4H7JA

Crystal structure of haloalkane dehalogenase linb h247a mutant from sphingobium sp. mi1205
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
total genus 111
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7jA00
4GLBA 4UHDA 1QIKA 1J07A 1EK2A 5T4EA 2ZJFA 3OOSA 1R1DA 3DYIA 5JATA 4ZV7A 3WK7A 3G0GA 4UUQA 4B81A 1DT3A 1Y7IA 3NWOA 1ORVA 2HU8A 3BJMA 4C6HA 3QPDA 2QXTA 3FYUB 4Q3KA 2PBLA 3BDIA 2H7XA 2WKWA 2GBIA 4EZIA 3YASA 4X6XA 4P08A 5ALXA 3WZLA 1PFQA 3IUJA 3C6BA 4Q3LA 4GDMA 2PUHA 4HZGA 3ILSA 4X95A 3EQ9A 3FYTA 4GBGA 3N2ZB 4BBZA 2HRQA 1J1IA 1ZGBA 4H7KA 3NUZA 4PQEA 3I2FA 2O7VA 3HZOA 3IA2A 5JIBA 1B6GA 1IUOA 1ZICA 2W6CX 2Z8ZA 5ALUA 5FOQA 2RAUA 5AKJA 1DT5A 1GQSA 2Z3WA 4JYMA 3E1GA 5ALRA 1XLUA 1BN6A 1RP1A 1QE3A 3WJ2A 4H18A 2HA7A 1R88A 1AMNA 1ZIXA 1VE7A 3G9TA 4C4ZA 4G8BA 5ALMA 3GBSA 4QLOA 1A8QA 3R3UA 4CCYB 3OTQA 3IURA 1EB9A 1HQDA 2RGUA 1UT6A 3DYVA 4C4XA 4P92A 2PVSA 2VEOA 1ZI6A 5K5EA 3WWCA 4MXDA 3DJYA 6YASA 5ALZA 2CMFA 3DLTA 4ZWNA 2ZJ7A 3QYJA 4IHAA 2ES4A 1J2EA 2Y2UA 4WY5A 3G0CA 5CH3A 3WYDA 1XZBA 4M0EA 5CT9A 2JGKA 4EUSA 1XKLA 3A70A 4WFKA 1H2XA 1QO9A 5AKEA 4O08A 1WPXA 2GYWA 3ZLTA 2EDCA 3C8DA 1TAHA 1XRNA 3DNMA 2XB6A 5FKJA 3PF9A 2C5FA 2BUCA 4YASA 4BDTA 4J0IA 1SC9A 4DMHA 2QT9A 4BRZA 2QJRA 3WI7A 3FYUC 1WM1A 4TVKA 4BE4A 3GA7A 4GXNA 1XZDA 1MTZA 2B61A 4BTLA 5FPQA 2OCIA 3QPAA 1BEZA 2PUJA 5CRIA 4B9AA 2V97A 1ZGCA 5K3BA 2PL5A 2IIVA 2JEYA 3K6KA 4FNGA 1MAAA 2DSNA 4B7ZA 4ETWA 4DM7A 3H2IA 4B0OA 4HVTA 4KYVA 2ECFA 1BCSA 3LP5A 1WHTA 5JD4A 2GBGA 1XRLA 1PJAA 4HAIA 4AX4A 1GKLA 1QIJA 2YYSA 2ZYSA 3W05A 3I2IA 3HXKA 1L7RA 3D7RA 1VXRA 5BWBA 5A7GA 1CUDA 4XIIA 3WIOA 1F8UA 1CFJA 1G42A 4BRSA 1G5FA 2OPHA 4Y2TA 4Y2JA 1VZ2A 2NW6A 4QWWA 2JBWA 2Y6VA 4H7EA 1H22A 1A8SA 4OB8A 4W63A 1UOPA 5AM5A 3VXKA 2JGLA 2OAEA 4X90A 3QVMA 4G1FA 4UBIA 1LZLA 1MNQA 2WFLA 2PM8A 2XUGA 1K6EA 5AJHA 5AP9A 5ALHA 2AJCA 1MJ5A 1TCBA 5ESRA 1FFEA 1CUGA 1IUNA 1QO7A 4MJ3A 1ZOIA 1YA8A 2H1IA 1PV1A 1W1IA 3BJRA 3STTA 3CCCA 5AKYA 2O2HA 4MEBA 2VT7A 3RLIA 3K2IA 2ZVDA 4J7AA 2B9VA 3B12A 2QOEA 1LPOA 2DHEA 2Q0XA 1EDBA 2D0DA 4LIPD 3G0BA 3V1KA 1YA4A 4RGYA 2ZYHA 4A5SA 1LBTA 2ZSIA 1YAHA 3LIPA 4G9GA 4CI9A 2XMQA 2EDAA 1W4LA 4J0CA 2WHPA 4IO0A 5ALTA 2QVBA 2VAVA 5FV4A 4E46A 5HF6A 4XJVA 5AKKA 1HBJA 1LPNA 4N8DA 5K3AA 3IUMA 4OU5A 2GYUA 4ARAA 2YASA 2FJ0A 1YS1X 4W1QA 3RK4A 2R8BA 4QE3A 3KXPA 1VA5A 4DNFA 5FLKA 1BCRA 1KU6A 1QFMA 2DR0A 1EK1A 4X71A 4MYDA 3IUNA 2K2QB 4B80A 4E14A 4X94A 4K5QA 1SCIA 2GZSA 3SWWA 2QRUA 4OUKX 4RPCA 3H2GA 1JJBA 2WIJA 2OQVA 1U8EA 4M0FA 5I7UA 4KE8A 2WIGA 3E0XA 4RNCA 2WIKA 4AZ3A 2WIFA 4G8CA 2XI4A 1FFDA 1CVLA 2J4FA 1XQXA 3FLEA 3WL7A 5AM3A 1CUBA 2E3JA 4EY6A 3C87A 1GT6A 1MU0A 3AIMA 4RE5A 5JD6A 4AMZA 1ZIYA 2X76A 5IVIA 1ODCA 2QS9A 2J3QA 1N5MA 4OYLA 5C7YA 1Q84A 4DNQA 2XE4A 3E4DA 5EI5A 3BIXA 3WMRA 5AI9A 2XMDA 2AJDA 5AK6A 3F98A 1XZFA 2C0PA 1E8NA 3B3QA 4OU4A 3BXPA 2QUBA 4WFIA 2G4LA 4Y2RA 3STYA 3HACA 1M33A 1MX1A 3FVTA 1VJ5A 3TRDA 1IMJA 4FDMA 1VLQA 4AO7A 5AM2A 2EEPA 1XZEA 1HLGA 4J3JA 2QZPA 2XQFA 1Y37A 3I2GA 5YASA 3PDCA 1JFRA 1XFDA 4UHCA 2CUTA 4LYDA 3H2KA 3DOHA 2RHWA 1K4YA 5LIPA 1QIEA 2OCLA 5LZ2A 2WJ6A 1TCAA 4BZWA 1FFCA 5AM1A 5DWDA 3F96A 3WWOA 4YX9A 4WJLA 2VAXA 2CB9A 1THTA 2OCGA 4HXGA 4H7JA 1CQWA 5C81A 2CZQA 3PUIA 3QMVA 5KREA 5D3KA 1HKHA 4BE9A 3WK6A 5JAOA 4FKBA 2AJ8A 3WKBA 4DYHA 1XZHA 1ZD4A 1XZJA 1UK9A 4UFOA 5JADA 1EVQA 2HHAA 3H1AA 1USWA 1QGED 1CRLA 1LPMA 1JU4A 4EHBA 4BDSA 5HF9A 5HKAA 3VJMA 4J0JA 3GROA 5BV7A 5JD5A 4ARBA 1LBSA 1R50A 5AM0A 3F8SA 3KWJA 3RARA 5K3DA 5E2IA 3WIBA 5HF5A 4LKOA 3OC0A 2DQZA 4HXFB 1GPLA 2ZSHA 4PSDA 3ZLVA 3W04A 3AILA 2OG1A 3KOOA 5EIAA 4QEKA 3AJAA 1E8MA 2OGZA 4X92A 2WHQA 3O9MA 4Y2UA 1R3DA 5CT4A 5AKLA 3W9BA 4CFSA 5J3JA 1WCYA 3KWFA 2JGJA 4HXEB 5AK5A 2VT6A 1DWQA 4RE6A 1WPRA 1VXOA 1XZCA 1ODTC 2XMBA 5ALEA 1VE6A 2QUAA 3WWDA 4BCBA 1F0PA 1CUXA 4QWMA 1R9NA 3WKEA 5ALVA 3QITA 4FHZA 4Q05A 3JYHA 1UOOA 2VQ6A 4PNZA 1UFOA 5K3FB 3G02A 2ONCA 3KD2A 1XLWA 3A2LA 5SYMA 1YCDA 2GBCA 3H1BA 4EY5A 1TK3A 2B20A 1TRHA 3VDXA 2CBGA 2HADA 1W52X 2H7CA 5ALYA 5FXMA 4UBMA 4K6GA 3H17A 3IDAA 3F97A 2WG1A 2VTVA 5FUMA 1L7AA 1LGYA 1A7UA 2WLSA 4KRYA 1E8DA 2WHRA 3ESBA 5AI6A 4IH4A 3C6ZA 3EF3A 4HRXA 5JAUA 2ACEA 5ALPA 4FBMA 5ALGA 5EHNA 3C6XA 4UBJA 4F5ZA 4QDOA 4U2DA 1XZGA 1N1MA 3S2ZA 1CUIA 3IVMA 2FX5A 2RI6A 3L1JA 1DU4A 2QMQA 4AN0A 2VF2A 4KR0A 4FTWA 5JZ9A 5AOAA 1WB5A 1CUUA 5JAPA 4C01A 3FYUA 2JF0A 5JAHA 4BAUA 1DTEA 4CIAA 1LPAB 1GKKA 2GZRA 5ALKA 4J0DA 5EIHA 5CT5A 1CUJA 3Q8WA 5DYTA 3GFFA 3FCYA 4FFWA 2CKMA 5DYYA 4IH9A 3DL4A 4BVJA 1SFRA 4I3FA 2AJLI 2XMGA 5LYYA 3WKDA 3BL8A 3H04A 2VJCA 4CG1A 1FFBA 1ORWA 4H35A 1ZI9A 4QDUA 1W75A 1EHYA 2WU3A 5A2GA 3U1TA 3PI6A 3L1HA 2FUKA 1IZ7A 1ZD2P 3R3XA 4X6YA 2XUAA 4S0XA 1CUFA 1GPNA 2OAGA 4FLEA 2HFJA 5AK4A 1MAHA 4BYMA 1QOZA 2BJHA 2ACKA 4GWLA 1ZD3A 1CUEA 3IUQA 3O4IA 4U2GA 3CXUA 4Y2XA 4CCYA 1QLWA 4W1SA 5D3ZA 1O6FA 2GYVA 3H2HA 3FOBA 4KJXA 5JASA 1QIGA 1EB8A 1LPBB 3R3YA 3G9ZA 4GHWA 3EBLA 4BATA 3AIOA 5JANA 4UHHA 1P0PA 2RHTA 4B6GA 3HI4A 5C8XA 3UMJA 3F67A 4X3CA 4KAFA 1ZJ4A 4FLMA 3T4UA 1U4NA 3D0KA 3V9AA 1AKNA 4WY8A 2Y2VA 2HA4A 3EIOA 3CCBA 5T4HA 1CUAA 5DTIA 5FPPA 4MEAA 5DLPA 1K63A 2PSFA 4J0KA 4EY8A 5HQ3B 1SCQA 1EDDA 3EQ8A 3BF8A 2XQKA 1UOQA 1BROA 1AZWA 2CEKA 2O7RA 2JEZA 5FP0A 2OXEA 5ALNA 1CPYA 4G4GA 2QJWA 4AMYA 1AGYA 2RONA 3STUA 5CXUA 2Z5GA 3D2BA 4FNMA 5CBKA 2QXUA 4Z49A 4A16A 1XKTA 3W06A 5AIBA 2OGTA 3JWEA 3L1IA 2HIHA 3DKKA 4QLAA 1T2NA 1DQYA 1QJ4A 3HC7A 1B41A 3ESDA 3W9UA 5AKXA 2WIDA 4UFPA 3WWEA 1JKMA 1RYYA 1W76A 4UFNA 2XQJA 4E11A 5BOVA 2AJBA 2PKYX 1UKBA 1IVYA 1WOMA 2WG0A 5DTJA 5DNWA 4I19A 5HKBA 1XZAA 3FSGA 3VJLA 3R41A 4OSEA 4F0JA 4WFJA 2V9ZA 4MYSA 1XRQA 3H0CA 1U2EA 1P0MA 3SK0A 3WWPA 5AKHA 5I9IA 3MUNA 3QMMA 4NMWA 2J3DA 3D2AA 3QBJA 1XRMA 2QR5A 1JI3A 4AO8A 5LLSA 5I8PA 4MQMA 5E4TA 4CG2A 4AB1A 2XLBA 2PSJA 3I6YA 1C7JA 3P2MA 1W6RA 3CN7A 4L9AA 4DMCA 2I78A 3FSGD 4BCDA 4A23A 4B85A 2HA6A 3D4LA 5FRDA 4ZGBA 1YR2A 1X2BA 4PV7A 5HFAA 3STXA 3BIWA 1XQVA 4P9NA 2WJ3A 2AXEA 2XUKA 3WL8A 2ZJ6A 5DNUA 1UK6A 1VKHA 5LZ8A 3O9VA 1MNAA 2WFMA 2ZYRA 4GI1A 4WCVA 1ISPA 5AHXA 2BKLA 3WYNA 1R4ZA 2BFNA 4QNNA 1LZKA 1CUSA 1MO2A 1XRRA 2D5LA 4X00A 3STWA 1WB4A 1QFSA 5AICA 2XQIA 3WJ1A 1UKCA 3I6ZA 1JMKC 1YAJA 2OQIA 3I28A 2C5GA 1AC5A 4ROTA 4BP9A 5AIAA 2BUBA 4P93A 4OD0A 4JNCA 1LNSA 5AI8A 1Q0ZA 4CG3A 3UUEA 3OG9A 5C8VA 1XZMA 5ALOA 1JJFA 5HZGA 2O2IA 3ZPXA 3I2HA 5ALFA 2ORYA 4AO6A 4PF1A 5A7FA 4TGLA 3E3AA 5AH0A 1K8QA 2XMCA 4KAJA 3C45A 2WSLA 3AZOA 2HFKA 4X91A 3HEAA 4C89A 4OPMA 2XUIA 2JGMA 3KSRA 4ZI5A 3WA6A 4BVKA 1DWOA 1KEZA 2HRRA 4IQ4A 3G9UA 4U2BA 3GUUA 1BE0A 3S8YA 2WU4A 3VVMA 4X93A 3FNBA 3U0VA 3QM1A 4FMPA 1X2EA 1QIDA 1CUHA 3FAKA 3ZWQA 4UPDA 4ZREA 3LCRA 1GXSA 3WK8A 2WUDA 4JH0A 1XZKA 2VJAA 1XROA 4G8DA 4QDXA 2DFPA 3K9BA 4CCWA 3D59A 2DQYA 1CEXA 5JZBA 4BC0A 1CUCA 4KE7A 1S8OA 4DNOA 3C5WP 3C43A 3FWHA 1BN7A 2VSQA 3HSSA 1G66A 5DJ5A 2PU7A 5LKRA 4LXHA 4H7DA 3MUOA 4Q1VA 3C5VA 3H19A 3G9XA 2QKYA 3HRHA 3T52A 1L7QA 2XT0A 5LZ4A 4YPVA 2Y6UA 2I03A 4X7BA 1DWPA 4KACA 3MVEA 2WUEA 3LLCA 1XQWA 1LPSA 4XX1A 3LIIA 1K5PA 4EY4A 1H2YA 1XLVA 2PSDA 2HA5A 2C7BA 5ALLA 3ANSA 3B5EA 3AZPA 4N8EA 4L72A 4W1PA 5AK3A 1LLFA 4B83A 5ALDA 3ANTA 1FFAA 2OCKA 3VVLA 2PSEA 5HK9A 1GPKA 4FBLA 2XMZA 5EFZA 2IITA 3FCXA 1U65A 1ZD5A 5CURA 5SYNA 3WZMA 4BVLA 1GQRA 3X3HA 1CQZA 5JYCA 3GELA 3WL5A 5CTAA 2WILA 3AIKA 3G0DA 3FLBA 5C8ZA 2VA9A 4XVCA 3O4HA 2HA3A 2XLCA 5ALQA 1AQLA 1CUZA 5AI5A 1IZ8A 4Y2QA 4NVRA 3PFBA 3DS8A 4BCCA 2OGSA 5IVDA 4H7FA 3G8YA 4YK7A 4N5HX 2VATA 4K6HA 3PE6A 3TJMA 4Y9SA 3AFIA 4PSCA 3UUFA 4ZV9A 1X70A 1TCCA 2Z8XA 3G0IA 1GGVA 5ALSA 4Q82A 3WK4A 2PPLA 2V96A 4B9EA 1TIBA 1ETHA 4N8SA 2VJDA 1DQZA 4BP8A 3AZQA 3PF8A 4W1RA 4D9JA 1UZAA 2DCMA 1Q83A 5ALJA 2WUGA 2XDWA 2Z3ZA 3R40A 4G9EA 1THGA 1UKAA 2GBFA 3O4JA 4CIBA 4AN1A 4WDRA 2WQZA 1UWCA 5LZ9A 5CT6A 1QIHA 1R9MA 4FFVA 1VA4A 3D2CA 5LZ7A 1BEEA 2P8SA 2XUPA 3PFCA 5T4BA 1MT3A 5IVKA 4LHEA 4Y2PA 2XUJA 5LKAA 4K2AA 4GEGA 1QONA 1WHSA 1YS2X 3N0TA 3QPCA 1ACLA 1AUOA 4ITVA 4Q3OA 1CR6A 7YASA 1NX9A 3ICWA 3WK9A 4DIUA 1EDEA 1JU3A 4UHFA 2HU7A 1EX9A 3VKFA 1VZ3A 1A88A 2UZ0A 4J0HA 1QZ3A 4X97A 3F9CA 3DD5A 3W2TA 1A8UA 1EI9A 1JMYA 2PSHA 4BC1A 3C8HA 4PW0A 3Q0TA 4Y2VA 2H7YA 2XUDA 4QDZA 1P0IA 4NS4A 3D3NA 3BDVA 4M0MA 4GW3A 3SX4A 3QH4A 3VISA 5D6OA 3PUHA 2WFLB 4MQLA 2HA2A 1ZI8A 1CLEA 2BUAA 1AX9A 1I6WA 5K3EA 3AUKA 2HU5A 3VJKA 3BF7A 5ISMA 3O4GA 3TEJA 1MPXA 4U2EA 3M83A 2B4KA 4W9RA 2WUFA 5AI0A 4AXBA 2BAGA 4BB0A 5ALWA 1UK8A 4UHEA 1ACJA 5K3FA 2HL6A 2C4HA 3HLKA 3IIIA 4H7IA 5LP1A 4Y2YA 1RWQA 2DHCA 2PX6A 4PSUA 5H3HA 5AM4A 4QDTA 3FVRA 3WLAA 1CUVA 1CIJA 1Z68A 4C4YA 4DSZA 2WTNA 1C4XA 3WKCA 4DMKA 4G4IA 1FSSA 3I1IA 5AKGA 4DLNA 1HL7A 4OB6A 1SCKA 2FJPA 4U2CA 5HF8A 3O95A 4BZZA 1J06A 3LS2A 4J03A 2BGNA 2WHPB 1FJ2A 1NU6A 1EINA 5EHZA 3AINA 3BWXA 1YB7A 3KDAA 5CMLA 2XUFA 3DCNA 4BAGA 4V2IA 3TGLA 4I4CA 2YXPX 3WL6A 2JIDA 4EY7A 3A6ZA 2JGIA 3H2JA 1Y7HA 2I3DA 3DDUA 3R3ZA 2XMSA 4OB7A 3FLAA 1DINA 4OYYA 2QM0A 3O0DA 1MX5A 5K3CA 2WFZA 2R11A 4DGQA 5CH5A 5ALIA 3BE8A 1IUPA 2I3ZA 4HTAA 4KEAA 5CXXA 5CW2A 5DYWA 4G4JA 1HPLA 4DTCA 3STVA 4ZRDA 2XMRA 3FBWA 1H2WA 1UXOA 4AZ0A 3NOXA 3R0VA 4UBLA 3M3DA 5JZSA 2X5XA 1E3QA 2V98A 3HYSA 3A2MA 1XZLA 2QTBA 2O2GA 4H7HA 4F21A 3ESAA 3QZUA 1F6WA 1P0QA 2VJBA 2X8BA 1N8SA 1KU0A 1YSCA 4X85A 4C87A 3SC2A 3H18A 1ZJ5A 4L3WA 3ZI7A 4Y7DA 3ICVA 1CUWA 4TPKA 1LPPA 4KE9A 5HCUA 4C88A 1TQHA 3I2JA 3IBTA 1C7IA 1N5RA 2XQGA 3QMWA 1BU8A 1EXWA 1E89A 3RM3A 3WKAA 2W22A 3D5EA 3DKRA 3WQHA 3WK5A 5AO9A 3WA7A 1H2ZA 1F0NA 5AOCA 5DNVA 4G5XA 3V48A 3EQ7A 1UK7A 4EB0A 5JALA 5EHXA 4U2FA 5AOBA 1ODSA 2C0QA 2XUOA 5A6VA 1T4MA 1YASA 5T4FA 3I1YA 3IB3A 4KE6A 2Y1KA 2J4CA 1JJIA 5E4JA 4OCZA 1QIFA 3MGAA 3PICA 4MWSA 4FOLA 5KBYA 4IH1A 4E15A 1XZIA 5HQ3A 4B0PA 3V1MA 2IX9A 3NGMA 1OILA 4HS9A 2JGFA 3I6MA 1BRTA 4Y2SA 3M81A 4JUIA 3DQZA 2WG2A 2JGEA 3OPMA 2ZYIA 4UBOA 1VOTA 3DL7A 1SOMA 1HDEA 5KWIA 4UHBA 1CV2A 4KRXA 4L0CA 5BWCA 4DSAA 5LZ5A 3GZJA 5CH8A 1QTRA 4BAZA 4X6UA 4ZXFA 5IVHA 5EHQA 1CUYA 1G4HA 1H23A 3I2KA 1E66A 2HA0A 1DX4A 1WB6A 2XUQA 5AKZA 1QIIA 4B84A 3OM8A 1MX9A 2G5PA 3ZV7A 4QZVA 4UBKA 2BGRA 3HABA 1QIMA 4HRYA 4H77A 5E4YA 4H0CA 4INZA 2CJPA 4PO3X 4EBBA 1JT2A 2PU5A 4FLFA 5D7BA 2H9YA 2XUHA 3C6YA 3CN9A 1BS9A 5AI4A 2WM2A 1QTIA 1XRPA 3HJUA 2HM7A 2YH2A 3RKSA 5KWJA 3C70A 4LXGA 3ZLUA 3IULA 5HK8A 2OLEA 4JEIA 1OCEA 2RIPA 4J0GA 1EA5A 5CT8A 1EH5A 4Q34A 4FWBA 3ESCA 4LXIA 1GZ7A 5A62A 2HDWA 1O6GA 3A2NA 4EA6A 2G5TA 3R3VA 1NU8A 5A71A 3V1NA 1OXMA 4JYPA 5HFNA 1E5TA 5F4ZA 2ROQA 4AQDA 2DHDA 1AURA 5A7HA 2C58A 2WJ4A 3DEAA 4QA9A 5IKXA 4DNPA 3OURA 3JW8A 5IH7A 5AKIA 2BCEA 3ED1A 5JARA 4K6KA 4B82A 1XQYA 4GECA 2WTMA 3M82A 4BTVA 3G7NA 4XWGA 4UBNA 5EGNA 2LIPA 3R3WA 1DX6A 4KAAA 1MN6A 1YB6A 1TKRA 3V1LA 4WDQA 4N5IX 1Q0RA 5EIEA 3DOIA 1EVEA 4F60A 4NZZA 5FDFA 1D07A 2G63A 4LYEA 4MWTA 4DMFA
chains in the Genus database with same CATH superfamily
1E7YA 1ETUA 3PGLA 4MMXB 2F1JA 3T3OA 4UHDA 1P7PA 3OIGA 3A1UA 1XNRB 5D1HA 3IP9A 3OQ6A 1IN4A 3O0TA 1SURA 3OBBA 1J07A 2O2EA 4Q0MA 4YP9A 5JNTA 3L0IB 3NTQA 5F76A 3PNVA 2B7LA 3NDPA 1YH3A 4FFOA 4AJ4A 2IIBA 1C7ZA 1LVHA 1EE9A 1W59A 3S1AB 5HM6A 1VFNA 4TQGA 1Q1BA 4ZZ1A 2ZJFA 2GKSA 3BRCA 1R1DA 1ZHOA 5JATA 3CZCA 1LCIA 2ATVA 2H2AA 1ONBA 1T9AA 2VLIA 3GWGA 3TZHA 3MTDA 1NFQA 3U3ZA 4MHSA 4ZQHA 3K4HA 2PMFA 4YRZA 3IBSA 3LHSA 4JLBA 3V7YA 1W5AA 2ZPTX 3CSUA 1RI5A 1NYLA 1CTQA 1HQKA 1Y7IA 4BNDA 1QGUB 1BRMA 1OWNA 721PA 3O8CA 3QEBZ 2ZJ3A 4UM5A 1AV6A 1A71A 1NTRA 2CJXA 5ENZA 3T9BA 4HP8A 1ORVA 2HU8A 1XNQB 4GMDA 2Q4RA 4KG7A 2W2PA 3CVJA 1IZ0A 3CNBA 1E2BA 1E0AA 2M6KA 5B58C 2H7XA 2C4WA 4HNQA 1JX6A 3ELUA 4TL6A 3JWPA 1CQIA 3CR3C 3RS8A 3ZW8A 4BFYA 1ZUNA 2G8NA 2PLAA 1TJ5A 3ZDAA 3YASA 1P2GA 1JAYA 1TTQB 4KXFB 1Z45A 1AA9A 3AUYA 1PFQA 3FFTA 4N65A 1TW2A 4WXMA 4AURA 5L3QA 2O2SA 1U2DC 2G1UA 1IPFA 4KNWA 2X77A 3COSA 4LQ4A 5KOHA 4HDCA 2WT4A 3CO0S 3OAAD 1KJ8A 1SC1A 3MS4A 1ZUD1 3FDIA 4N18A 2O2XA 4HNTA 1PEAA 5JD3A 1SVSA 5FTNA 3VTFA 2OOKA 2ACVA 3N2ZB 3HKDA 2FEWB 5FOVA 4ARZB 1ZG3A 2BFDB 2PL9A 3L92A 3FCCA 1AM4D 1A9ZA 3BXFA 4PFKA 1X14A 3ZVMA 2IU3A 1FTQA 4Q1BA 1KK2A 4WA7A 3QY0A 1D09A 4KBGA 4PIMA 4V0NA 2W2XA 4I14A 3C85A 3IA7A 4PQEA 2AFIE 2XEDA 2HMTA 3GFVA 1RMYA 5AW2A 3K0CC 5IT9A 5JI3E 3I32A 4FU0A 2C4UA 1DKRA 3AVTA 3VYSB 4FW9A 1GZUA 1I33A 2UUOA 4JJ8A 2W6CX 3A7EA 3V7UA 1VIVA 5F7ZA 1E2LA 4LE1A 3LYAA 4JU8A 2AUNA 4UTXA 2DSTA 5ICEA 3L4JA 2NU6B 4JYMA 1WSWA 3E1GA 3FVWA 1LBQA 3ZXYA 1KQGA 2GESA 1WY7A 2VXBA 3N8IA 2VDWB 3CB4A 2PO7A 2VP5A 2F8MA 3S7ZA 2JLVA 3WJ2A 4WCFC 2FA9A 3H6HA 4BU1A 1B0ZA 4ZOCA 1OZGA 2OUIA 3HB5X 1MENA 1R88A 1DKMA 3TINA 3G9TA 5HWSA 4IIJF 4KVAA 3COWA 2WT9A 4UASA 4UUPA 2W37A 1WZUA 4PNHA 3RNOA 2ALJA 5CG2A 5ES4B 5IJ9A 3GBSA 4MCIA 3DMGA 3G1UA 4QLOA 1V6SA 2FEAA 5HXAA 1X19A 2ATIA 4WTOA 3OIUA 1Q3KA 1EU1A 3CG4A 2PKEA 4HWSA 4FOPA 3W8EA 4K26A 2FAXA 4MI3A 4QG7A 3EWSA 4R01A 3Q41A 5EZ5A 1BMFA 1LTQA 4BKUA 4CMIB 4M1SA 1EJBA 4LFBB 1EB9A 1F8YA 1RWOA 4KQ6A 4WVFA 3LDAA 2RGUA 4FEGA 2HWWA 3MWDA 2C99A 2ZRBA 4C4XA 3ANLA 4ZYZA 5A9SA 3RS7A 1UIMA 2P4EA 2NZJA 1G3QA 5IF9A 2VEOA 3O94A 4RD1A 3WGQA 1P1CA 2PL3A 3L9WA 1ZI6A 3EA4A 3ZZ0A 1A50B 3NEJA 4JBYA 3NRJA 1R27A 5ALZA 4QUKA 3RC1A 2YFKA 1HRKA 3UICA 2L19A 2FR8C 1E9AA 1XQ1A 1RJWA 2ZJ7A 3SBXA 1Z13A 3KQSA 1W8DA 3QU2A 2YR0A 4NWIA 1IBMB 5CEEA 3Q6IA 1JNXX 1EXMA 4H6WA 4DMGA 4ZDIA 3NGLA 3D6JA 1UC9A 2ZRLA 1OXXK 5COQA 1WY5A 3TLAA 3BD8A 2XRFA 3AHFA 2WINI 5LB2A 2EX4A 3GLVA 1AXEA 3NXKA 1YL5A 3M4ZA 5ED0A 2O2JA 4LJKA 5CH3A 5EVCA 1XZBA 4KSBA 3WYDA 4UM9B 3U7HB 2JGKA 2FEOA 3KSAC 1Q0TA 3L02A 1T1SA 4BRWA 3W1WA 1E0KA 3AHGA 5ESXA 2B3DA 3PFHA 3USES 1IEWA 4LHWA 3O74A 2HR1A 1QYRA 5HS6A 2G88A 3I64A 1JKFA 4U3JB 1FMCA 2DFTA 4WFKA 1HTBA 2HLHA 2YZMA 4KQIA 3E8XA 4J1TA 5H82A 3H5TA 1B6TA 1X1DA 4QFDA 2SKDA 3A32A 2ZRMA 3PQ4A 4LZAA 5K51A 3TAUA 3UHAA 3RVOA 4N9QA 3TNFA 5DTMA 3ZHUA 2PA0A 4E03A 1XRNA 1M73E 2DMRA 4JYZA 3KLBA 1H65A 2A0FA 3H2ZA 4EECA 4B3MB 2ZULA 1MO3A 2ZITA 3U4AA 4DUGA 2CXRA 1FTNA 3EIFA 4Z4CA 1OH8A 2WHEA 5DP2A 3BWYA 4NBSA 4EA7A 5FKJA 4C7KA 3PYXA 4HGRA 1EFRA 2Y71A 4CZ2A 3THXA 1F14A 2HQ1A 2QT9A 5I9TA 4OYHA 4DMHA 4D02A 5AW7A 3OKPA 2O5EA 3W6OA 4U1RA 5BYBA 3QEKA 4GMHA 5TXGA 3RYFB 1TT5B 1HFKA 3FYUC 1WM1A 1XRSB 4BMZA 4KIUA 4E2ZA 1I1QB 1OXBB 2C84A 4ZDKA 3ELBA 4YRIA 2H17A 3FROA 2WM9B 1FE8A 1XAJA 5LQUA 3GA7A 4UPVA 2VSYA 4GXNA 5KMGB 1NJ2A 1K75A 1KHHA 4WNCA 1GL3A 4HH0A 5B64A 2OCIA 5JYDA 1H4VB 1BEZA 1YCHA 2H65A 3UGKA 1DAMA 2RG1A 5CRIA 2Y0EA 3ZYCA 2ZM5A 1O0BA 1Y89A 2CHVA 1H4SA 2Q9BA 3BQMB 1ZGCA 3RJTA 5ARBA 4HRAA 2PL5A 1I6KA 4DG8A 4JP3A 4K1LA 4S1PA 2G40A 4HGYA 1F2VA 4FZJA 3VNAA 3K6KA 4FNGA 4UAUA 4WK6A 1FPMA 4Q3NA 4XQGA 3W4JA 4YAIA 4H3VA 1SZPA 1YR3A 2C9DA 1G41A 2WU8A 4UXIA 2IDKA 1PGPA 4KAXA 3H2IA 1Z5GA 3E22B 4RETA 5DV9A 2O1SA 5CNIA 4P4SA 4YGXB 4B0OA 1I8TA 2ZSJA 3HJNA 4FFLA 1E4YA 3JSXA 3PEYA 3PHBE 2HYDA 1KI3A 1O5IA 1VGVA 1ZBQA 3C15C 3FBGA 3NJ8A 4LZZA 4LZPA 3IAUA 3JQFA 3NYRA 3QBDA 4HDOB 1GUFA 4HAOA 2VCYA 5DHRA 3VSEA 5FPYA 2OZEA 3B38A 3R6GA 2VT3A 3DWEX 3ZKAA 2D0IA 1Z88A 1GNRA 1G2IA 2GBGA 2HLDA 2IYRA 3PC3A 4FHGA 4PM4A 3F1KA 5EXTA 1PJAA 3ABSB 4HAIA 4BXOA 4XE5A 2PZEA 4PR3A 3CLTC 4G86A 1QIJA 1ZM3A 3U4CA 2YYSA 2ZAIA 2E21A 4WGGA 4BNNA 5TJ9A 4JJEA 4Q7QA 4ZPJA 1L7RA 2HRZA 3D7RA 2IV7A 1NI5A 4PFJA 3JQGB 3C14C 2JGDB 3VR5D 4DRZA 1D2CA 3WIOA 5LWHA 5BOSB 4L5YA 2BN4A 3R0XA 5LU9A 5G41A 3NBXX 4Z1OA 3GC6A 4PRKA 1SXJC 5CFZA 3ADDA 3JZDA 3TAXA 2ZSAA 1KEKA 3V2UA 1SEPA 3U39A 3H13A 2ZREA 2OMKA 4M0PA 3B20A 4H7EA 1JQDA 3LPDA 1H22A 5DMHA 1DBWA 3VI4B 1VJRA 4W63A 4K9SA 1P3Y1 4NZNA 4CTJA 2BH9A 2CXHA 4QQKA 3VXKA 2XB9A 2YHSA 4RH3A 3HV0A 1TNDA 2PUVA 3Q9SA 4BLUA 5K0SA 1V8PA 1GPAA 3F4KA 2FCAA 4JQSA 5L3VA 3UJHA 2YFYA 3JQ8A 3ZNPA 4DKXA 2X3FA 4ZN6A 4I36A 2XNDD 3QVMA 1D2EA 1UZLA 4IKPA 5L6LB 4GEKA 1VDMA 4I9FA 3DBLB 4YAFA 3TQHA 1CDDA 5LC1A 1Z0UA 2V6MA 4UBIA 1E2EA 1LZLA 1UDAA 3BMQB 4RXMA 3HVRA 1TM1E 2JCVA 2PM8A 4R0VA 4XTRA 2P6MA 4E5DA 4QRIA 3FG9A 5HQJA 1JG7A 2GWHA 2LNDA 1TCBA 5TX7A 1FFEA 1CUGA 4EMSA 4X66B 2EFYA 1RXYA 2QX4A 3L7AA 4K05A 1MDBA 4MV4A 1IHYA 2J7PA 1QG2A 1KQFA 1JHYA 1C5KA 5F5XA 5ULLA 1D7AA 1L8XA 3EJ6A 1YA8A 1HT0A 1PK9A 1R6BX 2UUPA 3EPHA 3Q7TA 2B1RA 5D5QA 4A8JA 4UOEA 1AOXA 1YRLA 2I6QA 3I6IA 3SHQA 3EFOB 3O8OA 3I39X 3IR5A 3QJ5A 1PV1A 1W1IA 3WIVA 521PA 1P6XA 2IWHA 2WR8A 3T8YA 4Z9YA 4MQEB 2Z0MA 1UJCA 3RJ5A 5KVVA 1PEDA 8ADHA 3G5LA 2R25B 3EXEB 1U6JA 3BA1A 2XE6A 2QY9A 3PNOA 4OKSA 3IT3A 5K7SA 4BTEA 2BV3A 1ONPA 3GLKA 1GDDA 4J07A 2BDTA 4RY9A 4A6PA 4UNNA 4V03A 3VZBA 1DG1G 4YC7A 5I6DA 5LQSA 2VWQA 4KKXB 1PP4A 3PNLA 2I2FA 2CXQA 2VT7A 3QQ5A 4HDQB 1EG7A 2PA3A 3WV4A 5B7PA 1YMUA 5BP7A 1J8QA 2O5CA 3A3KA 4OHBA 1KDTA 1NKTA 2HZBA 2QOEA 3B12A 4KGZA 4OM7A 3A11A 4ITUA 1LPOA 2A7XA 2QRJA 1L1QA 4HDNA 1I6LA 3QI2A 4RZUA 4D5EA 1A2KC 1A9PA 1EDBA 1ZGHA 2J4DA 3ROQA 3TO5A 4AJNA 5KOYA 2JFBA 4D96A 2UU9B 3SEFA 1E4EA 3BCUA 2P77A 1P9LA 5D6NA 5ITZA 2Q7OE 2J6CA 2GK7A 3PSHA 4GPIB 2JFHA 4MIYA 2YV2A 2I7VA 4ZVSA 4WINA 4EB3A 1R6XA 4DDMA 3LDFA 3QPVA 3ZHCA 2MSDB 7ADHA 4ZAGA 3C74A 2J0SA 2JLBA 3MT7A 4B3XA 3GNTA 1GUYA 4J0CA 3R7LA 1NVAA 2JI7A 3B9QA 4KRGA 4Z1MA 4TZ6A 5DNYB 3MT8A 2QTMA 4ACBA 1SVLA 3EVEA 4D3XA 5JH7B 3CSDA 2R00C 5CYOA 3KR2A 1AHNA 1W88A 3BBLA 4IVQA 1S8AA 1B8UA 4H0FA 1BHJA 1Q0HA 4U7HA 4DIEA 3UA3A 4B3FX 4EQZA 1QK5A 2VAVA 3RREA 5REQB 3F6YA 3QA9A 3SY8A 4CQLB 2JLWA 1DEOA 2QUZA 2GD1O 2F59A 3A4LA 3WNBA 2HSEA 1N8NA 1HBJA 2WT8A 1XXLA 3WGLA 3IUMA 4UD6A 4YRGA 4P7JA 1P44A 4LUCA 3NHBA 1SQGA 2FX2A 3EIXA 4MUGA 2W4QA 2PTGA 5AQ1A 4FFBB 1VFPA 3A9CA 1QE0A 2XJ9A 2GN4A 1SG6A 1JB1A 5DEOA 5GOZA 3KXPA 4CLEA 1VA5A 1UC4B 5LMZA 1H0SA 5K0ZA 3PEWA 1MFZA 4JVNA 5FBKA 1JMVA 4ZDJA 1BCRA 2CLFB 4J43A 2JVKA 3MJTA 1BW9A 1RM4A 1JKIA 3PR3A 4ZAFA 1A97A 1K0FA 4QRHA 3SZMA 2DR0A 3SX0A 1F8FA 1OZHA 4JBHA 3DMTC 5JCOA 3TM5A 3JARB 1ZMTA 3EH2A 4LJ5A 4L74A 2YCLA 2AX4A 2K2QB 3F6PA 5FFNA 1MH9A 1GWNA 1G0OA 4OOEA 4Q19A 4DYDA 4E14A 5CA1B 4US2R 4K5QA 2AFHA 1CJVC 2MR6A 3RAJA 3WGUA 4DV6B 1AGRA 3O4VA 2QRUA 4O5OA 3MOSA 4RPCA 5CEFA 2W48A 2W70A 1U8EA 3SYRA 2Y1LA 4RFVA 3ZUGA 3FMPB 1FNBA 2FRXA 2JCBA 2Q46A 1FP7A 2FLWA 4HDKB 5IJXA 4CQMA 4JS0A 3CISA 4RNCA 3PA6A 4F38A 3FUWA 4KQFA 4PC2A 2ZAOA 2WIFA 2GAFA 3FE2A 1US8A 2C5BA 5DISB 4QECA 2JZCA 1RM0A 3L3BA 3F6BX 1DC5A 4WGFA 5CJ2A 1SA0A 2WJPA 4C4SA 2VPWA 1E62A 3IBFA 4IUCS 1QTQA 2BGGA 3DBOB 1FCJA 2Q27A 1U11A 4CYMA 1HOTA 3ESRA 4PBRA 5GONA 4O4IF 2Q99A 4OXYA 3WL7A 4ABTA 4IJKA 3C8ZA 1A72A 2JBAB 4LFCB 3I4LA 1B74A 1QF9A 4WOBA 2FKAA 3V55A 3KZMA 4N5MA 4PCAA 2PS0A 4CKXA 2HYIC 3GY0A 3PQEA 2JLQA 3AIMA 5DVZA 1K6MA 2IHTA 2NG1A 1OTYA 3KM0A 3NHPA 3UC5A 2X0RA 2GDZA 3OQHA 4AMZA 4FJ0A 2X76A 1IM2A 2QRKA 5IVIA 4R16A 3VDRA 2J3QA 1I80A 2PTHA 5ABPA 1P18A 5C7YA 2DT8A 4D56A 1X42A 3WO0A 1NR7A 2DFKB 4DNQA 3WNZA 1YQ9A 5L4LA 4DSTA 2XE4A 4D0LB 1U5BB 1Y6JA 2PS9A 5EI5A 2VF4X 2I0FA 5A3RA 2PS1A 3DPUA 3U7FB 3CBGA 2H48A 3UVEA 3SU8A 1SBZA 1EFCA 1UWKA 2JVJA 3FYSA 3WRXC 2DUJA 2QWXA 4CTOA 1MB4A 2JAUA 1WBJB 2EOAA 2VHWA 5AI9A 3HKEB 3LTEA 1JL3A 4OSOA 3DDNA 1SWWA 4B6QA 1E1YA 2VHZA 3F98A 1XZFA 3SR0A 1KAOA 4YV0A 3LNCA 2IV2X 3K2BA 1WE2A 4D46A 2DULA 1NN3A 3LKZA 1L8QA 2P9TA 4WFIA 1UJMA 1FMLA 2C2XA 2G4LA 2GM9A 2RH8A 2RK3A 4Y2RA 3U3KA 2I9PA 4L4SA 1EFDN 2IRWA 1QCCA 2O9JA 1ICIA 3I83A 1MX1A 3TDNA 2ODEA 5IDWA 1O0CA 2QD5A 4CV2A 1JUDA 4XD7D 4PX3A 5FADA 3FSJX 1VI6A 3HRIA 3NDRA 1Z38A 3GRAA 4UNPA 4KR7A 2Q5QA 2J5BA 3PUVA 1LRJA 4FDMA 2PPVA 3IPXA 4PXSA 1DFIA 3ICOA 4V0QA 2EEPA 1YIOA 2OENG 2QZPA 2XX3A 1ECJA 2I54A 1QHXA 2GCOB 2XQFA 2GBLC 2Q5EA 4RM2A 4YQZA 4QREA 2R44A 5IW8A 1JU9A 1HFWA 1U7UA 3PDCA 4D8UA 3L6BA 1OLUB 4GWKA 5A9RA 4TL9A 1JFRA 1AF7A 5EIBC 4Z4IA 3MEQA 1QH9A 4DLWA 3WGTA 1CZLA 1C81A 1Q3HA 1XFDA 4UHCA 2CUTA 3BTOA 4NYJQ 5DHQA 3DOHA 3MYRA 1V43A 1ZH0A 2EBFX 2R751 2RBGA 4MUHA 4OXQA 1U5CA 1T6BY 3PNPA 1QQ5A 3GJ5A 2CFOA 4IG9A 1VE3A 3VC1A 1QIEA 1VL2A 1IK4A 4TS9A 2YJ5A 5LZ2A 2C97A 1H2BA 2BHRA 1HYEA 3GB9A 4IM7A 4TKUA 4K6CA 5CP8A 1GPDG 3RQSA 3KPVA 4F1JA 2HPVA 3ER9A 1FFCA 4DJDC 3V8PA 2BMWA 4LJ9A 4EVSA 2A9QA 4HR7A 4IZIA 3F96A 1QFXA 3BE4A 2XWQA 2Q07A 3DC7A 2PD4A 1SOUA 5F12A 1A76A 2QDXA 2DLDA 1DKQA 1BJRE 2OBXA 3CGGA 3CRRA 4HEQA 1ZN9A 4UJ3A 5IU6A 1FJGB 4KMSA 4NBRA 4DC1A 1KERA 1XCBA 1KVQA 2J0VA 4PC7A 5C1IA 2CB9A 1N3BA 2ZUTA 2BZGA 2WF8A 3ST7A 1THTA 4BHTA 2GARA 2WZBA 3RJ9A 2W6QA 4RTNA 3IR6A 1M7BA 3OX1A 1H42A 5LB4A 1K6XA 4ALIA 2HBRA 2DHRA 3EXFA 4NAUA 4XUGB 3VV2A 3WDSA 5D3KA 5KREA 3KTOA 4CL8A 4DV0B 3LUGA 3RIMA 3ZOKA 4TT3A 3PPIA 2EQ5A 4HTFB 1HKHA 3OQIB 4OJKA 3MJHA 4IL5A 2VNAA 3OH8A 1K7FB 4KDFA 4OQDA 2MSLA 3DJFA 2FDCA 3W5IA 1OBOA 5TF0A 2E1RA 3WKBA 2CE2X 3LX4A 1Z16A 2ZR8A 3RUIA 1ZD4A 3TW4A 2NUTB 1A77A 1L5FA 2AMYA 4ZP1A 3RBAA 2JEOA 3LK6A 4UFOA 4JDPA 1OD6A 5FOTA 3W79A 3H1AA 4ZOBA 1KK0A 3CH4B 2W83A 1A9YA 1RBQA 3FZYA 2P0AA 2QN9A 3RSFA 1LX7A 3H5LA 3WSWA 1XK6A 3TVYA 2Y8EA 3LXUX 1JU4A 1AMOA 3WB1A 4MLPA 1U2DA 4FYMA 4O59O 2D2XA 2HW8A 5J59A 1H5QA 1I14A 2ZT6A 2I55A 4GAEA 3HS3A 2EIHA 1KS2A 1RE0A 3LUAA 4HDRB 5BUCA 5BV7A 3N0RA 3RUAA 3FCOA 1R4MB 2V5VA 5AM0A 1KIAA 3F8SA 3NUQA 1WDWB 3KWJA 1CZKA 3VR4A 2PKRA 1T5DX 4JLUA 2KBEA 2J9FB 1PDWA 5IUKC 3SDZA 1AB5A 1XWWA 3MLBA 5I7HA 5AW3A 3TRIA 2WVHA 3ZI4A 1I0ZA 4PWZA 1MPTA 3ZNOA 2I2BA 2CDBA 3S68A 3K0CA 2XIQA 2CCJA 3C3XA 1U3UA 2H54A 1XSEA 2XYQA 5EPOA 5LBUA 5ER6A 2EG9A 2FWAA 2VS1A 4O63O 1Y98A 2HY7A 1FUEA 2NUPB 1H9CA 2X3YA 3P2EA 4LE0A 3S8EA 2FPSA 3S2YA 1UMDA 1VKZA 2PH7A 4RMNA 3EGCA 2GEKA 4QGSA 1XMSA 5LQKA 1B7GO 1G19A 4QOIA 2I7TA 4RHXA 1C4WA 4DR7B 2R87A 1W49A 2QRPA 5LLTA 3BSSA 5AKLA 1UPAA 2SCUA 4CFSA 5HCNA 1FSPA 1L8OA 3RS5A 4WCFA 2YJ4A 2EBWA 3DLPX 4G56A 3ROXA 4C7JA 2O8EB 3ITDA 2Q2QA 4DQLA 4MHOA 3JALA 1BGXT 3IVGA 4RDIA 1Z37A 1W46A 2FU5C 1EM6A 3ABIA 1JECA 3H4MA 4PGHA 1PHPA 2QMEA 2UZIR 4WH0A 4RE6A 4XYEA 4DR2B 2ZSDA 4M21A 5K4AA 1XZCA 3TK1A 1ODTC 1VP9A 3GCZA 2XMBA 4F3KA 3EDOA 3NDBB 1NXWA 4TYWA 5FL3A 4RD0A 4ESVA 3GT7A 1W9MA 4BCBA 4F3YA 4Z7NB 3EMVA 2JNWA 3MBKA 4QWMA 3N6XA 2FV8A 2AD5A 4TWZA 4QFMA 4N5DA 1M9NA 5FO1A 1OFUX 1SRRA 1Y1SA 2OFOA 2ODPA 2R84A 1JSLA 4IHJF 3CZAA 3QITA 4P6VF 5ALVA 2EX0A 3JYHA 4Q05A 3CE6A 4HLQB 1VB3A 1W9HA 3QHAA 3RD5A 2VJQA 5CDYA 5JC8A 1M2EA 4NMHA 2QYSA 3IEPA 1K3TA 1U8CB 2QZ4A 2RE8A 3W5AA 4PZ9A 2GFIA 4LJLA 3ODPA 3P9SA 5B4TA 4P7BA 5AW8A 3ZDBA 3UJ7A 2C1ZA 5CX1A 4P3KA 3WQBA 1M6YA 2AOTA 2FFAA 2FR8A 3BFVA 4L78A 2N46A 4UCWA 2HADA 3V8VA 2SICE 3HGTA 3UFBA 2ZSBA 5ALYA 1G7RA 4R2KA 2J6HA 5FXMA 3VTAA 3WADA 4NICA 4BKPA 3HM2A 1ZUIA 4P36A 4UEOA 4OI1A 4KWEA 5KKAA 2WG1A 3C0KA 2VTVA 1O94A 4PZLA 1LX6A 4XWTA 3RRMA 1EGAA 3TNYA 4FB4A 3RUPA 4EG6A 2IOFA 2O8FA 9GPBA 5KB3A 1L7AA 2WLSA 5THQA 2CXUA 4EABA 6REQB 1E8DA 2WHRA 1O5OA 3T5AA 3VYTB 1PGNA 3OZBA 2E4YA 2FETA 4ZEOA 2YKGA 4O0MA 1I10A 2JD1A 3BB4A 2UUBB 2D0OB 2F3UA 4FBMA 4RXTA 4ZI7F 5EHNA 2GAIA 2MMCA 4UBJA 2MYTA 4EPYA 2X4IA 4LBZA 4Q4JB 1CCWA 3B1FA 1XZGA 3FKSA 1BMTA 3HKCB 2ZWIA 2N42A 3H11A 3OI7A 3AUXA 4BUCA 1L1FA 4MQFB 1KJQA 3BOSA 1FQJA 2NVOA 3ABRB 4GE0A 1U2PA 2ZXFA 5ERYA 5HRUA 3L6RA 1DCTA 5I8WA 5UKDA 3AXSA 1E64A 1L7EA 4Q4LA 1IOVA 1FDUA 1NP7A 4NYIQ 1WVMA 3UKJA 4H3SA 5FBVB 1I7LA 3KSMA 3U4MA 1QZXA 1DU4A 1A04A 2IYWA 3ENZA 1JHPA 5KSYA 2JLCA 4KR0A 3AJ9A 1XCPA 1GGFA 1GZHB 4QU5A 3Q2OA 4C0WA 2E4ZA 5J4LA 2Z2JA 4FTWA 3OD5A 4GI7A 2ZE8A 1ZC3A 3RDPA 1I32A 3TZQA 1RC8A 2P1ZA 3B6JA 3WYGA 2EKLA 2X1HA 2ECOA 4P58A 4YAKA 2VNIA 3A6DA 5AOAA 4C5AA 3LXRA 2VYFA 3GEMA 4UTOA 5AVRA 4LTMA 1DHRA 3TZKA 1RRCA 3ACBA 1OV6A 3KQUA 3MD9A 2YX1A 3QXCA 5I8ZA 2IY7A 1DXQA 3NATA 3FYUA 3NW9A 3WLIA 5C7IO 3P5BA 1B0AA 4M8IA 1BA2A 1YRQA 1TO1E 4AXXA 3E03A 1M2VA 5DOVA 1DTEA 5EAIA 4CIAA 3TLCA 4KJZA 3LDGA 3H5VA 5F3WB 4J0DA 5FNVB 5DDIP 1SHTX 5CT5A 2BELA 1J23A 1VRWA 4AU1A 1KC1A 1DADA 1PDOA 3OU2A 4FW8A 2OBFA 3INRA 4FR2A 3Q8WA 1G6HA 5BT9A 1XHLA 5DYTA 2K5UA 2OYCA 4RH0A 2F3RA 2Z6AA 5CDUA 3BGSA 3AC0A 2WPDA 3GU3A 5FBQB 3LA8A 3BERA 3RCBA 4MLZA 3N2NA 1U0OC 4Q3CA 5TPZA 1IN6A 2J07A 3THYB 2VEDA 3NBKA 1OVMA 3DL4A 3O92A 1IWOA 2EZ9A 4K28A 4BVJA 1SFRA 4D3FA 2BMVA 2VPTA 3ZEAA 1NASA 4Q21A 4RTLA 3QBEA 4O0LA 1UBJS 3CPHA 5LYYA 3WKDA 2LW7A 3WIUA 1SQ6A 2B37A 3GD5A 3G2OA 2O05A 5JXJA 4RVDA 1GSHA 4W5OA 5HDQA 4IIJB 1MG5A 2DWOA 2HKIA 3MTJA 2EL9A 4ND4A 3PXDA 4E5PA 2ZIXB 5FJIA 5L7YA 3ND8A 4EFKA 4RCYA 4EG0A 2CT8A 4NH4A 1L7VC 4PINA 3ZGXA 2OHOA 4L95C 4DXDA 4RA6B 2QVYX 3B9BA 4C3VA 4YCCA 3AEKA 3LGXA 4MX8A 1PJ3A 5A2GA 1CEQA 2CLEB 2PT5A 2IH2A 1B2LA 1BWQA 4R2WA 3UBTA 4MP8A 4QASA 1HDYA 4MRSA 3PD0A 3FI9A 1QO0A 3TSYA 3LL4A 4LCEA 3L7OA 4X24A 5A02A 2QLBA 3H7AA 3OU7A 4S0XA 1G64A 2D74A 4B45A 3GGPA 2GGSA 4WKBA 4QXRA 3S3TA 2OAGA 2V03A 4EO9A 2F64A 3ZNNA 5CDHA 1MAHA 4BX2A 2AUMA 4BYMA 4N0DA 1QOZA 1KPHA 2PX3A 3N8DA 2P91A 1ZD3A 2Q2VA 1SXJA 1L5GB 3RVDA 3IUQA 3O4IA 3KG2A 4CLDA 3R7DA 1MXFA 2ZTLA 2ZRPA 3EC1A 4CCYA 2G7MC 4HK4A 5EWMA 1K8ZB 1U2QA 4LF6B 3GEPA 3HVUA 3R09A 4N0QA 2GYVA 1I36A 2HMSA 4KJXA 1QGAA 1QIGA 2OWEA 3A8TA 3NEPX 4RVNA 2JAWA 3FUXA 1LPBB 3Q85A 3VKGA 2APJA 2D4AA 5CFOA 3BFJA 1QYCA 3GFBA 4G5RA 4RS3A 1DVRA 1KWKA 3EBLA 2H0AA 3GPBA 4C4RA 2Z08A 4W9MC 1LLDA 1G5QA 1U04A 3WGKA 5A4FS 5HNKA 2CWWA 2BTOA 4PPFA 1FP2A 4KFRA 4M36A 1JDNA 1E7MA 4JJZA 3T15A 4AKHA 1PD1A 2YWCA 3QTTA 1YZLA 1ESCA 1ELOA 4X3CA 1I2MA 3EPKA 4DR1B 2TECE 2O3UA 2PMDA 4FLMA 4TQUS 3SYTA 1CQJB 5KDDA 1LNQA 4XM1A 4I4TF 2UYQA 3KKMA 1GARA 2I34A 1C0LA 1L4YA 4J4BA 2C7OA 4JI7B 2HA4A 4D41A 1XTSA 2YINC 4OQLA 1PZMA 1CY1A 1DKPA 1OKKA 3T94A 5T4HA 4C9BA 5JROA 3KC2A 4OBBA 3RVNA 4PRYA 3L93A 2G7ZA 3EBPA 4RAQA 3NWJA 4EGFA 4F91B 1Z75A 5DLPA 1K63A 3GVXA 4Y9RA 5AFSA 2G4VA 4JQCA 4DEVA 5B12A 1RYBA 2PSFA 3TMAA 4EY8A 4C76A 3E7WA 1QH1A 4O5AA 5TMBA 3KUDA 1U02A 1AQ6A 1KYXA 2Q3FA 1GU7A 5DM1A 3E9CA 3EQ8A 4ZAVA 4JLOA 4L4YA 4FDLA 3IOEA 5A4KA 1ODFA 4DPMA 1VCOA 1WCIA 3JATA 4PSAA 4F93B 3Q40A 3I3OA 5T8KC 1X74A 4PCUA 2HHCA 2WDZA 5FP0A 1BA3A 1SOAA 2OXEA 2FDXA 5CIWA 3KTAA 3WFIA 3AI2A 1F3LA 3JYQA 1OVGA 3D3JA 3ISTA 4KO8A 4M1TA 5IYZA 1HYBA 1FRZA 1T4BA 5JAIA 1CPYA 3OO1A 4M2LA 3CRNA 1ZH6A 2AH5A 4EYSA 5IKMA 2Q9AA 4P86A 3DZ8A 1AGYA 1XMVA 2WF9A 2FPRA 3R8XA 4NOMA 4UM9D 3DEIA 4KYTA 5CXUA 3D2BA 1EFKA 4S3MA 4ZCIA 5A4AA 1T2UA 4RCZA 2OAQ1 1YHZA 1JHRA 4PU0A 4YXFA 1U7WA 5BNTA 5L4NA 3U5ZB 5KDOA 3ZJVA 3KQNA 3D4PA 4Z49A 1IM5A 3MZ0A 3U7RA 3HKBB 4GZ3A 2PL1A 4Y67A 5BR1A 1XKTA 4GMXA 5CDGA 1QYVA 3PPVA 1T5OA 2ADMA 4LDAA 1BC5A 2D4HA 2FMKA 2OGTA 1ECLA 4KOAA 2GN9A 2GI4A 3CWQA 1M2FA 4U9IS 1J42A 3REGA 1RW4A 3G2LA 2B83A 4WN9B 5BQ3A 5J4YA 3G68A 4WJZA 4QVGA 1BD3A 2UVQA 4YY3B 4RKFA 3SJZA 3SIRA 2OO7A 1QX4A 1UZMA 4QLAA 1MRZA 4B2PA 3KCQA 4HMOA 1HSZA 2YVKA 1T2NA 3EZ9A 2K87A 1HYGA 2WM3A 1EVLA 1B41A 1M67A 2YXDA 4NZYA 4DBLE 3O3NB 3PYMA 3W9UA 2WIDA 4WBNA 4YAOA 3WWEA 1JKMA 5DT2A 1BFUA 2JRLA 3QF4B 4MS1B 1X7DA 3TSWA 3AR7A 2XQJA 4E11A 3P9XA 1X8KA 1XEWY 4REQB 4BNTA 3TL2A 3LCUA 3DT6A 5EJ2A 5ELLA 3LF1A 1DSSG 4LX0A 4R2JA 3B53X 1IVYA 3QV2A 4L4UA 4XR4A 3V7WA 1FJHA 5DNWA 2GNOA 4OL9A 2JCXA 3U49A 1W4AA 1XZAA 5EEHA 4DKJA 4O4LA 4DDHA 2QW1A 3L1VA 3DMTA 1XRQA 3E23A 4TM7A 4LZWA 3A2KA 2IJGX 4QULA 5A5DA 3JWJA 4X1IA 3SK0A 1S8FA 3UUWA 1T34A 1N2IA 4EJSC 3FRIA 5FOWA 1TJNA 3H1TA 1JSCA 3L41A 3QBJA 2CDNA 1XRMA 5HDBB 1PE0A 4HWRA 3HCFA 3EC2A 1YRYE 4QUJA 4AO8A 2JS7A 2O0JA 5G02A 3IAFA 4MQUA 4G63A 4MVJE 1LDYA 3DE1X 3CJQA 3AI3A 1L1EA 5IABA 3VTKA 5A1JA 4BEVA 4Y6LA 4CG2A 3R0QA 3C6KA 4AB1A 2RJ3A 4D0NA 3QXJA 1P0CA 2YOFA 1XPRA 2VK1A 3AETA 2SECE 4IDDA 3HZZA 2PZLA 3UY4A 3W77A 3I6YA 5I4CA 2P6UA 5L95A 4R2IA 5G3ZA 3LKDA 3QMPA 2NV6A 1VLHA 3FGNA 3EDYA 4MUKA 2FUG1 2G76A 1TF7A 1KK1A 1WOYA 1ZM2A 1NF9A 2I78A 3ONWA 4MK4A 2Y9PB 4RQUA 2ZRQA 5CK4A 4V2UA 3QELA 1U8YA 4FEYA 5I9LA 3A4YA 3QEAZ 3D4LA 4RQBA 1E3WA 2R4UA 5KSZA 2PZAA 2VTEA 4NCJA 3PNKA 3HA5A 4WZAA 5LQDA 3ZWMA 3ZZ1A 2E5WA 1HH4A 1JHXA 3RPEA 3KOZA 4GC5A 1YBVA 4LYYA 2VYND 5AVTA 1RJEA 5AVSA 3M6UA 3STXA 2OXTA 1J7KA 1H0HA 2A86A 1G55A 4FCTA 1C9DB 2IUSA 4IIFA 4KIWA 2WJ3A 5DTEA 4D4HA 5SY6A 1FL9A 2IYSA 2CHGA 2AXEA 3I23A 4D26A 3K9QO 4ZO4A 1O95D 5DHSA 1EG2A 2ZR9A 3HSKA 5FI1B 2NIPA 5LZ8A 5CFLA 1UEXC 4OHKA 1IQUA 4Q9KA 1T4CB 1WDKA 1Z2CA 2QD2A 1UP6A 4GI1A 2WICA 1VL5A 2F17A 1RD4A 4Y9TA 4L6AA 1W96A 1DIOB 2XADA 2BKLA 3OWXA 4J0FA 3WYNA 5KTSA 1R4ZA 1S9DA 4NMXB 2BFNA 5CJPA 4HO1X 4I2VA 1NF8A 2BFCB 4QJ4A 1CUSA 5KWSA 1MO2A 2F2TA 3SI7A 5K6TA 3N75A 4OG2A 1KP9A 1Q74A 4H6VA 2FE1A 2HN9A 1YQWA 3OT1B 4MW4A 4LBWA 2EP7A 2I62A 2BEVA 3STWA 3WRXA 5CYFA 3ICPA 1O4WA 2OP1A 4EHLA 2O20A 1A8PA 2XQIA 2BDUA 3ZS9A 3B3GA 1UKCA 4A2WA 1JMKC 1YAJA 1F20A 4X61A 1O89A 2GFQA 3I28A 1E3MA 2JI8A 1H2HA 4CM8B 3HA2A 1RPJA 1JZTA 4HUTA 4PHFA 1O97C 1IY0A 2VWHA 5FOXA 5IK2A 1C30A 2Z9DA 1P1JA 3AU9A 3QHPA 1RLIA 3A1DA 1N7HA 3IP8A 5CVEA 5J5AA 4HVLA 1MBZA 4KMOA 4OD0A 4JNCA 3RWOA 3EDMA 3HFGA 4P33A 2EX1A 1MQSA 1IXZA 1M34A 1AKEA 2JDID 2XCQA 2Z98A 4R1PA 5EQDA 3U17A 1ICEA 4A82A 4HSGA 4ZALA 4ZVVA 4AIIA 1JE0A 2BMDA 3O2NA 2G3YA 2ZT5A 5C8YA 1ZGZA 2FP3A 3FTPA 2XTMA 3CIOA 3OZTA 3R4CA 3HDYA 4R3UC 3S2IA 3UT6A 3ZPXA 5HZGA 5JOQA 4PF1A 1Y3HA 2GBLA 3KOWA 3R6TA 4QHTA 1GZDA 3JQ6A 5IULC 1E2QA 1MA3A 1L7PA 5TY0A 1LTHR 2BFEA 2QQGA 4PPNA 3PRHA 1IPEA 1N57A 3BZUA 4KXLA 3U6BA 3UM9A 4EB6B 3QLUC 1UMKA 1FYVA 4HAXA 4RIGA 4W6QA 1FXWF 3ZCRA 1KQNA 2GR9A 4C89A 3SVLA 4EPTA 3BRWA 4U6QA 4E12A 3RVSA 3QEJA 3SYNA 1SIOA 1GLGA 4I3GA 2WJHA 1U2RA 3V1TC 3N0XA 3B1ZA 2HRRA 4WUTA 4RELA 2KB0A 4B43A 3N58A 4HNHA 4F5YA 5CB0A 1XJWA 1KYQA 2R62A 2JAOA 4UVDA 3DOFA 4FXOA 1BS1A 4BE7B 4HB3A 5FTKA 1BE0A 4OUDB 2Q1WA 3UH0A 4C08A 1W44A 2PEYA 3IEXA 2VHJA 4NIMA 4BP3A 3CLKA 1T3ZA 3NBAA 4M1KA 3GFPA 4PWYA 2O4UX 5EKSA 2EFGA 4FMPA 1X2EA 2ISQA 1O9HA 2BKUA 3FRJA 3MRSA 3ZDRA 4XWWA 3VYRB 4ILEA 2PQ2A 3RRZA 3OEED 1NIPA 1JYEA 5M29A 1NM5C 1DC6A 4EQ6B 3ZHRA 3CLSD 3DE2X 1Z82A 2VNJA 1NUSA 2FN3A 4JH0A 4NCHA 1XZKA 3TQCA 2YV1A 4QDXA 3NHUA 1DRJA 2DFPA 3K9BA 6PFKA 1O7JA 1PWZA 2ZJOA 1OLSB 2V6JA 1NWHA 2DQYA 1OTXA 2FY8A 1QRRA 2C9YA 3MN1A 4RMHA 4QTUB 2NTEA 3O90A 3PZBA 5E6RB 3PE4A 4QG3A 2OHFA 3DFUA 1TKAA 3G8BA 3UZUA 1FX1A 3R8FA 5KTRA 3R7WB 1S8OA 4E2XA 4DNOA 3TLGB 4Z7QB 1S2GA 4RHCA 1TO6A 2BR3A 1ZW1A 2ZJBA 3C43A 3CUUA 1TA4A 1BN7A 3FWHA 1WABA 4YRDA 4ZCPA 5HRCA 4M1QA 4BO0A 2FWMX 2GYYA 3HSSA 5CLHA 2PU7A 3RK0A 4EHJA 4C0KA 2Y4NA 3OIDA 3HJGA 4LXHA 4NPCA 4O4IB 5IAGA 5COAA 1AVTA 4Q1VA 1HOXA 3EEQA 1FDIA 3JQAA 1JEQB 3SE0A 2JLXA 4UTPA 1KJYA 4YUXA 3JQDA 3ZHYA 1CJUC 2QI9C 5CA0A 2ZQ5A 3KKZA 4UATA 3RAPR 5L4SA 3PUJA 3KFXA 1RHQA 2RCNA 4GLJA 4RJLA 1E2JA 1I9GA 5EMKA 2C7GA 3U26A 2NN3C 1UC8A 2ZROA 2BH2A 1TQDA 4FS8A 2VTBB 1FLVA 2X8JB 1XQWA 4M7OA 1IATA 4YXWA 4XX1A 3W1EA 5ICMA 3ZR4B 1LA2A 1PWXA 1ZKDA 3QVGA 2MR5A 3H3FA 3PCTA 1IBRA 4I55B 4NOKA 4MDFA 3PDIA 1GKIA 2XVXA 2HA5A 1Y63A 4HX2A 5JXIA 1ZIOA 4RLQA 3F3SA 4JHXA 4YV1A 1WV0A 2A0KA 2W4MA 4R6XA 1U0LA 4Q4HA 5TGZA 1FUYB 3NAZA 4I0WB 1WR8A 5K03A 5FV7A 2E85A 1LK0A 1NRWA 1RC1A 1IU9A 3IH5A 4FNAA 4PTYA 2I6XA 2IDJA 4G3XA 3VVLA 3TTXA 1IHDA 1GPKA 2YUTA 1NN0A 4O4HA 4XRRA 3SJBA 3PT9A 4MKRA 2DFVA 4ASUD 5JTUA 4UNSA 1U0NA 1H3NA 3MAGA 1J2TA 1U99A 1I4OA 1M7GA 5TV2A 3RH0A 2IFTA 3GX1A 4DM4A 4RIFA 1ZD5A 2EZUA 3GNQA 5SYNA 5IXJA 1RZRA 1T13A 1JJAA 2DJIA 1NPTO 2YS6A 3H6GA 1HNXB 3ERCA 1GQRA 3R9XB 4ENTA 4M87A 1CQZA 3M4YA 3GELA 1D1PA 2CD7A 3WL5A 2VZLA 1TW3A 1CD5A 2ZZKA 3LX6A 3FLBA 4IVPA 2W8BA 4PBSA 2XTZA 2VA9A 4PZAA 1VJ0A 2AYZA 1Q15A 3MTEA 1PJ2A 1KIMA 2FWJA 3SVTA 3GLQA 5TE9A 3ETLA 2OXFA 4QTZA 3P2YA 1Z9BA 2F43A 2GILA 1COWD 3D4OA 5KSWB 4KODA 4Y2QA 1EE1A 5C5EA 2ERXA 5EP2A 4YO8A 1O9BA 2QYHA 2H16A 3AW8A 4CUKA 2CYCA 9LDBA 5IVDA 3RYCA 1DOHA 1TD9A 1ADFA 3G8YA 5ELXA 3P0JA 2Q3CA 1XKQA 4B5KA 4Q48A 3GIDA 3VKWA 4OLHA 2VATA 3AWDA 1E6WA 2FW0A 3TJMA 1T5IA 1F5NA 3UUFA 1YDWA 1QKIA 1O96B 5T3UA 3DMDA 4NEQA 1XEFA 4NU0A 3BIFA 3ZCSA 2CD9A 5DGHA 4UU1A 3KU4A 1P81A 3DM9B 2OV2A 2R68A 3FTCA 1OAOC 1C41A 4YJGA 5LA6A 2FRDC 5E6UA 4F8JA 1PZNA 4RHEA 4PLFA 2ZR0A 3CTPA 2P3OA 4OEHA 4Y6QA 2OHHA 4TYMA 1TM2A 3U3JA 2QE6A 1C9KA 1PSZA 2PPLA 1MLDA 1AK1A 3W5HA 1V7PC 5JU6A 3ZJUA 4RVFA 3OFKA 3DXFA 1SBQA 1ULSA 4MA4A 3AEUB 3CKLA 5LDGA 1DQZA 1GY8A 3KHUA 3BWVA 3FMFA 4AJOA 4BP8A 2XV1A 1FEZA 4MB0A 5ENVA 1NW6A 2A8YA 3D1VA 3PXUA 4KXVA 4F2DA 4J29A 1TMYA 1UZAA 2HPHA 2PR2A 4B3SB 3RK1A 1ZBDA 2JD0A 1Q83A 3HB7A 4LI0A 4MRMB 4MVWA 3ET5A 3SQNA 1IZZA 4CCAA 3WOVA 4TSFD 3FPEA 2EKQA 2NU9B 2HV8A 1EJ2A 2CVHA 3TBKA 2C7QA 1JDUA 3R6LA 1DXHA 3K1JA 5LYJB 5E3HA 4RHFA 4CIBA 4AN1A 5FA5A 4WDRA 4XUEA 2WQZA 1P1KA 4Z5XA 3EWAA 4IFIA 3ZW7A 1YS9A 4Q24A 1CJBA 4FFVA 1B73A 1NY6A 5EZYF 1WMDA 3AR9A 3OF3A 3PFCA 5I7OA 2CLLB 2VHYA 3R6WA 1AXGA 1W5SA 4KCGA 1NPDA 3LQYA 1VBNA 3ZY6A 4AECA 2WWGA 1R0YA 1P7VA 3INGA 5BSTA 5TDHA 3SFTA 2D2FA 4YREA 4OHXA 4Y2PA 1QCZA 3E9MA 3VKVA 2I7XA 2PUWA 3CB2A 4HB2A 3BORA 4CLRA 1GNVA 2OCYC 4K9LA 1UMBA 1OA0A 3BS4A 4K0RA 1YS2X 1QONA 1WHSA 1FXWA 3HFJA 3QFTA 4XA8A 5KQPA 2VUTA 3HYCA 1TTHA 3SPXA 4O2LA 1NNUA 1XDSA 2A5GA 4Q7JB 5HFJA 7YASA 1NX9A 1QF6A 1HRDA 1RAIA 3PPXA 9ATCA 3IMFA 4RPKA 1SKBA 2HEIA 1AF4A 3SJAA 5JWRA 5G1PA 4HGNA 3Q15C 3SP1A 3LK7A 2ZIVB 4CMCA 4NE7A 1U8TA 1EX9A 2HMVA 1ND6A 2HU7A 2M1ZA 3CUSA 3N53A 2I91A 1ULTA 4AW9A 1QHGA 1FDRA 1QYWA 3DV2A 3OOJA 1BXGB 4IF4A 2UZ0A 4Y9DA 3E9NA 3WBFA 5LQJA 3F5QA 3DE4X 1O4VA 1D8TA 5G4KB 3LX5A 4NOJA 4HNSA 3CNOA 4JWKA 1NXVA 2KX7A 2M6RA 3DD5A 3QE0A 5CM8B 2C1XA 5E7JA 3AV3A 1WW2A 3TGPA 3HBNA 4M7RA 3MINB 5C5IA 1RJFA 3K30A 4ML3A 4Y6GB 4C1NA 4KVGA 3VPGA 1ULZA 3W90A 4CM4B 2IUUA 1SU6A 2PCJA 3M49A 3OCJA 4A6DA 4V1CI 5FD8A 1KAGA 1NQUA 4N82A 2P5TB 3CF2A 2PSHA 1EBFA 2CNLA 4I4IA 3RIXA 4BC1A 1DWUA 3C8HA 2X14A 3O3CA 1Z83A 2F3TA 2V7TA 1EFLA 3A6FA 3Q0TA 2FPIB 4Y2VA 2NGRA 3V42A 1WEHA 3OSZA 1YB5A 5JNVA 1CYEA 1EVYA 1FSFA 2G9VA 5JCZA 4Z4EA 2FZLA 2ZUCA 1NJ6A 3D3NA 4LDNA 4YP6A 2ZBRA 3IQFA 4ROSA 2YMLA 2XCOA 3ILYA 2XHEA 3RJMA 3QH4A 1AGPA 1K8XB 1NMEA 4PX9A 3UWSA 3I6BA 3CH7A 3HBMA 4KFTA 1R8QA 3OE5A 4LA4A 2JA1A 1ZI8A 2ZTVA 3ZJ5A 3Q8KA 4QAQA 2FK8A 2PT7A 2YXEA 5A6SA 1AX9A 3GGOA 1EDZA 5KYNA 1OI2A 4JI0B 3LW8A 3LWNA 2B4QA 4J9VA 2FN9A 3ET4A 4H1TA 3AHHA 5B4UA 2AL7A 3SBDA 1MPXA 1X92A 1CR2A 3PFFA 4GZ6A 5EYPA 2CL7X 3WISA 3AM4A 4DLLA 4AXBA 1XX6A 4M1ZA 3F78A 4CRWB 4MULA 3LQ1A 4C3UA 1LSOA 3OIYA 4C05A 4UHEA 4CNBA 1O03A 2FP4A 2P4UA 2OCAA 1MX3A 3BH0A 3K09C 4LZOA 3ZZUA 1GYPA 2OXCA 3PL5A 2HREA 3HLKA 4QQ8A 5CCDA 1G18A 3DVLA 3NEYA 1RWQA 2HJRA 1Z6QA 2CVQA 3EN0A 2BM8A 1E1LA 1J25A 4IEIA 5K3OA 4O3MA 1QXSA 4G37A 3I61A 1I1NA 4KZPA 2EKBA 3AEZA 2Z09A 1JLKA 5H3HA 5C52B 5IM4F 1H8ED 4ZI7B 2R4QA 1CUVA 1POXA 4AJEA 4C6RA 4C4YA 2Z6VA 4DSZA 3AMVA 3QE3A 1XC7A 1DL5A 2V6IA 2WTNA 5KYXB 4NK4A 5PNTA 4GKJB 2ID9A 4G4IA 3E2MA 4CKEA 5IPFA 2GA9A 2ZYDA 4DF3A 4KQKA 4R9SA 1ISSA 3HDGA 5AKGA 1V1MB 4PO9A 1FZTA 2EG5A 3QKRB 1Z07A 4OB6A 2QMZA 1G6OA 2NAPA 2FJPA 2Y1GA 1XUOA 1DP4A 1V6AA 2G36A 4FKZA 4FS3A 5A0VA 1BXRA 4WOPA 2BHSA 2DT5A 3MG9A 4BZZA 4L7VA 3A1EA 3T5BA 5JZOA 2COKA 4D8WA 4IIHA 1OXUA 3A6HA 3KB8A 4BMOB 2TYSB 4D79A 1U1GA 2IS2A 1DRKA 1W0KD 1T0HB 2WHPB 3F9RA 4Q1FA 5FUWA 1DOAA 8GPBA 1PL0A 2VI5A 2QRVA 3AINA 3DD1A 4DWJA 3D6HA 3DHVA 1TI7A 2VRBA 1AHPA 1BQ4A 5T8KA 1J21A 3PC8C 5CNMA 3UFXA 4F2PA 3I04A 3OF2A 1LH0A 2ZRDA 4UW9A 5DHUA 3KJIA 2AQ8A 5TGDA 3WNVA 4O1HA 2PUFA 3W5BA 2DQSA 4OMDA 3FFAA 4S1VA 5GWXA 3IKMB 3EXIB 5FAKA 1TZMA 1Q20A 3ZWWA 3DXXA 2AMFA 3CYFA 2AG5A 2YXPX 3HV2A 3MJFA 3SF8B 4BMVA 2DQ4A 4HZUA 2VZ0A 2Z2XA 3OM0A 3A6ZA 2D1YA 4FQ7A 4NU6A 4ENWA 3ROPA 5DYGA 3H5IA 2EJWA 3GLGA 1YR6A 4JEHA 4L51A 1Y5MA 1QAQA 1QGOA 4BO1A 5BSMA 3J7TA 2P6RA 4IQ8A 1WPQA 1T5HX 1DINA 4EFMA 1M2OB 1A2OA 3A3PA 2B1GA 4GWGA 1UBUS 4YP7A 1FFYA 1Y1RA 4QSHA 3SNKA 3RUHA 3ER6A 1C2TA 4FMCF 2E37A 4XX0A 1FLNA 3KYDA 2R11A 3PENA 4Q7LA 5LMCA 2YVQA 2WD9A 3W2GA 3BE8A 2I3ZA 4GQBA 1P8AA 2CHFA 2HI0A 4LWZA 4OHCA 1RM3A 3FAZA 4IWNA 2ZYUX 5CW2A 5CXXA 1LD3A 2FXIA 1HPLA 2PGLA 1V0JA 2R6HA 3LECA 3B2QA 3KHSA 3M5DA 4PYNA 2J6BA 4QATA 4DTCA 1QPZA 1F8GA 1ULHA 3AKEA 3CC8A 3FBWA 3N3AC 3KJEA 2R6CA 1S7CA 1UXOA 4NC9A 4WZBB 1SN7A 3ZKWA 5D5PA 2ODNA 3NOXA 4YQFA 4YYZA 1DIAA 3IAXA 1MOZA 4PPQA 3G2PA 4UBLA 3M3DA 4FK8A 3RFXA 1N6RA 2J85A 1II8A 3FYHA 4Q3DA 2OUKA 2E6UX 2LDBA 4G1VA 5JCJA 3TD6A 4N6OA 3THWB 1HE3A 3RU3A 5G0UA 4H7HA 3QEMB 4WNIA 4NBKA 1B26A 3ESAA 4F21A 2UUAB 5A3SA 1F6WA 2OZLA 5LU8A 4RJKA 5EGSA 1RZRD 4UU7A 5C4GB 3D4IA 2V7VA 1NMQA 3MOGA 3JSAA 2OWDA 2VJBA 3CWCA 1NOKA 4YP0A 4RKRA 1CULC 3IEIA 1E0JA 1SBCA 4ETMA 1ZNWA 1IMOA 1ZJ5A 3GN1A 4L3WA 4M49A 4DB4A 2H63A 1JDPA 3BIJA 1VG9B 5JLJA 2NZVG 2O4CA 4OMCA 4EJSA 2E4AA 3HJCA 1CUWA 4TPKA 4ZI3A 5F98A 1FZQA 4RZSA 1UPCA 1II9A 3NCTA 3OZGA 1V3QE 2XT9A 3RQIA 3U4DA 2EU8A 5HCUA 4BNFA 5K4GA 3BHIA 5GJBA 3HB0A 2JI6A 1T24A 4W4TA 3WYEA 3H65A 3L9XA 3IBTA 4NHEA 1N5RA 1TDJA 3JVDA 5K0LA 1PJZA 1AT1A 4W6ZA 3RSCA 4DLTA 1L7BA 2H4HA 3TXXA 2Q0HA 2QA5A 2ZJYA 4IF6A 3EK2A 1IJEA 3C6MA 3L6OO 1HDZA 1VBMA 1W30A 1S7GA 2BFWA 3E2IA 3P0IA 1D4AA 4U6NA 2OFFA 3S2FA 4A0HA 4B48A 3CE9A 2O8BB 1GO2A 3G88A 3NT4A 3VZPA 3LWZA 1KY2A 3B3JA 3HXOA 1VP3A 2E4UA 2CV0A 2J0UB 5KYYB 3OP1A 3GAMA 2P9GA 4MQ6A 2C59A 3D5EA 5DW3A 1J2RA 1J0EA 2R8EA 3ICEA 4ZT2A 2VNSA 1JILA 4UMEA 3RVJA 3L7KA 2HDOA 1O58A 5FLXA 2LCFA 5F1KA 3WA7A 4JBNA 1KNQA 3EEFA 1MW9X 1Z6PA 3AKCA 4WN3A 5K0FA 4N76A 4E0BA 4LQLA 2QT1A 3PQ3A 4I4TB 2WSYB 5AOCA 2X42A 2X0IA 3TTVA 1RMTA 1TZCA 2XD9A 4G1UC 2C77A 3EH1A 1KDRA 3CJTA 2QN1A 3C41J 3DAHA 2DGDA 2I6TA 1CU1A 4XW2A 4YCJA 2QN3A 3AF2A 4PC1A 3LVFO 4TLCA 3ISJA 3UJBA 1WSAA 3SAJA 2LIVA 2F67A 1FYWA 2FW7A 3HPRA 3KDPA 4UU0A 4RLSA 1T8SA 4V0ME 2FSSA 3K2EA 1NMZA 2FOLA 4P98A 3R7AA 4XGIA 2RGCA 4MV5A 3H8SA 4EYOA 4FB5A 2OFPA 3A3NA 1SCDA 2W0MA 3MWFA 5CCXA 5G1NA 3NAQA 2JBHA 1BE1A 1J09A 1QIFA 5E6SB 1BO6A 1TVEA 1UKZA 5KX5F 1X0XA 2CN1A 1GR1A 3LM8A 4MWSA 2D1QA 2R8ZA 3BYZA 4O8CA 4RHTA 5KBYA 3TQQA 3GEGA 3Q6NA 5EUBA 4E15A 3OKCA 4HLUA 1RABA 4N0PA 2DB3A 4MSUA 1RXEA 4XVHA 3AGPA 4PN3A 4BVBA 1UBOS 1N0UA 4KGXA 5I9SA 4HWPA 1XMQB 2JZOA 3HN7A 1TEXA 3SOZA 4JI3B 3SLRA 3NGMA 1RYZA 4LY3A 1MUUA 1OILA 1KYIA 1N6LA 3ZI0A 3R0ZA 3RT7A 3HCBA 4P5PA 1E2NA 4WXYB 3TF5A 3IV7A 4Y2SA 4RCVA 5DXJA 4JUIA 5C3UA 3C4VA 3EVFA 5DW0A 2RHMA 3GH1A 1URPA 1JIXA 2WG2A 4O4JA 1RADA 2OC9A 3LGAA 3KQHA 2JFPA 3BHMA 1M1NB 3QIAA 1TJ3A 5D51S 4Z8YA 3UK1A 4EI9A 2AOUB 1C50A 4OBXA 3MJVA 1YKSA 4JB8A 3IIKA 3EJWA 4MAAA 3HR8A 3FOZA 5IM4A 4IAOA 1P7YA 3U7IA 3C3AA 1HDEA 4EY3A 2HSWA 4RDXA 4EVIA 1YNOA 2Y67A 3HP7A 4JGGA 2ID7A 4OHOA 4W7IA 2XWBF 1EUQA 2AN9A 1AQUA 4XQCA 1KZ4A 4YJHA 8OHMA 3E9ZA 1RXVA 3TR0A 1IM8A 3G79A 4Z9FA 1FNCA 1C3OB 5LZ5A 3VOTA 2HEGA 3PRYA 1TTPB 1JPJA 2PH5A 3QLUA 2YVUA 5CVDA 4ZXFA 1AE1A 3UYLA 4RVSA 4BAZA 2X4LA 2QU8A 3PKJA 4URHA 2XNKA 2FUG6 1K5GA 4R7GA 1H1TA 3I2KA 2IX3A 2HA0A 3GVHA 3T7TA 5AJVB 3D6TB 2J5XA 4DT1B 3LP6A 1HC7A 2XUQA 1G8MA 1NW3A 4JEUA 5AKZA 3GUCA 5JVDF 4C7BA 3OM8A 3NBUA 3GFOA 3KVYA 3CW9A 3W1VA 4CL3A 1V7CA 4R05A 4RGBA 3H5WA 1USKA 1TB4A 4GR9A 1ID8A 1QIMA 1ZD1A 3P0HA 2ZETA 4K0KB 4LRXA 5B58T 1M6EX 3E48A 1LSSA 3GMIA 1QANA 4PYRA 4AQYB 1YL6A 3GRZA 4PE5B 5LBTA 3U37A 4GZMA 1BWPA 4TUYF 1EFPB 3Q88A 3L4SO 5BVHB 1CR0A 2GK6A 5IASA 1U7PA 2J3MA 4EHFA 2JRCA 1RFLA 2O1XA 2R6GA 1NM5A 2ZB2A 3BK1A 4IIEA 4Q5IA 3X1DA 4MYUA 3I8SA 2WJIA 4G0PA 5F9MA 4KI7A 4PAQA 5F1YA 3VAZA 4GYKA 1NT4A 2AZMA 2OV4A 5HR5A 1UBTS 5AVWA 4DR3B 4M98A 4PGGA 1SD1A 4CGYA 1JJVA 1CQPA 3ZLJA 1LJUA 1C9YA 1F4LA 4HQLA 1QBGA 1J0AA 3AXTA 3BWDD 3WG9A 1VCIA 2YH2A 3VUEA 4ZD6A 1PU2A 1JR3E 3BMNA 4EW6A 4BVHA 4GXTA 1L5HA 2MOKA 2YY5A 3LHIA 4JXXA 1DEAA 3OLZA 2OM2A 3ES9A 4OQNA 4YRLA 3TW6A 3K73O 2VAMA 1GAWA 3ABZA 2JANA 3CGWA 3KZKA 3O1HB 5MHTA 1KQ3A 3H3XA 4DQKA 1NW5A 1P60A 1QHYA 2F48A 4NG5A 5FBLB 1TA9A 1SD5A 5EL0A 3HTXA 4Q6WA 3EE6A 4TS1A 4X1YA 3V8MA 4Q16A 3JQQA 3WYBA 4NRDA 3DXYA 5KOHB 4GBJA 1OCEA 4M0DA 4OQFA 2BEWB 1GN9A 1DNPA 4K1XA 3PX7A 3TX6A 1E59A 4BJHB 3ENNA 2AC4A 4DZTA 3WP1B 3OCYA 1EH5A 5CBPA 3NDIA 4FVTA 1PQUA 1SWVA 3QV1A 4P84A 4UUOA 5E0KB 5KO2A 4OQXA 3DC2A 1UT5A 1G9SA 4AC9A 4ZKDA 1GZ7A 4YBRA 4A1FA 4AJLA 2W6IA 1QWSA 3II6X 4B3CA 1IN5A 2JLYA 4YDRA 2F9FA 1GGKA 3AFGA 3BD6A 3DEKA 2G5TA 4TTVA 2O48X 2H3EA 1ZD9A 2OBYA 1NU8A 3WLMA 4BV2A 1B43A 1D1TA 1XJQA 5A71A 5IZ4A 4KN6A 1PT9A 4OVKA 4D9IA 4M22A 3BBPA 2CXSA 4K86A 4OHPA 1MW8X 3VYVA 3QVSA 5EHIA 4KH1A 2Q7DA 4BZXA 5F4ZA 4CHGA 5JY6A 4ZCSA 4AQDA 2PNFA 4B6PA 2ZVPX 2BF4A 4NBVA 4TV9B 5IBQA 3UK7A 2OY0A 1PJTA 4Y6PA 2IBSA 3GBVA 2D6FA 2C58A 2PVCA 5JI2E 2V1UA 1M10A 4Q7MB 2PT6A 4DV2B 3FI0A 2N1MA 1P2DA 2ZRGA 4G9BA 5AKIA 5H70A 5LQAA 1QDEA 3JYLA 3NVAA 4GZ5A 2IVZA 3VDNB 2VPYA 5H59A 3QG5A 4B82A 5JCXA 3FVVA 3KVRA 5IC6A 3AP2A 2WD8A 5GVSA 4ACAA 1FFXA 2Q9CA 1E9VA 4MAMA 3P5SA 4PYMA 1G8JA 3GZNA 1XYVA 2KE5A 4MGEA 1HZJA 2NP6A 1T3HA 2LIPA 2ZKIA 3GXOA 1FP6A 4R51A 2UZ1B 3PRKE 3VNRA 4EGSA 5KINB 4ER0A 3D6UA 3WLRA 1V95A 3UXYA 2NSLA 2QMUA 1SB8A 3COJA 1JVNA 1OY1A 4U39A 3V1LA 4A10A 1CP2A 3GQBB 4N5IX 4BWGA 2RFLA 1R0WA 1TJ4A 3OZCA 4HYTA 4LMPA 4NENB 4OOFA 2DR3A 2C5SA 4G26A 2JIZD 4JLNA 3WGYA 4EF4A 3HCCA 1ZRHA 4JVSB 2Y3IA 1D07A 3M1AA 2BM0A 1UP4A 3NTOA 4MWTA 3ZCPA 1E1MA 3G0HA 1GNQA