1PWHA 1Z5VA 4CM8A 1Z0UA 2ZE5A 3CIFA 4S12A 3SSNA 5C5CA 3P2KA 2R6JA 1IN1A 3ZTYA 4R9RA 3W6OA 2H8KA 3ZI0A 1ZMRA 4G1MB 2C58A 2OVBA 3R5XA 2CHUA 1UWLA 1DO0A 5ALXA 1D6JA 1Z6XA 2ORWA 2WTAA 4M9CA 1H2ZA 1U1EA 4QZVA 4IL5A 5KC9A 5E6RA 1T1GA 1W2HA 5KVQA 4FFMA 1P17A 3GOHA 4MWDA 1YR8A 5FWYB 2ZR8A 5LWQA 3DBRA 4D9NA 1XLWA 1GY8A 4GKKB 3HO6A 1JIKA 2ZRFA 4KO4S 5FTMA 3UJHA 1BCSA 3CNLA 2I29A 4L8LA 5IHPA 1KQFA 1AUPA 1TIKA 1U28A 1NVTA 1TTHA 3QX9A 4A73A 1U63A 3TIVA 1UBFA 3B9BA 5DLQC 2W8BB 2F43A 2X0EA 1XEAA 4OI2A 5K0JA 2NSHA 3MRSA 1VPDA 2QHXA 3A6ZA 3P0IA 4RHYA 1H2XA 3C3XA 2R48A 5DI3A 2KB0A 1KO4A 3HACA 3M6LA 4GI3A 2Z8YM 4HWOA 3ZQJA 4GC9A 3C4QA 3ICPA 4D74A 4M9ZA 4INOA 1NXQA 4QWWA 1YA6A 2PK3A 1W46A 2HO5A 2PRZA 4FVTA 4UHBA 4BEWA 2YWJA 1WXGA 1KYYA 1AQIA 1CP3A 4ZVPA 3MT9A 1TA4A 4DM4A 1QG2A 2PH7A 4YO8A 3QNWA 3TW8B 3KT6A 3F90A 3BS4A 3EQ6A 1ILEA 2W2VA 3NP7A 1OA0A 1KR2A 2DQSA 4E4RA 3LAWA 3WHLA 4U0KA 3JQAB 3LOPA 1FYFA 4FGKA 4ZANA 2O2SA 3IERA 3B1XA 4GSLA 3RFCA 1MJ5A 4QD3A 3V42A 3DFKA 1N2CA 2W00A 1THMA 3K0KA 2F9MA 3K09C 3L7CA 5LZ7A 5TNXA 1TU3A 2XNCA 2P9FA 2Z2JA 1JRLA 3HDQA 2VDPB 1H4SA 1JXQA 2NV6A 1E6UA 1SG0A 1SD2A 1UBNA 4GYYA 4LQLA 3T5CA 4XYLA 2AK2A 1Q21A 4G0YA 1LH0A 2OHJA 1XDSA 4JI8B 2JAQA 3WQHA 5JXWA 4KKVA 3UQYS 1VIMA 3ZXXA 2CZQA 4M9XA 4BJ3A 3U60B 2IA5A 1J42A 2J5XA 4CMEA 3RFTA 5DBOA 2J85A 2ZU0C 3QI2A 4C7KA 4RK7A 3ND6A 4Y2PA 1GPAA 3CNNA 3RYFA 4L3OA 3EIXA 4PFJA 3O8RA 2WUVA 4DIKA 3RBZA 2Z56A 1K8YB 1AS2A 3N2YA 4QYTA 4FWIB 3ZNPA 5HX7A 2VC2B 4MEJA 2TYSB 3SEFA 3PQ2A 4L4SA 3SBXA 4IDHA 4KXYA 1ECGA 5H02A 3P1JA 2OSBA 4BKMA 2ZWIA 2BLLA 5ALSA 4KRGA 5E0KB 1JQBA 1NLMA 3VPBA 4NAUA 3HCOA 3FJOA 3UXYA 1QRAA 1KFCB 1Z5PA 2Y05A 2ZB7A 1TM5E 2PLRA 4OD0A 4YRPA 4PPQA 3BK1A 3QEAZ 3H6HA 4X9XA 2IYOA 2C8KA 4HI0E 4DRXA 5JJ5A 5SZIA 5IH3A 2B35A 2QA5A 4EDHA 1XVAA 2JLYA 1ONOA 5EIHA 4J76A 1FLDA 2ZVQX 2IPMA 3B48A 4WACA 1JWBB 4CGYA 1EX6A 3DO8A 4TVSA 1U0OC 1D2RA 4FR2A 4IXDA 4GVPA 4L0MA 4ND1A 4C14A 5LMUB 1G17A 3T3NA 4DNFA 5JG7A 3A32A 5IASA 4ZVUA 4RHEA 3QBVA 4NX2A 1G3MA 2XIJA 2VDUE 4L74A 3AETA 2P5SA 4UM7A 4WGFA 4E03A 3WG9A 4BEVA 1G41A 3GDOA 4I9FA 1BEUB 1T6XA 1KZ6A 5AM5A 4EJSB 1V71A 4LE1A 3MA0A 2JVKA 4GBMA 2A5GA 3OZAA 4JQOA 1Y1KE 3AU9A 1YB7A 2IYSA 2C98A 3NHAA 3GF4A 1PN3A 1W93A 2EHJA 2VCHA 1ZONA 3EVEA 4J4TA 3UK7A 3GEDA 3Q3EA 4I46A 5LOVA 5EPUA 4EUHA 1NN0A 1S3IA 2E1PA 4UNQA 4FFWA 4J16A 3B6ZA 1D03A 2I2WA 3L8MA 4JJGA 5IBPA 3DZIA 3RAGA 1K5HA 1MO6A 1MTOA 1T6NA 3EXEB 3OIUA 1XFDA 4EY8A 1SKAA 4HEA6 5JI3E 5L4SA 1GEEA 4OHKA 2ECQA 1KY2A 1RE1A 5DWQA 4ZEXA 4UXHA 1WO8A 3TWOA 4DUYB 2P69A 4FOPA 3GLIB 3ZDCA 3IAEA 2CFOA 3LFUA 4AZ3A 3ZLJA 4MVJF 2IIVA 3WIUA 3WLRA 5C2JB 1R8XA 1QIHA 4PSCA 2PGXA 2RGDA 3MK31 5HFAA 3R0IA 2D13A 2IPOA 2ASVA 3ADKA 3BK7A 3L3BA 4QYWA 5FWNA 1T91A 1E9DA 2J3IA 2L69A 3MFYA 4JJAA 4X6YA 2IHVA 2REQA 1HM5A 4KUGA 4RD4A 2CN1A 1CE8B 4NP6A 3GDFA 1GQFA 1BHJA 1BA2A 3BHNA 3KWMA 5EZYA 4HXGA 4P0TA 4DIFA 1YCGA 3WQSB 5L6MB 4FMBB 4QDOA 5JANA 1U94A 2IW3A 3LFHA 4MW7A 1SKMA 1MH1A 9MHTA 4KQHA 3NKFA 3BIOA 3DZ8A 1Z6YA 4BAUA 1PJSA 1DBVO 2V0CA 2G67A 3SC4A 1PEAA 3U3MA 1GSOA 2AFIE 1LEHA 2OFOA 3BH7A 1HFKA 1B15A 2VXYA 2Y1WA 5ILOA 2FRXA 4G4IA 2H2WA 1PQPA 4FZ3A 4QECA 3AL0C 1I9CA 1NY6A 3FGZA 2R0QC 5KHLB 2OD7A 3ZR4B 1F8YA 3VSAA 2J32A 4QBHA 3QE0A 2GD1O 5DRTA 3ETEA 4BP8A 4IF6A 3ZS9A 4C5CA 4TV8A 3HA5A 3IODA 5LU8A 1VPWA 1M1UA 1RZRA 1DBSA 4ZMRA 3DFIA 1A8PA 3VH2A 1BMDA 3GFBA 3U17A 1IOLA 1XTTA 4LSWA 3OQ6A 3ZGYA 5G4LA 3F8TA 3OZUA 5T64A 4D8WA 3EJ6A 4C5AA 4NMXB 5JS6A 4OHCA 1YS6A 1SXQA 2WRZA 5AUNB 3ANSA 4LTMA 4MUMA 1KSGA 4MRSA 4K0KB 2JFGA 4LY6A 4AY3A 2A0XA 2WVJA 3CA8A 4RKFA 4MWSA 4L5YA 3CU5A 5L7TA 2VDWB 3F1LA 2H5LA 3A3PA 5HJEA 4IAOA 2AXQA 1Y1TA 1ENOA 3A6DA 1GQOA 1IM5A 3VOTA 1J09A 1W34A 4NE2A 3PQFA 4X7PA 1E3SA 5KTMA 2GHQA 1UT8A 2QV7A 1QR6A 3T7KA 3VR1A 1JQLB 4E5NA 2JD0A 5L9AA 4DREA 4C08A 1FYEA 4OV6B 2JI7A 3DOOA 1P2VA 4IIEA 5AYVA 2WUEA 1SOWA 5KYVA 2RHDA 5DXFA 4TV9A 3P9CA 4AG5A 4DV5B 3MXOA 2B1IA 4W82A 2CB9A 1IJKA 1N0WA 2D0IA 3TTTA 2QAGC 2WT8A 3PJGA 1FYDA 2BMDA 2VJDA 1ISSA 3VISA 2BM9A 4ECAA 4GLFA 3BIXA 2NZ2A 4R83A 2K2QB 4RPCA 1PWZA 4MAFA 5EFZA 4KLRA 2QUZA 3PFGA 4ZYUA 2QVCA 4OHRA 5U9CA 4C4ZA 3BXEA 3H2BA 2VQFB 2VQEB 4FINA 5E4YA 3RCBA 3LPAA 3K1TA 3E1SA 1PJ8A 1VCNA 2ABWA 3S2YA 1VI2A 3THSA 1JHAA 4ER6A 1ORIA 1T4GA 1TF2A 2ZRJA 3JASB 3KYDB 1H4QA 1P9WA 2BKUA 1THZA 4H3HB 4DDHA 2C95A 3FMFA 3AHHA 1GDTA 3EOZA 3SY8A 2I5PO 5F33A 3T9BA 3NC1C 3KDSE 1F14A 3IAM6 3D3EA 1COZA 2OTCA 2ZIUB 3EPPA 1W44A 3OOEA 1E1DA 2BGIA 5AM1A 3FWNA 1NR5A 4M9RA 3S2GA 1W9HA 4AJOA 2V7BA 2VVTA 4UZFA 1CF4A 2XT6A 1YQWA 3OFKA 3PGXA 3FOWA 3BKWA 3N0TA 4G26A 3D4NA 3WSVA 4RIHA 4HRXA 4E5SA 2Y67A 4OM8A 4RZIA 2J0QA 2J5BA 4B09A 2ISQA 3AF4A 4LVCA 4N6GA 3A31A 3F7OA 2XOXA 4WDQA 4B87A 1XU9A 4DPLA 4P4NA 4A6DA 1CCWA 2C2BA 5KJFA 3TRDA 2SNIE 4FB5A 1DWUA 1U31A 3L06A 4J2TA 1RVV1 2GBLC 2VJKA 4IFBA 1XJ0A 1OE0A 1DWPA 1WU8A 2YC2C 2G83A 2ZTUA 3FFTA 4I19A 1G16A 2VPXA 1NVMB 3K16A 4Q66C 5JIBA 4JP5A 4NQRA 3C43A 5EA2A 5TGDA 3VOAA 3DEZA 1Y7LA 2OHXA 4V39A 1IJEA 4AX8A 3L7JA 1W73A 4IZIA 2W43A 4TTAA 4YMIA 5K2OA 1SJ9A 3AI3A 5HDQA 3E22B 4F6LA 3I9JA 3MYYA 3G9XA 1EVQA 3NO4A 4ZGGA 2ZJ8A 1XK6A 3GT4A 3S55A 1MOZA 2Y27A 1BN6A 1QHYA 2PBLA 4P86A 2AJ8A 3WYBA 3U4IA 4MW9A 1ICEA 3IUYA 3UMFA 4H08A 3BL6A 4YONB 2ORIA 1T9GS 3FLEA 5K0SA 1QQAA 1XTQA 3IQZA 4MW6A 1RM3A 4Z8YA 4KX5A 2IWRA 3BWYA 3DBHB 1VGQA 4LWQA 4D1YA 3SSOA 1Q1BA 2NU8B 2PSHA 2Q29A 1R15A 4IILA 2E9SA 3G0HA 1ISGA 1ZHFA 3MCZA 3S81A 1K63A 4E5KA 1ZEMA 3BKXA 1ZKDA 1PSZA 4JU8A 4L08A 3QXGA 2OC4A 2HA3A 2C77A 3OA2A 2FMHA 1RKQA 1WKBA 2AB0A 2XDAA 4TTTS 4M7RA 3LA6A 1E89A 5CNMA 4L0DA 3ZWXA 3TZEA 5B2EA 4XQGA 1CQIA 4MQFA 1NI4B 3R0ZA 4JT8A 3TNFA 2WAOA 4QEZA 1W35A 1WIWA 2XITA 3AP1A 4FJ0A 3OKCA 1NPDA 4KG7A 3U3KA 1FX1A 3ICWA 5CB4B 2BGNA 4URXR 3TX2A 3DMRA 5LD2B 5LUAA 4RFLA 3UAOA 5CITA 3OZ7A 1VBMA 4GNRA 2WFLB 4JJZA 3PEFA 5AR1A 5KBYA 2ATVA 1Z2CA 4F21A 3LC1O 3EB9A 1KBZA 3PWTA 4US0R 4EL5A 1EEHA 1UBLS 1H2AS 3L8CA 3OZXA 4CCYA 4ZQGA 3L6UA 3RTDA 1M1NA 4DV6B 4FHCA 2GEBA 4OHOA 4KFCA 3G9TA 4E1BA 1F5SA 3K1ZA 1MA0A 1S2OA 1SHUX 4KFSA 4XWYA 3I0ZA 4HV4A 2VTKA 3TDNA 3SZUA 3NC4A 3HXMA 2VNSA 3C7CB 2ZK7A 3WJ7A 4NFLA 3DUFB 4BDTA 1GSHA 3FNBA 4D44A 3U4QA 1HEUA 2RGXA 1KJYA 1WPRA 3F7TA 3WGKA 4B48A 1XZNA 3BWVA 3WISA 3BT7A 5G0VA 2ZSJA 3FZYA 3V2UA 2D1YA 1Y7HA 2W2LA 4MWEA 3RSOA 1IAVA 2ODWA 5DNWA 5C37A 2JF0A 1CRZA 2EW2A 1A69A 2HTFA 3G8BA 2J67A 1WDMA 2WFMA 2GEJA 1XCMA 3EOBI 4LCJA 1IHOA 3FUVA 5EE5B 1JMVA 1K6EA 4HX9A 3LOQA 1CS4C 1TM7E 1ZRHA 1O08A 2JLCA 4S0ZA 4GOMD 2C7QA 4KR3A 1HT2E 2C2YA 1SC9A 2WJ4A 4KZKA 4WCFA 4FMDB 1U8FO 1W85A 4N9WA 4UVEA 3LSTA 2KPOA 1YJXA 3F98A 4OLJA 1T8WA 5HM8A 4JVNA 5LLTA 1SBTA 4J7XA